data_2OV2
# 
_entry.id   2OV2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OV2         
RCSB  RCSB041621   
WWPDB D_1000041621 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2G0N 
_pdbx_database_related.details        'Crystal Structure of Human RAC3 in complex with GDP and Chlorine' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OV2 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ugochukwu, E.'                        1  
'Yang, X.'                             2  
'Elkins, J.M.'                         3  
'Burgess-Brown, N.'                    4  
'Bunkoczi, G.'                         5  
'Debreczeni, J.E.D.'                   6  
'Sundstrom, M.'                        7  
'Arrowsmith, C.H.'                     8  
'Weigelt, J.'                          9  
'Edwards, A.'                          10 
'von Delft, F.'                        11 
'Knapp, S.'                            12 
'Doyle, D.A.'                          13 
'Structural Genomics Consortium (SGC)' 14 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 4 (PAK4)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ugochukwu, E.'     1 
primary 'Yang, X.'          2 
primary 'Elkins, J.M.'      3 
primary 'Burgess-Brown, N.' 4 
primary 'Knapp, S.'         5 
primary 'Doyle, D.A.'       6 
# 
_cell.entry_id           2OV2 
_cell.length_a           50.843 
_cell.length_b           73.859 
_cell.length_c           133.840 
_cell.angle_alpha        88.58 
_cell.angle_beta         87.76 
_cell.angle_gamma        70.64 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OV2 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related C3 botulinum toxin substrate 3'   19934.928 8    ?        ? ?             ? 
2 polymer     man 'Serine/threonine-protein kinase PAK 4'        4156.529  8    2.7.11.1 ? 'CRIB domain' ? 
3 non-polymer syn 'MAGNESIUM ION'                                24.305    8    ?        ? ?             ? 
4 non-polymer syn 'CHLORIDE ION'                                 35.453    8    ?        ? ?             ? 
5 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' 521.208   8    ?        ? ?             ? 
6 non-polymer syn 1,2-ETHANEDIOL                                 62.068    3    ?        ? ?             ? 
7 water       nat water                                          18.015    1132 ?        ? ?             ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RAC3, p21-Rac3'                      
2 'PAK4, p21-activated kinase 4, PAK-4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSA
LTQRGLKTVFDEAIRAVLG
;
;SMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFL
ICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSA
LTQRGLKTVFDEAIRAVLG
;
A,F,B,C,G,D,E,H ? 
2 'polypeptide(L)' no no EISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIE EISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIE I,J,K,L,M,N,O,P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLN n 
1 4   ALA n 
1 5   ILE n 
1 6   LYS n 
1 7   CYS n 
1 8   VAL n 
1 9   VAL n 
1 10  VAL n 
1 11  GLY n 
1 12  ASP n 
1 13  GLY n 
1 14  ALA n 
1 15  VAL n 
1 16  GLY n 
1 17  LYS n 
1 18  THR n 
1 19  CYS n 
1 20  LEU n 
1 21  LEU n 
1 22  ILE n 
1 23  SER n 
1 24  TYR n 
1 25  THR n 
1 26  THR n 
1 27  ASN n 
1 28  ALA n 
1 29  PHE n 
1 30  PRO n 
1 31  GLY n 
1 32  GLU n 
1 33  TYR n 
1 34  ILE n 
1 35  PRO n 
1 36  THR n 
1 37  VAL n 
1 38  PHE n 
1 39  ASP n 
1 40  ASN n 
1 41  TYR n 
1 42  SER n 
1 43  ALA n 
1 44  ASN n 
1 45  VAL n 
1 46  MET n 
1 47  VAL n 
1 48  ASP n 
1 49  GLY n 
1 50  LYS n 
1 51  PRO n 
1 52  VAL n 
1 53  ASN n 
1 54  LEU n 
1 55  GLY n 
1 56  LEU n 
1 57  TRP n 
1 58  ASP n 
1 59  THR n 
1 60  ALA n 
1 61  GLY n 
1 62  GLN n 
1 63  GLU n 
1 64  ASP n 
1 65  TYR n 
1 66  ASP n 
1 67  ARG n 
1 68  LEU n 
1 69  ARG n 
1 70  PRO n 
1 71  LEU n 
1 72  SER n 
1 73  TYR n 
1 74  PRO n 
1 75  GLN n 
1 76  THR n 
1 77  ASP n 
1 78  VAL n 
1 79  PHE n 
1 80  LEU n 
1 81  ILE n 
1 82  CYS n 
1 83  PHE n 
1 84  SER n 
1 85  LEU n 
1 86  VAL n 
1 87  SER n 
1 88  PRO n 
1 89  ALA n 
1 90  SER n 
1 91  PHE n 
1 92  GLU n 
1 93  ASN n 
1 94  VAL n 
1 95  ARG n 
1 96  ALA n 
1 97  LYS n 
1 98  TRP n 
1 99  TYR n 
1 100 PRO n 
1 101 GLU n 
1 102 VAL n 
1 103 ARG n 
1 104 HIS n 
1 105 HIS n 
1 106 CYS n 
1 107 PRO n 
1 108 HIS n 
1 109 THR n 
1 110 PRO n 
1 111 ILE n 
1 112 LEU n 
1 113 LEU n 
1 114 VAL n 
1 115 GLY n 
1 116 THR n 
1 117 LYS n 
1 118 LEU n 
1 119 ASP n 
1 120 LEU n 
1 121 ARG n 
1 122 ASP n 
1 123 ASP n 
1 124 LYS n 
1 125 ASP n 
1 126 THR n 
1 127 ILE n 
1 128 GLU n 
1 129 ARG n 
1 130 LEU n 
1 131 ARG n 
1 132 ASP n 
1 133 LYS n 
1 134 LYS n 
1 135 LEU n 
1 136 ALA n 
1 137 PRO n 
1 138 ILE n 
1 139 THR n 
1 140 TYR n 
1 141 PRO n 
1 142 GLN n 
1 143 GLY n 
1 144 LEU n 
1 145 ALA n 
1 146 MET n 
1 147 ALA n 
1 148 ARG n 
1 149 GLU n 
1 150 ILE n 
1 151 GLY n 
1 152 SER n 
1 153 VAL n 
1 154 LYS n 
1 155 TYR n 
1 156 LEU n 
1 157 GLU n 
1 158 CYS n 
1 159 SER n 
1 160 ALA n 
1 161 LEU n 
1 162 THR n 
1 163 GLN n 
1 164 ARG n 
1 165 GLY n 
1 166 LEU n 
1 167 LYS n 
1 168 THR n 
1 169 VAL n 
1 170 PHE n 
1 171 ASP n 
1 172 GLU n 
1 173 ALA n 
1 174 ILE n 
1 175 ARG n 
1 176 ALA n 
1 177 VAL n 
1 178 LEU n 
1 179 GLY n 
2 1   GLU n 
2 2   ILE n 
2 3   SER n 
2 4   ALA n 
2 5   PRO n 
2 6   SER n 
2 7   ASN n 
2 8   PHE n 
2 9   GLU n 
2 10  HIS n 
2 11  ARG n 
2 12  VAL n 
2 13  HIS n 
2 14  THR n 
2 15  GLY n 
2 16  PHE n 
2 17  ASP n 
2 18  GLN n 
2 19  HIS n 
2 20  GLU n 
2 21  GLN n 
2 22  LYS n 
2 23  PHE n 
2 24  THR n 
2 25  GLY n 
2 26  LEU n 
2 27  PRO n 
2 28  ARG n 
2 29  GLN n 
2 30  TRP n 
2 31  GLN n 
2 32  SER n 
2 33  LEU n 
2 34  ILE n 
2 35  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo RAC3             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 'BL21(DE3)-R3' ? ? ? ? ? ? ? Plasmid ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo 'PAK4, KIAA1142' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 'B834(DE3)'    ? ? ? ? ? ? ? Plasmid ? ? ? p11         ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RAC3_HUMAN P60763 1 
;MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLI
CFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSAL
TQRGLKTVFDEAIRAVL
;
1  ? 
2 UNP PAK4_HUMAN O96013 2 EISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIE 10 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2OV2 A 2 ? 178 ? P60763 1  ? 177 ? 1  177 
2  1 2OV2 B 2 ? 178 ? P60763 1  ? 177 ? 1  177 
3  1 2OV2 C 2 ? 178 ? P60763 1  ? 177 ? 1  177 
4  1 2OV2 D 2 ? 178 ? P60763 1  ? 177 ? 1  177 
5  1 2OV2 E 2 ? 178 ? P60763 1  ? 177 ? 1  177 
6  1 2OV2 F 2 ? 178 ? P60763 1  ? 177 ? 1  177 
7  1 2OV2 G 2 ? 178 ? P60763 1  ? 177 ? 1  177 
8  1 2OV2 H 2 ? 178 ? P60763 1  ? 177 ? 1  177 
9  2 2OV2 I 1 ? 35  ? O96013 10 ? 44  ? 10 44  
10 2 2OV2 J 1 ? 35  ? O96013 10 ? 44  ? 10 44  
11 2 2OV2 K 1 ? 35  ? O96013 10 ? 44  ? 10 44  
12 2 2OV2 L 1 ? 35  ? O96013 10 ? 44  ? 10 44  
13 2 2OV2 M 1 ? 35  ? O96013 10 ? 44  ? 10 44  
14 2 2OV2 N 1 ? 35  ? O96013 10 ? 44  ? 10 44  
15 2 2OV2 O 1 ? 35  ? O96013 10 ? 44  ? 10 44  
16 2 2OV2 P 1 ? 35  ? O96013 10 ? 44  ? 10 44  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OV2 SER A 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   1  
1 2OV2 GLY A 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 2  
2 2OV2 SER B 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   3  
2 2OV2 GLY B 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 4  
3 2OV2 SER C 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   5  
3 2OV2 GLY C 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 6  
4 2OV2 SER D 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   7  
4 2OV2 GLY D 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 8  
5 2OV2 SER E 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   9  
5 2OV2 GLY E 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 10 
6 2OV2 SER F 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   11 
6 2OV2 GLY F 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 12 
7 2OV2 SER G 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   13 
7 2OV2 GLY G 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 14 
8 2OV2 SER H 1   ? UNP P60763 ? ? 'CLONING ARTIFACT' 0   15 
8 2OV2 GLY H 179 ? UNP P60763 ? ? 'CLONING ARTIFACT' 178 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                        ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                                 ?                 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                       ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                 'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GCP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER' ?                 'C11 H18 N5 O13 P3' 521.208 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                ?                 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                      ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2OV2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   49.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'0.2M Ammonium acetate, 0.1M Citrate, 30% PEG 4000, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96870 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.96870 
# 
_reflns.entry_id                     2OV2 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.10 
_reflns.d_resolution_low             62.11 
_reflns.number_all                   ? 
_reflns.number_obs                   106111 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.147 
_reflns.pdbx_Rsym_value              0.147 
_reflns.pdbx_netI_over_sigmaI        7.8 
_reflns.B_iso_Wilson_estimate        20.5 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.602 
_reflns_shell.pdbx_Rsym_value        0.602 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      44621 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OV2 
_refine.ls_number_reflns_obs                     100750 
_refine.ls_number_reflns_all                     100750 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             62.11 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    98.93 
_refine.ls_R_factor_obs                          0.1745 
_refine.ls_R_factor_all                          0.1745 
_refine.ls_R_factor_R_work                       0.1719 
_refine.ls_R_factor_R_free                       0.22453 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5292 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.B_iso_mean                               30.184 
_refine.aniso_B[1][1]                            2.01 
_refine.aniso_B[2][2]                            -0.09 
_refine.aniso_B[3][3]                            -1.64 
_refine.aniso_B[1][2]                            -0.42 
_refine.aniso_B[1][3]                            -0.04 
_refine.aniso_B[2][3]                            0.02 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2G0N' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.214 
_refine.pdbx_overall_ESU_R_Free                  0.182 
_refine.overall_SU_ML                            0.137 
_refine.overall_SU_B                             9.181 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12994 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         284 
_refine_hist.number_atoms_solvent             1132 
_refine_hist.number_atoms_total               14410 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        62.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 13676 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001  0.020  ? 8891  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.485  1.984  ? 18750 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.968  3.000  ? 21762 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.093  5.000  ? 1718  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   39.709 23.641 ? 541   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   13.691 15.000 ? 2048  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   21.016 15.000 ? 68    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.086  0.200  ? 2143  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 15111 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 2749  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.201  0.200  ? 2549  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.193  0.200  ? 9118  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.178  0.200  ? 6529  'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.086  0.200  ? 6667  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.149  0.200  ? 859   'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      0.060  0.200  ? 9     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.185  0.200  ? 30    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.299  0.200  ? 86    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.183  0.200  ? 42    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.486  1.500  ? 8826  'X-RAY DIFFRACTION' ? 
r_mcbond_other           0.140  1.500  ? 3410  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.799  2.000  ? 13817 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.423  3.000  ? 5729  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.138  4.500  ? 4915  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1019 0.19 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1  ? ? ? 
2 B 1019 0.24 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 2  ? ? ? 
3 C 1019 0.19 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 3  ? ? ? 
4 D 1019 0.19 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 4  ? ? ? 
5 E 1019 0.16 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 5  ? ? ? 
6 F 1019 0.17 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 6  ? ? ? 
7 G 1019 0.17 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 7  ? ? ? 
8 H 1019 0.19 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 8  ? ? ? 
1 I 191  0.16 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 9  ? ? ? 
2 J 191  0.18 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 10 ? ? ? 
3 K 191  0.21 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 11 ? ? ? 
4 L 191  0.17 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 12 ? ? ? 
5 M 191  0.15 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 13 ? ? ? 
6 N 191  0.19 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 14 ? ? ? 
7 O 191  0.19 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 15 ? ? ? 
8 P 191  0.18 0.50  'medium positional' 2 'X-RAY DIFFRACTION' 16 ? ? ? 
1 A 1112 0.50 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 17 ? ? ? 
2 B 1112 0.37 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 18 ? ? ? 
3 C 1112 0.52 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 19 ? ? ? 
4 D 1112 0.38 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 20 ? ? ? 
5 E 1112 0.35 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 21 ? ? ? 
6 F 1112 0.33 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 22 ? ? ? 
7 G 1112 0.45 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 23 ? ? ? 
8 H 1112 0.38 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 24 ? ? ? 
1 I 203  0.45 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 25 ? ? ? 
2 J 203  0.33 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 26 ? ? ? 
3 K 203  0.51 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 27 ? ? ? 
4 L 203  0.65 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 28 ? ? ? 
5 M 203  0.50 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 29 ? ? ? 
6 N 203  0.44 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 30 ? ? ? 
7 O 203  0.38 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 31 ? ? ? 
8 P 203  0.47 5.00  'loose positional'  2 'X-RAY DIFFRACTION' 32 ? ? ? 
1 A 1019 0.53 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 33 ? ? ? 
2 B 1019 0.62 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 34 ? ? ? 
3 C 1019 0.54 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 35 ? ? ? 
4 D 1019 0.46 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 36 ? ? ? 
5 E 1019 0.47 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 37 ? ? ? 
6 F 1019 0.49 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 38 ? ? ? 
7 G 1019 0.47 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 39 ? ? ? 
8 H 1019 0.54 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 40 ? ? ? 
1 I 191  0.61 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 41 ? ? ? 
2 J 191  0.53 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 42 ? ? ? 
3 K 191  0.56 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 43 ? ? ? 
4 L 191  0.53 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 44 ? ? ? 
5 M 191  0.41 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 45 ? ? ? 
6 N 191  0.55 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 46 ? ? ? 
7 O 191  0.43 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 47 ? ? ? 
8 P 191  0.43 2.00  'medium thermal'    2 'X-RAY DIFFRACTION' 48 ? ? ? 
1 A 1112 1.16 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 49 ? ? ? 
2 B 1112 1.24 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 50 ? ? ? 
3 C 1112 1.09 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 51 ? ? ? 
4 D 1112 1.32 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 52 ? ? ? 
5 E 1112 1.12 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 53 ? ? ? 
6 F 1112 1.27 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 54 ? ? ? 
7 G 1112 1.11 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 55 ? ? ? 
8 H 1112 1.13 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 56 ? ? ? 
1 I 203  0.97 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 57 ? ? ? 
2 J 203  1.10 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 58 ? ? ? 
3 K 203  1.58 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 59 ? ? ? 
4 L 203  1.21 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 60 ? ? ? 
5 M 203  1.12 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 61 ? ? ? 
6 N 203  0.86 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 62 ? ? ? 
7 O 203  1.17 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 63 ? ? ? 
8 P 203  1.00 10.00 'loose thermal'     2 'X-RAY DIFFRACTION' 64 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.155 
_refine_ls_shell.number_reflns_R_work             6491 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.percent_reflns_obs               86.87 
_refine_ls_shell.R_factor_R_free                  0.285 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             386 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
1 5 E 
1 6 F 
1 7 G 
1 8 H 
2 1 I 
2 2 J 
2 3 K 
2 4 L 
2 5 M 
2 6 N 
2 7 O 
2 8 P 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 1  A 178 1 5 A MET 2 ? A GLY 179 ? 1 ? 
2 B 1  B 177 1 5 C MET 2 ? C LEU 178 ? 1 ? 
3 C 1  C 178 1 5 D MET 2 ? D GLY 179 ? 1 ? 
4 D 1  D 178 1 5 F MET 2 ? F GLY 179 ? 1 ? 
5 E 2  E 178 1 5 G GLN 3 ? G GLY 179 ? 1 ? 
6 F 1  F 178 1 5 B MET 2 ? B GLY 179 ? 1 ? 
7 G 1  G 178 1 5 E MET 2 ? E GLY 179 ? 1 ? 
8 H 1  H 178 1 5 H MET 2 ? H GLY 179 ? 1 ? 
1 I 10 I 43  1 5 I GLU 1 ? I ILE 34  ? 2 ? 
2 J 10 J 43  1 5 J GLU 1 ? J ILE 34  ? 2 ? 
3 K 10 K 43  1 5 K GLU 1 ? K ILE 34  ? 2 ? 
4 L 10 L 43  1 5 L GLU 1 ? L ILE 34  ? 2 ? 
5 M 10 M 43  1 5 M GLU 1 ? M ILE 34  ? 2 ? 
6 N 10 N 43  1 5 N GLU 1 ? N ILE 34  ? 2 ? 
7 O 10 O 43  1 5 O GLU 1 ? O ILE 34  ? 2 ? 
8 P 10 P 42  1 5 P GLU 1 ? P LEU 33  ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2OV2 
_struct.title                     
'The crystal structure of the human RAC3 in complex with the CRIB domain of human p21-activated kinase 4 (PAK4)' 
_struct.pdbx_descriptor           'Ras-related C3 botulinum toxin substrate 3, Serine/threonine-protein kinase PAK 4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OV2 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING/TRANSFERASE' 
_struct_keywords.text            
;GTPase RAC3, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signalling protein, CRIB, kinase, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING-TRANSFERASE COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 3 ? 
V  N N 5 ? 
W  N N 6 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 5 ? 
DA N N 6 ? 
EA N N 3 ? 
FA N N 5 ? 
GA N N 3 ? 
HA N N 5 ? 
IA N N 6 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 5 ? 
MA N N 3 ? 
NA N N 5 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 7 ? 
VA N N 7 ? 
WA N N 7 ? 
XA N N 7 ? 
YA N N 7 ? 
ZA N N 7 ? 
AB N N 7 ? 
BB N N 7 ? 
CB N N 7 ? 
DB N N 7 ? 
EB N N 7 ? 
FB N N 7 ? 
GB N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 16  ? ASN A 27  ? GLY A 15  ASN A 26  1 ? 12 
HELX_P HELX_P2  2  GLN A 62  ? ASP A 66  ? GLN A 61  ASP A 65  5 ? 5  
HELX_P HELX_P3  3  LEU A 68  ? TYR A 73  ? LEU A 67  TYR A 72  5 ? 6  
HELX_P HELX_P4  4  SER A 87  ? LYS A 97  ? SER A 86  LYS A 96  1 ? 11 
HELX_P HELX_P5  5  LYS A 97  ? CYS A 106 ? LYS A 96  CYS A 105 1 ? 10 
HELX_P HELX_P6  6  LYS A 117 ? ARG A 121 ? LYS A 116 ARG A 120 5 ? 5  
HELX_P HELX_P7  7  ASP A 123 ? LYS A 133 ? ASP A 122 LYS A 132 1 ? 11 
HELX_P HELX_P8  8  THR A 139 ? ILE A 150 ? THR A 138 ILE A 149 1 ? 12 
HELX_P HELX_P9  9  GLY A 165 ? GLY A 179 ? GLY A 164 GLY A 178 1 ? 15 
HELX_P HELX_P10 10 GLY B 16  ? ASN B 27  ? GLY F 15  ASN F 26  1 ? 12 
HELX_P HELX_P11 11 GLN B 62  ? ASP B 66  ? GLN F 61  ASP F 65  5 ? 5  
HELX_P HELX_P12 12 LEU B 68  ? TYR B 73  ? LEU F 67  TYR F 72  5 ? 6  
HELX_P HELX_P13 13 SER B 87  ? LYS B 97  ? SER F 86  LYS F 96  1 ? 11 
HELX_P HELX_P14 14 LYS B 97  ? CYS B 106 ? LYS F 96  CYS F 105 1 ? 10 
HELX_P HELX_P15 15 LYS B 117 ? ASP B 122 ? LYS F 116 ASP F 121 1 ? 6  
HELX_P HELX_P16 16 ASP B 123 ? LYS B 133 ? ASP F 122 LYS F 132 1 ? 11 
HELX_P HELX_P17 17 THR B 139 ? ILE B 150 ? THR F 138 ILE F 149 1 ? 12 
HELX_P HELX_P18 18 GLY B 165 ? GLY B 179 ? GLY F 164 GLY F 178 1 ? 15 
HELX_P HELX_P19 19 GLY C 16  ? ASN C 27  ? GLY B 15  ASN B 26  1 ? 12 
HELX_P HELX_P20 20 GLN C 62  ? ASP C 66  ? GLN B 61  ASP B 65  5 ? 5  
HELX_P HELX_P21 21 LEU C 68  ? TYR C 73  ? LEU B 67  TYR B 72  5 ? 6  
HELX_P HELX_P22 22 SER C 87  ? LYS C 97  ? SER B 86  LYS B 96  1 ? 11 
HELX_P HELX_P23 23 LYS C 97  ? CYS C 106 ? LYS B 96  CYS B 105 1 ? 10 
HELX_P HELX_P24 24 LYS C 117 ? ARG C 121 ? LYS B 116 ARG B 120 5 ? 5  
HELX_P HELX_P25 25 ASP C 123 ? ASP C 132 ? ASP B 122 ASP B 131 1 ? 10 
HELX_P HELX_P26 26 THR C 139 ? ILE C 150 ? THR B 138 ILE B 149 1 ? 12 
HELX_P HELX_P27 27 GLY C 165 ? LEU C 178 ? GLY B 164 LEU B 177 1 ? 14 
HELX_P HELX_P28 28 GLY D 16  ? ASN D 27  ? GLY C 15  ASN C 26  1 ? 12 
HELX_P HELX_P29 29 GLN D 62  ? ASP D 66  ? GLN C 61  ASP C 65  5 ? 5  
HELX_P HELX_P30 30 LEU D 68  ? TYR D 73  ? LEU C 67  TYR C 72  5 ? 6  
HELX_P HELX_P31 31 SER D 87  ? LYS D 97  ? SER C 86  LYS C 96  1 ? 11 
HELX_P HELX_P32 32 LYS D 97  ? CYS D 106 ? LYS C 96  CYS C 105 1 ? 10 
HELX_P HELX_P33 33 LYS D 117 ? ASP D 122 ? LYS C 116 ASP C 121 1 ? 6  
HELX_P HELX_P34 34 ASP D 123 ? LYS D 133 ? ASP C 122 LYS C 132 1 ? 11 
HELX_P HELX_P35 35 THR D 139 ? ILE D 150 ? THR C 138 ILE C 149 1 ? 12 
HELX_P HELX_P36 36 GLY D 165 ? GLY D 179 ? GLY C 164 GLY C 178 1 ? 15 
HELX_P HELX_P37 37 GLY E 16  ? ASN E 27  ? GLY G 15  ASN G 26  1 ? 12 
HELX_P HELX_P38 38 GLN E 62  ? ASP E 66  ? GLN G 61  ASP G 65  5 ? 5  
HELX_P HELX_P39 39 LEU E 68  ? TYR E 73  ? LEU G 67  TYR G 72  5 ? 6  
HELX_P HELX_P40 40 SER E 87  ? LYS E 97  ? SER G 86  LYS G 96  1 ? 11 
HELX_P HELX_P41 41 LYS E 97  ? CYS E 106 ? LYS G 96  CYS G 105 1 ? 10 
HELX_P HELX_P42 42 LYS E 117 ? ASP E 122 ? LYS G 116 ASP G 121 1 ? 6  
HELX_P HELX_P43 43 ASP E 123 ? LYS E 133 ? ASP G 122 LYS G 132 1 ? 11 
HELX_P HELX_P44 44 THR E 139 ? ILE E 150 ? THR G 138 ILE G 149 1 ? 12 
HELX_P HELX_P45 45 GLY E 165 ? GLY E 179 ? GLY G 164 GLY G 178 1 ? 15 
HELX_P HELX_P46 46 GLY F 16  ? ASN F 27  ? GLY D 15  ASN D 26  1 ? 12 
HELX_P HELX_P47 47 GLN F 62  ? ASP F 66  ? GLN D 61  ASP D 65  5 ? 5  
HELX_P HELX_P48 48 LEU F 68  ? TYR F 73  ? LEU D 67  TYR D 72  5 ? 6  
HELX_P HELX_P49 49 SER F 87  ? LYS F 97  ? SER D 86  LYS D 96  1 ? 11 
HELX_P HELX_P50 50 LYS F 97  ? CYS F 106 ? LYS D 96  CYS D 105 1 ? 10 
HELX_P HELX_P51 51 LYS F 117 ? ARG F 121 ? LYS D 116 ARG D 120 5 ? 5  
HELX_P HELX_P52 52 ASP F 123 ? LYS F 133 ? ASP D 122 LYS D 132 1 ? 11 
HELX_P HELX_P53 53 THR F 139 ? GLY F 151 ? THR D 138 GLY D 150 1 ? 13 
HELX_P HELX_P54 54 GLY F 165 ? GLY F 179 ? GLY D 164 GLY D 178 1 ? 15 
HELX_P HELX_P55 55 GLY G 16  ? ASN G 27  ? GLY E 15  ASN E 26  1 ? 12 
HELX_P HELX_P56 56 GLN G 62  ? ASP G 66  ? GLN E 61  ASP E 65  5 ? 5  
HELX_P HELX_P57 57 LEU G 68  ? TYR G 73  ? LEU E 67  TYR E 72  5 ? 6  
HELX_P HELX_P58 58 SER G 87  ? LYS G 97  ? SER E 86  LYS E 96  1 ? 11 
HELX_P HELX_P59 59 LYS G 97  ? CYS G 106 ? LYS E 96  CYS E 105 1 ? 10 
HELX_P HELX_P60 60 LYS G 117 ? ARG G 121 ? LYS E 116 ARG E 120 5 ? 5  
HELX_P HELX_P61 61 ASP G 123 ? LYS G 133 ? ASP E 122 LYS E 132 1 ? 11 
HELX_P HELX_P62 62 THR G 139 ? ILE G 150 ? THR E 138 ILE E 149 1 ? 12 
HELX_P HELX_P63 63 GLY G 165 ? GLY G 179 ? GLY E 164 GLY E 178 1 ? 15 
HELX_P HELX_P64 64 GLY H 16  ? ASN H 27  ? GLY H 15  ASN H 26  1 ? 12 
HELX_P HELX_P65 65 GLN H 62  ? ASP H 66  ? GLN H 61  ASP H 65  5 ? 5  
HELX_P HELX_P66 66 LEU H 68  ? TYR H 73  ? LEU H 67  TYR H 72  5 ? 6  
HELX_P HELX_P67 67 SER H 87  ? LYS H 97  ? SER H 86  LYS H 96  1 ? 11 
HELX_P HELX_P68 68 LYS H 97  ? CYS H 106 ? LYS H 96  CYS H 105 1 ? 10 
HELX_P HELX_P69 69 LYS H 117 ? ASP H 122 ? LYS H 116 ASP H 121 1 ? 6  
HELX_P HELX_P70 70 ASP H 125 ? ASP H 132 ? ASP H 124 ASP H 131 1 ? 8  
HELX_P HELX_P71 71 THR H 139 ? ILE H 150 ? THR H 138 ILE H 149 1 ? 12 
HELX_P HELX_P72 72 GLY H 165 ? GLY H 179 ? GLY H 164 GLY H 178 1 ? 15 
HELX_P HELX_P73 73 PRO I 27  ? GLN I 31  ? PRO I 36  GLN I 40  5 ? 5  
HELX_P HELX_P74 74 PRO J 27  ? SER J 32  ? PRO J 36  SER J 41  1 ? 6  
HELX_P HELX_P75 75 PRO K 27  ? SER K 32  ? PRO K 36  SER K 41  1 ? 6  
HELX_P HELX_P76 76 PRO L 27  ? ILE L 34  ? PRO L 36  ILE L 43  1 ? 8  
HELX_P HELX_P77 77 PRO M 27  ? GLN M 31  ? PRO M 36  GLN M 40  5 ? 5  
HELX_P HELX_P78 78 PRO O 27  ? GLN O 31  ? PRO O 36  GLN O 40  5 ? 5  
HELX_P HELX_P79 79 GLN P 29  ? LEU P 33  ? GLN P 38  LEU P 42  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? T  GCP . O1G ? ? ? 1_555 Q  MG  .  MG  ? ? A GCP 200 A MG  202  1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc2  metalc ? ? T  GCP . O2B ? ? ? 1_555 Q  MG  .  MG  ? ? A GCP 200 A MG  202  1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc3  metalc ? ? Q  MG  . MG  ? ? ? 1_555 RA HOH .  O   ? ? A MG  202 A HOH 1250 1_555 ? ? ? ? ? ? ? 2.063 ? 
metalc4  metalc ? ? Q  MG  . MG  ? ? ? 1_555 A  THR 36 OG1 ? ? A MG  202 A THR 35   1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc5  metalc ? ? Q  MG  . MG  ? ? ? 1_555 RA HOH .  O   ? ? A MG  202 A HOH 1222 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc6  metalc ? ? Q  MG  . MG  ? ? ? 1_555 A  THR 18 OG1 ? ? A MG  202 A THR 17   1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc7  metalc ? ? Z  GCP . O2B ? ? ? 1_555 X  MG  .  MG  ? ? B GCP 200 B MG  202  1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc8  metalc ? ? Z  GCP . O1G ? ? ? 1_555 X  MG  .  MG  ? ? B GCP 200 B MG  202  1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc9  metalc ? ? X  MG  . MG  ? ? ? 1_555 C  THR 18 OG1 ? ? B MG  202 B THR 17   1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc10 metalc ? ? X  MG  . MG  ? ? ? 1_555 C  THR 36 OG1 ? ? B MG  202 B THR 35   1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc11 metalc ? ? X  MG  . MG  ? ? ? 1_555 TA HOH .  O   ? ? B MG  202 B HOH 1253 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc12 metalc ? ? X  MG  . MG  ? ? ? 1_555 TA HOH .  O   ? ? B MG  202 B HOH 1220 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc13 metalc ? ? CA GCP . O3G ? ? ? 1_555 AA MG  .  MG  ? ? C GCP 200 C MG  202  1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc14 metalc ? ? AA MG  . MG  ? ? ? 1_555 D  THR 18 OG1 ? ? C MG  202 C THR 17   1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc15 metalc ? ? AA MG  . MG  ? ? ? 1_555 D  THR 36 OG1 ? ? C MG  202 C THR 35   1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc16 metalc ? ? AA MG  . MG  ? ? ? 1_555 UA HOH .  O   ? ? C MG  202 C HOH 1308 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc17 metalc ? ? AA MG  . MG  ? ? ? 1_555 CA GCP .  O1B ? ? C MG  202 C GCP 200  1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc18 metalc ? ? AA MG  . MG  ? ? ? 1_555 UA HOH .  O   ? ? C MG  202 C HOH 1360 1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc19 metalc ? ? HA GCP . O2G ? ? ? 1_555 GA MG  .  MG  ? ? D GCP 200 D MG  202  1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc20 metalc ? ? HA GCP . O1B ? ? ? 1_555 GA MG  .  MG  ? ? D GCP 200 D MG  202  1_555 ? ? ? ? ? ? ? 1.956 ? 
metalc21 metalc ? ? GA MG  . MG  ? ? ? 1_555 WA HOH .  O   ? ? D MG  202 D HOH 1328 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc22 metalc ? ? GA MG  . MG  ? ? ? 1_555 WA HOH .  O   ? ? D MG  202 D HOH 1317 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc23 metalc ? ? GA MG  . MG  ? ? ? 1_555 F  THR 18 OG1 ? ? D MG  202 D THR 17   1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc24 metalc ? ? GA MG  . MG  ? ? ? 1_555 F  THR 36 OG1 ? ? D MG  202 D THR 35   1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc25 metalc ? ? LA GCP . O3G ? ? ? 1_555 JA MG  .  MG  ? ? E GCP 200 E MG  202  1_555 ? ? ? ? ? ? ? 1.913 ? 
metalc26 metalc ? ? JA MG  . MG  ? ? ? 1_555 G  THR 18 OG1 ? ? E MG  202 E THR 17   1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc27 metalc ? ? JA MG  . MG  ? ? ? 1_555 G  THR 36 OG1 ? ? E MG  202 E THR 35   1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc28 metalc ? ? JA MG  . MG  ? ? ? 1_555 XA HOH .  O   ? ? E MG  202 E HOH 1242 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc29 metalc ? ? JA MG  . MG  ? ? ? 1_555 LA GCP .  O1B ? ? E MG  202 E GCP 200  1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc30 metalc ? ? JA MG  . MG  ? ? ? 1_555 XA HOH .  O   ? ? E MG  202 E HOH 1249 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc31 metalc ? ? V  GCP . O2G ? ? ? 1_555 U  MG  .  MG  ? ? F GCP 200 F MG  202  1_555 ? ? ? ? ? ? ? 1.909 ? 
metalc32 metalc ? ? U  MG  . MG  ? ? ? 1_555 B  THR 18 OG1 ? ? F MG  202 F THR 17   1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc33 metalc ? ? U  MG  . MG  ? ? ? 1_555 B  THR 36 OG1 ? ? F MG  202 F THR 35   1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc34 metalc ? ? U  MG  . MG  ? ? ? 1_555 V  GCP .  O1B ? ? F MG  202 F GCP 200  1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc35 metalc ? ? U  MG  . MG  ? ? ? 1_555 SA HOH .  O   ? ? F MG  202 F HOH 1334 1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc36 metalc ? ? U  MG  . MG  ? ? ? 1_555 SA HOH .  O   ? ? F MG  202 F HOH 1302 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc37 metalc ? ? EA MG  . MG  ? ? ? 1_555 FA GCP .  O1B ? ? G MG  202 G GCP 200  1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc38 metalc ? ? EA MG  . MG  ? ? ? 1_555 E  THR 18 OG1 ? ? G MG  202 G THR 17   1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc39 metalc ? ? EA MG  . MG  ? ? ? 1_555 VA HOH .  O   ? ? G MG  202 G HOH 249  1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc40 metalc ? ? EA MG  . MG  ? ? ? 1_555 FA GCP .  O3G ? ? G MG  202 G GCP 200  1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc41 metalc ? ? EA MG  . MG  ? ? ? 1_555 E  THR 36 OG1 ? ? G MG  202 G THR 35   1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc42 metalc ? ? EA MG  . MG  ? ? ? 1_555 VA HOH .  O   ? ? G MG  202 G HOH 236  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc43 metalc ? ? NA GCP . O1G ? ? ? 1_555 MA MG  .  MG  ? ? H GCP 200 H MG  202  1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc44 metalc ? ? NA GCP . O2B ? ? ? 1_555 MA MG  .  MG  ? ? H GCP 200 H MG  202  1_555 ? ? ? ? ? ? ? 1.876 ? 
metalc45 metalc ? ? MA MG  . MG  ? ? ? 1_555 YA HOH .  O   ? ? H MG  202 H HOH 263  1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc46 metalc ? ? MA MG  . MG  ? ? ? 1_555 YA HOH .  O   ? ? H MG  202 H HOH 217  1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc47 metalc ? ? MA MG  . MG  ? ? ? 1_555 H  THR 36 OG1 ? ? H MG  202 H THR 35   1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc48 metalc ? ? MA MG  . MG  ? ? ? 1_555 H  THR 18 OG1 ? ? H MG  202 H THR 17   1_555 ? ? ? ? ? ? ? 2.222 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
C ? 8 ? 
D ? 8 ? 
E ? 8 ? 
F ? 8 ? 
G ? 8 ? 
H ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
E 7 8 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
F 7 8 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
G 7 8 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
H 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 154 ? GLU A 157 ? LYS A 153 GLU A 156 
A 2 ILE A 111 ? THR A 116 ? ILE A 110 THR A 115 
A 3 VAL A 78  ? SER A 84  ? VAL A 77  SER A 83  
A 4 GLN A 3   ? GLY A 11  ? GLN A 2   GLY A 10  
A 5 LYS A 50  ? ASP A 58  ? LYS A 49  ASP A 57  
A 6 PHE A 38  ? VAL A 47  ? PHE A 37  VAL A 46  
A 7 SER I 6   ? ASP I 17  ? SER I 15  ASP I 26  
A 8 LYS I 22  ? THR I 24  ? LYS I 31  THR I 33  
B 1 LYS B 154 ? GLU B 157 ? LYS F 153 GLU F 156 
B 2 ILE B 111 ? THR B 116 ? ILE F 110 THR F 115 
B 3 VAL B 78  ? SER B 84  ? VAL F 77  SER F 83  
B 4 ALA B 4   ? GLY B 11  ? ALA F 3   GLY F 10  
B 5 LYS B 50  ? THR B 59  ? LYS F 49  THR F 58  
B 6 PHE B 38  ? VAL B 47  ? PHE F 37  VAL F 46  
B 7 SER N 6   ? ASP N 17  ? SER N 15  ASP N 26  
B 8 LYS N 22  ? THR N 24  ? LYS N 31  THR N 33  
C 1 LYS C 154 ? GLU C 157 ? LYS B 153 GLU B 156 
C 2 ILE C 111 ? THR C 116 ? ILE B 110 THR B 115 
C 3 VAL C 78  ? SER C 84  ? VAL B 77  SER B 83  
C 4 ALA C 4   ? GLY C 11  ? ALA B 3   GLY B 10  
C 5 LYS C 50  ? THR C 59  ? LYS B 49  THR B 58  
C 6 PHE C 38  ? VAL C 47  ? PHE B 37  VAL B 46  
C 7 SER J 6   ? ASP J 17  ? SER J 15  ASP J 26  
C 8 LYS J 22  ? THR J 24  ? LYS J 31  THR J 33  
D 1 LYS D 154 ? GLU D 157 ? LYS C 153 GLU C 156 
D 2 ILE D 111 ? THR D 116 ? ILE C 110 THR C 115 
D 3 VAL D 78  ? SER D 84  ? VAL C 77  SER C 83  
D 4 GLN D 3   ? GLY D 11  ? GLN C 2   GLY C 10  
D 5 LYS D 50  ? THR D 59  ? LYS C 49  THR C 58  
D 6 PHE D 38  ? VAL D 47  ? PHE C 37  VAL C 46  
D 7 SER K 6   ? ASP K 17  ? SER K 15  ASP K 26  
D 8 LYS K 22  ? THR K 24  ? LYS K 31  THR K 33  
E 1 LYS E 154 ? GLU E 157 ? LYS G 153 GLU G 156 
E 2 ILE E 111 ? THR E 116 ? ILE G 110 THR G 115 
E 3 VAL E 78  ? SER E 84  ? VAL G 77  SER G 83  
E 4 GLN E 3   ? GLY E 11  ? GLN G 2   GLY G 10  
E 5 LYS E 50  ? THR E 59  ? LYS G 49  THR G 58  
E 6 PHE E 38  ? VAL E 47  ? PHE G 37  VAL G 46  
E 7 SER O 6   ? ASP O 17  ? SER O 15  ASP O 26  
E 8 LYS O 22  ? THR O 24  ? LYS O 31  THR O 33  
F 1 LYS F 154 ? GLU F 157 ? LYS D 153 GLU D 156 
F 2 ILE F 111 ? THR F 116 ? ILE D 110 THR D 115 
F 3 VAL F 78  ? SER F 84  ? VAL D 77  SER D 83  
F 4 GLN F 3   ? GLY F 11  ? GLN D 2   GLY D 10  
F 5 LYS F 50  ? THR F 59  ? LYS D 49  THR D 58  
F 6 PHE F 38  ? VAL F 47  ? PHE D 37  VAL D 46  
F 7 SER L 6   ? ASP L 17  ? SER L 15  ASP L 26  
F 8 LYS L 22  ? THR L 24  ? LYS L 31  THR L 33  
G 1 LYS G 154 ? GLU G 157 ? LYS E 153 GLU E 156 
G 2 ILE G 111 ? THR G 116 ? ILE E 110 THR E 115 
G 3 VAL G 78  ? SER G 84  ? VAL E 77  SER E 83  
G 4 ALA G 4   ? GLY G 11  ? ALA E 3   GLY E 10  
G 5 LYS G 50  ? THR G 59  ? LYS E 49  THR E 58  
G 6 PHE G 38  ? VAL G 47  ? PHE E 37  VAL E 46  
G 7 SER M 6   ? ASP M 17  ? SER M 15  ASP M 26  
G 8 LYS M 22  ? THR M 24  ? LYS M 31  THR M 33  
H 1 LYS H 154 ? GLU H 157 ? LYS H 153 GLU H 156 
H 2 ILE H 111 ? THR H 116 ? ILE H 110 THR H 115 
H 3 VAL H 78  ? SER H 84  ? VAL H 77  SER H 83  
H 4 ALA H 4   ? GLY H 11  ? ALA H 3   GLY H 10  
H 5 LYS H 50  ? THR H 59  ? LYS H 49  THR H 58  
H 6 PHE H 38  ? VAL H 47  ? PHE H 37  VAL H 46  
H 7 SER P 6   ? ASP P 17  ? SER P 15  ASP P 26  
H 8 LYS P 22  ? THR P 24  ? LYS P 31  THR P 33  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 156 ? O LEU A 155 N GLY A 115 ? N GLY A 114 
A 2 3 O VAL A 114 ? O VAL A 113 N ILE A 81  ? N ILE A 80  
A 3 4 O CYS A 82  ? O CYS A 81  N VAL A 10  ? N VAL A 9   
A 4 5 N VAL A 9   ? N VAL A 8   O TRP A 57  ? O TRP A 56  
A 5 6 O LYS A 50  ? O LYS A 49  N VAL A 47  ? N VAL A 46  
A 6 7 N ASN A 44  ? N ASN A 43  O SER I 6   ? O SER I 15  
A 7 8 N ASP I 17  ? N ASP I 26  O LYS I 22  ? O LYS I 31  
B 1 2 O LEU B 156 ? O LEU F 155 N GLY B 115 ? N GLY F 114 
B 2 3 O THR B 116 ? O THR F 115 N PHE B 83  ? N PHE F 82  
B 3 4 O CYS B 82  ? O CYS F 81  N VAL B 10  ? N VAL F 9   
B 4 5 N CYS B 7   ? N CYS F 6   O GLY B 55  ? O GLY F 54  
B 5 6 O LEU B 56  ? O LEU F 55  N TYR B 41  ? N TYR F 40  
B 6 7 N ASN B 44  ? N ASN F 43  O SER N 6   ? O SER N 15  
B 7 8 N ASP N 17  ? N ASP N 26  O LYS N 22  ? O LYS N 31  
C 1 2 O LEU C 156 ? O LEU B 155 N GLY C 115 ? N GLY B 114 
C 2 3 O THR C 116 ? O THR B 115 N PHE C 83  ? N PHE B 82  
C 3 4 O CYS C 82  ? O CYS B 81  N VAL C 10  ? N VAL B 9   
C 4 5 N ILE C 5   ? N ILE B 4   O GLY C 55  ? O GLY B 54  
C 5 6 O LEU C 54  ? O LEU B 53  N ALA C 43  ? N ALA B 42  
C 6 7 N PHE C 38  ? N PHE B 37  O THR J 14  ? O THR J 23  
C 7 8 N ASP J 17  ? N ASP J 26  O LYS J 22  ? O LYS J 31  
D 1 2 O LEU D 156 ? O LEU C 155 N GLY D 115 ? N GLY C 114 
D 2 3 O VAL D 114 ? O VAL C 113 N ILE D 81  ? N ILE C 80  
D 3 4 O CYS D 82  ? O CYS C 81  N VAL D 10  ? N VAL C 9   
D 4 5 N ILE D 5   ? N ILE C 4   O GLY D 55  ? O GLY C 54  
D 5 6 O LYS D 50  ? O LYS C 49  N VAL D 47  ? N VAL C 46  
D 6 7 N PHE D 38  ? N PHE C 37  O THR K 14  ? O THR K 23  
D 7 8 N ASP K 17  ? N ASP K 26  O LYS K 22  ? O LYS K 31  
E 1 2 O LEU E 156 ? O LEU G 155 N GLY E 115 ? N GLY G 114 
E 2 3 O THR E 116 ? O THR G 115 N PHE E 83  ? N PHE G 82  
E 3 4 O CYS E 82  ? O CYS G 81  N VAL E 10  ? N VAL G 9   
E 4 5 N GLN E 3   ? N GLN G 2   O ASN E 53  ? O ASN G 52  
E 5 6 O LEU E 56  ? O LEU G 55  N TYR E 41  ? N TYR G 40  
E 6 7 N ASN E 44  ? N ASN G 43  O SER O 6   ? O SER O 15  
E 7 8 N ASP O 17  ? N ASP O 26  O LYS O 22  ? O LYS O 31  
F 1 2 O LEU F 156 ? O LEU D 155 N GLY F 115 ? N GLY D 114 
F 2 3 O VAL F 114 ? O VAL D 113 N ILE F 81  ? N ILE D 80  
F 3 4 O LEU F 80  ? O LEU D 79  N VAL F 10  ? N VAL D 9   
F 4 5 N CYS F 7   ? N CYS D 6   O GLY F 55  ? O GLY D 54  
F 5 6 O LEU F 54  ? O LEU D 53  N ALA F 43  ? N ALA D 42  
F 6 7 N PHE F 38  ? N PHE D 37  O THR L 14  ? O THR L 23  
F 7 8 N GLY L 15  ? N GLY L 24  O THR L 24  ? O THR L 33  
G 1 2 O LEU G 156 ? O LEU E 155 N GLY G 115 ? N GLY E 114 
G 2 3 O LEU G 112 ? O LEU E 111 N PHE G 79  ? N PHE E 78  
G 3 4 O CYS G 82  ? O CYS E 81  N VAL G 10  ? N VAL E 9   
G 4 5 N ILE G 5   ? N ILE E 4   O GLY G 55  ? O GLY E 54  
G 5 6 O LEU G 56  ? O LEU E 55  N TYR G 41  ? N TYR E 40  
G 6 7 N PHE G 38  ? N PHE E 37  O THR M 14  ? O THR M 23  
G 7 8 N ASP M 17  ? N ASP M 26  O LYS M 22  ? O LYS M 31  
H 1 2 O LEU H 156 ? O LEU H 155 N GLY H 115 ? N GLY H 114 
H 2 3 O LEU H 112 ? O LEU H 111 N PHE H 79  ? N PHE H 78  
H 3 4 O CYS H 82  ? O CYS H 81  N VAL H 10  ? N VAL H 9   
H 4 5 N ILE H 5   ? N ILE H 4   O GLY H 55  ? O GLY H 54  
H 5 6 O LYS H 50  ? O LYS H 49  N VAL H 47  ? N VAL H 46  
H 6 7 N ASN H 44  ? N ASN H 43  O SER P 6   ? O SER P 15  
H 7 8 N ASP P 17  ? N ASP P 26  O LYS P 22  ? O LYS P 31  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 202'   
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG F 202'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 202'   
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG C 202'   
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG G 202'   
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG D 202'   
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG E 202'   
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG H 202'   
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1201'  
BC1 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL C 1203'  
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B 1204'  
BC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL P 1205'  
BC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL N 1206'  
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL O 1209'  
BC6 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE GCP A 200'  
BC7 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE GCP F 200'  
BC8 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE GCP B 200'  
BC9 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE GCP C 200'  
CC1 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE GCP G 200'  
CC2 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE GCP D 200'  
CC3 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE GCP E 200'  
CC4 Software ? ? ? ? 30 'BINDING SITE FOR RESIDUE GCP H 200'  
CC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO F 1301' 
CC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO C 1302' 
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE EDO D 1303' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  THR A  18  ? THR A 17   . ? 1_555 ? 
2   AC1 5  THR A  36  ? THR A 35   . ? 1_555 ? 
3   AC1 5  GCP T  .   ? GCP A 200  . ? 1_555 ? 
4   AC1 5  HOH RA .   ? HOH A 1222 . ? 1_555 ? 
5   AC1 5  HOH RA .   ? HOH A 1250 . ? 1_555 ? 
6   AC2 5  THR B  18  ? THR F 17   . ? 1_555 ? 
7   AC2 5  THR B  36  ? THR F 35   . ? 1_555 ? 
8   AC2 5  GCP V  .   ? GCP F 200  . ? 1_555 ? 
9   AC2 5  HOH SA .   ? HOH F 1302 . ? 1_555 ? 
10  AC2 5  HOH SA .   ? HOH F 1334 . ? 1_555 ? 
11  AC3 5  THR C  18  ? THR B 17   . ? 1_555 ? 
12  AC3 5  THR C  36  ? THR B 35   . ? 1_555 ? 
13  AC3 5  GCP Z  .   ? GCP B 200  . ? 1_555 ? 
14  AC3 5  HOH TA .   ? HOH B 1220 . ? 1_555 ? 
15  AC3 5  HOH TA .   ? HOH B 1253 . ? 1_555 ? 
16  AC4 5  THR D  18  ? THR C 17   . ? 1_555 ? 
17  AC4 5  THR D  36  ? THR C 35   . ? 1_555 ? 
18  AC4 5  GCP CA .   ? GCP C 200  . ? 1_555 ? 
19  AC4 5  HOH UA .   ? HOH C 1308 . ? 1_555 ? 
20  AC4 5  HOH UA .   ? HOH C 1360 . ? 1_555 ? 
21  AC5 5  THR E  18  ? THR G 17   . ? 1_555 ? 
22  AC5 5  THR E  36  ? THR G 35   . ? 1_555 ? 
23  AC5 5  GCP FA .   ? GCP G 200  . ? 1_555 ? 
24  AC5 5  HOH VA .   ? HOH G 236  . ? 1_555 ? 
25  AC5 5  HOH VA .   ? HOH G 249  . ? 1_555 ? 
26  AC6 5  THR F  18  ? THR D 17   . ? 1_555 ? 
27  AC6 5  THR F  36  ? THR D 35   . ? 1_555 ? 
28  AC6 5  GCP HA .   ? GCP D 200  . ? 1_555 ? 
29  AC6 5  HOH WA .   ? HOH D 1317 . ? 1_555 ? 
30  AC6 5  HOH WA .   ? HOH D 1328 . ? 1_555 ? 
31  AC7 5  THR G  18  ? THR E 17   . ? 1_555 ? 
32  AC7 5  THR G  36  ? THR E 35   . ? 1_555 ? 
33  AC7 5  GCP LA .   ? GCP E 200  . ? 1_555 ? 
34  AC7 5  HOH XA .   ? HOH E 1242 . ? 1_555 ? 
35  AC7 5  HOH XA .   ? HOH E 1249 . ? 1_555 ? 
36  AC8 5  THR H  18  ? THR H 17   . ? 1_555 ? 
37  AC8 5  THR H  36  ? THR H 35   . ? 1_555 ? 
38  AC8 5  GCP NA .   ? GCP H 200  . ? 1_555 ? 
39  AC8 5  HOH YA .   ? HOH H 217  . ? 1_555 ? 
40  AC8 5  HOH YA .   ? HOH H 263  . ? 1_555 ? 
41  AC9 1  SER A  152 ? SER A 151  . ? 1_555 ? 
42  BC1 2  HOH TA .   ? HOH B 1213 . ? 1_555 ? 
43  BC1 2  ARG D  103 ? ARG C 102  . ? 1_555 ? 
44  BC2 2  SER C  23  ? SER B 22   . ? 1_555 ? 
45  BC2 2  LEU C  161 ? LEU B 160  . ? 1_555 ? 
46  BC3 1  GLN P  18  ? GLN P 27   . ? 1_555 ? 
47  BC4 1  PRO N  5   ? PRO N 14   . ? 1_555 ? 
48  BC5 2  GLN O  18  ? GLN O 27   . ? 1_555 ? 
49  BC5 2  HOH FB .   ? HOH O 759  . ? 1_555 ? 
50  BC6 30 ALA A  14  ? ALA A 13   . ? 1_555 ? 
51  BC6 30 VAL A  15  ? VAL A 14   . ? 1_555 ? 
52  BC6 30 GLY A  16  ? GLY A 15   . ? 1_555 ? 
53  BC6 30 LYS A  17  ? LYS A 16   . ? 1_555 ? 
54  BC6 30 THR A  18  ? THR A 17   . ? 1_555 ? 
55  BC6 30 CYS A  19  ? CYS A 18   . ? 1_555 ? 
56  BC6 30 PHE A  29  ? PHE A 28   . ? 1_555 ? 
57  BC6 30 TYR A  33  ? TYR A 32   . ? 1_555 ? 
58  BC6 30 PRO A  35  ? PRO A 34   . ? 1_555 ? 
59  BC6 30 THR A  36  ? THR A 35   . ? 1_555 ? 
60  BC6 30 GLY A  61  ? GLY A 60   . ? 1_555 ? 
61  BC6 30 LYS A  117 ? LYS A 116  . ? 1_555 ? 
62  BC6 30 ASP A  119 ? ASP A 118  . ? 1_555 ? 
63  BC6 30 LEU A  120 ? LEU A 119  . ? 1_555 ? 
64  BC6 30 SER A  159 ? SER A 158  . ? 1_555 ? 
65  BC6 30 ALA A  160 ? ALA A 159  . ? 1_555 ? 
66  BC6 30 LEU A  161 ? LEU A 160  . ? 1_555 ? 
67  BC6 30 MG  Q  .   ? MG  A 202  . ? 1_555 ? 
68  BC6 30 HOH RA .   ? HOH A 1208 . ? 1_555 ? 
69  BC6 30 HOH RA .   ? HOH A 1209 . ? 1_555 ? 
70  BC6 30 HOH RA .   ? HOH A 1210 . ? 1_555 ? 
71  BC6 30 HOH RA .   ? HOH A 1221 . ? 1_555 ? 
72  BC6 30 HOH RA .   ? HOH A 1222 . ? 1_555 ? 
73  BC6 30 HOH RA .   ? HOH A 1227 . ? 1_555 ? 
74  BC6 30 HOH RA .   ? HOH A 1234 . ? 1_555 ? 
75  BC6 30 HOH RA .   ? HOH A 1250 . ? 1_555 ? 
76  BC6 30 HOH RA .   ? HOH A 1254 . ? 1_555 ? 
77  BC6 30 HOH RA .   ? HOH A 1283 . ? 1_555 ? 
78  BC6 30 HOH RA .   ? HOH A 1290 . ? 1_555 ? 
79  BC6 30 GLN J  18  ? GLN J 27   . ? 1_555 ? 
80  BC7 29 ALA B  14  ? ALA F 13   . ? 1_555 ? 
81  BC7 29 VAL B  15  ? VAL F 14   . ? 1_555 ? 
82  BC7 29 GLY B  16  ? GLY F 15   . ? 1_555 ? 
83  BC7 29 LYS B  17  ? LYS F 16   . ? 1_555 ? 
84  BC7 29 THR B  18  ? THR F 17   . ? 1_555 ? 
85  BC7 29 CYS B  19  ? CYS F 18   . ? 1_555 ? 
86  BC7 29 PHE B  29  ? PHE F 28   . ? 1_555 ? 
87  BC7 29 TYR B  33  ? TYR F 32   . ? 1_555 ? 
88  BC7 29 PRO B  35  ? PRO F 34   . ? 1_555 ? 
89  BC7 29 THR B  36  ? THR F 35   . ? 1_555 ? 
90  BC7 29 GLY B  61  ? GLY F 60   . ? 1_555 ? 
91  BC7 29 LYS B  117 ? LYS F 116  . ? 1_555 ? 
92  BC7 29 ASP B  119 ? ASP F 118  . ? 1_555 ? 
93  BC7 29 LEU B  120 ? LEU F 119  . ? 1_555 ? 
94  BC7 29 SER B  159 ? SER F 158  . ? 1_555 ? 
95  BC7 29 ALA B  160 ? ALA F 159  . ? 1_555 ? 
96  BC7 29 LEU B  161 ? LEU F 160  . ? 1_555 ? 
97  BC7 29 MG  U  .   ? MG  F 202  . ? 1_555 ? 
98  BC7 29 EDO W  .   ? EDO F 1301 . ? 1_555 ? 
99  BC7 29 HOH SA .   ? HOH F 1302 . ? 1_555 ? 
100 BC7 29 HOH SA .   ? HOH F 1303 . ? 1_555 ? 
101 BC7 29 HOH SA .   ? HOH F 1319 . ? 1_555 ? 
102 BC7 29 HOH SA .   ? HOH F 1332 . ? 1_555 ? 
103 BC7 29 HOH SA .   ? HOH F 1333 . ? 1_555 ? 
104 BC7 29 HOH SA .   ? HOH F 1334 . ? 1_555 ? 
105 BC7 29 HOH SA .   ? HOH F 1335 . ? 1_555 ? 
106 BC7 29 HOH VA .   ? HOH G 207  . ? 1_554 ? 
107 BC7 29 GLN O  18  ? GLN O 27   . ? 1_554 ? 
108 BC7 29 HOH FB .   ? HOH O 586  . ? 1_554 ? 
109 BC8 28 HOH RA .   ? HOH A 1241 . ? 1_555 ? 
110 BC8 28 ALA C  14  ? ALA B 13   . ? 1_555 ? 
111 BC8 28 VAL C  15  ? VAL B 14   . ? 1_555 ? 
112 BC8 28 GLY C  16  ? GLY B 15   . ? 1_555 ? 
113 BC8 28 LYS C  17  ? LYS B 16   . ? 1_555 ? 
114 BC8 28 THR C  18  ? THR B 17   . ? 1_555 ? 
115 BC8 28 CYS C  19  ? CYS B 18   . ? 1_555 ? 
116 BC8 28 PHE C  29  ? PHE B 28   . ? 1_555 ? 
117 BC8 28 TYR C  33  ? TYR B 32   . ? 1_555 ? 
118 BC8 28 PRO C  35  ? PRO B 34   . ? 1_555 ? 
119 BC8 28 THR C  36  ? THR B 35   . ? 1_555 ? 
120 BC8 28 GLY C  61  ? GLY B 60   . ? 1_555 ? 
121 BC8 28 LYS C  117 ? LYS B 116  . ? 1_555 ? 
122 BC8 28 ASP C  119 ? ASP B 118  . ? 1_555 ? 
123 BC8 28 LEU C  120 ? LEU B 119  . ? 1_555 ? 
124 BC8 28 SER C  159 ? SER B 158  . ? 1_555 ? 
125 BC8 28 ALA C  160 ? ALA B 159  . ? 1_555 ? 
126 BC8 28 LEU C  161 ? LEU B 160  . ? 1_555 ? 
127 BC8 28 MG  X  .   ? MG  B 202  . ? 1_555 ? 
128 BC8 28 HOH TA .   ? HOH B 1205 . ? 1_555 ? 
129 BC8 28 HOH TA .   ? HOH B 1209 . ? 1_555 ? 
130 BC8 28 HOH TA .   ? HOH B 1219 . ? 1_555 ? 
131 BC8 28 HOH TA .   ? HOH B 1220 . ? 1_555 ? 
132 BC8 28 HOH TA .   ? HOH B 1226 . ? 1_555 ? 
133 BC8 28 HOH TA .   ? HOH B 1228 . ? 1_555 ? 
134 BC8 28 HOH TA .   ? HOH B 1232 . ? 1_555 ? 
135 BC8 28 HOH TA .   ? HOH B 1253 . ? 1_555 ? 
136 BC8 28 GLN I  18  ? GLN I 27   . ? 1_555 ? 
137 BC9 28 ALA D  14  ? ALA C 13   . ? 1_555 ? 
138 BC9 28 VAL D  15  ? VAL C 14   . ? 1_555 ? 
139 BC9 28 GLY D  16  ? GLY C 15   . ? 1_555 ? 
140 BC9 28 LYS D  17  ? LYS C 16   . ? 1_555 ? 
141 BC9 28 THR D  18  ? THR C 17   . ? 1_555 ? 
142 BC9 28 CYS D  19  ? CYS C 18   . ? 1_555 ? 
143 BC9 28 PHE D  29  ? PHE C 28   . ? 1_555 ? 
144 BC9 28 TYR D  33  ? TYR C 32   . ? 1_555 ? 
145 BC9 28 PRO D  35  ? PRO C 34   . ? 1_555 ? 
146 BC9 28 THR D  36  ? THR C 35   . ? 1_555 ? 
147 BC9 28 GLY D  61  ? GLY C 60   . ? 1_555 ? 
148 BC9 28 LYS D  117 ? LYS C 116  . ? 1_555 ? 
149 BC9 28 ASP D  119 ? ASP C 118  . ? 1_555 ? 
150 BC9 28 LEU D  120 ? LEU C 119  . ? 1_555 ? 
151 BC9 28 SER D  159 ? SER C 158  . ? 1_555 ? 
152 BC9 28 ALA D  160 ? ALA C 159  . ? 1_555 ? 
153 BC9 28 LEU D  161 ? LEU C 160  . ? 1_555 ? 
154 BC9 28 MG  AA .   ? MG  C 202  . ? 1_555 ? 
155 BC9 28 EDO DA .   ? EDO C 1302 . ? 1_555 ? 
156 BC9 28 HOH UA .   ? HOH C 1303 . ? 1_555 ? 
157 BC9 28 HOH UA .   ? HOH C 1307 . ? 1_555 ? 
158 BC9 28 HOH UA .   ? HOH C 1308 . ? 1_555 ? 
159 BC9 28 HOH UA .   ? HOH C 1321 . ? 1_555 ? 
160 BC9 28 HOH UA .   ? HOH C 1330 . ? 1_555 ? 
161 BC9 28 HOH UA .   ? HOH C 1338 . ? 1_555 ? 
162 BC9 28 HOH UA .   ? HOH C 1339 . ? 1_555 ? 
163 BC9 28 HOH UA .   ? HOH C 1360 . ? 1_555 ? 
164 BC9 28 GLN L  18  ? GLN L 27   . ? 1_645 ? 
165 CC1 29 HOH SA .   ? HOH F 1304 . ? 1_556 ? 
166 CC1 29 ALA E  14  ? ALA G 13   . ? 1_555 ? 
167 CC1 29 VAL E  15  ? VAL G 14   . ? 1_555 ? 
168 CC1 29 GLY E  16  ? GLY G 15   . ? 1_555 ? 
169 CC1 29 LYS E  17  ? LYS G 16   . ? 1_555 ? 
170 CC1 29 THR E  18  ? THR G 17   . ? 1_555 ? 
171 CC1 29 CYS E  19  ? CYS G 18   . ? 1_555 ? 
172 CC1 29 PHE E  29  ? PHE G 28   . ? 1_555 ? 
173 CC1 29 TYR E  33  ? TYR G 32   . ? 1_555 ? 
174 CC1 29 PRO E  35  ? PRO G 34   . ? 1_555 ? 
175 CC1 29 THR E  36  ? THR G 35   . ? 1_555 ? 
176 CC1 29 GLY E  61  ? GLY G 60   . ? 1_555 ? 
177 CC1 29 LYS E  117 ? LYS G 116  . ? 1_555 ? 
178 CC1 29 ASP E  119 ? ASP G 118  . ? 1_555 ? 
179 CC1 29 LEU E  120 ? LEU G 119  . ? 1_555 ? 
180 CC1 29 SER E  159 ? SER G 158  . ? 1_555 ? 
181 CC1 29 ALA E  160 ? ALA G 159  . ? 1_555 ? 
182 CC1 29 LEU E  161 ? LEU G 160  . ? 1_555 ? 
183 CC1 29 MG  EA .   ? MG  G 202  . ? 1_555 ? 
184 CC1 29 HOH VA .   ? HOH G 203  . ? 1_555 ? 
185 CC1 29 HOH VA .   ? HOH G 204  . ? 1_555 ? 
186 CC1 29 HOH VA .   ? HOH G 213  . ? 1_555 ? 
187 CC1 29 HOH VA .   ? HOH G 221  . ? 1_555 ? 
188 CC1 29 HOH VA .   ? HOH G 225  . ? 1_555 ? 
189 CC1 29 HOH VA .   ? HOH G 236  . ? 1_555 ? 
190 CC1 29 HOH VA .   ? HOH G 237  . ? 1_555 ? 
191 CC1 29 HOH VA .   ? HOH G 249  . ? 1_555 ? 
192 CC1 29 GLN N  18  ? GLN N 27   . ? 1_556 ? 
193 CC1 29 HOH EB .   ? HOH N 530  . ? 1_556 ? 
194 CC2 27 ALA F  14  ? ALA D 13   . ? 1_555 ? 
195 CC2 27 VAL F  15  ? VAL D 14   . ? 1_555 ? 
196 CC2 27 GLY F  16  ? GLY D 15   . ? 1_555 ? 
197 CC2 27 LYS F  17  ? LYS D 16   . ? 1_555 ? 
198 CC2 27 THR F  18  ? THR D 17   . ? 1_555 ? 
199 CC2 27 CYS F  19  ? CYS D 18   . ? 1_555 ? 
200 CC2 27 PHE F  29  ? PHE D 28   . ? 1_555 ? 
201 CC2 27 TYR F  33  ? TYR D 32   . ? 1_555 ? 
202 CC2 27 PRO F  35  ? PRO D 34   . ? 1_555 ? 
203 CC2 27 THR F  36  ? THR D 35   . ? 1_555 ? 
204 CC2 27 GLY F  61  ? GLY D 60   . ? 1_555 ? 
205 CC2 27 LYS F  117 ? LYS D 116  . ? 1_555 ? 
206 CC2 27 ASP F  119 ? ASP D 118  . ? 1_555 ? 
207 CC2 27 SER F  159 ? SER D 158  . ? 1_555 ? 
208 CC2 27 ALA F  160 ? ALA D 159  . ? 1_555 ? 
209 CC2 27 LEU F  161 ? LEU D 160  . ? 1_555 ? 
210 CC2 27 MG  GA .   ? MG  D 202  . ? 1_555 ? 
211 CC2 27 EDO IA .   ? EDO D 1303 . ? 1_555 ? 
212 CC2 27 HOH WA .   ? HOH D 1305 . ? 1_555 ? 
213 CC2 27 HOH WA .   ? HOH D 1317 . ? 1_555 ? 
214 CC2 27 HOH WA .   ? HOH D 1328 . ? 1_555 ? 
215 CC2 27 HOH WA .   ? HOH D 1330 . ? 1_555 ? 
216 CC2 27 HOH WA .   ? HOH D 1333 . ? 1_555 ? 
217 CC2 27 HOH WA .   ? HOH D 1334 . ? 1_555 ? 
218 CC2 27 HOH WA .   ? HOH D 1339 . ? 1_555 ? 
219 CC2 27 HOH WA .   ? HOH D 1340 . ? 1_555 ? 
220 CC2 27 GLN K  18  ? GLN K 27   . ? 1_465 ? 
221 CC3 28 ALA G  14  ? ALA E 13   . ? 1_555 ? 
222 CC3 28 VAL G  15  ? VAL E 14   . ? 1_555 ? 
223 CC3 28 GLY G  16  ? GLY E 15   . ? 1_555 ? 
224 CC3 28 LYS G  17  ? LYS E 16   . ? 1_555 ? 
225 CC3 28 THR G  18  ? THR E 17   . ? 1_555 ? 
226 CC3 28 CYS G  19  ? CYS E 18   . ? 1_555 ? 
227 CC3 28 PHE G  29  ? PHE E 28   . ? 1_555 ? 
228 CC3 28 TYR G  33  ? TYR E 32   . ? 1_555 ? 
229 CC3 28 PRO G  35  ? PRO E 34   . ? 1_555 ? 
230 CC3 28 THR G  36  ? THR E 35   . ? 1_555 ? 
231 CC3 28 GLY G  61  ? GLY E 60   . ? 1_555 ? 
232 CC3 28 LYS G  117 ? LYS E 116  . ? 1_555 ? 
233 CC3 28 ASP G  119 ? ASP E 118  . ? 1_555 ? 
234 CC3 28 LEU G  120 ? LEU E 119  . ? 1_555 ? 
235 CC3 28 SER G  159 ? SER E 158  . ? 1_555 ? 
236 CC3 28 ALA G  160 ? ALA E 159  . ? 1_555 ? 
237 CC3 28 LEU G  161 ? LEU E 160  . ? 1_555 ? 
238 CC3 28 MG  JA .   ? MG  E 202  . ? 1_555 ? 
239 CC3 28 HOH XA .   ? HOH E 1209 . ? 1_555 ? 
240 CC3 28 HOH XA .   ? HOH E 1213 . ? 1_555 ? 
241 CC3 28 HOH XA .   ? HOH E 1215 . ? 1_555 ? 
242 CC3 28 HOH XA .   ? HOH E 1216 . ? 1_555 ? 
243 CC3 28 HOH XA .   ? HOH E 1240 . ? 1_555 ? 
244 CC3 28 HOH XA .   ? HOH E 1242 . ? 1_555 ? 
245 CC3 28 HOH XA .   ? HOH E 1249 . ? 1_555 ? 
246 CC3 28 HOH XA .   ? HOH E 1259 . ? 1_555 ? 
247 CC3 28 HOH YA .   ? HOH H 208  . ? 1_555 ? 
248 CC3 28 GLN P  18  ? GLN P 27   . ? 1_555 ? 
249 CC4 30 HOH XA .   ? HOH E 1225 . ? 1_555 ? 
250 CC4 30 ALA H  14  ? ALA H 13   . ? 1_555 ? 
251 CC4 30 VAL H  15  ? VAL H 14   . ? 1_555 ? 
252 CC4 30 GLY H  16  ? GLY H 15   . ? 1_555 ? 
253 CC4 30 LYS H  17  ? LYS H 16   . ? 1_555 ? 
254 CC4 30 THR H  18  ? THR H 17   . ? 1_555 ? 
255 CC4 30 CYS H  19  ? CYS H 18   . ? 1_555 ? 
256 CC4 30 PHE H  29  ? PHE H 28   . ? 1_555 ? 
257 CC4 30 TYR H  33  ? TYR H 32   . ? 1_555 ? 
258 CC4 30 PRO H  35  ? PRO H 34   . ? 1_555 ? 
259 CC4 30 THR H  36  ? THR H 35   . ? 1_555 ? 
260 CC4 30 GLY H  61  ? GLY H 60   . ? 1_555 ? 
261 CC4 30 LYS H  117 ? LYS H 116  . ? 1_555 ? 
262 CC4 30 ASP H  119 ? ASP H 118  . ? 1_555 ? 
263 CC4 30 LEU H  120 ? LEU H 119  . ? 1_555 ? 
264 CC4 30 SER H  159 ? SER H 158  . ? 1_555 ? 
265 CC4 30 ALA H  160 ? ALA H 159  . ? 1_555 ? 
266 CC4 30 LEU H  161 ? LEU H 160  . ? 1_555 ? 
267 CC4 30 MG  MA .   ? MG  H 202  . ? 1_555 ? 
268 CC4 30 HOH YA .   ? HOH H 207  . ? 1_555 ? 
269 CC4 30 HOH YA .   ? HOH H 215  . ? 1_555 ? 
270 CC4 30 HOH YA .   ? HOH H 217  . ? 1_555 ? 
271 CC4 30 HOH YA .   ? HOH H 219  . ? 1_555 ? 
272 CC4 30 HOH YA .   ? HOH H 225  . ? 1_555 ? 
273 CC4 30 HOH YA .   ? HOH H 239  . ? 1_555 ? 
274 CC4 30 HOH YA .   ? HOH H 247  . ? 1_555 ? 
275 CC4 30 HOH YA .   ? HOH H 263  . ? 1_555 ? 
276 CC4 30 HOH YA .   ? HOH H 306  . ? 1_555 ? 
277 CC4 30 GLN M  18  ? GLN M 27   . ? 1_555 ? 
278 CC4 30 HOH DB .   ? HOH M 595  . ? 1_555 ? 
279 CC5 6  PRO B  30  ? PRO F 29   . ? 1_555 ? 
280 CC5 6  GLU B  32  ? GLU F 31   . ? 1_555 ? 
281 CC5 6  TYR B  33  ? TYR F 32   . ? 1_555 ? 
282 CC5 6  ILE B  34  ? ILE F 33   . ? 1_555 ? 
283 CC5 6  GCP V  .   ? GCP F 200  . ? 1_555 ? 
284 CC5 6  HOH SA .   ? HOH F 1373 . ? 1_555 ? 
285 CC6 6  THR D  18  ? THR C 17   . ? 1_555 ? 
286 CC6 6  GLU D  32  ? GLU C 31   . ? 1_555 ? 
287 CC6 6  TYR D  33  ? TYR C 32   . ? 1_555 ? 
288 CC6 6  ILE D  34  ? ILE C 33   . ? 1_555 ? 
289 CC6 6  GCP CA .   ? GCP C 200  . ? 1_555 ? 
290 CC6 6  HOH UA .   ? HOH C 1407 . ? 1_555 ? 
291 CC7 6  THR F  18  ? THR D 17   . ? 1_555 ? 
292 CC7 6  GLU F  32  ? GLU D 31   . ? 1_555 ? 
293 CC7 6  TYR F  33  ? TYR D 32   . ? 1_555 ? 
294 CC7 6  ILE F  34  ? ILE D 33   . ? 1_555 ? 
295 CC7 6  GCP HA .   ? GCP D 200  . ? 1_555 ? 
296 CC7 6  HOH WA .   ? HOH D 1364 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OV2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OV2 
_atom_sites.fract_transf_matrix[1][1]   0.019668 
_atom_sites.fract_transf_matrix[1][2]   -0.006911 
_atom_sites.fract_transf_matrix[1][3]   -0.000683 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014351 
_atom_sites.fract_transf_matrix[2][3]   -0.000181 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007478 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A  1 2   ? -17.789 -0.653  21.509  1.00 48.22 ? 1    MET A N     1 
ATOM   2     C  CA    . MET A  1 2   ? -18.571 -1.922  21.361  1.00 48.16 ? 1    MET A CA    1 
ATOM   3     C  C     . MET A  1 2   ? -18.183 -2.900  22.468  1.00 47.26 ? 1    MET A C     1 
ATOM   4     O  O     . MET A  1 2   ? -16.994 -3.128  22.712  1.00 47.20 ? 1    MET A O     1 
ATOM   5     C  CB    . MET A  1 2   ? -18.286 -2.570  19.994  1.00 48.29 ? 1    MET A CB    1 
ATOM   6     C  CG    . MET A  1 2   ? -19.216 -3.742  19.637  1.00 48.88 ? 1    MET A CG    1 
ATOM   7     S  SD    . MET A  1 2   ? -18.914 -4.576  18.046  1.00 50.71 ? 1    MET A SD    1 
ATOM   8     C  CE    . MET A  1 2   ? -19.174 -3.164  16.952  1.00 47.48 ? 1    MET A CE    1 
ATOM   9     N  N     . GLN A  1 3   ? -19.171 -3.497  23.128  1.00 45.93 ? 2    GLN A N     1 
ATOM   10    C  CA    . GLN A  1 3   ? -18.889 -4.613  24.034  1.00 45.30 ? 2    GLN A CA    1 
ATOM   11    C  C     . GLN A  1 3   ? -18.086 -5.691  23.312  1.00 43.86 ? 2    GLN A C     1 
ATOM   12    O  O     . GLN A  1 3   ? -18.293 -5.939  22.120  1.00 43.76 ? 2    GLN A O     1 
ATOM   13    C  CB    . GLN A  1 3   ? -20.179 -5.234  24.567  1.00 45.17 ? 2    GLN A CB    1 
ATOM   14    C  CG    . GLN A  1 3   ? -20.648 -4.677  25.906  1.00 47.29 ? 2    GLN A CG    1 
ATOM   15    C  CD    . GLN A  1 3   ? -22.160 -4.853  26.124  1.00 47.57 ? 2    GLN A CD    1 
ATOM   16    O  OE1   . GLN A  1 3   ? -22.973 -4.621  25.200  1.00 51.26 ? 2    GLN A OE1   1 
ATOM   17    N  NE2   . GLN A  1 3   ? -22.545 -5.251  27.347  1.00 47.73 ? 2    GLN A NE2   1 
ATOM   18    N  N     . ALA A  1 4   ? -17.177 -6.334  24.038  1.00 42.52 ? 3    ALA A N     1 
ATOM   19    C  CA    . ALA A  1 4   ? -16.444 -7.472  23.505  1.00 41.68 ? 3    ALA A CA    1 
ATOM   20    C  C     . ALA A  1 4   ? -16.368 -8.625  24.537  1.00 40.80 ? 3    ALA A C     1 
ATOM   21    O  O     . ALA A  1 4   ? -16.285 -8.382  25.739  1.00 40.58 ? 3    ALA A O     1 
ATOM   22    C  CB    . ALA A  1 4   ? -15.071 -7.037  23.057  1.00 41.22 ? 3    ALA A CB    1 
ATOM   23    N  N     . ILE A  1 5   ? -16.417 -9.858  24.038  1.00 39.81 ? 4    ILE A N     1 
ATOM   24    C  CA    . ILE A  1 5   ? -16.386 -11.080 24.840  1.00 39.42 ? 4    ILE A CA    1 
ATOM   25    C  C     . ILE A  1 5   ? -15.233 -11.932 24.372  1.00 39.26 ? 4    ILE A C     1 
ATOM   26    O  O     . ILE A  1 5   ? -15.132 -12.200 23.176  1.00 40.58 ? 4    ILE A O     1 
ATOM   27    C  CB    . ILE A  1 5   ? -17.672 -11.943 24.642  1.00 39.53 ? 4    ILE A CB    1 
ATOM   28    C  CG1   . ILE A  1 5   ? -18.915 -11.195 25.112  1.00 39.17 ? 4    ILE A CG1   1 
ATOM   29    C  CG2   . ILE A  1 5   ? -17.592 -13.266 25.394  1.00 38.50 ? 4    ILE A CG2   1 
ATOM   30    C  CD1   . ILE A  1 5   ? -20.169 -12.035 25.009  1.00 39.19 ? 4    ILE A CD1   1 
ATOM   31    N  N     . LYS A  1 6   ? -14.374 -12.360 25.299  1.00 38.08 ? 5    LYS A N     1 
ATOM   32    C  CA    . LYS A  1 6   ? -13.349 -13.360 25.012  1.00 37.62 ? 5    LYS A CA    1 
ATOM   33    C  C     . LYS A  1 6   ? -13.844 -14.728 25.482  1.00 37.19 ? 5    LYS A C     1 
ATOM   34    O  O     . LYS A  1 6   ? -14.017 -14.972 26.671  1.00 36.46 ? 5    LYS A O     1 
ATOM   35    C  CB    . LYS A  1 6   ? -12.005 -12.991 25.667  1.00 37.63 ? 5    LYS A CB    1 
ATOM   36    C  CG    . LYS A  1 6   ? -10.929 -14.068 25.581  1.00 37.25 ? 5    LYS A CG    1 
ATOM   37    C  CD    . LYS A  1 6   ? -9.541  -13.493 25.816  1.00 37.82 ? 5    LYS A CD    1 
ATOM   38    C  CE    . LYS A  1 6   ? -8.496  -14.602 26.028  1.00 37.05 ? 5    LYS A CE    1 
ATOM   39    N  NZ    . LYS A  1 6   ? -7.138  -14.088 26.369  1.00 36.83 ? 5    LYS A NZ    1 
ATOM   40    N  N     . CYS A  1 7   ? -14.087 -15.608 24.519  1.00 36.79 ? 6    CYS A N     1 
ATOM   41    C  CA    . CYS A  1 7   ? -14.558 -16.941 24.789  1.00 36.86 ? 6    CYS A CA    1 
ATOM   42    C  C     . CYS A  1 7   ? -13.457 -17.884 24.347  1.00 36.59 ? 6    CYS A C     1 
ATOM   43    O  O     . CYS A  1 7   ? -13.040 -17.819 23.216  1.00 36.98 ? 6    CYS A O     1 
ATOM   44    C  CB    . CYS A  1 7   ? -15.844 -17.191 23.998  1.00 37.30 ? 6    CYS A CB    1 
ATOM   45    S  SG    . CYS A  1 7   ? -16.390 -18.903 23.972  1.00 36.69 ? 6    CYS A SG    1 
ATOM   46    N  N     . VAL A  1 8   ? -12.961 -18.723 25.256  1.00 36.80 ? 7    VAL A N     1 
ATOM   47    C  CA    . VAL A  1 8   ? -11.871 -19.649 24.966  1.00 36.06 ? 7    VAL A CA    1 
ATOM   48    C  C     . VAL A  1 8   ? -12.415 -21.085 24.942  1.00 36.32 ? 7    VAL A C     1 
ATOM   49    O  O     . VAL A  1 8   ? -13.175 -21.472 25.815  1.00 36.66 ? 7    VAL A O     1 
ATOM   50    C  CB    . VAL A  1 8   ? -10.722 -19.495 25.999  1.00 35.99 ? 7    VAL A CB    1 
ATOM   51    C  CG1   . VAL A  1 8   ? -9.655  -20.591 25.846  1.00 34.00 ? 7    VAL A CG1   1 
ATOM   52    C  CG2   . VAL A  1 8   ? -10.090 -18.126 25.873  1.00 35.46 ? 7    VAL A CG2   1 
ATOM   53    N  N     . VAL A  1 9   ? -12.044 -21.850 23.919  1.00 36.30 ? 8    VAL A N     1 
ATOM   54    C  CA    . VAL A  1 9   ? -12.554 -23.215 23.727  1.00 36.57 ? 8    VAL A CA    1 
ATOM   55    C  C     . VAL A  1 9   ? -11.464 -24.296 23.912  1.00 36.27 ? 8    VAL A C     1 
ATOM   56    O  O     . VAL A  1 9   ? -10.429 -24.252 23.241  1.00 36.61 ? 8    VAL A O     1 
ATOM   57    C  CB    . VAL A  1 9   ? -13.174 -23.391 22.332  1.00 36.57 ? 8    VAL A CB    1 
ATOM   58    C  CG1   . VAL A  1 9   ? -13.812 -24.769 22.226  1.00 35.94 ? 8    VAL A CG1   1 
ATOM   59    C  CG2   . VAL A  1 9   ? -14.221 -22.309 22.061  1.00 36.43 ? 8    VAL A CG2   1 
ATOM   60    N  N     . VAL A  1 10  ? -11.716 -25.259 24.803  1.00 35.94 ? 9    VAL A N     1 
ATOM   61    C  CA    . VAL A  1 10  ? -10.728 -26.314 25.157  1.00 35.71 ? 9    VAL A CA    1 
ATOM   62    C  C     . VAL A  1 10  ? -11.366 -27.705 25.271  1.00 35.73 ? 9    VAL A C     1 
ATOM   63    O  O     . VAL A  1 10  ? -12.578 -27.843 25.357  1.00 35.31 ? 9    VAL A O     1 
ATOM   64    C  CB    . VAL A  1 10  ? -9.973  -25.993 26.469  1.00 35.86 ? 9    VAL A CB    1 
ATOM   65    C  CG1   . VAL A  1 10  ? -9.333  -24.597 26.391  1.00 35.39 ? 9    VAL A CG1   1 
ATOM   66    C  CG2   . VAL A  1 10  ? -10.911 -26.113 27.706  1.00 33.89 ? 9    VAL A CG2   1 
ATOM   67    N  N     . GLY A  1 11  ? -10.518 -28.729 25.236  1.00 36.06 ? 10   GLY A N     1 
ATOM   68    C  CA    . GLY A  1 11  ? -10.948 -30.128 25.239  1.00 36.13 ? 10   GLY A CA    1 
ATOM   69    C  C     . GLY A  1 11  ? -10.018 -31.037 24.456  1.00 36.37 ? 10   GLY A C     1 
ATOM   70    O  O     . GLY A  1 11  ? -9.151  -30.570 23.721  1.00 36.29 ? 10   GLY A O     1 
ATOM   71    N  N     . ASP A  1 12  ? -10.222 -32.341 24.607  1.00 36.73 ? 11   ASP A N     1 
ATOM   72    C  CA    . ASP A  1 12  ? -9.385  -33.346 23.980  1.00 37.42 ? 11   ASP A CA    1 
ATOM   73    C  C     . ASP A  1 12  ? -9.275  -33.184 22.466  1.00 37.82 ? 11   ASP A C     1 
ATOM   74    O  O     . ASP A  1 12  ? -10.144 -32.589 21.819  1.00 37.56 ? 11   ASP A O     1 
ATOM   75    C  CB    . ASP A  1 12  ? -9.959  -34.741 24.268  1.00 37.46 ? 11   ASP A CB    1 
ATOM   76    C  CG    . ASP A  1 12  ? -9.417  -35.348 25.554  1.00 37.93 ? 11   ASP A CG    1 
ATOM   77    O  OD1   . ASP A  1 12  ? -8.877  -34.590 26.397  1.00 35.71 ? 11   ASP A OD1   1 
ATOM   78    O  OD2   . ASP A  1 12  ? -9.524  -36.594 25.707  1.00 36.62 ? 11   ASP A OD2   1 
ATOM   79    N  N     . GLY A  1 13  ? -8.207  -33.747 21.919  1.00 37.91 ? 12   GLY A N     1 
ATOM   80    C  CA    . GLY A  1 13  ? -8.109  -33.991 20.492  1.00 38.11 ? 12   GLY A CA    1 
ATOM   81    C  C     . GLY A  1 13  ? -9.342  -34.714 19.975  1.00 38.14 ? 12   GLY A C     1 
ATOM   82    O  O     . GLY A  1 13  ? -10.008 -35.470 20.722  1.00 38.54 ? 12   GLY A O     1 
ATOM   83    N  N     . ALA A  1 14  ? -9.659  -34.445 18.707  1.00 37.46 ? 13   ALA A N     1 
ATOM   84    C  CA    . ALA A  1 14  ? -10.728 -35.103 17.988  1.00 37.33 ? 13   ALA A CA    1 
ATOM   85    C  C     . ALA A  1 14  ? -12.130 -34.871 18.558  1.00 37.38 ? 13   ALA A C     1 
ATOM   86    O  O     . ALA A  1 14  ? -13.063 -35.561 18.138  1.00 38.56 ? 13   ALA A O     1 
ATOM   87    C  CB    . ALA A  1 14  ? -10.446 -36.601 17.895  1.00 36.98 ? 13   ALA A CB    1 
ATOM   88    N  N     . VAL A  1 15  ? -12.325 -33.915 19.468  1.00 36.83 ? 14   VAL A N     1 
ATOM   89    C  CA    . VAL A  1 15  ? -13.676 -33.746 20.035  1.00 35.81 ? 14   VAL A CA    1 
ATOM   90    C  C     . VAL A  1 15  ? -14.637 -32.898 19.199  1.00 36.09 ? 14   VAL A C     1 
ATOM   91    O  O     . VAL A  1 15  ? -15.874 -32.999 19.372  1.00 36.48 ? 14   VAL A O     1 
ATOM   92    C  CB    . VAL A  1 15  ? -13.695 -33.206 21.516  1.00 36.44 ? 14   VAL A CB    1 
ATOM   93    C  CG1   . VAL A  1 15  ? -12.961 -34.164 22.465  1.00 33.34 ? 14   VAL A CG1   1 
ATOM   94    C  CG2   . VAL A  1 15  ? -13.231 -31.772 21.621  1.00 35.87 ? 14   VAL A CG2   1 
ATOM   95    N  N     . GLY A  1 16  ? -14.117 -32.033 18.338  1.00 35.87 ? 15   GLY A N     1 
ATOM   96    C  CA    . GLY A  1 16  ? -14.971 -31.182 17.497  1.00 35.98 ? 15   GLY A CA    1 
ATOM   97    C  C     . GLY A  1 16  ? -15.006 -29.666 17.764  1.00 35.84 ? 15   GLY A C     1 
ATOM   98    O  O     . GLY A  1 16  ? -15.903 -28.989 17.282  1.00 36.91 ? 15   GLY A O     1 
ATOM   99    N  N     . LYS A  1 17  ? -13.997 -29.134 18.453  1.00 36.31 ? 16   LYS A N     1 
ATOM   100   C  CA    . LYS A  1 17  ? -13.893 -27.721 18.815  1.00 36.09 ? 16   LYS A CA    1 
ATOM   101   C  C     . LYS A  1 17  ? -13.825 -26.812 17.606  1.00 36.55 ? 16   LYS A C     1 
ATOM   102   O  O     . LYS A  1 17  ? -14.533 -25.799 17.549  1.00 35.86 ? 16   LYS A O     1 
ATOM   103   C  CB    . LYS A  1 17  ? -12.628 -27.474 19.649  1.00 36.26 ? 16   LYS A CB    1 
ATOM   104   C  CG    . LYS A  1 17  ? -12.635 -28.181 20.987  1.00 35.80 ? 16   LYS A CG    1 
ATOM   105   C  CD    . LYS A  1 17  ? -11.409 -27.835 21.861  1.00 35.56 ? 16   LYS A CD    1 
ATOM   106   C  CE    . LYS A  1 17  ? -10.094 -28.297 21.279  1.00 34.15 ? 16   LYS A CE    1 
ATOM   107   N  NZ    . LYS A  1 17  ? -10.085 -29.751 21.001  1.00 34.90 ? 16   LYS A NZ    1 
ATOM   108   N  N     . THR A  1 18  ? -12.973 -27.160 16.629  1.00 36.15 ? 17   THR A N     1 
ATOM   109   C  CA    . THR A  1 18  ? -12.881 -26.323 15.449  1.00 36.06 ? 17   THR A CA    1 
ATOM   110   C  C     . THR A  1 18  ? -14.144 -26.394 14.601  1.00 35.50 ? 17   THR A C     1 
ATOM   111   O  O     . THR A  1 18  ? -14.637 -25.356 14.161  1.00 35.12 ? 17   THR A O     1 
ATOM   112   C  CB    . THR A  1 18  ? -11.638 -26.585 14.627  1.00 35.78 ? 17   THR A CB    1 
ATOM   113   O  OG1   . THR A  1 18  ? -10.484 -26.322 15.442  1.00 38.19 ? 17   THR A OG1   1 
ATOM   114   C  CG2   . THR A  1 18  ? -11.593 -25.670 13.432  1.00 35.71 ? 17   THR A CG2   1 
ATOM   115   N  N     . CYS A  1 19  ? -14.665 -27.588 14.356  1.00 35.48 ? 18   CYS A N     1 
ATOM   116   C  CA    . CYS A  1 19  ? -15.916 -27.690 13.596  1.00 36.61 ? 18   CYS A CA    1 
ATOM   117   C  C     . CYS A  1 19  ? -17.041 -26.899 14.249  1.00 37.13 ? 18   CYS A C     1 
ATOM   118   O  O     . CYS A  1 19  ? -17.821 -26.237 13.558  1.00 37.86 ? 18   CYS A O     1 
ATOM   119   C  CB    . CYS A  1 19  ? -16.336 -29.136 13.375  1.00 36.48 ? 18   CYS A CB    1 
ATOM   120   S  SG    . CYS A  1 19  ? -15.250 -30.001 12.244  1.00 37.30 ? 18   CYS A SG    1 
ATOM   121   N  N     . LEU A  1 20  ? -17.110 -26.947 15.575  1.00 38.07 ? 19   LEU A N     1 
ATOM   122   C  CA    . LEU A  1 20  ? -18.131 -26.204 16.335  1.00 38.48 ? 19   LEU A CA    1 
ATOM   123   C  C     . LEU A  1 20  ? -17.986 -24.677 16.068  1.00 38.08 ? 19   LEU A C     1 
ATOM   124   O  O     . LEU A  1 20  ? -18.957 -24.006 15.736  1.00 37.08 ? 19   LEU A O     1 
ATOM   125   C  CB    . LEU A  1 20  ? -18.035 -26.536 17.846  1.00 39.00 ? 19   LEU A CB    1 
ATOM   126   C  CG    . LEU A  1 20  ? -18.779 -25.666 18.864  1.00 40.44 ? 19   LEU A CG    1 
ATOM   127   C  CD1   . LEU A  1 20  ? -20.134 -26.311 19.193  1.00 46.67 ? 19   LEU A CD1   1 
ATOM   128   C  CD2   . LEU A  1 20  ? -17.978 -25.445 20.109  1.00 43.60 ? 19   LEU A CD2   1 
ATOM   129   N  N     . LEU A  1 21  ? -16.767 -24.151 16.171  1.00 37.23 ? 20   LEU A N     1 
ATOM   130   C  CA    . LEU A  1 21  ? -16.560 -22.721 15.987  1.00 37.16 ? 20   LEU A CA    1 
ATOM   131   C  C     . LEU A  1 21  ? -16.775 -22.267 14.542  1.00 36.59 ? 20   LEU A C     1 
ATOM   132   O  O     . LEU A  1 21  ? -17.369 -21.236 14.292  1.00 36.01 ? 20   LEU A O     1 
ATOM   133   C  CB    . LEU A  1 21  ? -15.175 -22.320 16.461  1.00 37.03 ? 20   LEU A CB    1 
ATOM   134   C  CG    . LEU A  1 21  ? -14.955 -22.362 17.974  1.00 38.46 ? 20   LEU A CG    1 
ATOM   135   C  CD1   . LEU A  1 21  ? -13.452 -22.327 18.301  1.00 39.93 ? 20   LEU A CD1   1 
ATOM   136   C  CD2   . LEU A  1 21  ? -15.712 -21.216 18.693  1.00 38.46 ? 20   LEU A CD2   1 
ATOM   137   N  N     . ILE A  1 22  ? -16.288 -23.063 13.602  1.00 37.03 ? 21   ILE A N     1 
ATOM   138   C  CA    . ILE A  1 22  ? -16.382 -22.749 12.185  1.00 36.66 ? 21   ILE A CA    1 
ATOM   139   C  C     . ILE A  1 22  ? -17.817 -22.954 11.691  1.00 36.51 ? 21   ILE A C     1 
ATOM   140   O  O     . ILE A  1 22  ? -18.311 -22.184 10.860  1.00 37.46 ? 21   ILE A O     1 
ATOM   141   C  CB    . ILE A  1 22  ? -15.374 -23.589 11.361  1.00 36.56 ? 21   ILE A CB    1 
ATOM   142   C  CG1   . ILE A  1 22  ? -13.929 -23.295 11.792  1.00 37.04 ? 21   ILE A CG1   1 
ATOM   143   C  CG2   . ILE A  1 22  ? -15.545 -23.344 9.831   1.00 36.15 ? 21   ILE A CG2   1 
ATOM   144   C  CD1   . ILE A  1 22  ? -13.531 -21.813 11.722  1.00 36.85 ? 21   ILE A CD1   1 
ATOM   145   N  N     . SER A  1 23  ? -18.513 -23.961 12.204  1.00 36.43 ? 22   SER A N     1 
ATOM   146   C  CA    . SER A  1 23  ? -19.904 -24.178 11.777  1.00 36.08 ? 22   SER A CA    1 
ATOM   147   C  C     . SER A  1 23  ? -20.811 -23.048 12.277  1.00 36.48 ? 22   SER A C     1 
ATOM   148   O  O     . SER A  1 23  ? -21.676 -22.596 11.546  1.00 36.47 ? 22   SER A O     1 
ATOM   149   C  CB    . SER A  1 23  ? -20.432 -25.542 12.216  1.00 36.12 ? 22   SER A CB    1 
ATOM   150   O  OG    . SER A  1 23  ? -21.784 -25.751 11.815  1.00 33.55 ? 22   SER A OG    1 
ATOM   151   N  N     . TYR A  1 24  ? -20.596 -22.584 13.510  1.00 36.69 ? 23   TYR A N     1 
ATOM   152   C  CA    . TYR A  1 24  ? -21.361 -21.451 14.043  1.00 36.91 ? 23   TYR A CA    1 
ATOM   153   C  C     . TYR A  1 24  ? -21.072 -20.144 13.312  1.00 37.11 ? 23   TYR A C     1 
ATOM   154   O  O     . TYR A  1 24  ? -21.983 -19.405 12.988  1.00 37.62 ? 23   TYR A O     1 
ATOM   155   C  CB    . TYR A  1 24  ? -21.119 -21.298 15.560  1.00 36.65 ? 23   TYR A CB    1 
ATOM   156   C  CG    . TYR A  1 24  ? -21.670 -20.017 16.182  1.00 36.20 ? 23   TYR A CG    1 
ATOM   157   C  CD1   . TYR A  1 24  ? -23.041 -19.837 16.400  1.00 36.60 ? 23   TYR A CD1   1 
ATOM   158   C  CD2   . TYR A  1 24  ? -20.809 -19.003 16.587  1.00 35.71 ? 23   TYR A CD2   1 
ATOM   159   C  CE1   . TYR A  1 24  ? -23.518 -18.650 16.959  1.00 36.34 ? 23   TYR A CE1   1 
ATOM   160   C  CE2   . TYR A  1 24  ? -21.271 -17.847 17.149  1.00 35.75 ? 23   TYR A CE2   1 
ATOM   161   C  CZ    . TYR A  1 24  ? -22.615 -17.669 17.333  1.00 35.61 ? 23   TYR A CZ    1 
ATOM   162   O  OH    . TYR A  1 24  ? -23.024 -16.512 17.914  1.00 35.92 ? 23   TYR A OH    1 
ATOM   163   N  N     . THR A  1 25  ? -19.804 -19.839 13.068  1.00 37.80 ? 24   THR A N     1 
ATOM   164   C  CA    . THR A  1 25  ? -19.447 -18.529 12.530  1.00 37.68 ? 24   THR A CA    1 
ATOM   165   C  C     . THR A  1 25  ? -19.632 -18.434 11.027  1.00 38.05 ? 24   THR A C     1 
ATOM   166   O  O     . THR A  1 25  ? -19.975 -17.364 10.524  1.00 38.48 ? 24   THR A O     1 
ATOM   167   C  CB    . THR A  1 25  ? -18.010 -18.129 12.847  1.00 37.51 ? 24   THR A CB    1 
ATOM   168   O  OG1   . THR A  1 25  ? -17.130 -19.205 12.511  1.00 37.78 ? 24   THR A OG1   1 
ATOM   169   C  CG2   . THR A  1 25  ? -17.859 -17.758 14.323  1.00 38.17 ? 24   THR A CG2   1 
ATOM   170   N  N     . THR A  1 26  ? -19.397 -19.526 10.308  1.00 38.11 ? 25   THR A N     1 
ATOM   171   C  CA    . THR A  1 26  ? -19.418 -19.476 8.845   1.00 38.25 ? 25   THR A CA    1 
ATOM   172   C  C     . THR A  1 26  ? -20.482 -20.345 8.216   1.00 38.69 ? 25   THR A C     1 
ATOM   173   O  O     . THR A  1 26  ? -20.601 -20.335 7.001   1.00 38.66 ? 25   THR A O     1 
ATOM   174   C  CB    . THR A  1 26  ? -18.035 -19.844 8.235   1.00 38.35 ? 25   THR A CB    1 
ATOM   175   O  OG1   . THR A  1 26  ? -17.834 -21.268 8.295   1.00 36.14 ? 25   THR A OG1   1 
ATOM   176   C  CG2   . THR A  1 26  ? -16.917 -19.100 8.955   1.00 35.66 ? 25   THR A CG2   1 
ATOM   177   N  N     . ASN A  1 27  ? -21.241 -21.082 9.034   1.00 39.15 ? 26   ASN A N     1 
ATOM   178   C  CA    . ASN A  1 27  ? -22.225 -22.068 8.561   1.00 39.64 ? 26   ASN A CA    1 
ATOM   179   C  C     . ASN A  1 27  ? -21.687 -23.095 7.576   1.00 39.17 ? 26   ASN A C     1 
ATOM   180   O  O     . ASN A  1 27  ? -22.398 -23.527 6.676   1.00 38.95 ? 26   ASN A O     1 
ATOM   181   C  CB    . ASN A  1 27  ? -23.461 -21.394 7.940   1.00 40.39 ? 26   ASN A CB    1 
ATOM   182   C  CG    . ASN A  1 27  ? -24.399 -20.794 8.973   1.00 42.98 ? 26   ASN A CG    1 
ATOM   183   O  OD1   . ASN A  1 27  ? -24.524 -21.291 10.111  1.00 44.52 ? 26   ASN A OD1   1 
ATOM   184   N  ND2   . ASN A  1 27  ? -25.103 -19.718 8.567   1.00 44.66 ? 26   ASN A ND2   1 
ATOM   185   N  N     . ALA A  1 28  ? -20.439 -23.487 7.738   1.00 38.83 ? 27   ALA A N     1 
ATOM   186   C  CA    . ALA A  1 28  ? -19.902 -24.583 6.956   1.00 38.54 ? 27   ALA A CA    1 
ATOM   187   C  C     . ALA A  1 28  ? -19.295 -25.582 7.928   1.00 38.31 ? 27   ALA A C     1 
ATOM   188   O  O     . ALA A  1 28  ? -18.733 -25.190 8.942   1.00 38.48 ? 27   ALA A O     1 
ATOM   189   C  CB    . ALA A  1 28  ? -18.871 -24.076 5.972   1.00 38.15 ? 27   ALA A CB    1 
ATOM   190   N  N     . PHE A  1 29  ? -19.460 -26.868 7.642   1.00 38.24 ? 28   PHE A N     1 
ATOM   191   C  CA    . PHE A  1 29  ? -18.749 -27.935 8.360   1.00 38.27 ? 28   PHE A CA    1 
ATOM   192   C  C     . PHE A  1 29  ? -17.447 -28.221 7.597   1.00 38.42 ? 28   PHE A C     1 
ATOM   193   O  O     . PHE A  1 29  ? -17.484 -28.629 6.429   1.00 37.82 ? 28   PHE A O     1 
ATOM   194   C  CB    . PHE A  1 29  ? -19.604 -29.192 8.420   1.00 38.23 ? 28   PHE A CB    1 
ATOM   195   C  CG    . PHE A  1 29  ? -19.029 -30.280 9.260   1.00 37.60 ? 28   PHE A CG    1 
ATOM   196   C  CD1   . PHE A  1 29  ? -19.110 -30.220 10.648  1.00 37.83 ? 28   PHE A CD1   1 
ATOM   197   C  CD2   . PHE A  1 29  ? -18.427 -31.385 8.672   1.00 39.27 ? 28   PHE A CD2   1 
ATOM   198   C  CE1   . PHE A  1 29  ? -18.581 -31.253 11.442  1.00 37.54 ? 28   PHE A CE1   1 
ATOM   199   C  CE2   . PHE A  1 29  ? -17.875 -32.435 9.461   1.00 38.86 ? 28   PHE A CE2   1 
ATOM   200   C  CZ    . PHE A  1 29  ? -17.959 -32.359 10.848  1.00 38.76 ? 28   PHE A CZ    1 
ATOM   201   N  N     . PRO A  1 30  ? -16.284 -27.982 8.231   1.00 39.04 ? 29   PRO A N     1 
ATOM   202   C  CA    . PRO A  1 30  ? -15.037 -28.283 7.537   1.00 39.38 ? 29   PRO A CA    1 
ATOM   203   C  C     . PRO A  1 30  ? -15.032 -29.696 6.978   1.00 39.87 ? 29   PRO A C     1 
ATOM   204   O  O     . PRO A  1 30  ? -15.436 -30.621 7.664   1.00 39.94 ? 29   PRO A O     1 
ATOM   205   C  CB    . PRO A  1 30  ? -13.993 -28.142 8.638   1.00 39.74 ? 29   PRO A CB    1 
ATOM   206   C  CG    . PRO A  1 30  ? -14.576 -27.117 9.545   1.00 39.51 ? 29   PRO A CG    1 
ATOM   207   C  CD    . PRO A  1 30  ? -16.043 -27.401 9.557   1.00 39.03 ? 29   PRO A CD    1 
ATOM   208   N  N     . GLY A  1 31  ? -14.583 -29.849 5.739   1.00 40.39 ? 30   GLY A N     1 
ATOM   209   C  CA    . GLY A  1 31  ? -14.514 -31.159 5.091   1.00 40.92 ? 30   GLY A CA    1 
ATOM   210   C  C     . GLY A  1 31  ? -13.336 -32.014 5.514   1.00 41.18 ? 30   GLY A C     1 
ATOM   211   O  O     . GLY A  1 31  ? -13.419 -33.224 5.461   1.00 41.53 ? 30   GLY A O     1 
ATOM   212   N  N     . GLU A  1 32  ? -12.235 -31.389 5.920   1.00 41.11 ? 31   GLU A N     1 
ATOM   213   C  CA    . GLU A  1 32  ? -11.042 -32.122 6.354   1.00 40.97 ? 31   GLU A CA    1 
ATOM   214   C  C     . GLU A  1 32  ? -10.870 -32.003 7.861   1.00 39.22 ? 31   GLU A C     1 
ATOM   215   O  O     . GLU A  1 32  ? -11.244 -30.986 8.461   1.00 38.50 ? 31   GLU A O     1 
ATOM   216   C  CB    . GLU A  1 32  ? -9.783  -31.598 5.640   1.00 41.05 ? 31   GLU A CB    1 
ATOM   217   C  CG    . GLU A  1 32  ? -9.519  -32.285 4.322   1.00 43.16 ? 31   GLU A CG    1 
ATOM   218   C  CD    . GLU A  1 32  ? -8.150  -31.965 3.729   1.00 43.86 ? 31   GLU A CD    1 
ATOM   219   O  OE1   . GLU A  1 32  ? -7.862  -30.772 3.462   1.00 48.86 ? 31   GLU A OE1   1 
ATOM   220   O  OE2   . GLU A  1 32  ? -7.365  -32.913 3.509   1.00 47.90 ? 31   GLU A OE2   1 
ATOM   221   N  N     . TYR A  1 33  ? -10.334 -33.066 8.452   1.00 38.05 ? 32   TYR A N     1 
ATOM   222   C  CA    . TYR A  1 33  ? -9.912  -33.075 9.857   1.00 37.37 ? 32   TYR A CA    1 
ATOM   223   C  C     . TYR A  1 33  ? -8.435  -32.651 9.920   1.00 36.97 ? 32   TYR A C     1 
ATOM   224   O  O     . TYR A  1 33  ? -7.531  -33.424 9.567   1.00 36.78 ? 32   TYR A O     1 
ATOM   225   C  CB    . TYR A  1 33  ? -10.165 -34.458 10.475  1.00 37.11 ? 32   TYR A CB    1 
ATOM   226   C  CG    . TYR A  1 33  ? -9.540  -34.731 11.848  1.00 36.43 ? 32   TYR A CG    1 
ATOM   227   C  CD1   . TYR A  1 33  ? -9.269  -33.702 12.759  1.00 35.78 ? 32   TYR A CD1   1 
ATOM   228   C  CD2   . TYR A  1 33  ? -9.257  -36.029 12.235  1.00 35.07 ? 32   TYR A CD2   1 
ATOM   229   C  CE1   . TYR A  1 33  ? -8.705  -33.971 14.005  1.00 36.29 ? 32   TYR A CE1   1 
ATOM   230   C  CE2   . TYR A  1 33  ? -8.695  -36.307 13.464  1.00 37.15 ? 32   TYR A CE2   1 
ATOM   231   C  CZ    . TYR A  1 33  ? -8.417  -35.280 14.355  1.00 36.94 ? 32   TYR A CZ    1 
ATOM   232   O  OH    . TYR A  1 33  ? -7.862  -35.597 15.592  1.00 36.91 ? 32   TYR A OH    1 
ATOM   233   N  N     . ILE A  1 34  ? -8.219  -31.408 10.348  1.00 36.70 ? 33   ILE A N     1 
ATOM   234   C  CA    . ILE A  1 34  ? -6.891  -30.826 10.512  1.00 36.69 ? 33   ILE A CA    1 
ATOM   235   C  C     . ILE A  1 34  ? -6.695  -30.322 11.944  1.00 36.18 ? 33   ILE A C     1 
ATOM   236   O  O     . ILE A  1 34  ? -7.245  -29.282 12.315  1.00 36.03 ? 33   ILE A O     1 
ATOM   237   C  CB    . ILE A  1 34  ? -6.673  -29.624 9.552   1.00 37.11 ? 33   ILE A CB    1 
ATOM   238   C  CG1   . ILE A  1 34  ? -7.040  -30.014 8.105   1.00 37.46 ? 33   ILE A CG1   1 
ATOM   239   C  CG2   . ILE A  1 34  ? -5.170  -29.106 9.671   1.00 37.45 ? 33   ILE A CG2   1 
ATOM   240   C  CD1   . ILE A  1 34  ? -6.772  -28.912 7.088   1.00 37.01 ? 33   ILE A CD1   1 
ATOM   241   N  N     . PRO A  1 35  ? -5.928  -31.058 12.766  1.00 35.49 ? 34   PRO A N     1 
ATOM   242   C  CA    . PRO A  1 35  ? -5.684  -30.525 14.115  1.00 35.58 ? 34   PRO A CA    1 
ATOM   243   C  C     . PRO A  1 35  ? -5.118  -29.091 14.180  1.00 35.17 ? 34   PRO A C     1 
ATOM   244   O  O     . PRO A  1 35  ? -4.292  -28.707 13.374  1.00 36.11 ? 34   PRO A O     1 
ATOM   245   C  CB    . PRO A  1 35  ? -4.699  -31.542 14.717  1.00 35.03 ? 34   PRO A CB    1 
ATOM   246   C  CG    . PRO A  1 35  ? -5.023  -32.820 13.997  1.00 34.62 ? 34   PRO A CG    1 
ATOM   247   C  CD    . PRO A  1 35  ? -5.319  -32.388 12.592  1.00 35.19 ? 34   PRO A CD    1 
ATOM   248   N  N     . THR A  1 36  ? -5.546  -28.364 15.199  1.00 35.11 ? 35   THR A N     1 
ATOM   249   C  CA    . THR A  1 36  ? -5.201  -26.962 15.486  1.00 34.76 ? 35   THR A CA    1 
ATOM   250   C  C     . THR A  1 36  ? -3.937  -26.838 16.336  1.00 34.34 ? 35   THR A C     1 
ATOM   251   O  O     . THR A  1 36  ? -3.744  -27.625 17.257  1.00 33.53 ? 35   THR A O     1 
ATOM   252   C  CB    . THR A  1 36  ? -6.346  -26.383 16.332  1.00 34.82 ? 35   THR A CB    1 
ATOM   253   O  OG1   . THR A  1 36  ? -7.567  -26.499 15.584  1.00 34.51 ? 35   THR A OG1   1 
ATOM   254   C  CG2   . THR A  1 36  ? -6.095  -24.938 16.782  1.00 34.64 ? 35   THR A CG2   1 
ATOM   255   N  N     . VAL A  1 37  ? -3.094  -25.854 16.011  1.00 34.43 ? 36   VAL A N     1 
ATOM   256   C  CA    . VAL A  1 37  ? -2.038  -25.375 16.912  1.00 34.31 ? 36   VAL A CA    1 
ATOM   257   C  C     . VAL A  1 37  ? -2.637  -24.225 17.757  1.00 35.10 ? 36   VAL A C     1 
ATOM   258   O  O     . VAL A  1 37  ? -2.744  -24.336 18.979  1.00 35.37 ? 36   VAL A O     1 
ATOM   259   C  CB    . VAL A  1 37  ? -0.754  -24.967 16.134  1.00 34.80 ? 36   VAL A CB    1 
ATOM   260   C  CG1   . VAL A  1 37  ? 0.405   -24.540 17.092  1.00 33.38 ? 36   VAL A CG1   1 
ATOM   261   C  CG2   . VAL A  1 37  ? -0.292  -26.130 15.250  1.00 32.44 ? 36   VAL A CG2   1 
ATOM   262   N  N     . PHE A  1 38  ? -3.061  -23.149 17.097  1.00 34.97 ? 37   PHE A N     1 
ATOM   263   C  CA    . PHE A  1 38  ? -3.898  -22.116 17.700  1.00 34.55 ? 37   PHE A CA    1 
ATOM   264   C  C     . PHE A  1 38  ? -4.489  -21.239 16.619  1.00 35.11 ? 37   PHE A C     1 
ATOM   265   O  O     . PHE A  1 38  ? -3.785  -20.877 15.688  1.00 34.83 ? 37   PHE A O     1 
ATOM   266   C  CB    . PHE A  1 38  ? -3.147  -21.213 18.677  1.00 34.39 ? 37   PHE A CB    1 
ATOM   267   C  CG    . PHE A  1 38  ? -3.964  -20.032 19.129  1.00 32.32 ? 37   PHE A CG    1 
ATOM   268   C  CD1   . PHE A  1 38  ? -4.958  -20.192 20.069  1.00 34.30 ? 37   PHE A CD1   1 
ATOM   269   C  CD2   . PHE A  1 38  ? -3.789  -18.787 18.556  1.00 33.45 ? 37   PHE A CD2   1 
ATOM   270   C  CE1   . PHE A  1 38  ? -5.749  -19.131 20.462  1.00 34.38 ? 37   PHE A CE1   1 
ATOM   271   C  CE2   . PHE A  1 38  ? -4.570  -17.704 18.940  1.00 33.79 ? 37   PHE A CE2   1 
ATOM   272   C  CZ    . PHE A  1 38  ? -5.546  -17.872 19.892  1.00 34.09 ? 37   PHE A CZ    1 
ATOM   273   N  N     . ASP A  1 39  ? -5.763  -20.875 16.783  1.00 35.58 ? 38   ASP A N     1 
ATOM   274   C  CA    . ASP A  1 39  ? -6.442  -19.902 15.919  1.00 36.74 ? 38   ASP A CA    1 
ATOM   275   C  C     . ASP A  1 39  ? -7.369  -18.965 16.686  1.00 36.82 ? 38   ASP A C     1 
ATOM   276   O  O     . ASP A  1 39  ? -8.002  -19.362 17.666  1.00 36.42 ? 38   ASP A O     1 
ATOM   277   C  CB    . ASP A  1 39  ? -7.310  -20.624 14.888  1.00 37.18 ? 38   ASP A CB    1 
ATOM   278   C  CG    . ASP A  1 39  ? -6.492  -21.338 13.855  1.00 37.67 ? 38   ASP A CG    1 
ATOM   279   O  OD1   . ASP A  1 39  ? -5.953  -20.650 12.962  1.00 37.12 ? 38   ASP A OD1   1 
ATOM   280   O  OD2   . ASP A  1 39  ? -6.377  -22.579 13.959  1.00 39.52 ? 38   ASP A OD2   1 
ATOM   281   N  N     . ASN A  1 40  ? -7.479  -17.735 16.198  1.00 37.22 ? 39   ASN A N     1 
ATOM   282   C  CA    . ASN A  1 40  ? -8.341  -16.726 16.796  1.00 37.62 ? 39   ASN A CA    1 
ATOM   283   C  C     . ASN A  1 40  ? -9.302  -16.213 15.726  1.00 38.03 ? 39   ASN A C     1 
ATOM   284   O  O     . ASN A  1 40  ? -8.872  -15.735 14.670  1.00 37.21 ? 39   ASN A O     1 
ATOM   285   C  CB    . ASN A  1 40  ? -7.518  -15.576 17.373  1.00 37.83 ? 39   ASN A CB    1 
ATOM   286   C  CG    . ASN A  1 40  ? -8.386  -14.458 17.970  1.00 39.86 ? 39   ASN A CG    1 
ATOM   287   O  OD1   . ASN A  1 40  ? -8.391  -13.347 17.473  1.00 43.81 ? 39   ASN A OD1   1 
ATOM   288   N  ND2   . ASN A  1 40  ? -9.137  -14.768 19.011  1.00 43.15 ? 39   ASN A ND2   1 
ATOM   289   N  N     . TYR A  1 41  ? -10.598 -16.351 15.999  1.00 38.07 ? 40   TYR A N     1 
ATOM   290   C  CA    . TYR A  1 41  ? -11.629 -15.830 15.121  1.00 38.41 ? 40   TYR A CA    1 
ATOM   291   C  C     . TYR A  1 41  ? -12.403 -14.734 15.825  1.00 38.57 ? 40   TYR A C     1 
ATOM   292   O  O     . TYR A  1 41  ? -12.506 -14.716 17.057  1.00 38.09 ? 40   TYR A O     1 
ATOM   293   C  CB    . TYR A  1 41  ? -12.618 -16.930 14.709  1.00 37.97 ? 40   TYR A CB    1 
ATOM   294   C  CG    . TYR A  1 41  ? -11.985 -18.271 14.433  1.00 38.94 ? 40   TYR A CG    1 
ATOM   295   C  CD1   . TYR A  1 41  ? -12.379 -19.403 15.148  1.00 38.83 ? 40   TYR A CD1   1 
ATOM   296   C  CD2   . TYR A  1 41  ? -10.984 -18.420 13.460  1.00 38.21 ? 40   TYR A CD2   1 
ATOM   297   C  CE1   . TYR A  1 41  ? -11.793 -20.647 14.914  1.00 38.40 ? 40   TYR A CE1   1 
ATOM   298   C  CE2   . TYR A  1 41  ? -10.409 -19.672 13.222  1.00 38.35 ? 40   TYR A CE2   1 
ATOM   299   C  CZ    . TYR A  1 41  ? -10.821 -20.773 13.966  1.00 37.57 ? 40   TYR A CZ    1 
ATOM   300   O  OH    . TYR A  1 41  ? -10.275 -22.016 13.756  1.00 38.21 ? 40   TYR A OH    1 
ATOM   301   N  N     . SER A  1 42  ? -12.961 -13.834 15.028  1.00 38.92 ? 41   SER A N     1 
ATOM   302   C  CA    A SER A  1 42  ? -13.868 -12.802 15.501  0.50 38.99 ? 41   SER A CA    1 
ATOM   303   C  CA    B SER A  1 42  ? -13.921 -12.883 15.558  0.50 39.13 ? 41   SER A CA    1 
ATOM   304   C  C     . SER A  1 42  ? -15.176 -12.855 14.696  1.00 39.40 ? 41   SER A C     1 
ATOM   305   O  O     . SER A  1 42  ? -15.164 -13.209 13.525  1.00 40.17 ? 41   SER A O     1 
ATOM   306   C  CB    A SER A  1 42  ? -13.193 -11.438 15.357  0.50 38.81 ? 41   SER A CB    1 
ATOM   307   C  CB    B SER A  1 42  ? -13.322 -11.484 15.741  0.50 38.96 ? 41   SER A CB    1 
ATOM   308   O  OG    A SER A  1 42  ? -14.131 -10.384 15.356  0.50 38.13 ? 41   SER A OG    1 
ATOM   309   O  OG    B SER A  1 42  ? -12.721 -10.998 14.563  0.50 39.05 ? 41   SER A OG    1 
ATOM   310   N  N     . ALA A  1 43  ? -16.284 -12.492 15.320  1.00 39.55 ? 42   ALA A N     1 
ATOM   311   C  CA    . ALA A  1 43  ? -17.547 -12.348 14.627  1.00 39.72 ? 42   ALA A CA    1 
ATOM   312   C  C     . ALA A  1 43  ? -18.393 -11.347 15.402  1.00 40.18 ? 42   ALA A C     1 
ATOM   313   O  O     . ALA A  1 43  ? -18.238 -11.196 16.611  1.00 39.71 ? 42   ALA A O     1 
ATOM   314   C  CB    . ALA A  1 43  ? -18.264 -13.715 14.481  1.00 39.43 ? 42   ALA A CB    1 
ATOM   315   N  N     . ASN A  1 44  ? -19.254 -10.634 14.689  1.00 40.84 ? 43   ASN A N     1 
ATOM   316   C  CA    . ASN A  1 44  ? -20.203 -9.731  15.309  1.00 41.62 ? 43   ASN A CA    1 
ATOM   317   C  C     . ASN A  1 44  ? -21.524 -10.445 15.574  1.00 41.50 ? 43   ASN A C     1 
ATOM   318   O  O     . ASN A  1 44  ? -21.935 -11.313 14.813  1.00 41.03 ? 43   ASN A O     1 
ATOM   319   C  CB    . ASN A  1 44  ? -20.460 -8.511  14.415  1.00 42.15 ? 43   ASN A CB    1 
ATOM   320   C  CG    . ASN A  1 44  ? -19.347 -7.486  14.489  1.00 44.28 ? 43   ASN A CG    1 
ATOM   321   O  OD1   . ASN A  1 44  ? -18.738 -7.290  15.546  1.00 49.43 ? 43   ASN A OD1   1 
ATOM   322   N  ND2   . ASN A  1 44  ? -19.079 -6.818  13.370  1.00 43.95 ? 43   ASN A ND2   1 
ATOM   323   N  N     . VAL A  1 45  ? -22.162 -10.067 16.672  1.00 41.46 ? 44   VAL A N     1 
ATOM   324   C  CA    . VAL A  1 45  ? -23.476 -10.563 17.048  1.00 42.02 ? 44   VAL A CA    1 
ATOM   325   C  C     . VAL A  1 45  ? -24.279 -9.377  17.610  1.00 42.17 ? 44   VAL A C     1 
ATOM   326   O  O     . VAL A  1 45  ? -23.730 -8.505  18.266  1.00 42.07 ? 44   VAL A O     1 
ATOM   327   C  CB    . VAL A  1 45  ? -23.375 -11.735 18.067  1.00 41.59 ? 44   VAL A CB    1 
ATOM   328   C  CG1   . VAL A  1 45  ? -24.702 -12.010 18.712  1.00 42.11 ? 44   VAL A CG1   1 
ATOM   329   C  CG2   . VAL A  1 45  ? -22.885 -13.006 17.373  1.00 41.82 ? 44   VAL A CG2   1 
ATOM   330   N  N     . MET A  1 46  ? -25.563 -9.322  17.299  1.00 42.96 ? 45   MET A N     1 
ATOM   331   C  CA    . MET A  1 46  ? -26.433 -8.270  17.828  1.00 43.74 ? 45   MET A CA    1 
ATOM   332   C  C     . MET A  1 46  ? -27.103 -8.861  19.057  1.00 43.53 ? 45   MET A C     1 
ATOM   333   O  O     . MET A  1 46  ? -27.753 -9.900  18.965  1.00 43.48 ? 45   MET A O     1 
ATOM   334   C  CB    . MET A  1 46  ? -27.470 -7.851  16.789  1.00 44.24 ? 45   MET A CB    1 
ATOM   335   C  CG    . MET A  1 46  ? -27.991 -6.413  16.937  1.00 46.62 ? 45   MET A CG    1 
ATOM   336   S  SD    . MET A  1 46  ? -26.766 -5.100  16.619  1.00 51.37 ? 45   MET A SD    1 
ATOM   337   C  CE    . MET A  1 46  ? -25.606 -5.967  15.564  1.00 44.23 ? 45   MET A CE    1 
ATOM   338   N  N     . VAL A  1 47  ? -26.901 -8.233  20.211  1.00 43.22 ? 46   VAL A N     1 
ATOM   339   C  CA    . VAL A  1 47  ? -27.472 -8.724  21.459  1.00 43.17 ? 46   VAL A CA    1 
ATOM   340   C  C     . VAL A  1 47  ? -28.342 -7.626  22.034  1.00 43.72 ? 46   VAL A C     1 
ATOM   341   O  O     . VAL A  1 47  ? -27.833 -6.578  22.416  1.00 42.93 ? 46   VAL A O     1 
ATOM   342   C  CB    . VAL A  1 47  ? -26.384 -9.104  22.490  1.00 43.05 ? 46   VAL A CB    1 
ATOM   343   C  CG1   . VAL A  1 47  ? -27.024 -9.712  23.714  1.00 42.21 ? 46   VAL A CG1   1 
ATOM   344   C  CG2   . VAL A  1 47  ? -25.358 -10.070 21.882  1.00 42.35 ? 46   VAL A CG2   1 
ATOM   345   N  N     . ASP A  1 48  ? -29.649 -7.890  22.073  1.00 44.59 ? 47   ASP A N     1 
ATOM   346   C  CA    . ASP A  1 48  ? -30.664 -6.953  22.541  1.00 45.63 ? 47   ASP A CA    1 
ATOM   347   C  C     . ASP A  1 48  ? -30.545 -5.595  21.847  1.00 45.89 ? 47   ASP A C     1 
ATOM   348   O  O     . ASP A  1 48  ? -30.616 -4.551  22.486  1.00 46.12 ? 47   ASP A O     1 
ATOM   349   C  CB    . ASP A  1 48  ? -30.612 -6.802  24.070  1.00 45.97 ? 47   ASP A CB    1 
ATOM   350   C  CG    . ASP A  1 48  ? -30.816 -8.132  24.813  1.00 47.11 ? 47   ASP A CG    1 
ATOM   351   O  OD1   . ASP A  1 48  ? -31.402 -9.087  24.254  1.00 48.20 ? 47   ASP A OD1   1 
ATOM   352   O  OD2   . ASP A  1 48  ? -30.383 -8.228  25.979  1.00 50.00 ? 47   ASP A OD2   1 
ATOM   353   N  N     . GLY A  1 49  ? -30.354 -5.619  20.531  1.00 46.12 ? 48   GLY A N     1 
ATOM   354   C  CA    . GLY A  1 49  ? -30.214 -4.390  19.757  1.00 46.24 ? 48   GLY A CA    1 
ATOM   355   C  C     . GLY A  1 49  ? -28.803 -3.820  19.705  1.00 46.43 ? 48   GLY A C     1 
ATOM   356   O  O     . GLY A  1 49  ? -28.509 -3.008  18.824  1.00 46.72 ? 48   GLY A O     1 
ATOM   357   N  N     . LYS A  1 50  ? -27.933 -4.230  20.635  1.00 46.01 ? 49   LYS A N     1 
ATOM   358   C  CA    . LYS A  1 50  ? -26.569 -3.700  20.706  1.00 45.63 ? 49   LYS A CA    1 
ATOM   359   C  C     . LYS A  1 50  ? -25.564 -4.669  20.080  1.00 44.89 ? 49   LYS A C     1 
ATOM   360   O  O     . LYS A  1 50  ? -25.603 -5.874  20.338  1.00 43.82 ? 49   LYS A O     1 
ATOM   361   C  CB    . LYS A  1 50  ? -26.141 -3.418  22.149  1.00 45.82 ? 49   LYS A CB    1 
ATOM   362   C  CG    . LYS A  1 50  ? -26.966 -2.369  22.877  1.00 46.48 ? 49   LYS A CG    1 
ATOM   363   C  CD    . LYS A  1 50  ? -27.797 -2.983  24.015  1.00 48.11 ? 49   LYS A CD    1 
ATOM   364   N  N     . PRO A  1 51  ? -24.637 -4.127  19.278  1.00 44.47 ? 50   PRO A N     1 
ATOM   365   C  CA    . PRO A  1 51  ? -23.614 -4.943  18.657  1.00 44.10 ? 50   PRO A CA    1 
ATOM   366   C  C     . PRO A  1 51  ? -22.558 -5.392  19.676  1.00 43.44 ? 50   PRO A C     1 
ATOM   367   O  O     . PRO A  1 51  ? -22.129 -4.602  20.532  1.00 42.78 ? 50   PRO A O     1 
ATOM   368   C  CB    . PRO A  1 51  ? -23.016 -4.015  17.598  1.00 44.07 ? 50   PRO A CB    1 
ATOM   369   C  CG    . PRO A  1 51  ? -23.270 -2.661  18.081  1.00 44.57 ? 50   PRO A CG    1 
ATOM   370   C  CD    . PRO A  1 51  ? -24.502 -2.701  18.927  1.00 44.67 ? 50   PRO A CD    1 
ATOM   371   N  N     . VAL A  1 52  ? -22.181 -6.665  19.592  1.00 42.75 ? 51   VAL A N     1 
ATOM   372   C  CA    . VAL A  1 52  ? -21.168 -7.244  20.476  1.00 42.21 ? 51   VAL A CA    1 
ATOM   373   C  C     . VAL A  1 52  ? -20.109 -7.934  19.641  1.00 42.29 ? 51   VAL A C     1 
ATOM   374   O  O     . VAL A  1 52  ? -20.434 -8.635  18.688  1.00 42.00 ? 51   VAL A O     1 
ATOM   375   C  CB    . VAL A  1 52  ? -21.795 -8.244  21.454  1.00 42.13 ? 51   VAL A CB    1 
ATOM   376   C  CG1   . VAL A  1 52  ? -20.711 -9.037  22.202  1.00 41.22 ? 51   VAL A CG1   1 
ATOM   377   C  CG2   . VAL A  1 52  ? -22.697 -7.521  22.425  1.00 40.36 ? 51   VAL A CG2   1 
ATOM   378   N  N     . ASN A  1 53  ? -18.843 -7.728  20.001  1.00 42.38 ? 52   ASN A N     1 
ATOM   379   C  CA    . ASN A  1 53  ? -17.740 -8.368  19.318  1.00 42.37 ? 52   ASN A CA    1 
ATOM   380   C  C     . ASN A  1 53  ? -17.358 -9.670  20.016  1.00 42.22 ? 52   ASN A C     1 
ATOM   381   O  O     . ASN A  1 53  ? -16.819 -9.660  21.116  1.00 41.48 ? 52   ASN A O     1 
ATOM   382   C  CB    . ASN A  1 53  ? -16.530 -7.439  19.268  1.00 42.80 ? 52   ASN A CB    1 
ATOM   383   C  CG    . ASN A  1 53  ? -15.304 -8.097  18.620  1.00 43.87 ? 52   ASN A CG    1 
ATOM   384   O  OD1   . ASN A  1 53  ? -15.412 -9.049  17.842  1.00 44.87 ? 52   ASN A OD1   1 
ATOM   385   N  ND2   . ASN A  1 53  ? -14.135 -7.563  18.924  1.00 47.03 ? 52   ASN A ND2   1 
ATOM   386   N  N     . LEU A  1 54  ? -17.603 -10.786 19.346  1.00 41.63 ? 53   LEU A N     1 
ATOM   387   C  CA    . LEU A  1 54  ? -17.314 -12.076 19.908  1.00 41.76 ? 53   LEU A CA    1 
ATOM   388   C  C     . LEU A  1 54  ? -15.938 -12.567 19.427  1.00 41.49 ? 53   LEU A C     1 
ATOM   389   O  O     . LEU A  1 54  ? -15.738 -12.811 18.240  1.00 41.49 ? 53   LEU A O     1 
ATOM   390   C  CB    . LEU A  1 54  ? -18.427 -13.037 19.516  1.00 41.82 ? 53   LEU A CB    1 
ATOM   391   C  CG    . LEU A  1 54  ? -18.329 -14.489 19.970  1.00 42.16 ? 53   LEU A CG    1 
ATOM   392   C  CD1   . LEU A  1 54  ? -18.052 -14.614 21.467  1.00 43.11 ? 53   LEU A CD1   1 
ATOM   393   C  CD2   . LEU A  1 54  ? -19.655 -15.169 19.605  1.00 42.55 ? 53   LEU A CD2   1 
ATOM   394   N  N     . GLY A  1 55  ? -14.992 -12.673 20.362  1.00 40.86 ? 54   GLY A N     1 
ATOM   395   C  CA    . GLY A  1 55  ? -13.629 -13.165 20.098  1.00 40.05 ? 54   GLY A CA    1 
ATOM   396   C  C     . GLY A  1 55  ? -13.522 -14.625 20.528  1.00 39.58 ? 54   GLY A C     1 
ATOM   397   O  O     . GLY A  1 55  ? -13.834 -14.971 21.657  1.00 39.32 ? 54   GLY A O     1 
ATOM   398   N  N     . LEU A  1 56  ? -13.086 -15.478 19.613  1.00 39.17 ? 55   LEU A N     1 
ATOM   399   C  CA    . LEU A  1 56  ? -13.106 -16.922 19.818  1.00 39.33 ? 55   LEU A CA    1 
ATOM   400   C  C     . LEU A  1 56  ? -11.695 -17.506 19.745  1.00 39.27 ? 55   LEU A C     1 
ATOM   401   O  O     . LEU A  1 56  ? -11.010 -17.380 18.730  1.00 39.38 ? 55   LEU A O     1 
ATOM   402   C  CB    . LEU A  1 56  ? -14.008 -17.575 18.775  1.00 39.02 ? 55   LEU A CB    1 
ATOM   403   C  CG    . LEU A  1 56  ? -15.494 -17.233 18.991  1.00 39.38 ? 55   LEU A CG    1 
ATOM   404   C  CD1   . LEU A  1 56  ? -16.277 -17.390 17.707  1.00 38.29 ? 55   LEU A CD1   1 
ATOM   405   C  CD2   . LEU A  1 56  ? -16.057 -18.123 20.091  1.00 38.19 ? 55   LEU A CD2   1 
ATOM   406   N  N     . TRP A  1 57  ? -11.287 -18.157 20.826  1.00 38.95 ? 56   TRP A N     1 
ATOM   407   C  CA    . TRP A  1 57  ? -9.930  -18.636 20.976  1.00 38.87 ? 56   TRP A CA    1 
ATOM   408   C  C     . TRP A  1 57  ? -9.975  -20.159 20.886  1.00 38.70 ? 56   TRP A C     1 
ATOM   409   O  O     . TRP A  1 57  ? -10.456 -20.826 21.799  1.00 37.90 ? 56   TRP A O     1 
ATOM   410   C  CB    . TRP A  1 57  ? -9.335  -18.097 22.280  1.00 39.29 ? 56   TRP A CB    1 
ATOM   411   C  CG    . TRP A  1 57  ? -9.344  -16.546 22.296  1.00 40.21 ? 56   TRP A CG    1 
ATOM   412   C  CD1   . TRP A  1 57  ? -10.438 -15.721 22.110  1.00 41.15 ? 56   TRP A CD1   1 
ATOM   413   C  CD2   . TRP A  1 57  ? -8.226  -15.676 22.471  1.00 39.94 ? 56   TRP A CD2   1 
ATOM   414   N  NE1   . TRP A  1 57  ? -10.062 -14.408 22.161  1.00 41.41 ? 56   TRP A NE1   1 
ATOM   415   C  CE2   . TRP A  1 57  ? -8.712  -14.345 22.385  1.00 40.75 ? 56   TRP A CE2   1 
ATOM   416   C  CE3   . TRP A  1 57  ? -6.864  -15.888 22.692  1.00 40.11 ? 56   TRP A CE3   1 
ATOM   417   C  CZ2   . TRP A  1 57  ? -7.887  -13.232 22.527  1.00 41.31 ? 56   TRP A CZ2   1 
ATOM   418   C  CZ3   . TRP A  1 57  ? -6.032  -14.788 22.830  1.00 41.38 ? 56   TRP A CZ3   1 
ATOM   419   C  CH2   . TRP A  1 57  ? -6.546  -13.464 22.737  1.00 42.11 ? 56   TRP A CH2   1 
ATOM   420   N  N     . ASP A  1 58  ? -9.495  -20.670 19.742  1.00 38.35 ? 57   ASP A N     1 
ATOM   421   C  CA    . ASP A  1 58  ? -9.575  -22.097 19.352  1.00 38.10 ? 57   ASP A CA    1 
ATOM   422   C  C     . ASP A  1 58  ? -8.255  -22.750 19.685  1.00 37.72 ? 57   ASP A C     1 
ATOM   423   O  O     . ASP A  1 58  ? -7.250  -22.516 19.022  1.00 38.10 ? 57   ASP A O     1 
ATOM   424   C  CB    . ASP A  1 58  ? -9.856  -22.216 17.847  1.00 37.29 ? 57   ASP A CB    1 
ATOM   425   C  CG    . ASP A  1 58  ? -10.240 -23.618 17.418  1.00 36.61 ? 57   ASP A CG    1 
ATOM   426   O  OD1   . ASP A  1 58  ? -10.455 -24.499 18.263  1.00 35.58 ? 57   ASP A OD1   1 
ATOM   427   O  OD2   . ASP A  1 58  ? -10.343 -23.843 16.204  1.00 38.61 ? 57   ASP A OD2   1 
ATOM   428   N  N     . THR A  1 59  ? -8.256  -23.551 20.741  1.00 37.78 ? 58   THR A N     1 
ATOM   429   C  CA    . THR A  1 59  ? -7.032  -24.099 21.309  1.00 37.36 ? 58   THR A CA    1 
ATOM   430   C  C     . THR A  1 59  ? -6.770  -25.559 20.904  1.00 37.34 ? 58   THR A C     1 
ATOM   431   O  O     . THR A  1 59  ? -7.611  -26.225 20.306  1.00 37.83 ? 58   THR A O     1 
ATOM   432   C  CB    . THR A  1 59  ? -7.035  -23.971 22.846  1.00 37.05 ? 58   THR A CB    1 
ATOM   433   O  OG1   . THR A  1 59  ? -7.969  -24.905 23.410  1.00 38.36 ? 58   THR A OG1   1 
ATOM   434   C  CG2   . THR A  1 59  ? -7.388  -22.540 23.251  1.00 35.72 ? 58   THR A CG2   1 
ATOM   435   N  N     . ALA A  1 60  ? -5.585  -26.039 21.251  1.00 37.28 ? 59   ALA A N     1 
ATOM   436   C  CA    . ALA A  1 60  ? -5.074  -27.322 20.766  1.00 37.29 ? 59   ALA A CA    1 
ATOM   437   C  C     . ALA A  1 60  ? -5.401  -28.371 21.778  1.00 36.94 ? 59   ALA A C     1 
ATOM   438   O  O     . ALA A  1 60  ? -5.063  -28.218 22.939  1.00 36.83 ? 59   ALA A O     1 
ATOM   439   C  CB    . ALA A  1 60  ? -3.531  -27.257 20.542  1.00 37.10 ? 59   ALA A CB    1 
ATOM   440   N  N     . GLY A  1 61  ? -6.101  -29.417 21.352  1.00 36.98 ? 60   GLY A N     1 
ATOM   441   C  CA    . GLY A  1 61  ? -6.359  -30.573 22.218  1.00 36.59 ? 60   GLY A CA    1 
ATOM   442   C  C     . GLY A  1 61  ? -5.136  -31.461 22.332  1.00 36.90 ? 60   GLY A C     1 
ATOM   443   O  O     . GLY A  1 61  ? -5.047  -32.269 23.239  1.00 36.87 ? 60   GLY A O     1 
ATOM   444   N  N     . GLN A  1 62  ? -4.198  -31.309 21.403  1.00 36.99 ? 61   GLN A N     1 
ATOM   445   C  CA    . GLN A  1 62  ? -2.943  -32.041 21.456  1.00 37.07 ? 61   GLN A CA    1 
ATOM   446   C  C     . GLN A  1 62  ? -2.148  -31.663 22.693  1.00 37.63 ? 61   GLN A C     1 
ATOM   447   O  O     . GLN A  1 62  ? -1.805  -30.496 22.922  1.00 36.50 ? 61   GLN A O     1 
ATOM   448   C  CB    . GLN A  1 62  ? -2.078  -31.786 20.217  1.00 36.61 ? 61   GLN A CB    1 
ATOM   449   C  CG    . GLN A  1 62  ? -2.480  -32.584 19.000  1.00 36.55 ? 61   GLN A CG    1 
ATOM   450   C  CD    . GLN A  1 62  ? -1.731  -32.150 17.777  1.00 35.97 ? 61   GLN A CD    1 
ATOM   451   O  OE1   . GLN A  1 62  ? -2.106  -31.182 17.122  1.00 36.15 ? 61   GLN A OE1   1 
ATOM   452   N  NE2   . GLN A  1 62  ? -0.638  -32.847 17.467  1.00 36.09 ? 61   GLN A NE2   1 
ATOM   453   N  N     . GLU A  1 63  ? -1.855  -32.701 23.458  1.00 38.26 ? 62   GLU A N     1 
ATOM   454   C  CA    . GLU A  1 63  ? -1.001  -32.661 24.608  1.00 39.89 ? 62   GLU A CA    1 
ATOM   455   C  C     . GLU A  1 63  ? 0.343   -31.998 24.293  1.00 39.20 ? 62   GLU A C     1 
ATOM   456   O  O     . GLU A  1 63  ? 0.891   -31.282 25.119  1.00 38.22 ? 62   GLU A O     1 
ATOM   457   C  CB    . GLU A  1 63  ? -0.775  -34.114 24.992  1.00 40.93 ? 62   GLU A CB    1 
ATOM   458   C  CG    . GLU A  1 63  ? -0.113  -34.397 26.253  1.00 45.21 ? 62   GLU A CG    1 
ATOM   459   C  CD    . GLU A  1 63  ? -0.284  -35.873 26.601  1.00 50.71 ? 62   GLU A CD    1 
ATOM   460   O  OE1   . GLU A  1 63  ? 0.350   -36.710 25.914  1.00 53.66 ? 62   GLU A OE1   1 
ATOM   461   O  OE2   . GLU A  1 63  ? -1.078  -36.181 27.525  1.00 53.84 ? 62   GLU A OE2   1 
ATOM   462   N  N     . ASP A  1 64  ? 0.867   -32.245 23.092  1.00 38.81 ? 63   ASP A N     1 
ATOM   463   C  CA    . ASP A  1 64  ? 2.148   -31.669 22.672  1.00 38.61 ? 63   ASP A CA    1 
ATOM   464   C  C     . ASP A  1 64  ? 2.135   -30.138 22.698  1.00 38.49 ? 63   ASP A C     1 
ATOM   465   O  O     . ASP A  1 64  ? 3.188   -29.514 22.771  1.00 37.67 ? 63   ASP A O     1 
ATOM   466   C  CB    . ASP A  1 64  ? 2.524   -32.153 21.269  1.00 38.80 ? 63   ASP A CB    1 
ATOM   467   C  CG    . ASP A  1 64  ? 3.089   -33.578 21.270  1.00 40.34 ? 63   ASP A CG    1 
ATOM   468   O  OD1   . ASP A  1 64  ? 3.124   -34.206 22.351  1.00 43.16 ? 63   ASP A OD1   1 
ATOM   469   O  OD2   . ASP A  1 64  ? 3.502   -34.068 20.197  1.00 39.19 ? 63   ASP A OD2   1 
ATOM   470   N  N     . TYR A  1 65  ? 0.945   -29.535 22.670  1.00 37.77 ? 64   TYR A N     1 
ATOM   471   C  CA    . TYR A  1 65  ? 0.857   -28.088 22.743  1.00 37.61 ? 64   TYR A CA    1 
ATOM   472   C  C     . TYR A  1 65  ? 0.422   -27.582 24.101  1.00 37.39 ? 64   TYR A C     1 
ATOM   473   O  O     . TYR A  1 65  ? -0.032  -26.456 24.220  1.00 37.55 ? 64   TYR A O     1 
ATOM   474   C  CB    . TYR A  1 65  ? 0.000   -27.556 21.576  1.00 37.26 ? 64   TYR A CB    1 
ATOM   475   C  CG    . TYR A  1 65  ? 0.700   -27.818 20.267  1.00 37.29 ? 64   TYR A CG    1 
ATOM   476   C  CD1   . TYR A  1 65  ? 0.102   -28.575 19.267  1.00 36.82 ? 64   TYR A CD1   1 
ATOM   477   C  CD2   . TYR A  1 65  ? 2.012   -27.366 20.064  1.00 37.35 ? 64   TYR A CD2   1 
ATOM   478   C  CE1   . TYR A  1 65  ? 0.761   -28.829 18.073  1.00 36.15 ? 64   TYR A CE1   1 
ATOM   479   C  CE2   . TYR A  1 65  ? 2.695   -27.625 18.877  1.00 37.56 ? 64   TYR A CE2   1 
ATOM   480   C  CZ    . TYR A  1 65  ? 2.058   -28.363 17.882  1.00 38.26 ? 64   TYR A CZ    1 
ATOM   481   O  OH    . TYR A  1 65  ? 2.721   -28.638 16.712  1.00 37.13 ? 64   TYR A OH    1 
ATOM   482   N  N     . ASP A  1 66  ? 0.626   -28.396 25.132  1.00 37.54 ? 65   ASP A N     1 
ATOM   483   C  CA    . ASP A  1 66  ? 0.236   -28.042 26.507  1.00 38.10 ? 65   ASP A CA    1 
ATOM   484   C  C     . ASP A  1 66  ? 0.862   -26.735 27.009  1.00 37.92 ? 65   ASP A C     1 
ATOM   485   O  O     . ASP A  1 66  ? 0.280   -26.057 27.826  1.00 37.69 ? 65   ASP A O     1 
ATOM   486   C  CB    . ASP A  1 66  ? 0.618   -29.162 27.495  1.00 38.08 ? 65   ASP A CB    1 
ATOM   487   C  CG    . ASP A  1 66  ? -0.477  -30.203 27.685  1.00 39.41 ? 65   ASP A CG    1 
ATOM   488   O  OD1   . ASP A  1 66  ? -1.583  -30.091 27.082  1.00 39.92 ? 65   ASP A OD1   1 
ATOM   489   O  OD2   . ASP A  1 66  ? -0.224  -31.150 28.474  1.00 40.54 ? 65   ASP A OD2   1 
ATOM   490   N  N     . ARG A  1 67  ? 2.061   -26.402 26.554  1.00 38.21 ? 66   ARG A N     1 
ATOM   491   C  CA    . ARG A  1 67  ? 2.720   -25.191 27.032  1.00 38.38 ? 66   ARG A CA    1 
ATOM   492   C  C     . ARG A  1 67  ? 2.242   -23.931 26.282  1.00 38.00 ? 66   ARG A C     1 
ATOM   493   O  O     . ARG A  1 67  ? 2.267   -22.838 26.841  1.00 37.98 ? 66   ARG A O     1 
ATOM   494   C  CB    . ARG A  1 67  ? 4.244   -25.369 27.016  1.00 38.35 ? 66   ARG A CB    1 
ATOM   495   C  CG    . ARG A  1 67  ? 4.712   -26.436 28.031  1.00 39.08 ? 66   ARG A CG    1 
ATOM   496   C  CD    . ARG A  1 67  ? 6.236   -26.546 28.138  1.00 39.77 ? 66   ARG A CD    1 
ATOM   497   N  N     . LEU A  1 68  ? 1.763   -24.089 25.048  1.00 37.70 ? 67   LEU A N     1 
ATOM   498   C  CA    . LEU A  1 68  ? 1.203   -22.960 24.278  1.00 37.64 ? 67   LEU A CA    1 
ATOM   499   C  C     . LEU A  1 68  ? -0.205  -22.610 24.764  1.00 37.80 ? 67   LEU A C     1 
ATOM   500   O  O     . LEU A  1 68  ? -0.580  -21.436 24.817  1.00 37.80 ? 67   LEU A O     1 
ATOM   501   C  CB    . LEU A  1 68  ? 1.151   -23.285 22.774  1.00 37.54 ? 67   LEU A CB    1 
ATOM   502   C  CG    . LEU A  1 68  ? 0.557   -22.223 21.828  1.00 36.41 ? 67   LEU A CG    1 
ATOM   503   C  CD1   . LEU A  1 68  ? 1.513   -21.042 21.650  1.00 33.84 ? 67   LEU A CD1   1 
ATOM   504   C  CD2   . LEU A  1 68  ? 0.173   -22.840 20.495  1.00 33.34 ? 67   LEU A CD2   1 
ATOM   505   N  N     . ARG A  1 69  ? -0.980  -23.625 25.131  1.00 38.01 ? 68   ARG A N     1 
ATOM   506   C  CA    . ARG A  1 69  ? -2.389  -23.415 25.478  1.00 37.82 ? 68   ARG A CA    1 
ATOM   507   C  C     . ARG A  1 69  ? -2.724  -22.285 26.496  1.00 37.91 ? 68   ARG A C     1 
ATOM   508   O  O     . ARG A  1 69  ? -3.584  -21.441 26.206  1.00 37.43 ? 68   ARG A O     1 
ATOM   509   C  CB    . ARG A  1 69  ? -3.056  -24.725 25.899  1.00 37.86 ? 68   ARG A CB    1 
ATOM   510   C  CG    . ARG A  1 69  ? -4.594  -24.664 25.741  1.00 37.53 ? 68   ARG A CG    1 
ATOM   511   C  CD    . ARG A  1 69  ? -5.301  -25.983 26.086  1.00 37.59 ? 68   ARG A CD    1 
ATOM   512   N  NE    . ARG A  1 69  ? -4.660  -27.092 25.402  1.00 36.36 ? 68   ARG A NE    1 
ATOM   513   C  CZ    . ARG A  1 69  ? -3.830  -27.966 25.959  1.00 36.72 ? 68   ARG A CZ    1 
ATOM   514   N  NH1   . ARG A  1 69  ? -3.499  -27.879 27.241  1.00 36.76 ? 68   ARG A NH1   1 
ATOM   515   N  NH2   . ARG A  1 69  ? -3.293  -28.920 25.201  1.00 37.20 ? 68   ARG A NH2   1 
ATOM   516   N  N     . PRO A  1 70  ? -2.081  -22.275 27.686  1.00 37.74 ? 69   PRO A N     1 
ATOM   517   C  CA    . PRO A  1 70  ? -2.382  -21.255 28.697  1.00 37.75 ? 69   PRO A CA    1 
ATOM   518   C  C     . PRO A  1 70  ? -2.119  -19.816 28.321  1.00 37.61 ? 69   PRO A C     1 
ATOM   519   O  O     . PRO A  1 70  ? -2.607  -18.922 29.003  1.00 37.81 ? 69   PRO A O     1 
ATOM   520   C  CB    . PRO A  1 70  ? -1.499  -21.652 29.875  1.00 37.55 ? 69   PRO A CB    1 
ATOM   521   C  CG    . PRO A  1 70  ? -1.236  -23.106 29.643  1.00 38.24 ? 69   PRO A CG    1 
ATOM   522   C  CD    . PRO A  1 70  ? -1.078  -23.221 28.182  1.00 37.44 ? 69   PRO A CD    1 
ATOM   523   N  N     . LEU A  1 71  ? -1.389  -19.574 27.242  1.00 37.48 ? 70   LEU A N     1 
ATOM   524   C  CA    . LEU A  1 71  ? -1.182  -18.206 26.773  1.00 37.15 ? 70   LEU A CA    1 
ATOM   525   C  C     . LEU A  1 71  ? -2.492  -17.548 26.332  1.00 36.99 ? 70   LEU A C     1 
ATOM   526   O  O     . LEU A  1 71  ? -2.582  -16.327 26.293  1.00 36.80 ? 70   LEU A O     1 
ATOM   527   C  CB    . LEU A  1 71  ? -0.153  -18.168 25.644  1.00 37.04 ? 70   LEU A CB    1 
ATOM   528   C  CG    . LEU A  1 71  ? 1.263   -18.609 26.002  1.00 36.70 ? 70   LEU A CG    1 
ATOM   529   C  CD1   . LEU A  1 71  ? 2.197   -18.347 24.826  1.00 36.16 ? 70   LEU A CD1   1 
ATOM   530   C  CD2   . LEU A  1 71  ? 1.775   -17.890 27.240  1.00 37.10 ? 70   LEU A CD2   1 
ATOM   531   N  N     . SER A  1 72  ? -3.501  -18.358 26.027  1.00 36.94 ? 71   SER A N     1 
ATOM   532   C  CA    A SER A  1 72  ? -4.835  -17.881 25.649  0.50 37.12 ? 71   SER A CA    1 
ATOM   533   C  CA    B SER A  1 72  ? -4.800  -17.812 25.644  0.50 37.52 ? 71   SER A CA    1 
ATOM   534   C  C     . SER A  1 72  ? -5.688  -17.451 26.841  1.00 37.26 ? 71   SER A C     1 
ATOM   535   O  O     . SER A  1 72  ? -6.734  -16.826 26.660  1.00 36.88 ? 71   SER A O     1 
ATOM   536   C  CB    A SER A  1 72  ? -5.617  -18.986 24.918  0.50 37.00 ? 71   SER A CB    1 
ATOM   537   C  CB    B SER A  1 72  ? -5.537  -18.788 24.726  0.50 37.51 ? 71   SER A CB    1 
ATOM   538   O  OG    A SER A  1 72  ? -5.017  -19.371 23.696  0.50 36.18 ? 71   SER A OG    1 
ATOM   539   O  OG    B SER A  1 72  ? -5.618  -20.063 25.319  0.50 38.97 ? 71   SER A OG    1 
ATOM   540   N  N     . TYR A  1 73  ? -5.277  -17.826 28.053  1.00 37.03 ? 72   TYR A N     1 
ATOM   541   C  CA    . TYR A  1 73  ? -6.191  -17.780 29.208  1.00 36.96 ? 72   TYR A CA    1 
ATOM   542   C  C     . TYR A  1 73  ? -6.348  -16.414 29.885  1.00 37.15 ? 72   TYR A C     1 
ATOM   543   O  O     . TYR A  1 73  ? -7.434  -16.094 30.344  1.00 36.61 ? 72   TYR A O     1 
ATOM   544   C  CB    . TYR A  1 73  ? -5.813  -18.849 30.266  1.00 36.78 ? 72   TYR A CB    1 
ATOM   545   C  CG    . TYR A  1 73  ? -5.904  -20.305 29.836  1.00 35.22 ? 72   TYR A CG    1 
ATOM   546   C  CD1   . TYR A  1 73  ? -6.613  -20.687 28.704  1.00 37.26 ? 72   TYR A CD1   1 
ATOM   547   C  CD2   . TYR A  1 73  ? -5.296  -21.313 30.592  1.00 34.48 ? 72   TYR A CD2   1 
ATOM   548   C  CE1   . TYR A  1 73  ? -6.700  -22.032 28.316  1.00 36.30 ? 72   TYR A CE1   1 
ATOM   549   C  CE2   . TYR A  1 73  ? -5.372  -22.659 30.210  1.00 33.83 ? 72   TYR A CE2   1 
ATOM   550   C  CZ    . TYR A  1 73  ? -6.085  -23.000 29.071  1.00 35.39 ? 72   TYR A CZ    1 
ATOM   551   O  OH    . TYR A  1 73  ? -6.194  -24.300 28.670  1.00 35.47 ? 72   TYR A OH    1 
ATOM   552   N  N     . PRO A  1 74  ? -5.274  -15.614 29.973  1.00 37.53 ? 73   PRO A N     1 
ATOM   553   C  CA    . PRO A  1 74  ? -5.486  -14.341 30.668  1.00 38.14 ? 73   PRO A CA    1 
ATOM   554   C  C     . PRO A  1 74  ? -6.679  -13.530 30.119  1.00 38.07 ? 73   PRO A C     1 
ATOM   555   O  O     . PRO A  1 74  ? -6.897  -13.489 28.915  1.00 38.23 ? 73   PRO A O     1 
ATOM   556   C  CB    . PRO A  1 74  ? -4.145  -13.610 30.497  1.00 37.99 ? 73   PRO A CB    1 
ATOM   557   C  CG    . PRO A  1 74  ? -3.129  -14.734 30.364  1.00 37.80 ? 73   PRO A CG    1 
ATOM   558   C  CD    . PRO A  1 74  ? -3.869  -15.798 29.573  1.00 37.99 ? 73   PRO A CD    1 
ATOM   559   N  N     . GLN A  1 75  ? -7.469  -12.970 31.036  1.00 37.94 ? 74   GLN A N     1 
ATOM   560   C  CA    . GLN A  1 75  ? -8.594  -12.088 30.732  1.00 37.61 ? 74   GLN A CA    1 
ATOM   561   C  C     . GLN A  1 75  ? -9.737  -12.754 29.942  1.00 37.70 ? 74   GLN A C     1 
ATOM   562   O  O     . GLN A  1 75  ? -10.537 -12.072 29.314  1.00 37.12 ? 74   GLN A O     1 
ATOM   563   C  CB    . GLN A  1 75  ? -8.084  -10.807 30.046  1.00 37.90 ? 74   GLN A CB    1 
ATOM   564   C  CG    . GLN A  1 75  ? -7.212  -9.900  30.955  1.00 37.64 ? 74   GLN A CG    1 
ATOM   565   N  N     . THR A  1 76  ? -9.830  -14.088 30.017  1.00 37.28 ? 75   THR A N     1 
ATOM   566   C  CA    . THR A  1 76  ? -10.937 -14.835 29.432  1.00 36.65 ? 75   THR A CA    1 
ATOM   567   C  C     . THR A  1 76  ? -12.259 -14.494 30.146  1.00 36.91 ? 75   THR A C     1 
ATOM   568   O  O     . THR A  1 76  ? -12.298 -14.354 31.373  1.00 36.63 ? 75   THR A O     1 
ATOM   569   C  CB    . THR A  1 76  ? -10.666 -16.361 29.496  1.00 37.00 ? 75   THR A CB    1 
ATOM   570   O  OG1   . THR A  1 76  ? -9.455  -16.654 28.776  1.00 36.87 ? 75   THR A OG1   1 
ATOM   571   C  CG2   . THR A  1 76  ? -11.833 -17.181 28.907  1.00 34.98 ? 75   THR A CG2   1 
ATOM   572   N  N     . ASP A  1 77  ? -13.339 -14.357 29.373  1.00 36.15 ? 76   ASP A N     1 
ATOM   573   C  CA    . ASP A  1 77  ? -14.658 -14.065 29.943  1.00 35.85 ? 76   ASP A CA    1 
ATOM   574   C  C     . ASP A  1 77  ? -15.504 -15.323 30.131  1.00 35.68 ? 76   ASP A C     1 
ATOM   575   O  O     . ASP A  1 77  ? -16.378 -15.370 30.991  1.00 35.17 ? 76   ASP A O     1 
ATOM   576   C  CB    . ASP A  1 77  ? -15.399 -13.061 29.067  1.00 36.02 ? 76   ASP A CB    1 
ATOM   577   C  CG    . ASP A  1 77  ? -14.693 -11.710 29.000  1.00 35.83 ? 76   ASP A CG    1 
ATOM   578   O  OD1   . ASP A  1 77  ? -14.229 -11.207 30.055  1.00 35.29 ? 76   ASP A OD1   1 
ATOM   579   O  OD2   . ASP A  1 77  ? -14.606 -11.163 27.885  1.00 35.51 ? 76   ASP A OD2   1 
ATOM   580   N  N     . VAL A  1 78  ? -15.255 -16.340 29.313  1.00 35.86 ? 77   VAL A N     1 
ATOM   581   C  CA    . VAL A  1 78  ? -16.011 -17.584 29.406  1.00 35.22 ? 77   VAL A CA    1 
ATOM   582   C  C     . VAL A  1 78  ? -15.258 -18.682 28.681  1.00 35.62 ? 77   VAL A C     1 
ATOM   583   O  O     . VAL A  1 78  ? -14.575 -18.432 27.696  1.00 35.47 ? 77   VAL A O     1 
ATOM   584   C  CB    . VAL A  1 78  ? -17.437 -17.427 28.845  1.00 35.05 ? 77   VAL A CB    1 
ATOM   585   C  CG1   . VAL A  1 78  ? -17.395 -16.987 27.377  1.00 34.13 ? 77   VAL A CG1   1 
ATOM   586   C  CG2   . VAL A  1 78  ? -18.246 -18.707 29.028  1.00 34.19 ? 77   VAL A CG2   1 
ATOM   587   N  N     . PHE A  1 79  ? -15.360 -19.885 29.234  1.00 35.91 ? 78   PHE A N     1 
ATOM   588   C  CA    . PHE A  1 79  ? -14.757 -21.072 28.700  1.00 36.23 ? 78   PHE A CA    1 
ATOM   589   C  C     . PHE A  1 79  ? -15.837 -22.001 28.231  1.00 36.56 ? 78   PHE A C     1 
ATOM   590   O  O     . PHE A  1 79  ? -16.856 -22.156 28.891  1.00 36.84 ? 78   PHE A O     1 
ATOM   591   C  CB    . PHE A  1 79  ? -13.960 -21.793 29.794  1.00 36.26 ? 78   PHE A CB    1 
ATOM   592   C  CG    . PHE A  1 79  ? -12.569 -21.262 29.971  1.00 35.85 ? 78   PHE A CG    1 
ATOM   593   C  CD1   . PHE A  1 79  ? -12.290 -20.305 30.932  1.00 35.89 ? 78   PHE A CD1   1 
ATOM   594   C  CD2   . PHE A  1 79  ? -11.534 -21.719 29.172  1.00 34.98 ? 78   PHE A CD2   1 
ATOM   595   C  CE1   . PHE A  1 79  ? -10.994 -19.806 31.089  1.00 36.23 ? 78   PHE A CE1   1 
ATOM   596   C  CE2   . PHE A  1 79  ? -10.248 -21.216 29.324  1.00 35.27 ? 78   PHE A CE2   1 
ATOM   597   C  CZ    . PHE A  1 79  ? -9.982  -20.263 30.278  1.00 35.04 ? 78   PHE A CZ    1 
ATOM   598   N  N     . LEU A  1 80  ? -15.609 -22.609 27.078  1.00 36.64 ? 79   LEU A N     1 
ATOM   599   C  CA    . LEU A  1 80  ? -16.337 -23.792 26.670  1.00 36.20 ? 79   LEU A CA    1 
ATOM   600   C  C     . LEU A  1 80  ? -15.409 -24.959 26.868  1.00 35.72 ? 79   LEU A C     1 
ATOM   601   O  O     . LEU A  1 80  ? -14.362 -24.998 26.227  1.00 36.11 ? 79   LEU A O     1 
ATOM   602   C  CB    . LEU A  1 80  ? -16.738 -23.684 25.198  1.00 36.19 ? 79   LEU A CB    1 
ATOM   603   C  CG    . LEU A  1 80  ? -17.528 -22.433 24.788  1.00 36.92 ? 79   LEU A CG    1 
ATOM   604   C  CD1   . LEU A  1 80  ? -18.023 -22.556 23.341  1.00 35.11 ? 79   LEU A CD1   1 
ATOM   605   C  CD2   . LEU A  1 80  ? -18.695 -22.184 25.732  1.00 35.78 ? 79   LEU A CD2   1 
ATOM   606   N  N     . ILE A  1 81  ? -15.736 -25.871 27.786  1.00 35.61 ? 80   ILE A N     1 
ATOM   607   C  CA    . ILE A  1 81  ? -15.030 -27.155 27.867  1.00 35.81 ? 80   ILE A CA    1 
ATOM   608   C  C     . ILE A  1 81  ? -15.872 -28.154 27.121  1.00 36.14 ? 80   ILE A C     1 
ATOM   609   O  O     . ILE A  1 81  ? -17.072 -28.293 27.398  1.00 37.28 ? 80   ILE A O     1 
ATOM   610   C  CB    . ILE A  1 81  ? -14.804 -27.652 29.311  1.00 35.84 ? 80   ILE A CB    1 
ATOM   611   C  CG1   . ILE A  1 81  ? -13.956 -26.653 30.096  1.00 35.98 ? 80   ILE A CG1   1 
ATOM   612   C  CG2   . ILE A  1 81  ? -14.078 -29.024 29.283  1.00 36.15 ? 80   ILE A CG2   1 
ATOM   613   C  CD1   . ILE A  1 81  ? -13.682 -27.085 31.595  1.00 35.40 ? 80   ILE A CD1   1 
ATOM   614   N  N     . CYS A  1 82  ? -15.276 -28.773 26.117  1.00 36.68 ? 81   CYS A N     1 
ATOM   615   C  CA    . CYS A  1 82  ? -15.958 -29.663 25.197  1.00 37.11 ? 81   CYS A CA    1 
ATOM   616   C  C     . CYS A  1 82  ? -15.437 -31.094 25.328  1.00 36.55 ? 81   CYS A C     1 
ATOM   617   O  O     . CYS A  1 82  ? -14.242 -31.320 25.570  1.00 36.44 ? 81   CYS A O     1 
ATOM   618   C  CB    . CYS A  1 82  ? -15.716 -29.230 23.746  1.00 37.06 ? 81   CYS A CB    1 
ATOM   619   S  SG    . CYS A  1 82  ? -16.115 -27.526 23.370  1.00 39.85 ? 81   CYS A SG    1 
ATOM   620   N  N     . PHE A  1 83  ? -16.344 -32.046 25.125  1.00 35.91 ? 82   PHE A N     1 
ATOM   621   C  CA    . PHE A  1 83  ? -15.996 -33.461 25.021  1.00 35.71 ? 82   PHE A CA    1 
ATOM   622   C  C     . PHE A  1 83  ? -16.948 -34.076 23.988  1.00 35.70 ? 82   PHE A C     1 
ATOM   623   O  O     . PHE A  1 83  ? -18.006 -33.532 23.751  1.00 36.03 ? 82   PHE A O     1 
ATOM   624   C  CB    . PHE A  1 83  ? -16.135 -34.140 26.405  1.00 35.21 ? 82   PHE A CB    1 
ATOM   625   C  CG    . PHE A  1 83  ? -17.561 -34.311 26.844  1.00 33.80 ? 82   PHE A CG    1 
ATOM   626   C  CD1   . PHE A  1 83  ? -18.231 -33.282 27.487  1.00 31.73 ? 82   PHE A CD1   1 
ATOM   627   C  CD2   . PHE A  1 83  ? -18.248 -35.481 26.558  1.00 34.31 ? 82   PHE A CD2   1 
ATOM   628   C  CE1   . PHE A  1 83  ? -19.561 -33.409 27.837  1.00 32.42 ? 82   PHE A CE1   1 
ATOM   629   C  CE2   . PHE A  1 83  ? -19.575 -35.621 26.911  1.00 33.59 ? 82   PHE A CE2   1 
ATOM   630   C  CZ    . PHE A  1 83  ? -20.224 -34.585 27.561  1.00 34.22 ? 82   PHE A CZ    1 
ATOM   631   N  N     . SER A  1 84  ? -16.577 -35.200 23.378  1.00 36.05 ? 83   SER A N     1 
ATOM   632   C  CA    . SER A  1 84  ? -17.447 -35.850 22.392  1.00 35.78 ? 83   SER A CA    1 
ATOM   633   C  C     . SER A  1 84  ? -18.406 -36.770 23.107  1.00 35.93 ? 83   SER A C     1 
ATOM   634   O  O     . SER A  1 84  ? -18.006 -37.561 23.968  1.00 35.96 ? 83   SER A O     1 
ATOM   635   C  CB    . SER A  1 84  ? -16.640 -36.614 21.321  1.00 35.85 ? 83   SER A CB    1 
ATOM   636   O  OG    . SER A  1 84  ? -17.437 -37.603 20.665  1.00 35.26 ? 83   SER A OG    1 
ATOM   637   N  N     . LEU A  1 85  ? -19.684 -36.671 22.746  1.00 35.90 ? 84   LEU A N     1 
ATOM   638   C  CA    . LEU A  1 85  ? -20.696 -37.520 23.359  1.00 35.83 ? 84   LEU A CA    1 
ATOM   639   C  C     . LEU A  1 85  ? -20.438 -38.994 23.025  1.00 35.51 ? 84   LEU A C     1 
ATOM   640   O  O     . LEU A  1 85  ? -21.049 -39.857 23.628  1.00 35.74 ? 84   LEU A O     1 
ATOM   641   C  CB    . LEU A  1 85  ? -22.113 -37.113 22.935  1.00 35.32 ? 84   LEU A CB    1 
ATOM   642   C  CG    . LEU A  1 85  ? -22.667 -35.772 23.449  1.00 35.76 ? 84   LEU A CG    1 
ATOM   643   C  CD1   . LEU A  1 85  ? -23.927 -35.348 22.654  1.00 31.46 ? 84   LEU A CD1   1 
ATOM   644   C  CD2   . LEU A  1 85  ? -22.966 -35.839 24.933  1.00 34.21 ? 84   LEU A CD2   1 
ATOM   645   N  N     . VAL A  1 86  ? -19.555 -39.282 22.066  1.00 35.34 ? 85   VAL A N     1 
ATOM   646   C  CA    . VAL A  1 86  ? -19.242 -40.682 21.707  1.00 35.20 ? 85   VAL A CA    1 
ATOM   647   C  C     . VAL A  1 86  ? -17.771 -41.068 22.002  1.00 35.99 ? 85   VAL A C     1 
ATOM   648   O  O     . VAL A  1 86  ? -17.257 -42.070 21.484  1.00 36.31 ? 85   VAL A O     1 
ATOM   649   C  CB    . VAL A  1 86  ? -19.697 -41.010 20.243  1.00 35.15 ? 85   VAL A CB    1 
ATOM   650   C  CG1   . VAL A  1 86  ? -21.230 -40.847 20.130  1.00 34.40 ? 85   VAL A CG1   1 
ATOM   651   C  CG2   . VAL A  1 86  ? -19.020 -40.105 19.200  1.00 34.67 ? 85   VAL A CG2   1 
ATOM   652   N  N     . SER A  1 87  ? -17.133 -40.300 22.889  1.00 36.49 ? 86   SER A N     1 
ATOM   653   C  CA    . SER A  1 87  ? -15.803 -40.619 23.411  1.00 37.28 ? 86   SER A CA    1 
ATOM   654   C  C     . SER A  1 87  ? -15.818 -40.495 24.939  1.00 37.19 ? 86   SER A C     1 
ATOM   655   O  O     . SER A  1 87  ? -15.656 -39.408 25.464  1.00 38.02 ? 86   SER A O     1 
ATOM   656   C  CB    . SER A  1 87  ? -14.765 -39.682 22.802  1.00 37.41 ? 86   SER A CB    1 
ATOM   657   O  OG    . SER A  1 87  ? -13.480 -39.858 23.389  1.00 39.17 ? 86   SER A OG    1 
ATOM   658   N  N     . PRO A  1 88  ? -16.123 -41.590 25.654  1.00 37.16 ? 87   PRO A N     1 
ATOM   659   C  CA    . PRO A  1 88  ? -15.995 -41.627 27.107  1.00 37.06 ? 87   PRO A CA    1 
ATOM   660   C  C     . PRO A  1 88  ? -14.716 -41.047 27.657  1.00 36.66 ? 87   PRO A C     1 
ATOM   661   O  O     . PRO A  1 88  ? -14.767 -40.315 28.630  1.00 36.60 ? 87   PRO A O     1 
ATOM   662   C  CB    . PRO A  1 88  ? -16.097 -43.122 27.417  1.00 37.05 ? 87   PRO A CB    1 
ATOM   663   C  CG    . PRO A  1 88  ? -17.123 -43.594 26.407  1.00 37.56 ? 87   PRO A CG    1 
ATOM   664   C  CD    . PRO A  1 88  ? -16.753 -42.826 25.142  1.00 37.34 ? 87   PRO A CD    1 
ATOM   665   N  N     . ALA A  1 89  ? -13.599 -41.348 27.004  1.00 36.50 ? 88   ALA A N     1 
ATOM   666   C  CA    . ALA A  1 89  ? -12.297 -40.863 27.399  1.00 36.48 ? 88   ALA A CA    1 
ATOM   667   C  C     . ALA A  1 89  ? -12.203 -39.342 27.405  1.00 36.65 ? 88   ALA A C     1 
ATOM   668   O  O     . ALA A  1 89  ? -11.644 -38.777 28.340  1.00 35.82 ? 88   ALA A O     1 
ATOM   669   C  CB    . ALA A  1 89  ? -11.232 -41.462 26.504  1.00 36.06 ? 88   ALA A CB    1 
ATOM   670   N  N     . SER A  1 90  ? -12.747 -38.684 26.374  1.00 36.73 ? 89   SER A N     1 
ATOM   671   C  CA    . SER A  1 90  ? -12.764 -37.218 26.313  1.00 36.87 ? 89   SER A CA    1 
ATOM   672   C  C     . SER A  1 90  ? -13.598 -36.624 27.439  1.00 37.20 ? 89   SER A C     1 
ATOM   673   O  O     . SER A  1 90  ? -13.266 -35.570 27.991  1.00 37.57 ? 89   SER A O     1 
ATOM   674   C  CB    . SER A  1 90  ? -13.278 -36.723 24.955  1.00 36.86 ? 89   SER A CB    1 
ATOM   675   O  OG    . SER A  1 90  ? -14.680 -36.860 24.842  1.00 38.31 ? 89   SER A OG    1 
ATOM   676   N  N     . PHE A  1 91  ? -14.690 -37.306 27.771  1.00 37.54 ? 90   PHE A N     1 
ATOM   677   C  CA    . PHE A  1 91  ? -15.538 -36.946 28.879  1.00 37.63 ? 90   PHE A CA    1 
ATOM   678   C  C     . PHE A  1 91  ? -14.815 -37.119 30.232  1.00 38.22 ? 90   PHE A C     1 
ATOM   679   O  O     . PHE A  1 91  ? -14.776 -36.219 31.051  1.00 38.56 ? 90   PHE A O     1 
ATOM   680   C  CB    . PHE A  1 91  ? -16.766 -37.828 28.809  1.00 37.43 ? 90   PHE A CB    1 
ATOM   681   C  CG    . PHE A  1 91  ? -17.767 -37.589 29.885  1.00 36.98 ? 90   PHE A CG    1 
ATOM   682   C  CD1   . PHE A  1 91  ? -18.424 -36.375 29.987  1.00 37.55 ? 90   PHE A CD1   1 
ATOM   683   C  CD2   . PHE A  1 91  ? -18.124 -38.604 30.753  1.00 38.33 ? 90   PHE A CD2   1 
ATOM   684   C  CE1   . PHE A  1 91  ? -19.384 -36.185 30.937  1.00 36.40 ? 90   PHE A CE1   1 
ATOM   685   C  CE2   . PHE A  1 91  ? -19.098 -38.398 31.716  1.00 35.98 ? 90   PHE A CE2   1 
ATOM   686   C  CZ    . PHE A  1 91  ? -19.716 -37.193 31.795  1.00 36.52 ? 90   PHE A CZ    1 
ATOM   687   N  N     . GLU A  1 92  ? -14.230 -38.274 30.465  1.00 39.36 ? 91   GLU A N     1 
ATOM   688   C  CA    . GLU A  1 92  ? -13.408 -38.460 31.669  1.00 40.21 ? 91   GLU A CA    1 
ATOM   689   C  C     . GLU A  1 92  ? -12.327 -37.367 31.813  1.00 39.30 ? 91   GLU A C     1 
ATOM   690   O  O     . GLU A  1 92  ? -11.994 -36.957 32.920  1.00 38.86 ? 91   GLU A O     1 
ATOM   691   C  CB    . GLU A  1 92  ? -12.798 -39.872 31.694  1.00 41.23 ? 91   GLU A CB    1 
ATOM   692   C  CG    . GLU A  1 92  ? -13.511 -40.907 32.620  1.00 46.95 ? 91   GLU A CG    1 
ATOM   693   C  CD    . GLU A  1 92  ? -15.056 -40.956 32.495  1.00 53.62 ? 91   GLU A CD    1 
ATOM   694   O  OE1   . GLU A  1 92  ? -15.592 -41.465 31.457  1.00 56.95 ? 91   GLU A OE1   1 
ATOM   695   O  OE2   . GLU A  1 92  ? -15.725 -40.510 33.470  1.00 56.27 ? 91   GLU A OE2   1 
ATOM   696   N  N     . ASN A  1 93  ? -11.811 -36.867 30.693  1.00 38.95 ? 92   ASN A N     1 
ATOM   697   C  CA    . ASN A  1 93  ? -10.783 -35.825 30.726  1.00 38.78 ? 92   ASN A CA    1 
ATOM   698   C  C     . ASN A  1 93  ? -11.274 -34.425 31.073  1.00 38.37 ? 92   ASN A C     1 
ATOM   699   O  O     . ASN A  1 93  ? -10.462 -33.560 31.364  1.00 37.65 ? 92   ASN A O     1 
ATOM   700   C  CB    . ASN A  1 93  ? -9.990  -35.799 29.414  1.00 38.78 ? 92   ASN A CB    1 
ATOM   701   C  CG    . ASN A  1 93  ? -8.928  -36.884 29.358  1.00 40.36 ? 92   ASN A CG    1 
ATOM   702   O  OD1   . ASN A  1 93  ? -8.366  -37.278 30.387  1.00 43.19 ? 92   ASN A OD1   1 
ATOM   703   N  ND2   . ASN A  1 93  ? -8.651  -37.380 28.148  1.00 41.53 ? 92   ASN A ND2   1 
ATOM   704   N  N     . VAL A  1 94  ? -12.593 -34.202 31.049  1.00 38.44 ? 93   VAL A N     1 
ATOM   705   C  CA    . VAL A  1 94  ? -13.177 -32.981 31.630  1.00 38.32 ? 93   VAL A CA    1 
ATOM   706   C  C     . VAL A  1 94  ? -12.811 -32.830 33.120  1.00 39.00 ? 93   VAL A C     1 
ATOM   707   O  O     . VAL A  1 94  ? -12.342 -31.777 33.562  1.00 38.95 ? 93   VAL A O     1 
ATOM   708   C  CB    . VAL A  1 94  ? -14.698 -32.956 31.454  1.00 38.39 ? 93   VAL A CB    1 
ATOM   709   C  CG1   . VAL A  1 94  ? -15.318 -31.832 32.248  1.00 36.52 ? 93   VAL A CG1   1 
ATOM   710   C  CG2   . VAL A  1 94  ? -15.046 -32.843 29.969  1.00 37.22 ? 93   VAL A CG2   1 
ATOM   711   N  N     . ARG A  1 95  ? -13.029 -33.905 33.869  1.00 39.50 ? 94   ARG A N     1 
ATOM   712   C  CA    . ARG A  1 95  ? -12.632 -34.024 35.265  1.00 40.16 ? 94   ARG A CA    1 
ATOM   713   C  C     . ARG A  1 95  ? -11.091 -34.084 35.429  1.00 39.49 ? 94   ARG A C     1 
ATOM   714   O  O     . ARG A  1 95  ? -10.504 -33.324 36.200  1.00 39.95 ? 94   ARG A O     1 
ATOM   715   C  CB    . ARG A  1 95  ? -13.267 -35.294 35.830  1.00 39.85 ? 94   ARG A CB    1 
ATOM   716   C  CG    . ARG A  1 95  ? -12.909 -35.622 37.248  1.00 42.08 ? 94   ARG A CG    1 
ATOM   717   C  CD    . ARG A  1 95  ? -13.419 -37.000 37.645  1.00 43.53 ? 94   ARG A CD    1 
ATOM   718   N  NE    . ARG A  1 95  ? -14.879 -37.041 37.776  1.00 46.68 ? 94   ARG A NE    1 
ATOM   719   C  CZ    . ARG A  1 95  ? -15.692 -37.882 37.134  1.00 48.43 ? 94   ARG A CZ    1 
ATOM   720   N  NH1   . ARG A  1 95  ? -15.231 -38.812 36.295  1.00 50.14 ? 94   ARG A NH1   1 
ATOM   721   N  NH2   . ARG A  1 95  ? -17.001 -37.807 37.353  1.00 49.13 ? 94   ARG A NH2   1 
ATOM   722   N  N     . ALA A  1 96  ? -10.450 -34.983 34.695  1.00 38.96 ? 95   ALA A N     1 
ATOM   723   C  CA    . ALA A  1 96  ? -9.027  -35.270 34.874  1.00 38.65 ? 95   ALA A CA    1 
ATOM   724   C  C     . ALA A  1 96  ? -8.054  -34.164 34.440  1.00 38.50 ? 95   ALA A C     1 
ATOM   725   O  O     . ALA A  1 96  ? -6.985  -34.003 35.047  1.00 39.17 ? 95   ALA A O     1 
ATOM   726   C  CB    . ALA A  1 96  ? -8.670  -36.572 34.173  1.00 38.61 ? 95   ALA A CB    1 
ATOM   727   N  N     . LYS A  1 97  ? -8.400  -33.419 33.399  1.00 38.48 ? 96   LYS A N     1 
ATOM   728   C  CA    . LYS A  1 97  ? -7.482  -32.425 32.821  1.00 38.37 ? 96   LYS A CA    1 
ATOM   729   C  C     . LYS A  1 97  ? -8.066  -31.008 32.635  1.00 37.97 ? 96   LYS A C     1 
ATOM   730   O  O     . LYS A  1 97  ? -7.485  -30.057 33.117  1.00 37.34 ? 96   LYS A O     1 
ATOM   731   C  CB    . LYS A  1 97  ? -6.917  -32.944 31.490  1.00 38.03 ? 96   LYS A CB    1 
ATOM   732   C  CG    . LYS A  1 97  ? -6.044  -31.942 30.739  1.00 39.08 ? 96   LYS A CG    1 
ATOM   733   C  CD    . LYS A  1 97  ? -5.197  -32.594 29.638  1.00 38.55 ? 96   LYS A CD    1 
ATOM   734   C  CE    . LYS A  1 97  ? -4.241  -31.570 28.976  1.00 39.63 ? 96   LYS A CE    1 
ATOM   735   N  NZ    . LYS A  1 97  ? -3.209  -32.186 28.058  1.00 37.59 ? 96   LYS A NZ    1 
ATOM   736   N  N     . TRP A  1 98  ? -9.180  -30.871 31.922  1.00 38.01 ? 97   TRP A N     1 
ATOM   737   C  CA    . TRP A  1 98  ? -9.597  -29.559 31.402  1.00 38.39 ? 97   TRP A CA    1 
ATOM   738   C  C     . TRP A  1 98  ? -10.110 -28.610 32.461  1.00 38.38 ? 97   TRP A C     1 
ATOM   739   O  O     . TRP A  1 98  ? -9.670  -27.460 32.505  1.00 37.81 ? 97   TRP A O     1 
ATOM   740   C  CB    . TRP A  1 98  ? -10.602 -29.702 30.238  1.00 39.08 ? 97   TRP A CB    1 
ATOM   741   C  CG    . TRP A  1 98  ? -9.988  -30.490 29.164  1.00 39.63 ? 97   TRP A CG    1 
ATOM   742   C  CD1   . TRP A  1 98  ? -10.282 -31.777 28.821  1.00 40.91 ? 97   TRP A CD1   1 
ATOM   743   C  CD2   . TRP A  1 98  ? -8.861  -30.110 28.369  1.00 39.44 ? 97   TRP A CD2   1 
ATOM   744   N  NE1   . TRP A  1 98  ? -9.432  -32.208 27.835  1.00 39.94 ? 97   TRP A NE1   1 
ATOM   745   C  CE2   . TRP A  1 98  ? -8.549  -31.208 27.536  1.00 39.49 ? 97   TRP A CE2   1 
ATOM   746   C  CE3   . TRP A  1 98  ? -8.090  -28.950 28.275  1.00 39.75 ? 97   TRP A CE3   1 
ATOM   747   C  CZ2   . TRP A  1 98  ? -7.511  -31.174 26.604  1.00 39.91 ? 97   TRP A CZ2   1 
ATOM   748   C  CZ3   . TRP A  1 98  ? -7.051  -28.920 27.355  1.00 40.59 ? 97   TRP A CZ3   1 
ATOM   749   C  CH2   . TRP A  1 98  ? -6.778  -30.021 26.524  1.00 40.56 ? 97   TRP A CH2   1 
ATOM   750   N  N     . TYR A  1 99  ? -11.004 -29.097 33.325  1.00 38.54 ? 98   TYR A N     1 
ATOM   751   C  CA    . TYR A  1 99  ? -11.494 -28.303 34.448  1.00 39.06 ? 98   TYR A CA    1 
ATOM   752   C  C     . TYR A  1 99  ? -10.362 -27.821 35.389  1.00 38.91 ? 98   TYR A C     1 
ATOM   753   O  O     . TYR A  1 99  ? -10.293 -26.632 35.707  1.00 38.71 ? 98   TYR A O     1 
ATOM   754   C  CB    . TYR A  1 99  ? -12.607 -29.062 35.207  1.00 39.49 ? 98   TYR A CB    1 
ATOM   755   C  CG    . TYR A  1 99  ? -13.023 -28.451 36.533  1.00 39.55 ? 98   TYR A CG    1 
ATOM   756   C  CD1   . TYR A  1 99  ? -13.416 -27.125 36.609  1.00 38.30 ? 98   TYR A CD1   1 
ATOM   757   C  CD2   . TYR A  1 99  ? -13.037 -29.213 37.699  1.00 39.31 ? 98   TYR A CD2   1 
ATOM   758   C  CE1   . TYR A  1 99  ? -13.824 -26.569 37.804  1.00 39.80 ? 98   TYR A CE1   1 
ATOM   759   C  CE2   . TYR A  1 99  ? -13.433 -28.664 38.914  1.00 40.20 ? 98   TYR A CE2   1 
ATOM   760   C  CZ    . TYR A  1 99  ? -13.828 -27.343 38.965  1.00 40.13 ? 98   TYR A CZ    1 
ATOM   761   O  OH    . TYR A  1 99  ? -14.204 -26.785 40.164  1.00 38.75 ? 98   TYR A OH    1 
ATOM   762   N  N     . PRO A  1 100 ? -9.488  -28.731 35.845  1.00 38.78 ? 99   PRO A N     1 
ATOM   763   C  CA    . PRO A  1 100 ? -8.314  -28.342 36.646  1.00 38.77 ? 99   PRO A CA    1 
ATOM   764   C  C     . PRO A  1 100 ? -7.362  -27.321 35.998  1.00 38.62 ? 99   PRO A C     1 
ATOM   765   O  O     . PRO A  1 100 ? -6.851  -26.444 36.671  1.00 37.70 ? 99   PRO A O     1 
ATOM   766   C  CB    . PRO A  1 100 ? -7.562  -29.667 36.832  1.00 38.68 ? 99   PRO A CB    1 
ATOM   767   C  CG    . PRO A  1 100 ? -8.569  -30.720 36.629  1.00 39.23 ? 99   PRO A CG    1 
ATOM   768   C  CD    . PRO A  1 100 ? -9.608  -30.195 35.718  1.00 39.13 ? 99   PRO A CD    1 
ATOM   769   N  N     . GLU A  1 101 ? -7.086  -27.478 34.711  1.00 39.14 ? 100  GLU A N     1 
ATOM   770   C  CA    . GLU A  1 101 ? -6.175  -26.571 34.018  1.00 39.59 ? 100  GLU A CA    1 
ATOM   771   C  C     . GLU A  1 101 ? -6.778  -25.175 33.903  1.00 39.10 ? 100  GLU A C     1 
ATOM   772   O  O     . GLU A  1 101 ? -6.114  -24.181 34.135  1.00 38.77 ? 100  GLU A O     1 
ATOM   773   C  CB    . GLU A  1 101 ? -5.846  -27.105 32.631  1.00 39.53 ? 100  GLU A CB    1 
ATOM   774   C  CG    . GLU A  1 101 ? -5.043  -26.147 31.775  1.00 40.55 ? 100  GLU A CG    1 
ATOM   775   C  CD    . GLU A  1 101 ? -4.528  -26.779 30.498  1.00 40.77 ? 100  GLU A CD    1 
ATOM   776   O  OE1   . GLU A  1 101 ? -4.061  -27.938 30.549  1.00 41.86 ? 100  GLU A OE1   1 
ATOM   777   O  OE2   . GLU A  1 101 ? -4.579  -26.096 29.449  1.00 41.90 ? 100  GLU A OE2   1 
ATOM   778   N  N     . VAL A  1 102 ? -8.034  -25.132 33.502  1.00 39.46 ? 101  VAL A N     1 
ATOM   779   C  CA    . VAL A  1 102 ? -8.761  -23.887 33.279  1.00 39.78 ? 101  VAL A CA    1 
ATOM   780   C  C     . VAL A  1 102 ? -8.861  -23.129 34.594  1.00 39.90 ? 101  VAL A C     1 
ATOM   781   O  O     . VAL A  1 102 ? -8.524  -21.941 34.680  1.00 39.51 ? 101  VAL A O     1 
ATOM   782   C  CB    . VAL A  1 102 ? -10.183 -24.193 32.661  1.00 40.21 ? 101  VAL A CB    1 
ATOM   783   C  CG1   . VAL A  1 102 ? -11.103 -23.017 32.785  1.00 41.76 ? 101  VAL A CG1   1 
ATOM   784   C  CG2   . VAL A  1 102 ? -10.039 -24.611 31.184  1.00 39.30 ? 101  VAL A CG2   1 
ATOM   785   N  N     . ARG A  1 103 ? -9.257  -23.865 35.629  1.00 39.66 ? 102  ARG A N     1 
ATOM   786   C  CA    . ARG A  1 103 ? -9.556  -23.308 36.936  1.00 40.05 ? 102  ARG A CA    1 
ATOM   787   C  C     . ARG A  1 103 ? -8.302  -22.862 37.663  1.00 39.97 ? 102  ARG A C     1 
ATOM   788   O  O     . ARG A  1 103 ? -8.333  -21.889 38.400  1.00 39.96 ? 102  ARG A O     1 
ATOM   789   C  CB    . ARG A  1 103 ? -10.355 -24.349 37.741  1.00 40.24 ? 102  ARG A CB    1 
ATOM   790   C  CG    . ARG A  1 103 ? -11.157 -23.847 38.892  1.00 41.16 ? 102  ARG A CG    1 
ATOM   791   C  CD    . ARG A  1 103 ? -11.879 -22.522 38.628  1.00 39.07 ? 102  ARG A CD    1 
ATOM   792   N  NE    . ARG A  1 103 ? -13.314 -22.572 38.376  1.00 35.90 ? 102  ARG A NE    1 
ATOM   793   C  CZ    . ARG A  1 103 ? -13.918 -21.921 37.379  1.00 35.66 ? 102  ARG A CZ    1 
ATOM   794   N  NH1   . ARG A  1 103 ? -13.201 -21.240 36.486  1.00 33.56 ? 102  ARG A NH1   1 
ATOM   795   N  NH2   . ARG A  1 103 ? -15.246 -21.964 37.261  1.00 34.66 ? 102  ARG A NH2   1 
ATOM   796   N  N     . HIS A  1 104 ? -7.192  -23.553 37.415  1.00 39.98 ? 103  HIS A N     1 
ATOM   797   C  CA    . HIS A  1 104 ? -5.873  -23.126 37.863  1.00 39.79 ? 103  HIS A CA    1 
ATOM   798   C  C     . HIS A  1 104 ? -5.444  -21.785 37.281  1.00 39.54 ? 103  HIS A C     1 
ATOM   799   O  O     . HIS A  1 104 ? -4.776  -21.013 37.949  1.00 38.96 ? 103  HIS A O     1 
ATOM   800   C  CB    . HIS A  1 104 ? -4.808  -24.180 37.530  1.00 40.22 ? 103  HIS A CB    1 
ATOM   801   C  CG    . HIS A  1 104 ? -3.416  -23.758 37.891  1.00 40.49 ? 103  HIS A CG    1 
ATOM   802   N  ND1   . HIS A  1 104 ? -2.966  -23.718 39.193  1.00 41.83 ? 103  HIS A ND1   1 
ATOM   803   C  CD2   . HIS A  1 104 ? -2.383  -23.330 37.124  1.00 41.11 ? 103  HIS A CD2   1 
ATOM   804   C  CE1   . HIS A  1 104 ? -1.714  -23.291 39.214  1.00 41.32 ? 103  HIS A CE1   1 
ATOM   805   N  NE2   . HIS A  1 104 ? -1.336  -23.045 37.972  1.00 41.62 ? 103  HIS A NE2   1 
ATOM   806   N  N     . HIS A  1 105 ? -5.807  -21.494 36.039  1.00 39.31 ? 104  HIS A N     1 
ATOM   807   C  CA    . HIS A  1 105 ? -5.387  -20.227 35.442  1.00 39.17 ? 104  HIS A CA    1 
ATOM   808   C  C     . HIS A  1 105 ? -6.447  -19.134 35.664  1.00 39.13 ? 104  HIS A C     1 
ATOM   809   O  O     . HIS A  1 105 ? -6.108  -17.959 35.850  1.00 39.84 ? 104  HIS A O     1 
ATOM   810   C  CB    . HIS A  1 105 ? -4.994  -20.416 33.960  1.00 38.95 ? 104  HIS A CB    1 
ATOM   811   C  CG    . HIS A  1 105 ? -3.721  -21.195 33.780  1.00 38.96 ? 104  HIS A CG    1 
ATOM   812   N  ND1   . HIS A  1 105 ? -2.472  -20.605 33.835  1.00 39.25 ? 104  HIS A ND1   1 
ATOM   813   C  CD2   . HIS A  1 105 ? -3.499  -22.521 33.602  1.00 37.66 ? 104  HIS A CD2   1 
ATOM   814   C  CE1   . HIS A  1 105 ? -1.540  -21.531 33.696  1.00 37.74 ? 104  HIS A CE1   1 
ATOM   815   N  NE2   . HIS A  1 105 ? -2.135  -22.702 33.557  1.00 38.19 ? 104  HIS A NE2   1 
ATOM   816   N  N     . CYS A  1 106 ? -7.716  -19.536 35.701  1.00 38.77 ? 105  CYS A N     1 
ATOM   817   C  CA    . CYS A  1 106 ? -8.838  -18.596 35.808  1.00 38.59 ? 105  CYS A CA    1 
ATOM   818   C  C     . CYS A  1 106 ? -9.806  -19.090 36.906  1.00 38.07 ? 105  CYS A C     1 
ATOM   819   O  O     . CYS A  1 106 ? -10.827 -19.745 36.611  1.00 38.22 ? 105  CYS A O     1 
ATOM   820   C  CB    . CYS A  1 106 ? -9.529  -18.467 34.442  1.00 37.88 ? 105  CYS A CB    1 
ATOM   821   S  SG    . CYS A  1 106 ? -8.404  -18.006 33.089  1.00 38.33 ? 105  CYS A SG    1 
ATOM   822   N  N     . PRO A  1 107 ? -9.468  -18.813 38.174  1.00 37.29 ? 106  PRO A N     1 
ATOM   823   C  CA    . PRO A  1 107 ? -10.226 -19.376 39.288  1.00 37.27 ? 106  PRO A CA    1 
ATOM   824   C  C     . PRO A  1 107 ? -11.713 -18.967 39.412  1.00 37.16 ? 106  PRO A C     1 
ATOM   825   O  O     . PRO A  1 107 ? -12.452 -19.621 40.145  1.00 36.73 ? 106  PRO A O     1 
ATOM   826   C  CB    . PRO A  1 107 ? -9.422  -18.955 40.513  1.00 37.29 ? 106  PRO A CB    1 
ATOM   827   C  CG    . PRO A  1 107 ? -8.519  -17.894 40.068  1.00 37.43 ? 106  PRO A CG    1 
ATOM   828   C  CD    . PRO A  1 107 ? -8.321  -18.007 38.626  1.00 37.35 ? 106  PRO A CD    1 
ATOM   829   N  N     . HIS A  1 108 ? -12.157 -17.932 38.699  1.00 37.02 ? 107  HIS A N     1 
ATOM   830   C  CA    . HIS A  1 108 ? -13.555 -17.501 38.805  1.00 36.92 ? 107  HIS A CA    1 
ATOM   831   C  C     . HIS A  1 108 ? -14.268 -17.247 37.484  1.00 36.85 ? 107  HIS A C     1 
ATOM   832   O  O     . HIS A  1 108 ? -15.357 -16.678 37.486  1.00 36.77 ? 107  HIS A O     1 
ATOM   833   C  CB    . HIS A  1 108 ? -13.678 -16.260 39.700  1.00 37.21 ? 107  HIS A CB    1 
ATOM   834   C  CG    . HIS A  1 108 ? -12.877 -15.088 39.227  1.00 37.98 ? 107  HIS A CG    1 
ATOM   835   N  ND1   . HIS A  1 108 ? -13.250 -14.317 38.146  1.00 39.79 ? 107  HIS A ND1   1 
ATOM   836   C  CD2   . HIS A  1 108 ? -11.706 -14.575 39.670  1.00 37.33 ? 107  HIS A CD2   1 
ATOM   837   C  CE1   . HIS A  1 108 ? -12.344 -13.374 37.953  1.00 38.42 ? 107  HIS A CE1   1 
ATOM   838   N  NE2   . HIS A  1 108 ? -11.397 -13.512 38.861  1.00 37.87 ? 107  HIS A NE2   1 
ATOM   839   N  N     . THR A  1 109 ? -13.692 -17.682 36.366  1.00 36.63 ? 108  THR A N     1 
ATOM   840   C  CA    . THR A  1 109 ? -14.324 -17.470 35.058  1.00 36.31 ? 108  THR A CA    1 
ATOM   841   C  C     . THR A  1 109 ? -15.393 -18.531 34.813  1.00 36.52 ? 108  THR A C     1 
ATOM   842   O  O     . THR A  1 109 ? -15.170 -19.715 35.069  1.00 36.48 ? 108  THR A O     1 
ATOM   843   C  CB    . THR A  1 109 ? -13.299 -17.532 33.933  1.00 36.96 ? 108  THR A CB    1 
ATOM   844   O  OG1   . THR A  1 109 ? -12.307 -16.520 34.135  1.00 34.76 ? 108  THR A OG1   1 
ATOM   845   C  CG2   . THR A  1 109 ? -13.982 -17.347 32.552  1.00 36.52 ? 108  THR A CG2   1 
ATOM   846   N  N     . PRO A  1 110 ? -16.569 -18.124 34.324  1.00 36.24 ? 109  PRO A N     1 
ATOM   847   C  CA    . PRO A  1 110 ? -17.595 -19.159 34.088  1.00 36.29 ? 109  PRO A CA    1 
ATOM   848   C  C     . PRO A  1 110 ? -17.221 -20.195 33.003  1.00 36.49 ? 109  PRO A C     1 
ATOM   849   O  O     . PRO A  1 110 ? -16.565 -19.867 32.012  1.00 35.87 ? 109  PRO A O     1 
ATOM   850   C  CB    . PRO A  1 110 ? -18.826 -18.343 33.679  1.00 35.93 ? 109  PRO A CB    1 
ATOM   851   C  CG    . PRO A  1 110 ? -18.266 -17.064 33.121  1.00 35.44 ? 109  PRO A CG    1 
ATOM   852   C  CD    . PRO A  1 110 ? -17.059 -16.774 33.973  1.00 36.51 ? 109  PRO A CD    1 
ATOM   853   N  N     . ILE A  1 111 ? -17.619 -21.441 33.242  1.00 36.55 ? 110  ILE A N     1 
ATOM   854   C  CA    . ILE A  1 111 ? -17.374 -22.566 32.347  1.00 36.64 ? 110  ILE A CA    1 
ATOM   855   C  C     . ILE A  1 111 ? -18.719 -23.090 31.850  1.00 36.70 ? 110  ILE A C     1 
ATOM   856   O  O     . ILE A  1 111 ? -19.623 -23.284 32.659  1.00 37.20 ? 110  ILE A O     1 
ATOM   857   C  CB    . ILE A  1 111 ? -16.684 -23.739 33.098  1.00 36.56 ? 110  ILE A CB    1 
ATOM   858   C  CG1   . ILE A  1 111 ? -15.358 -23.288 33.704  1.00 36.54 ? 110  ILE A CG1   1 
ATOM   859   C  CG2   . ILE A  1 111 ? -16.504 -24.950 32.165  1.00 36.05 ? 110  ILE A CG2   1 
ATOM   860   C  CD1   . ILE A  1 111 ? -14.660 -24.358 34.604  1.00 36.44 ? 110  ILE A CD1   1 
ATOM   861   N  N     . LEU A  1 112 ? -18.875 -23.241 30.528  1.00 36.82 ? 111  LEU A N     1 
ATOM   862   C  CA    . LEU A  1 112 ? -19.995 -24.005 29.952  1.00 36.55 ? 111  LEU A CA    1 
ATOM   863   C  C     . LEU A  1 112 ? -19.453 -25.371 29.539  1.00 36.31 ? 111  LEU A C     1 
ATOM   864   O  O     . LEU A  1 112 ? -18.414 -25.456 28.900  1.00 35.86 ? 111  LEU A O     1 
ATOM   865   C  CB    . LEU A  1 112 ? -20.628 -23.306 28.748  1.00 36.69 ? 111  LEU A CB    1 
ATOM   866   C  CG    . LEU A  1 112 ? -21.730 -22.248 28.983  1.00 36.97 ? 111  LEU A CG    1 
ATOM   867   C  CD1   . LEU A  1 112 ? -21.168 -21.003 29.613  1.00 38.74 ? 111  LEU A CD1   1 
ATOM   868   C  CD2   . LEU A  1 112 ? -22.432 -21.881 27.679  1.00 36.08 ? 111  LEU A CD2   1 
ATOM   869   N  N     . LEU A  1 113 ? -20.132 -26.438 29.950  1.00 36.27 ? 112  LEU A N     1 
ATOM   870   C  CA    . LEU A  1 113 ? -19.782 -27.798 29.509  1.00 35.65 ? 112  LEU A CA    1 
ATOM   871   C  C     . LEU A  1 113 ? -20.546 -28.138 28.239  1.00 35.73 ? 112  LEU A C     1 
ATOM   872   O  O     . LEU A  1 113 ? -21.786 -28.059 28.225  1.00 36.60 ? 112  LEU A O     1 
ATOM   873   C  CB    . LEU A  1 113 ? -20.127 -28.817 30.588  1.00 35.40 ? 112  LEU A CB    1 
ATOM   874   C  CG    . LEU A  1 113 ? -19.586 -30.225 30.302  1.00 36.36 ? 112  LEU A CG    1 
ATOM   875   C  CD1   . LEU A  1 113 ? -18.053 -30.194 30.164  1.00 32.99 ? 112  LEU A CD1   1 
ATOM   876   C  CD2   . LEU A  1 113 ? -19.998 -31.219 31.367  1.00 34.91 ? 112  LEU A CD2   1 
ATOM   877   N  N     . VAL A  1 114 ? -19.820 -28.507 27.183  1.00 35.36 ? 113  VAL A N     1 
ATOM   878   C  CA    . VAL A  1 114 ? -20.397 -28.727 25.879  1.00 35.61 ? 113  VAL A CA    1 
ATOM   879   C  C     . VAL A  1 114 ? -20.123 -30.151 25.378  1.00 36.23 ? 113  VAL A C     1 
ATOM   880   O  O     . VAL A  1 114 ? -18.973 -30.540 25.147  1.00 36.21 ? 113  VAL A O     1 
ATOM   881   C  CB    . VAL A  1 114 ? -19.896 -27.680 24.828  1.00 35.67 ? 113  VAL A CB    1 
ATOM   882   C  CG1   . VAL A  1 114 ? -20.494 -27.982 23.436  1.00 36.02 ? 113  VAL A CG1   1 
ATOM   883   C  CG2   . VAL A  1 114 ? -20.287 -26.222 25.241  1.00 35.12 ? 113  VAL A CG2   1 
ATOM   884   N  N     . GLY A  1 115 ? -21.199 -30.907 25.182  1.00 36.25 ? 114  GLY A N     1 
ATOM   885   C  CA    . GLY A  1 115 ? -21.114 -32.223 24.552  1.00 36.23 ? 114  GLY A CA    1 
ATOM   886   C  C     . GLY A  1 115 ? -21.343 -32.106 23.057  1.00 35.69 ? 114  GLY A C     1 
ATOM   887   O  O     . GLY A  1 115 ? -22.366 -31.595 22.616  1.00 35.37 ? 114  GLY A O     1 
ATOM   888   N  N     . THR A  1 116 ? -20.370 -32.581 22.288  1.00 35.01 ? 115  THR A N     1 
ATOM   889   C  CA    . THR A  1 116 ? -20.346 -32.434 20.852  1.00 34.59 ? 115  THR A CA    1 
ATOM   890   C  C     . THR A  1 116 ? -20.710 -33.747 20.144  1.00 34.71 ? 115  THR A C     1 
ATOM   891   O  O     . THR A  1 116 ? -20.770 -34.806 20.769  1.00 34.02 ? 115  THR A O     1 
ATOM   892   C  CB    . THR A  1 116 ? -18.916 -32.032 20.382  1.00 34.63 ? 115  THR A CB    1 
ATOM   893   O  OG1   . THR A  1 116 ? -18.000 -33.068 20.739  1.00 32.09 ? 115  THR A OG1   1 
ATOM   894   C  CG2   . THR A  1 116 ? -18.494 -30.706 21.001  1.00 34.07 ? 115  THR A CG2   1 
ATOM   895   N  N     . LYS A  1 117 ? -20.897 -33.665 18.825  1.00 34.95 ? 116  LYS A N     1 
ATOM   896   C  CA    . LYS A  1 117 ? -21.175 -34.846 17.978  1.00 34.68 ? 116  LYS A CA    1 
ATOM   897   C  C     . LYS A  1 117 ? -22.485 -35.539 18.362  1.00 35.21 ? 116  LYS A C     1 
ATOM   898   O  O     . LYS A  1 117 ? -22.568 -36.771 18.372  1.00 35.99 ? 116  LYS A O     1 
ATOM   899   C  CB    . LYS A  1 117 ? -20.018 -35.848 18.036  1.00 35.03 ? 116  LYS A CB    1 
ATOM   900   C  CG    . LYS A  1 117 ? -18.658 -35.215 17.707  1.00 33.63 ? 116  LYS A CG    1 
ATOM   901   C  CD    . LYS A  1 117 ? -17.590 -36.259 17.415  1.00 34.06 ? 116  LYS A CD    1 
ATOM   902   C  CE    . LYS A  1 117 ? -16.248 -35.614 17.116  1.00 32.85 ? 116  LYS A CE    1 
ATOM   903   N  NZ    . LYS A  1 117 ? -15.214 -36.651 16.803  1.00 33.55 ? 116  LYS A NZ    1 
ATOM   904   N  N     . LEU A  1 118 ? -23.501 -34.749 18.668  1.00 35.39 ? 117  LEU A N     1 
ATOM   905   C  CA    . LEU A  1 118 ? -24.813 -35.300 19.079  1.00 35.69 ? 117  LEU A CA    1 
ATOM   906   C  C     . LEU A  1 118 ? -25.458 -36.185 17.991  1.00 36.22 ? 117  LEU A C     1 
ATOM   907   O  O     . LEU A  1 118 ? -26.225 -37.128 18.283  1.00 36.31 ? 117  LEU A O     1 
ATOM   908   C  CB    . LEU A  1 118 ? -25.749 -34.160 19.474  1.00 35.26 ? 117  LEU A CB    1 
ATOM   909   C  CG    . LEU A  1 118 ? -27.236 -34.448 19.844  1.00 36.02 ? 117  LEU A CG    1 
ATOM   910   C  CD1   . LEU A  1 118 ? -27.402 -35.296 21.107  1.00 33.84 ? 117  LEU A CD1   1 
ATOM   911   C  CD2   . LEU A  1 118 ? -28.007 -33.130 19.984  1.00 35.27 ? 117  LEU A CD2   1 
ATOM   912   N  N     . ASP A  1 119 ? -25.130 -35.891 16.739  1.00 36.73 ? 118  ASP A N     1 
ATOM   913   C  CA    . ASP A  1 119 ? -25.625 -36.672 15.608  1.00 37.00 ? 118  ASP A CA    1 
ATOM   914   C  C     . ASP A  1 119 ? -25.143 -38.122 15.650  1.00 37.16 ? 118  ASP A C     1 
ATOM   915   O  O     . ASP A  1 119 ? -25.747 -38.973 15.031  1.00 36.47 ? 118  ASP A O     1 
ATOM   916   C  CB    . ASP A  1 119 ? -25.221 -36.027 14.272  1.00 36.79 ? 118  ASP A CB    1 
ATOM   917   C  CG    . ASP A  1 119 ? -23.706 -35.887 14.105  1.00 37.31 ? 118  ASP A CG    1 
ATOM   918   O  OD1   . ASP A  1 119 ? -23.101 -34.993 14.745  1.00 36.86 ? 118  ASP A OD1   1 
ATOM   919   O  OD2   . ASP A  1 119 ? -23.128 -36.659 13.313  1.00 35.53 ? 118  ASP A OD2   1 
ATOM   920   N  N     . LEU A  1 120 ? -24.066 -38.391 16.392  1.00 37.64 ? 119  LEU A N     1 
ATOM   921   C  CA    . LEU A  1 120 ? -23.488 -39.739 16.466  1.00 37.90 ? 119  LEU A CA    1 
ATOM   922   C  C     . LEU A  1 120 ? -24.008 -40.573 17.641  1.00 38.46 ? 119  LEU A C     1 
ATOM   923   O  O     . LEU A  1 120 ? -23.839 -41.776 17.633  1.00 38.45 ? 119  LEU A O     1 
ATOM   924   C  CB    . LEU A  1 120 ? -21.958 -39.662 16.539  1.00 37.80 ? 119  LEU A CB    1 
ATOM   925   C  CG    . LEU A  1 120 ? -21.163 -39.158 15.325  1.00 37.67 ? 119  LEU A CG    1 
ATOM   926   C  CD1   . LEU A  1 120 ? -19.650 -39.100 15.657  1.00 37.59 ? 119  LEU A CD1   1 
ATOM   927   C  CD2   . LEU A  1 120 ? -21.398 -40.034 14.104  1.00 35.89 ? 119  LEU A CD2   1 
ATOM   928   N  N     . ARG A  1 121 ? -24.633 -39.956 18.643  1.00 38.86 ? 120  ARG A N     1 
ATOM   929   C  CA    . ARG A  1 121 ? -25.128 -40.708 19.808  1.00 39.16 ? 120  ARG A CA    1 
ATOM   930   C  C     . ARG A  1 121 ? -26.114 -41.804 19.438  1.00 39.59 ? 120  ARG A C     1 
ATOM   931   O  O     . ARG A  1 121 ? -26.145 -42.841 20.095  1.00 38.64 ? 120  ARG A O     1 
ATOM   932   C  CB    . ARG A  1 121 ? -25.776 -39.799 20.855  1.00 39.18 ? 120  ARG A CB    1 
ATOM   933   C  CG    . ARG A  1 121 ? -26.170 -40.556 22.138  1.00 38.49 ? 120  ARG A CG    1 
ATOM   934   C  CD    . ARG A  1 121 ? -26.136 -39.655 23.355  1.00 37.71 ? 120  ARG A CD    1 
ATOM   935   N  NE    . ARG A  1 121 ? -27.193 -38.645 23.284  1.00 35.05 ? 120  ARG A NE    1 
ATOM   936   C  CZ    . ARG A  1 121 ? -27.271 -37.578 24.068  1.00 34.21 ? 120  ARG A CZ    1 
ATOM   937   N  NH1   . ARG A  1 121 ? -26.386 -37.359 25.020  1.00 34.15 ? 120  ARG A NH1   1 
ATOM   938   N  NH2   . ARG A  1 121 ? -28.247 -36.720 23.883  1.00 35.97 ? 120  ARG A NH2   1 
ATOM   939   N  N     . ASP A  1 122 ? -26.888 -41.590 18.382  1.00 40.66 ? 121  ASP A N     1 
ATOM   940   C  CA    . ASP A  1 122 ? -27.783 -42.635 17.873  1.00 42.15 ? 121  ASP A CA    1 
ATOM   941   C  C     . ASP A  1 122 ? -27.253 -43.403 16.660  1.00 42.24 ? 121  ASP A C     1 
ATOM   942   O  O     . ASP A  1 122 ? -27.929 -44.253 16.127  1.00 43.39 ? 121  ASP A O     1 
ATOM   943   C  CB    . ASP A  1 122 ? -29.164 -42.046 17.556  1.00 42.72 ? 121  ASP A CB    1 
ATOM   944   C  CG    . ASP A  1 122 ? -29.786 -41.351 18.757  1.00 44.45 ? 121  ASP A CG    1 
ATOM   945   O  OD1   . ASP A  1 122 ? -30.091 -42.038 19.754  1.00 47.26 ? 121  ASP A OD1   1 
ATOM   946   O  OD2   . ASP A  1 122 ? -29.949 -40.108 18.713  1.00 47.81 ? 121  ASP A OD2   1 
ATOM   947   N  N     . ASP A  1 123 ? -26.048 -43.120 16.216  1.00 42.89 ? 122  ASP A N     1 
ATOM   948   C  CA    . ASP A  1 123 ? -25.466 -43.869 15.101  1.00 42.99 ? 122  ASP A CA    1 
ATOM   949   C  C     . ASP A  1 123 ? -25.158 -45.329 15.483  1.00 42.89 ? 122  ASP A C     1 
ATOM   950   O  O     . ASP A  1 123 ? -24.210 -45.598 16.213  1.00 42.36 ? 122  ASP A O     1 
ATOM   951   C  CB    . ASP A  1 123 ? -24.196 -43.186 14.640  1.00 42.95 ? 122  ASP A CB    1 
ATOM   952   C  CG    . ASP A  1 123 ? -23.603 -43.846 13.447  1.00 43.54 ? 122  ASP A CG    1 
ATOM   953   O  OD1   . ASP A  1 123 ? -24.251 -43.799 12.386  1.00 45.53 ? 122  ASP A OD1   1 
ATOM   954   O  OD2   . ASP A  1 123 ? -22.496 -44.406 13.573  1.00 44.28 ? 122  ASP A OD2   1 
ATOM   955   N  N     . LYS A  1 124 ? -25.956 -46.263 14.966  1.00 43.05 ? 123  LYS A N     1 
ATOM   956   C  CA    . LYS A  1 124 ? -25.852 -47.685 15.341  1.00 42.93 ? 123  LYS A CA    1 
ATOM   957   C  C     . LYS A  1 124 ? -24.408 -48.239 15.249  1.00 42.93 ? 123  LYS A C     1 
ATOM   958   O  O     . LYS A  1 124 ? -23.961 -48.952 16.141  1.00 43.03 ? 123  LYS A O     1 
ATOM   959   C  CB    . LYS A  1 124 ? -26.841 -48.531 14.523  1.00 43.24 ? 123  LYS A CB    1 
ATOM   960   N  N     . ASP A  1 125 ? -23.670 -47.874 14.203  1.00 42.69 ? 124  ASP A N     1 
ATOM   961   C  CA    . ASP A  1 125 ? -22.287 -48.346 14.041  1.00 42.54 ? 124  ASP A CA    1 
ATOM   962   C  C     . ASP A  1 125 ? -21.368 -47.820 15.126  1.00 42.36 ? 124  ASP A C     1 
ATOM   963   O  O     . ASP A  1 125 ? -20.467 -48.519 15.597  1.00 42.58 ? 124  ASP A O     1 
ATOM   964   C  CB    . ASP A  1 125 ? -21.710 -47.902 12.692  1.00 43.08 ? 124  ASP A CB    1 
ATOM   965   N  N     . THR A  1 126 ? -21.558 -46.555 15.477  1.00 41.90 ? 125  THR A N     1 
ATOM   966   C  CA    . THR A  1 126 ? -20.821 -45.954 16.572  1.00 40.99 ? 125  THR A CA    1 
ATOM   967   C  C     . THR A  1 126 ? -21.167 -46.679 17.870  1.00 40.38 ? 125  THR A C     1 
ATOM   968   O  O     . THR A  1 126 ? -20.281 -47.009 18.649  1.00 39.72 ? 125  THR A O     1 
ATOM   969   C  CB    . THR A  1 126 ? -21.136 -44.437 16.683  1.00 41.11 ? 125  THR A CB    1 
ATOM   970   O  OG1   . THR A  1 126 ? -20.721 -43.783 15.472  1.00 41.17 ? 125  THR A OG1   1 
ATOM   971   C  CG2   . THR A  1 126 ? -20.396 -43.817 17.859  1.00 40.54 ? 125  THR A CG2   1 
ATOM   972   N  N     . ILE A  1 127 ? -22.457 -46.912 18.105  1.00 40.29 ? 126  ILE A N     1 
ATOM   973   C  CA    . ILE A  1 127 ? -22.887 -47.592 19.315  1.00 40.32 ? 126  ILE A CA    1 
ATOM   974   C  C     . ILE A  1 127 ? -22.210 -48.972 19.374  1.00 40.50 ? 126  ILE A C     1 
ATOM   975   O  O     . ILE A  1 127 ? -21.610 -49.327 20.385  1.00 40.60 ? 126  ILE A O     1 
ATOM   976   C  CB    . ILE A  1 127 ? -24.431 -47.698 19.397  1.00 40.49 ? 126  ILE A CB    1 
ATOM   977   C  CG1   . ILE A  1 127 ? -25.052 -46.322 19.695  1.00 39.57 ? 126  ILE A CG1   1 
ATOM   978   C  CG2   . ILE A  1 127 ? -24.873 -48.714 20.469  1.00 40.56 ? 126  ILE A CG2   1 
ATOM   979   C  CD1   . ILE A  1 127 ? -26.512 -46.223 19.308  1.00 38.17 ? 126  ILE A CD1   1 
ATOM   980   N  N     . GLU A  1 128 ? -22.253 -49.707 18.268  1.00 40.79 ? 127  GLU A N     1 
ATOM   981   C  CA    . GLU A  1 128 ? -21.677 -51.062 18.207  1.00 41.11 ? 127  GLU A CA    1 
ATOM   982   C  C     . GLU A  1 128 ? -20.181 -51.084 18.524  1.00 41.32 ? 127  GLU A C     1 
ATOM   983   O  O     . GLU A  1 128 ? -19.733 -51.899 19.332  1.00 41.12 ? 127  GLU A O     1 
ATOM   984   C  CB    . GLU A  1 128 ? -21.954 -51.723 16.846  1.00 41.19 ? 127  GLU A CB    1 
ATOM   985   N  N     . ARG A  1 129 ? -19.418 -50.180 17.908  1.00 41.57 ? 128  ARG A N     1 
ATOM   986   C  CA    . ARG A  1 129 ? -17.963 -50.140 18.100  1.00 41.71 ? 128  ARG A CA    1 
ATOM   987   C  C     . ARG A  1 129 ? -17.600 -49.652 19.501  1.00 41.97 ? 128  ARG A C     1 
ATOM   988   O  O     . ARG A  1 129 ? -16.602 -50.096 20.070  1.00 41.67 ? 128  ARG A O     1 
ATOM   989   C  CB    . ARG A  1 129 ? -17.275 -49.269 17.030  1.00 42.06 ? 128  ARG A CB    1 
ATOM   990   N  N     . LEU A  1 130 ? -18.396 -48.736 20.057  1.00 41.88 ? 129  LEU A N     1 
ATOM   991   C  CA    . LEU A  1 130 ? -18.300 -48.430 21.494  1.00 41.96 ? 129  LEU A CA    1 
ATOM   992   C  C     . LEU A  1 130 ? -18.552 -49.709 22.341  1.00 42.33 ? 129  LEU A C     1 
ATOM   993   O  O     . LEU A  1 130 ? -17.764 -50.049 23.225  1.00 41.90 ? 129  LEU A O     1 
ATOM   994   C  CB    . LEU A  1 130 ? -19.258 -47.287 21.891  1.00 41.91 ? 129  LEU A CB    1 
ATOM   995   C  CG    . LEU A  1 130 ? -18.757 -45.857 21.567  1.00 41.49 ? 129  LEU A CG    1 
ATOM   996   C  CD1   . LEU A  1 130 ? -19.867 -44.789 21.574  1.00 41.40 ? 129  LEU A CD1   1 
ATOM   997   C  CD2   . LEU A  1 130 ? -17.651 -45.441 22.522  1.00 41.99 ? 129  LEU A CD2   1 
ATOM   998   N  N     . ARG A  1 131 ? -19.644 -50.414 22.060  1.00 42.88 ? 130  ARG A N     1 
ATOM   999   C  CA    . ARG A  1 131 ? -19.984 -51.595 22.821  1.00 43.53 ? 130  ARG A CA    1 
ATOM   1000  C  C     . ARG A  1 131 ? -18.849 -52.630 22.739  1.00 43.58 ? 130  ARG A C     1 
ATOM   1001  O  O     . ARG A  1 131 ? -18.549 -53.282 23.737  1.00 42.93 ? 130  ARG A O     1 
ATOM   1002  C  CB    . ARG A  1 131 ? -21.287 -52.206 22.333  1.00 43.44 ? 130  ARG A CB    1 
ATOM   1003  C  CG    . ARG A  1 131 ? -21.757 -53.378 23.204  1.00 44.85 ? 130  ARG A CG    1 
ATOM   1004  C  CD    . ARG A  1 131 ? -22.918 -54.163 22.608  1.00 45.80 ? 130  ARG A CD    1 
ATOM   1005  N  NE    . ARG A  1 131 ? -24.049 -53.293 22.287  1.00 49.31 ? 130  ARG A NE    1 
ATOM   1006  C  CZ    . ARG A  1 131 ? -24.418 -52.917 21.058  1.00 51.48 ? 130  ARG A CZ    1 
ATOM   1007  N  NH1   . ARG A  1 131 ? -23.761 -53.343 19.970  1.00 52.70 ? 130  ARG A NH1   1 
ATOM   1008  N  NH2   . ARG A  1 131 ? -25.469 -52.107 20.913  1.00 50.48 ? 130  ARG A NH2   1 
ATOM   1009  N  N     . ASP A  1 132 ? -18.224 -52.749 21.561  1.00 43.98 ? 131  ASP A N     1 
ATOM   1010  C  CA    . ASP A  1 132 ? -17.082 -53.653 21.338  1.00 44.67 ? 131  ASP A CA    1 
ATOM   1011  C  C     . ASP A  1 132 ? -15.913 -53.356 22.273  1.00 44.36 ? 131  ASP A C     1 
ATOM   1012  O  O     . ASP A  1 132 ? -15.176 -54.264 22.650  1.00 43.90 ? 131  ASP A O     1 
ATOM   1013  C  CB    . ASP A  1 132 ? -16.555 -53.536 19.895  1.00 45.48 ? 131  ASP A CB    1 
ATOM   1014  C  CG    . ASP A  1 132 ? -17.289 -54.432 18.898  1.00 47.99 ? 131  ASP A CG    1 
ATOM   1015  O  OD1   . ASP A  1 132 ? -18.388 -54.968 19.216  1.00 51.08 ? 131  ASP A OD1   1 
ATOM   1016  O  OD2   . ASP A  1 132 ? -16.749 -54.577 17.769  1.00 50.69 ? 131  ASP A OD2   1 
ATOM   1017  N  N     . LYS A  1 133 ? -15.728 -52.083 22.619  1.00 43.86 ? 132  LYS A N     1 
ATOM   1018  C  CA    . LYS A  1 133 ? -14.646 -51.681 23.525  1.00 43.81 ? 132  LYS A CA    1 
ATOM   1019  C  C     . LYS A  1 133 ? -15.130 -51.496 24.975  1.00 43.54 ? 132  LYS A C     1 
ATOM   1020  O  O     . LYS A  1 133 ? -14.432 -50.884 25.792  1.00 43.87 ? 132  LYS A O     1 
ATOM   1021  C  CB    . LYS A  1 133 ? -13.963 -50.402 23.014  1.00 44.25 ? 132  LYS A CB    1 
ATOM   1022  C  CG    . LYS A  1 133 ? -12.961 -50.623 21.864  1.00 44.06 ? 132  LYS A CG    1 
ATOM   1023  N  N     . LYS A  1 134 ? -16.300 -52.054 25.297  1.00 42.64 ? 133  LYS A N     1 
ATOM   1024  C  CA    . LYS A  1 134 ? -16.877 -51.974 26.643  1.00 42.09 ? 133  LYS A CA    1 
ATOM   1025  C  C     . LYS A  1 134 ? -17.285 -50.533 27.008  1.00 41.34 ? 133  LYS A C     1 
ATOM   1026  O  O     . LYS A  1 134 ? -17.162 -50.119 28.156  1.00 41.19 ? 133  LYS A O     1 
ATOM   1027  C  CB    . LYS A  1 134 ? -15.917 -52.573 27.690  1.00 41.58 ? 133  LYS A CB    1 
ATOM   1028  N  N     . LEU A  1 135 ? -17.798 -49.797 26.026  1.00 40.76 ? 134  LEU A N     1 
ATOM   1029  C  CA    . LEU A  1 135 ? -18.159 -48.388 26.200  1.00 40.22 ? 134  LEU A CA    1 
ATOM   1030  C  C     . LEU A  1 135 ? -19.571 -48.080 25.698  1.00 39.47 ? 134  LEU A C     1 
ATOM   1031  O  O     . LEU A  1 135 ? -20.182 -48.853 24.952  1.00 38.50 ? 134  LEU A O     1 
ATOM   1032  C  CB    . LEU A  1 135 ? -17.165 -47.490 25.455  1.00 40.30 ? 134  LEU A CB    1 
ATOM   1033  C  CG    . LEU A  1 135 ? -15.691 -47.604 25.862  1.00 41.54 ? 134  LEU A CG    1 
ATOM   1034  C  CD1   . LEU A  1 135 ? -14.779 -46.879 24.871  1.00 42.05 ? 134  LEU A CD1   1 
ATOM   1035  C  CD2   . LEU A  1 135 ? -15.484 -47.092 27.273  1.00 42.17 ? 134  LEU A CD2   1 
ATOM   1036  N  N     . ALA A  1 136 ? -20.080 -46.923 26.102  1.00 38.79 ? 135  ALA A N     1 
ATOM   1037  C  CA    . ALA A  1 136 ? -21.343 -46.447 25.581  1.00 38.11 ? 135  ALA A CA    1 
ATOM   1038  C  C     . ALA A  1 136 ? -21.295 -44.941 25.447  1.00 37.84 ? 135  ALA A C     1 
ATOM   1039  O  O     . ALA A  1 136 ? -20.501 -44.276 26.122  1.00 37.70 ? 135  ALA A O     1 
ATOM   1040  C  CB    . ALA A  1 136 ? -22.472 -46.863 26.489  1.00 38.10 ? 135  ALA A CB    1 
ATOM   1041  N  N     . PRO A  1 137 ? -22.164 -44.385 24.592  1.00 37.31 ? 136  PRO A N     1 
ATOM   1042  C  CA    . PRO A  1 137 ? -22.189 -42.944 24.493  1.00 37.13 ? 136  PRO A CA    1 
ATOM   1043  C  C     . PRO A  1 137 ? -22.632 -42.306 25.805  1.00 36.76 ? 136  PRO A C     1 
ATOM   1044  O  O     . PRO A  1 137 ? -23.375 -42.914 26.582  1.00 36.79 ? 136  PRO A O     1 
ATOM   1045  C  CB    . PRO A  1 137 ? -23.212 -42.682 23.383  1.00 36.92 ? 136  PRO A CB    1 
ATOM   1046  C  CG    . PRO A  1 137 ? -23.384 -43.986 22.690  1.00 37.57 ? 136  PRO A CG    1 
ATOM   1047  C  CD    . PRO A  1 137 ? -23.148 -45.020 23.701  1.00 37.12 ? 136  PRO A CD    1 
ATOM   1048  N  N     . ILE A  1 138 ? -22.164 -41.087 26.037  1.00 36.41 ? 137  ILE A N     1 
ATOM   1049  C  CA    . ILE A  1 138 ? -22.520 -40.343 27.234  1.00 36.17 ? 137  ILE A CA    1 
ATOM   1050  C  C     . ILE A  1 138 ? -23.946 -39.835 27.045  1.00 35.94 ? 137  ILE A C     1 
ATOM   1051  O  O     . ILE A  1 138 ? -24.268 -39.318 25.989  1.00 36.44 ? 137  ILE A O     1 
ATOM   1052  C  CB    . ILE A  1 138 ? -21.564 -39.155 27.460  1.00 35.93 ? 137  ILE A CB    1 
ATOM   1053  C  CG1   . ILE A  1 138 ? -20.098 -39.639 27.504  1.00 35.28 ? 137  ILE A CG1   1 
ATOM   1054  C  CG2   . ILE A  1 138 ? -21.945 -38.399 28.717  1.00 34.91 ? 137  ILE A CG2   1 
ATOM   1055  C  CD1   . ILE A  1 138 ? -19.851 -40.734 28.532  1.00 34.87 ? 137  ILE A CD1   1 
ATOM   1056  N  N     . THR A  1 139 ? -24.790 -39.993 28.059  1.00 35.86 ? 138  THR A N     1 
ATOM   1057  C  CA    . THR A  1 139 ? -26.184 -39.530 27.985  1.00 35.81 ? 138  THR A CA    1 
ATOM   1058  C  C     . THR A  1 139 ? -26.337 -38.118 28.581  1.00 36.64 ? 138  THR A C     1 
ATOM   1059  O  O     . THR A  1 139 ? -25.446 -37.629 29.290  1.00 37.10 ? 138  THR A O     1 
ATOM   1060  C  CB    . THR A  1 139 ? -27.099 -40.442 28.775  1.00 35.41 ? 138  THR A CB    1 
ATOM   1061  O  OG1   . THR A  1 139 ? -26.697 -40.413 30.144  1.00 34.35 ? 138  THR A OG1   1 
ATOM   1062  C  CG2   . THR A  1 139 ? -27.071 -41.873 28.257  1.00 34.04 ? 138  THR A CG2   1 
ATOM   1063  N  N     . TYR A  1 140 ? -27.490 -37.493 28.341  1.00 37.15 ? 139  TYR A N     1 
ATOM   1064  C  CA    . TYR A  1 140 ? -27.754 -36.146 28.881  1.00 37.31 ? 139  TYR A CA    1 
ATOM   1065  C  C     . TYR A  1 140 ? -27.562 -36.091 30.415  1.00 37.20 ? 139  TYR A C     1 
ATOM   1066  O  O     . TYR A  1 140 ? -26.755 -35.284 30.890  1.00 38.63 ? 139  TYR A O     1 
ATOM   1067  C  CB    . TYR A  1 140 ? -29.123 -35.583 28.426  1.00 37.22 ? 139  TYR A CB    1 
ATOM   1068  C  CG    . TYR A  1 140 ? -29.343 -34.154 28.885  1.00 37.98 ? 139  TYR A CG    1 
ATOM   1069  C  CD1   . TYR A  1 140 ? -29.902 -33.875 30.124  1.00 38.63 ? 139  TYR A CD1   1 
ATOM   1070  C  CD2   . TYR A  1 140 ? -28.962 -33.079 28.088  1.00 38.05 ? 139  TYR A CD2   1 
ATOM   1071  C  CE1   . TYR A  1 140 ? -30.086 -32.559 30.548  1.00 39.04 ? 139  TYR A CE1   1 
ATOM   1072  C  CE2   . TYR A  1 140 ? -29.136 -31.771 28.502  1.00 38.36 ? 139  TYR A CE2   1 
ATOM   1073  C  CZ    . TYR A  1 140 ? -29.689 -31.516 29.727  1.00 38.50 ? 139  TYR A CZ    1 
ATOM   1074  O  OH    . TYR A  1 140 ? -29.848 -30.218 30.140  1.00 39.92 ? 139  TYR A OH    1 
ATOM   1075  N  N     . PRO A  1 141 ? -28.260 -36.952 31.191  1.00 36.95 ? 140  PRO A N     1 
ATOM   1076  C  CA    . PRO A  1 141 ? -28.044 -37.016 32.640  1.00 36.53 ? 140  PRO A CA    1 
ATOM   1077  C  C     . PRO A  1 141 ? -26.590 -37.163 33.092  1.00 36.43 ? 140  PRO A C     1 
ATOM   1078  O  O     . PRO A  1 141 ? -26.200 -36.566 34.082  1.00 36.41 ? 140  PRO A O     1 
ATOM   1079  C  CB    . PRO A  1 141 ? -28.818 -38.271 33.049  1.00 36.85 ? 140  PRO A CB    1 
ATOM   1080  C  CG    . PRO A  1 141 ? -29.876 -38.397 32.039  1.00 37.74 ? 140  PRO A CG    1 
ATOM   1081  C  CD    . PRO A  1 141 ? -29.298 -37.913 30.765  1.00 37.06 ? 140  PRO A CD    1 
ATOM   1082  N  N     . GLN A  1 142 ? -25.816 -37.981 32.396  1.00 35.82 ? 141  GLN A N     1 
ATOM   1083  C  CA    . GLN A  1 142 ? -24.398 -38.114 32.702  1.00 36.38 ? 141  GLN A CA    1 
ATOM   1084  C  C     . GLN A  1 142 ? -23.662 -36.794 32.443  1.00 35.65 ? 141  GLN A C     1 
ATOM   1085  O  O     . GLN A  1 142 ? -22.936 -36.303 33.286  1.00 35.06 ? 141  GLN A O     1 
ATOM   1086  C  CB    . GLN A  1 142 ? -23.795 -39.277 31.900  1.00 36.18 ? 141  GLN A CB    1 
ATOM   1087  C  CG    . GLN A  1 142 ? -24.332 -40.640 32.330  1.00 37.82 ? 141  GLN A CG    1 
ATOM   1088  C  CD    . GLN A  1 142 ? -24.025 -41.785 31.354  1.00 38.43 ? 141  GLN A CD    1 
ATOM   1089  O  OE1   . GLN A  1 142 ? -23.410 -41.598 30.307  1.00 40.14 ? 141  GLN A OE1   1 
ATOM   1090  N  NE2   . GLN A  1 142 ? -24.474 -42.982 31.712  1.00 40.59 ? 141  GLN A NE2   1 
ATOM   1091  N  N     . GLY A  1 143 ? -23.880 -36.212 31.276  1.00 35.96 ? 142  GLY A N     1 
ATOM   1092  C  CA    . GLY A  1 143 ? -23.337 -34.894 30.966  1.00 36.17 ? 142  GLY A CA    1 
ATOM   1093  C  C     . GLY A  1 143 ? -23.703 -33.845 31.993  1.00 36.40 ? 142  GLY A C     1 
ATOM   1094  O  O     . GLY A  1 143 ? -22.840 -33.086 32.439  1.00 36.16 ? 142  GLY A O     1 
ATOM   1095  N  N     . LEU A  1 144 ? -24.985 -33.817 32.387  1.00 36.88 ? 143  LEU A N     1 
ATOM   1096  C  CA    . LEU A  1 144 ? -25.468 -32.834 33.361  1.00 36.79 ? 143  LEU A CA    1 
ATOM   1097  C  C     . LEU A  1 144 ? -24.828 -33.045 34.742  1.00 37.34 ? 143  LEU A C     1 
ATOM   1098  O  O     . LEU A  1 144 ? -24.556 -32.070 35.459  1.00 37.39 ? 143  LEU A O     1 
ATOM   1099  C  CB    . LEU A  1 144 ? -26.995 -32.893 33.481  1.00 36.40 ? 143  LEU A CB    1 
ATOM   1100  C  CG    . LEU A  1 144 ? -27.710 -31.858 34.369  1.00 37.45 ? 143  LEU A CG    1 
ATOM   1101  C  CD1   . LEU A  1 144 ? -27.424 -30.414 33.907  1.00 37.97 ? 143  LEU A CD1   1 
ATOM   1102  C  CD2   . LEU A  1 144 ? -29.254 -32.117 34.420  1.00 36.30 ? 143  LEU A CD2   1 
ATOM   1103  N  N     . ALA A  1 145 ? -24.620 -34.309 35.121  1.00 37.27 ? 144  ALA A N     1 
ATOM   1104  C  CA    . ALA A  1 145 ? -23.972 -34.620 36.390  1.00 37.89 ? 144  ALA A CA    1 
ATOM   1105  C  C     . ALA A  1 145 ? -22.533 -34.107 36.386  1.00 37.76 ? 144  ALA A C     1 
ATOM   1106  O  O     . ALA A  1 145 ? -22.087 -33.523 37.349  1.00 37.89 ? 144  ALA A O     1 
ATOM   1107  C  CB    . ALA A  1 145 ? -24.012 -36.142 36.687  1.00 37.68 ? 144  ALA A CB    1 
ATOM   1108  N  N     . MET A  1 146 ? -21.812 -34.337 35.300  1.00 38.60 ? 145  MET A N     1 
ATOM   1109  C  CA    . MET A  1 146 ? -20.441 -33.831 35.172  1.00 39.24 ? 145  MET A CA    1 
ATOM   1110  C  C     . MET A  1 146 ? -20.406 -32.302 35.265  1.00 39.52 ? 145  MET A C     1 
ATOM   1111  O  O     . MET A  1 146 ? -19.553 -31.749 35.944  1.00 39.63 ? 145  MET A O     1 
ATOM   1112  C  CB    . MET A  1 146 ? -19.822 -34.283 33.853  1.00 39.51 ? 145  MET A CB    1 
ATOM   1113  C  CG    . MET A  1 146 ? -18.371 -33.811 33.631  1.00 40.16 ? 145  MET A CG    1 
ATOM   1114  S  SD    . MET A  1 146 ? -17.203 -34.486 34.834  1.00 43.54 ? 145  MET A SD    1 
ATOM   1115  C  CE    . MET A  1 146 ? -16.878 -36.064 34.021  1.00 38.46 ? 145  MET A CE    1 
ATOM   1116  N  N     . ALA A  1 147 ? -21.347 -31.638 34.590  1.00 40.04 ? 146  ALA A N     1 
ATOM   1117  C  CA    . ALA A  1 147 ? -21.443 -30.168 34.603  1.00 40.02 ? 146  ALA A CA    1 
ATOM   1118  C  C     . ALA A  1 147 ? -21.639 -29.630 35.999  1.00 40.37 ? 146  ALA A C     1 
ATOM   1119  O  O     . ALA A  1 147 ? -21.039 -28.623 36.369  1.00 39.65 ? 146  ALA A O     1 
ATOM   1120  C  CB    . ALA A  1 147 ? -22.592 -29.702 33.728  1.00 39.51 ? 146  ALA A CB    1 
ATOM   1121  N  N     . ARG A  1 148 ? -22.510 -30.293 36.760  1.00 41.48 ? 147  ARG A N     1 
ATOM   1122  C  CA    . ARG A  1 148 ? -22.808 -29.883 38.126  1.00 42.59 ? 147  ARG A CA    1 
ATOM   1123  C  C     . ARG A  1 148 ? -21.590 -30.041 39.013  1.00 42.06 ? 147  ARG A C     1 
ATOM   1124  O  O     . ARG A  1 148 ? -21.299 -29.166 39.845  1.00 42.16 ? 147  ARG A O     1 
ATOM   1125  C  CB    . ARG A  1 148 ? -23.997 -30.678 38.685  1.00 43.21 ? 147  ARG A CB    1 
ATOM   1126  C  CG    . ARG A  1 148 ? -25.314 -30.162 38.167  1.00 44.65 ? 147  ARG A CG    1 
ATOM   1127  C  CD    . ARG A  1 148 ? -26.501 -31.078 38.452  1.00 46.89 ? 147  ARG A CD    1 
ATOM   1128  N  NE    . ARG A  1 148 ? -27.762 -30.408 38.077  1.00 50.50 ? 147  ARG A NE    1 
ATOM   1129  C  CZ    . ARG A  1 148 ? -28.957 -30.994 38.036  1.00 52.15 ? 147  ARG A CZ    1 
ATOM   1130  N  NH1   . ARG A  1 148 ? -29.085 -32.282 38.347  1.00 54.60 ? 147  ARG A NH1   1 
ATOM   1131  N  NH2   . ARG A  1 148 ? -30.033 -30.285 37.689  1.00 52.11 ? 147  ARG A NH2   1 
ATOM   1132  N  N     . GLU A  1 149 ? -20.869 -31.140 38.813  1.00 41.47 ? 148  GLU A N     1 
ATOM   1133  C  CA    . GLU A  1 149 ? -19.665 -31.430 39.578  1.00 41.68 ? 148  GLU A CA    1 
ATOM   1134  C  C     . GLU A  1 149 ? -18.534 -30.425 39.345  1.00 40.68 ? 148  GLU A C     1 
ATOM   1135  O  O     . GLU A  1 149 ? -17.738 -30.192 40.245  1.00 40.34 ? 148  GLU A O     1 
ATOM   1136  C  CB    . GLU A  1 149 ? -19.162 -32.839 39.239  1.00 41.81 ? 148  GLU A CB    1 
ATOM   1137  C  CG    . GLU A  1 149 ? -17.784 -33.169 39.762  1.00 42.88 ? 148  GLU A CG    1 
ATOM   1138  C  CD    . GLU A  1 149 ? -17.309 -34.521 39.294  1.00 44.28 ? 148  GLU A CD    1 
ATOM   1139  O  OE1   . GLU A  1 149 ? -18.139 -35.458 39.259  1.00 46.02 ? 148  GLU A OE1   1 
ATOM   1140  O  OE2   . GLU A  1 149 ? -16.099 -34.638 38.955  1.00 49.26 ? 148  GLU A OE2   1 
ATOM   1141  N  N     . ILE A  1 150 ? -18.432 -29.857 38.143  1.00 39.96 ? 149  ILE A N     1 
ATOM   1142  C  CA    . ILE A  1 150 ? -17.371 -28.864 37.875  1.00 38.88 ? 149  ILE A CA    1 
ATOM   1143  C  C     . ILE A  1 150 ? -17.868 -27.422 38.067  1.00 38.46 ? 149  ILE A C     1 
ATOM   1144  O  O     . ILE A  1 150 ? -17.131 -26.468 37.854  1.00 38.75 ? 149  ILE A O     1 
ATOM   1145  C  CB    . ILE A  1 150 ? -16.685 -29.085 36.516  1.00 38.42 ? 149  ILE A CB    1 
ATOM   1146  C  CG1   . ILE A  1 150 ? -17.553 -28.655 35.333  1.00 38.75 ? 149  ILE A CG1   1 
ATOM   1147  C  CG2   . ILE A  1 150 ? -16.316 -30.554 36.371  1.00 38.50 ? 149  ILE A CG2   1 
ATOM   1148  C  CD1   . ILE A  1 150 ? -16.781 -28.609 34.032  1.00 37.81 ? 149  ILE A CD1   1 
ATOM   1149  N  N     . GLY A  1 151 ? -19.101 -27.279 38.531  1.00 37.87 ? 150  GLY A N     1 
ATOM   1150  C  CA    . GLY A  1 151 ? -19.668 -25.982 38.797  1.00 37.64 ? 150  GLY A CA    1 
ATOM   1151  C  C     . GLY A  1 151 ? -19.886 -25.182 37.534  1.00 37.70 ? 150  GLY A C     1 
ATOM   1152  O  O     . GLY A  1 151 ? -19.684 -23.969 37.523  1.00 37.44 ? 150  GLY A O     1 
ATOM   1153  N  N     . SER A  1 152 ? -20.282 -25.847 36.455  1.00 37.71 ? 151  SER A N     1 
ATOM   1154  C  CA    A SER A  1 152 ? -20.550 -25.188 35.177  0.50 37.96 ? 151  SER A CA    1 
ATOM   1155  C  CA    B SER A  1 152 ? -20.498 -25.105 35.208  0.50 37.81 ? 151  SER A CA    1 
ATOM   1156  C  C     . SER A  1 152 ? -21.827 -24.373 35.281  1.00 37.99 ? 151  SER A C     1 
ATOM   1157  O  O     . SER A  1 152 ? -22.700 -24.721 36.055  1.00 37.83 ? 151  SER A O     1 
ATOM   1158  C  CB    A SER A  1 152 ? -20.706 -26.239 34.080  0.50 37.72 ? 151  SER A CB    1 
ATOM   1159  C  CB    B SER A  1 152 ? -20.388 -25.977 33.949  0.50 37.64 ? 151  SER A CB    1 
ATOM   1160  O  OG    A SER A  1 152 ? -20.980 -25.629 32.842  0.50 38.89 ? 151  SER A OG    1 
ATOM   1161  O  OG    B SER A  1 152 ? -21.079 -27.185 34.065  0.50 37.56 ? 151  SER A OG    1 
ATOM   1162  N  N     . VAL A  1 153 ? -21.930 -23.304 34.502  1.00 38.05 ? 152  VAL A N     1 
ATOM   1163  C  CA    . VAL A  1 153 ? -23.136 -22.513 34.481  1.00 38.49 ? 152  VAL A CA    1 
ATOM   1164  C  C     . VAL A  1 153 ? -24.186 -23.150 33.570  1.00 38.50 ? 152  VAL A C     1 
ATOM   1165  O  O     . VAL A  1 153 ? -25.370 -22.897 33.719  1.00 38.10 ? 152  VAL A O     1 
ATOM   1166  C  CB    . VAL A  1 153 ? -22.868 -21.047 34.081  1.00 38.35 ? 152  VAL A CB    1 
ATOM   1167  C  CG1   . VAL A  1 153 ? -21.820 -20.439 35.026  1.00 38.99 ? 152  VAL A CG1   1 
ATOM   1168  C  CG2   . VAL A  1 153 ? -22.445 -20.959 32.659  1.00 38.81 ? 152  VAL A CG2   1 
ATOM   1169  N  N     . LYS A  1 154 ? -23.764 -24.009 32.652  1.00 38.73 ? 153  LYS A N     1 
ATOM   1170  C  CA    . LYS A  1 154 ? -24.709 -24.602 31.739  1.00 39.24 ? 153  LYS A CA    1 
ATOM   1171  C  C     . LYS A  1 154 ? -24.121 -25.843 31.113  1.00 38.88 ? 153  LYS A C     1 
ATOM   1172  O  O     . LYS A  1 154 ? -22.950 -25.858 30.771  1.00 40.29 ? 153  LYS A O     1 
ATOM   1173  C  CB    . LYS A  1 154 ? -25.073 -23.580 30.643  1.00 39.67 ? 153  LYS A CB    1 
ATOM   1174  C  CG    . LYS A  1 154 ? -26.520 -23.560 30.248  1.00 40.78 ? 153  LYS A CG    1 
ATOM   1175  C  CD    . LYS A  1 154 ? -27.317 -22.531 31.035  1.00 42.58 ? 153  LYS A CD    1 
ATOM   1176  N  N     . TYR A  1 155 ? -24.928 -26.888 30.985  1.00 38.31 ? 154  TYR A N     1 
ATOM   1177  C  CA    . TYR A  1 155 ? -24.596 -28.041 30.160  1.00 37.66 ? 154  TYR A CA    1 
ATOM   1178  C  C     . TYR A  1 155 ? -25.391 -28.025 28.853  1.00 37.38 ? 154  TYR A C     1 
ATOM   1179  O  O     . TYR A  1 155 ? -26.630 -28.001 28.867  1.00 37.52 ? 154  TYR A O     1 
ATOM   1180  C  CB    . TYR A  1 155 ? -24.856 -29.349 30.897  1.00 37.53 ? 154  TYR A CB    1 
ATOM   1181  C  CG    . TYR A  1 155 ? -24.642 -30.562 30.025  1.00 37.03 ? 154  TYR A CG    1 
ATOM   1182  C  CD1   . TYR A  1 155 ? -23.386 -30.846 29.485  1.00 36.85 ? 154  TYR A CD1   1 
ATOM   1183  C  CD2   . TYR A  1 155 ? -25.691 -31.439 29.746  1.00 38.11 ? 154  TYR A CD2   1 
ATOM   1184  C  CE1   . TYR A  1 155 ? -23.199 -31.964 28.676  1.00 37.13 ? 154  TYR A CE1   1 
ATOM   1185  C  CE2   . TYR A  1 155 ? -25.504 -32.568 28.933  1.00 35.27 ? 154  TYR A CE2   1 
ATOM   1186  C  CZ    . TYR A  1 155 ? -24.282 -32.813 28.395  1.00 36.98 ? 154  TYR A CZ    1 
ATOM   1187  O  OH    . TYR A  1 155 ? -24.125 -33.923 27.595  1.00 35.74 ? 154  TYR A OH    1 
ATOM   1188  N  N     . LEU A  1 156 ? -24.676 -28.063 27.729  1.00 36.66 ? 155  LEU A N     1 
ATOM   1189  C  CA    . LEU A  1 156 ? -25.293 -28.030 26.412  1.00 36.78 ? 155  LEU A CA    1 
ATOM   1190  C  C     . LEU A  1 156 ? -24.777 -29.157 25.521  1.00 36.88 ? 155  LEU A C     1 
ATOM   1191  O  O     . LEU A  1 156 ? -23.575 -29.474 25.529  1.00 37.73 ? 155  LEU A O     1 
ATOM   1192  C  CB    . LEU A  1 156 ? -25.060 -26.664 25.758  1.00 36.75 ? 155  LEU A CB    1 
ATOM   1193  C  CG    . LEU A  1 156 ? -25.689 -25.499 26.535  1.00 37.34 ? 155  LEU A CG    1 
ATOM   1194  C  CD1   . LEU A  1 156 ? -25.045 -24.186 26.186  1.00 39.25 ? 155  LEU A CD1   1 
ATOM   1195  C  CD2   . LEU A  1 156 ? -27.207 -25.438 26.329  1.00 38.20 ? 155  LEU A CD2   1 
ATOM   1196  N  N     . GLU A  1 157 ? -25.688 -29.755 24.757  1.00 36.77 ? 156  GLU A N     1 
ATOM   1197  C  CA    . GLU A  1 157 ? -25.333 -30.713 23.709  1.00 37.09 ? 156  GLU A CA    1 
ATOM   1198  C  C     . GLU A  1 157 ? -25.603 -30.126 22.318  1.00 36.93 ? 156  GLU A C     1 
ATOM   1199  O  O     . GLU A  1 157 ? -26.561 -29.395 22.126  1.00 36.20 ? 156  GLU A O     1 
ATOM   1200  C  CB    . GLU A  1 157 ? -26.113 -32.002 23.892  1.00 37.26 ? 156  GLU A CB    1 
ATOM   1201  C  CG    . GLU A  1 157 ? -26.004 -32.551 25.312  1.00 37.43 ? 156  GLU A CG    1 
ATOM   1202  C  CD    . GLU A  1 157 ? -26.681 -33.891 25.494  1.00 37.53 ? 156  GLU A CD    1 
ATOM   1203  O  OE1   . GLU A  1 157 ? -27.750 -34.100 24.879  1.00 37.23 ? 156  GLU A OE1   1 
ATOM   1204  O  OE2   . GLU A  1 157 ? -26.153 -34.719 26.273  1.00 38.08 ? 156  GLU A OE2   1 
ATOM   1205  N  N     . CYS A  1 158 ? -24.729 -30.433 21.360  1.00 37.45 ? 157  CYS A N     1 
ATOM   1206  C  CA    . CYS A  1 158 ? -24.866 -29.934 19.989  1.00 37.59 ? 157  CYS A CA    1 
ATOM   1207  C  C     . CYS A  1 158 ? -24.167 -30.811 18.973  1.00 37.18 ? 157  CYS A C     1 
ATOM   1208  O  O     . CYS A  1 158 ? -23.365 -31.680 19.322  1.00 37.04 ? 157  CYS A O     1 
ATOM   1209  C  CB    . CYS A  1 158 ? -24.286 -28.528 19.871  1.00 37.79 ? 157  CYS A CB    1 
ATOM   1210  S  SG    . CYS A  1 158 ? -22.514 -28.519 20.027  1.00 39.44 ? 157  CYS A SG    1 
ATOM   1211  N  N     . SER A  1 159 ? -24.493 -30.556 17.707  1.00 36.73 ? 158  SER A N     1 
ATOM   1212  C  CA    . SER A  1 159 ? -23.806 -31.144 16.577  1.00 36.50 ? 158  SER A CA    1 
ATOM   1213  C  C     . SER A  1 159 ? -23.329 -30.025 15.667  1.00 36.66 ? 158  SER A C     1 
ATOM   1214  O  O     . SER A  1 159 ? -24.150 -29.306 15.142  1.00 35.98 ? 158  SER A O     1 
ATOM   1215  C  CB    . SER A  1 159 ? -24.748 -32.072 15.804  1.00 35.71 ? 158  SER A CB    1 
ATOM   1216  O  OG    . SER A  1 159 ? -24.169 -32.461 14.565  1.00 35.62 ? 158  SER A OG    1 
ATOM   1217  N  N     . ALA A  1 160 ? -22.011 -29.892 15.458  1.00 36.67 ? 159  ALA A N     1 
ATOM   1218  C  CA    . ALA A  1 160 ? -21.498 -28.967 14.434  1.00 37.14 ? 159  ALA A CA    1 
ATOM   1219  C  C     . ALA A  1 160 ? -22.009 -29.348 13.029  1.00 37.25 ? 159  ALA A C     1 
ATOM   1220  O  O     . ALA A  1 160 ? -22.204 -28.470 12.167  1.00 37.87 ? 159  ALA A O     1 
ATOM   1221  C  CB    . ALA A  1 160 ? -19.961 -28.932 14.445  1.00 37.68 ? 159  ALA A CB    1 
ATOM   1222  N  N     . LEU A  1 161 ? -22.206 -30.651 12.794  1.00 36.82 ? 160  LEU A N     1 
ATOM   1223  C  CA    . LEU A  1 161 ? -22.546 -31.152 11.468  1.00 36.62 ? 160  LEU A CA    1 
ATOM   1224  C  C     . LEU A  1 161 ? -23.969 -30.774 11.103  1.00 37.02 ? 160  LEU A C     1 
ATOM   1225  O  O     . LEU A  1 161 ? -24.205 -30.244 10.012  1.00 36.76 ? 160  LEU A O     1 
ATOM   1226  C  CB    . LEU A  1 161 ? -22.345 -32.665 11.391  1.00 36.87 ? 160  LEU A CB    1 
ATOM   1227  C  CG    . LEU A  1 161 ? -22.707 -33.348 10.059  1.00 37.39 ? 160  LEU A CG    1 
ATOM   1228  C  CD1   . LEU A  1 161 ? -21.768 -32.943 8.932   1.00 36.89 ? 160  LEU A CD1   1 
ATOM   1229  C  CD2   . LEU A  1 161 ? -22.735 -34.878 10.238  1.00 36.40 ? 160  LEU A CD2   1 
ATOM   1230  N  N     . THR A  1 162 ? -24.916 -31.011 12.013  1.00 36.80 ? 161  THR A N     1 
ATOM   1231  C  CA    . THR A  1 162 ? -26.323 -30.676 11.736  1.00 36.18 ? 161  THR A CA    1 
ATOM   1232  C  C     . THR A  1 162 ? -26.714 -29.278 12.229  1.00 36.67 ? 161  THR A C     1 
ATOM   1233  O  O     . THR A  1 162 ? -27.770 -28.737 11.822  1.00 35.86 ? 161  THR A O     1 
ATOM   1234  C  CB    . THR A  1 162 ? -27.258 -31.705 12.349  1.00 35.97 ? 161  THR A CB    1 
ATOM   1235  O  OG1   . THR A  1 162 ? -27.187 -31.594 13.770  1.00 35.33 ? 161  THR A OG1   1 
ATOM   1236  C  CG2   . THR A  1 162 ? -26.862 -33.180 11.897  1.00 35.45 ? 161  THR A CG2   1 
ATOM   1237  N  N     . GLN A  1 163 ? -25.877 -28.701 13.103  1.00 36.56 ? 162  GLN A N     1 
ATOM   1238  C  CA    . GLN A  1 163 ? -26.145 -27.412 13.772  1.00 36.83 ? 162  GLN A CA    1 
ATOM   1239  C  C     . GLN A  1 163 ? -27.268 -27.465 14.810  1.00 37.08 ? 162  GLN A C     1 
ATOM   1240  O  O     . GLN A  1 163 ? -27.605 -26.449 15.418  1.00 36.49 ? 162  GLN A O     1 
ATOM   1241  C  CB    . GLN A  1 163 ? -26.405 -26.276 12.762  1.00 36.26 ? 162  GLN A CB    1 
ATOM   1242  C  CG    . GLN A  1 163 ? -25.289 -26.125 11.756  1.00 36.81 ? 162  GLN A CG    1 
ATOM   1243  C  CD    . GLN A  1 163 ? -25.298 -24.798 11.021  1.00 37.26 ? 162  GLN A CD    1 
ATOM   1244  O  OE1   . GLN A  1 163 ? -26.327 -24.394 10.469  1.00 41.07 ? 162  GLN A OE1   1 
ATOM   1245  N  NE2   . GLN A  1 163 ? -24.142 -24.108 11.005  1.00 38.12 ? 162  GLN A NE2   1 
ATOM   1246  N  N     . ARG A  1 164 ? -27.819 -28.648 15.055  1.00 37.76 ? 163  ARG A N     1 
ATOM   1247  C  CA    . ARG A  1 164 ? -28.758 -28.822 16.156  1.00 37.87 ? 163  ARG A CA    1 
ATOM   1248  C  C     . ARG A  1 164 ? -28.100 -28.405 17.473  1.00 38.05 ? 163  ARG A C     1 
ATOM   1249  O  O     . ARG A  1 164 ? -26.985 -28.835 17.785  1.00 37.46 ? 163  ARG A O     1 
ATOM   1250  C  CB    . ARG A  1 164 ? -29.223 -30.262 16.274  1.00 37.94 ? 163  ARG A CB    1 
ATOM   1251  C  CG    . ARG A  1 164 ? -30.311 -30.377 17.292  1.00 39.52 ? 163  ARG A CG    1 
ATOM   1252  C  CD    . ARG A  1 164 ? -30.914 -31.748 17.402  1.00 41.51 ? 163  ARG A CD    1 
ATOM   1253  N  NE    . ARG A  1 164 ? -32.101 -31.670 18.254  1.00 42.34 ? 163  ARG A NE    1 
ATOM   1254  C  CZ    . ARG A  1 164 ? -32.885 -32.692 18.569  1.00 43.85 ? 163  ARG A CZ    1 
ATOM   1255  N  NH1   . ARG A  1 164 ? -32.630 -33.902 18.093  1.00 44.00 ? 163  ARG A NH1   1 
ATOM   1256  N  NH2   . ARG A  1 164 ? -33.945 -32.495 19.357  1.00 43.16 ? 163  ARG A NH2   1 
ATOM   1257  N  N     . GLY A  1 165 ? -28.780 -27.525 18.203  1.00 37.95 ? 164  GLY A N     1 
ATOM   1258  C  CA    . GLY A  1 165 ? -28.270 -26.985 19.445  1.00 38.54 ? 164  GLY A CA    1 
ATOM   1259  C  C     . GLY A  1 165 ? -27.051 -26.067 19.356  1.00 38.60 ? 164  GLY A C     1 
ATOM   1260  O  O     . GLY A  1 165 ? -26.565 -25.588 20.382  1.00 39.55 ? 164  GLY A O     1 
ATOM   1261  N  N     . LEU A  1 166 ? -26.583 -25.777 18.151  1.00 38.51 ? 165  LEU A N     1 
ATOM   1262  C  CA    . LEU A  1 166 ? -25.329 -25.055 17.969  1.00 38.08 ? 165  LEU A CA    1 
ATOM   1263  C  C     . LEU A  1 166 ? -25.393 -23.565 18.372  1.00 38.75 ? 165  LEU A C     1 
ATOM   1264  O  O     . LEU A  1 166 ? -24.554 -23.098 19.153  1.00 39.12 ? 165  LEU A O     1 
ATOM   1265  C  CB    . LEU A  1 166 ? -24.872 -25.185 16.523  1.00 37.93 ? 165  LEU A CB    1 
ATOM   1266  C  CG    . LEU A  1 166 ? -23.517 -24.523 16.230  1.00 36.96 ? 165  LEU A CG    1 
ATOM   1267  C  CD1   . LEU A  1 166 ? -22.449 -25.107 17.075  1.00 34.94 ? 165  LEU A CD1   1 
ATOM   1268  C  CD2   . LEU A  1 166 ? -23.181 -24.624 14.769  1.00 34.30 ? 165  LEU A CD2   1 
ATOM   1269  N  N     . LYS A  1 167 ? -26.385 -22.832 17.866  1.00 38.37 ? 166  LYS A N     1 
ATOM   1270  C  CA    . LYS A  1 167 ? -26.509 -21.406 18.175  1.00 38.57 ? 166  LYS A CA    1 
ATOM   1271  C  C     . LYS A  1 167 ? -26.661 -21.171 19.671  1.00 38.76 ? 166  LYS A C     1 
ATOM   1272  O  O     . LYS A  1 167 ? -26.098 -20.211 20.220  1.00 38.05 ? 166  LYS A O     1 
ATOM   1273  C  CB    . LYS A  1 167 ? -27.676 -20.767 17.433  1.00 38.67 ? 166  LYS A CB    1 
ATOM   1274  C  CG    . LYS A  1 167 ? -27.726 -19.221 17.545  1.00 38.44 ? 166  LYS A CG    1 
ATOM   1275  C  CD    . LYS A  1 167 ? -28.940 -18.652 16.822  1.00 39.67 ? 166  LYS A CD    1 
ATOM   1276  C  CE    . LYS A  1 167 ? -29.083 -17.135 16.982  1.00 39.46 ? 166  LYS A CE    1 
ATOM   1277  N  NZ    . LYS A  1 167 ? -29.492 -16.763 18.354  1.00 38.78 ? 166  LYS A NZ    1 
ATOM   1278  N  N     . THR A  1 168 ? -27.437 -22.058 20.305  1.00 39.11 ? 167  THR A N     1 
ATOM   1279  C  CA    . THR A  1 168 ? -27.679 -22.077 21.751  1.00 38.68 ? 167  THR A CA    1 
ATOM   1280  C  C     . THR A  1 168 ? -26.399 -22.129 22.594  1.00 38.56 ? 167  THR A C     1 
ATOM   1281  O  O     . THR A  1 168 ? -26.291 -21.430 23.595  1.00 38.51 ? 167  THR A O     1 
ATOM   1282  C  CB    . THR A  1 168 ? -28.640 -23.244 22.086  1.00 39.24 ? 167  THR A CB    1 
ATOM   1283  O  OG1   . THR A  1 168 ? -29.914 -22.966 21.480  1.00 38.95 ? 167  THR A OG1   1 
ATOM   1284  C  CG2   . THR A  1 168 ? -28.834 -23.441 23.579  1.00 38.89 ? 167  THR A CG2   1 
ATOM   1285  N  N     . VAL A  1 169 ? -25.412 -22.918 22.189  1.00 38.40 ? 168  VAL A N     1 
ATOM   1286  C  CA    . VAL A  1 169 ? -24.131 -22.909 22.888  1.00 38.07 ? 168  VAL A CA    1 
ATOM   1287  C  C     . VAL A  1 169 ? -23.572 -21.481 23.005  1.00 38.40 ? 168  VAL A C     1 
ATOM   1288  O  O     . VAL A  1 169 ? -23.189 -21.029 24.094  1.00 37.74 ? 168  VAL A O     1 
ATOM   1289  C  CB    . VAL A  1 169 ? -23.102 -23.814 22.198  1.00 38.52 ? 168  VAL A CB    1 
ATOM   1290  C  CG1   . VAL A  1 169 ? -21.703 -23.554 22.729  1.00 37.53 ? 168  VAL A CG1   1 
ATOM   1291  C  CG2   . VAL A  1 169 ? -23.497 -25.276 22.380  1.00 37.04 ? 168  VAL A CG2   1 
ATOM   1292  N  N     . PHE A  1 170 ? -23.537 -20.779 21.881  1.00 38.04 ? 169  PHE A N     1 
ATOM   1293  C  CA    . PHE A  1 170 ? -22.949 -19.449 21.837  1.00 38.25 ? 169  PHE A CA    1 
ATOM   1294  C  C     . PHE A  1 170 ? -23.866 -18.361 22.403  1.00 38.40 ? 169  PHE A C     1 
ATOM   1295  O  O     . PHE A  1 170 ? -23.395 -17.410 23.031  1.00 38.28 ? 169  PHE A O     1 
ATOM   1296  C  CB    . PHE A  1 170 ? -22.460 -19.163 20.411  1.00 38.17 ? 169  PHE A CB    1 
ATOM   1297  C  CG    . PHE A  1 170 ? -21.276 -20.020 20.026  1.00 37.72 ? 169  PHE A CG    1 
ATOM   1298  C  CD1   . PHE A  1 170 ? -20.000 -19.644 20.388  1.00 36.00 ? 169  PHE A CD1   1 
ATOM   1299  C  CD2   . PHE A  1 170 ? -21.459 -21.233 19.360  1.00 37.21 ? 169  PHE A CD2   1 
ATOM   1300  C  CE1   . PHE A  1 170 ? -18.919 -20.431 20.051  1.00 39.38 ? 169  PHE A CE1   1 
ATOM   1301  C  CE2   . PHE A  1 170 ? -20.387 -22.033 19.036  1.00 38.74 ? 169  PHE A CE2   1 
ATOM   1302  C  CZ    . PHE A  1 170 ? -19.110 -21.643 19.383  1.00 37.73 ? 169  PHE A CZ    1 
ATOM   1303  N  N     . ASP A  1 171 ? -25.173 -18.518 22.222  1.00 38.61 ? 170  ASP A N     1 
ATOM   1304  C  CA    . ASP A  1 171 ? -26.125 -17.648 22.893  1.00 38.93 ? 170  ASP A CA    1 
ATOM   1305  C  C     . ASP A  1 171 ? -25.972 -17.731 24.426  1.00 39.34 ? 170  ASP A C     1 
ATOM   1306  O  O     . ASP A  1 171 ? -25.928 -16.707 25.122  1.00 38.62 ? 170  ASP A O     1 
ATOM   1307  C  CB    . ASP A  1 171 ? -27.549 -17.991 22.465  1.00 39.41 ? 170  ASP A CB    1 
ATOM   1308  C  CG    . ASP A  1 171 ? -27.870 -17.532 21.023  1.00 41.08 ? 170  ASP A CG    1 
ATOM   1309  O  OD1   . ASP A  1 171 ? -26.959 -17.043 20.292  1.00 42.13 ? 170  ASP A OD1   1 
ATOM   1310  O  OD2   . ASP A  1 171 ? -29.049 -17.666 20.619  1.00 42.05 ? 170  ASP A OD2   1 
ATOM   1311  N  N     . GLU A  1 172 ? -25.884 -18.947 24.956  1.00 39.53 ? 171  GLU A N     1 
ATOM   1312  C  CA    . GLU A  1 172 ? -25.694 -19.136 26.401  1.00 39.82 ? 171  GLU A CA    1 
ATOM   1313  C  C     . GLU A  1 172 ? -24.345 -18.608 26.910  1.00 39.25 ? 171  GLU A C     1 
ATOM   1314  O  O     . GLU A  1 172 ? -24.277 -18.029 27.994  1.00 39.02 ? 171  GLU A O     1 
ATOM   1315  C  CB    . GLU A  1 172 ? -25.857 -20.612 26.783  1.00 40.16 ? 171  GLU A CB    1 
ATOM   1316  C  CG    . GLU A  1 172 ? -27.277 -21.159 26.579  1.00 42.27 ? 171  GLU A CG    1 
ATOM   1317  C  CD    . GLU A  1 172 ? -28.315 -20.589 27.534  1.00 46.46 ? 171  GLU A CD    1 
ATOM   1318  O  OE1   . GLU A  1 172 ? -27.956 -19.958 28.554  1.00 48.77 ? 171  GLU A OE1   1 
ATOM   1319  O  OE2   . GLU A  1 172 ? -29.516 -20.781 27.257  1.00 50.43 ? 171  GLU A OE2   1 
ATOM   1320  N  N     . ALA A  1 173 ? -23.284 -18.843 26.136  1.00 38.91 ? 172  ALA A N     1 
ATOM   1321  C  CA    . ALA A  1 173 ? -21.958 -18.306 26.428  1.00 38.93 ? 172  ALA A CA    1 
ATOM   1322  C  C     . ALA A  1 173 ? -22.036 -16.783 26.547  1.00 38.84 ? 172  ALA A C     1 
ATOM   1323  O  O     . ALA A  1 173 ? -21.499 -16.193 27.482  1.00 38.57 ? 172  ALA A O     1 
ATOM   1324  C  CB    . ALA A  1 173 ? -20.992 -18.687 25.322  1.00 38.50 ? 172  ALA A CB    1 
ATOM   1325  N  N     . ILE A  1 174 ? -22.712 -16.155 25.587  1.00 38.37 ? 173  ILE A N     1 
ATOM   1326  C  CA    . ILE A  1 174 ? -22.915 -14.725 25.611  1.00 38.42 ? 173  ILE A CA    1 
ATOM   1327  C  C     . ILE A  1 174 ? -23.714 -14.313 26.847  1.00 38.62 ? 173  ILE A C     1 
ATOM   1328  O  O     . ILE A  1 174 ? -23.299 -13.402 27.570  1.00 38.81 ? 173  ILE A O     1 
ATOM   1329  C  CB    . ILE A  1 174 ? -23.656 -14.237 24.319  1.00 38.94 ? 173  ILE A CB    1 
ATOM   1330  C  CG1   . ILE A  1 174 ? -22.748 -14.363 23.088  1.00 38.77 ? 173  ILE A CG1   1 
ATOM   1331  C  CG2   . ILE A  1 174 ? -24.172 -12.826 24.484  1.00 37.09 ? 173  ILE A CG2   1 
ATOM   1332  C  CD1   . ILE A  1 174 ? -23.484 -14.201 21.772  1.00 38.70 ? 173  ILE A CD1   1 
ATOM   1333  N  N     . ARG A  1 175 ? -24.844 -14.968 27.122  1.00 38.83 ? 174  ARG A N     1 
ATOM   1334  C  CA    . ARG A  1 175 ? -25.667 -14.539 28.282  1.00 39.59 ? 174  ARG A CA    1 
ATOM   1335  C  C     . ARG A  1 175 ? -24.903 -14.758 29.613  1.00 39.12 ? 174  ARG A C     1 
ATOM   1336  O  O     . ARG A  1 175 ? -25.162 -14.065 30.607  1.00 38.14 ? 174  ARG A O     1 
ATOM   1337  C  CB    . ARG A  1 175 ? -27.035 -15.245 28.374  1.00 40.27 ? 174  ARG A CB    1 
ATOM   1338  C  CG    . ARG A  1 175 ? -27.884 -15.295 27.102  1.00 42.36 ? 174  ARG A CG    1 
ATOM   1339  C  CD    . ARG A  1 175 ? -29.168 -14.479 27.142  1.00 46.43 ? 174  ARG A CD    1 
ATOM   1340  N  NE    . ARG A  1 175 ? -28.948 -13.039 27.017  1.00 47.18 ? 174  ARG A NE    1 
ATOM   1341  C  CZ    . ARG A  1 175 ? -29.728 -12.197 26.340  1.00 48.96 ? 174  ARG A CZ    1 
ATOM   1342  N  NH1   . ARG A  1 175 ? -29.433 -10.904 26.330  1.00 49.53 ? 174  ARG A NH1   1 
ATOM   1343  N  NH2   . ARG A  1 175 ? -30.786 -12.615 25.651  1.00 50.34 ? 174  ARG A NH2   1 
ATOM   1344  N  N     . ALA A  1 176 ? -24.002 -15.736 29.619  1.00 38.18 ? 175  ALA A N     1 
ATOM   1345  C  CA    . ALA A  1 176 ? -23.161 -16.023 30.793  1.00 38.75 ? 175  ALA A CA    1 
ATOM   1346  C  C     . ALA A  1 176 ? -22.234 -14.865 31.142  1.00 38.60 ? 175  ALA A C     1 
ATOM   1347  O  O     . ALA A  1 176 ? -21.925 -14.653 32.319  1.00 38.47 ? 175  ALA A O     1 
ATOM   1348  C  CB    . ALA A  1 176 ? -22.342 -17.267 30.575  1.00 37.73 ? 175  ALA A CB    1 
ATOM   1349  N  N     . VAL A  1 177 ? -21.799 -14.124 30.122  1.00 38.77 ? 176  VAL A N     1 
ATOM   1350  C  CA    . VAL A  1 177 ? -20.869 -13.007 30.307  1.00 38.75 ? 176  VAL A CA    1 
ATOM   1351  C  C     . VAL A  1 177 ? -21.611 -11.672 30.446  1.00 39.18 ? 176  VAL A C     1 
ATOM   1352  O  O     . VAL A  1 177 ? -21.292 -10.869 31.323  1.00 38.34 ? 176  VAL A O     1 
ATOM   1353  C  CB    . VAL A  1 177 ? -19.842 -12.923 29.144  1.00 38.52 ? 176  VAL A CB    1 
ATOM   1354  C  CG1   . VAL A  1 177 ? -18.961 -11.685 29.301  1.00 38.96 ? 176  VAL A CG1   1 
ATOM   1355  C  CG2   . VAL A  1 177 ? -18.981 -14.196 29.082  1.00 37.25 ? 176  VAL A CG2   1 
ATOM   1356  N  N     . LEU A  1 178 ? -22.601 -11.445 29.578  1.00 40.23 ? 177  LEU A N     1 
ATOM   1357  C  CA    . LEU A  1 178 ? -23.314 -10.161 29.517  1.00 40.81 ? 177  LEU A CA    1 
ATOM   1358  C  C     . LEU A  1 178 ? -24.652 -10.121 30.266  1.00 41.83 ? 177  LEU A C     1 
ATOM   1359  O  O     . LEU A  1 178 ? -25.188 -9.048  30.489  1.00 42.22 ? 177  LEU A O     1 
ATOM   1360  C  CB    . LEU A  1 178 ? -23.530 -9.748  28.052  1.00 40.87 ? 177  LEU A CB    1 
ATOM   1361  C  CG    . LEU A  1 178 ? -22.273 -9.528  27.192  1.00 40.66 ? 177  LEU A CG    1 
ATOM   1362  C  CD1   . LEU A  1 178 ? -22.647 -9.077  25.781  1.00 41.24 ? 177  LEU A CD1   1 
ATOM   1363  C  CD2   . LEU A  1 178 ? -21.319 -8.528  27.836  1.00 39.49 ? 177  LEU A CD2   1 
ATOM   1364  N  N     . GLY A  1 179 ? -25.189 -11.272 30.660  1.00 43.12 ? 178  GLY A N     1 
ATOM   1365  C  CA    . GLY A  1 179 ? -26.498 -11.328 31.300  1.00 44.04 ? 178  GLY A CA    1 
ATOM   1366  C  C     . GLY A  1 179 ? -27.593 -11.346 30.255  1.00 45.05 ? 178  GLY A C     1 
ATOM   1367  O  O     . GLY A  1 179 ? -28.695 -10.854 30.453  1.00 46.15 ? 178  GLY A O     1 
ATOM   1368  O  OXT   . GLY A  1 179 ? -27.415 -11.847 29.151  1.00 46.27 ? 178  GLY A OXT   1 
ATOM   1369  N  N     . SER B  1 1   ? 2.369   -59.804 -2.341  1.00 45.75 ? 0    SER F N     1 
ATOM   1370  C  CA    . SER B  1 1   ? 1.925   -58.600 -3.104  1.00 45.51 ? 0    SER F CA    1 
ATOM   1371  C  C     . SER B  1 1   ? 0.567   -58.851 -3.760  1.00 45.48 ? 0    SER F C     1 
ATOM   1372  O  O     . SER B  1 1   ? 0.011   -59.956 -3.677  1.00 44.93 ? 0    SER F O     1 
ATOM   1373  C  CB    . SER B  1 1   ? 2.990   -58.175 -4.142  1.00 46.02 ? 0    SER F CB    1 
ATOM   1374  O  OG    . SER B  1 1   ? 3.856   -59.245 -4.499  1.00 45.64 ? 0    SER F OG    1 
ATOM   1375  N  N     . MET B  1 2   ? 0.015   -57.811 -4.382  1.00 45.14 ? 1    MET F N     1 
ATOM   1376  C  CA    . MET B  1 2   ? -1.277  -57.938 -5.056  1.00 44.80 ? 1    MET F CA    1 
ATOM   1377  C  C     . MET B  1 2   ? -1.077  -58.745 -6.335  1.00 44.19 ? 1    MET F C     1 
ATOM   1378  O  O     . MET B  1 2   ? -0.013  -58.678 -6.958  1.00 44.00 ? 1    MET F O     1 
ATOM   1379  C  CB    . MET B  1 2   ? -1.885  -56.564 -5.344  1.00 44.92 ? 1    MET F CB    1 
ATOM   1380  C  CG    . MET B  1 2   ? -2.014  -55.676 -4.100  1.00 45.76 ? 1    MET F CG    1 
ATOM   1381  S  SD    . MET B  1 2   ? -3.005  -56.406 -2.758  1.00 47.71 ? 1    MET F SD    1 
ATOM   1382  C  CE    . MET B  1 2   ? -4.650  -55.886 -3.261  1.00 49.31 ? 1    MET F CE    1 
ATOM   1383  N  N     . GLN B  1 3   ? -2.075  -59.539 -6.703  1.00 43.39 ? 2    GLN F N     1 
ATOM   1384  C  CA    . GLN B  1 3   ? -1.911  -60.428 -7.841  1.00 42.97 ? 2    GLN F CA    1 
ATOM   1385  C  C     . GLN B  1 3   ? -1.765  -59.621 -9.135  1.00 42.52 ? 2    GLN F C     1 
ATOM   1386  O  O     . GLN B  1 3   ? -2.535  -58.694 -9.400  1.00 41.84 ? 2    GLN F O     1 
ATOM   1387  C  CB    . GLN B  1 3   ? -3.066  -61.430 -7.940  1.00 43.31 ? 2    GLN F CB    1 
ATOM   1388  C  CG    . GLN B  1 3   ? -2.889  -62.475 -9.044  1.00 43.05 ? 2    GLN F CG    1 
ATOM   1389  C  CD    . GLN B  1 3   ? -1.758  -63.454 -8.750  1.00 44.35 ? 2    GLN F CD    1 
ATOM   1390  O  OE1   . GLN B  1 3   ? -0.777  -63.552 -9.507  1.00 42.15 ? 2    GLN F OE1   1 
ATOM   1391  N  NE2   . GLN B  1 3   ? -1.893  -64.192 -7.650  1.00 44.96 ? 2    GLN F NE2   1 
ATOM   1392  N  N     . ALA B  1 4   ? -0.736  -59.964 -9.906  1.00 41.56 ? 3    ALA F N     1 
ATOM   1393  C  CA    . ALA B  1 4   ? -0.479  -59.364 -11.211 1.00 41.27 ? 3    ALA F CA    1 
ATOM   1394  C  C     . ALA B  1 4   ? -0.113  -60.482 -12.178 1.00 40.88 ? 3    ALA F C     1 
ATOM   1395  O  O     . ALA B  1 4   ? 0.531   -61.459 -11.794 1.00 41.00 ? 3    ALA F O     1 
ATOM   1396  C  CB    . ALA B  1 4   ? 0.654   -58.324 -11.124 1.00 41.21 ? 3    ALA F CB    1 
ATOM   1397  N  N     . ILE B  1 5   ? -0.558  -60.351 -13.423 1.00 40.55 ? 4    ILE F N     1 
ATOM   1398  C  CA    . ILE B  1 5   ? -0.289  -61.332 -14.457 1.00 39.67 ? 4    ILE F CA    1 
ATOM   1399  C  C     . ILE B  1 5   ? 0.395   -60.607 -15.611 1.00 39.01 ? 4    ILE F C     1 
ATOM   1400  O  O     . ILE B  1 5   ? -0.092  -59.566 -16.075 1.00 38.55 ? 4    ILE F O     1 
ATOM   1401  C  CB    . ILE B  1 5   ? -1.594  -62.008 -14.930 1.00 39.86 ? 4    ILE F CB    1 
ATOM   1402  C  CG1   . ILE B  1 5   ? -2.237  -62.815 -13.792 1.00 39.58 ? 4    ILE F CG1   1 
ATOM   1403  C  CG2   . ILE B  1 5   ? -1.326  -62.890 -16.138 1.00 39.41 ? 4    ILE F CG2   1 
ATOM   1404  C  CD1   . ILE B  1 5   ? -3.690  -63.202 -14.061 1.00 40.63 ? 4    ILE F CD1   1 
ATOM   1405  N  N     . LYS B  1 6   ? 1.557   -61.117 -16.017 1.00 38.04 ? 5    LYS F N     1 
ATOM   1406  C  CA    . LYS B  1 6   ? 2.241   -60.629 -17.201 1.00 37.66 ? 5    LYS F CA    1 
ATOM   1407  C  C     . LYS B  1 6   ? 1.889   -61.570 -18.344 1.00 37.85 ? 5    LYS F C     1 
ATOM   1408  O  O     . LYS B  1 6   ? 2.279   -62.748 -18.342 1.00 36.90 ? 5    LYS F O     1 
ATOM   1409  C  CB    . LYS B  1 6   ? 3.753   -60.575 -17.003 1.00 37.87 ? 5    LYS F CB    1 
ATOM   1410  C  CG    . LYS B  1 6   ? 4.528   -60.189 -18.265 1.00 36.73 ? 5    LYS F CG    1 
ATOM   1411  C  CD    . LYS B  1 6   ? 5.978   -59.884 -17.976 1.00 37.38 ? 5    LYS F CD    1 
ATOM   1412  C  CE    . LYS B  1 6   ? 6.721   -59.510 -19.252 1.00 35.05 ? 5    LYS F CE    1 
ATOM   1413  N  NZ    . LYS B  1 6   ? 8.064   -58.999 -18.942 1.00 34.89 ? 5    LYS F NZ    1 
ATOM   1414  N  N     . CYS B  1 7   ? 1.130   -61.037 -19.296 1.00 37.76 ? 6    CYS F N     1 
ATOM   1415  C  CA    . CYS B  1 7   ? 0.729   -61.760 -20.505 1.00 38.17 ? 6    CYS F CA    1 
ATOM   1416  C  C     . CYS B  1 7   ? 1.416   -61.144 -21.728 1.00 37.56 ? 6    CYS F C     1 
ATOM   1417  O  O     . CYS B  1 7   ? 1.238   -59.960 -22.016 1.00 37.37 ? 6    CYS F O     1 
ATOM   1418  C  CB    . CYS B  1 7   ? -0.801  -61.705 -20.672 1.00 38.21 ? 6    CYS F CB    1 
ATOM   1419  S  SG    . CYS B  1 7   ? -1.395  -62.446 -22.232 1.00 39.93 ? 6    CYS F SG    1 
ATOM   1420  N  N     . VAL B  1 8   ? 2.210   -61.956 -22.420 1.00 37.38 ? 7    VAL F N     1 
ATOM   1421  C  CA    . VAL B  1 8   ? 2.963   -61.545 -23.597 1.00 37.06 ? 7    VAL F CA    1 
ATOM   1422  C  C     . VAL B  1 8   ? 2.390   -62.182 -24.872 1.00 37.13 ? 7    VAL F C     1 
ATOM   1423  O  O     . VAL B  1 8   ? 2.288   -63.409 -24.966 1.00 36.91 ? 7    VAL F O     1 
ATOM   1424  C  CB    . VAL B  1 8   ? 4.441   -61.985 -23.491 1.00 37.35 ? 7    VAL F CB    1 
ATOM   1425  C  CG1   . VAL B  1 8   ? 5.175   -61.675 -24.792 1.00 37.06 ? 7    VAL F CG1   1 
ATOM   1426  C  CG2   . VAL B  1 8   ? 5.147   -61.296 -22.274 1.00 36.55 ? 7    VAL F CG2   1 
ATOM   1427  N  N     . VAL B  1 9   ? 2.089   -61.344 -25.868 1.00 36.87 ? 8    VAL F N     1 
ATOM   1428  C  CA    . VAL B  1 9   ? 1.395   -61.791 -27.076 1.00 36.81 ? 8    VAL F CA    1 
ATOM   1429  C  C     . VAL B  1 9   ? 2.329   -61.752 -28.294 1.00 36.52 ? 8    VAL F C     1 
ATOM   1430  O  O     . VAL B  1 9   ? 2.814   -60.688 -28.675 1.00 36.47 ? 8    VAL F O     1 
ATOM   1431  C  CB    . VAL B  1 9   ? 0.118   -60.934 -27.331 1.00 37.11 ? 8    VAL F CB    1 
ATOM   1432  C  CG1   . VAL B  1 9   ? -0.791  -61.590 -28.407 1.00 36.08 ? 8    VAL F CG1   1 
ATOM   1433  C  CG2   . VAL B  1 9   ? -0.635  -60.723 -26.034 1.00 35.62 ? 8    VAL F CG2   1 
ATOM   1434  N  N     . VAL B  1 10  ? 2.575   -62.927 -28.883 1.00 35.99 ? 9    VAL F N     1 
ATOM   1435  C  CA    . VAL B  1 10  ? 3.453   -63.076 -30.046 1.00 35.96 ? 9    VAL F CA    1 
ATOM   1436  C  C     . VAL B  1 10  ? 2.780   -63.803 -31.245 1.00 36.57 ? 9    VAL F C     1 
ATOM   1437  O  O     . VAL B  1 10  ? 1.786   -64.510 -31.089 1.00 37.43 ? 9    VAL F O     1 
ATOM   1438  C  CB    . VAL B  1 10  ? 4.787   -63.789 -29.678 1.00 36.17 ? 9    VAL F CB    1 
ATOM   1439  C  CG1   . VAL B  1 10  ? 5.432   -63.131 -28.420 1.00 34.38 ? 9    VAL F CG1   1 
ATOM   1440  C  CG2   . VAL B  1 10  ? 4.593   -65.305 -29.480 1.00 35.05 ? 9    VAL F CG2   1 
ATOM   1441  N  N     . GLY B  1 11  ? 3.321   -63.569 -32.436 1.00 36.44 ? 10   GLY F N     1 
ATOM   1442  C  CA    . GLY B  1 11  ? 2.867   -64.188 -33.665 1.00 36.26 ? 10   GLY F CA    1 
ATOM   1443  C  C     . GLY B  1 11  ? 3.317   -63.401 -34.893 1.00 36.39 ? 10   GLY F C     1 
ATOM   1444  O  O     . GLY B  1 11  ? 3.881   -62.298 -34.803 1.00 35.69 ? 10   GLY F O     1 
ATOM   1445  N  N     . ASP B  1 12  ? 3.045   -63.974 -36.053 1.00 36.66 ? 11   ASP F N     1 
ATOM   1446  C  CA    . ASP B  1 12  ? 3.370   -63.337 -37.328 1.00 37.17 ? 11   ASP F CA    1 
ATOM   1447  C  C     . ASP B  1 12  ? 2.754   -61.955 -37.485 1.00 37.08 ? 11   ASP F C     1 
ATOM   1448  O  O     . ASP B  1 12  ? 1.774   -61.598 -36.817 1.00 36.12 ? 11   ASP F O     1 
ATOM   1449  C  CB    . ASP B  1 12  ? 2.898   -64.215 -38.498 1.00 37.23 ? 11   ASP F CB    1 
ATOM   1450  C  CG    . ASP B  1 12  ? 3.923   -65.267 -38.897 1.00 37.70 ? 11   ASP F CG    1 
ATOM   1451  O  OD1   . ASP B  1 12  ? 4.917   -65.472 -38.162 1.00 37.75 ? 11   ASP F OD1   1 
ATOM   1452  O  OD2   . ASP B  1 12  ? 3.752   -65.864 -39.981 1.00 38.54 ? 11   ASP F OD2   1 
ATOM   1453  N  N     . GLY B  1 13  ? 3.354   -61.170 -38.370 1.00 37.09 ? 12   GLY F N     1 
ATOM   1454  C  CA    . GLY B  1 13  ? 2.724   -59.941 -38.822 1.00 37.11 ? 12   GLY F CA    1 
ATOM   1455  C  C     . GLY B  1 13  ? 1.360   -60.228 -39.421 1.00 37.36 ? 12   GLY F C     1 
ATOM   1456  O  O     . GLY B  1 13  ? 1.086   -61.343 -39.891 1.00 37.16 ? 12   GLY F O     1 
ATOM   1457  N  N     . ALA B  1 14  ? 0.521   -59.196 -39.383 1.00 37.41 ? 13   ALA F N     1 
ATOM   1458  C  CA    . ALA B  1 14  ? -0.870  -59.201 -39.852 1.00 37.84 ? 13   ALA F CA    1 
ATOM   1459  C  C     . ALA B  1 14  ? -1.882  -60.185 -39.208 1.00 37.71 ? 13   ALA F C     1 
ATOM   1460  O  O     . ALA B  1 14  ? -3.024  -60.268 -39.708 1.00 38.55 ? 13   ALA F O     1 
ATOM   1461  C  CB    . ALA B  1 14  ? -0.914  -59.313 -41.422 1.00 37.37 ? 13   ALA F CB    1 
ATOM   1462  N  N     . VAL B  1 15  ? -1.532  -60.875 -38.115 1.00 37.57 ? 14   VAL F N     1 
ATOM   1463  C  CA    . VAL B  1 15  ? -2.439  -61.926 -37.576 1.00 37.62 ? 14   VAL F CA    1 
ATOM   1464  C  C     . VAL B  1 15  ? -3.579  -61.375 -36.718 1.00 37.13 ? 14   VAL F C     1 
ATOM   1465  O  O     . VAL B  1 15  ? -4.651  -61.974 -36.685 1.00 37.64 ? 14   VAL F O     1 
ATOM   1466  C  CB    . VAL B  1 15  ? -1.738  -63.108 -36.830 1.00 37.50 ? 14   VAL F CB    1 
ATOM   1467  C  CG1   . VAL B  1 15  ? -0.654  -63.739 -37.685 1.00 36.67 ? 14   VAL F CG1   1 
ATOM   1468  C  CG2   . VAL B  1 15  ? -1.197  -62.687 -35.483 1.00 39.72 ? 14   VAL F CG2   1 
ATOM   1469  N  N     . GLY B  1 16  ? -3.366  -60.217 -36.097 1.00 36.54 ? 15   GLY F N     1 
ATOM   1470  C  CA    . GLY B  1 16  ? -4.412  -59.513 -35.360 1.00 35.99 ? 15   GLY F CA    1 
ATOM   1471  C  C     . GLY B  1 16  ? -4.134  -59.399 -33.865 1.00 35.99 ? 15   GLY F C     1 
ATOM   1472  O  O     . GLY B  1 16  ? -5.057  -59.316 -33.075 1.00 34.93 ? 15   GLY F O     1 
ATOM   1473  N  N     . LYS B  1 17  ? -2.858  -59.379 -33.476 1.00 36.00 ? 16   LYS F N     1 
ATOM   1474  C  CA    . LYS B  1 17  ? -2.498  -59.386 -32.059 1.00 35.90 ? 16   LYS F CA    1 
ATOM   1475  C  C     . LYS B  1 17  ? -2.935  -58.107 -31.355 1.00 36.06 ? 16   LYS F C     1 
ATOM   1476  O  O     . LYS B  1 17  ? -3.483  -58.158 -30.243 1.00 35.85 ? 16   LYS F O     1 
ATOM   1477  C  CB    . LYS B  1 17  ? -1.004  -59.580 -31.877 1.00 35.70 ? 16   LYS F CB    1 
ATOM   1478  C  CG    . LYS B  1 17  ? -0.461  -60.884 -32.409 1.00 35.76 ? 16   LYS F CG    1 
ATOM   1479  C  CD    . LYS B  1 17  ? 1.067   -61.002 -32.127 1.00 36.12 ? 16   LYS F CD    1 
ATOM   1480  C  CE    . LYS B  1 17  ? 1.921   -59.964 -32.864 1.00 34.66 ? 16   LYS F CE    1 
ATOM   1481  N  NZ    . LYS B  1 17  ? 1.855   -60.108 -34.336 1.00 35.76 ? 16   LYS F NZ    1 
ATOM   1482  N  N     . THR B  1 18  ? -2.743  -56.967 -32.018 1.00 36.57 ? 17   THR F N     1 
ATOM   1483  C  CA    . THR B  1 18  ? -3.068  -55.665 -31.417 1.00 36.23 ? 17   THR F CA    1 
ATOM   1484  C  C     . THR B  1 18  ? -4.579  -55.481 -31.346 1.00 37.07 ? 17   THR F C     1 
ATOM   1485  O  O     . THR B  1 18  ? -5.113  -55.074 -30.299 1.00 37.20 ? 17   THR F O     1 
ATOM   1486  C  CB    . THR B  1 18  ? -2.405  -54.516 -32.192 1.00 36.41 ? 17   THR F CB    1 
ATOM   1487  O  OG1   . THR B  1 18  ? -0.997  -54.685 -32.135 1.00 33.97 ? 17   THR F OG1   1 
ATOM   1488  C  CG2   . THR B  1 18  ? -2.779  -53.127 -31.632 1.00 34.61 ? 17   THR F CG2   1 
ATOM   1489  N  N     . CYS B  1 19  ? -5.262  -55.790 -32.450 1.00 37.08 ? 18   CYS F N     1 
ATOM   1490  C  CA    . CYS B  1 19  ? -6.722  -55.718 -32.503 1.00 37.36 ? 18   CYS F CA    1 
ATOM   1491  C  C     . CYS B  1 19  ? -7.398  -56.578 -31.407 1.00 37.05 ? 18   CYS F C     1 
ATOM   1492  O  O     . CYS B  1 19  ? -8.347  -56.162 -30.784 1.00 36.88 ? 18   CYS F O     1 
ATOM   1493  C  CB    . CYS B  1 19  ? -7.225  -56.142 -33.894 1.00 37.19 ? 18   CYS F CB    1 
ATOM   1494  S  SG    . CYS B  1 19  ? -7.080  -54.855 -35.130 1.00 39.03 ? 18   CYS F SG    1 
ATOM   1495  N  N     . LEU B  1 20  ? -6.910  -57.787 -31.212 1.00 37.40 ? 19   LEU F N     1 
ATOM   1496  C  CA    . LEU B  1 20  ? -7.339  -58.636 -30.093 1.00 38.19 ? 19   LEU F CA    1 
ATOM   1497  C  C     . LEU B  1 20  ? -7.257  -57.909 -28.716 1.00 37.40 ? 19   LEU F C     1 
ATOM   1498  O  O     . LEU B  1 20  ? -8.204  -57.917 -27.940 1.00 36.22 ? 19   LEU F O     1 
ATOM   1499  C  CB    . LEU B  1 20  ? -6.474  -59.895 -30.090 1.00 38.84 ? 19   LEU F CB    1 
ATOM   1500  C  CG    . LEU B  1 20  ? -6.515  -60.811 -28.881 1.00 41.41 ? 19   LEU F CG    1 
ATOM   1501  C  CD1   . LEU B  1 20  ? -7.570  -61.896 -29.120 1.00 44.92 ? 19   LEU F CD1   1 
ATOM   1502  C  CD2   . LEU B  1 20  ? -5.168  -61.418 -28.672 1.00 44.74 ? 19   LEU F CD2   1 
ATOM   1503  N  N     . LEU B  1 21  ? -6.118  -57.275 -28.448 1.00 37.26 ? 20   LEU F N     1 
ATOM   1504  C  CA    . LEU B  1 21  ? -5.865  -56.598 -27.176 1.00 37.13 ? 20   LEU F CA    1 
ATOM   1505  C  C     . LEU B  1 21  ? -6.699  -55.317 -27.041 1.00 37.35 ? 20   LEU F C     1 
ATOM   1506  O  O     . LEU B  1 21  ? -7.341  -55.096 -26.020 1.00 37.17 ? 20   LEU F O     1 
ATOM   1507  C  CB    . LEU B  1 21  ? -4.363  -56.299 -27.034 1.00 37.56 ? 20   LEU F CB    1 
ATOM   1508  C  CG    . LEU B  1 21  ? -3.425  -57.521 -26.953 1.00 37.82 ? 20   LEU F CG    1 
ATOM   1509  C  CD1   . LEU B  1 21  ? -1.942  -57.149 -27.194 1.00 37.69 ? 20   LEU F CD1   1 
ATOM   1510  C  CD2   . LEU B  1 21  ? -3.554  -58.272 -25.612 1.00 35.77 ? 20   LEU F CD2   1 
ATOM   1511  N  N     . ILE B  1 22  ? -6.733  -54.504 -28.099 1.00 37.09 ? 21   ILE F N     1 
ATOM   1512  C  CA    . ILE B  1 22  ? -7.491  -53.259 -28.096 1.00 36.82 ? 21   ILE F CA    1 
ATOM   1513  C  C     . ILE B  1 22  ? -8.995  -53.527 -28.037 1.00 36.69 ? 21   ILE F C     1 
ATOM   1514  O  O     . ILE B  1 22  ? -9.730  -52.836 -27.331 1.00 36.75 ? 21   ILE F O     1 
ATOM   1515  C  CB    . ILE B  1 22  ? -7.109  -52.367 -29.314 1.00 36.73 ? 21   ILE F CB    1 
ATOM   1516  C  CG1   . ILE B  1 22  ? -5.628  -51.933 -29.226 1.00 37.62 ? 21   ILE F CG1   1 
ATOM   1517  C  CG2   . ILE B  1 22  ? -7.977  -51.128 -29.401 1.00 36.24 ? 21   ILE F CG2   1 
ATOM   1518  C  CD1   . ILE B  1 22  ? -5.247  -51.171 -27.925 1.00 37.50 ? 21   ILE F CD1   1 
ATOM   1519  N  N     . SER B  1 23  ? -9.451  -54.549 -28.753 1.00 36.74 ? 22   SER F N     1 
ATOM   1520  C  CA    . SER B  1 23  ? -10.866 -54.929 -28.729 1.00 36.27 ? 22   SER F CA    1 
ATOM   1521  C  C     . SER B  1 23  ? -11.298 -55.394 -27.340 1.00 36.59 ? 22   SER F C     1 
ATOM   1522  O  O     . SER B  1 23  ? -12.363 -55.011 -26.814 1.00 35.76 ? 22   SER F O     1 
ATOM   1523  C  CB    . SER B  1 23  ? -11.124 -56.038 -29.743 1.00 36.10 ? 22   SER F CB    1 
ATOM   1524  O  OG    . SER B  1 23  ? -12.503 -56.299 -29.836 1.00 35.15 ? 22   SER F OG    1 
ATOM   1525  N  N     . TYR B  1 24  ? -10.463 -56.235 -26.743 1.00 36.93 ? 23   TYR F N     1 
ATOM   1526  C  CA    . TYR B  1 24  ? -10.741 -56.764 -25.417 1.00 37.17 ? 23   TYR F CA    1 
ATOM   1527  C  C     . TYR B  1 24  ? -10.734 -55.647 -24.354 1.00 37.58 ? 23   TYR F C     1 
ATOM   1528  O  O     . TYR B  1 24  ? -11.664 -55.544 -23.569 1.00 37.28 ? 23   TYR F O     1 
ATOM   1529  C  CB    . TYR B  1 24  ? -9.738  -57.873 -25.085 1.00 37.15 ? 23   TYR F CB    1 
ATOM   1530  C  CG    . TYR B  1 24  ? -9.765  -58.312 -23.658 1.00 37.09 ? 23   TYR F CG    1 
ATOM   1531  C  CD1   . TYR B  1 24  ? -10.886 -58.941 -23.126 1.00 36.78 ? 23   TYR F CD1   1 
ATOM   1532  C  CD2   . TYR B  1 24  ? -8.679  -58.076 -22.824 1.00 35.81 ? 23   TYR F CD2   1 
ATOM   1533  C  CE1   . TYR B  1 24  ? -10.910 -59.333 -21.790 1.00 37.53 ? 23   TYR F CE1   1 
ATOM   1534  C  CE2   . TYR B  1 24  ? -8.697  -58.455 -21.502 1.00 36.37 ? 23   TYR F CE2   1 
ATOM   1535  C  CZ    . TYR B  1 24  ? -9.804  -59.087 -20.985 1.00 36.52 ? 23   TYR F CZ    1 
ATOM   1536  O  OH    . TYR B  1 24  ? -9.809  -59.439 -19.654 1.00 37.54 ? 23   TYR F OH    1 
ATOM   1537  N  N     . THR B  1 25  ? -9.707  -54.800 -24.356 1.00 37.99 ? 24   THR F N     1 
ATOM   1538  C  CA    . THR B  1 25  ? -9.547  -53.778 -23.310 1.00 38.68 ? 24   THR F CA    1 
ATOM   1539  C  C     . THR B  1 25  ? -10.416 -52.505 -23.480 1.00 38.61 ? 24   THR F C     1 
ATOM   1540  O  O     . THR B  1 25  ? -10.821 -51.891 -22.488 1.00 38.63 ? 24   THR F O     1 
ATOM   1541  C  CB    . THR B  1 25  ? -8.078  -53.343 -23.172 1.00 38.88 ? 24   THR F CB    1 
ATOM   1542  O  OG1   . THR B  1 25  ? -7.632  -52.752 -24.389 1.00 40.97 ? 24   THR F OG1   1 
ATOM   1543  C  CG2   . THR B  1 25  ? -7.190  -54.507 -22.862 1.00 39.66 ? 24   THR F CG2   1 
ATOM   1544  N  N     . THR B  1 26  ? -10.713 -52.111 -24.717 1.00 38.86 ? 25   THR F N     1 
ATOM   1545  C  CA    . THR B  1 26  ? -11.480 -50.874 -24.967 1.00 38.86 ? 25   THR F CA    1 
ATOM   1546  C  C     . THR B  1 26  ? -12.829 -51.082 -25.660 1.00 38.98 ? 25   THR F C     1 
ATOM   1547  O  O     . THR B  1 26  ? -13.597 -50.119 -25.824 1.00 38.92 ? 25   THR F O     1 
ATOM   1548  C  CB    . THR B  1 26  ? -10.686 -49.920 -25.862 1.00 38.82 ? 25   THR F CB    1 
ATOM   1549  O  OG1   . THR B  1 26  ? -10.669 -50.431 -27.201 1.00 39.82 ? 25   THR F OG1   1 
ATOM   1550  C  CG2   . THR B  1 26  ? -9.267  -49.759 -25.356 1.00 37.94 ? 25   THR F CG2   1 
ATOM   1551  N  N     . ASN B  1 27  ? -13.107 -52.309 -26.099 1.00 38.89 ? 26   ASN F N     1 
ATOM   1552  C  CA    . ASN B  1 27  ? -14.323 -52.618 -26.859 1.00 39.34 ? 26   ASN F CA    1 
ATOM   1553  C  C     . ASN B  1 27  ? -14.453 -51.808 -28.149 1.00 39.33 ? 26   ASN F C     1 
ATOM   1554  O  O     . ASN B  1 27  ? -15.545 -51.507 -28.590 1.00 39.94 ? 26   ASN F O     1 
ATOM   1555  C  CB    . ASN B  1 27  ? -15.573 -52.445 -25.978 1.00 39.39 ? 26   ASN F CB    1 
ATOM   1556  C  CG    . ASN B  1 27  ? -15.883 -53.677 -25.138 1.00 40.67 ? 26   ASN F CG    1 
ATOM   1557  O  OD1   . ASN B  1 27  ? -15.308 -54.757 -25.331 1.00 41.89 ? 26   ASN F OD1   1 
ATOM   1558  N  ND2   . ASN B  1 27  ? -16.825 -53.523 -24.206 1.00 41.12 ? 26   ASN F ND2   1 
ATOM   1559  N  N     . ALA B  1 28  ? -13.329 -51.445 -28.746 1.00 39.44 ? 27   ALA F N     1 
ATOM   1560  C  CA    . ALA B  1 28  ? -13.319 -50.779 -30.048 1.00 39.62 ? 27   ALA F CA    1 
ATOM   1561  C  C     . ALA B  1 28  ? -12.286 -51.470 -30.922 1.00 39.26 ? 27   ALA F C     1 
ATOM   1562  O  O     . ALA B  1 28  ? -11.287 -51.974 -30.418 1.00 39.25 ? 27   ALA F O     1 
ATOM   1563  C  CB    . ALA B  1 28  ? -13.008 -49.275 -29.902 1.00 39.72 ? 27   ALA F CB    1 
ATOM   1564  N  N     . PHE B  1 29  ? -12.571 -51.545 -32.217 1.00 39.37 ? 28   PHE F N     1 
ATOM   1565  C  CA    . PHE B  1 29  ? -11.698 -52.194 -33.197 1.00 39.10 ? 28   PHE F CA    1 
ATOM   1566  C  C     . PHE B  1 29  ? -10.921 -51.087 -33.881 1.00 39.29 ? 28   PHE F C     1 
ATOM   1567  O  O     . PHE B  1 29  ? -11.524 -50.156 -34.412 1.00 39.09 ? 28   PHE F O     1 
ATOM   1568  C  CB    . PHE B  1 29  ? -12.539 -52.960 -34.225 1.00 38.94 ? 28   PHE F CB    1 
ATOM   1569  C  CG    . PHE B  1 29  ? -11.737 -53.851 -35.143 1.00 38.48 ? 28   PHE F CG    1 
ATOM   1570  C  CD1   . PHE B  1 29  ? -11.394 -55.135 -34.762 1.00 38.04 ? 28   PHE F CD1   1 
ATOM   1571  C  CD2   . PHE B  1 29  ? -11.353 -53.413 -36.397 1.00 39.09 ? 28   PHE F CD2   1 
ATOM   1572  C  CE1   . PHE B  1 29  ? -10.661 -55.961 -35.603 1.00 36.57 ? 28   PHE F CE1   1 
ATOM   1573  C  CE2   . PHE B  1 29  ? -10.622 -54.233 -37.240 1.00 37.64 ? 28   PHE F CE2   1 
ATOM   1574  C  CZ    . PHE B  1 29  ? -10.283 -55.507 -36.835 1.00 38.41 ? 28   PHE F CZ    1 
ATOM   1575  N  N     . PRO B  1 30  ? -9.576  -51.171 -33.860 1.00 40.18 ? 29   PRO F N     1 
ATOM   1576  C  CA    . PRO B  1 30  ? -8.759  -50.167 -34.542 1.00 40.26 ? 29   PRO F CA    1 
ATOM   1577  C  C     . PRO B  1 30  ? -9.118  -49.973 -36.010 1.00 40.44 ? 29   PRO F C     1 
ATOM   1578  O  O     . PRO B  1 30  ? -9.229  -50.937 -36.762 1.00 40.05 ? 29   PRO F O     1 
ATOM   1579  C  CB    . PRO B  1 30  ? -7.343  -50.725 -34.403 1.00 40.50 ? 29   PRO F CB    1 
ATOM   1580  C  CG    . PRO B  1 30  ? -7.409  -51.551 -33.125 1.00 40.30 ? 29   PRO F CG    1 
ATOM   1581  C  CD    . PRO B  1 30  ? -8.744  -52.184 -33.176 1.00 39.77 ? 29   PRO F CD    1 
ATOM   1582  N  N     . GLY B  1 31  ? -9.278  -48.715 -36.403 1.00 41.13 ? 30   GLY F N     1 
ATOM   1583  C  CA    . GLY B  1 31  ? -9.717  -48.357 -37.757 1.00 41.16 ? 30   GLY F CA    1 
ATOM   1584  C  C     . GLY B  1 31  ? -8.637  -48.379 -38.831 1.00 41.14 ? 30   GLY F C     1 
ATOM   1585  O  O     . GLY B  1 31  ? -8.965  -48.357 -40.015 1.00 41.67 ? 30   GLY F O     1 
ATOM   1586  N  N     . GLU B  1 32  ? -7.368  -48.398 -38.421 1.00 40.69 ? 31   GLU F N     1 
ATOM   1587  C  CA    . GLU B  1 32  ? -6.227  -48.565 -39.323 1.00 40.70 ? 31   GLU F CA    1 
ATOM   1588  C  C     . GLU B  1 32  ? -5.401  -49.806 -38.971 1.00 40.05 ? 31   GLU F C     1 
ATOM   1589  O  O     . GLU B  1 32  ? -5.345  -50.234 -37.814 1.00 40.73 ? 31   GLU F O     1 
ATOM   1590  C  CB    . GLU B  1 32  ? -5.262  -47.373 -39.216 1.00 40.91 ? 31   GLU F CB    1 
ATOM   1591  C  CG    . GLU B  1 32  ? -5.740  -46.039 -39.755 1.00 42.91 ? 31   GLU F CG    1 
ATOM   1592  C  CD    . GLU B  1 32  ? -6.087  -46.069 -41.239 1.00 46.56 ? 31   GLU F CD    1 
ATOM   1593  O  OE1   . GLU B  1 32  ? -5.368  -46.743 -42.022 1.00 48.81 ? 31   GLU F OE1   1 
ATOM   1594  O  OE2   . GLU B  1 32  ? -7.083  -45.407 -41.620 1.00 47.92 ? 31   GLU F OE2   1 
ATOM   1595  N  N     . TYR B  1 33  ? -4.709  -50.339 -39.970 1.00 38.58 ? 32   TYR F N     1 
ATOM   1596  C  CA    . TYR B  1 33  ? -3.713  -51.355 -39.759 1.00 37.70 ? 32   TYR F CA    1 
ATOM   1597  C  C     . TYR B  1 33  ? -2.317  -50.689 -39.657 1.00 36.85 ? 32   TYR F C     1 
ATOM   1598  O  O     . TYR B  1 33  ? -1.808  -50.107 -40.628 1.00 36.09 ? 32   TYR F O     1 
ATOM   1599  C  CB    . TYR B  1 33  ? -3.806  -52.401 -40.876 1.00 37.63 ? 32   TYR F CB    1 
ATOM   1600  C  CG    . TYR B  1 33  ? -2.615  -53.344 -40.971 1.00 37.62 ? 32   TYR F CG    1 
ATOM   1601  C  CD1   . TYR B  1 33  ? -1.959  -53.807 -39.825 1.00 37.77 ? 32   TYR F CD1   1 
ATOM   1602  C  CD2   . TYR B  1 33  ? -2.156  -53.783 -42.205 1.00 36.98 ? 32   TYR F CD2   1 
ATOM   1603  C  CE1   . TYR B  1 33  ? -0.876  -54.662 -39.917 1.00 36.74 ? 32   TYR F CE1   1 
ATOM   1604  C  CE2   . TYR B  1 33  ? -1.076  -54.655 -42.303 1.00 36.95 ? 32   TYR F CE2   1 
ATOM   1605  C  CZ    . TYR B  1 33  ? -0.444  -55.091 -41.157 1.00 37.35 ? 32   TYR F CZ    1 
ATOM   1606  O  OH    . TYR B  1 33  ? 0.635   -55.937 -41.263 1.00 38.37 ? 32   TYR F OH    1 
ATOM   1607  N  N     . ILE B  1 34  ? -1.733  -50.749 -38.456 1.00 36.37 ? 33   ILE F N     1 
ATOM   1608  C  CA    . ILE B  1 34  ? -0.433  -50.124 -38.155 1.00 35.91 ? 33   ILE F CA    1 
ATOM   1609  C  C     . ILE B  1 34  ? 0.371   -51.106 -37.309 1.00 35.80 ? 33   ILE F C     1 
ATOM   1610  O  O     . ILE B  1 34  ? 0.062   -51.301 -36.147 1.00 36.07 ? 33   ILE F O     1 
ATOM   1611  C  CB    . ILE B  1 34  ? -0.576  -48.794 -37.356 1.00 35.77 ? 33   ILE F CB    1 
ATOM   1612  C  CG1   . ILE B  1 34  ? -1.406  -47.757 -38.113 1.00 35.74 ? 33   ILE F CG1   1 
ATOM   1613  C  CG2   . ILE B  1 34  ? 0.784   -48.188 -37.029 1.00 35.55 ? 33   ILE F CG2   1 
ATOM   1614  C  CD1   . ILE B  1 34  ? -1.807  -46.545 -37.226 1.00 35.54 ? 33   ILE F CD1   1 
ATOM   1615  N  N     . PRO B  1 35  ? 1.392   -51.745 -37.891 1.00 35.64 ? 34   PRO F N     1 
ATOM   1616  C  CA    . PRO B  1 35  ? 2.232   -52.682 -37.169 1.00 35.80 ? 34   PRO F CA    1 
ATOM   1617  C  C     . PRO B  1 35  ? 2.910   -52.109 -35.920 1.00 35.70 ? 34   PRO F C     1 
ATOM   1618  O  O     . PRO B  1 35  ? 3.234   -50.928 -35.854 1.00 36.03 ? 34   PRO F O     1 
ATOM   1619  C  CB    . PRO B  1 35  ? 3.315   -53.028 -38.191 1.00 35.65 ? 34   PRO F CB    1 
ATOM   1620  C  CG    . PRO B  1 35  ? 2.708   -52.807 -39.470 1.00 36.18 ? 34   PRO F CG    1 
ATOM   1621  C  CD    . PRO B  1 35  ? 1.790   -51.657 -39.304 1.00 35.80 ? 34   PRO F CD    1 
ATOM   1622  N  N     . THR B  1 36  ? 3.202   -53.002 -34.996 1.00 35.87 ? 35   THR F N     1 
ATOM   1623  C  CA    . THR B  1 36  ? 3.673   -52.668 -33.678 1.00 35.92 ? 35   THR F CA    1 
ATOM   1624  C  C     . THR B  1 36  ? 5.170   -52.761 -33.644 1.00 35.62 ? 35   THR F C     1 
ATOM   1625  O  O     . THR B  1 36  ? 5.749   -53.666 -34.242 1.00 35.51 ? 35   THR F O     1 
ATOM   1626  C  CB    . THR B  1 36  ? 3.076   -53.686 -32.680 1.00 35.94 ? 35   THR F CB    1 
ATOM   1627  O  OG1   . THR B  1 36  ? 1.645   -53.564 -32.711 1.00 36.62 ? 35   THR F OG1   1 
ATOM   1628  C  CG2   . THR B  1 36  ? 3.595   -53.472 -31.259 1.00 35.75 ? 35   THR F CG2   1 
ATOM   1629  N  N     . VAL B  1 37  ? 5.808   -51.850 -32.928 1.00 35.66 ? 36   VAL F N     1 
ATOM   1630  C  CA    . VAL B  1 37  ? 7.207   -52.064 -32.570 1.00 35.71 ? 36   VAL F CA    1 
ATOM   1631  C  C     . VAL B  1 37  ? 7.165   -52.738 -31.207 1.00 36.00 ? 36   VAL F C     1 
ATOM   1632  O  O     . VAL B  1 37  ? 7.589   -53.891 -31.067 1.00 36.19 ? 36   VAL F O     1 
ATOM   1633  C  CB    . VAL B  1 37  ? 8.010   -50.767 -32.568 1.00 36.13 ? 36   VAL F CB    1 
ATOM   1634  C  CG1   . VAL B  1 37  ? 9.477   -51.025 -32.126 1.00 35.32 ? 36   VAL F CG1   1 
ATOM   1635  C  CG2   . VAL B  1 37  ? 7.925   -50.106 -33.954 1.00 35.71 ? 36   VAL F CG2   1 
ATOM   1636  N  N     . PHE B  1 38  ? 6.636   -52.009 -30.217 1.00 35.95 ? 37   PHE F N     1 
ATOM   1637  C  CA    . PHE B  1 38  ? 6.247   -52.574 -28.940 1.00 35.67 ? 37   PHE F CA    1 
ATOM   1638  C  C     . PHE B  1 38  ? 5.249   -51.669 -28.218 1.00 36.22 ? 37   PHE F C     1 
ATOM   1639  O  O     . PHE B  1 38  ? 5.367   -50.437 -28.239 1.00 36.87 ? 37   PHE F O     1 
ATOM   1640  C  CB    . PHE B  1 38  ? 7.463   -52.831 -28.043 1.00 35.39 ? 37   PHE F CB    1 
ATOM   1641  C  CG    . PHE B  1 38  ? 7.083   -53.236 -26.652 1.00 34.58 ? 37   PHE F CG    1 
ATOM   1642  C  CD1   . PHE B  1 38  ? 6.562   -54.492 -26.413 1.00 35.21 ? 37   PHE F CD1   1 
ATOM   1643  C  CD2   . PHE B  1 38  ? 7.168   -52.336 -25.598 1.00 34.45 ? 37   PHE F CD2   1 
ATOM   1644  C  CE1   . PHE B  1 38  ? 6.168   -54.863 -25.154 1.00 34.32 ? 37   PHE F CE1   1 
ATOM   1645  C  CE2   . PHE B  1 38  ? 6.791   -52.711 -24.342 1.00 34.61 ? 37   PHE F CE2   1 
ATOM   1646  C  CZ    . PHE B  1 38  ? 6.281   -53.979 -24.120 1.00 33.74 ? 37   PHE F CZ    1 
ATOM   1647  N  N     . ASP B  1 39  ? 4.257   -52.276 -27.581 1.00 36.72 ? 38   ASP F N     1 
ATOM   1648  C  CA    . ASP B  1 39  ? 3.309   -51.527 -26.749 1.00 37.33 ? 38   ASP F CA    1 
ATOM   1649  C  C     . ASP B  1 39  ? 2.984   -52.304 -25.486 1.00 37.31 ? 38   ASP F C     1 
ATOM   1650  O  O     . ASP B  1 39  ? 2.968   -53.530 -25.493 1.00 37.12 ? 38   ASP F O     1 
ATOM   1651  C  CB    . ASP B  1 39  ? 2.021   -51.195 -27.518 1.00 37.45 ? 38   ASP F CB    1 
ATOM   1652  C  CG    . ASP B  1 39  ? 2.206   -50.060 -28.526 1.00 39.14 ? 38   ASP F CG    1 
ATOM   1653  O  OD1   . ASP B  1 39  ? 2.046   -48.883 -28.153 1.00 39.60 ? 38   ASP F OD1   1 
ATOM   1654  O  OD2   . ASP B  1 39  ? 2.502   -50.347 -29.696 1.00 42.42 ? 38   ASP F OD2   1 
ATOM   1655  N  N     . ASN B  1 40  ? 2.734   -51.579 -24.399 1.00 37.80 ? 39   ASN F N     1 
ATOM   1656  C  CA    . ASN B  1 40  ? 2.329   -52.200 -23.135 1.00 38.24 ? 39   ASN F CA    1 
ATOM   1657  C  C     . ASN B  1 40  ? 1.024   -51.600 -22.659 1.00 38.35 ? 39   ASN F C     1 
ATOM   1658  O  O     . ASN B  1 40  ? 0.860   -50.376 -22.612 1.00 38.06 ? 39   ASN F O     1 
ATOM   1659  C  CB    . ASN B  1 40  ? 3.398   -52.031 -22.066 1.00 38.81 ? 39   ASN F CB    1 
ATOM   1660  C  CG    . ASN B  1 40  ? 2.980   -52.588 -20.714 1.00 39.80 ? 39   ASN F CG    1 
ATOM   1661  O  OD1   . ASN B  1 40  ? 2.685   -51.836 -19.807 1.00 46.42 ? 39   ASN F OD1   1 
ATOM   1662  N  ND2   . ASN B  1 40  ? 2.966   -53.897 -20.578 1.00 44.16 ? 39   ASN F ND2   1 
ATOM   1663  N  N     . TYR B  1 41  ? 0.088   -52.475 -22.339 1.00 38.66 ? 40   TYR F N     1 
ATOM   1664  C  CA    . TYR B  1 41  ? -1.205  -52.064 -21.852 1.00 39.71 ? 40   TYR F CA    1 
ATOM   1665  C  C     . TYR B  1 41  ? -1.454  -52.665 -20.466 1.00 39.93 ? 40   TYR F C     1 
ATOM   1666  O  O     . TYR B  1 41  ? -0.941  -53.734 -20.140 1.00 39.64 ? 40   TYR F O     1 
ATOM   1667  C  CB    . TYR B  1 41  ? -2.294  -52.507 -22.826 1.00 40.56 ? 40   TYR F CB    1 
ATOM   1668  C  CG    . TYR B  1 41  ? -2.010  -52.169 -24.280 1.00 41.42 ? 40   TYR F CG    1 
ATOM   1669  C  CD1   . TYR B  1 41  ? -1.723  -53.169 -25.196 1.00 42.55 ? 40   TYR F CD1   1 
ATOM   1670  C  CD2   . TYR B  1 41  ? -2.056  -50.855 -24.738 1.00 41.14 ? 40   TYR F CD2   1 
ATOM   1671  C  CE1   . TYR B  1 41  ? -1.474  -52.873 -26.528 1.00 42.40 ? 40   TYR F CE1   1 
ATOM   1672  C  CE2   . TYR B  1 41  ? -1.809  -50.550 -26.074 1.00 41.64 ? 40   TYR F CE2   1 
ATOM   1673  C  CZ    . TYR B  1 41  ? -1.509  -51.568 -26.951 1.00 42.86 ? 40   TYR F CZ    1 
ATOM   1674  O  OH    . TYR B  1 41  ? -1.254  -51.301 -28.259 1.00 44.48 ? 40   TYR F OH    1 
ATOM   1675  N  N     . SER B  1 42  ? -2.215  -51.943 -19.649 1.00 40.04 ? 41   SER F N     1 
ATOM   1676  C  CA    A SER B  1 42  ? -2.684  -52.479 -18.380 0.50 40.16 ? 41   SER F CA    1 
ATOM   1677  C  CA    B SER B  1 42  ? -2.680  -52.432 -18.355 0.50 40.51 ? 41   SER F CA    1 
ATOM   1678  C  C     . SER B  1 42  ? -4.195  -52.323 -18.269 1.00 40.37 ? 41   SER F C     1 
ATOM   1679  O  O     . SER B  1 42  ? -4.794  -51.429 -18.890 1.00 40.05 ? 41   SER F O     1 
ATOM   1680  C  CB    A SER B  1 42  ? -1.987  -51.805 -17.192 0.50 40.21 ? 41   SER F CB    1 
ATOM   1681  C  CB    B SER B  1 42  ? -2.068  -51.613 -17.219 0.50 40.64 ? 41   SER F CB    1 
ATOM   1682  O  OG    A SER B  1 42  ? -2.209  -50.408 -17.178 0.50 39.69 ? 41   SER F OG    1 
ATOM   1683  O  OG    B SER B  1 42  ? -0.657  -51.635 -17.285 0.50 42.20 ? 41   SER F OG    1 
ATOM   1684  N  N     . ALA B  1 43  ? -4.798  -53.222 -17.495 1.00 40.56 ? 42   ALA F N     1 
ATOM   1685  C  CA    . ALA B  1 43  ? -6.219  -53.153 -17.142 1.00 40.75 ? 42   ALA F CA    1 
ATOM   1686  C  C     . ALA B  1 43  ? -6.431  -53.846 -15.796 1.00 40.98 ? 42   ALA F C     1 
ATOM   1687  O  O     . ALA B  1 43  ? -5.562  -54.571 -15.325 1.00 40.25 ? 42   ALA F O     1 
ATOM   1688  C  CB    . ALA B  1 43  ? -7.094  -53.801 -18.228 1.00 40.87 ? 42   ALA F CB    1 
ATOM   1689  N  N     . ASN B  1 44  ? -7.574  -53.586 -15.167 1.00 41.68 ? 43   ASN F N     1 
ATOM   1690  C  CA    . ASN B  1 44  ? -7.980  -54.331 -13.983 1.00 42.33 ? 43   ASN F CA    1 
ATOM   1691  C  C     . ASN B  1 44  ? -9.108  -55.296 -14.317 1.00 42.27 ? 43   ASN F C     1 
ATOM   1692  O  O     . ASN B  1 44  ? -9.988  -55.006 -15.129 1.00 41.71 ? 43   ASN F O     1 
ATOM   1693  C  CB    . ASN B  1 44  ? -8.387  -53.387 -12.849 1.00 42.97 ? 43   ASN F CB    1 
ATOM   1694  C  CG    . ASN B  1 44  ? -7.195  -52.662 -12.254 1.00 45.27 ? 43   ASN F CG    1 
ATOM   1695  O  OD1   . ASN B  1 44  ? -6.094  -53.228 -12.160 1.00 49.52 ? 43   ASN F OD1   1 
ATOM   1696  N  ND2   . ASN B  1 44  ? -7.395  -51.403 -11.860 1.00 46.33 ? 43   ASN F ND2   1 
ATOM   1697  N  N     . VAL B  1 45  ? -9.032  -56.468 -13.705 1.00 42.38 ? 44   VAL F N     1 
ATOM   1698  C  CA    . VAL B  1 45  ? -10.064 -57.467 -13.792 1.00 42.57 ? 44   VAL F CA    1 
ATOM   1699  C  C     . VAL B  1 45  ? -10.322 -57.952 -12.359 1.00 43.11 ? 44   VAL F C     1 
ATOM   1700  O  O     . VAL B  1 45  ? -9.419  -57.953 -11.506 1.00 42.57 ? 44   VAL F O     1 
ATOM   1701  C  CB    . VAL B  1 45  ? -9.628  -58.618 -14.742 1.00 42.61 ? 44   VAL F CB    1 
ATOM   1702  C  CG1   . VAL B  1 45  ? -10.554 -59.797 -14.647 1.00 43.04 ? 44   VAL F CG1   1 
ATOM   1703  C  CG2   . VAL B  1 45  ? -9.600  -58.118 -16.174 1.00 42.61 ? 44   VAL F CG2   1 
ATOM   1704  N  N     . MET B  1 46  ? -11.566 -58.334 -12.103 1.00 43.57 ? 45   MET F N     1 
ATOM   1705  C  CA    . MET B  1 46  ? -11.974 -58.843 -10.808 1.00 44.17 ? 45   MET F CA    1 
ATOM   1706  C  C     . MET B  1 46  ? -12.213 -60.341 -10.994 1.00 44.10 ? 45   MET F C     1 
ATOM   1707  O  O     . MET B  1 46  ? -12.984 -60.739 -11.860 1.00 43.57 ? 45   MET F O     1 
ATOM   1708  C  CB    . MET B  1 46  ? -13.244 -58.126 -10.347 1.00 44.59 ? 45   MET F CB    1 
ATOM   1709  C  CG    . MET B  1 46  ? -13.243 -57.763 -8.890  1.00 46.47 ? 45   MET F CG    1 
ATOM   1710  S  SD    . MET B  1 46  ? -12.177 -56.352 -8.545  1.00 50.05 ? 45   MET F SD    1 
ATOM   1711  C  CE    . MET B  1 46  ? -11.756 -56.703 -6.845  1.00 46.99 ? 45   MET F CE    1 
ATOM   1712  N  N     . VAL B  1 47  ? -11.516 -61.154 -10.204 1.00 44.37 ? 46   VAL F N     1 
ATOM   1713  C  CA    . VAL B  1 47  ? -11.554 -62.606 -10.316 1.00 44.48 ? 46   VAL F CA    1 
ATOM   1714  C  C     . VAL B  1 47  ? -12.022 -63.162 -8.983  1.00 45.17 ? 46   VAL F C     1 
ATOM   1715  O  O     . VAL B  1 47  ? -11.319 -63.042 -7.976  1.00 45.35 ? 46   VAL F O     1 
ATOM   1716  C  CB    . VAL B  1 47  ? -10.158 -63.173 -10.629 1.00 44.69 ? 46   VAL F CB    1 
ATOM   1717  C  CG1   . VAL B  1 47  ? -10.239 -64.669 -10.933 1.00 44.46 ? 46   VAL F CG1   1 
ATOM   1718  C  CG2   . VAL B  1 47  ? -9.510  -62.410 -11.787 1.00 44.30 ? 46   VAL F CG2   1 
ATOM   1719  N  N     . ASP B  1 48  ? -13.214 -63.757 -8.966  1.00 45.90 ? 47   ASP F N     1 
ATOM   1720  C  CA    . ASP B  1 48  ? -13.812 -64.256 -7.725  1.00 46.48 ? 47   ASP F CA    1 
ATOM   1721  C  C     . ASP B  1 48  ? -13.726 -63.191 -6.617  1.00 46.60 ? 47   ASP F C     1 
ATOM   1722  O  O     . ASP B  1 48  ? -13.370 -63.496 -5.472  1.00 46.90 ? 47   ASP F O     1 
ATOM   1723  C  CB    . ASP B  1 48  ? -13.127 -65.555 -7.253  1.00 46.67 ? 47   ASP F CB    1 
ATOM   1724  C  CG    . ASP B  1 48  ? -13.063 -66.624 -8.335  1.00 48.11 ? 47   ASP F CG    1 
ATOM   1725  O  OD1   . ASP B  1 48  ? -13.969 -66.681 -9.202  1.00 50.78 ? 47   ASP F OD1   1 
ATOM   1726  O  OD2   . ASP B  1 48  ? -12.095 -67.413 -8.315  1.00 49.21 ? 47   ASP F OD2   1 
ATOM   1727  N  N     . GLY B  1 49  ? -14.017 -61.943 -6.967  1.00 46.59 ? 48   GLY F N     1 
ATOM   1728  C  CA    . GLY B  1 49  ? -14.031 -60.857 -5.983  1.00 46.89 ? 48   GLY F CA    1 
ATOM   1729  C  C     . GLY B  1 49  ? -12.683 -60.248 -5.593  1.00 46.99 ? 48   GLY F C     1 
ATOM   1730  O  O     . GLY B  1 49  ? -12.649 -59.293 -4.801  1.00 47.46 ? 48   GLY F O     1 
ATOM   1731  N  N     . LYS B  1 50  ? -11.585 -60.775 -6.145  1.00 46.60 ? 49   LYS F N     1 
ATOM   1732  C  CA    . LYS B  1 50  ? -10.240 -60.265 -5.871  1.00 46.08 ? 49   LYS F CA    1 
ATOM   1733  C  C     . LYS B  1 50  ? -9.730  -59.456 -7.077  1.00 45.32 ? 49   LYS F C     1 
ATOM   1734  O  O     . LYS B  1 50  ? -10.012 -59.803 -8.211  1.00 44.87 ? 49   LYS F O     1 
ATOM   1735  C  CB    . LYS B  1 50  ? -9.280  -61.422 -5.560  1.00 46.31 ? 49   LYS F CB    1 
ATOM   1736  C  CG    . LYS B  1 50  ? -9.402  -62.018 -4.143  1.00 47.80 ? 49   LYS F CG    1 
ATOM   1737  C  CD    . LYS B  1 50  ? -10.060 -63.406 -4.125  1.00 49.84 ? 49   LYS F CD    1 
ATOM   1738  N  N     . PRO B  1 51  ? -8.984  -58.363 -6.835  1.00 44.63 ? 50   PRO F N     1 
ATOM   1739  C  CA    . PRO B  1 51  ? -8.501  -57.574 -7.956  1.00 44.01 ? 50   PRO F CA    1 
ATOM   1740  C  C     . PRO B  1 51  ? -7.180  -58.100 -8.511  1.00 43.53 ? 50   PRO F C     1 
ATOM   1741  O  O     . PRO B  1 51  ? -6.289  -58.524 -7.760  1.00 42.79 ? 50   PRO F O     1 
ATOM   1742  C  CB    . PRO B  1 51  ? -8.336  -56.175 -7.361  1.00 44.05 ? 50   PRO F CB    1 
ATOM   1743  C  CG    . PRO B  1 51  ? -8.158  -56.382 -5.895  1.00 44.60 ? 50   PRO F CG    1 
ATOM   1744  C  CD    . PRO B  1 51  ? -8.565  -57.791 -5.544  1.00 44.70 ? 50   PRO F CD    1 
ATOM   1745  N  N     . VAL B  1 52  ? -7.076  -58.081 -9.832  1.00 42.99 ? 51   VAL F N     1 
ATOM   1746  C  CA    . VAL B  1 52  ? -5.909  -58.599 -10.522 1.00 42.65 ? 51   VAL F CA    1 
ATOM   1747  C  C     . VAL B  1 52  ? -5.428  -57.547 -11.500 1.00 42.96 ? 51   VAL F C     1 
ATOM   1748  O  O     . VAL B  1 52  ? -6.229  -56.997 -12.261 1.00 43.07 ? 51   VAL F O     1 
ATOM   1749  C  CB    . VAL B  1 52  ? -6.229  -59.924 -11.277 1.00 42.32 ? 51   VAL F CB    1 
ATOM   1750  C  CG1   . VAL B  1 52  ? -4.979  -60.463 -11.947 1.00 42.02 ? 51   VAL F CG1   1 
ATOM   1751  C  CG2   . VAL B  1 52  ? -6.794  -60.949 -10.331 1.00 40.58 ? 51   VAL F CG2   1 
ATOM   1752  N  N     . ASN B  1 53  ? -4.135  -57.240 -11.470 1.00 43.30 ? 52   ASN F N     1 
ATOM   1753  C  CA    . ASN B  1 53  ? -3.581  -56.304 -12.437 1.00 44.11 ? 52   ASN F CA    1 
ATOM   1754  C  C     . ASN B  1 53  ? -3.055  -57.052 -13.649 1.00 43.72 ? 52   ASN F C     1 
ATOM   1755  O  O     . ASN B  1 53  ? -2.040  -57.753 -13.584 1.00 43.48 ? 52   ASN F O     1 
ATOM   1756  C  CB    . ASN B  1 53  ? -2.486  -55.429 -11.823 1.00 44.73 ? 52   ASN F CB    1 
ATOM   1757  C  CG    . ASN B  1 53  ? -1.902  -54.401 -12.827 1.00 48.12 ? 52   ASN F CG    1 
ATOM   1758  O  OD1   . ASN B  1 53  ? -0.713  -54.082 -12.756 1.00 53.49 ? 52   ASN F OD1   1 
ATOM   1759  N  ND2   . ASN B  1 53  ? -2.734  -53.884 -13.749 1.00 49.29 ? 52   ASN F ND2   1 
ATOM   1760  N  N     . LEU B  1 54  ? -3.745  -56.866 -14.763 1.00 43.31 ? 53   LEU F N     1 
ATOM   1761  C  CA    . LEU B  1 54  ? -3.445  -57.567 -15.993 1.00 43.26 ? 53   LEU F CA    1 
ATOM   1762  C  C     . LEU B  1 54  ? -2.507  -56.679 -16.808 1.00 42.55 ? 53   LEU F C     1 
ATOM   1763  O  O     . LEU B  1 54  ? -2.850  -55.532 -17.108 1.00 42.66 ? 53   LEU F O     1 
ATOM   1764  C  CB    . LEU B  1 54  ? -4.766  -57.832 -16.719 1.00 43.30 ? 53   LEU F CB    1 
ATOM   1765  C  CG    . LEU B  1 54  ? -4.787  -58.729 -17.950 1.00 44.94 ? 53   LEU F CG    1 
ATOM   1766  C  CD1   . LEU B  1 54  ? -4.061  -60.058 -17.726 1.00 47.14 ? 53   LEU F CD1   1 
ATOM   1767  C  CD2   . LEU B  1 54  ? -6.238  -58.979 -18.346 1.00 44.80 ? 53   LEU F CD2   1 
ATOM   1768  N  N     . GLY B  1 55  ? -1.312  -57.187 -17.113 1.00 41.20 ? 54   GLY F N     1 
ATOM   1769  C  CA    . GLY B  1 55  ? -0.314  -56.467 -17.912 1.00 40.60 ? 54   GLY F CA    1 
ATOM   1770  C  C     . GLY B  1 55  ? -0.160  -57.139 -19.261 1.00 39.96 ? 54   GLY F C     1 
ATOM   1771  O  O     . GLY B  1 55  ? 0.105   -58.344 -19.322 1.00 38.98 ? 54   GLY F O     1 
ATOM   1772  N  N     . LEU B  1 56  ? -0.335  -56.373 -20.339 1.00 39.43 ? 55   LEU F N     1 
ATOM   1773  C  CA    . LEU B  1 56  ? -0.377  -56.941 -21.693 1.00 39.65 ? 55   LEU F CA    1 
ATOM   1774  C  C     . LEU B  1 56  ? 0.755   -56.356 -22.539 1.00 39.33 ? 55   LEU F C     1 
ATOM   1775  O  O     . LEU B  1 56  ? 0.824   -55.149 -22.739 1.00 38.94 ? 55   LEU F O     1 
ATOM   1776  C  CB    . LEU B  1 56  ? -1.736  -56.664 -22.349 1.00 39.88 ? 55   LEU F CB    1 
ATOM   1777  C  CG    . LEU B  1 56  ? -3.036  -57.040 -21.596 1.00 40.62 ? 55   LEU F CG    1 
ATOM   1778  C  CD1   . LEU B  1 56  ? -4.186  -56.181 -22.085 1.00 39.43 ? 55   LEU F CD1   1 
ATOM   1779  C  CD2   . LEU B  1 56  ? -3.400  -58.532 -21.730 1.00 41.78 ? 55   LEU F CD2   1 
ATOM   1780  N  N     . TRP B  1 57  ? 1.656   -57.228 -22.985 1.00 39.35 ? 56   TRP F N     1 
ATOM   1781  C  CA    . TRP B  1 57  ? 2.871   -56.851 -23.699 1.00 39.39 ? 56   TRP F CA    1 
ATOM   1782  C  C     . TRP B  1 57  ? 2.660   -57.268 -25.143 1.00 39.04 ? 56   TRP F C     1 
ATOM   1783  O  O     . TRP B  1 57  ? 2.677   -58.469 -25.473 1.00 38.83 ? 56   TRP F O     1 
ATOM   1784  C  CB    . TRP B  1 57  ? 4.092   -57.533 -23.073 1.00 40.17 ? 56   TRP F CB    1 
ATOM   1785  C  CG    . TRP B  1 57  ? 4.245   -57.182 -21.600 1.00 41.48 ? 56   TRP F CG    1 
ATOM   1786  C  CD1   . TRP B  1 57  ? 3.309   -57.374 -20.604 1.00 41.15 ? 56   TRP F CD1   1 
ATOM   1787  C  CD2   . TRP B  1 57  ? 5.379   -56.583 -20.967 1.00 40.63 ? 56   TRP F CD2   1 
ATOM   1788  N  NE1   . TRP B  1 57  ? 3.788   -56.917 -19.415 1.00 41.64 ? 56   TRP F NE1   1 
ATOM   1789  C  CE2   . TRP B  1 57  ? 5.057   -56.426 -19.602 1.00 41.77 ? 56   TRP F CE2   1 
ATOM   1790  C  CE3   . TRP B  1 57  ? 6.632   -56.164 -21.418 1.00 41.20 ? 56   TRP F CE3   1 
ATOM   1791  C  CZ2   . TRP B  1 57  ? 5.954   -55.865 -18.677 1.00 42.14 ? 56   TRP F CZ2   1 
ATOM   1792  C  CZ3   . TRP B  1 57  ? 7.525   -55.592 -20.504 1.00 41.60 ? 56   TRP F CZ3   1 
ATOM   1793  C  CH2   . TRP B  1 57  ? 7.179   -55.438 -19.153 1.00 42.08 ? 56   TRP F CH2   1 
ATOM   1794  N  N     . ASP B  1 58  ? 2.376   -56.263 -25.974 1.00 38.21 ? 57   ASP F N     1 
ATOM   1795  C  CA    . ASP B  1 58  ? 2.008   -56.438 -27.380 1.00 37.78 ? 57   ASP F CA    1 
ATOM   1796  C  C     . ASP B  1 58  ? 3.279   -56.309 -28.233 1.00 37.38 ? 57   ASP F C     1 
ATOM   1797  O  O     . ASP B  1 58  ? 3.788   -55.200 -28.414 1.00 37.70 ? 57   ASP F O     1 
ATOM   1798  C  CB    . ASP B  1 58  ? 0.991   -55.345 -27.775 1.00 37.75 ? 57   ASP F CB    1 
ATOM   1799  C  CG    . ASP B  1 58  ? 0.379   -55.574 -29.153 1.00 38.93 ? 57   ASP F CG    1 
ATOM   1800  O  OD1   . ASP B  1 58  ? 0.523   -56.687 -29.682 1.00 41.82 ? 57   ASP F OD1   1 
ATOM   1801  O  OD2   . ASP B  1 58  ? -0.211  -54.639 -29.730 1.00 37.35 ? 57   ASP F OD2   1 
ATOM   1802  N  N     . THR B  1 59  ? 3.804   -57.434 -28.729 1.00 36.63 ? 58   THR F N     1 
ATOM   1803  C  CA    . THR B  1 59  ? 5.081   -57.432 -29.454 1.00 35.96 ? 58   THR F CA    1 
ATOM   1804  C  C     . THR B  1 59  ? 4.977   -57.339 -30.990 1.00 36.41 ? 58   THR F C     1 
ATOM   1805  O  O     . THR B  1 59  ? 3.870   -57.388 -31.589 1.00 35.98 ? 58   THR F O     1 
ATOM   1806  C  CB    . THR B  1 59  ? 5.926   -58.679 -29.111 1.00 35.86 ? 58   THR F CB    1 
ATOM   1807  O  OG1   . THR B  1 59  ? 5.339   -59.829 -29.739 1.00 34.66 ? 58   THR F OG1   1 
ATOM   1808  C  CG2   . THR B  1 59  ? 6.075   -58.878 -27.576 1.00 34.30 ? 58   THR F CG2   1 
ATOM   1809  N  N     . ALA B  1 60  ? 6.150   -57.203 -31.628 1.00 36.46 ? 59   ALA F N     1 
ATOM   1810  C  CA    . ALA B  1 60  ? 6.241   -57.049 -33.094 1.00 36.56 ? 59   ALA F CA    1 
ATOM   1811  C  C     . ALA B  1 60  ? 6.216   -58.391 -33.813 1.00 36.75 ? 59   ALA F C     1 
ATOM   1812  O  O     . ALA B  1 60  ? 6.951   -59.310 -33.469 1.00 37.03 ? 59   ALA F O     1 
ATOM   1813  C  CB    . ALA B  1 60  ? 7.506   -56.279 -33.482 1.00 36.42 ? 59   ALA F CB    1 
ATOM   1814  N  N     . GLY B  1 61  ? 5.365   -58.505 -34.820 1.00 36.99 ? 60   GLY F N     1 
ATOM   1815  C  CA    . GLY B  1 61  ? 5.375   -59.675 -35.687 1.00 37.81 ? 60   GLY F CA    1 
ATOM   1816  C  C     . GLY B  1 61  ? 6.427   -59.570 -36.766 1.00 37.71 ? 60   GLY F C     1 
ATOM   1817  O  O     . GLY B  1 61  ? 6.833   -60.571 -37.333 1.00 37.81 ? 60   GLY F O     1 
ATOM   1818  N  N     . GLN B  1 62  ? 6.861   -58.344 -37.053 1.00 38.00 ? 61   GLN F N     1 
ATOM   1819  C  CA    . GLN B  1 62  ? 7.882   -58.107 -38.053 1.00 38.06 ? 61   GLN F CA    1 
ATOM   1820  C  C     . GLN B  1 62  ? 9.211   -58.715 -37.622 1.00 38.03 ? 61   GLN F C     1 
ATOM   1821  O  O     . GLN B  1 62  ? 9.723   -58.408 -36.537 1.00 37.47 ? 61   GLN F O     1 
ATOM   1822  C  CB    . GLN B  1 62  ? 8.084   -56.614 -38.265 1.00 37.57 ? 61   GLN F CB    1 
ATOM   1823  C  CG    . GLN B  1 62  ? 6.953   -55.894 -38.949 1.00 38.78 ? 61   GLN F CG    1 
ATOM   1824  C  CD    . GLN B  1 62  ? 7.165   -54.380 -38.896 1.00 37.87 ? 61   GLN F CD    1 
ATOM   1825  O  OE1   . GLN B  1 62  ? 6.555   -53.662 -38.079 1.00 37.41 ? 61   GLN F OE1   1 
ATOM   1826  N  NE2   . GLN B  1 62  ? 8.076   -53.907 -39.724 1.00 33.51 ? 61   GLN F NE2   1 
ATOM   1827  N  N     . GLU B  1 63  ? 9.796   -59.536 -38.487 1.00 38.49 ? 62   GLU F N     1 
ATOM   1828  C  CA    . GLU B  1 63  ? 11.072  -60.183 -38.155 1.00 39.59 ? 62   GLU F CA    1 
ATOM   1829  C  C     . GLU B  1 63  ? 12.230  -59.193 -38.026 1.00 39.05 ? 62   GLU F C     1 
ATOM   1830  O  O     . GLU B  1 63  ? 13.171  -59.458 -37.287 1.00 39.09 ? 62   GLU F O     1 
ATOM   1831  C  CB    . GLU B  1 63  ? 11.414  -61.310 -39.138 1.00 39.52 ? 62   GLU F CB    1 
ATOM   1832  C  CG    . GLU B  1 63  ? 11.951  -60.866 -40.491 1.00 41.62 ? 62   GLU F CG    1 
ATOM   1833  C  CD    . GLU B  1 63  ? 12.145  -62.030 -41.453 1.00 42.12 ? 62   GLU F CD    1 
ATOM   1834  O  OE1   . GLU B  1 63  ? 12.497  -63.144 -41.005 1.00 45.22 ? 62   GLU F OE1   1 
ATOM   1835  O  OE2   . GLU B  1 63  ? 11.957  -61.819 -42.669 1.00 46.18 ? 62   GLU F OE2   1 
ATOM   1836  N  N     . ASP B  1 64  ? 12.147  -58.051 -38.712 1.00 38.93 ? 63   ASP F N     1 
ATOM   1837  C  CA    . ASP B  1 64  ? 13.111  -56.942 -38.509 1.00 38.85 ? 63   ASP F CA    1 
ATOM   1838  C  C     . ASP B  1 64  ? 13.216  -56.491 -37.042 1.00 38.42 ? 63   ASP F C     1 
ATOM   1839  O  O     . ASP B  1 64  ? 14.222  -55.895 -36.642 1.00 38.33 ? 63   ASP F O     1 
ATOM   1840  C  CB    . ASP B  1 64  ? 12.738  -55.719 -39.367 1.00 39.08 ? 63   ASP F CB    1 
ATOM   1841  C  CG    . ASP B  1 64  ? 13.188  -55.838 -40.825 1.00 39.99 ? 63   ASP F CG    1 
ATOM   1842  O  OD1   . ASP B  1 64  ? 13.729  -56.880 -41.258 1.00 39.39 ? 63   ASP F OD1   1 
ATOM   1843  O  OD2   . ASP B  1 64  ? 12.996  -54.847 -41.557 1.00 43.27 ? 63   ASP F OD2   1 
ATOM   1844  N  N     . TYR B  1 65  ? 12.184  -56.757 -36.239 1.00 37.66 ? 64   TYR F N     1 
ATOM   1845  C  CA    . TYR B  1 65  ? 12.224  -56.429 -34.806 1.00 37.47 ? 64   TYR F CA    1 
ATOM   1846  C  C     . TYR B  1 65  ? 12.529  -57.617 -33.887 1.00 37.86 ? 64   TYR F C     1 
ATOM   1847  O  O     . TYR B  1 65  ? 12.263  -57.545 -32.696 1.00 38.12 ? 64   TYR F O     1 
ATOM   1848  C  CB    . TYR B  1 65  ? 10.941  -55.690 -34.371 1.00 37.11 ? 64   TYR F CB    1 
ATOM   1849  C  CG    . TYR B  1 65  ? 10.884  -54.287 -34.924 1.00 36.17 ? 64   TYR F CG    1 
ATOM   1850  C  CD1   . TYR B  1 65  ? 9.946   -53.928 -35.890 1.00 37.92 ? 64   TYR F CD1   1 
ATOM   1851  C  CD2   . TYR B  1 65  ? 11.791  -53.332 -34.514 1.00 36.99 ? 64   TYR F CD2   1 
ATOM   1852  C  CE1   . TYR B  1 65  ? 9.909   -52.630 -36.425 1.00 37.14 ? 64   TYR F CE1   1 
ATOM   1853  C  CE2   . TYR B  1 65  ? 11.763  -52.034 -35.032 1.00 37.61 ? 64   TYR F CE2   1 
ATOM   1854  C  CZ    . TYR B  1 65  ? 10.826  -51.691 -35.988 1.00 37.08 ? 64   TYR F CZ    1 
ATOM   1855  O  OH    . TYR B  1 65  ? 10.818  -50.399 -36.499 1.00 36.79 ? 64   TYR F OH    1 
ATOM   1856  N  N     . ASP B  1 66  ? 13.146  -58.668 -34.437 1.00 38.10 ? 65   ASP F N     1 
ATOM   1857  C  CA    . ASP B  1 66  ? 13.562  -59.848 -33.669 1.00 38.37 ? 65   ASP F CA    1 
ATOM   1858  C  C     . ASP B  1 66  ? 14.438  -59.504 -32.464 1.00 38.51 ? 65   ASP F C     1 
ATOM   1859  O  O     . ASP B  1 66  ? 14.358  -60.158 -31.437 1.00 38.10 ? 65   ASP F O     1 
ATOM   1860  C  CB    . ASP B  1 66  ? 14.301  -60.870 -34.573 1.00 38.15 ? 65   ASP F CB    1 
ATOM   1861  C  CG    . ASP B  1 66  ? 13.328  -61.744 -35.400 1.00 39.18 ? 65   ASP F CG    1 
ATOM   1862  O  OD1   . ASP B  1 66  ? 12.122  -61.747 -35.095 1.00 36.68 ? 65   ASP F OD1   1 
ATOM   1863  O  OD2   . ASP B  1 66  ? 13.759  -62.414 -36.372 1.00 39.73 ? 65   ASP F OD2   1 
ATOM   1864  N  N     . ARG B  1 67  ? 15.285  -58.496 -32.600 1.00 38.78 ? 66   ARG F N     1 
ATOM   1865  C  CA    . ARG B  1 67  ? 16.225  -58.156 -31.545 1.00 39.61 ? 66   ARG F CA    1 
ATOM   1866  C  C     . ARG B  1 67  ? 15.523  -57.513 -30.342 1.00 38.99 ? 66   ARG F C     1 
ATOM   1867  O  O     . ARG B  1 67  ? 15.940  -57.680 -29.212 1.00 38.86 ? 66   ARG F O     1 
ATOM   1868  C  CB    . ARG B  1 67  ? 17.355  -57.268 -32.085 1.00 39.53 ? 66   ARG F CB    1 
ATOM   1869  C  CG    . ARG B  1 67  ? 17.010  -55.788 -32.333 1.00 41.02 ? 66   ARG F CG    1 
ATOM   1870  C  CD    . ARG B  1 67  ? 18.164  -55.100 -33.051 1.00 41.49 ? 66   ARG F CD    1 
ATOM   1871  N  NE    . ARG B  1 67  ? 17.944  -53.682 -33.366 1.00 42.15 ? 66   ARG F NE    1 
ATOM   1872  C  CZ    . ARG B  1 67  ? 17.272  -53.222 -34.425 1.00 43.48 ? 66   ARG F CZ    1 
ATOM   1873  N  NH1   . ARG B  1 67  ? 17.175  -51.898 -34.623 1.00 43.35 ? 66   ARG F NH1   1 
ATOM   1874  N  NH2   . ARG B  1 67  ? 16.691  -54.062 -35.279 1.00 41.95 ? 66   ARG F NH2   1 
ATOM   1875  N  N     . LEU B  1 68  ? 14.428  -56.812 -30.584 1.00 39.07 ? 67   LEU F N     1 
ATOM   1876  C  CA    . LEU B  1 68  ? 13.695  -56.177 -29.500 1.00 38.65 ? 67   LEU F CA    1 
ATOM   1877  C  C     . LEU B  1 68  ? 12.832  -57.169 -28.745 1.00 38.24 ? 67   LEU F C     1 
ATOM   1878  O  O     . LEU B  1 68  ? 12.713  -57.085 -27.530 1.00 38.79 ? 67   LEU F O     1 
ATOM   1879  C  CB    . LEU B  1 68  ? 12.834  -55.024 -30.033 1.00 38.41 ? 67   LEU F CB    1 
ATOM   1880  C  CG    . LEU B  1 68  ? 12.168  -54.126 -28.993 1.00 38.77 ? 67   LEU F CG    1 
ATOM   1881  C  CD1   . LEU B  1 68  ? 13.206  -53.271 -28.284 1.00 37.66 ? 67   LEU F CD1   1 
ATOM   1882  C  CD2   . LEU B  1 68  ? 11.089  -53.237 -29.629 1.00 38.82 ? 67   LEU F CD2   1 
ATOM   1883  N  N     . ARG B  1 69  ? 12.214  -58.095 -29.457 1.00 37.98 ? 68   ARG F N     1 
ATOM   1884  C  CA    . ARG B  1 69  ? 11.094  -58.855 -28.901 1.00 37.71 ? 68   ARG F CA    1 
ATOM   1885  C  C     . ARG B  1 69  ? 11.396  -59.625 -27.593 1.00 37.88 ? 68   ARG F C     1 
ATOM   1886  O  O     . ARG B  1 69  ? 10.548  -59.699 -26.693 1.00 37.42 ? 68   ARG F O     1 
ATOM   1887  C  CB    . ARG B  1 69  ? 10.541  -59.812 -29.961 1.00 37.78 ? 68   ARG F CB    1 
ATOM   1888  C  CG    . ARG B  1 69  ? 9.201   -60.432 -29.614 1.00 37.60 ? 68   ARG F CG    1 
ATOM   1889  C  CD    . ARG B  1 69  ? 8.653   -61.364 -30.709 1.00 36.93 ? 68   ARG F CD    1 
ATOM   1890  N  NE    . ARG B  1 69  ? 8.775   -60.745 -32.019 1.00 37.00 ? 68   ARG F NE    1 
ATOM   1891  C  CZ    . ARG B  1 69  ? 9.670   -61.084 -32.944 1.00 36.48 ? 68   ARG F CZ    1 
ATOM   1892  N  NH1   . ARG B  1 69  ? 10.526  -62.081 -32.741 1.00 36.80 ? 68   ARG F NH1   1 
ATOM   1893  N  NH2   . ARG B  1 69  ? 9.684   -60.435 -34.102 1.00 36.96 ? 68   ARG F NH2   1 
ATOM   1894  N  N     . PRO B  1 70  ? 12.568  -60.266 -27.511 1.00 38.08 ? 69   PRO F N     1 
ATOM   1895  C  CA    . PRO B  1 70  ? 12.851  -61.036 -26.304 1.00 38.32 ? 69   PRO F CA    1 
ATOM   1896  C  C     . PRO B  1 70  ? 13.075  -60.244 -25.012 1.00 38.15 ? 69   PRO F C     1 
ATOM   1897  O  O     . PRO B  1 70  ? 13.120  -60.848 -23.953 1.00 38.51 ? 69   PRO F O     1 
ATOM   1898  C  CB    . PRO B  1 70  ? 14.084  -61.855 -26.710 1.00 38.54 ? 69   PRO F CB    1 
ATOM   1899  C  CG    . PRO B  1 70  ? 14.013  -61.878 -28.224 1.00 38.15 ? 69   PRO F CG    1 
ATOM   1900  C  CD    . PRO B  1 70  ? 13.615  -60.481 -28.515 1.00 37.85 ? 69   PRO F CD    1 
ATOM   1901  N  N     . LEU B  1 71  ? 13.191  -58.919 -25.094 1.00 38.18 ? 70   LEU F N     1 
ATOM   1902  C  CA    A LEU B  1 71  ? 13.275  -58.086 -23.898 0.50 38.29 ? 70   LEU F CA    1 
ATOM   1903  C  CA    B LEU B  1 71  ? 13.274  -58.070 -23.904 0.50 38.34 ? 70   LEU F CA    1 
ATOM   1904  C  C     . LEU B  1 71  ? 11.954  -58.105 -23.125 1.00 38.39 ? 70   LEU F C     1 
ATOM   1905  O  O     . LEU B  1 71  ? 11.897  -57.760 -21.932 1.00 37.97 ? 70   LEU F O     1 
ATOM   1906  C  CB    A LEU B  1 71  ? 13.664  -56.652 -24.267 0.50 38.30 ? 70   LEU F CB    1 
ATOM   1907  C  CB    B LEU B  1 71  ? 13.623  -56.622 -24.279 0.50 38.44 ? 70   LEU F CB    1 
ATOM   1908  C  CG    A LEU B  1 71  ? 15.062  -56.503 -24.865 0.50 38.04 ? 70   LEU F CG    1 
ATOM   1909  C  CG    B LEU B  1 71  ? 15.091  -56.239 -24.488 0.50 38.47 ? 70   LEU F CG    1 
ATOM   1910  C  CD1   A LEU B  1 71  ? 15.316  -55.055 -25.255 0.50 37.52 ? 70   LEU F CD1   1 
ATOM   1911  C  CD1   B LEU B  1 71  ? 15.815  -57.187 -25.431 0.50 38.21 ? 70   LEU F CD1   1 
ATOM   1912  C  CD2   A LEU B  1 71  ? 16.115  -57.008 -23.886 0.50 36.80 ? 70   LEU F CD2   1 
ATOM   1913  C  CD2   B LEU B  1 71  ? 15.164  -54.802 -24.998 0.50 38.17 ? 70   LEU F CD2   1 
ATOM   1914  N  N     . SER B  1 72  ? 10.885  -58.529 -23.793 1.00 38.53 ? 71   SER F N     1 
ATOM   1915  C  CA    A SER B  1 72  ? 9.574   -58.684 -23.151 0.50 38.18 ? 71   SER F CA    1 
ATOM   1916  C  CA    B SER B  1 72  ? 9.596   -58.663 -23.116 0.50 38.49 ? 71   SER F CA    1 
ATOM   1917  C  C     . SER B  1 72  ? 9.456   -59.976 -22.344 1.00 38.27 ? 71   SER F C     1 
ATOM   1918  O  O     . SER B  1 72  ? 8.547   -60.108 -21.564 1.00 38.44 ? 71   SER F O     1 
ATOM   1919  C  CB    A SER B  1 72  ? 8.437   -58.661 -24.197 0.50 38.16 ? 71   SER F CB    1 
ATOM   1920  C  CB    B SER B  1 72  ? 8.450   -58.540 -24.123 0.50 38.54 ? 71   SER F CB    1 
ATOM   1921  O  OG    A SER B  1 72  ? 8.235   -57.375 -24.756 0.50 36.87 ? 71   SER F OG    1 
ATOM   1922  O  OG    B SER B  1 72  ? 8.542   -59.570 -25.083 0.50 39.07 ? 71   SER F OG    1 
ATOM   1923  N  N     . TYR B  1 73  ? 10.375  -60.926 -22.535 1.00 38.13 ? 72   TYR F N     1 
ATOM   1924  C  CA    . TYR B  1 73  ? 10.135  -62.306 -22.071 1.00 38.42 ? 72   TYR F CA    1 
ATOM   1925  C  C     . TYR B  1 73  ? 10.341  -62.655 -20.597 1.00 38.17 ? 72   TYR F C     1 
ATOM   1926  O  O     . TYR B  1 73  ? 9.533   -63.382 -20.041 1.00 37.68 ? 72   TYR F O     1 
ATOM   1927  C  CB    . TYR B  1 73  ? 10.909  -63.317 -22.940 1.00 39.10 ? 72   TYR F CB    1 
ATOM   1928  C  CG    . TYR B  1 73  ? 10.464  -63.382 -24.393 1.00 39.62 ? 72   TYR F CG    1 
ATOM   1929  C  CD1   . TYR B  1 73  ? 9.271   -62.807 -24.816 1.00 38.96 ? 72   TYR F CD1   1 
ATOM   1930  C  CD2   . TYR B  1 73  ? 11.237  -64.059 -25.347 1.00 40.66 ? 72   TYR F CD2   1 
ATOM   1931  C  CE1   . TYR B  1 73  ? 8.876   -62.874 -26.150 1.00 40.63 ? 72   TYR F CE1   1 
ATOM   1932  C  CE2   . TYR B  1 73  ? 10.840  -64.128 -26.694 1.00 38.69 ? 72   TYR F CE2   1 
ATOM   1933  C  CZ    . TYR B  1 73  ? 9.668   -63.540 -27.079 1.00 39.19 ? 72   TYR F CZ    1 
ATOM   1934  O  OH    . TYR B  1 73  ? 9.262   -63.587 -28.384 1.00 39.09 ? 72   TYR F OH    1 
ATOM   1935  N  N     . PRO B  1 74  ? 11.425  -62.176 -19.970 1.00 38.44 ? 73   PRO F N     1 
ATOM   1936  C  CA    . PRO B  1 74  ? 11.653  -62.460 -18.562 1.00 38.45 ? 73   PRO F CA    1 
ATOM   1937  C  C     . PRO B  1 74  ? 10.476  -62.114 -17.669 1.00 38.64 ? 73   PRO F C     1 
ATOM   1938  O  O     . PRO B  1 74  ? 9.872   -61.040 -17.820 1.00 38.20 ? 73   PRO F O     1 
ATOM   1939  C  CB    . PRO B  1 74  ? 12.845  -61.568 -18.224 1.00 38.84 ? 73   PRO F CB    1 
ATOM   1940  C  CG    . PRO B  1 74  ? 13.595  -61.478 -19.516 1.00 38.82 ? 73   PRO F CG    1 
ATOM   1941  C  CD    . PRO B  1 74  ? 12.527  -61.381 -20.542 1.00 38.65 ? 73   PRO F CD    1 
ATOM   1942  N  N     . GLN B  1 75  ? 10.169  -63.044 -16.757 1.00 38.73 ? 74   GLN F N     1 
ATOM   1943  C  CA    A GLN B  1 75  ? 9.129   -62.855 -15.739 0.50 38.68 ? 74   GLN F CA    1 
ATOM   1944  C  CA    B GLN B  1 75  ? 9.137   -62.882 -15.735 0.50 38.90 ? 74   GLN F CA    1 
ATOM   1945  C  C     . GLN B  1 75  ? 7.710   -62.954 -16.314 1.00 38.65 ? 74   GLN F C     1 
ATOM   1946  O  O     . GLN B  1 75  ? 6.750   -62.550 -15.662 1.00 39.03 ? 74   GLN F O     1 
ATOM   1947  C  CB    A GLN B  1 75  ? 9.290   -61.505 -15.014 0.50 38.97 ? 74   GLN F CB    1 
ATOM   1948  C  CB    B GLN B  1 75  ? 9.337   -61.576 -14.943 0.50 39.42 ? 74   GLN F CB    1 
ATOM   1949  C  CG    A GLN B  1 75  ? 10.719  -61.173 -14.530 0.50 39.12 ? 74   GLN F CG    1 
ATOM   1950  C  CG    B GLN B  1 75  ? 10.813  -61.123 -14.711 0.50 40.61 ? 74   GLN F CG    1 
ATOM   1951  C  CD    A GLN B  1 75  ? 10.915  -59.693 -14.186 0.50 38.90 ? 74   GLN F CD    1 
ATOM   1952  C  CD    B GLN B  1 75  ? 11.686  -62.175 -14.049 0.50 42.20 ? 74   GLN F CD    1 
ATOM   1953  O  OE1   A GLN B  1 75  ? 10.413  -58.791 -14.871 0.50 37.41 ? 74   GLN F OE1   1 
ATOM   1954  O  OE1   B GLN B  1 75  ? 11.196  -63.023 -13.306 0.50 44.31 ? 74   GLN F OE1   1 
ATOM   1955  N  NE2   A GLN B  1 75  ? 11.666  -59.445 -13.121 0.50 40.28 ? 74   GLN F NE2   1 
ATOM   1956  N  NE2   B GLN B  1 75  ? 12.998  -62.106 -14.297 0.50 43.02 ? 74   GLN F NE2   1 
ATOM   1957  N  N     . THR B  1 76  ? 7.568   -63.485 -17.527 1.00 37.83 ? 75   THR F N     1 
ATOM   1958  C  CA    . THR B  1 76  ? 6.245   -63.666 -18.157 1.00 37.01 ? 75   THR F CA    1 
ATOM   1959  C  C     . THR B  1 76  ? 5.498   -64.782 -17.442 1.00 36.47 ? 75   THR F C     1 
ATOM   1960  O  O     . THR B  1 76  ? 6.092   -65.788 -17.063 1.00 35.54 ? 75   THR F O     1 
ATOM   1961  C  CB    . THR B  1 76  ? 6.341   -64.001 -19.668 1.00 37.18 ? 75   THR F CB    1 
ATOM   1962  O  OG1   . THR B  1 76  ? 7.019   -62.937 -20.366 1.00 38.43 ? 75   THR F OG1   1 
ATOM   1963  C  CG2   . THR B  1 76  ? 4.938   -64.210 -20.288 1.00 36.65 ? 75   THR F CG2   1 
ATOM   1964  N  N     . ASP B  1 77  ? 4.204   -64.571 -17.233 1.00 35.96 ? 76   ASP F N     1 
ATOM   1965  C  CA    . ASP B  1 77  ? 3.334   -65.541 -16.576 1.00 36.24 ? 76   ASP F CA    1 
ATOM   1966  C  C     . ASP B  1 77  ? 2.580   -66.399 -17.589 1.00 35.53 ? 76   ASP F C     1 
ATOM   1967  O  O     . ASP B  1 77  ? 2.377   -67.583 -17.372 1.00 35.50 ? 76   ASP F O     1 
ATOM   1968  C  CB    . ASP B  1 77  ? 2.348   -64.826 -15.638 1.00 36.13 ? 76   ASP F CB    1 
ATOM   1969  C  CG    . ASP B  1 77  ? 3.048   -64.103 -14.495 1.00 37.96 ? 76   ASP F CG    1 
ATOM   1970  O  OD1   . ASP B  1 77  ? 3.789   -64.775 -13.734 1.00 37.02 ? 76   ASP F OD1   1 
ATOM   1971  O  OD2   . ASP B  1 77  ? 2.851   -62.863 -14.351 1.00 38.39 ? 76   ASP F OD2   1 
ATOM   1972  N  N     . VAL B  1 78  ? 2.154   -65.812 -18.694 1.00 35.16 ? 77   VAL F N     1 
ATOM   1973  C  CA    . VAL B  1 78  ? 1.497   -66.587 -19.749 1.00 35.35 ? 77   VAL F CA    1 
ATOM   1974  C  C     . VAL B  1 78  ? 1.779   -65.960 -21.122 1.00 35.62 ? 77   VAL F C     1 
ATOM   1975  O  O     . VAL B  1 78  ? 1.877   -64.729 -21.256 1.00 35.31 ? 77   VAL F O     1 
ATOM   1976  C  CB    . VAL B  1 78  ? -0.044  -66.744 -19.445 1.00 35.11 ? 77   VAL F CB    1 
ATOM   1977  C  CG1   . VAL B  1 78  ? -0.718  -65.361 -19.257 1.00 36.41 ? 77   VAL F CG1   1 
ATOM   1978  C  CG2   . VAL B  1 78  ? -0.774  -67.573 -20.504 1.00 35.19 ? 77   VAL F CG2   1 
ATOM   1979  N  N     . PHE B  1 79  ? 1.983   -66.821 -22.124 1.00 36.25 ? 78   PHE F N     1 
ATOM   1980  C  CA    . PHE B  1 79  ? 2.121   -66.384 -23.519 1.00 36.57 ? 78   PHE F CA    1 
ATOM   1981  C  C     . PHE B  1 79  ? 0.865   -66.699 -24.318 1.00 36.69 ? 78   PHE F C     1 
ATOM   1982  O  O     . PHE B  1 79  ? 0.317   -67.796 -24.201 1.00 36.51 ? 78   PHE F O     1 
ATOM   1983  C  CB    . PHE B  1 79  ? 3.280   -67.094 -24.193 1.00 36.74 ? 78   PHE F CB    1 
ATOM   1984  C  CG    . PHE B  1 79  ? 4.632   -66.622 -23.748 1.00 37.28 ? 78   PHE F CG    1 
ATOM   1985  C  CD1   . PHE B  1 79  ? 5.286   -67.252 -22.700 1.00 37.03 ? 78   PHE F CD1   1 
ATOM   1986  C  CD2   . PHE B  1 79  ? 5.269   -65.569 -24.407 1.00 37.51 ? 78   PHE F CD2   1 
ATOM   1987  C  CE1   . PHE B  1 79  ? 6.553   -66.835 -22.303 1.00 37.17 ? 78   PHE F CE1   1 
ATOM   1988  C  CE2   . PHE B  1 79  ? 6.545   -65.149 -24.019 1.00 36.43 ? 78   PHE F CE2   1 
ATOM   1989  C  CZ    . PHE B  1 79  ? 7.177   -65.775 -22.969 1.00 36.96 ? 78   PHE F CZ    1 
ATOM   1990  N  N     . LEU B  1 80  ? 0.423   -65.739 -25.134 1.00 36.66 ? 79   LEU F N     1 
ATOM   1991  C  CA    . LEU B  1 80  ? -0.507  -66.028 -26.224 1.00 36.65 ? 79   LEU F CA    1 
ATOM   1992  C  C     . LEU B  1 80  ? 0.289   -66.097 -27.525 1.00 36.61 ? 79   LEU F C     1 
ATOM   1993  O  O     . LEU B  1 80  ? 0.767   -65.081 -28.007 1.00 36.63 ? 79   LEU F O     1 
ATOM   1994  C  CB    . LEU B  1 80  ? -1.604  -64.958 -26.335 1.00 36.60 ? 79   LEU F CB    1 
ATOM   1995  C  CG    . LEU B  1 80  ? -2.474  -64.650 -25.132 1.00 37.02 ? 79   LEU F CG    1 
ATOM   1996  C  CD1   . LEU B  1 80  ? -3.580  -63.655 -25.521 1.00 38.37 ? 79   LEU F CD1   1 
ATOM   1997  C  CD2   . LEU B  1 80  ? -3.057  -65.912 -24.526 1.00 37.10 ? 79   LEU F CD2   1 
ATOM   1998  N  N     . ILE B  1 81  ? 0.470   -67.300 -28.066 1.00 36.95 ? 80   ILE F N     1 
ATOM   1999  C  CA    . ILE B  1 81  ? 1.001   -67.479 -29.437 1.00 37.17 ? 80   ILE F CA    1 
ATOM   2000  C  C     . ILE B  1 81  ? -0.180  -67.470 -30.420 1.00 37.43 ? 80   ILE F C     1 
ATOM   2001  O  O     . ILE B  1 81  ? -1.045  -68.330 -30.349 1.00 37.60 ? 80   ILE F O     1 
ATOM   2002  C  CB    . ILE B  1 81  ? 1.801   -68.796 -29.593 1.00 37.56 ? 80   ILE F CB    1 
ATOM   2003  C  CG1   . ILE B  1 81  ? 2.979   -68.820 -28.616 1.00 37.26 ? 80   ILE F CG1   1 
ATOM   2004  C  CG2   . ILE B  1 81  ? 2.273   -68.991 -31.061 1.00 36.09 ? 80   ILE F CG2   1 
ATOM   2005  C  CD1   . ILE B  1 81  ? 3.860   -70.136 -28.676 1.00 37.40 ? 80   ILE F CD1   1 
ATOM   2006  N  N     . CYS B  1 82  ? -0.209  -66.473 -31.308 1.00 37.76 ? 81   CYS F N     1 
ATOM   2007  C  CA    . CYS B  1 82  ? -1.342  -66.209 -32.192 1.00 37.90 ? 81   CYS F CA    1 
ATOM   2008  C  C     . CYS B  1 82  ? -1.021  -66.501 -33.661 1.00 37.42 ? 81   CYS F C     1 
ATOM   2009  O  O     . CYS B  1 82  ? 0.103   -66.297 -34.108 1.00 37.47 ? 81   CYS F O     1 
ATOM   2010  C  CB    . CYS B  1 82  ? -1.764  -64.747 -32.076 1.00 38.44 ? 81   CYS F CB    1 
ATOM   2011  S  SG    . CYS B  1 82  ? -2.143  -64.143 -30.431 1.00 40.16 ? 81   CYS F SG    1 
ATOM   2012  N  N     . PHE B  1 83  ? -2.017  -67.000 -34.390 1.00 36.91 ? 82   PHE F N     1 
ATOM   2013  C  CA    . PHE B  1 83  ? -1.968  -67.154 -35.854 1.00 36.86 ? 82   PHE F CA    1 
ATOM   2014  C  C     . PHE B  1 83  ? -3.346  -66.845 -36.433 1.00 36.48 ? 82   PHE F C     1 
ATOM   2015  O  O     . PHE B  1 83  ? -4.370  -67.091 -35.779 1.00 36.60 ? 82   PHE F O     1 
ATOM   2016  C  CB    . PHE B  1 83  ? -1.564  -68.589 -36.247 1.00 36.97 ? 82   PHE F CB    1 
ATOM   2017  C  CG    . PHE B  1 83  ? -2.631  -69.620 -35.951 1.00 37.77 ? 82   PHE F CG    1 
ATOM   2018  C  CD1   . PHE B  1 83  ? -2.712  -70.212 -34.695 1.00 37.81 ? 82   PHE F CD1   1 
ATOM   2019  C  CD2   . PHE B  1 83  ? -3.567  -69.978 -36.923 1.00 37.47 ? 82   PHE F CD2   1 
ATOM   2020  C  CE1   . PHE B  1 83  ? -3.717  -71.165 -34.407 1.00 39.19 ? 82   PHE F CE1   1 
ATOM   2021  C  CE2   . PHE B  1 83  ? -4.561  -70.927 -36.654 1.00 39.09 ? 82   PHE F CE2   1 
ATOM   2022  C  CZ    . PHE B  1 83  ? -4.638  -71.524 -35.398 1.00 38.91 ? 82   PHE F CZ    1 
ATOM   2023  N  N     . SER B  1 84  ? -3.387  -66.347 -37.665 1.00 36.08 ? 83   SER F N     1 
ATOM   2024  C  CA    . SER B  1 84  ? -4.670  -66.154 -38.359 1.00 35.55 ? 83   SER F CA    1 
ATOM   2025  C  C     . SER B  1 84  ? -5.264  -67.456 -38.884 1.00 35.17 ? 83   SER F C     1 
ATOM   2026  O  O     . SER B  1 84  ? -4.609  -68.205 -39.589 1.00 33.67 ? 83   SER F O     1 
ATOM   2027  C  CB    . SER B  1 84  ? -4.536  -65.168 -39.533 1.00 35.43 ? 83   SER F CB    1 
ATOM   2028  O  OG    . SER B  1 84  ? -5.762  -65.128 -40.255 1.00 35.28 ? 83   SER F OG    1 
ATOM   2029  N  N     . LEU B  1 85  ? -6.543  -67.681 -38.601 1.00 35.42 ? 84   LEU F N     1 
ATOM   2030  C  CA    . LEU B  1 85  ? -7.213  -68.871 -39.099 1.00 35.41 ? 84   LEU F CA    1 
ATOM   2031  C  C     . LEU B  1 85  ? -7.293  -68.888 -40.627 1.00 35.90 ? 84   LEU F C     1 
ATOM   2032  O  O     . LEU B  1 85  ? -7.582  -69.936 -41.226 1.00 36.34 ? 84   LEU F O     1 
ATOM   2033  C  CB    . LEU B  1 85  ? -8.599  -69.019 -38.466 1.00 35.42 ? 84   LEU F CB    1 
ATOM   2034  C  CG    . LEU B  1 85  ? -8.551  -69.429 -36.988 1.00 35.82 ? 84   LEU F CG    1 
ATOM   2035  C  CD1   . LEU B  1 85  ? -9.911  -69.234 -36.311 1.00 38.38 ? 84   LEU F CD1   1 
ATOM   2036  C  CD2   . LEU B  1 85  ? -8.075  -70.886 -36.845 1.00 33.11 ? 84   LEU F CD2   1 
ATOM   2037  N  N     . VAL B  1 86  ? -7.042  -67.744 -41.261 1.00 35.49 ? 85   VAL F N     1 
ATOM   2038  C  CA    . VAL B  1 86  ? -7.049  -67.687 -42.723 1.00 35.77 ? 85   VAL F CA    1 
ATOM   2039  C  C     . VAL B  1 86  ? -5.663  -67.435 -43.328 1.00 35.66 ? 85   VAL F C     1 
ATOM   2040  O  O     . VAL B  1 86  ? -5.559  -67.053 -44.495 1.00 35.87 ? 85   VAL F O     1 
ATOM   2041  C  CB    . VAL B  1 86  ? -8.076  -66.648 -43.254 1.00 36.05 ? 85   VAL F CB    1 
ATOM   2042  C  CG1   . VAL B  1 86  ? -9.482  -67.096 -42.895 1.00 35.73 ? 85   VAL F CG1   1 
ATOM   2043  C  CG2   . VAL B  1 86  ? -7.768  -65.235 -42.723 1.00 34.76 ? 85   VAL F CG2   1 
ATOM   2044  N  N     . SER B  1 87  ? -4.608  -67.680 -42.548 1.00 35.52 ? 86   SER F N     1 
ATOM   2045  C  CA    . SER B  1 87  ? -3.236  -67.638 -43.043 1.00 35.82 ? 86   SER F CA    1 
ATOM   2046  C  C     . SER B  1 87  ? -2.480  -68.888 -42.626 1.00 36.08 ? 86   SER F C     1 
ATOM   2047  O  O     . SER B  1 87  ? -1.872  -68.916 -41.561 1.00 35.48 ? 86   SER F O     1 
ATOM   2048  C  CB    . SER B  1 87  ? -2.503  -66.416 -42.511 1.00 35.57 ? 86   SER F CB    1 
ATOM   2049  O  OG    . SER B  1 87  ? -1.129  -66.490 -42.841 1.00 36.34 ? 86   SER F OG    1 
ATOM   2050  N  N     . PRO B  1 88  ? -2.520  -69.936 -43.459 1.00 36.68 ? 87   PRO F N     1 
ATOM   2051  C  CA    . PRO B  1 88  ? -1.807  -71.151 -43.095 1.00 37.06 ? 87   PRO F CA    1 
ATOM   2052  C  C     . PRO B  1 88  ? -0.284  -70.940 -42.964 1.00 37.27 ? 87   PRO F C     1 
ATOM   2053  O  O     . PRO B  1 88  ? 0.371   -71.692 -42.270 1.00 36.95 ? 87   PRO F O     1 
ATOM   2054  C  CB    . PRO B  1 88  ? -2.158  -72.121 -44.236 1.00 37.29 ? 87   PRO F CB    1 
ATOM   2055  C  CG    . PRO B  1 88  ? -3.369  -71.569 -44.851 1.00 36.57 ? 87   PRO F CG    1 
ATOM   2056  C  CD    . PRO B  1 88  ? -3.249  -70.094 -44.728 1.00 36.99 ? 87   PRO F CD    1 
ATOM   2057  N  N     . ALA B  1 89  ? 0.264   -69.911 -43.610 1.00 37.28 ? 88   ALA F N     1 
ATOM   2058  C  CA    . ALA B  1 89  ? 1.655   -69.538 -43.382 1.00 37.07 ? 88   ALA F CA    1 
ATOM   2059  C  C     . ALA B  1 89  ? 1.907   -69.154 -41.916 1.00 37.07 ? 88   ALA F C     1 
ATOM   2060  O  O     . ALA B  1 89  ? 2.886   -69.604 -41.322 1.00 36.54 ? 88   ALA F O     1 
ATOM   2061  C  CB    . ALA B  1 89  ? 2.069   -68.393 -44.332 1.00 37.70 ? 88   ALA F CB    1 
ATOM   2062  N  N     . SER B  1 90  ? 1.015   -68.339 -41.351 1.00 37.21 ? 89   SER F N     1 
ATOM   2063  C  CA    . SER B  1 90  ? 1.097   -67.911 -39.942 1.00 37.75 ? 89   SER F CA    1 
ATOM   2064  C  C     . SER B  1 90  ? 0.981   -69.095 -38.988 1.00 38.09 ? 89   SER F C     1 
ATOM   2065  O  O     . SER B  1 90  ? 1.669   -69.143 -37.960 1.00 38.11 ? 89   SER F O     1 
ATOM   2066  C  CB    . SER B  1 90  ? 0.046   -66.826 -39.603 1.00 37.93 ? 89   SER F CB    1 
ATOM   2067  O  OG    . SER B  1 90  ? -1.279  -67.338 -39.457 1.00 37.38 ? 89   SER F OG    1 
ATOM   2068  N  N     . PHE B  1 91  ? 0.116   -70.043 -39.348 1.00 38.02 ? 90   PHE F N     1 
ATOM   2069  C  CA    . PHE B  1 91  ? -0.071  -71.287 -38.604 1.00 38.25 ? 90   PHE F CA    1 
ATOM   2070  C  C     . PHE B  1 91  ? 1.212   -72.126 -38.552 1.00 38.64 ? 90   PHE F C     1 
ATOM   2071  O  O     . PHE B  1 91  ? 1.611   -72.587 -37.478 1.00 38.72 ? 90   PHE F O     1 
ATOM   2072  C  CB    . PHE B  1 91  ? -1.203  -72.086 -39.260 1.00 38.40 ? 90   PHE F CB    1 
ATOM   2073  C  CG    . PHE B  1 91  ? -1.609  -73.326 -38.510 1.00 38.80 ? 90   PHE F CG    1 
ATOM   2074  C  CD1   . PHE B  1 91  ? -1.963  -73.269 -37.162 1.00 39.30 ? 90   PHE F CD1   1 
ATOM   2075  C  CD2   . PHE B  1 91  ? -1.684  -74.554 -39.165 1.00 38.65 ? 90   PHE F CD2   1 
ATOM   2076  C  CE1   . PHE B  1 91  ? -2.345  -74.423 -36.479 1.00 38.44 ? 90   PHE F CE1   1 
ATOM   2077  C  CE2   . PHE B  1 91  ? -2.076  -75.703 -38.481 1.00 37.61 ? 90   PHE F CE2   1 
ATOM   2078  C  CZ    . PHE B  1 91  ? -2.403  -75.635 -37.153 1.00 37.51 ? 90   PHE F CZ    1 
ATOM   2079  N  N     . GLU B  1 92  ? 1.856   -72.317 -39.707 1.00 39.01 ? 91   GLU F N     1 
ATOM   2080  C  CA    . GLU B  1 92  ? 3.127   -73.062 -39.788 1.00 38.98 ? 91   GLU F CA    1 
ATOM   2081  C  C     . GLU B  1 92  ? 4.247   -72.357 -39.019 1.00 38.91 ? 91   GLU F C     1 
ATOM   2082  O  O     . GLU B  1 92  ? 5.155   -73.018 -38.501 1.00 38.61 ? 91   GLU F O     1 
ATOM   2083  C  CB    . GLU B  1 92  ? 3.579   -73.249 -41.239 1.00 38.97 ? 91   GLU F CB    1 
ATOM   2084  C  CG    . GLU B  1 92  ? 2.544   -73.881 -42.159 1.00 41.16 ? 91   GLU F CG    1 
ATOM   2085  N  N     . ASN B  1 93  ? 4.198   -71.025 -38.952 1.00 38.56 ? 92   ASN F N     1 
ATOM   2086  C  CA    . ASN B  1 93  ? 5.208   -70.280 -38.195 1.00 38.69 ? 92   ASN F CA    1 
ATOM   2087  C  C     . ASN B  1 93  ? 5.048   -70.416 -36.682 1.00 38.38 ? 92   ASN F C     1 
ATOM   2088  O  O     . ASN B  1 93  ? 5.976   -70.105 -35.936 1.00 38.30 ? 92   ASN F O     1 
ATOM   2089  C  CB    . ASN B  1 93  ? 5.239   -68.798 -38.596 1.00 38.96 ? 92   ASN F CB    1 
ATOM   2090  C  CG    . ASN B  1 93  ? 6.123   -68.539 -39.798 1.00 41.49 ? 92   ASN F CG    1 
ATOM   2091  O  OD1   . ASN B  1 93  ? 7.102   -69.269 -40.048 1.00 43.76 ? 92   ASN F OD1   1 
ATOM   2092  N  ND2   . ASN B  1 93  ? 5.787   -67.497 -40.563 1.00 43.32 ? 92   ASN F ND2   1 
ATOM   2093  N  N     . VAL B  1 94  ? 3.888   -70.874 -36.216 1.00 38.23 ? 93   VAL F N     1 
ATOM   2094  C  CA    . VAL B  1 94  ? 3.769   -71.257 -34.810 1.00 38.04 ? 93   VAL F CA    1 
ATOM   2095  C  C     . VAL B  1 94  ? 4.835   -72.288 -34.496 1.00 38.19 ? 93   VAL F C     1 
ATOM   2096  O  O     . VAL B  1 94  ? 5.577   -72.171 -33.535 1.00 37.57 ? 93   VAL F O     1 
ATOM   2097  C  CB    . VAL B  1 94  ? 2.419   -71.879 -34.480 1.00 37.81 ? 93   VAL F CB    1 
ATOM   2098  C  CG1   . VAL B  1 94  ? 2.459   -72.536 -33.054 1.00 36.66 ? 93   VAL F CG1   1 
ATOM   2099  C  CG2   . VAL B  1 94  ? 1.303   -70.833 -34.621 1.00 36.77 ? 93   VAL F CG2   1 
ATOM   2100  N  N     . ARG B  1 95  ? 4.907   -73.293 -35.351 1.00 39.32 ? 94   ARG F N     1 
ATOM   2101  C  CA    . ARG B  1 95  ? 5.841   -74.401 -35.184 1.00 39.67 ? 94   ARG F CA    1 
ATOM   2102  C  C     . ARG B  1 95  ? 7.270   -73.960 -35.536 1.00 39.53 ? 94   ARG F C     1 
ATOM   2103  O  O     . ARG B  1 95  ? 8.238   -74.307 -34.841 1.00 39.07 ? 94   ARG F O     1 
ATOM   2104  C  CB    . ARG B  1 95  ? 5.421   -75.522 -36.125 1.00 39.98 ? 94   ARG F CB    1 
ATOM   2105  C  CG    . ARG B  1 95  ? 6.252   -76.754 -36.020 1.00 42.66 ? 94   ARG F CG    1 
ATOM   2106  C  CD    . ARG B  1 95  ? 5.981   -77.699 -37.186 1.00 45.37 ? 94   ARG F CD    1 
ATOM   2107  N  NE    . ARG B  1 95  ? 4.769   -78.498 -37.009 1.00 46.16 ? 94   ARG F NE    1 
ATOM   2108  C  CZ    . ARG B  1 95  ? 3.717   -78.498 -37.826 1.00 47.62 ? 94   ARG F CZ    1 
ATOM   2109  N  NH1   . ARG B  1 95  ? 3.684   -77.754 -38.934 1.00 48.20 ? 94   ARG F NH1   1 
ATOM   2110  N  NH2   . ARG B  1 95  ? 2.687   -79.289 -37.544 1.00 46.57 ? 94   ARG F NH2   1 
ATOM   2111  N  N     . ALA B  1 96  ? 7.384   -73.223 -36.643 1.00 38.91 ? 95   ALA F N     1 
ATOM   2112  C  CA    . ALA B  1 96  ? 8.679   -72.890 -37.227 1.00 38.60 ? 95   ALA F CA    1 
ATOM   2113  C  C     . ALA B  1 96  ? 9.397   -71.815 -36.413 1.00 38.57 ? 95   ALA F C     1 
ATOM   2114  O  O     . ALA B  1 96  ? 10.620  -71.847 -36.277 1.00 38.72 ? 95   ALA F O     1 
ATOM   2115  C  CB    . ALA B  1 96  ? 8.507   -72.425 -38.675 1.00 38.37 ? 95   ALA F CB    1 
ATOM   2116  N  N     . LYS B  1 97  ? 8.646   -70.875 -35.855 1.00 37.99 ? 96   LYS F N     1 
ATOM   2117  C  CA    . LYS B  1 97  ? 9.270   -69.706 -35.264 1.00 37.83 ? 96   LYS F CA    1 
ATOM   2118  C  C     . LYS B  1 97  ? 8.883   -69.442 -33.813 1.00 38.25 ? 96   LYS F C     1 
ATOM   2119  O  O     . LYS B  1 97  ? 9.766   -69.276 -32.949 1.00 38.38 ? 96   LYS F O     1 
ATOM   2120  C  CB    . LYS B  1 97  ? 8.971   -68.462 -36.102 1.00 37.62 ? 96   LYS F CB    1 
ATOM   2121  C  CG    . LYS B  1 97  ? 9.527   -67.199 -35.466 1.00 36.74 ? 96   LYS F CG    1 
ATOM   2122  C  CD    . LYS B  1 97  ? 9.748   -66.057 -36.417 1.00 35.68 ? 96   LYS F CD    1 
ATOM   2123  C  CE    . LYS B  1 97  ? 10.592  -64.952 -35.717 1.00 34.53 ? 96   LYS F CE    1 
ATOM   2124  N  NZ    . LYS B  1 97  ? 10.864  -63.758 -36.554 1.00 30.99 ? 96   LYS F NZ    1 
ATOM   2125  N  N     . TRP B  1 98  ? 7.578   -69.389 -33.549 1.00 38.17 ? 97   TRP F N     1 
ATOM   2126  C  CA    . TRP B  1 98  ? 7.095   -68.823 -32.303 1.00 38.21 ? 97   TRP F CA    1 
ATOM   2127  C  C     . TRP B  1 98  ? 7.336   -69.722 -31.108 1.00 38.57 ? 97   TRP F C     1 
ATOM   2128  O  O     . TRP B  1 98  ? 7.898   -69.287 -30.121 1.00 38.22 ? 97   TRP F O     1 
ATOM   2129  C  CB    . TRP B  1 98  ? 5.642   -68.345 -32.456 1.00 38.11 ? 97   TRP F CB    1 
ATOM   2130  C  CG    . TRP B  1 98  ? 5.605   -67.283 -33.521 1.00 38.19 ? 97   TRP F CG    1 
ATOM   2131  C  CD1   . TRP B  1 98  ? 5.011   -67.368 -34.728 1.00 37.87 ? 97   TRP F CD1   1 
ATOM   2132  C  CD2   . TRP B  1 98  ? 6.304   -66.030 -33.502 1.00 38.38 ? 97   TRP F CD2   1 
ATOM   2133  N  NE1   . TRP B  1 98  ? 5.239   -66.236 -35.454 1.00 38.53 ? 97   TRP F NE1   1 
ATOM   2134  C  CE2   . TRP B  1 98  ? 6.047   -65.396 -34.732 1.00 39.42 ? 97   TRP F CE2   1 
ATOM   2135  C  CE3   . TRP B  1 98  ? 7.104   -65.372 -32.553 1.00 38.50 ? 97   TRP F CE3   1 
ATOM   2136  C  CZ2   . TRP B  1 98  ? 6.553   -64.131 -35.045 1.00 38.72 ? 97   TRP F CZ2   1 
ATOM   2137  C  CZ3   . TRP B  1 98  ? 7.614   -64.110 -32.867 1.00 38.24 ? 97   TRP F CZ3   1 
ATOM   2138  C  CH2   . TRP B  1 98  ? 7.335   -63.505 -34.103 1.00 38.12 ? 97   TRP F CH2   1 
ATOM   2139  N  N     . TYR B  1 99  ? 6.958   -70.986 -31.223 1.00 39.30 ? 98   TYR F N     1 
ATOM   2140  C  CA    . TYR B  1 99  ? 7.199   -71.954 -30.155 1.00 39.98 ? 98   TYR F CA    1 
ATOM   2141  C  C     . TYR B  1 99  ? 8.699   -72.104 -29.827 1.00 39.52 ? 98   TYR F C     1 
ATOM   2142  O  O     . TYR B  1 99  ? 9.069   -72.050 -28.660 1.00 39.81 ? 98   TYR F O     1 
ATOM   2143  C  CB    . TYR B  1 99  ? 6.553   -73.300 -30.522 1.00 41.19 ? 98   TYR F CB    1 
ATOM   2144  C  CG    . TYR B  1 99  ? 7.069   -74.520 -29.785 1.00 42.58 ? 98   TYR F CG    1 
ATOM   2145  C  CD1   . TYR B  1 99  ? 6.737   -74.760 -28.463 1.00 42.78 ? 98   TYR F CD1   1 
ATOM   2146  C  CD2   . TYR B  1 99  ? 7.845   -75.459 -30.437 1.00 45.69 ? 98   TYR F CD2   1 
ATOM   2147  C  CE1   . TYR B  1 99  ? 7.185   -75.898 -27.799 1.00 44.03 ? 98   TYR F CE1   1 
ATOM   2148  C  CE2   . TYR B  1 99  ? 8.300   -76.600 -29.784 1.00 46.09 ? 98   TYR F CE2   1 
ATOM   2149  C  CZ    . TYR B  1 99  ? 7.971   -76.813 -28.461 1.00 44.71 ? 98   TYR F CZ    1 
ATOM   2150  O  OH    . TYR B  1 99  ? 8.432   -77.967 -27.825 1.00 45.86 ? 98   TYR F OH    1 
ATOM   2151  N  N     . PRO B  1 100 ? 9.564   -72.303 -30.843 1.00 39.11 ? 99   PRO F N     1 
ATOM   2152  C  CA    . PRO B  1 100 ? 11.013  -72.322 -30.575 1.00 38.94 ? 99   PRO F CA    1 
ATOM   2153  C  C     . PRO B  1 100 ? 11.542  -71.040 -29.929 1.00 38.71 ? 99   PRO F C     1 
ATOM   2154  O  O     . PRO B  1 100 ? 12.301  -71.115 -28.967 1.00 39.03 ? 99   PRO F O     1 
ATOM   2155  C  CB    . PRO B  1 100 ? 11.620  -72.507 -31.958 1.00 38.80 ? 99   PRO F CB    1 
ATOM   2156  C  CG    . PRO B  1 100 ? 10.564  -73.181 -32.729 1.00 39.49 ? 99   PRO F CG    1 
ATOM   2157  C  CD    . PRO B  1 100 ? 9.288   -72.588 -32.258 1.00 38.96 ? 99   PRO F CD    1 
ATOM   2158  N  N     . GLU B  1 101 ? 11.139  -69.879 -30.418 1.00 38.25 ? 100  GLU F N     1 
ATOM   2159  C  CA    . GLU B  1 101 ? 11.654  -68.629 -29.831 1.00 38.74 ? 100  GLU F CA    1 
ATOM   2160  C  C     . GLU B  1 101 ? 11.261  -68.473 -28.375 1.00 38.42 ? 100  GLU F C     1 
ATOM   2161  O  O     . GLU B  1 101 ? 12.104  -68.187 -27.513 1.00 38.33 ? 100  GLU F O     1 
ATOM   2162  C  CB    . GLU B  1 101 ? 11.203  -67.383 -30.605 1.00 38.61 ? 100  GLU F CB    1 
ATOM   2163  C  CG    . GLU B  1 101 ? 11.811  -66.099 -30.028 1.00 38.44 ? 100  GLU F CG    1 
ATOM   2164  C  CD    . GLU B  1 101 ? 11.592  -64.867 -30.895 1.00 39.04 ? 100  GLU F CD    1 
ATOM   2165  O  OE1   . GLU B  1 101 ? 11.974  -64.878 -32.077 1.00 42.23 ? 100  GLU F OE1   1 
ATOM   2166  O  OE2   . GLU B  1 101 ? 11.054  -63.866 -30.388 1.00 40.05 ? 100  GLU F OE2   1 
ATOM   2167  N  N     . VAL B  1 102 ? 9.978   -68.640 -28.110 1.00 38.53 ? 101  VAL F N     1 
ATOM   2168  C  CA    . VAL B  1 102 ? 9.457   -68.508 -26.759 1.00 38.67 ? 101  VAL F CA    1 
ATOM   2169  C  C     . VAL B  1 102 ? 10.098  -69.515 -25.816 1.00 38.48 ? 101  VAL F C     1 
ATOM   2170  O  O     . VAL B  1 102 ? 10.514  -69.170 -24.725 1.00 37.96 ? 101  VAL F O     1 
ATOM   2171  C  CB    . VAL B  1 102 ? 7.905   -68.671 -26.745 1.00 38.82 ? 101  VAL F CB    1 
ATOM   2172  C  CG1   . VAL B  1 102 ? 7.383   -68.850 -25.331 1.00 37.60 ? 101  VAL F CG1   1 
ATOM   2173  C  CG2   . VAL B  1 102 ? 7.259   -67.461 -27.392 1.00 38.82 ? 101  VAL F CG2   1 
ATOM   2174  N  N     . ARG B  1 103 ? 10.197  -70.761 -26.255 1.00 39.20 ? 102  ARG F N     1 
ATOM   2175  C  CA    . ARG B  1 103 ? 10.729  -71.814 -25.407 1.00 39.23 ? 102  ARG F CA    1 
ATOM   2176  C  C     . ARG B  1 103 ? 12.226  -71.689 -25.142 1.00 39.83 ? 102  ARG F C     1 
ATOM   2177  O  O     . ARG B  1 103 ? 12.697  -72.126 -24.086 1.00 40.10 ? 102  ARG F O     1 
ATOM   2178  C  CB    . ARG B  1 103 ? 10.360  -73.193 -25.960 1.00 39.21 ? 102  ARG F CB    1 
ATOM   2179  C  CG    . ARG B  1 103 ? 8.908   -73.580 -25.653 1.00 39.07 ? 102  ARG F CG    1 
ATOM   2180  C  CD    . ARG B  1 103 ? 8.750   -73.878 -24.166 1.00 39.06 ? 102  ARG F CD    1 
ATOM   2181  N  NE    . ARG B  1 103 ? 7.391   -74.266 -23.789 1.00 39.45 ? 102  ARG F NE    1 
ATOM   2182  C  CZ    . ARG B  1 103 ? 6.561   -73.545 -23.031 1.00 39.07 ? 102  ARG F CZ    1 
ATOM   2183  N  NH1   . ARG B  1 103 ? 6.930   -72.373 -22.535 1.00 38.08 ? 102  ARG F NH1   1 
ATOM   2184  N  NH2   . ARG B  1 103 ? 5.347   -74.006 -22.772 1.00 39.70 ? 102  ARG F NH2   1 
ATOM   2185  N  N     . HIS B  1 104 ? 12.963  -71.057 -26.054 1.00 40.32 ? 103  HIS F N     1 
ATOM   2186  C  CA    . HIS B  1 104 ? 14.394  -70.805 -25.845 1.00 40.91 ? 103  HIS F CA    1 
ATOM   2187  C  C     . HIS B  1 104 ? 14.586  -69.879 -24.636 1.00 40.57 ? 103  HIS F C     1 
ATOM   2188  O  O     . HIS B  1 104 ? 15.540  -70.016 -23.886 1.00 40.25 ? 103  HIS F O     1 
ATOM   2189  C  CB    . HIS B  1 104 ? 15.029  -70.188 -27.107 1.00 41.98 ? 103  HIS F CB    1 
ATOM   2190  C  CG    . HIS B  1 104 ? 16.441  -69.714 -26.912 1.00 45.29 ? 103  HIS F CG    1 
ATOM   2191  N  ND1   . HIS B  1 104 ? 17.534  -70.556 -26.984 1.00 48.10 ? 103  HIS F ND1   1 
ATOM   2192  C  CD2   . HIS B  1 104 ? 16.936  -68.486 -26.619 1.00 48.35 ? 103  HIS F CD2   1 
ATOM   2193  C  CE1   . HIS B  1 104 ? 18.638  -69.866 -26.757 1.00 48.90 ? 103  HIS F CE1   1 
ATOM   2194  N  NE2   . HIS B  1 104 ? 18.303  -68.607 -26.531 1.00 50.00 ? 103  HIS F NE2   1 
ATOM   2195  N  N     . HIS B  1 105 ? 13.653  -68.954 -24.431 1.00 40.03 ? 104  HIS F N     1 
ATOM   2196  C  CA    . HIS B  1 105 ? 13.780  -67.987 -23.353 1.00 39.84 ? 104  HIS F CA    1 
ATOM   2197  C  C     . HIS B  1 105 ? 13.020  -68.439 -22.096 1.00 39.73 ? 104  HIS F C     1 
ATOM   2198  O  O     . HIS B  1 105 ? 13.449  -68.171 -20.970 1.00 39.94 ? 104  HIS F O     1 
ATOM   2199  C  CB    . HIS B  1 105 ? 13.300  -66.620 -23.841 1.00 39.57 ? 104  HIS F CB    1 
ATOM   2200  C  CG    . HIS B  1 105 ? 14.128  -66.055 -24.957 1.00 39.79 ? 104  HIS F CG    1 
ATOM   2201  N  ND1   . HIS B  1 105 ? 15.305  -65.372 -24.739 1.00 42.02 ? 104  HIS F ND1   1 
ATOM   2202  C  CD2   . HIS B  1 105 ? 13.947  -66.068 -26.301 1.00 40.10 ? 104  HIS F CD2   1 
ATOM   2203  C  CE1   . HIS B  1 105 ? 15.815  -64.988 -25.898 1.00 41.44 ? 104  HIS F CE1   1 
ATOM   2204  N  NE2   . HIS B  1 105 ? 15.013  -65.407 -26.863 1.00 41.54 ? 104  HIS F NE2   1 
ATOM   2205  N  N     . CYS B  1 106 ? 11.892  -69.121 -22.289 1.00 39.49 ? 105  CYS F N     1 
ATOM   2206  C  CA    . CYS B  1 106 ? 11.020  -69.521 -21.181 1.00 39.15 ? 105  CYS F CA    1 
ATOM   2207  C  C     . CYS B  1 106 ? 10.625  -70.971 -21.371 1.00 38.46 ? 105  CYS F C     1 
ATOM   2208  O  O     . CYS B  1 106 ? 9.616   -71.238 -21.994 1.00 38.59 ? 105  CYS F O     1 
ATOM   2209  C  CB    . CYS B  1 106 ? 9.760   -68.646 -21.154 1.00 39.38 ? 105  CYS F CB    1 
ATOM   2210  S  SG    . CYS B  1 106 ? 10.051  -66.858 -21.195 1.00 43.36 ? 105  CYS F SG    1 
ATOM   2211  N  N     . PRO B  1 107 ? 11.445  -71.921 -20.876 1.00 38.29 ? 106  PRO F N     1 
ATOM   2212  C  CA    . PRO B  1 107 ? 11.231  -73.343 -21.182 1.00 37.60 ? 106  PRO F CA    1 
ATOM   2213  C  C     . PRO B  1 107 ? 9.869   -73.959 -20.805 1.00 37.38 ? 106  PRO F C     1 
ATOM   2214  O  O     . PRO B  1 107 ? 9.455   -74.928 -21.447 1.00 36.91 ? 106  PRO F O     1 
ATOM   2215  C  CB    . PRO B  1 107 ? 12.361  -74.029 -20.423 1.00 37.92 ? 106  PRO F CB    1 
ATOM   2216  C  CG    . PRO B  1 107 ? 13.423  -72.959 -20.285 1.00 37.97 ? 106  PRO F CG    1 
ATOM   2217  C  CD    . PRO B  1 107 ? 12.660  -71.714 -20.062 1.00 38.14 ? 106  PRO F CD    1 
ATOM   2218  N  N     . HIS B  1 108 ? 9.175   -73.427 -19.803 1.00 36.71 ? 107  HIS F N     1 
ATOM   2219  C  CA    . HIS B  1 108 ? 7.943   -74.073 -19.353 1.00 36.61 ? 107  HIS F CA    1 
ATOM   2220  C  C     . HIS B  1 108 ? 6.757   -73.141 -19.062 1.00 36.51 ? 107  HIS F C     1 
ATOM   2221  O  O     . HIS B  1 108 ? 5.664   -73.610 -18.741 1.00 36.47 ? 107  HIS F O     1 
ATOM   2222  C  CB    . HIS B  1 108 ? 8.233   -74.942 -18.124 1.00 36.43 ? 107  HIS F CB    1 
ATOM   2223  C  CG    . HIS B  1 108 ? 9.229   -76.034 -18.363 1.00 35.74 ? 107  HIS F CG    1 
ATOM   2224  N  ND1   . HIS B  1 108 ? 9.026   -77.049 -19.280 1.00 35.81 ? 107  HIS F ND1   1 
ATOM   2225  C  CD2   . HIS B  1 108 ? 10.421  -76.289 -17.775 1.00 36.20 ? 107  HIS F CD2   1 
ATOM   2226  C  CE1   . HIS B  1 108 ? 10.061  -77.870 -19.252 1.00 37.20 ? 107  HIS F CE1   1 
ATOM   2227  N  NE2   . HIS B  1 108 ? 10.914  -77.438 -18.336 1.00 36.14 ? 107  HIS F NE2   1 
ATOM   2228  N  N     . THR B  1 109 ? 6.952   -71.832 -19.200 1.00 36.62 ? 108  THR F N     1 
ATOM   2229  C  CA    . THR B  1 109 ? 5.876   -70.863 -19.005 1.00 36.18 ? 108  THR F CA    1 
ATOM   2230  C  C     . THR B  1 109 ? 4.670   -71.296 -19.831 1.00 36.72 ? 108  THR F C     1 
ATOM   2231  O  O     . THR B  1 109 ? 4.845   -71.748 -20.955 1.00 36.90 ? 108  THR F O     1 
ATOM   2232  C  CB    . THR B  1 109 ? 6.341   -69.491 -19.470 1.00 36.32 ? 108  THR F CB    1 
ATOM   2233  O  OG1   . THR B  1 109 ? 7.529   -69.149 -18.749 1.00 36.43 ? 108  THR F OG1   1 
ATOM   2234  C  CG2   . THR B  1 109 ? 5.293   -68.442 -19.257 1.00 35.17 ? 108  THR F CG2   1 
ATOM   2235  N  N     . PRO B  1 110 ? 3.439   -71.197 -19.269 1.00 36.75 ? 109  PRO F N     1 
ATOM   2236  C  CA    . PRO B  1 110 ? 2.312   -71.666 -20.045 1.00 36.76 ? 109  PRO F CA    1 
ATOM   2237  C  C     . PRO B  1 110 ? 2.050   -70.877 -21.326 1.00 36.70 ? 109  PRO F C     1 
ATOM   2238  O  O     . PRO B  1 110 ? 2.166   -69.652 -21.362 1.00 36.83 ? 109  PRO F O     1 
ATOM   2239  C  CB    . PRO B  1 110 ? 1.128   -71.567 -19.069 1.00 36.81 ? 109  PRO F CB    1 
ATOM   2240  C  CG    . PRO B  1 110 ? 1.549   -70.676 -18.006 1.00 37.29 ? 109  PRO F CG    1 
ATOM   2241  C  CD    . PRO B  1 110 ? 3.030   -70.754 -17.924 1.00 36.90 ? 109  PRO F CD    1 
ATOM   2242  N  N     . ILE B  1 111 ? 1.673   -71.613 -22.357 1.00 36.56 ? 110  ILE F N     1 
ATOM   2243  C  CA    . ILE B  1 111 ? 1.350   -71.063 -23.647 1.00 36.35 ? 110  ILE F CA    1 
ATOM   2244  C  C     . ILE B  1 111 ? -0.112  -71.370 -23.960 1.00 36.85 ? 110  ILE F C     1 
ATOM   2245  O  O     . ILE B  1 111 ? -0.555  -72.514 -23.797 1.00 36.95 ? 110  ILE F O     1 
ATOM   2246  C  CB    . ILE B  1 111 ? 2.221   -71.721 -24.736 1.00 36.38 ? 110  ILE F CB    1 
ATOM   2247  C  CG1   . ILE B  1 111 ? 3.686   -71.309 -24.585 1.00 35.99 ? 110  ILE F CG1   1 
ATOM   2248  C  CG2   . ILE B  1 111 ? 1.689   -71.361 -26.125 1.00 35.25 ? 110  ILE F CG2   1 
ATOM   2249  C  CD1   . ILE B  1 111 ? 4.694   -72.199 -25.381 1.00 35.70 ? 110  ILE F CD1   1 
ATOM   2250  N  N     . LEU B  1 112 ? -0.863  -70.350 -24.385 1.00 37.20 ? 111  LEU F N     1 
ATOM   2251  C  CA    . LEU B  1 112 ? -2.145  -70.576 -25.039 1.00 37.75 ? 111  LEU F CA    1 
ATOM   2252  C  C     . LEU B  1 112 ? -1.954  -70.309 -26.520 1.00 37.30 ? 111  LEU F C     1 
ATOM   2253  O  O     . LEU B  1 112 ? -1.366  -69.292 -26.907 1.00 36.59 ? 111  LEU F O     1 
ATOM   2254  C  CB    . LEU B  1 112 ? -3.254  -69.687 -24.487 1.00 38.02 ? 111  LEU F CB    1 
ATOM   2255  C  CG    . LEU B  1 112 ? -3.961  -70.046 -23.167 1.00 39.91 ? 111  LEU F CG    1 
ATOM   2256  C  CD1   . LEU B  1 112 ? -2.974  -70.198 -22.021 1.00 41.30 ? 111  LEU F CD1   1 
ATOM   2257  C  CD2   . LEU B  1 112 ? -5.001  -68.969 -22.823 1.00 39.21 ? 111  LEU F CD2   1 
ATOM   2258  N  N     . LEU B  1 113 ? -2.445  -71.247 -27.340 1.00 37.27 ? 112  LEU F N     1 
ATOM   2259  C  CA    . LEU B  1 113 ? -2.446  -71.108 -28.793 1.00 37.02 ? 112  LEU F CA    1 
ATOM   2260  C  C     . LEU B  1 113 ? -3.777  -70.496 -29.246 1.00 36.76 ? 112  LEU F C     1 
ATOM   2261  O  O     . LEU B  1 113 ? -4.823  -71.080 -29.033 1.00 36.46 ? 112  LEU F O     1 
ATOM   2262  C  CB    . LEU B  1 113 ? -2.219  -72.475 -29.455 1.00 36.72 ? 112  LEU F CB    1 
ATOM   2263  C  CG    . LEU B  1 113 ? -2.058  -72.483 -30.988 1.00 36.91 ? 112  LEU F CG    1 
ATOM   2264  C  CD1   . LEU B  1 113 ? -0.945  -71.580 -31.431 1.00 34.58 ? 112  LEU F CD1   1 
ATOM   2265  C  CD2   . LEU B  1 113 ? -1.861  -73.929 -31.562 1.00 37.61 ? 112  LEU F CD2   1 
ATOM   2266  N  N     . VAL B  1 114 ? -3.718  -69.315 -29.878 1.00 37.17 ? 113  VAL F N     1 
ATOM   2267  C  CA    . VAL B  1 114 ? -4.922  -68.548 -30.252 1.00 36.61 ? 113  VAL F CA    1 
ATOM   2268  C  C     . VAL B  1 114 ? -5.069  -68.394 -31.770 1.00 36.80 ? 113  VAL F C     1 
ATOM   2269  O  O     . VAL B  1 114 ? -4.192  -67.828 -32.439 1.00 36.47 ? 113  VAL F O     1 
ATOM   2270  C  CB    . VAL B  1 114 ? -4.909  -67.138 -29.607 1.00 36.65 ? 113  VAL F CB    1 
ATOM   2271  C  CG1   . VAL B  1 114 ? -6.121  -66.297 -30.078 1.00 36.10 ? 113  VAL F CG1   1 
ATOM   2272  C  CG2   . VAL B  1 114 ? -4.864  -67.264 -28.090 1.00 34.88 ? 113  VAL F CG2   1 
ATOM   2273  N  N     . GLY B  1 115 ? -6.179  -68.915 -32.299 1.00 36.72 ? 114  GLY F N     1 
ATOM   2274  C  CA    . GLY B  1 115 ? -6.538  -68.749 -33.705 1.00 36.33 ? 114  GLY F CA    1 
ATOM   2275  C  C     . GLY B  1 115 ? -7.359  -67.482 -33.826 1.00 36.30 ? 114  GLY F C     1 
ATOM   2276  O  O     . GLY B  1 115 ? -8.406  -67.354 -33.194 1.00 36.38 ? 114  GLY F O     1 
ATOM   2277  N  N     . THR B  1 116 ? -6.884  -66.542 -34.632 1.00 36.19 ? 115  THR F N     1 
ATOM   2278  C  CA    . THR B  1 116 ? -7.526  -65.247 -34.776 1.00 35.92 ? 115  THR F CA    1 
ATOM   2279  C  C     . THR B  1 116 ? -8.346  -65.144 -36.060 1.00 35.79 ? 115  THR F C     1 
ATOM   2280  O  O     . THR B  1 116 ? -8.208  -65.971 -36.952 1.00 35.97 ? 115  THR F O     1 
ATOM   2281  C  CB    . THR B  1 116 ? -6.459  -64.138 -34.828 1.00 36.42 ? 115  THR F CB    1 
ATOM   2282  O  OG1   . THR B  1 116 ? -5.643  -64.316 -36.000 1.00 34.54 ? 115  THR F OG1   1 
ATOM   2283  C  CG2   . THR B  1 116 ? -5.594  -64.157 -33.552 1.00 35.77 ? 115  THR F CG2   1 
ATOM   2284  N  N     . LYS B  1 117 ? -9.162  -64.094 -36.146 1.00 35.89 ? 116  LYS F N     1 
ATOM   2285  C  CA    . LYS B  1 117 ? -9.989  -63.781 -37.322 1.00 35.71 ? 116  LYS F CA    1 
ATOM   2286  C  C     . LYS B  1 117 ? -11.025 -64.865 -37.622 1.00 36.05 ? 116  LYS F C     1 
ATOM   2287  O  O     . LYS B  1 117 ? -11.310 -65.157 -38.792 1.00 35.75 ? 116  LYS F O     1 
ATOM   2288  C  CB    . LYS B  1 117 ? -9.132  -63.512 -38.573 1.00 35.85 ? 116  LYS F CB    1 
ATOM   2289  C  CG    . LYS B  1 117 ? -7.986  -62.494 -38.363 1.00 36.60 ? 116  LYS F CG    1 
ATOM   2290  C  CD    . LYS B  1 117 ? -7.345  -62.093 -39.673 1.00 35.54 ? 116  LYS F CD    1 
ATOM   2291  C  CE    . LYS B  1 117 ? -6.200  -61.092 -39.472 1.00 35.99 ? 116  LYS F CE    1 
ATOM   2292  N  NZ    . LYS B  1 117 ? -5.689  -60.577 -40.778 1.00 35.01 ? 116  LYS F NZ    1 
ATOM   2293  N  N     . LEU B  1 118 ? -11.604 -65.438 -36.570 1.00 36.31 ? 117  LEU F N     1 
ATOM   2294  C  CA    . LEU B  1 118 ? -12.614 -66.484 -36.715 1.00 36.68 ? 117  LEU F CA    1 
ATOM   2295  C  C     . LEU B  1 118 ? -13.733 -66.055 -37.659 1.00 36.69 ? 117  LEU F C     1 
ATOM   2296  O  O     . LEU B  1 118 ? -14.330 -66.885 -38.329 1.00 36.90 ? 117  LEU F O     1 
ATOM   2297  C  CB    . LEU B  1 118 ? -13.206 -66.869 -35.347 1.00 36.71 ? 117  LEU F CB    1 
ATOM   2298  C  CG    . LEU B  1 118 ? -14.311 -67.957 -35.294 1.00 37.26 ? 117  LEU F CG    1 
ATOM   2299  C  CD1   . LEU B  1 118 ? -13.883 -69.301 -35.917 1.00 37.37 ? 117  LEU F CD1   1 
ATOM   2300  C  CD2   . LEU B  1 118 ? -14.800 -68.183 -33.864 1.00 36.84 ? 117  LEU F CD2   1 
ATOM   2301  N  N     . ASP B  1 119 ? -14.010 -64.754 -37.713 1.00 36.84 ? 118  ASP F N     1 
ATOM   2302  C  CA    . ASP B  1 119 ? -15.081 -64.228 -38.563 1.00 36.73 ? 118  ASP F CA    1 
ATOM   2303  C  C     . ASP B  1 119 ? -14.871 -64.457 -40.058 1.00 36.89 ? 118  ASP F C     1 
ATOM   2304  O  O     . ASP B  1 119 ? -15.833 -64.414 -40.824 1.00 36.25 ? 118  ASP F O     1 
ATOM   2305  C  CB    . ASP B  1 119 ? -15.299 -62.733 -38.296 1.00 36.54 ? 118  ASP F CB    1 
ATOM   2306  C  CG    . ASP B  1 119 ? -14.072 -61.903 -38.590 1.00 36.56 ? 118  ASP F CG    1 
ATOM   2307  O  OD1   . ASP B  1 119 ? -13.091 -62.027 -37.819 1.00 37.43 ? 118  ASP F OD1   1 
ATOM   2308  O  OD2   . ASP B  1 119 ? -14.091 -61.136 -39.589 1.00 34.60 ? 118  ASP F OD2   1 
ATOM   2309  N  N     . LEU B  1 120 ? -13.625 -64.692 -40.468 1.00 37.74 ? 119  LEU F N     1 
ATOM   2310  C  CA    . LEU B  1 120 ? -13.284 -64.877 -41.887 1.00 38.23 ? 119  LEU F CA    1 
ATOM   2311  C  C     . LEU B  1 120 ? -13.284 -66.349 -42.333 1.00 38.81 ? 119  LEU F C     1 
ATOM   2312  O  O     . LEU B  1 120 ? -13.450 -66.624 -43.514 1.00 38.77 ? 119  LEU F O     1 
ATOM   2313  C  CB    . LEU B  1 120 ? -11.926 -64.224 -42.223 1.00 37.92 ? 119  LEU F CB    1 
ATOM   2314  C  CG    . LEU B  1 120 ? -11.761 -62.691 -42.160 1.00 38.16 ? 119  LEU F CG    1 
ATOM   2315  C  CD1   . LEU B  1 120 ? -10.303 -62.256 -42.441 1.00 37.86 ? 119  LEU F CD1   1 
ATOM   2316  C  CD2   . LEU B  1 120 ? -12.697 -61.977 -43.107 1.00 37.20 ? 119  LEU F CD2   1 
ATOM   2317  N  N     . ARG B  1 121 ? -13.104 -67.296 -41.416 1.00 39.61 ? 120  ARG F N     1 
ATOM   2318  C  CA    . ARG B  1 121 ? -12.982 -68.715 -41.815 1.00 40.21 ? 120  ARG F CA    1 
ATOM   2319  C  C     . ARG B  1 121 ? -14.146 -69.264 -42.657 1.00 41.01 ? 120  ARG F C     1 
ATOM   2320  O  O     . ARG B  1 121 ? -13.929 -70.067 -43.578 1.00 41.12 ? 120  ARG F O     1 
ATOM   2321  C  CB    . ARG B  1 121 ? -12.776 -69.611 -40.602 1.00 40.23 ? 120  ARG F CB    1 
ATOM   2322  C  CG    . ARG B  1 121 ? -12.744 -71.080 -40.976 1.00 40.72 ? 120  ARG F CG    1 
ATOM   2323  C  CD    . ARG B  1 121 ? -12.084 -71.914 -39.919 1.00 41.24 ? 120  ARG F CD    1 
ATOM   2324  N  NE    . ARG B  1 121 ? -12.938 -72.127 -38.754 1.00 40.43 ? 120  ARG F NE    1 
ATOM   2325  C  CZ    . ARG B  1 121 ? -12.504 -72.616 -37.591 1.00 40.37 ? 120  ARG F CZ    1 
ATOM   2326  N  NH1   . ARG B  1 121 ? -11.224 -72.950 -37.427 1.00 38.14 ? 120  ARG F NH1   1 
ATOM   2327  N  NH2   . ARG B  1 121 ? -13.360 -72.765 -36.584 1.00 40.83 ? 120  ARG F NH2   1 
ATOM   2328  N  N     . ASP B  1 122 ? -15.371 -68.840 -42.337 1.00 41.80 ? 121  ASP F N     1 
ATOM   2329  C  CA    . ASP B  1 122 ? -16.569 -69.269 -43.070 1.00 42.07 ? 121  ASP F CA    1 
ATOM   2330  C  C     . ASP B  1 122 ? -16.999 -68.234 -44.129 1.00 42.32 ? 121  ASP F C     1 
ATOM   2331  O  O     . ASP B  1 122 ? -18.073 -68.366 -44.727 1.00 42.73 ? 121  ASP F O     1 
ATOM   2332  C  CB    . ASP B  1 122 ? -17.709 -69.576 -42.083 1.00 42.18 ? 121  ASP F CB    1 
ATOM   2333  N  N     . ASP B  1 123 ? -16.147 -67.231 -44.369 1.00 42.22 ? 122  ASP F N     1 
ATOM   2334  C  CA    . ASP B  1 123 ? -16.365 -66.211 -45.402 1.00 42.48 ? 122  ASP F CA    1 
ATOM   2335  C  C     . ASP B  1 123 ? -16.130 -66.806 -46.790 1.00 42.00 ? 122  ASP F C     1 
ATOM   2336  O  O     . ASP B  1 123 ? -15.007 -67.195 -47.099 1.00 41.80 ? 122  ASP F O     1 
ATOM   2337  C  CB    . ASP B  1 123 ? -15.405 -65.028 -45.177 1.00 42.45 ? 122  ASP F CB    1 
ATOM   2338  C  CG    . ASP B  1 123 ? -15.513 -63.957 -46.253 1.00 43.91 ? 122  ASP F CG    1 
ATOM   2339  O  OD1   . ASP B  1 123 ? -16.614 -63.412 -46.430 1.00 45.84 ? 122  ASP F OD1   1 
ATOM   2340  O  OD2   . ASP B  1 123 ? -14.489 -63.641 -46.911 1.00 45.16 ? 122  ASP F OD2   1 
ATOM   2341  N  N     . LYS B  1 124 ? -17.182 -66.855 -47.616 1.00 41.71 ? 123  LYS F N     1 
ATOM   2342  C  CA    . LYS B  1 124 ? -17.122 -67.459 -48.966 1.00 41.51 ? 123  LYS F CA    1 
ATOM   2343  C  C     . LYS B  1 124 ? -15.994 -66.909 -49.836 1.00 41.16 ? 123  LYS F C     1 
ATOM   2344  O  O     . LYS B  1 124 ? -15.234 -67.668 -50.444 1.00 40.93 ? 123  LYS F O     1 
ATOM   2345  C  CB    . LYS B  1 124 ? -18.460 -67.280 -49.719 1.00 41.36 ? 123  LYS F CB    1 
ATOM   2346  N  N     . ASP B  1 125 ? -15.881 -65.588 -49.889 1.00 41.15 ? 124  ASP F N     1 
ATOM   2347  C  CA    . ASP B  1 125 ? -14.834 -64.955 -50.687 1.00 41.13 ? 124  ASP F CA    1 
ATOM   2348  C  C     . ASP B  1 125 ? -13.432 -65.270 -50.155 1.00 40.75 ? 124  ASP F C     1 
ATOM   2349  O  O     . ASP B  1 125 ? -12.507 -65.463 -50.948 1.00 40.64 ? 124  ASP F O     1 
ATOM   2350  C  CB    . ASP B  1 125 ? -15.068 -63.445 -50.807 1.00 41.28 ? 124  ASP F CB    1 
ATOM   2351  N  N     . THR B  1 126 ? -13.266 -65.341 -48.831 1.00 40.56 ? 125  THR F N     1 
ATOM   2352  C  CA    . THR B  1 126 ? -11.956 -65.690 -48.255 1.00 40.15 ? 125  THR F CA    1 
ATOM   2353  C  C     . THR B  1 126 ? -11.624 -67.131 -48.609 1.00 39.96 ? 125  THR F C     1 
ATOM   2354  O  O     . THR B  1 126 ? -10.506 -67.421 -49.014 1.00 40.44 ? 125  THR F O     1 
ATOM   2355  C  CB    . THR B  1 126 ? -11.883 -65.506 -46.714 1.00 39.92 ? 125  THR F CB    1 
ATOM   2356  O  OG1   . THR B  1 126 ? -11.947 -64.119 -46.384 1.00 40.59 ? 125  THR F OG1   1 
ATOM   2357  C  CG2   . THR B  1 126 ? -10.582 -66.062 -46.151 1.00 39.10 ? 125  THR F CG2   1 
ATOM   2358  N  N     . ILE B  1 127 ? -12.601 -68.019 -48.461 1.00 39.86 ? 126  ILE F N     1 
ATOM   2359  C  CA    . ILE B  1 127 ? -12.443 -69.428 -48.835 1.00 39.85 ? 126  ILE F CA    1 
ATOM   2360  C  C     . ILE B  1 127 ? -11.996 -69.547 -50.292 1.00 39.98 ? 126  ILE F C     1 
ATOM   2361  O  O     . ILE B  1 127 ? -11.004 -70.224 -50.569 1.00 39.62 ? 126  ILE F O     1 
ATOM   2362  C  CB    . ILE B  1 127 ? -13.735 -70.250 -48.551 1.00 39.58 ? 126  ILE F CB    1 
ATOM   2363  C  CG1   . ILE B  1 127 ? -13.957 -70.372 -47.043 1.00 39.78 ? 126  ILE F CG1   1 
ATOM   2364  C  CG2   . ILE B  1 127 ? -13.673 -71.649 -49.160 1.00 39.28 ? 126  ILE F CG2   1 
ATOM   2365  C  CD1   . ILE B  1 127 ? -15.352 -70.871 -46.647 1.00 39.77 ? 126  ILE F CD1   1 
ATOM   2366  N  N     . GLU B  1 128 ? -12.683 -68.853 -51.208 1.00 40.45 ? 127  GLU F N     1 
ATOM   2367  C  CA    . GLU B  1 128 ? -12.309 -68.884 -52.634 1.00 40.94 ? 127  GLU F CA    1 
ATOM   2368  C  C     . GLU B  1 128 ? -10.876 -68.415 -52.899 1.00 41.35 ? 127  GLU F C     1 
ATOM   2369  O  O     . GLU B  1 128 ? -10.127 -69.090 -53.604 1.00 41.60 ? 127  GLU F O     1 
ATOM   2370  C  CB    . GLU B  1 128 ? -13.290 -68.082 -53.495 1.00 40.90 ? 127  GLU F CB    1 
ATOM   2371  N  N     . ARG B  1 129 ? -10.501 -67.268 -52.338 1.00 41.71 ? 128  ARG F N     1 
ATOM   2372  C  CA    . ARG B  1 129 ? -9.152  -66.729 -52.509 1.00 42.44 ? 128  ARG F CA    1 
ATOM   2373  C  C     . ARG B  1 129 ? -8.056  -67.693 -52.036 1.00 42.32 ? 128  ARG F C     1 
ATOM   2374  O  O     . ARG B  1 129 ? -7.005  -67.799 -52.665 1.00 42.45 ? 128  ARG F O     1 
ATOM   2375  C  CB    . ARG B  1 129 ? -8.997  -65.403 -51.754 1.00 42.63 ? 128  ARG F CB    1 
ATOM   2376  C  CG    . ARG B  1 129 ? -9.602  -64.198 -52.456 1.00 43.55 ? 128  ARG F CG    1 
ATOM   2377  C  CD    . ARG B  1 129 ? -9.179  -62.888 -51.761 1.00 44.62 ? 128  ARG F CD    1 
ATOM   2378  N  NE    . ARG B  1 129 ? -9.952  -62.607 -50.547 1.00 46.15 ? 128  ARG F NE    1 
ATOM   2379  C  CZ    . ARG B  1 129 ? -11.211 -62.160 -50.525 1.00 46.18 ? 128  ARG F CZ    1 
ATOM   2380  N  NH1   . ARG B  1 129 ? -11.872 -61.930 -51.655 1.00 46.48 ? 128  ARG F NH1   1 
ATOM   2381  N  NH2   . ARG B  1 129 ? -11.814 -61.942 -49.354 1.00 46.24 ? 128  ARG F NH2   1 
ATOM   2382  N  N     . LEU B  1 130 ? -8.282  -68.365 -50.914 1.00 42.08 ? 129  LEU F N     1 
ATOM   2383  C  CA    . LEU B  1 130 ? -7.343  -69.383 -50.439 1.00 42.01 ? 129  LEU F CA    1 
ATOM   2384  C  C     . LEU B  1 130 ? -7.341  -70.620 -51.364 1.00 42.25 ? 129  LEU F C     1 
ATOM   2385  O  O     . LEU B  1 130 ? -6.274  -71.161 -51.681 1.00 41.99 ? 129  LEU F O     1 
ATOM   2386  C  CB    . LEU B  1 130 ? -7.667  -69.785 -48.984 1.00 42.06 ? 129  LEU F CB    1 
ATOM   2387  C  CG    . LEU B  1 130 ? -7.372  -68.747 -47.884 1.00 41.59 ? 129  LEU F CG    1 
ATOM   2388  C  CD1   . LEU B  1 130 ? -8.053  -69.108 -46.562 1.00 39.48 ? 129  LEU F CD1   1 
ATOM   2389  C  CD2   . LEU B  1 130 ? -5.863  -68.603 -47.683 1.00 40.77 ? 129  LEU F CD2   1 
ATOM   2390  N  N     . ARG B  1 131 ? -8.523  -71.056 -51.802 1.00 42.36 ? 130  ARG F N     1 
ATOM   2391  C  CA    . ARG B  1 131 ? -8.627  -72.233 -52.679 1.00 43.02 ? 130  ARG F CA    1 
ATOM   2392  C  C     . ARG B  1 131 ? -7.843  -72.030 -53.975 1.00 43.60 ? 130  ARG F C     1 
ATOM   2393  O  O     . ARG B  1 131 ? -7.272  -72.983 -54.506 1.00 43.51 ? 130  ARG F O     1 
ATOM   2394  C  CB    . ARG B  1 131 ? -10.090 -72.560 -53.012 1.00 42.99 ? 130  ARG F CB    1 
ATOM   2395  N  N     . ASP B  1 132 ? -7.823  -70.783 -54.459 1.00 44.26 ? 131  ASP F N     1 
ATOM   2396  C  CA    . ASP B  1 132 ? -7.088  -70.402 -55.671 1.00 45.06 ? 131  ASP F CA    1 
ATOM   2397  C  C     . ASP B  1 132 ? -5.578  -70.595 -55.515 1.00 44.70 ? 131  ASP F C     1 
ATOM   2398  O  O     . ASP B  1 132 ? -4.885  -70.827 -56.497 1.00 44.59 ? 131  ASP F O     1 
ATOM   2399  C  CB    . ASP B  1 132 ? -7.395  -68.942 -56.068 1.00 45.58 ? 131  ASP F CB    1 
ATOM   2400  C  CG    . ASP B  1 132 ? -8.804  -68.759 -56.682 1.00 48.12 ? 131  ASP F CG    1 
ATOM   2401  O  OD1   . ASP B  1 132 ? -9.484  -69.754 -57.038 1.00 50.73 ? 131  ASP F OD1   1 
ATOM   2402  O  OD2   . ASP B  1 132 ? -9.234  -67.590 -56.821 1.00 52.95 ? 131  ASP F OD2   1 
ATOM   2403  N  N     . LYS B  1 133 ? -5.075  -70.513 -54.286 1.00 44.52 ? 132  LYS F N     1 
ATOM   2404  C  CA    . LYS B  1 133 ? -3.654  -70.768 -54.011 1.00 44.42 ? 132  LYS F CA    1 
ATOM   2405  C  C     . LYS B  1 133 ? -3.414  -72.191 -53.502 1.00 44.17 ? 132  LYS F C     1 
ATOM   2406  O  O     . LYS B  1 133 ? -2.338  -72.492 -53.003 1.00 44.59 ? 132  LYS F O     1 
ATOM   2407  C  CB    . LYS B  1 133 ? -3.116  -69.739 -53.016 1.00 44.34 ? 132  LYS F CB    1 
ATOM   2408  C  CG    . LYS B  1 133 ? -3.266  -68.290 -53.490 1.00 44.70 ? 132  LYS F CG    1 
ATOM   2409  N  N     . LYS B  1 134 ? -4.409  -73.063 -53.671 1.00 43.78 ? 133  LYS F N     1 
ATOM   2410  C  CA    . LYS B  1 134 ? -4.392  -74.425 -53.130 1.00 43.63 ? 133  LYS F CA    1 
ATOM   2411  C  C     . LYS B  1 134 ? -4.162  -74.430 -51.610 1.00 43.47 ? 133  LYS F C     1 
ATOM   2412  O  O     . LYS B  1 134 ? -3.374  -75.236 -51.079 1.00 43.92 ? 133  LYS F O     1 
ATOM   2413  C  CB    . LYS B  1 134 ? -3.358  -75.293 -53.864 1.00 44.22 ? 133  LYS F CB    1 
ATOM   2414  N  N     . LEU B  1 135 ? -4.858  -73.519 -50.925 1.00 42.54 ? 134  LEU F N     1 
ATOM   2415  C  CA    . LEU B  1 135 ? -4.857  -73.447 -49.467 1.00 41.95 ? 134  LEU F CA    1 
ATOM   2416  C  C     . LEU B  1 135 ? -6.300  -73.487 -48.927 1.00 41.04 ? 134  LEU F C     1 
ATOM   2417  O  O     . LEU B  1 135 ? -7.271  -73.360 -49.686 1.00 40.95 ? 134  LEU F O     1 
ATOM   2418  C  CB    . LEU B  1 135 ? -4.164  -72.162 -48.997 1.00 42.31 ? 134  LEU F CB    1 
ATOM   2419  C  CG    . LEU B  1 135 ? -2.665  -72.039 -49.325 1.00 43.83 ? 134  LEU F CG    1 
ATOM   2420  C  CD1   . LEU B  1 135 ? -2.142  -70.677 -48.971 1.00 43.54 ? 134  LEU F CD1   1 
ATOM   2421  C  CD2   . LEU B  1 135 ? -1.843  -73.121 -48.618 1.00 45.65 ? 134  LEU F CD2   1 
ATOM   2422  N  N     . ALA B  1 136 ? -6.424  -73.675 -47.613 1.00 39.89 ? 135  ALA F N     1 
ATOM   2423  C  CA    . ALA B  1 136 ? -7.724  -73.680 -46.935 1.00 39.02 ? 135  ALA F CA    1 
ATOM   2424  C  C     . ALA B  1 136 ? -7.586  -72.982 -45.589 1.00 38.21 ? 135  ALA F C     1 
ATOM   2425  O  O     . ALA B  1 136 ? -6.492  -72.874 -45.061 1.00 37.89 ? 135  ALA F O     1 
ATOM   2426  C  CB    . ALA B  1 136 ? -8.240  -75.109 -46.749 1.00 38.67 ? 135  ALA F CB    1 
ATOM   2427  N  N     . PRO B  1 137 ? -8.696  -72.469 -45.046 1.00 37.92 ? 136  PRO F N     1 
ATOM   2428  C  CA    . PRO B  1 137 ? -8.608  -71.941 -43.685 1.00 37.84 ? 136  PRO F CA    1 
ATOM   2429  C  C     . PRO B  1 137 ? -8.256  -73.039 -42.684 1.00 37.43 ? 136  PRO F C     1 
ATOM   2430  O  O     . PRO B  1 137 ? -8.590  -74.208 -42.904 1.00 37.35 ? 136  PRO F O     1 
ATOM   2431  C  CB    . PRO B  1 137 ? -10.021 -71.402 -43.422 1.00 37.89 ? 136  PRO F CB    1 
ATOM   2432  C  CG    . PRO B  1 137 ? -10.611 -71.175 -44.774 1.00 37.86 ? 136  PRO F CG    1 
ATOM   2433  C  CD    . PRO B  1 137 ? -10.048 -72.288 -45.617 1.00 37.94 ? 136  PRO F CD    1 
ATOM   2434  N  N     . ILE B  1 138 ? -7.585  -72.665 -41.601 1.00 36.79 ? 137  ILE F N     1 
ATOM   2435  C  CA    . ILE B  1 138 ? -7.200  -73.638 -40.576 1.00 36.54 ? 137  ILE F CA    1 
ATOM   2436  C  C     . ILE B  1 138 ? -8.449  -74.067 -39.810 1.00 36.39 ? 137  ILE F C     1 
ATOM   2437  O  O     . ILE B  1 138 ? -9.229  -73.228 -39.356 1.00 36.24 ? 137  ILE F O     1 
ATOM   2438  C  CB    . ILE B  1 138 ? -6.193  -73.057 -39.551 1.00 36.51 ? 137  ILE F CB    1 
ATOM   2439  C  CG1   . ILE B  1 138 ? -4.945  -72.476 -40.239 1.00 36.51 ? 137  ILE F CG1   1 
ATOM   2440  C  CG2   . ILE B  1 138 ? -5.816  -74.123 -38.488 1.00 34.86 ? 137  ILE F CG2   1 
ATOM   2441  C  CD1   . ILE B  1 138 ? -4.143  -73.463 -41.073 1.00 38.27 ? 137  ILE F CD1   1 
ATOM   2442  N  N     . THR B  1 139 ? -8.615  -75.370 -39.636 1.00 36.24 ? 138  THR F N     1 
ATOM   2443  C  CA    . THR B  1 139 ? -9.772  -75.911 -38.920 1.00 36.09 ? 138  THR F CA    1 
ATOM   2444  C  C     . THR B  1 139 ? -9.490  -76.069 -37.428 1.00 36.33 ? 138  THR F C     1 
ATOM   2445  O  O     . THR B  1 139 ? -8.331  -76.083 -37.000 1.00 36.62 ? 138  THR F O     1 
ATOM   2446  C  CB    . THR B  1 139 ? -10.201 -77.284 -39.500 1.00 36.06 ? 138  THR F CB    1 
ATOM   2447  O  OG1   . THR B  1 139 ? -9.165  -78.237 -39.277 1.00 34.61 ? 138  THR F OG1   1 
ATOM   2448  C  CG2   . THR B  1 139 ? -10.481 -77.189 -40.975 1.00 36.25 ? 138  THR F CG2   1 
ATOM   2449  N  N     . TYR B  1 140 ? -10.561 -76.168 -36.643 1.00 36.43 ? 139  TYR F N     1 
ATOM   2450  C  CA    . TYR B  1 140 ? -10.462 -76.403 -35.210 1.00 36.84 ? 139  TYR F CA    1 
ATOM   2451  C  C     . TYR B  1 140 ? -9.626  -77.652 -34.873 1.00 36.69 ? 139  TYR F C     1 
ATOM   2452  O  O     . TYR B  1 140 ? -8.680  -77.547 -34.092 1.00 36.51 ? 139  TYR F O     1 
ATOM   2453  C  CB    . TYR B  1 140 ? -11.856 -76.484 -34.564 1.00 37.05 ? 139  TYR F CB    1 
ATOM   2454  C  CG    . TYR B  1 140 ? -11.807 -76.451 -33.063 1.00 37.19 ? 139  TYR F CG    1 
ATOM   2455  C  CD1   . TYR B  1 140 ? -11.625 -77.622 -32.325 1.00 36.46 ? 139  TYR F CD1   1 
ATOM   2456  C  CD2   . TYR B  1 140 ? -11.907 -75.239 -32.374 1.00 37.56 ? 139  TYR F CD2   1 
ATOM   2457  C  CE1   . TYR B  1 140 ? -11.548 -77.585 -30.952 1.00 36.41 ? 139  TYR F CE1   1 
ATOM   2458  C  CE2   . TYR B  1 140 ? -11.836 -75.192 -31.001 1.00 36.31 ? 139  TYR F CE2   1 
ATOM   2459  C  CZ    . TYR B  1 140 ? -11.660 -76.370 -30.291 1.00 37.37 ? 139  TYR F CZ    1 
ATOM   2460  O  OH    . TYR B  1 140 ? -11.590 -76.332 -28.913 1.00 37.34 ? 139  TYR F OH    1 
ATOM   2461  N  N     . PRO B  1 141 ? -9.958  -78.825 -35.462 1.00 36.72 ? 140  PRO F N     1 
ATOM   2462  C  CA    . PRO B  1 141 ? -9.135  -80.016 -35.204 1.00 36.95 ? 140  PRO F CA    1 
ATOM   2463  C  C     . PRO B  1 141 ? -7.650  -79.823 -35.524 1.00 37.15 ? 140  PRO F C     1 
ATOM   2464  O  O     . PRO B  1 141 ? -6.806  -80.354 -34.810 1.00 37.02 ? 140  PRO F O     1 
ATOM   2465  C  CB    . PRO B  1 141 ? -9.757  -81.099 -36.111 1.00 36.84 ? 140  PRO F CB    1 
ATOM   2466  C  CG    . PRO B  1 141 ? -11.125 -80.668 -36.351 1.00 36.93 ? 140  PRO F CG    1 
ATOM   2467  C  CD    . PRO B  1 141 ? -11.076 -79.144 -36.370 1.00 36.99 ? 140  PRO F CD    1 
ATOM   2468  N  N     . GLN B  1 142 ? -7.337  -79.052 -36.567 1.00 37.68 ? 141  GLN F N     1 
ATOM   2469  C  CA    . GLN B  1 142 ? -5.942  -78.687 -36.885 1.00 37.93 ? 141  GLN F CA    1 
ATOM   2470  C  C     . GLN B  1 142 ? -5.261  -77.833 -35.806 1.00 37.38 ? 141  GLN F C     1 
ATOM   2471  O  O     . GLN B  1 142 ? -4.099  -78.048 -35.463 1.00 36.62 ? 141  GLN F O     1 
ATOM   2472  C  CB    . GLN B  1 142 ? -5.886  -77.897 -38.187 1.00 38.28 ? 141  GLN F CB    1 
ATOM   2473  C  CG    . GLN B  1 142 ? -6.038  -78.695 -39.449 1.00 40.10 ? 141  GLN F CG    1 
ATOM   2474  C  CD    . GLN B  1 142 ? -5.948  -77.777 -40.657 1.00 40.79 ? 141  GLN F CD    1 
ATOM   2475  O  OE1   . GLN B  1 142 ? -6.928  -77.142 -41.033 1.00 45.92 ? 141  GLN F OE1   1 
ATOM   2476  N  NE2   . GLN B  1 142 ? -4.757  -77.667 -41.242 1.00 43.24 ? 141  GLN F NE2   1 
ATOM   2477  N  N     . GLY B  1 143 ? -5.971  -76.825 -35.308 1.00 37.30 ? 142  GLY F N     1 
ATOM   2478  C  CA    . GLY B  1 143 ? -5.445  -75.986 -34.238 1.00 37.26 ? 142  GLY F CA    1 
ATOM   2479  C  C     . GLY B  1 143 ? -5.220  -76.767 -32.963 1.00 37.74 ? 142  GLY F C     1 
ATOM   2480  O  O     . GLY B  1 143 ? -4.251  -76.533 -32.234 1.00 38.01 ? 142  GLY F O     1 
ATOM   2481  N  N     . LEU B  1 144 ? -6.117  -77.711 -32.698 1.00 37.80 ? 143  LEU F N     1 
ATOM   2482  C  CA    . LEU B  1 144 ? -5.977  -78.580 -31.554 1.00 38.24 ? 143  LEU F CA    1 
ATOM   2483  C  C     . LEU B  1 144 ? -4.726  -79.457 -31.669 1.00 37.96 ? 143  LEU F C     1 
ATOM   2484  O  O     . LEU B  1 144 ? -3.974  -79.596 -30.701 1.00 37.83 ? 143  LEU F O     1 
ATOM   2485  C  CB    . LEU B  1 144 ? -7.230  -79.428 -31.396 1.00 38.10 ? 143  LEU F CB    1 
ATOM   2486  C  CG    . LEU B  1 144 ? -7.573  -79.907 -30.001 1.00 39.40 ? 143  LEU F CG    1 
ATOM   2487  C  CD1   . LEU B  1 144 ? -7.984  -78.735 -29.104 1.00 40.21 ? 143  LEU F CD1   1 
ATOM   2488  C  CD2   . LEU B  1 144 ? -8.685  -80.987 -30.117 1.00 38.93 ? 143  LEU F CD2   1 
ATOM   2489  N  N     . ALA B  1 145 ? -4.495  -80.024 -32.851 1.00 38.03 ? 144  ALA F N     1 
ATOM   2490  C  CA    . ALA B  1 145 ? -3.285  -80.832 -33.109 1.00 38.00 ? 144  ALA F CA    1 
ATOM   2491  C  C     . ALA B  1 145 ? -2.022  -79.991 -32.893 1.00 37.93 ? 144  ALA F C     1 
ATOM   2492  O  O     . ALA B  1 145 ? -1.069  -80.444 -32.265 1.00 37.44 ? 144  ALA F O     1 
ATOM   2493  C  CB    . ALA B  1 145 ? -3.307  -81.421 -34.535 1.00 38.02 ? 144  ALA F CB    1 
ATOM   2494  N  N     . MET B  1 146 ? -2.020  -78.759 -33.395 1.00 38.18 ? 145  MET F N     1 
ATOM   2495  C  CA    . MET B  1 146 ? -0.866  -77.871 -33.184 1.00 38.38 ? 145  MET F CA    1 
ATOM   2496  C  C     . MET B  1 146 ? -0.659  -77.552 -31.698 1.00 38.42 ? 145  MET F C     1 
ATOM   2497  O  O     . MET B  1 146 ? 0.467   -77.519 -31.227 1.00 38.37 ? 145  MET F O     1 
ATOM   2498  C  CB    . MET B  1 146 ? -1.006  -76.566 -33.982 1.00 38.51 ? 145  MET F CB    1 
ATOM   2499  C  CG    . MET B  1 146 ? 0.204   -75.617 -33.872 1.00 38.57 ? 145  MET F CG    1 
ATOM   2500  S  SD    . MET B  1 146 ? 1.715   -76.263 -34.644 1.00 38.44 ? 145  MET F SD    1 
ATOM   2501  C  CE    . MET B  1 146 ? 1.382   -75.745 -36.334 1.00 38.22 ? 145  MET F CE    1 
ATOM   2502  N  N     . ALA B  1 147 ? -1.742  -77.304 -30.972 1.00 38.94 ? 146  ALA F N     1 
ATOM   2503  C  CA    . ALA B  1 147 ? -1.649  -76.952 -29.550 1.00 39.26 ? 146  ALA F CA    1 
ATOM   2504  C  C     . ALA B  1 147 ? -1.006  -78.094 -28.751 1.00 39.93 ? 146  ALA F C     1 
ATOM   2505  O  O     . ALA B  1 147 ? -0.172  -77.870 -27.874 1.00 39.47 ? 146  ALA F O     1 
ATOM   2506  C  CB    . ALA B  1 147 ? -3.026  -76.593 -28.992 1.00 38.46 ? 146  ALA F CB    1 
ATOM   2507  N  N     . ARG B  1 148 ? -1.393  -79.318 -29.078 1.00 40.70 ? 147  ARG F N     1 
ATOM   2508  C  CA    . ARG B  1 148 ? -0.757  -80.510 -28.517 1.00 41.88 ? 147  ARG F CA    1 
ATOM   2509  C  C     . ARG B  1 148 ? 0.730   -80.634 -28.873 1.00 41.80 ? 147  ARG F C     1 
ATOM   2510  O  O     . ARG B  1 148 ? 1.558   -80.957 -28.014 1.00 41.57 ? 147  ARG F O     1 
ATOM   2511  C  CB    . ARG B  1 148 ? -1.528  -81.748 -28.964 1.00 42.63 ? 147  ARG F CB    1 
ATOM   2512  C  CG    . ARG B  1 148 ? -2.876  -81.820 -28.264 1.00 45.85 ? 147  ARG F CG    1 
ATOM   2513  C  CD    . ARG B  1 148 ? -3.755  -82.943 -28.742 1.00 50.72 ? 147  ARG F CD    1 
ATOM   2514  N  NE    . ARG B  1 148 ? -5.019  -82.946 -27.987 1.00 52.90 ? 147  ARG F NE    1 
ATOM   2515  C  CZ    . ARG B  1 148 ? -6.178  -83.443 -28.427 1.00 54.71 ? 147  ARG F CZ    1 
ATOM   2516  N  NH1   . ARG B  1 148 ? -6.281  -83.981 -29.639 1.00 55.83 ? 147  ARG F NH1   1 
ATOM   2517  N  NH2   . ARG B  1 148 ? -7.254  -83.397 -27.648 1.00 55.37 ? 147  ARG F NH2   1 
ATOM   2518  N  N     . GLU B  1 149 ? 1.068   -80.350 -30.128 1.00 41.64 ? 148  GLU F N     1 
ATOM   2519  C  CA    . GLU B  1 149 ? 2.450   -80.449 -30.586 1.00 41.81 ? 148  GLU F CA    1 
ATOM   2520  C  C     . GLU B  1 149 ? 3.385   -79.494 -29.854 1.00 41.02 ? 148  GLU F C     1 
ATOM   2521  O  O     . GLU B  1 149 ? 4.513   -79.853 -29.549 1.00 41.24 ? 148  GLU F O     1 
ATOM   2522  C  CB    . GLU B  1 149 ? 2.542   -80.178 -32.085 1.00 42.01 ? 148  GLU F CB    1 
ATOM   2523  C  CG    . GLU B  1 149 ? 3.961   -80.308 -32.643 1.00 43.52 ? 148  GLU F CG    1 
ATOM   2524  C  CD    . GLU B  1 149 ? 4.042   -80.107 -34.158 1.00 44.72 ? 148  GLU F CD    1 
ATOM   2525  O  OE1   . GLU B  1 149 ? 3.138   -80.582 -34.889 1.00 47.10 ? 148  GLU F OE1   1 
ATOM   2526  O  OE2   . GLU B  1 149 ? 5.036   -79.484 -34.606 1.00 48.88 ? 148  GLU F OE2   1 
ATOM   2527  N  N     . ILE B  1 150 ? 2.922   -78.280 -29.580 1.00 40.45 ? 149  ILE F N     1 
ATOM   2528  C  CA    . ILE B  1 150 ? 3.756   -77.280 -28.910 1.00 39.90 ? 149  ILE F CA    1 
ATOM   2529  C  C     . ILE B  1 150 ? 3.616   -77.261 -27.366 1.00 39.89 ? 149  ILE F C     1 
ATOM   2530  O  O     . ILE B  1 150 ? 4.221   -76.405 -26.715 1.00 39.79 ? 149  ILE F O     1 
ATOM   2531  C  CB    . ILE B  1 150 ? 3.532   -75.871 -29.517 1.00 39.94 ? 149  ILE F CB    1 
ATOM   2532  C  CG1   . ILE B  1 150 ? 2.155   -75.299 -29.161 1.00 40.35 ? 149  ILE F CG1   1 
ATOM   2533  C  CG2   . ILE B  1 150 ? 3.717   -75.915 -31.054 1.00 39.11 ? 149  ILE F CG2   1 
ATOM   2534  C  CD1   . ILE B  1 150 ? 1.966   -73.840 -29.593 1.00 38.71 ? 149  ILE F CD1   1 
ATOM   2535  N  N     . GLY B  1 151 ? 2.850   -78.213 -26.806 1.00 39.23 ? 150  GLY F N     1 
ATOM   2536  C  CA    . GLY B  1 151 ? 2.614   -78.317 -25.362 1.00 39.12 ? 150  GLY F CA    1 
ATOM   2537  C  C     . GLY B  1 151 ? 1.814   -77.164 -24.766 1.00 39.23 ? 150  GLY F C     1 
ATOM   2538  O  O     . GLY B  1 151 ? 2.107   -76.673 -23.681 1.00 38.70 ? 150  GLY F O     1 
ATOM   2539  N  N     . SER B  1 152 ? 0.795   -76.746 -25.490 1.00 39.32 ? 151  SER F N     1 
ATOM   2540  C  CA    . SER B  1 152 ? -0.047  -75.636 -25.105 1.00 39.98 ? 151  SER F CA    1 
ATOM   2541  C  C     . SER B  1 152 ? -1.041  -76.035 -24.002 1.00 39.66 ? 151  SER F C     1 
ATOM   2542  O  O     . SER B  1 152 ? -1.515  -77.173 -23.941 1.00 39.09 ? 151  SER F O     1 
ATOM   2543  C  CB    . SER B  1 152 ? -0.814  -75.153 -26.339 1.00 40.20 ? 151  SER F CB    1 
ATOM   2544  O  OG    . SER B  1 152 ? -1.720  -74.131 -26.000 1.00 44.04 ? 151  SER F OG    1 
ATOM   2545  N  N     . VAL B  1 153 ? -1.350  -75.083 -23.122 1.00 39.53 ? 152  VAL F N     1 
ATOM   2546  C  CA    . VAL B  1 153 ? -2.326  -75.316 -22.074 1.00 38.69 ? 152  VAL F CA    1 
ATOM   2547  C  C     . VAL B  1 153 ? -3.692  -75.526 -22.725 1.00 38.94 ? 152  VAL F C     1 
ATOM   2548  O  O     . VAL B  1 153 ? -4.444  -76.409 -22.320 1.00 38.61 ? 152  VAL F O     1 
ATOM   2549  C  CB    . VAL B  1 153 ? -2.372  -74.132 -21.038 1.00 38.77 ? 152  VAL F CB    1 
ATOM   2550  C  CG1   . VAL B  1 153 ? -3.522  -74.312 -20.053 1.00 38.98 ? 152  VAL F CG1   1 
ATOM   2551  C  CG2   . VAL B  1 153 ? -1.031  -74.008 -20.278 1.00 38.11 ? 152  VAL F CG2   1 
ATOM   2552  N  N     . LYS B  1 154 ? -3.994  -74.723 -23.745 1.00 38.87 ? 153  LYS F N     1 
ATOM   2553  C  CA    . LYS B  1 154 ? -5.309  -74.698 -24.354 1.00 39.64 ? 153  LYS F CA    1 
ATOM   2554  C  C     . LYS B  1 154 ? -5.219  -74.113 -25.770 1.00 39.14 ? 153  LYS F C     1 
ATOM   2555  O  O     . LYS B  1 154 ? -4.315  -73.328 -26.070 1.00 39.12 ? 153  LYS F O     1 
ATOM   2556  C  CB    . LYS B  1 154 ? -6.241  -73.846 -23.484 1.00 40.84 ? 153  LYS F CB    1 
ATOM   2557  C  CG    . LYS B  1 154 ? -7.743  -73.906 -23.841 1.00 43.63 ? 153  LYS F CG    1 
ATOM   2558  C  CD    . LYS B  1 154 ? -8.527  -74.829 -22.903 1.00 46.67 ? 153  LYS F CD    1 
ATOM   2559  N  N     . TYR B  1 155 ? -6.121  -74.552 -26.646 1.00 38.23 ? 154  TYR F N     1 
ATOM   2560  C  CA    . TYR B  1 155 ? -6.334  -73.948 -27.949 1.00 37.87 ? 154  TYR F CA    1 
ATOM   2561  C  C     . TYR B  1 155 ? -7.640  -73.202 -27.903 1.00 37.78 ? 154  TYR F C     1 
ATOM   2562  O  O     . TYR B  1 155 ? -8.648  -73.757 -27.475 1.00 38.24 ? 154  TYR F O     1 
ATOM   2563  C  CB    . TYR B  1 155 ? -6.396  -75.010 -29.057 1.00 37.74 ? 154  TYR F CB    1 
ATOM   2564  C  CG    . TYR B  1 155 ? -6.784  -74.460 -30.416 1.00 37.00 ? 154  TYR F CG    1 
ATOM   2565  C  CD1   . TYR B  1 155 ? -5.970  -73.538 -31.071 1.00 37.36 ? 154  TYR F CD1   1 
ATOM   2566  C  CD2   . TYR B  1 155 ? -7.980  -74.843 -31.041 1.00 36.28 ? 154  TYR F CD2   1 
ATOM   2567  C  CE1   . TYR B  1 155 ? -6.324  -73.008 -32.312 1.00 35.97 ? 154  TYR F CE1   1 
ATOM   2568  C  CE2   . TYR B  1 155 ? -8.332  -74.335 -32.291 1.00 35.96 ? 154  TYR F CE2   1 
ATOM   2569  C  CZ    . TYR B  1 155 ? -7.510  -73.422 -32.916 1.00 36.78 ? 154  TYR F CZ    1 
ATOM   2570  O  OH    . TYR B  1 155 ? -7.846  -72.911 -34.149 1.00 37.26 ? 154  TYR F OH    1 
ATOM   2571  N  N     . LEU B  1 156 ? -7.618  -71.950 -28.357 1.00 37.83 ? 155  LEU F N     1 
ATOM   2572  C  CA    . LEU B  1 156 ? -8.807  -71.092 -28.403 1.00 37.77 ? 155  LEU F CA    1 
ATOM   2573  C  C     . LEU B  1 156 ? -8.914  -70.376 -29.750 1.00 37.73 ? 155  LEU F C     1 
ATOM   2574  O  O     . LEU B  1 156 ? -7.907  -69.974 -30.337 1.00 37.77 ? 155  LEU F O     1 
ATOM   2575  C  CB    . LEU B  1 156 ? -8.747  -70.051 -27.271 1.00 37.96 ? 155  LEU F CB    1 
ATOM   2576  C  CG    . LEU B  1 156 ? -8.699  -70.623 -25.845 1.00 37.91 ? 155  LEU F CG    1 
ATOM   2577  C  CD1   . LEU B  1 156 ? -8.303  -69.538 -24.867 1.00 38.85 ? 155  LEU F CD1   1 
ATOM   2578  C  CD2   . LEU B  1 156 ? -10.047 -71.246 -25.461 1.00 37.55 ? 155  LEU F CD2   1 
ATOM   2579  N  N     . GLU B  1 157 ? -10.132 -70.212 -30.246 1.00 37.42 ? 156  GLU F N     1 
ATOM   2580  C  CA    . GLU B  1 157 ? -10.347 -69.396 -31.450 1.00 37.42 ? 156  GLU F CA    1 
ATOM   2581  C  C     . GLU B  1 157 ? -11.164 -68.138 -31.126 1.00 37.29 ? 156  GLU F C     1 
ATOM   2582  O  O     . GLU B  1 157 ? -12.069 -68.170 -30.277 1.00 36.69 ? 156  GLU F O     1 
ATOM   2583  C  CB    . GLU B  1 157 ? -11.049 -70.215 -32.522 1.00 37.63 ? 156  GLU F CB    1 
ATOM   2584  C  CG    . GLU B  1 157 ? -10.343 -71.525 -32.830 1.00 37.75 ? 156  GLU F CG    1 
ATOM   2585  C  CD    . GLU B  1 157 ? -11.012 -72.304 -33.959 1.00 37.79 ? 156  GLU F CD    1 
ATOM   2586  O  OE1   . GLU B  1 157 ? -12.249 -72.221 -34.063 1.00 37.88 ? 156  GLU F OE1   1 
ATOM   2587  O  OE2   . GLU B  1 157 ? -10.297 -73.001 -34.725 1.00 37.34 ? 156  GLU F OE2   1 
ATOM   2588  N  N     . CYS B  1 158 ? -10.836 -67.022 -31.777 1.00 37.36 ? 157  CYS F N     1 
ATOM   2589  C  CA    . CYS B  1 158 ? -11.633 -65.810 -31.574 1.00 37.77 ? 157  CYS F CA    1 
ATOM   2590  C  C     . CYS B  1 158 ? -11.646 -64.886 -32.772 1.00 37.42 ? 157  CYS F C     1 
ATOM   2591  O  O     . CYS B  1 158 ? -10.946 -65.111 -33.748 1.00 37.66 ? 157  CYS F O     1 
ATOM   2592  C  CB    . CYS B  1 158 ? -11.127 -65.032 -30.343 1.00 38.09 ? 157  CYS F CB    1 
ATOM   2593  S  SG    . CYS B  1 158 ? -9.510  -64.238 -30.575 1.00 40.27 ? 157  CYS F SG    1 
ATOM   2594  N  N     . SER B  1 159 ? -12.472 -63.851 -32.660 1.00 36.75 ? 158  SER F N     1 
ATOM   2595  C  CA    . SER B  1 159 ? -12.479 -62.717 -33.545 1.00 36.27 ? 158  SER F CA    1 
ATOM   2596  C  C     . SER B  1 159 ? -12.464 -61.417 -32.708 1.00 36.48 ? 158  SER F C     1 
ATOM   2597  O  O     . SER B  1 159 ? -13.403 -61.129 -31.954 1.00 35.94 ? 158  SER F O     1 
ATOM   2598  C  CB    . SER B  1 159 ? -13.729 -62.740 -34.443 1.00 36.22 ? 158  SER F CB    1 
ATOM   2599  O  OG    . SER B  1 159 ? -13.901 -61.503 -35.112 1.00 35.42 ? 158  SER F OG    1 
ATOM   2600  N  N     . ALA B  1 160 ? -11.416 -60.623 -32.873 1.00 35.91 ? 159  ALA F N     1 
ATOM   2601  C  CA    . ALA B  1 160 ? -11.366 -59.304 -32.296 1.00 36.07 ? 159  ALA F CA    1 
ATOM   2602  C  C     . ALA B  1 160 ? -12.516 -58.437 -32.847 1.00 36.68 ? 159  ALA F C     1 
ATOM   2603  O  O     . ALA B  1 160 ? -13.110 -57.636 -32.122 1.00 36.43 ? 159  ALA F O     1 
ATOM   2604  C  CB    . ALA B  1 160 ? -9.996  -58.673 -32.581 1.00 36.39 ? 159  ALA F CB    1 
ATOM   2605  N  N     . LEU B  1 161 ? -12.875 -58.664 -34.113 1.00 37.20 ? 160  LEU F N     1 
ATOM   2606  C  CA    . LEU B  1 161 ? -13.868 -57.843 -34.831 1.00 37.01 ? 160  LEU F CA    1 
ATOM   2607  C  C     . LEU B  1 161 ? -15.289 -57.997 -34.305 1.00 37.21 ? 160  LEU F C     1 
ATOM   2608  O  O     . LEU B  1 161 ? -15.952 -56.996 -34.017 1.00 37.18 ? 160  LEU F O     1 
ATOM   2609  C  CB    . LEU B  1 161 ? -13.825 -58.141 -36.342 1.00 36.71 ? 160  LEU F CB    1 
ATOM   2610  C  CG    . LEU B  1 161 ? -14.782 -57.428 -37.315 1.00 37.28 ? 160  LEU F CG    1 
ATOM   2611  C  CD1   . LEU B  1 161 ? -14.533 -55.900 -37.464 1.00 36.62 ? 160  LEU F CD1   1 
ATOM   2612  C  CD2   . LEU B  1 161 ? -14.724 -58.116 -38.695 1.00 36.71 ? 160  LEU F CD2   1 
ATOM   2613  N  N     . THR B  1 162 ? -15.763 -59.238 -34.203 1.00 37.44 ? 161  THR F N     1 
ATOM   2614  C  CA    . THR B  1 162 ? -17.112 -59.526 -33.682 1.00 37.15 ? 161  THR F CA    1 
ATOM   2615  C  C     . THR B  1 162 ? -17.124 -59.761 -32.176 1.00 37.13 ? 161  THR F C     1 
ATOM   2616  O  O     . THR B  1 162 ? -18.182 -59.789 -31.564 1.00 36.77 ? 161  THR F O     1 
ATOM   2617  C  CB    . THR B  1 162 ? -17.705 -60.793 -34.322 1.00 37.27 ? 161  THR F CB    1 
ATOM   2618  O  OG1   . THR B  1 162 ? -16.929 -61.928 -33.909 1.00 36.94 ? 161  THR F OG1   1 
ATOM   2619  C  CG2   . THR B  1 162 ? -17.718 -60.686 -35.855 1.00 36.81 ? 161  THR F CG2   1 
ATOM   2620  N  N     . GLN B  1 163 ? -15.944 -59.940 -31.602 1.00 37.18 ? 162  GLN F N     1 
ATOM   2621  C  CA    . GLN B  1 163 ? -15.739 -60.293 -30.196 1.00 38.02 ? 162  GLN F CA    1 
ATOM   2622  C  C     . GLN B  1 163 ? -16.122 -61.730 -29.843 1.00 38.06 ? 162  GLN F C     1 
ATOM   2623  O  O     . GLN B  1 163 ? -16.091 -62.101 -28.666 1.00 38.10 ? 162  GLN F O     1 
ATOM   2624  C  CB    . GLN B  1 163 ? -16.394 -59.277 -29.250 1.00 38.13 ? 162  GLN F CB    1 
ATOM   2625  C  CG    . GLN B  1 163 ? -15.950 -57.840 -29.541 1.00 40.06 ? 162  GLN F CG    1 
ATOM   2626  C  CD    . GLN B  1 163 ? -16.111 -56.905 -28.351 1.00 40.62 ? 162  GLN F CD    1 
ATOM   2627  O  OE1   . GLN B  1 163 ? -17.194 -56.768 -27.800 1.00 39.06 ? 162  GLN F OE1   1 
ATOM   2628  N  NE2   . GLN B  1 163 ? -15.023 -56.253 -27.958 1.00 41.67 ? 162  GLN F NE2   1 
ATOM   2629  N  N     . ARG B  1 164 ? -16.435 -62.552 -30.850 1.00 38.31 ? 163  ARG F N     1 
ATOM   2630  C  CA    . ARG B  1 164 ? -16.719 -63.970 -30.612 1.00 38.41 ? 163  ARG F CA    1 
ATOM   2631  C  C     . ARG B  1 164 ? -15.487 -64.683 -30.063 1.00 37.94 ? 163  ARG F C     1 
ATOM   2632  O  O     . ARG B  1 164 ? -14.420 -64.667 -30.687 1.00 36.90 ? 163  ARG F O     1 
ATOM   2633  C  CB    . ARG B  1 164 ? -17.166 -64.673 -31.887 1.00 39.21 ? 163  ARG F CB    1 
ATOM   2634  C  CG    . ARG B  1 164 ? -17.781 -66.018 -31.599 1.00 42.99 ? 163  ARG F CG    1 
ATOM   2635  C  CD    . ARG B  1 164 ? -17.843 -66.939 -32.812 1.00 47.90 ? 163  ARG F CD    1 
ATOM   2636  N  NE    . ARG B  1 164 ? -18.352 -68.259 -32.416 1.00 50.23 ? 163  ARG F NE    1 
ATOM   2637  C  CZ    . ARG B  1 164 ? -18.668 -69.247 -33.254 1.00 51.86 ? 163  ARG F CZ    1 
ATOM   2638  N  NH1   . ARG B  1 164 ? -18.518 -69.094 -34.575 1.00 53.15 ? 163  ARG F NH1   1 
ATOM   2639  N  NH2   . ARG B  1 164 ? -19.134 -70.404 -32.761 1.00 50.94 ? 163  ARG F NH2   1 
ATOM   2640  N  N     . GLY B  1 165 ? -15.634 -65.272 -28.878 1.00 37.53 ? 164  GLY F N     1 
ATOM   2641  C  CA    . GLY B  1 165 ? -14.542 -65.974 -28.222 1.00 37.28 ? 164  GLY F CA    1 
ATOM   2642  C  C     . GLY B  1 165 ? -13.497 -65.098 -27.557 1.00 37.11 ? 164  GLY F C     1 
ATOM   2643  O  O     . GLY B  1 165 ? -12.540 -65.624 -26.978 1.00 37.68 ? 164  GLY F O     1 
ATOM   2644  N  N     . LEU B  1 166 ? -13.664 -63.776 -27.610 1.00 36.82 ? 165  LEU F N     1 
ATOM   2645  C  CA    . LEU B  1 166 ? -12.595 -62.852 -27.220 1.00 36.95 ? 165  LEU F CA    1 
ATOM   2646  C  C     . LEU B  1 166 ? -12.365 -62.819 -25.703 1.00 37.24 ? 165  LEU F C     1 
ATOM   2647  O  O     . LEU B  1 166 ? -11.249 -63.036 -25.233 1.00 36.29 ? 165  LEU F O     1 
ATOM   2648  C  CB    . LEU B  1 166 ? -12.864 -61.439 -27.762 1.00 37.03 ? 165  LEU F CB    1 
ATOM   2649  C  CG    . LEU B  1 166 ? -11.761 -60.378 -27.542 1.00 36.59 ? 165  LEU F CG    1 
ATOM   2650  C  CD1   . LEU B  1 166 ? -10.430 -60.812 -28.099 1.00 35.82 ? 165  LEU F CD1   1 
ATOM   2651  C  CD2   . LEU B  1 166 ? -12.152 -59.041 -28.149 1.00 36.45 ? 165  LEU F CD2   1 
ATOM   2652  N  N     . LYS B  1 167 ? -13.427 -62.575 -24.938 1.00 37.90 ? 166  LYS F N     1 
ATOM   2653  C  CA    . LYS B  1 167 ? -13.320 -62.572 -23.475 1.00 38.37 ? 166  LYS F CA    1 
ATOM   2654  C  C     . LYS B  1 167 ? -12.790 -63.903 -22.942 1.00 38.34 ? 166  LYS F C     1 
ATOM   2655  O  O     . LYS B  1 167 ? -12.006 -63.913 -21.997 1.00 38.33 ? 166  LYS F O     1 
ATOM   2656  C  CB    . LYS B  1 167 ? -14.649 -62.250 -22.804 1.00 38.33 ? 166  LYS F CB    1 
ATOM   2657  C  CG    . LYS B  1 167 ? -14.496 -61.938 -21.317 1.00 39.24 ? 166  LYS F CG    1 
ATOM   2658  C  CD    . LYS B  1 167 ? -15.831 -61.573 -20.663 1.00 39.54 ? 166  LYS F CD    1 
ATOM   2659  C  CE    . LYS B  1 167 ? -15.685 -61.291 -19.175 1.00 40.22 ? 166  LYS F CE    1 
ATOM   2660  N  NZ    . LYS B  1 167 ? -15.636 -62.553 -18.370 1.00 41.68 ? 166  LYS F NZ    1 
ATOM   2661  N  N     . THR B  1 168 ? -13.201 -65.010 -23.550 1.00 38.01 ? 167  THR F N     1 
ATOM   2662  C  CA    . THR B  1 168 ? -12.703 -66.339 -23.156 1.00 37.87 ? 167  THR F CA    1 
ATOM   2663  C  C     . THR B  1 168 ? -11.182 -66.487 -23.265 1.00 37.95 ? 167  THR F C     1 
ATOM   2664  O  O     . THR B  1 168 ? -10.567 -67.111 -22.402 1.00 38.12 ? 167  THR F O     1 
ATOM   2665  C  CB    . THR B  1 168 ? -13.409 -67.445 -23.966 1.00 37.78 ? 167  THR F CB    1 
ATOM   2666  O  OG1   . THR B  1 168 ? -14.807 -67.340 -23.714 1.00 36.98 ? 167  THR F OG1   1 
ATOM   2667  C  CG2   . THR B  1 168 ? -12.912 -68.876 -23.593 1.00 37.21 ? 167  THR F CG2   1 
ATOM   2668  N  N     . VAL B  1 169 ? -10.570 -65.903 -24.297 1.00 37.96 ? 168  VAL F N     1 
ATOM   2669  C  CA    . VAL B  1 169 ? -9.104  -65.931 -24.436 1.00 37.73 ? 168  VAL F CA    1 
ATOM   2670  C  C     . VAL B  1 169 ? -8.426  -65.383 -23.175 1.00 37.94 ? 168  VAL F C     1 
ATOM   2671  O  O     . VAL B  1 169 ? -7.566  -66.034 -22.570 1.00 37.21 ? 168  VAL F O     1 
ATOM   2672  C  CB    . VAL B  1 169 ? -8.644  -65.150 -25.689 1.00 37.86 ? 168  VAL F CB    1 
ATOM   2673  C  CG1   . VAL B  1 169 ? -7.131  -64.967 -25.707 1.00 38.51 ? 168  VAL F CG1   1 
ATOM   2674  C  CG2   . VAL B  1 169 ? -9.116  -65.856 -26.969 1.00 36.89 ? 168  VAL F CG2   1 
ATOM   2675  N  N     . PHE B  1 170 ? -8.862  -64.207 -22.742 1.00 38.20 ? 169  PHE F N     1 
ATOM   2676  C  CA    . PHE B  1 170 ? -8.258  -63.575 -21.582 1.00 38.82 ? 169  PHE F CA    1 
ATOM   2677  C  C     . PHE B  1 170 ? -8.695  -64.175 -20.254 1.00 38.86 ? 169  PHE F C     1 
ATOM   2678  O  O     . PHE B  1 170 ? -7.909  -64.229 -19.328 1.00 39.31 ? 169  PHE F O     1 
ATOM   2679  C  CB    . PHE B  1 170 ? -8.448  -62.057 -21.673 1.00 39.56 ? 169  PHE F CB    1 
ATOM   2680  C  CG    . PHE B  1 170 ? -7.708  -61.469 -22.840 1.00 39.86 ? 169  PHE F CG    1 
ATOM   2681  C  CD1   . PHE B  1 170 ? -6.354  -61.188 -22.740 1.00 40.31 ? 169  PHE F CD1   1 
ATOM   2682  C  CD2   . PHE B  1 170 ? -8.338  -61.297 -24.063 1.00 40.45 ? 169  PHE F CD2   1 
ATOM   2683  C  CE1   . PHE B  1 170 ? -5.654  -60.694 -23.828 1.00 41.69 ? 169  PHE F CE1   1 
ATOM   2684  C  CE2   . PHE B  1 170 ? -7.645  -60.808 -25.156 1.00 41.14 ? 169  PHE F CE2   1 
ATOM   2685  C  CZ    . PHE B  1 170 ? -6.302  -60.512 -25.045 1.00 41.41 ? 169  PHE F CZ    1 
ATOM   2686  N  N     . ASP B  1 171 ? -9.920  -64.675 -20.178 1.00 38.84 ? 170  ASP F N     1 
ATOM   2687  C  CA    . ASP B  1 171 ? -10.363 -65.455 -19.034 1.00 39.26 ? 170  ASP F CA    1 
ATOM   2688  C  C     . ASP B  1 171 ? -9.491  -66.724 -18.843 1.00 39.50 ? 170  ASP F C     1 
ATOM   2689  O  O     . ASP B  1 171 ? -9.063  -67.033 -17.723 1.00 38.83 ? 170  ASP F O     1 
ATOM   2690  C  CB    . ASP B  1 171 ? -11.852 -65.832 -19.183 1.00 39.02 ? 170  ASP F CB    1 
ATOM   2691  C  CG    . ASP B  1 171 ? -12.807 -64.649 -18.909 1.00 40.73 ? 170  ASP F CG    1 
ATOM   2692  O  OD1   . ASP B  1 171 ? -12.337 -63.505 -18.637 1.00 38.96 ? 170  ASP F OD1   1 
ATOM   2693  O  OD2   . ASP B  1 171 ? -14.042 -64.876 -18.968 1.00 39.80 ? 170  ASP F OD2   1 
ATOM   2694  N  N     . GLU B  1 172 ? -9.226  -67.438 -19.936 1.00 39.73 ? 171  GLU F N     1 
ATOM   2695  C  CA    . GLU B  1 172 ? -8.364  -68.622 -19.893 1.00 40.18 ? 171  GLU F CA    1 
ATOM   2696  C  C     . GLU B  1 172 ? -6.895  -68.290 -19.626 1.00 39.88 ? 171  GLU F C     1 
ATOM   2697  O  O     . GLU B  1 172 ? -6.201  -69.061 -18.964 1.00 39.61 ? 171  GLU F O     1 
ATOM   2698  C  CB    . GLU B  1 172 ? -8.498  -69.432 -21.174 1.00 40.61 ? 171  GLU F CB    1 
ATOM   2699  C  CG    . GLU B  1 172 ? -9.866  -70.115 -21.324 1.00 43.05 ? 171  GLU F CG    1 
ATOM   2700  C  CD    . GLU B  1 172 ? -10.091 -71.230 -20.296 1.00 48.05 ? 171  GLU F CD    1 
ATOM   2701  O  OE1   . GLU B  1 172 ? -9.136  -72.001 -20.037 1.00 49.45 ? 171  GLU F OE1   1 
ATOM   2702  O  OE2   . GLU B  1 172 ? -11.221 -71.334 -19.742 1.00 50.53 ? 171  GLU F OE2   1 
ATOM   2703  N  N     . ALA B  1 173 ? -6.415  -67.159 -20.144 1.00 39.77 ? 172  ALA F N     1 
ATOM   2704  C  CA    . ALA B  1 173 ? -5.063  -66.680 -19.813 1.00 39.25 ? 172  ALA F CA    1 
ATOM   2705  C  C     . ALA B  1 173 ? -4.939  -66.493 -18.297 1.00 39.03 ? 172  ALA F C     1 
ATOM   2706  O  O     . ALA B  1 173 ? -3.982  -66.946 -17.678 1.00 39.10 ? 172  ALA F O     1 
ATOM   2707  C  CB    . ALA B  1 173 ? -4.773  -65.386 -20.515 1.00 39.07 ? 172  ALA F CB    1 
ATOM   2708  N  N     . ILE B  1 174 ? -5.951  -65.862 -17.710 1.00 38.91 ? 173  ILE F N     1 
ATOM   2709  C  CA    . ILE B  1 174 ? -5.990  -65.605 -16.278 1.00 38.61 ? 173  ILE F CA    1 
ATOM   2710  C  C     . ILE B  1 174 ? -6.055  -66.911 -15.465 1.00 38.67 ? 173  ILE F C     1 
ATOM   2711  O  O     . ILE B  1 174 ? -5.258  -67.111 -14.532 1.00 37.52 ? 173  ILE F O     1 
ATOM   2712  C  CB    . ILE B  1 174 ? -7.152  -64.651 -15.917 1.00 38.54 ? 173  ILE F CB    1 
ATOM   2713  C  CG1   . ILE B  1 174 ? -6.915  -63.259 -16.526 1.00 39.28 ? 173  ILE F CG1   1 
ATOM   2714  C  CG2   . ILE B  1 174 ? -7.293  -64.534 -14.419 1.00 38.70 ? 173  ILE F CG2   1 
ATOM   2715  C  CD1   . ILE B  1 174 ? -8.156  -62.349 -16.587 1.00 38.34 ? 173  ILE F CD1   1 
ATOM   2716  N  N     . ARG B  1 175 ? -6.984  -67.802 -15.820 1.00 38.84 ? 174  ARG F N     1 
ATOM   2717  C  CA    . ARG B  1 175 ? -7.088  -69.096 -15.139 1.00 39.43 ? 174  ARG F CA    1 
ATOM   2718  C  C     . ARG B  1 175 ? -5.810  -69.926 -15.294 1.00 39.39 ? 174  ARG F C     1 
ATOM   2719  O  O     . ARG B  1 175 ? -5.458  -70.701 -14.401 1.00 39.39 ? 174  ARG F O     1 
ATOM   2720  C  CB    . ARG B  1 175 ? -8.291  -69.908 -15.634 1.00 39.92 ? 174  ARG F CB    1 
ATOM   2721  C  CG    . ARG B  1 175 ? -9.646  -69.327 -15.299 1.00 40.92 ? 174  ARG F CG    1 
ATOM   2722  C  CD    . ARG B  1 175 ? -9.904  -69.256 -13.804 1.00 44.93 ? 174  ARG F CD    1 
ATOM   2723  N  NE    . ARG B  1 175 ? -11.312 -68.924 -13.530 1.00 45.98 ? 174  ARG F NE    1 
ATOM   2724  C  CZ    . ARG B  1 175 ? -11.766 -68.432 -12.382 1.00 47.21 ? 174  ARG F CZ    1 
ATOM   2725  N  NH1   . ARG B  1 175 ? -10.942 -68.221 -11.356 1.00 48.95 ? 174  ARG F NH1   1 
ATOM   2726  N  NH2   . ARG B  1 175 ? -13.063 -68.147 -12.257 1.00 47.03 ? 174  ARG F NH2   1 
ATOM   2727  N  N     . ALA B  1 176 ? -5.110  -69.743 -16.413 1.00 38.97 ? 175  ALA F N     1 
ATOM   2728  C  CA    . ALA B  1 176 ? -3.812  -70.403 -16.645 1.00 38.73 ? 175  ALA F CA    1 
ATOM   2729  C  C     . ALA B  1 176 ? -2.723  -70.047 -15.599 1.00 38.63 ? 175  ALA F C     1 
ATOM   2730  O  O     . ALA B  1 176 ? -1.796  -70.833 -15.369 1.00 38.25 ? 175  ALA F O     1 
ATOM   2731  C  CB    . ALA B  1 176 ? -3.324  -70.086 -18.036 1.00 38.05 ? 175  ALA F CB    1 
ATOM   2732  N  N     . VAL B  1 177 ? -2.846  -68.870 -14.975 1.00 38.05 ? 176  VAL F N     1 
ATOM   2733  C  CA    . VAL B  1 177 ? -1.876  -68.393 -13.985 1.00 37.66 ? 176  VAL F CA    1 
ATOM   2734  C  C     . VAL B  1 177 ? -2.393  -68.621 -12.560 1.00 38.27 ? 176  VAL F C     1 
ATOM   2735  O  O     . VAL B  1 177 ? -1.643  -69.039 -11.677 1.00 37.28 ? 176  VAL F O     1 
ATOM   2736  C  CB    . VAL B  1 177 ? -1.569  -66.886 -14.213 1.00 37.12 ? 176  VAL F CB    1 
ATOM   2737  C  CG1   . VAL B  1 177 ? -0.580  -66.366 -13.214 1.00 35.09 ? 176  VAL F CG1   1 
ATOM   2738  C  CG2   . VAL B  1 177 ? -1.058  -66.677 -15.607 1.00 35.33 ? 176  VAL F CG2   1 
ATOM   2739  N  N     . LEU B  1 178 ? -3.679  -68.327 -12.356 1.00 38.69 ? 177  LEU F N     1 
ATOM   2740  C  CA    . LEU B  1 178 ? -4.308  -68.361 -11.031 1.00 39.09 ? 177  LEU F CA    1 
ATOM   2741  C  C     . LEU B  1 178 ? -4.946  -69.713 -10.690 1.00 39.26 ? 177  LEU F C     1 
ATOM   2742  O  O     . LEU B  1 178 ? -5.312  -69.966 -9.540  1.00 39.13 ? 177  LEU F O     1 
ATOM   2743  C  CB    . LEU B  1 178 ? -5.332  -67.243 -10.929 1.00 38.78 ? 177  LEU F CB    1 
ATOM   2744  C  CG    . LEU B  1 178 ? -4.715  -65.861 -11.153 1.00 40.13 ? 177  LEU F CG    1 
ATOM   2745  C  CD1   . LEU B  1 178 ? -5.766  -64.775 -10.960 1.00 41.59 ? 177  LEU F CD1   1 
ATOM   2746  C  CD2   . LEU B  1 178 ? -3.495  -65.623 -10.243 1.00 37.99 ? 177  LEU F CD2   1 
ATOM   2747  N  N     A GLY B  1 179 ? -5.026  -70.560 -11.713 0.50 39.16 ? 178  GLY F N     1 
ATOM   2748  N  N     B GLY B  1 179 ? -5.137  -70.561 -11.697 0.50 39.48 ? 178  GLY F N     1 
ATOM   2749  C  CA    A GLY B  1 179 ? -5.017  -72.010 -11.572 0.50 39.00 ? 178  GLY F CA    1 
ATOM   2750  C  CA    B GLY B  1 179 ? -5.978  -71.742 -11.550 0.50 39.59 ? 178  GLY F CA    1 
ATOM   2751  C  C     A GLY B  1 179 ? -4.162  -72.589 -12.698 0.50 38.93 ? 178  GLY F C     1 
ATOM   2752  C  C     B GLY B  1 179 ? -7.435  -71.304 -11.540 0.50 39.65 ? 178  GLY F C     1 
ATOM   2753  O  O     A GLY B  1 179 ? -2.939  -72.705 -12.612 0.50 38.07 ? 178  GLY F O     1 
ATOM   2754  O  O     B GLY B  1 179 ? -7.657  -72.411 -11.023 0.50 39.69 ? 178  GLY F O     1 
ATOM   2755  O  OXT   A GLY B  1 179 ? -4.677  -72.943 -13.761 0.50 39.16 ? 178  GLY F OXT   1 
ATOM   2756  O  OXT   B GLY B  1 179 ? -8.642  -71.237 -11.325 0.50 40.00 ? 178  GLY F OXT   1 
ATOM   2757  N  N     . SER C  1 1   ? 5.264   -62.068 -13.327 1.00 39.58 ? 0    SER B N     1 
ATOM   2758  C  CA    . SER C  1 1   ? 5.358   -60.606 -13.527 1.00 39.95 ? 0    SER B CA    1 
ATOM   2759  C  C     . SER C  1 1   ? 6.540   -60.068 -12.720 1.00 40.02 ? 0    SER B C     1 
ATOM   2760  O  O     . SER C  1 1   ? 7.212   -60.832 -12.029 1.00 39.63 ? 0    SER B O     1 
ATOM   2761  C  CB    . SER C  1 1   ? 4.053   -59.946 -13.087 1.00 39.94 ? 0    SER B CB    1 
ATOM   2762  O  OG    . SER C  1 1   ? 3.729   -60.324 -11.759 1.00 41.05 ? 0    SER B OG    1 
ATOM   2763  N  N     . MET C  1 2   ? 6.793   -58.765 -12.794 1.00 40.16 ? 1    MET B N     1 
ATOM   2764  C  CA    . MET C  1 2   ? 7.924   -58.174 -12.076 1.00 40.54 ? 1    MET B CA    1 
ATOM   2765  C  C     . MET C  1 2   ? 7.804   -58.290 -10.556 1.00 40.98 ? 1    MET B C     1 
ATOM   2766  O  O     . MET C  1 2   ? 6.694   -58.326 -10.006 1.00 40.63 ? 1    MET B O     1 
ATOM   2767  C  CB    . MET C  1 2   ? 8.111   -56.698 -12.448 1.00 40.71 ? 1    MET B CB    1 
ATOM   2768  C  CG    . MET C  1 2   ? 7.088   -55.739 -11.850 1.00 40.09 ? 1    MET B CG    1 
ATOM   2769  C  CE    . MET C  1 2   ? 8.803   -53.540 -11.726 1.00 43.22 ? 1    MET B CE    1 
ATOM   2770  N  N     . GLN C  1 3   ? 8.966   -58.362 -9.903  1.00 41.75 ? 2    GLN B N     1 
ATOM   2771  C  CA    . GLN C  1 3   ? 9.074   -58.290 -8.457  1.00 42.22 ? 2    GLN B CA    1 
ATOM   2772  C  C     . GLN C  1 3   ? 8.257   -57.097 -7.955  1.00 42.18 ? 2    GLN B C     1 
ATOM   2773  O  O     . GLN C  1 3   ? 8.486   -55.956 -8.370  1.00 42.04 ? 2    GLN B O     1 
ATOM   2774  C  CB    . GLN C  1 3   ? 10.539  -58.142 -8.012  1.00 42.60 ? 2    GLN B CB    1 
ATOM   2775  C  CG    . GLN C  1 3   ? 11.222  -59.448 -7.529  1.00 43.95 ? 2    GLN B CG    1 
ATOM   2776  C  CD    . GLN C  1 3   ? 12.754  -59.420 -7.656  1.00 43.22 ? 2    GLN B CD    1 
ATOM   2777  N  N     . ALA C  1 4   ? 7.284   -57.395 -7.096  1.00 41.58 ? 3    ALA B N     1 
ATOM   2778  C  CA    . ALA C  1 4   ? 6.508   -56.391 -6.392  1.00 41.39 ? 3    ALA B CA    1 
ATOM   2779  C  C     . ALA C  1 4   ? 6.585   -56.667 -4.896  1.00 40.74 ? 3    ALA B C     1 
ATOM   2780  O  O     . ALA C  1 4   ? 6.772   -57.816 -4.482  1.00 40.85 ? 3    ALA B O     1 
ATOM   2781  C  CB    . ALA C  1 4   ? 5.072   -56.408 -6.868  1.00 41.40 ? 3    ALA B CB    1 
ATOM   2782  N  N     . ILE C  1 5   ? 6.486   -55.605 -4.102  1.00 40.07 ? 4    ILE B N     1 
ATOM   2783  C  CA    . ILE C  1 5   ? 6.418   -55.702 -2.648  1.00 39.63 ? 4    ILE B CA    1 
ATOM   2784  C  C     . ILE C  1 5   ? 5.269   -54.852 -2.101  1.00 39.16 ? 4    ILE B C     1 
ATOM   2785  O  O     . ILE C  1 5   ? 5.197   -53.647 -2.346  1.00 39.14 ? 4    ILE B O     1 
ATOM   2786  C  CB    . ILE C  1 5   ? 7.737   -55.242 -1.979  1.00 40.06 ? 4    ILE B CB    1 
ATOM   2787  C  CG1   . ILE C  1 5   ? 8.845   -56.279 -2.213  1.00 39.81 ? 4    ILE B CG1   1 
ATOM   2788  C  CG2   . ILE C  1 5   ? 7.529   -55.027 -0.496  1.00 38.65 ? 4    ILE B CG2   1 
ATOM   2789  C  CD1   . ILE C  1 5   ? 10.222  -55.759 -1.914  1.00 40.80 ? 4    ILE B CD1   1 
ATOM   2790  N  N     . LYS C  1 6   ? 4.371   -55.501 -1.370  1.00 38.29 ? 5    LYS B N     1 
ATOM   2791  C  CA    . LYS C  1 6   ? 3.326   -54.818 -0.636  1.00 37.99 ? 5    LYS B CA    1 
ATOM   2792  C  C     . LYS C  1 6   ? 3.770   -54.544 0.806   1.00 37.33 ? 5    LYS B C     1 
ATOM   2793  O  O     . LYS C  1 6   ? 3.924   -55.470 1.609   1.00 36.62 ? 5    LYS B O     1 
ATOM   2794  C  CB    . LYS C  1 6   ? 2.024   -55.635 -0.649  1.00 37.79 ? 5    LYS B CB    1 
ATOM   2795  C  CG    . LYS C  1 6   ? 0.921   -55.002 0.192   1.00 37.80 ? 5    LYS B CG    1 
ATOM   2796  C  CD    . LYS C  1 6   ? -0.439  -55.592 -0.077  1.00 38.18 ? 5    LYS B CD    1 
ATOM   2797  C  CE    . LYS C  1 6   ? -1.438  -55.092 0.930   1.00 38.16 ? 5    LYS B CE    1 
ATOM   2798  N  NZ    . LYS C  1 6   ? -2.826  -55.456 0.532   1.00 39.55 ? 5    LYS B NZ    1 
ATOM   2799  N  N     . CYS C  1 7   ? 3.947   -53.269 1.127   1.00 37.20 ? 6    CYS B N     1 
ATOM   2800  C  CA    . CYS C  1 7   ? 4.340   -52.856 2.481   1.00 37.29 ? 6    CYS B CA    1 
ATOM   2801  C  C     . CYS C  1 7   ? 3.212   -52.084 3.152   1.00 37.06 ? 6    CYS B C     1 
ATOM   2802  O  O     . CYS C  1 7   ? 2.776   -51.051 2.644   1.00 37.35 ? 6    CYS B O     1 
ATOM   2803  C  CB    . CYS C  1 7   ? 5.609   -52.013 2.433   1.00 37.14 ? 6    CYS B CB    1 
ATOM   2804  S  SG    . CYS C  1 7   ? 6.114   -51.335 4.030   1.00 38.71 ? 6    CYS B SG    1 
ATOM   2805  N  N     . VAL C  1 8   ? 2.712   -52.608 4.273   1.00 36.89 ? 7    VAL B N     1 
ATOM   2806  C  CA    . VAL C  1 8   ? 1.625   -51.971 5.029   1.00 36.08 ? 7    VAL B CA    1 
ATOM   2807  C  C     . VAL C  1 8   ? 2.224   -51.354 6.296   1.00 36.49 ? 7    VAL B C     1 
ATOM   2808  O  O     . VAL C  1 8   ? 3.074   -51.966 6.958   1.00 37.49 ? 7    VAL B O     1 
ATOM   2809  C  CB    . VAL C  1 8   ? 0.505   -52.980 5.362   1.00 35.89 ? 7    VAL B CB    1 
ATOM   2810  C  CG1   . VAL C  1 8   ? -0.572  -52.356 6.281   1.00 35.65 ? 7    VAL B CG1   1 
ATOM   2811  C  CG2   . VAL C  1 8   ? -0.130  -53.507 4.058   1.00 34.61 ? 7    VAL B CG2   1 
ATOM   2812  N  N     . VAL C  1 9   ? 1.818   -50.123 6.605   1.00 36.29 ? 8    VAL B N     1 
ATOM   2813  C  CA    . VAL C  1 9   ? 2.392   -49.356 7.709   1.00 35.57 ? 8    VAL B CA    1 
ATOM   2814  C  C     . VAL C  1 9   ? 1.292   -49.091 8.703   1.00 36.05 ? 8    VAL B C     1 
ATOM   2815  O  O     . VAL C  1 9   ? 0.237   -48.568 8.330   1.00 35.74 ? 8    VAL B O     1 
ATOM   2816  C  CB    . VAL C  1 9   ? 2.991   -48.038 7.228   1.00 35.85 ? 8    VAL B CB    1 
ATOM   2817  C  CG1   . VAL C  1 9   ? 3.647   -47.284 8.395   1.00 34.12 ? 8    VAL B CG1   1 
ATOM   2818  C  CG2   . VAL C  1 9   ? 4.014   -48.311 6.119   1.00 35.45 ? 8    VAL B CG2   1 
ATOM   2819  N  N     . VAL C  1 10  ? 1.518   -49.487 9.955   1.00 35.81 ? 9    VAL B N     1 
ATOM   2820  C  CA    . VAL C  1 10  ? 0.529   -49.336 11.003  1.00 35.60 ? 9    VAL B CA    1 
ATOM   2821  C  C     . VAL C  1 10  ? 1.183   -48.759 12.250  1.00 36.09 ? 9    VAL B C     1 
ATOM   2822  O  O     . VAL C  1 10  ? 2.397   -48.795 12.390  1.00 36.40 ? 9    VAL B O     1 
ATOM   2823  C  CB    . VAL C  1 10  ? -0.154  -50.681 11.303  1.00 35.88 ? 9    VAL B CB    1 
ATOM   2824  C  CG1   . VAL C  1 10  ? -0.464  -51.397 9.992   1.00 35.88 ? 9    VAL B CG1   1 
ATOM   2825  C  CG2   . VAL C  1 10  ? 0.686   -51.566 12.226  1.00 34.75 ? 9    VAL B CG2   1 
ATOM   2826  N  N     . GLY C  1 11  ? 0.365   -48.206 13.142  1.00 35.87 ? 10   GLY B N     1 
ATOM   2827  C  CA    . GLY C  1 11  ? 0.839   -47.544 14.352  1.00 35.67 ? 10   GLY B CA    1 
ATOM   2828  C  C     . GLY C  1 11  ? -0.166  -46.517 14.852  1.00 35.85 ? 10   GLY B C     1 
ATOM   2829  O  O     . GLY C  1 11  ? -1.065  -46.112 14.115  1.00 34.68 ? 10   GLY B O     1 
ATOM   2830  N  N     . ASP C  1 12  ? 0.029   -46.075 16.095  1.00 35.90 ? 11   ASP B N     1 
ATOM   2831  C  CA    . ASP C  1 12  ? -0.834  -45.094 16.732  1.00 36.40 ? 11   ASP B CA    1 
ATOM   2832  C  C     . ASP C  1 12  ? -0.942  -43.797 15.951  1.00 36.67 ? 11   ASP B C     1 
ATOM   2833  O  O     . ASP C  1 12  ? -0.128  -43.486 15.087  1.00 36.58 ? 11   ASP B O     1 
ATOM   2834  C  CB    . ASP C  1 12  ? -0.321  -44.763 18.140  1.00 36.83 ? 11   ASP B CB    1 
ATOM   2835  C  CG    . ASP C  1 12  ? -0.801  -45.751 19.203  1.00 38.39 ? 11   ASP B CG    1 
ATOM   2836  O  OD1   . ASP C  1 12  ? -1.392  -46.844 18.891  1.00 38.07 ? 11   ASP B OD1   1 
ATOM   2837  O  OD2   . ASP C  1 12  ? -0.609  -45.396 20.375  1.00 39.19 ? 11   ASP B OD2   1 
ATOM   2838  N  N     . GLY C  1 13  ? -1.981  -43.054 16.270  1.00 37.49 ? 12   GLY B N     1 
ATOM   2839  C  CA    . GLY C  1 13  ? -2.122  -41.683 15.838  1.00 37.91 ? 12   GLY B CA    1 
ATOM   2840  C  C     . GLY C  1 13  ? -0.916  -40.837 16.207  1.00 37.36 ? 12   GLY B C     1 
ATOM   2841  O  O     . GLY C  1 13  ? -0.263  -41.043 17.239  1.00 37.27 ? 12   GLY B O     1 
ATOM   2842  N  N     . ALA C  1 14  ? -0.638  -39.873 15.342  1.00 37.11 ? 13   ALA B N     1 
ATOM   2843  C  CA    . ALA C  1 14  ? 0.422   -38.894 15.530  1.00 37.31 ? 13   ALA B CA    1 
ATOM   2844  C  C     . ALA C  1 14  ? 1.833   -39.473 15.542  1.00 37.08 ? 13   ALA B C     1 
ATOM   2845  O  O     . ALA C  1 14  ? 2.768   -38.763 15.878  1.00 38.21 ? 13   ALA B O     1 
ATOM   2846  C  CB    . ALA C  1 14  ? 0.156   -38.064 16.801  1.00 36.57 ? 13   ALA B CB    1 
ATOM   2847  N  N     . VAL C  1 15  ? 2.023   -40.738 15.162  1.00 37.88 ? 14   VAL B N     1 
ATOM   2848  C  CA    . VAL C  1 15  ? 3.366   -41.349 15.267  1.00 37.47 ? 14   VAL B CA    1 
ATOM   2849  C  C     . VAL C  1 15  ? 4.326   -40.919 14.157  1.00 37.69 ? 14   VAL B C     1 
ATOM   2850  O  O     . VAL C  1 15  ? 5.562   -40.917 14.351  1.00 38.71 ? 14   VAL B O     1 
ATOM   2851  C  CB    . VAL C  1 15  ? 3.340   -42.930 15.369  1.00 37.83 ? 14   VAL B CB    1 
ATOM   2852  C  CG1   . VAL C  1 15  ? 2.830   -43.387 16.743  1.00 36.63 ? 14   VAL B CG1   1 
ATOM   2853  C  CG2   . VAL C  1 15  ? 2.537   -43.538 14.259  1.00 39.82 ? 14   VAL B CG2   1 
ATOM   2854  N  N     . GLY C  1 16  ? 3.793   -40.605 12.981  1.00 37.15 ? 15   GLY B N     1 
ATOM   2855  C  CA    . GLY C  1 16  ? 4.622   -40.174 11.866  1.00 36.95 ? 15   GLY B CA    1 
ATOM   2856  C  C     . GLY C  1 16  ? 4.630   -41.079 10.651  1.00 36.56 ? 15   GLY B C     1 
ATOM   2857  O  O     . GLY C  1 16  ? 5.543   -40.991 9.849   1.00 36.13 ? 15   GLY B O     1 
ATOM   2858  N  N     . LYS C  1 17  ? 3.599   -41.913 10.497  1.00 36.37 ? 16   LYS B N     1 
ATOM   2859  C  CA    . LYS C  1 17  ? 3.552   -42.910 9.407   1.00 36.07 ? 16   LYS B CA    1 
ATOM   2860  C  C     . LYS C  1 17  ? 3.546   -42.268 8.003   1.00 35.92 ? 16   LYS B C     1 
ATOM   2861  O  O     . LYS C  1 17  ? 4.295   -42.700 7.111   1.00 36.94 ? 16   LYS B O     1 
ATOM   2862  C  CB    . LYS C  1 17  ? 2.345   -43.848 9.566   1.00 35.42 ? 16   LYS B CB    1 
ATOM   2863  C  CG    . LYS C  1 17  ? 2.371   -44.638 10.848  1.00 35.98 ? 16   LYS B CG    1 
ATOM   2864  C  CD    . LYS C  1 17  ? 1.269   -45.647 10.988  1.00 36.55 ? 16   LYS B CD    1 
ATOM   2865  C  CE    . LYS C  1 17  ? -0.133  -45.042 11.082  1.00 36.59 ? 16   LYS B CE    1 
ATOM   2866  N  NZ    . LYS C  1 17  ? -0.338  -44.132 12.236  1.00 37.00 ? 16   LYS B NZ    1 
ATOM   2867  N  N     . THR C  1 18  ? 2.722   -41.245 7.819   1.00 35.87 ? 17   THR B N     1 
ATOM   2868  C  CA    . THR C  1 18  ? 2.535   -40.612 6.507   1.00 35.84 ? 17   THR B CA    1 
ATOM   2869  C  C     . THR C  1 18  ? 3.782   -39.823 6.141   1.00 36.35 ? 17   THR B C     1 
ATOM   2870  O  O     . THR C  1 18  ? 4.298   -39.957 5.038   1.00 36.61 ? 17   THR B O     1 
ATOM   2871  C  CB    . THR C  1 18  ? 1.280   -39.710 6.529   1.00 35.65 ? 17   THR B CB    1 
ATOM   2872  O  OG1   . THR C  1 18  ? 0.157   -40.528 6.835   1.00 34.68 ? 17   THR B OG1   1 
ATOM   2873  C  CG2   . THR C  1 18  ? 1.024   -38.964 5.191   1.00 33.06 ? 17   THR B CG2   1 
ATOM   2874  N  N     . CYS C  1 19  ? 4.309   -39.064 7.102   1.00 37.04 ? 18   CYS B N     1 
ATOM   2875  C  CA    . CYS C  1 19  ? 5.571   -38.330 6.921   1.00 37.05 ? 18   CYS B CA    1 
ATOM   2876  C  C     . CYS C  1 19  ? 6.728   -39.266 6.558   1.00 37.55 ? 18   CYS B C     1 
ATOM   2877  O  O     . CYS C  1 19  ? 7.550   -38.939 5.709   1.00 37.54 ? 18   CYS B O     1 
ATOM   2878  C  CB    . CYS C  1 19  ? 5.914   -37.517 8.173   1.00 36.71 ? 18   CYS B CB    1 
ATOM   2879  S  SG    . CYS C  1 19  ? 4.889   -36.016 8.408   1.00 37.24 ? 18   CYS B SG    1 
ATOM   2880  N  N     . LEU C  1 20  ? 6.786   -40.416 7.227   1.00 38.06 ? 19   LEU B N     1 
ATOM   2881  C  CA    . LEU C  1 20  ? 7.781   -41.451 6.942   1.00 38.37 ? 19   LEU B CA    1 
ATOM   2882  C  C     . LEU C  1 20  ? 7.702   -41.823 5.453   1.00 37.50 ? 19   LEU B C     1 
ATOM   2883  O  O     . LEU C  1 20  ? 8.671   -41.730 4.721   1.00 36.55 ? 19   LEU B O     1 
ATOM   2884  C  CB    . LEU C  1 20  ? 7.500   -42.663 7.855   1.00 38.81 ? 19   LEU B CB    1 
ATOM   2885  C  CG    . LEU C  1 20  ? 8.347   -43.934 7.857   1.00 39.45 ? 19   LEU B CG    1 
ATOM   2886  C  CD1   . LEU C  1 20  ? 9.702   -43.712 8.599   1.00 41.78 ? 19   LEU B CD1   1 
ATOM   2887  C  CD2   . LEU C  1 20  ? 7.589   -45.091 8.490   1.00 39.07 ? 19   LEU B CD2   1 
ATOM   2888  N  N     . LEU C  1 21  ? 6.510   -42.191 5.003   1.00 37.74 ? 20   LEU B N     1 
ATOM   2889  C  CA    . LEU C  1 21  ? 6.298   -42.634 3.611   1.00 37.23 ? 20   LEU B CA    1 
ATOM   2890  C  C     . LEU C  1 21  ? 6.508   -41.502 2.622   1.00 36.87 ? 20   LEU B C     1 
ATOM   2891  O  O     . LEU C  1 21  ? 7.045   -41.710 1.554   1.00 36.81 ? 20   LEU B O     1 
ATOM   2892  C  CB    . LEU C  1 21  ? 4.884   -43.216 3.445   1.00 37.56 ? 20   LEU B CB    1 
ATOM   2893  C  CG    . LEU C  1 21  ? 4.614   -44.496 4.239   1.00 37.58 ? 20   LEU B CG    1 
ATOM   2894  C  CD1   . LEU C  1 21  ? 3.163   -44.902 4.129   1.00 37.83 ? 20   LEU B CD1   1 
ATOM   2895  C  CD2   . LEU C  1 21  ? 5.531   -45.631 3.793   1.00 37.82 ? 20   LEU B CD2   1 
ATOM   2896  N  N     . ILE C  1 22  ? 6.086   -40.294 2.979   1.00 37.24 ? 21   ILE B N     1 
ATOM   2897  C  CA    . ILE C  1 22  ? 6.221   -39.168 2.049   1.00 37.45 ? 21   ILE B CA    1 
ATOM   2898  C  C     . ILE C  1 22  ? 7.665   -38.661 1.938   1.00 37.26 ? 21   ILE B C     1 
ATOM   2899  O  O     . ILE C  1 22  ? 8.120   -38.338 0.838   1.00 37.94 ? 21   ILE B O     1 
ATOM   2900  C  CB    . ILE C  1 22  ? 5.286   -38.019 2.402   1.00 37.17 ? 21   ILE B CB    1 
ATOM   2901  C  CG1   . ILE C  1 22  ? 3.835   -38.471 2.242   1.00 38.20 ? 21   ILE B CG1   1 
ATOM   2902  C  CG2   . ILE C  1 22  ? 5.572   -36.781 1.526   1.00 38.15 ? 21   ILE B CG2   1 
ATOM   2903  C  CD1   . ILE C  1 22  ? 3.472   -38.941 0.825   1.00 39.60 ? 21   ILE B CD1   1 
ATOM   2904  N  N     . SER C  1 23  ? 8.364   -38.558 3.059   1.00 36.22 ? 22   SER B N     1 
ATOM   2905  C  CA    . SER C  1 23  ? 9.751   -38.133 3.036   1.00 36.36 ? 22   SER B CA    1 
ATOM   2906  C  C     . SER C  1 23  ? 10.618  -39.113 2.224   1.00 36.26 ? 22   SER B C     1 
ATOM   2907  O  O     . SER C  1 23  ? 11.462  -38.703 1.413   1.00 35.93 ? 22   SER B O     1 
ATOM   2908  C  CB    . SER C  1 23  ? 10.296  -38.010 4.457   1.00 36.21 ? 22   SER B CB    1 
ATOM   2909  O  OG    . SER C  1 23  ? 11.525  -37.302 4.446   1.00 37.01 ? 22   SER B OG    1 
ATOM   2910  N  N     . TYR C  1 24  ? 10.400  -40.404 2.443   1.00 36.25 ? 23   TYR B N     1 
ATOM   2911  C  CA    . TYR C  1 24  ? 11.137  -41.433 1.714   1.00 36.83 ? 23   TYR B CA    1 
ATOM   2912  C  C     . TYR C  1 24  ? 10.835  -41.367 0.208   1.00 37.06 ? 23   TYR B C     1 
ATOM   2913  O  O     . TYR C  1 24  ? 11.732  -41.271 -0.595  1.00 36.64 ? 23   TYR B O     1 
ATOM   2914  C  CB    . TYR C  1 24  ? 10.807  -42.821 2.289   1.00 36.36 ? 23   TYR B CB    1 
ATOM   2915  C  CG    . TYR C  1 24  ? 11.370  -43.973 1.486   1.00 37.03 ? 23   TYR B CG    1 
ATOM   2916  C  CD1   . TYR C  1 24  ? 12.743  -44.172 1.393   1.00 36.16 ? 23   TYR B CD1   1 
ATOM   2917  C  CD2   . TYR C  1 24  ? 10.528  -44.864 0.808   1.00 37.27 ? 23   TYR B CD2   1 
ATOM   2918  C  CE1   . TYR C  1 24  ? 13.253  -45.214 0.665   1.00 36.99 ? 23   TYR B CE1   1 
ATOM   2919  C  CE2   . TYR C  1 24  ? 11.041  -45.915 0.081   1.00 35.26 ? 23   TYR B CE2   1 
ATOM   2920  C  CZ    . TYR C  1 24  ? 12.391  -46.086 0.008   1.00 36.65 ? 23   TYR B CZ    1 
ATOM   2921  O  OH    . TYR C  1 24  ? 12.909  -47.135 -0.719  1.00 36.42 ? 23   TYR B OH    1 
ATOM   2922  N  N     . THR C  1 25  ? 9.558   -41.357 -0.166  1.00 37.86 ? 24   THR B N     1 
ATOM   2923  C  CA    . THR C  1 25  ? 9.198   -41.422 -1.576  1.00 37.94 ? 24   THR B CA    1 
ATOM   2924  C  C     . THR C  1 25  ? 9.407   -40.118 -2.325  1.00 38.58 ? 24   THR B C     1 
ATOM   2925  O  O     . THR C  1 25  ? 9.655   -40.157 -3.528  1.00 39.20 ? 24   THR B O     1 
ATOM   2926  C  CB    . THR C  1 25  ? 7.745   -41.859 -1.781  1.00 38.02 ? 24   THR B CB    1 
ATOM   2927  O  OG1   . THR C  1 25  ? 6.866   -40.970 -1.071  1.00 38.38 ? 24   THR B OG1   1 
ATOM   2928  C  CG2   . THR C  1 25  ? 7.539   -43.299 -1.298  1.00 36.65 ? 24   THR B CG2   1 
ATOM   2929  N  N     . THR C  1 26  ? 9.293   -38.969 -1.651  1.00 39.06 ? 25   THR B N     1 
ATOM   2930  C  CA    . THR C  1 26  ? 9.321   -37.664 -2.357  1.00 39.16 ? 25   THR B CA    1 
ATOM   2931  C  C     . THR C  1 26  ? 10.430  -36.682 -1.927  1.00 39.55 ? 25   THR B C     1 
ATOM   2932  O  O     . THR C  1 26  ? 10.606  -35.649 -2.577  1.00 39.64 ? 25   THR B O     1 
ATOM   2933  C  CB    . THR C  1 26  ? 7.949   -36.929 -2.258  1.00 39.25 ? 25   THR B CB    1 
ATOM   2934  O  OG1   . THR C  1 26  ? 7.784   -36.372 -0.952  1.00 38.61 ? 25   THR B OG1   1 
ATOM   2935  C  CG2   . THR C  1 26  ? 6.807   -37.873 -2.550  1.00 38.96 ? 25   THR B CG2   1 
ATOM   2936  N  N     . ASN C  1 27  ? 11.182  -37.012 -0.873  1.00 39.72 ? 26   ASN B N     1 
ATOM   2937  C  CA    . ASN C  1 27  ? 12.134  -36.090 -0.238  1.00 39.75 ? 26   ASN B CA    1 
ATOM   2938  C  C     . ASN C  1 27  ? 11.528  -34.748 0.182   1.00 39.71 ? 26   ASN B C     1 
ATOM   2939  O  O     . ASN C  1 27  ? 12.186  -33.709 0.145   1.00 39.98 ? 26   ASN B O     1 
ATOM   2940  C  CB    . ASN C  1 27  ? 13.393  -35.889 -1.111  1.00 40.02 ? 26   ASN B CB    1 
ATOM   2941  C  CG    . ASN C  1 27  ? 14.182  -37.170 -1.289  1.00 40.24 ? 26   ASN B CG    1 
ATOM   2942  O  OD1   . ASN C  1 27  ? 14.337  -37.949 -0.348  1.00 40.61 ? 26   ASN B OD1   1 
ATOM   2943  N  ND2   . ASN C  1 27  ? 14.665  -37.409 -2.502  1.00 41.23 ? 26   ASN B ND2   1 
ATOM   2944  N  N     . ALA C  1 28  ? 10.273  -34.779 0.599   1.00 39.45 ? 27   ALA B N     1 
ATOM   2945  C  CA    . ALA C  1 28  ? 9.590   -33.579 1.073   1.00 39.83 ? 27   ALA B CA    1 
ATOM   2946  C  C     . ALA C  1 28  ? 8.855   -33.962 2.329   1.00 39.24 ? 27   ALA B C     1 
ATOM   2947  O  O     . ALA C  1 28  ? 8.267   -35.027 2.401   1.00 39.39 ? 27   ALA B O     1 
ATOM   2948  C  CB    . ALA C  1 28  ? 8.612   -33.021 0.011   1.00 39.74 ? 27   ALA B CB    1 
ATOM   2949  N  N     . PHE C  1 29  ? 8.936   -33.106 3.332   1.00 39.04 ? 28   PHE B N     1 
ATOM   2950  C  CA    . PHE C  1 29  ? 8.213   -33.306 4.572   1.00 38.87 ? 28   PHE B CA    1 
ATOM   2951  C  C     . PHE C  1 29  ? 6.915   -32.519 4.475   1.00 39.13 ? 28   PHE B C     1 
ATOM   2952  O  O     . PHE C  1 29  ? 6.965   -31.338 4.191   1.00 38.84 ? 28   PHE B O     1 
ATOM   2953  C  CB    . PHE C  1 29  ? 9.054   -32.781 5.714   1.00 38.76 ? 28   PHE B CB    1 
ATOM   2954  C  CG    . PHE C  1 29  ? 8.564   -33.190 7.060   1.00 38.63 ? 28   PHE B CG    1 
ATOM   2955  C  CD1   . PHE C  1 29  ? 8.833   -34.457 7.548   1.00 37.76 ? 28   PHE B CD1   1 
ATOM   2956  C  CD2   . PHE C  1 29  ? 7.863   -32.303 7.850   1.00 37.57 ? 28   PHE B CD2   1 
ATOM   2957  C  CE1   . PHE C  1 29  ? 8.391   -34.832 8.789   1.00 37.14 ? 28   PHE B CE1   1 
ATOM   2958  C  CE2   . PHE C  1 29  ? 7.435   -32.675 9.094   1.00 38.13 ? 28   PHE B CE2   1 
ATOM   2959  C  CZ    . PHE C  1 29  ? 7.704   -33.937 9.563   1.00 38.17 ? 28   PHE B CZ    1 
ATOM   2960  N  N     . PRO C  1 30  ? 5.748   -33.180 4.684   1.00 39.84 ? 29   PRO B N     1 
ATOM   2961  C  CA    . PRO C  1 30  ? 4.453   -32.502 4.660   1.00 39.92 ? 29   PRO B CA    1 
ATOM   2962  C  C     . PRO C  1 30  ? 4.358   -31.302 5.607   1.00 40.27 ? 29   PRO B C     1 
ATOM   2963  O  O     . PRO C  1 30  ? 4.684   -31.386 6.801   1.00 40.70 ? 29   PRO B O     1 
ATOM   2964  C  CB    . PRO C  1 30  ? 3.477   -33.596 5.086   1.00 39.67 ? 29   PRO B CB    1 
ATOM   2965  C  CG    . PRO C  1 30  ? 4.132   -34.858 4.669   1.00 39.89 ? 29   PRO B CG    1 
ATOM   2966  C  CD    . PRO C  1 30  ? 5.584   -34.631 4.928   1.00 40.23 ? 29   PRO B CD    1 
ATOM   2967  N  N     . GLY C  1 31  ? 3.897   -30.191 5.061   1.00 40.79 ? 30   GLY B N     1 
ATOM   2968  C  CA    . GLY C  1 31  ? 3.834   -28.928 5.796   1.00 41.15 ? 30   GLY B CA    1 
ATOM   2969  C  C     . GLY C  1 31  ? 2.687   -28.867 6.795   1.00 41.05 ? 30   GLY B C     1 
ATOM   2970  O  O     . GLY C  1 31  ? 2.674   -27.980 7.648   1.00 41.59 ? 30   GLY B O     1 
ATOM   2971  N  N     . GLU C  1 32  ? 1.754   -29.816 6.703   1.00 40.68 ? 31   GLU B N     1 
ATOM   2972  C  CA    . GLU C  1 32  ? 0.524   -29.821 7.514   1.00 40.52 ? 31   GLU B CA    1 
ATOM   2973  C  C     . GLU C  1 32  ? 0.354   -31.206 8.161   1.00 39.51 ? 31   GLU B C     1 
ATOM   2974  O  O     . GLU C  1 32  ? 0.718   -32.220 7.571   1.00 39.10 ? 31   GLU B O     1 
ATOM   2975  C  CB    . GLU C  1 32  ? -0.684  -29.504 6.619   1.00 40.98 ? 31   GLU B CB    1 
ATOM   2976  C  CG    . GLU C  1 32  ? -1.488  -28.280 7.006   1.00 43.20 ? 31   GLU B CG    1 
ATOM   2977  N  N     . TYR C  1 33  ? -0.162  -31.227 9.386   1.00 38.00 ? 32   TYR B N     1 
ATOM   2978  C  CA    . TYR C  1 33  ? -0.585  -32.449 10.034  1.00 37.42 ? 32   TYR B CA    1 
ATOM   2979  C  C     . TYR C  1 33  ? -2.067  -32.771 9.709   1.00 36.74 ? 32   TYR B C     1 
ATOM   2980  O  O     . TYR C  1 33  ? -2.972  -32.132 10.233  1.00 35.42 ? 32   TYR B O     1 
ATOM   2981  C  CB    . TYR C  1 33  ? -0.350  -32.343 11.545  1.00 37.46 ? 32   TYR B CB    1 
ATOM   2982  C  CG    . TYR C  1 33  ? -0.921  -33.484 12.389  1.00 37.65 ? 32   TYR B CG    1 
ATOM   2983  C  CD1   . TYR C  1 33  ? -1.048  -34.785 11.887  1.00 37.95 ? 32   TYR B CD1   1 
ATOM   2984  C  CD2   . TYR C  1 33  ? -1.315  -33.254 13.693  1.00 38.29 ? 32   TYR B CD2   1 
ATOM   2985  C  CE1   . TYR C  1 33  ? -1.577  -35.793 12.652  1.00 36.57 ? 32   TYR B CE1   1 
ATOM   2986  C  CE2   . TYR C  1 33  ? -1.840  -34.263 14.471  1.00 38.27 ? 32   TYR B CE2   1 
ATOM   2987  C  CZ    . TYR C  1 33  ? -1.961  -35.533 13.953  1.00 38.07 ? 32   TYR B CZ    1 
ATOM   2988  O  OH    . TYR C  1 33  ? -2.479  -36.516 14.763  1.00 37.11 ? 32   TYR B OH    1 
ATOM   2989  N  N     . ILE C  1 34  ? -2.276  -33.766 8.837   1.00 35.94 ? 33   ILE B N     1 
ATOM   2990  C  CA    . ILE C  1 34  ? -3.613  -34.206 8.415   1.00 35.08 ? 33   ILE B CA    1 
ATOM   2991  C  C     . ILE C  1 34  ? -3.715  -35.723 8.660   1.00 35.26 ? 33   ILE B C     1 
ATOM   2992  O  O     . ILE C  1 34  ? -3.100  -36.515 7.961   1.00 34.41 ? 33   ILE B O     1 
ATOM   2993  C  CB    . ILE C  1 34  ? -3.905  -33.834 6.930   1.00 35.06 ? 33   ILE B CB    1 
ATOM   2994  C  CG1   . ILE C  1 34  ? -3.870  -32.305 6.740   1.00 34.14 ? 33   ILE B CG1   1 
ATOM   2995  C  CG2   . ILE C  1 34  ? -5.291  -34.397 6.482   1.00 34.35 ? 33   ILE B CG2   1 
ATOM   2996  C  CD1   . ILE C  1 34  ? -3.830  -31.822 5.309   1.00 34.55 ? 33   ILE B CD1   1 
ATOM   2997  N  N     . PRO C  1 35  ? -4.443  -36.134 9.711   1.00 35.51 ? 34   PRO B N     1 
ATOM   2998  C  CA    . PRO C  1 35  ? -4.556  -37.586 9.926   1.00 35.14 ? 34   PRO B CA    1 
ATOM   2999  C  C     . PRO C  1 35  ? -5.152  -38.357 8.722   1.00 35.21 ? 34   PRO B C     1 
ATOM   3000  O  O     . PRO C  1 35  ? -6.001  -37.825 7.989   1.00 35.10 ? 34   PRO B O     1 
ATOM   3001  C  CB    . PRO C  1 35  ? -5.468  -37.672 11.159  1.00 35.52 ? 34   PRO B CB    1 
ATOM   3002  C  CG    . PRO C  1 35  ? -5.190  -36.371 11.909  1.00 35.13 ? 34   PRO B CG    1 
ATOM   3003  C  CD    . PRO C  1 35  ? -5.134  -35.375 10.776  1.00 35.17 ? 34   PRO B CD    1 
ATOM   3004  N  N     . THR C  1 36  ? -4.708  -39.600 8.573   1.00 34.34 ? 35   THR B N     1 
ATOM   3005  C  CA    . THR C  1 36  ? -5.011  -40.480 7.441   1.00 34.80 ? 35   THR B CA    1 
ATOM   3006  C  C     . THR C  1 36  ? -6.250  -41.338 7.681   1.00 34.59 ? 35   THR B C     1 
ATOM   3007  O  O     . THR C  1 36  ? -6.466  -41.807 8.798   1.00 34.78 ? 35   THR B O     1 
ATOM   3008  C  CB    . THR C  1 36  ? -3.818  -41.461 7.240   1.00 34.71 ? 35   THR B CB    1 
ATOM   3009  O  OG1   . THR C  1 36  ? -2.633  -40.700 6.984   1.00 34.07 ? 35   THR B OG1   1 
ATOM   3010  C  CG2   . THR C  1 36  ? -4.078  -42.506 6.104   1.00 33.69 ? 35   THR B CG2   1 
ATOM   3011  N  N     . VAL C  1 37  ? -7.062  -41.517 6.640   1.00 35.01 ? 36   VAL B N     1 
ATOM   3012  C  CA    . VAL C  1 37  ? -8.153  -42.492 6.650   1.00 34.44 ? 36   VAL B CA    1 
ATOM   3013  C  C     . VAL C  1 37  ? -7.576  -43.732 5.957   1.00 34.47 ? 36   VAL B C     1 
ATOM   3014  O  O     . VAL C  1 37  ? -7.458  -44.794 6.567   1.00 33.84 ? 36   VAL B O     1 
ATOM   3015  C  CB    . VAL C  1 37  ? -9.459  -41.951 5.974   1.00 34.45 ? 36   VAL B CB    1 
ATOM   3016  C  CG1   . VAL C  1 37  ? -10.569 -43.002 5.992   1.00 33.91 ? 36   VAL B CG1   1 
ATOM   3017  C  CG2   . VAL C  1 37  ? -9.959  -40.690 6.668   1.00 32.77 ? 36   VAL B CG2   1 
ATOM   3018  N  N     . PHE C  1 38  ? -7.205  -43.572 4.689   1.00 34.93 ? 37   PHE B N     1 
ATOM   3019  C  CA    . PHE C  1 38  ? -6.390  -44.539 3.954   1.00 34.71 ? 37   PHE B CA    1 
ATOM   3020  C  C     . PHE C  1 38  ? -5.813  -43.906 2.697   1.00 35.76 ? 37   PHE B C     1 
ATOM   3021  O  O     . PHE C  1 38  ? -6.510  -43.213 1.948   1.00 35.48 ? 37   PHE B O     1 
ATOM   3022  C  CB    . PHE C  1 38  ? -7.164  -45.791 3.516   1.00 34.82 ? 37   PHE B CB    1 
ATOM   3023  C  CG    . PHE C  1 38  ? -6.316  -46.718 2.663   1.00 34.67 ? 37   PHE B CG    1 
ATOM   3024  C  CD1   . PHE C  1 38  ? -5.296  -47.456 3.240   1.00 33.53 ? 37   PHE B CD1   1 
ATOM   3025  C  CD2   . PHE C  1 38  ? -6.473  -46.763 1.275   1.00 33.98 ? 37   PHE B CD2   1 
ATOM   3026  C  CE1   . PHE C  1 38  ? -4.453  -48.265 2.453   1.00 33.80 ? 37   PHE B CE1   1 
ATOM   3027  C  CE2   . PHE C  1 38  ? -5.657  -47.571 0.490   1.00 34.29 ? 37   PHE B CE2   1 
ATOM   3028  C  CZ    . PHE C  1 38  ? -4.641  -48.330 1.086   1.00 33.69 ? 37   PHE B CZ    1 
ATOM   3029  N  N     . ASP C  1 39  ? -4.542  -44.181 2.452   1.00 36.13 ? 38   ASP B N     1 
ATOM   3030  C  CA    . ASP C  1 39  ? -3.872  -43.713 1.255   1.00 36.73 ? 38   ASP B CA    1 
ATOM   3031  C  C     . ASP C  1 39  ? -2.944  -44.799 0.754   1.00 36.90 ? 38   ASP B C     1 
ATOM   3032  O  O     . ASP C  1 39  ? -2.415  -45.566 1.539   1.00 37.04 ? 38   ASP B O     1 
ATOM   3033  C  CB    . ASP C  1 39  ? -3.093  -42.435 1.572   1.00 36.67 ? 38   ASP B CB    1 
ATOM   3034  C  CG    . ASP C  1 39  ? -4.000  -41.224 1.681   1.00 36.67 ? 38   ASP B CG    1 
ATOM   3035  O  OD1   . ASP C  1 39  ? -4.387  -40.675 0.630   1.00 35.58 ? 38   ASP B OD1   1 
ATOM   3036  O  OD2   . ASP C  1 39  ? -4.338  -40.831 2.819   1.00 37.90 ? 38   ASP B OD2   1 
ATOM   3037  N  N     . ASN C  1 40  ? -2.755  -44.850 -0.560  1.00 38.10 ? 39   ASN B N     1 
ATOM   3038  C  CA    . ASN C  1 40  ? -1.918  -45.843 -1.215  1.00 38.48 ? 39   ASN B CA    1 
ATOM   3039  C  C     . ASN C  1 40  ? -0.974  -45.100 -2.127  1.00 38.82 ? 39   ASN B C     1 
ATOM   3040  O  O     . ASN C  1 40  ? -1.410  -44.275 -2.954  1.00 39.14 ? 39   ASN B O     1 
ATOM   3041  C  CB    . ASN C  1 40  ? -2.779  -46.826 -2.027  1.00 38.83 ? 39   ASN B CB    1 
ATOM   3042  C  CG    . ASN C  1 40  ? -1.975  -47.957 -2.644  1.00 41.54 ? 39   ASN B CG    1 
ATOM   3043  O  OD1   . ASN C  1 40  ? -1.783  -47.999 -3.857  1.00 46.66 ? 39   ASN B OD1   1 
ATOM   3044  N  ND2   . ASN C  1 40  ? -1.503  -48.884 -1.814  1.00 44.70 ? 39   ASN B ND2   1 
ATOM   3045  N  N     . TYR C  1 41  ? 0.317   -45.376 -1.964  1.00 38.88 ? 40   TYR B N     1 
ATOM   3046  C  CA    . TYR C  1 41  ? 1.359   -44.812 -2.815  1.00 39.32 ? 40   TYR B CA    1 
ATOM   3047  C  C     . TYR C  1 41  ? 2.156   -45.936 -3.461  1.00 38.97 ? 40   TYR B C     1 
ATOM   3048  O  O     . TYR C  1 41  ? 2.252   -47.047 -2.917  1.00 38.74 ? 40   TYR B O     1 
ATOM   3049  C  CB    . TYR C  1 41  ? 2.343   -43.942 -2.016  1.00 39.89 ? 40   TYR B CB    1 
ATOM   3050  C  CG    . TYR C  1 41  ? 1.724   -43.141 -0.904  1.00 40.44 ? 40   TYR B CG    1 
ATOM   3051  C  CD1   . TYR C  1 41  ? 1.972   -43.470 0.414   1.00 40.78 ? 40   TYR B CD1   1 
ATOM   3052  C  CD2   . TYR C  1 41  ? 0.887   -42.049 -1.172  1.00 40.13 ? 40   TYR B CD2   1 
ATOM   3053  C  CE1   . TYR C  1 41  ? 1.425   -42.746 1.445   1.00 42.40 ? 40   TYR B CE1   1 
ATOM   3054  C  CE2   . TYR C  1 41  ? 0.316   -41.307 -0.128  1.00 39.91 ? 40   TYR B CE2   1 
ATOM   3055  C  CZ    . TYR C  1 41  ? 0.585   -41.674 1.174   1.00 41.04 ? 40   TYR B CZ    1 
ATOM   3056  O  OH    . TYR C  1 41  ? 0.055   -40.986 2.245   1.00 43.29 ? 40   TYR B OH    1 
ATOM   3057  N  N     . SER C  1 42  ? 2.746   -45.615 -4.603  1.00 38.71 ? 41   SER B N     1 
ATOM   3058  C  CA    A SER C  1 42  ? 3.592   -46.559 -5.316  0.50 38.96 ? 41   SER B CA    1 
ATOM   3059  C  CA    B SER C  1 42  ? 3.572   -46.547 -5.349  0.50 39.12 ? 41   SER B CA    1 
ATOM   3060  C  C     . SER C  1 42  ? 4.911   -45.903 -5.692  1.00 39.10 ? 41   SER B C     1 
ATOM   3061  O  O     . SER C  1 42  ? 4.975   -44.700 -5.931  1.00 39.11 ? 41   SER B O     1 
ATOM   3062  C  CB    A SER C  1 42  ? 2.884   -47.108 -6.558  0.50 38.55 ? 41   SER B CB    1 
ATOM   3063  C  CB    B SER C  1 42  ? 2.850   -46.965 -6.626  0.50 38.77 ? 41   SER B CB    1 
ATOM   3064  O  OG    A SER C  1 42  ? 2.637   -46.092 -7.511  0.50 38.59 ? 41   SER B OG    1 
ATOM   3065  O  OG    B SER C  1 42  ? 3.679   -47.777 -7.427  0.50 39.72 ? 41   SER B OG    1 
ATOM   3066  N  N     . ALA C  1 43  ? 5.967   -46.713 -5.727  1.00 39.67 ? 42   ALA B N     1 
ATOM   3067  C  CA    . ALA C  1 43  ? 7.303   -46.248 -6.106  1.00 39.83 ? 42   ALA B CA    1 
ATOM   3068  C  C     . ALA C  1 43  ? 8.095   -47.390 -6.708  1.00 40.56 ? 42   ALA B C     1 
ATOM   3069  O  O     . ALA C  1 43  ? 7.830   -48.557 -6.418  1.00 40.49 ? 42   ALA B O     1 
ATOM   3070  C  CB    . ALA C  1 43  ? 8.032   -45.694 -4.895  1.00 39.32 ? 42   ALA B CB    1 
ATOM   3071  N  N     . ASN C  1 44  ? 9.074   -47.051 -7.540  1.00 41.33 ? 43   ASN B N     1 
ATOM   3072  C  CA    . ASN C  1 44  ? 10.005  -48.037 -8.048  1.00 42.17 ? 43   ASN B CA    1 
ATOM   3073  C  C     . ASN C  1 44  ? 11.342  -47.886 -7.361  1.00 41.99 ? 43   ASN B C     1 
ATOM   3074  O  O     . ASN C  1 44  ? 11.806  -46.774 -7.091  1.00 41.53 ? 43   ASN B O     1 
ATOM   3075  C  CB    . ASN C  1 44  ? 10.169  -47.931 -9.561  1.00 42.52 ? 43   ASN B CB    1 
ATOM   3076  C  CG    . ASN C  1 44  ? 8.961   -48.474 -10.318 1.00 45.77 ? 43   ASN B CG    1 
ATOM   3077  O  OD1   . ASN C  1 44  ? 8.534   -49.622 -10.100 1.00 50.03 ? 43   ASN B OD1   1 
ATOM   3078  N  ND2   . ASN C  1 44  ? 8.411   -47.656 -11.228 1.00 46.83 ? 43   ASN B ND2   1 
ATOM   3079  N  N     . VAL C  1 45  ? 11.935  -49.036 -7.072  1.00 42.09 ? 44   VAL B N     1 
ATOM   3080  C  CA    . VAL C  1 45  ? 13.249  -49.126 -6.494  1.00 42.50 ? 44   VAL B CA    1 
ATOM   3081  C  C     . VAL C  1 45  ? 14.082  -50.112 -7.337  1.00 43.13 ? 44   VAL B C     1 
ATOM   3082  O  O     . VAL C  1 45  ? 13.550  -51.007 -7.994  1.00 43.01 ? 44   VAL B O     1 
ATOM   3083  C  CB    . VAL C  1 45  ? 13.132  -49.523 -4.997  1.00 42.76 ? 44   VAL B CB    1 
ATOM   3084  C  CG1   . VAL C  1 45  ? 14.005  -50.688 -4.647  1.00 42.99 ? 44   VAL B CG1   1 
ATOM   3085  C  CG2   . VAL C  1 45  ? 13.426  -48.324 -4.108  1.00 41.97 ? 44   VAL B CG2   1 
ATOM   3086  N  N     . MET C  1 46  ? 15.386  -49.889 -7.360  1.00 43.41 ? 45   MET B N     1 
ATOM   3087  C  CA    . MET C  1 46  ? 16.303  -50.781 -8.011  1.00 44.16 ? 45   MET B CA    1 
ATOM   3088  C  C     . MET C  1 46  ? 16.951  -51.610 -6.916  1.00 44.01 ? 45   MET B C     1 
ATOM   3089  O  O     . MET C  1 46  ? 17.504  -51.054 -5.972  1.00 43.81 ? 45   MET B O     1 
ATOM   3090  C  CB    . MET C  1 46  ? 17.345  -49.964 -8.778  1.00 44.75 ? 45   MET B CB    1 
ATOM   3091  C  CG    . MET C  1 46  ? 17.785  -50.586 -10.062 1.00 46.78 ? 45   MET B CG    1 
ATOM   3092  S  SD    . MET C  1 46  ? 16.543  -50.595 -11.386 1.00 50.52 ? 45   MET B SD    1 
ATOM   3093  C  CE    . MET C  1 46  ? 17.443  -51.658 -12.514 1.00 47.58 ? 45   MET B CE    1 
ATOM   3094  N  N     . VAL C  1 47  ? 16.852  -52.933 -7.027  1.00 44.21 ? 46   VAL B N     1 
ATOM   3095  C  CA    . VAL C  1 47  ? 17.400  -53.854 -6.026  1.00 44.40 ? 46   VAL B CA    1 
ATOM   3096  C  C     . VAL C  1 47  ? 18.379  -54.803 -6.705  1.00 45.09 ? 46   VAL B C     1 
ATOM   3097  O  O     . VAL C  1 47  ? 17.979  -55.697 -7.460  1.00 45.11 ? 46   VAL B O     1 
ATOM   3098  C  CB    . VAL C  1 47  ? 16.292  -54.677 -5.293  1.00 44.35 ? 46   VAL B CB    1 
ATOM   3099  C  CG1   . VAL C  1 47  ? 16.907  -55.743 -4.389  1.00 44.55 ? 46   VAL B CG1   1 
ATOM   3100  C  CG2   . VAL C  1 47  ? 15.387  -53.768 -4.468  1.00 42.87 ? 46   VAL B CG2   1 
ATOM   3101  N  N     . ASP C  1 48  ? 19.666  -54.592 -6.433  1.00 45.81 ? 47   ASP B N     1 
ATOM   3102  C  CA    . ASP C  1 48  ? 20.729  -55.395 -7.015  1.00 46.38 ? 47   ASP B CA    1 
ATOM   3103  C  C     . ASP C  1 48  ? 20.625  -55.458 -8.542  1.00 46.55 ? 47   ASP B C     1 
ATOM   3104  O  O     . ASP C  1 48  ? 20.896  -56.496 -9.157  1.00 46.87 ? 47   ASP B O     1 
ATOM   3105  C  CB    . ASP C  1 48  ? 20.722  -56.799 -6.389  1.00 46.85 ? 47   ASP B CB    1 
ATOM   3106  C  CG    . ASP C  1 48  ? 21.052  -56.781 -4.901  1.00 47.74 ? 47   ASP B CG    1 
ATOM   3107  O  OD1   . ASP C  1 48  ? 21.614  -55.771 -4.416  1.00 49.86 ? 47   ASP B OD1   1 
ATOM   3108  O  OD2   . ASP C  1 48  ? 20.761  -57.785 -4.210  1.00 49.43 ? 47   ASP B OD2   1 
ATOM   3109  N  N     . GLY C  1 49  ? 20.229  -54.338 -9.153  1.00 46.67 ? 48   GLY B N     1 
ATOM   3110  C  CA    . GLY C  1 49  ? 20.190  -54.226 -10.609 1.00 46.47 ? 48   GLY B CA    1 
ATOM   3111  C  C     . GLY C  1 49  ? 18.882  -54.634 -11.265 1.00 46.57 ? 48   GLY B C     1 
ATOM   3112  O  O     . GLY C  1 49  ? 18.785  -54.629 -12.496 1.00 46.61 ? 48   GLY B O     1 
ATOM   3113  N  N     . LYS C  1 50  ? 17.876  -54.982 -10.458 1.00 46.29 ? 49   LYS B N     1 
ATOM   3114  C  CA    . LYS C  1 50  ? 16.553  -55.286 -10.980 1.00 45.85 ? 49   LYS B CA    1 
ATOM   3115  C  C     . LYS C  1 50  ? 15.552  -54.281 -10.436 1.00 45.37 ? 49   LYS B C     1 
ATOM   3116  O  O     . LYS C  1 50  ? 15.643  -53.874 -9.283  1.00 44.85 ? 49   LYS B O     1 
ATOM   3117  C  CB    . LYS C  1 50  ? 16.102  -56.694 -10.587 1.00 46.16 ? 49   LYS B CB    1 
ATOM   3118  C  CG    . LYS C  1 50  ? 17.078  -57.818 -10.922 1.00 46.89 ? 49   LYS B CG    1 
ATOM   3119  C  CD    . LYS C  1 50  ? 17.606  -58.486 -9.652  1.00 48.75 ? 49   LYS B CD    1 
ATOM   3120  N  N     . PRO C  1 51  ? 14.583  -53.877 -11.267 1.00 44.85 ? 50   PRO B N     1 
ATOM   3121  C  CA    . PRO C  1 51  ? 13.502  -53.046 -10.756 1.00 44.35 ? 50   PRO B CA    1 
ATOM   3122  C  C     . PRO C  1 51  ? 12.564  -53.829 -9.845  1.00 44.00 ? 50   PRO B C     1 
ATOM   3123  O  O     . PRO C  1 51  ? 12.333  -55.018 -10.067 1.00 43.79 ? 50   PRO B O     1 
ATOM   3124  C  CB    . PRO C  1 51  ? 12.777  -52.612 -12.023 1.00 44.24 ? 50   PRO B CB    1 
ATOM   3125  C  CG    . PRO C  1 51  ? 13.046  -53.675 -12.988 1.00 44.40 ? 50   PRO B CG    1 
ATOM   3126  C  CD    . PRO C  1 51  ? 14.428  -54.151 -12.707 1.00 44.90 ? 50   PRO B CD    1 
ATOM   3127  N  N     . VAL C  1 52  ? 12.049  -53.153 -8.823  1.00 43.82 ? 51   VAL B N     1 
ATOM   3128  C  CA    . VAL C  1 52  ? 11.027  -53.700 -7.925  1.00 43.33 ? 51   VAL B CA    1 
ATOM   3129  C  C     . VAL C  1 52  ? 9.926   -52.646 -7.738  1.00 43.50 ? 51   VAL B C     1 
ATOM   3130  O  O     . VAL C  1 52  ? 10.220  -51.479 -7.467  1.00 43.56 ? 51   VAL B O     1 
ATOM   3131  C  CB    . VAL C  1 52  ? 11.645  -54.105 -6.544  1.00 43.29 ? 51   VAL B CB    1 
ATOM   3132  C  CG1   . VAL C  1 52  ? 10.581  -54.605 -5.573  1.00 42.20 ? 51   VAL B CG1   1 
ATOM   3133  C  CG2   . VAL C  1 52  ? 12.727  -55.157 -6.738  1.00 42.03 ? 51   VAL B CG2   1 
ATOM   3134  N  N     . ASN C  1 53  ? 8.668   -53.050 -7.905  1.00 43.58 ? 52   ASN B N     1 
ATOM   3135  C  CA    . ASN C  1 53  ? 7.541   -52.147 -7.650  1.00 44.13 ? 52   ASN B CA    1 
ATOM   3136  C  C     . ASN C  1 53  ? 7.191   -52.188 -6.168  1.00 43.40 ? 52   ASN B C     1 
ATOM   3137  O  O     . ASN C  1 53  ? 6.785   -53.221 -5.627  1.00 43.03 ? 52   ASN B O     1 
ATOM   3138  C  CB    . ASN C  1 53  ? 6.322   -52.505 -8.501  1.00 44.39 ? 52   ASN B CB    1 
ATOM   3139  C  CG    . ASN C  1 53  ? 5.148   -51.516 -8.328  1.00 47.64 ? 52   ASN B CG    1 
ATOM   3140  O  OD1   . ASN C  1 53  ? 5.253   -50.467 -7.664  1.00 51.03 ? 52   ASN B OD1   1 
ATOM   3141  N  ND2   . ASN C  1 53  ? 4.021   -51.851 -8.950  1.00 51.29 ? 52   ASN B ND2   1 
ATOM   3142  N  N     . LEU C  1 54  ? 7.353   -51.044 -5.525  1.00 42.87 ? 53   LEU B N     1 
ATOM   3143  C  CA    . LEU C  1 54  ? 7.101   -50.902 -4.107  1.00 43.14 ? 53   LEU B CA    1 
ATOM   3144  C  C     . LEU C  1 54  ? 5.695   -50.332 -3.931  1.00 42.09 ? 53   LEU B C     1 
ATOM   3145  O  O     . LEU C  1 54  ? 5.403   -49.253 -4.438  1.00 42.35 ? 53   LEU B O     1 
ATOM   3146  C  CB    . LEU C  1 54  ? 8.173   -49.980 -3.530  1.00 43.33 ? 53   LEU B CB    1 
ATOM   3147  C  CG    . LEU C  1 54  ? 8.387   -49.847 -2.038  1.00 45.61 ? 53   LEU B CG    1 
ATOM   3148  C  CD1   . LEU C  1 54  ? 8.317   -51.198 -1.290  1.00 47.70 ? 53   LEU B CD1   1 
ATOM   3149  C  CD2   . LEU C  1 54  ? 9.745   -49.152 -1.844  1.00 44.24 ? 53   LEU B CD2   1 
ATOM   3150  N  N     . GLY C  1 55  ? 4.818   -51.094 -3.275  1.00 41.09 ? 54   GLY B N     1 
ATOM   3151  C  CA    . GLY C  1 55  ? 3.451   -50.658 -2.960  1.00 40.53 ? 54   GLY B CA    1 
ATOM   3152  C  C     . GLY C  1 55  ? 3.327   -50.314 -1.486  1.00 39.73 ? 54   GLY B C     1 
ATOM   3153  O  O     . GLY C  1 55  ? 3.679   -51.132 -0.630  1.00 39.12 ? 54   GLY B O     1 
ATOM   3154  N  N     . LEU C  1 56  ? 2.850   -49.105 -1.187  1.00 38.84 ? 55   LEU B N     1 
ATOM   3155  C  CA    . LEU C  1 56  ? 2.831   -48.625 0.192   1.00 38.83 ? 55   LEU B CA    1 
ATOM   3156  C  C     . LEU C  1 56  ? 1.415   -48.216 0.624   1.00 38.94 ? 55   LEU B C     1 
ATOM   3157  O  O     . LEU C  1 56  ? 0.800   -47.323 0.050   1.00 38.21 ? 55   LEU B O     1 
ATOM   3158  C  CB    . LEU C  1 56  ? 3.810   -47.472 0.405   1.00 39.11 ? 55   LEU B CB    1 
ATOM   3159  C  CG    . LEU C  1 56  ? 5.266   -47.627 -0.070  1.00 39.27 ? 55   LEU B CG    1 
ATOM   3160  C  CD1   . LEU C  1 56  ? 5.888   -46.236 -0.219  1.00 39.71 ? 55   LEU B CD1   1 
ATOM   3161  C  CD2   . LEU C  1 56  ? 6.073   -48.500 0.892   1.00 38.72 ? 55   LEU B CD2   1 
ATOM   3162  N  N     . TRP C  1 57  ? 0.946   -48.901 1.656   1.00 38.52 ? 56   TRP B N     1 
ATOM   3163  C  CA    . TRP C  1 57  ? -0.388  -48.799 2.164   1.00 38.85 ? 56   TRP B CA    1 
ATOM   3164  C  C     . TRP C  1 57  ? -0.332  -48.088 3.516   1.00 38.32 ? 56   TRP B C     1 
ATOM   3165  O  O     . TRP C  1 57  ? 0.166   -48.633 4.507   1.00 37.90 ? 56   TRP B O     1 
ATOM   3166  C  CB    . TRP C  1 57  ? -0.952  -50.206 2.260   1.00 40.01 ? 56   TRP B CB    1 
ATOM   3167  C  CG    . TRP C  1 57  ? -0.928  -50.924 0.901   1.00 41.02 ? 56   TRP B CG    1 
ATOM   3168  C  CD1   . TRP C  1 57  ? 0.179   -51.198 0.107   1.00 41.91 ? 56   TRP B CD1   1 
ATOM   3169  C  CD2   . TRP C  1 57  ? -2.044  -51.439 0.201   1.00 41.78 ? 56   TRP B CD2   1 
ATOM   3170  N  NE1   . TRP C  1 57  ? -0.202  -51.843 -1.037  1.00 41.33 ? 56   TRP B NE1   1 
ATOM   3171  C  CE2   . TRP C  1 57  ? -1.561  -52.012 -1.003  1.00 42.10 ? 56   TRP B CE2   1 
ATOM   3172  C  CE3   . TRP C  1 57  ? -3.414  -51.491 0.477   1.00 42.46 ? 56   TRP B CE3   1 
ATOM   3173  C  CZ2   . TRP C  1 57  ? -2.396  -52.620 -1.917  1.00 42.15 ? 56   TRP B CZ2   1 
ATOM   3174  C  CZ3   . TRP C  1 57  ? -4.245  -52.075 -0.441  1.00 41.89 ? 56   TRP B CZ3   1 
ATOM   3175  C  CH2   . TRP C  1 57  ? -3.736  -52.640 -1.628  1.00 42.43 ? 56   TRP B CH2   1 
ATOM   3176  N  N     . ASP C  1 58  ? -0.795  -46.841 3.511   1.00 37.70 ? 57   ASP B N     1 
ATOM   3177  C  CA    . ASP C  1 58  ? -0.709  -45.912 4.631   1.00 37.37 ? 57   ASP B CA    1 
ATOM   3178  C  C     . ASP C  1 58  ? -2.036  -45.985 5.373   1.00 37.37 ? 57   ASP B C     1 
ATOM   3179  O  O     . ASP C  1 58  ? -3.059  -45.608 4.830   1.00 37.15 ? 57   ASP B O     1 
ATOM   3180  C  CB    . ASP C  1 58  ? -0.515  -44.505 4.075   1.00 37.18 ? 57   ASP B CB    1 
ATOM   3181  C  CG    . ASP C  1 58  ? -0.094  -43.499 5.119   1.00 37.72 ? 57   ASP B CG    1 
ATOM   3182  O  OD1   . ASP C  1 58  ? 0.234   -43.874 6.283   1.00 40.58 ? 57   ASP B OD1   1 
ATOM   3183  O  OD2   . ASP C  1 58  ? -0.064  -42.308 4.756   1.00 36.17 ? 57   ASP B OD2   1 
ATOM   3184  N  N     . THR C  1 59  ? -2.037  -46.515 6.586   1.00 36.95 ? 58   THR B N     1 
ATOM   3185  C  CA    . THR C  1 59  ? -3.301  -46.778 7.273   1.00 36.47 ? 58   THR B CA    1 
ATOM   3186  C  C     . THR C  1 59  ? -3.598  -45.748 8.373   1.00 36.37 ? 58   THR B C     1 
ATOM   3187  O  O     . THR C  1 59  ? -2.743  -44.910 8.714   1.00 36.17 ? 58   THR B O     1 
ATOM   3188  C  CB    . THR C  1 59  ? -3.321  -48.204 7.846   1.00 36.54 ? 58   THR B CB    1 
ATOM   3189  O  OG1   . THR C  1 59  ? -2.412  -48.289 8.952   1.00 37.70 ? 58   THR B OG1   1 
ATOM   3190  C  CG2   . THR C  1 59  ? -2.930  -49.252 6.773   1.00 35.68 ? 58   THR B CG2   1 
ATOM   3191  N  N     . ALA C  1 60  ? -4.817  -45.825 8.918   1.00 36.06 ? 59   ALA B N     1 
ATOM   3192  C  CA    . ALA C  1 60  ? -5.308  -44.873 9.920   1.00 36.11 ? 59   ALA B CA    1 
ATOM   3193  C  C     . ALA C  1 60  ? -4.880  -45.294 11.321  1.00 36.24 ? 59   ALA B C     1 
ATOM   3194  O  O     . ALA C  1 60  ? -5.076  -46.443 11.727  1.00 36.57 ? 59   ALA B O     1 
ATOM   3195  C  CB    . ALA C  1 60  ? -6.829  -44.748 9.858   1.00 35.35 ? 59   ALA B CB    1 
ATOM   3196  N  N     . GLY C  1 61  ? -4.264  -44.355 12.029  1.00 36.53 ? 60   GLY B N     1 
ATOM   3197  C  CA    . GLY C  1 61  ? -3.898  -44.522 13.428  1.00 36.78 ? 60   GLY B CA    1 
ATOM   3198  C  C     . GLY C  1 61  ? -5.084  -44.317 14.347  1.00 36.44 ? 60   GLY B C     1 
ATOM   3199  O  O     . GLY C  1 61  ? -5.083  -44.818 15.453  1.00 36.26 ? 60   GLY B O     1 
ATOM   3200  N  N     . GLN C  1 62  ? -6.100  -43.594 13.883  1.00 36.94 ? 61   GLN B N     1 
ATOM   3201  C  CA    . GLN C  1 62  ? -7.298  -43.371 14.673  1.00 37.20 ? 61   GLN B CA    1 
ATOM   3202  C  C     . GLN C  1 62  ? -8.050  -44.679 14.849  1.00 38.18 ? 61   GLN B C     1 
ATOM   3203  O  O     . GLN C  1 62  ? -8.359  -45.377 13.873  1.00 37.56 ? 61   GLN B O     1 
ATOM   3204  C  CB    . GLN C  1 62  ? -8.208  -42.363 13.999  1.00 37.06 ? 61   GLN B CB    1 
ATOM   3205  C  CG    . GLN C  1 62  ? -7.656  -40.962 13.937  1.00 36.81 ? 61   GLN B CG    1 
ATOM   3206  C  CD    . GLN C  1 62  ? -8.436  -40.091 12.995  1.00 36.88 ? 61   GLN B CD    1 
ATOM   3207  O  OE1   . GLN C  1 62  ? -9.427  -39.484 13.388  1.00 35.68 ? 61   GLN B OE1   1 
ATOM   3208  N  NE2   . GLN C  1 62  ? -8.009  -40.042 11.733  1.00 35.79 ? 61   GLN B NE2   1 
ATOM   3209  N  N     . GLU C  1 63  ? -8.349  -45.020 16.096  1.00 39.45 ? 62   GLU B N     1 
ATOM   3210  C  CA    . GLU C  1 63  ? -9.137  -46.228 16.361  1.00 40.62 ? 62   GLU B CA    1 
ATOM   3211  C  C     . GLU C  1 63  ? -10.563 -46.158 15.786  1.00 39.88 ? 62   GLU B C     1 
ATOM   3212  O  O     . GLU C  1 63  ? -11.180 -47.180 15.525  1.00 39.47 ? 62   GLU B O     1 
ATOM   3213  C  CB    . GLU C  1 63  ? -9.173  -46.539 17.843  1.00 40.82 ? 62   GLU B CB    1 
ATOM   3214  C  CG    . GLU C  1 63  ? -9.865  -45.539 18.711  1.00 42.82 ? 62   GLU B CG    1 
ATOM   3215  C  CD    . GLU C  1 63  ? -9.664  -45.857 20.189  1.00 44.54 ? 62   GLU B CD    1 
ATOM   3216  O  OE1   . GLU C  1 63  ? -8.756  -46.668 20.492  1.00 50.46 ? 62   GLU B OE1   1 
ATOM   3217  O  OE2   . GLU C  1 63  ? -10.419 -45.321 21.038  1.00 49.32 ? 62   GLU B OE2   1 
ATOM   3218  N  N     . ASP C  1 64  ? -11.080 -44.952 15.579  1.00 39.59 ? 63   ASP B N     1 
ATOM   3219  C  CA    . ASP C  1 64  ? -12.382 -44.779 14.924  1.00 39.08 ? 63   ASP B CA    1 
ATOM   3220  C  C     . ASP C  1 64  ? -12.460 -45.475 13.559  1.00 38.78 ? 63   ASP B C     1 
ATOM   3221  O  O     . ASP C  1 64  ? -13.564 -45.821 13.083  1.00 38.29 ? 63   ASP B O     1 
ATOM   3222  C  CB    . ASP C  1 64  ? -12.677 -43.301 14.762  1.00 38.96 ? 63   ASP B CB    1 
ATOM   3223  C  CG    . ASP C  1 64  ? -13.248 -42.682 16.024  1.00 40.62 ? 63   ASP B CG    1 
ATOM   3224  O  OD1   . ASP C  1 64  ? -13.784 -41.552 15.921  1.00 40.16 ? 63   ASP B OD1   1 
ATOM   3225  O  OD2   . ASP C  1 64  ? -13.180 -43.325 17.106  1.00 42.18 ? 63   ASP B OD2   1 
ATOM   3226  N  N     . TYR C  1 65  ? -11.287 -45.675 12.951  1.00 38.32 ? 64   TYR B N     1 
ATOM   3227  C  CA    . TYR C  1 65  ? -11.138 -46.372 11.663  1.00 38.46 ? 64   TYR B CA    1 
ATOM   3228  C  C     . TYR C  1 65  ? -10.643 -47.830 11.743  1.00 38.29 ? 64   TYR B C     1 
ATOM   3229  O  O     . TYR C  1 65  ? -10.225 -48.384 10.733  1.00 38.39 ? 64   TYR B O     1 
ATOM   3230  C  CB    . TYR C  1 65  ? -10.261 -45.534 10.708  1.00 38.58 ? 64   TYR B CB    1 
ATOM   3231  C  CG    . TYR C  1 65  ? -10.939 -44.234 10.329  1.00 38.39 ? 64   TYR B CG    1 
ATOM   3232  C  CD1   . TYR C  1 65  ? -10.375 -43.003 10.635  1.00 38.80 ? 64   TYR B CD1   1 
ATOM   3233  C  CD2   . TYR C  1 65  ? -12.173 -44.246 9.706   1.00 38.79 ? 64   TYR B CD2   1 
ATOM   3234  C  CE1   . TYR C  1 65  ? -11.014 -41.814 10.295  1.00 39.08 ? 64   TYR B CE1   1 
ATOM   3235  C  CE2   . TYR C  1 65  ? -12.826 -43.074 9.375   1.00 39.08 ? 64   TYR B CE2   1 
ATOM   3236  C  CZ    . TYR C  1 65  ? -12.252 -41.855 9.674   1.00 39.57 ? 64   TYR B CZ    1 
ATOM   3237  O  OH    . TYR C  1 65  ? -12.929 -40.687 9.343   1.00 38.98 ? 64   TYR B OH    1 
ATOM   3238  N  N     . ASP C  1 66  ? -10.801 -48.472 12.900  1.00 38.40 ? 65   ASP B N     1 
ATOM   3239  C  CA    . ASP C  1 66  ? -10.399 -49.878 13.083  1.00 38.51 ? 65   ASP B CA    1 
ATOM   3240  C  C     . ASP C  1 66  ? -11.043 -50.840 12.063  1.00 38.93 ? 65   ASP B C     1 
ATOM   3241  O  O     . ASP C  1 66  ? -10.421 -51.826 11.650  1.00 38.66 ? 65   ASP B O     1 
ATOM   3242  C  CB    . ASP C  1 66  ? -10.785 -50.377 14.475  1.00 38.07 ? 65   ASP B CB    1 
ATOM   3243  C  CG    . ASP C  1 66  ? -9.843  -49.930 15.562  1.00 37.70 ? 65   ASP B CG    1 
ATOM   3244  O  OD1   . ASP C  1 66  ? -8.744  -49.439 15.278  1.00 36.84 ? 65   ASP B OD1   1 
ATOM   3245  O  OD2   . ASP C  1 66  ? -10.217 -50.083 16.743  1.00 37.32 ? 65   ASP B OD2   1 
ATOM   3246  N  N     . ARG C  1 67  ? -12.285 -50.566 11.683  1.00 38.90 ? 66   ARG B N     1 
ATOM   3247  C  CA    . ARG C  1 67  ? -13.017 -51.455 10.797  1.00 39.91 ? 66   ARG B CA    1 
ATOM   3248  C  C     . ARG C  1 67  ? -12.457 -51.462 9.388   1.00 39.14 ? 66   ARG B C     1 
ATOM   3249  O  O     . ARG C  1 67  ? -12.541 -52.481 8.694   1.00 38.97 ? 66   ARG B O     1 
ATOM   3250  C  CB    . ARG C  1 67  ? -14.523 -51.129 10.792  1.00 40.31 ? 66   ARG B CB    1 
ATOM   3251  C  CG    . ARG C  1 67  ? -14.927 -49.780 10.173  1.00 42.68 ? 66   ARG B CG    1 
ATOM   3252  C  CD    . ARG C  1 67  ? -16.399 -49.478 10.506  1.00 43.14 ? 66   ARG B CD    1 
ATOM   3253  N  NE    . ARG C  1 67  ? -16.886 -48.222 9.921   1.00 46.67 ? 66   ARG B NE    1 
ATOM   3254  C  CZ    . ARG C  1 67  ? -16.562 -47.002 10.355  1.00 47.70 ? 66   ARG B CZ    1 
ATOM   3255  N  NH1   . ARG C  1 67  ? -15.726 -46.843 11.383  1.00 48.58 ? 66   ARG B NH1   1 
ATOM   3256  N  NH2   . ARG C  1 67  ? -17.061 -45.926 9.744   1.00 46.60 ? 66   ARG B NH2   1 
ATOM   3257  N  N     . LEU C  1 68  ? -11.863 -50.344 8.977   1.00 38.59 ? 67   LEU B N     1 
ATOM   3258  C  CA    . LEU C  1 68  ? -11.343 -50.207 7.624   1.00 38.20 ? 67   LEU B CA    1 
ATOM   3259  C  C     . LEU C  1 68  ? -9.957  -50.811 7.520   1.00 38.17 ? 67   LEU B C     1 
ATOM   3260  O  O     . LEU C  1 68  ? -9.594  -51.376 6.484   1.00 37.39 ? 67   LEU B O     1 
ATOM   3261  C  CB    . LEU C  1 68  ? -11.307 -48.728 7.210   1.00 38.12 ? 67   LEU B CB    1 
ATOM   3262  C  CG    . LEU C  1 68  ? -10.798 -48.370 5.808   1.00 38.56 ? 67   LEU B CG    1 
ATOM   3263  C  CD1   . LEU C  1 68  ? -11.813 -48.815 4.754   1.00 35.97 ? 67   LEU B CD1   1 
ATOM   3264  C  CD2   . LEU C  1 68  ? -10.464 -46.854 5.685   1.00 36.48 ? 67   LEU B CD2   1 
ATOM   3265  N  N     . ARG C  1 69  ? -9.187  -50.705 8.603   1.00 38.39 ? 68   ARG B N     1 
ATOM   3266  C  CA    . ARG C  1 69  ? -7.753  -50.997 8.548   1.00 38.21 ? 68   ARG B CA    1 
ATOM   3267  C  C     . ARG C  1 69  ? -7.420  -52.380 7.968   1.00 38.42 ? 68   ARG B C     1 
ATOM   3268  O  O     . ARG C  1 69  ? -6.578  -52.476 7.078   1.00 38.30 ? 68   ARG B O     1 
ATOM   3269  C  CB    . ARG C  1 69  ? -7.084  -50.805 9.923   1.00 38.31 ? 68   ARG B CB    1 
ATOM   3270  C  CG    . ARG C  1 69  ? -5.601  -50.584 9.827   1.00 37.41 ? 68   ARG B CG    1 
ATOM   3271  C  CD    . ARG C  1 69  ? -4.934  -50.302 11.160  1.00 37.12 ? 68   ARG B CD    1 
ATOM   3272  N  NE    . ARG C  1 69  ? -5.562  -49.188 11.853  1.00 36.43 ? 68   ARG B NE    1 
ATOM   3273  C  CZ    . ARG C  1 69  ? -6.382  -49.300 12.886  1.00 36.16 ? 68   ARG B CZ    1 
ATOM   3274  N  NH1   . ARG C  1 69  ? -6.705  -50.489 13.373  1.00 36.10 ? 68   ARG B NH1   1 
ATOM   3275  N  NH2   . ARG C  1 69  ? -6.884  -48.200 13.435  1.00 38.05 ? 68   ARG B NH2   1 
ATOM   3276  N  N     . PRO C  1 70  ? -8.057  -53.451 8.483   1.00 38.44 ? 69   PRO B N     1 
ATOM   3277  C  CA    . PRO C  1 70  ? -7.791  -54.806 8.000   1.00 38.66 ? 69   PRO B CA    1 
ATOM   3278  C  C     . PRO C  1 70  ? -8.072  -55.082 6.530   1.00 38.23 ? 69   PRO B C     1 
ATOM   3279  O  O     . PRO C  1 70  ? -7.582  -56.076 6.018   1.00 37.98 ? 69   PRO B O     1 
ATOM   3280  C  CB    . PRO C  1 70  ? -8.728  -55.683 8.848   1.00 38.29 ? 69   PRO B CB    1 
ATOM   3281  C  CG    . PRO C  1 70  ? -9.002  -54.918 10.016  1.00 38.84 ? 69   PRO B CG    1 
ATOM   3282  C  CD    . PRO C  1 70  ? -9.034  -53.480 9.577   1.00 38.86 ? 69   PRO B CD    1 
ATOM   3283  N  N     . LEU C  1 71  ? -8.864  -54.251 5.860   1.00 37.77 ? 70   LEU B N     1 
ATOM   3284  C  CA    . LEU C  1 71  ? -8.991  -54.382 4.403   1.00 37.52 ? 70   LEU B CA    1 
ATOM   3285  C  C     . LEU C  1 71  ? -7.628  -54.238 3.666   1.00 37.46 ? 70   LEU B C     1 
ATOM   3286  O  O     . LEU C  1 71  ? -7.465  -54.744 2.555   1.00 36.70 ? 70   LEU B O     1 
ATOM   3287  C  CB    . LEU C  1 71  ? -10.018 -53.388 3.854   1.00 37.31 ? 70   LEU B CB    1 
ATOM   3288  C  CG    . LEU C  1 71  ? -11.435 -53.412 4.456   1.00 37.40 ? 70   LEU B CG    1 
ATOM   3289  C  CD1   . LEU C  1 71  ? -12.337 -52.443 3.701   1.00 35.71 ? 70   LEU B CD1   1 
ATOM   3290  C  CD2   . LEU C  1 71  ? -12.038 -54.837 4.455   1.00 37.70 ? 70   LEU B CD2   1 
ATOM   3291  N  N     . SER C  1 72  ? -6.651  -53.573 4.286   1.00 37.31 ? 71   SER B N     1 
ATOM   3292  C  CA    A SER C  1 72  ? -5.311  -53.430 3.687   0.50 37.29 ? 71   SER B CA    1 
ATOM   3293  C  CA    B SER C  1 72  ? -5.320  -53.437 3.679   0.50 37.70 ? 71   SER B CA    1 
ATOM   3294  C  C     . SER C  1 72  ? -4.430  -54.669 3.862   1.00 37.61 ? 71   SER B C     1 
ATOM   3295  O  O     . SER C  1 72  ? -3.379  -54.768 3.232   1.00 37.76 ? 71   SER B O     1 
ATOM   3296  C  CB    A SER C  1 72  ? -4.559  -52.222 4.276   0.50 37.14 ? 71   SER B CB    1 
ATOM   3297  C  CB    B SER C  1 72  ? -4.597  -52.215 4.251   0.50 37.64 ? 71   SER B CB    1 
ATOM   3298  O  OG    A SER C  1 72  ? -5.239  -50.996 4.063   0.50 35.23 ? 71   SER B OG    1 
ATOM   3299  O  OG    B SER C  1 72  ? -4.444  -52.341 5.656   0.50 38.30 ? 71   SER B OG    1 
ATOM   3300  N  N     . TYR C  1 73  ? -4.838  -55.609 4.714   1.00 37.94 ? 72   TYR B N     1 
ATOM   3301  C  CA    . TYR C  1 73  ? -3.918  -56.678 5.162   1.00 38.33 ? 72   TYR B CA    1 
ATOM   3302  C  C     . TYR C  1 73  ? -3.687  -57.875 4.233   1.00 38.31 ? 72   TYR B C     1 
ATOM   3303  O  O     . TYR C  1 73  ? -2.573  -58.378 4.183   1.00 37.94 ? 72   TYR B O     1 
ATOM   3304  C  CB    . TYR C  1 73  ? -4.315  -57.190 6.557   1.00 38.35 ? 72   TYR B CB    1 
ATOM   3305  C  CG    . TYR C  1 73  ? -4.196  -56.173 7.681   1.00 38.41 ? 72   TYR B CG    1 
ATOM   3306  C  CD1   . TYR C  1 73  ? -3.524  -54.959 7.514   1.00 38.46 ? 72   TYR B CD1   1 
ATOM   3307  C  CD2   . TYR C  1 73  ? -4.729  -56.451 8.931   1.00 38.55 ? 72   TYR B CD2   1 
ATOM   3308  C  CE1   . TYR C  1 73  ? -3.421  -54.047 8.550   1.00 38.25 ? 72   TYR B CE1   1 
ATOM   3309  C  CE2   . TYR C  1 73  ? -4.623  -55.557 9.975   1.00 38.91 ? 72   TYR B CE2   1 
ATOM   3310  C  CZ    . TYR C  1 73  ? -3.973  -54.355 9.786   1.00 38.75 ? 72   TYR B CZ    1 
ATOM   3311  O  OH    . TYR C  1 73  ? -3.885  -53.472 10.834  1.00 38.77 ? 72   TYR B OH    1 
ATOM   3312  N  N     . PRO C  1 74  ? -4.731  -58.363 3.536   1.00 38.57 ? 73   PRO B N     1 
ATOM   3313  C  CA    . PRO C  1 74  ? -4.507  -59.473 2.608   1.00 38.77 ? 73   PRO B CA    1 
ATOM   3314  C  C     . PRO C  1 74  ? -3.307  -59.312 1.648   1.00 38.75 ? 73   PRO B C     1 
ATOM   3315  O  O     . PRO C  1 74  ? -3.055  -58.227 1.119   1.00 38.58 ? 73   PRO B O     1 
ATOM   3316  C  CB    . PRO C  1 74  ? -5.835  -59.564 1.850   1.00 39.19 ? 73   PRO B CB    1 
ATOM   3317  C  CG    . PRO C  1 74  ? -6.852  -59.122 2.885   1.00 39.35 ? 73   PRO B CG    1 
ATOM   3318  C  CD    . PRO C  1 74  ? -6.157  -57.984 3.600   1.00 38.79 ? 73   PRO B CD    1 
ATOM   3319  N  N     . GLN C  1 75  ? -2.563  -60.400 1.491   1.00 38.70 ? 74   GLN B N     1 
ATOM   3320  C  CA    . GLN C  1 75  ? -1.380  -60.475 0.629   1.00 39.17 ? 74   GLN B CA    1 
ATOM   3321  C  C     . GLN C  1 75  ? -0.266  -59.440 0.877   1.00 38.30 ? 74   GLN B C     1 
ATOM   3322  O  O     . GLN C  1 75  ? 0.479   -59.100 -0.050  1.00 38.50 ? 74   GLN B O     1 
ATOM   3323  C  CB    . GLN C  1 75  ? -1.797  -60.485 -0.859  1.00 40.10 ? 74   GLN B CB    1 
ATOM   3324  C  CG    . GLN C  1 75  ? -2.432  -61.812 -1.333  1.00 42.29 ? 74   GLN B CG    1 
ATOM   3325  C  CD    . GLN C  1 75  ? -3.939  -61.825 -1.137  1.00 47.09 ? 74   GLN B CD    1 
ATOM   3326  O  OE1   . GLN C  1 75  ? -4.604  -60.806 -1.341  1.00 50.76 ? 74   GLN B OE1   1 
ATOM   3327  N  NE2   . GLN C  1 75  ? -4.490  -62.977 -0.755  1.00 49.07 ? 74   GLN B NE2   1 
ATOM   3328  N  N     . THR C  1 76  ? -0.141  -58.976 2.121   1.00 37.29 ? 75   THR B N     1 
ATOM   3329  C  CA    . THR C  1 76  ? 0.958   -58.095 2.546   1.00 36.50 ? 75   THR B CA    1 
ATOM   3330  C  C     . THR C  1 76  ? 2.271   -58.883 2.593   1.00 36.46 ? 75   THR B C     1 
ATOM   3331  O  O     . THR C  1 76  ? 2.286   -60.032 3.008   1.00 36.15 ? 75   THR B O     1 
ATOM   3332  C  CB    . THR C  1 76  ? 0.663   -57.491 3.926   1.00 36.14 ? 75   THR B CB    1 
ATOM   3333  O  OG1   . THR C  1 76  ? -0.557  -56.729 3.858   1.00 35.58 ? 75   THR B OG1   1 
ATOM   3334  C  CG2   . THR C  1 76  ? 1.795   -56.597 4.404   1.00 34.12 ? 75   THR B CG2   1 
ATOM   3335  N  N     . ASP C  1 77  ? 3.359   -58.253 2.165   1.00 36.28 ? 76   ASP B N     1 
ATOM   3336  C  CA    . ASP C  1 77  ? 4.661   -58.885 2.141   1.00 36.43 ? 76   ASP B CA    1 
ATOM   3337  C  C     . ASP C  1 77  ? 5.452   -58.560 3.400   1.00 36.23 ? 76   ASP B C     1 
ATOM   3338  O  O     . ASP C  1 77  ? 6.250   -59.358 3.851   1.00 36.33 ? 76   ASP B O     1 
ATOM   3339  C  CB    . ASP C  1 77  ? 5.443   -58.453 0.889   1.00 36.64 ? 76   ASP B CB    1 
ATOM   3340  C  CG    . ASP C  1 77  ? 4.830   -58.986 -0.405  1.00 36.64 ? 76   ASP B CG    1 
ATOM   3341  O  OD1   . ASP C  1 77  ? 4.850   -60.220 -0.619  1.00 34.81 ? 76   ASP B OD1   1 
ATOM   3342  O  OD2   . ASP C  1 77  ? 4.318   -58.164 -1.201  1.00 34.79 ? 76   ASP B OD2   1 
ATOM   3343  N  N     . VAL C  1 78  ? 5.206   -57.395 3.981   1.00 36.42 ? 77   VAL B N     1 
ATOM   3344  C  CA    . VAL C  1 78  ? 5.975   -56.938 5.128   1.00 36.09 ? 77   VAL B CA    1 
ATOM   3345  C  C     . VAL C  1 78  ? 5.219   -55.825 5.833   1.00 36.29 ? 77   VAL B C     1 
ATOM   3346  O  O     . VAL C  1 78  ? 4.524   -55.044 5.199   1.00 36.34 ? 77   VAL B O     1 
ATOM   3347  C  CB    . VAL C  1 78  ? 7.390   -56.436 4.683   1.00 36.22 ? 77   VAL B CB    1 
ATOM   3348  C  CG1   . VAL C  1 78  ? 7.266   -55.217 3.751   1.00 34.58 ? 77   VAL B CG1   1 
ATOM   3349  C  CG2   . VAL C  1 78  ? 8.238   -56.134 5.886   1.00 35.20 ? 77   VAL B CG2   1 
ATOM   3350  N  N     . PHE C  1 79  ? 5.342   -55.780 7.153   1.00 36.75 ? 78   PHE B N     1 
ATOM   3351  C  CA    . PHE C  1 79  ? 4.687   -54.747 7.972   1.00 37.08 ? 78   PHE B CA    1 
ATOM   3352  C  C     . PHE C  1 79  ? 5.718   -53.853 8.603   1.00 37.11 ? 78   PHE B C     1 
ATOM   3353  O  O     . PHE C  1 79  ? 6.771   -54.322 9.007   1.00 37.35 ? 78   PHE B O     1 
ATOM   3354  C  CB    . PHE C  1 79  ? 3.843   -55.382 9.092   1.00 36.88 ? 78   PHE B CB    1 
ATOM   3355  C  CG    . PHE C  1 79  ? 2.494   -55.842 8.628   1.00 37.21 ? 78   PHE B CG    1 
ATOM   3356  C  CD1   . PHE C  1 79  ? 2.302   -57.149 8.182   1.00 36.99 ? 78   PHE B CD1   1 
ATOM   3357  C  CD2   . PHE C  1 79  ? 1.428   -54.963 8.605   1.00 36.42 ? 78   PHE B CD2   1 
ATOM   3358  C  CE1   . PHE C  1 79  ? 1.065   -57.565 7.736   1.00 36.69 ? 78   PHE B CE1   1 
ATOM   3359  C  CE2   . PHE C  1 79  ? 0.184   -55.379 8.160   1.00 36.47 ? 78   PHE B CE2   1 
ATOM   3360  C  CZ    . PHE C  1 79  ? 0.005   -56.680 7.721   1.00 36.35 ? 78   PHE B CZ    1 
ATOM   3361  N  N     . LEU C  1 80  ? 5.411   -52.565 8.675   1.00 36.93 ? 79   LEU B N     1 
ATOM   3362  C  CA    . LEU C  1 80  ? 6.111   -51.677 9.561   1.00 36.30 ? 79   LEU B CA    1 
ATOM   3363  C  C     . LEU C  1 80  ? 5.154   -51.304 10.680  1.00 36.57 ? 79   LEU B C     1 
ATOM   3364  O  O     . LEU C  1 80  ? 4.159   -50.633 10.447  1.00 36.73 ? 79   LEU B O     1 
ATOM   3365  C  CB    . LEU C  1 80  ? 6.572   -50.415 8.839   1.00 36.49 ? 79   LEU B CB    1 
ATOM   3366  C  CG    . LEU C  1 80  ? 7.326   -50.489 7.522   1.00 34.92 ? 79   LEU B CG    1 
ATOM   3367  C  CD1   . LEU C  1 80  ? 7.707   -49.076 7.093   1.00 30.40 ? 79   LEU B CD1   1 
ATOM   3368  C  CD2   . LEU C  1 80  ? 8.556   -51.441 7.609   1.00 34.40 ? 79   LEU B CD2   1 
ATOM   3369  N  N     . ILE C  1 81  ? 5.441   -51.754 11.897  1.00 36.58 ? 80   ILE B N     1 
ATOM   3370  C  CA    . ILE C  1 81  ? 4.743   -51.244 13.070  1.00 36.36 ? 80   ILE B CA    1 
ATOM   3371  C  C     . ILE C  1 81  ? 5.583   -50.088 13.610  1.00 37.07 ? 80   ILE B C     1 
ATOM   3372  O  O     . ILE C  1 81  ? 6.751   -50.284 14.015  1.00 37.13 ? 80   ILE B O     1 
ATOM   3373  C  CB    . ILE C  1 81  ? 4.535   -52.333 14.149  1.00 36.26 ? 80   ILE B CB    1 
ATOM   3374  C  CG1   . ILE C  1 81  ? 3.649   -53.461 13.613  1.00 36.12 ? 80   ILE B CG1   1 
ATOM   3375  C  CG2   . ILE C  1 81  ? 3.921   -51.738 15.386  1.00 35.53 ? 80   ILE B CG2   1 
ATOM   3376  C  CD1   . ILE C  1 81  ? 3.343   -54.587 14.637  1.00 36.30 ? 80   ILE B CD1   1 
ATOM   3377  N  N     . CYS C  1 82  ? 5.012   -48.889 13.597  1.00 37.28 ? 81   CYS B N     1 
ATOM   3378  C  CA    . CYS C  1 82  ? 5.727   -47.683 14.022  1.00 37.77 ? 81   CYS B CA    1 
ATOM   3379  C  C     . CYS C  1 82  ? 5.221   -47.139 15.369  1.00 37.47 ? 81   CYS B C     1 
ATOM   3380  O  O     . CYS C  1 82  ? 4.044   -47.255 15.714  1.00 37.61 ? 81   CYS B O     1 
ATOM   3381  C  CB    . CYS C  1 82  ? 5.569   -46.575 12.969  1.00 38.41 ? 81   CYS B CB    1 
ATOM   3382  S  SG    . CYS C  1 82  ? 5.907   -47.067 11.278  1.00 40.61 ? 81   CYS B SG    1 
ATOM   3383  N  N     . PHE C  1 83  ? 6.116   -46.514 16.114  1.00 36.85 ? 82   PHE B N     1 
ATOM   3384  C  CA    . PHE C  1 83  ? 5.733   -45.772 17.312  1.00 36.15 ? 82   PHE B CA    1 
ATOM   3385  C  C     . PHE C  1 83  ? 6.678   -44.594 17.414  1.00 35.83 ? 82   PHE B C     1 
ATOM   3386  O  O     . PHE C  1 83  ? 7.801   -44.666 16.911  1.00 35.39 ? 82   PHE B O     1 
ATOM   3387  C  CB    . PHE C  1 83  ? 5.868   -46.658 18.554  1.00 35.94 ? 82   PHE B CB    1 
ATOM   3388  C  CG    . PHE C  1 83  ? 7.274   -46.988 18.894  1.00 35.62 ? 82   PHE B CG    1 
ATOM   3389  C  CD1   . PHE C  1 83  ? 7.919   -48.044 18.266  1.00 35.40 ? 82   PHE B CD1   1 
ATOM   3390  C  CD2   . PHE C  1 83  ? 7.969   -46.232 19.825  1.00 35.23 ? 82   PHE B CD2   1 
ATOM   3391  C  CE1   . PHE C  1 83  ? 9.241   -48.339 18.563  1.00 35.22 ? 82   PHE B CE1   1 
ATOM   3392  C  CE2   . PHE C  1 83  ? 9.273   -46.515 20.135  1.00 35.84 ? 82   PHE B CE2   1 
ATOM   3393  C  CZ    . PHE C  1 83  ? 9.920   -47.581 19.502  1.00 36.20 ? 82   PHE B CZ    1 
ATOM   3394  N  N     . SER C  1 84  ? 6.232   -43.523 18.063  1.00 35.78 ? 83   SER B N     1 
ATOM   3395  C  CA    . SER C  1 84  ? 7.087   -42.351 18.266  1.00 35.81 ? 83   SER B CA    1 
ATOM   3396  C  C     . SER C  1 84  ? 8.069   -42.606 19.393  1.00 35.88 ? 83   SER B C     1 
ATOM   3397  O  O     . SER C  1 84  ? 7.693   -43.049 20.457  1.00 36.09 ? 83   SER B O     1 
ATOM   3398  C  CB    . SER C  1 84  ? 6.248   -41.107 18.585  1.00 35.60 ? 83   SER B CB    1 
ATOM   3399  O  OG    . SER C  1 84  ? 7.102   -40.014 18.931  1.00 34.01 ? 83   SER B OG    1 
ATOM   3400  N  N     . LEU C  1 85  ? 9.333   -42.305 19.165  1.00 36.44 ? 84   LEU B N     1 
ATOM   3401  C  CA    . LEU C  1 85  ? 10.356  -42.452 20.195  1.00 35.98 ? 84   LEU B CA    1 
ATOM   3402  C  C     . LEU C  1 85  ? 10.070  -41.561 21.410  1.00 35.80 ? 84   LEU B C     1 
ATOM   3403  O  O     . LEU C  1 85  ? 10.597  -41.785 22.510  1.00 36.15 ? 84   LEU B O     1 
ATOM   3404  C  CB    . LEU C  1 85  ? 11.752  -42.142 19.598  1.00 36.21 ? 84   LEU B CB    1 
ATOM   3405  C  CG    . LEU C  1 85  ? 12.402  -43.250 18.751  1.00 35.89 ? 84   LEU B CG    1 
ATOM   3406  C  CD1   . LEU C  1 85  ? 13.663  -42.768 17.981  1.00 36.48 ? 84   LEU B CD1   1 
ATOM   3407  C  CD2   . LEU C  1 85  ? 12.730  -44.466 19.632  1.00 35.28 ? 84   LEU B CD2   1 
ATOM   3408  N  N     . VAL C  1 86  ? 9.236   -40.550 21.222  1.00 35.37 ? 85   VAL B N     1 
ATOM   3409  C  CA    . VAL C  1 86  ? 8.860   -39.654 22.316  1.00 35.26 ? 85   VAL B CA    1 
ATOM   3410  C  C     . VAL C  1 86  ? 7.381   -39.794 22.739  1.00 36.00 ? 85   VAL B C     1 
ATOM   3411  O  O     . VAL C  1 86  ? 6.830   -38.911 23.411  1.00 37.13 ? 85   VAL B O     1 
ATOM   3412  C  CB    . VAL C  1 86  ? 9.281   -38.177 21.980  1.00 35.41 ? 85   VAL B CB    1 
ATOM   3413  C  CG1   . VAL C  1 86  ? 10.830  -38.103 21.849  1.00 33.29 ? 85   VAL B CG1   1 
ATOM   3414  C  CG2   . VAL C  1 86  ? 8.616   -37.644 20.703  1.00 32.88 ? 85   VAL B CG2   1 
ATOM   3415  N  N     . SER C  1 87  ? 6.753   -40.917 22.382  1.00 36.48 ? 86   SER B N     1 
ATOM   3416  C  CA    . SER C  1 87  ? 5.427   -41.295 22.932  1.00 36.74 ? 86   SER B CA    1 
ATOM   3417  C  C     . SER C  1 87  ? 5.425   -42.724 23.496  1.00 37.03 ? 86   SER B C     1 
ATOM   3418  O  O     . SER C  1 87  ? 5.110   -43.670 22.793  1.00 36.31 ? 86   SER B O     1 
ATOM   3419  C  CB    . SER C  1 87  ? 4.324   -41.167 21.901  1.00 36.90 ? 86   SER B CB    1 
ATOM   3420  O  OG    . SER C  1 87  ? 3.060   -41.430 22.515  1.00 37.30 ? 86   SER B OG    1 
ATOM   3421  N  N     . PRO C  1 88  ? 5.784   -42.870 24.787  1.00 37.31 ? 87   PRO B N     1 
ATOM   3422  C  CA    . PRO C  1 88  ? 5.672   -44.153 25.494  1.00 36.88 ? 87   PRO B CA    1 
ATOM   3423  C  C     . PRO C  1 88  ? 4.318   -44.823 25.354  1.00 36.53 ? 87   PRO B C     1 
ATOM   3424  O  O     . PRO C  1 88  ? 4.251   -46.049 25.379  1.00 36.12 ? 87   PRO B O     1 
ATOM   3425  C  CB    . PRO C  1 88  ? 5.953   -43.774 26.947  1.00 36.30 ? 87   PRO B CB    1 
ATOM   3426  C  CG    . PRO C  1 88  ? 6.930   -42.635 26.822  1.00 37.76 ? 87   PRO B CG    1 
ATOM   3427  C  CD    . PRO C  1 88  ? 6.372   -41.828 25.655  1.00 37.69 ? 87   PRO B CD    1 
ATOM   3428  N  N     . ALA C  1 89  ? 3.246   -44.031 25.220  1.00 36.42 ? 88   ALA B N     1 
ATOM   3429  C  CA    . ALA C  1 89  ? 1.923   -44.594 25.012  1.00 36.36 ? 88   ALA B CA    1 
ATOM   3430  C  C     . ALA C  1 89  ? 1.880   -45.370 23.705  1.00 35.96 ? 88   ALA B C     1 
ATOM   3431  O  O     . ALA C  1 89  ? 1.378   -46.486 23.664  1.00 35.96 ? 88   ALA B O     1 
ATOM   3432  C  CB    . ALA C  1 89  ? 0.832   -43.482 25.038  1.00 36.64 ? 88   ALA B CB    1 
ATOM   3433  N  N     . SER C  1 90  ? 2.419   -44.772 22.648  1.00 36.41 ? 89   SER B N     1 
ATOM   3434  C  CA    . SER C  1 90  ? 2.432   -45.368 21.304  1.00 36.27 ? 89   SER B CA    1 
ATOM   3435  C  C     . SER C  1 90  ? 3.320   -46.611 21.241  1.00 36.59 ? 89   SER B C     1 
ATOM   3436  O  O     . SER C  1 90  ? 3.049   -47.547 20.481  1.00 35.91 ? 89   SER B O     1 
ATOM   3437  C  CB    . SER C  1 90  ? 2.868   -44.332 20.247  1.00 35.94 ? 89   SER B CB    1 
ATOM   3438  O  OG    . SER C  1 90  ? 4.274   -44.123 20.211  1.00 35.75 ? 89   SER B OG    1 
ATOM   3439  N  N     . PHE C  1 91  ? 4.376   -46.597 22.052  1.00 36.85 ? 90   PHE B N     1 
ATOM   3440  C  CA    . PHE C  1 91  ? 5.287   -47.728 22.234  1.00 37.10 ? 90   PHE B CA    1 
ATOM   3441  C  C     . PHE C  1 91  ? 4.594   -48.916 22.915  1.00 38.21 ? 90   PHE B C     1 
ATOM   3442  O  O     . PHE C  1 91  ? 4.677   -50.049 22.440  1.00 39.50 ? 90   PHE B O     1 
ATOM   3443  C  CB    . PHE C  1 91  ? 6.469   -47.260 23.078  1.00 37.23 ? 90   PHE B CB    1 
ATOM   3444  C  CG    . PHE C  1 91  ? 7.547   -48.299 23.286  1.00 36.03 ? 90   PHE B CG    1 
ATOM   3445  C  CD1   . PHE C  1 91  ? 8.146   -48.929 22.206  1.00 37.28 ? 90   PHE B CD1   1 
ATOM   3446  C  CD2   . PHE C  1 91  ? 7.974   -48.622 24.574  1.00 36.53 ? 90   PHE B CD2   1 
ATOM   3447  C  CE1   . PHE C  1 91  ? 9.147   -49.874 22.394  1.00 37.22 ? 90   PHE B CE1   1 
ATOM   3448  C  CE2   . PHE C  1 91  ? 8.974   -49.570 24.777  1.00 36.67 ? 90   PHE B CE2   1 
ATOM   3449  C  CZ    . PHE C  1 91  ? 9.563   -50.188 23.679  1.00 37.14 ? 90   PHE B CZ    1 
ATOM   3450  N  N     . GLU C  1 92  ? 3.925   -48.658 24.029  1.00 39.46 ? 91   GLU B N     1 
ATOM   3451  C  CA    . GLU C  1 92  ? 3.092   -49.666 24.734  1.00 40.48 ? 91   GLU B CA    1 
ATOM   3452  C  C     . GLU C  1 92  ? 2.043   -50.301 23.821  1.00 39.91 ? 91   GLU B C     1 
ATOM   3453  O  O     . GLU C  1 92  ? 1.795   -51.507 23.900  1.00 40.25 ? 91   GLU B O     1 
ATOM   3454  C  CB    . GLU C  1 92  ? 2.384   -49.045 25.945  1.00 39.98 ? 91   GLU B CB    1 
ATOM   3455  C  CG    . GLU C  1 92  ? 3.315   -48.839 27.158  1.00 43.24 ? 91   GLU B CG    1 
ATOM   3456  C  CD    . GLU C  1 92  ? 2.665   -48.073 28.330  1.00 43.60 ? 91   GLU B CD    1 
ATOM   3457  O  OE1   . GLU C  1 92  ? 1.450   -47.769 28.288  1.00 49.27 ? 91   GLU B OE1   1 
ATOM   3458  O  OE2   . GLU C  1 92  ? 3.392   -47.772 29.306  1.00 49.41 ? 91   GLU B OE2   1 
ATOM   3459  N  N     . ASN C  1 93  ? 1.443   -49.497 22.946  1.00 39.62 ? 92   ASN B N     1 
ATOM   3460  C  CA    . ASN C  1 93  ? 0.469   -50.021 21.983  1.00 39.65 ? 92   ASN B CA    1 
ATOM   3461  C  C     . ASN C  1 93  ? 1.036   -50.916 20.883  1.00 38.77 ? 92   ASN B C     1 
ATOM   3462  O  O     . ASN C  1 93  ? 0.284   -51.592 20.201  1.00 39.14 ? 92   ASN B O     1 
ATOM   3463  C  CB    . ASN C  1 93  ? -0.357  -48.886 21.399  1.00 39.91 ? 92   ASN B CB    1 
ATOM   3464  C  CG    . ASN C  1 93  ? -1.401  -48.395 22.368  1.00 42.18 ? 92   ASN B CG    1 
ATOM   3465  O  OD1   . ASN C  1 93  ? -1.951  -49.187 23.140  1.00 46.22 ? 92   ASN B OD1   1 
ATOM   3466  N  ND2   . ASN C  1 93  ? -1.684  -47.086 22.350  1.00 44.33 ? 92   ASN B ND2   1 
ATOM   3467  N  N     . VAL C  1 94  ? 2.350   -50.921 20.704  1.00 38.83 ? 93   VAL B N     1 
ATOM   3468  C  CA    . VAL C  1 94  ? 2.978   -51.908 19.828  1.00 38.49 ? 93   VAL B CA    1 
ATOM   3469  C  C     . VAL C  1 94  ? 2.617   -53.317 20.282  1.00 38.83 ? 93   VAL B C     1 
ATOM   3470  O  O     . VAL C  1 94  ? 2.219   -54.160 19.481  1.00 38.79 ? 93   VAL B O     1 
ATOM   3471  C  CB    . VAL C  1 94  ? 4.501   -51.759 19.787  1.00 38.92 ? 93   VAL B CB    1 
ATOM   3472  C  CG1   . VAL C  1 94  ? 5.132   -52.930 19.031  1.00 37.06 ? 93   VAL B CG1   1 
ATOM   3473  C  CG2   . VAL C  1 94  ? 4.889   -50.430 19.172  1.00 37.33 ? 93   VAL B CG2   1 
ATOM   3474  N  N     . ARG C  1 95  ? 2.722   -53.568 21.577  1.00 39.43 ? 94   ARG B N     1 
ATOM   3475  C  CA    . ARG C  1 95  ? 2.370   -54.878 22.113  1.00 39.90 ? 94   ARG B CA    1 
ATOM   3476  C  C     . ARG C  1 95  ? 0.876   -55.015 22.437  1.00 39.36 ? 94   ARG B C     1 
ATOM   3477  O  O     . ARG C  1 95  ? 0.296   -56.083 22.244  1.00 39.02 ? 94   ARG B O     1 
ATOM   3478  C  CB    . ARG C  1 95  ? 3.181   -55.166 23.364  1.00 40.97 ? 94   ARG B CB    1 
ATOM   3479  C  CG    . ARG C  1 95  ? 2.860   -56.501 24.016  1.00 44.04 ? 94   ARG B CG    1 
ATOM   3480  C  CD    . ARG C  1 95  ? 3.039   -56.415 25.514  1.00 49.75 ? 94   ARG B CD    1 
ATOM   3481  N  NE    . ARG C  1 95  ? 4.397   -56.760 25.912  1.00 51.80 ? 94   ARG B NE    1 
ATOM   3482  C  CZ    . ARG C  1 95  ? 5.024   -56.279 26.984  1.00 52.37 ? 94   ARG B CZ    1 
ATOM   3483  N  NH1   . ARG C  1 95  ? 4.447   -55.385 27.796  1.00 52.46 ? 94   ARG B NH1   1 
ATOM   3484  N  NH2   . ARG C  1 95  ? 6.265   -56.686 27.219  1.00 52.80 ? 94   ARG B NH2   1 
ATOM   3485  N  N     . ALA C  1 96  ? 0.253   -53.956 22.941  1.00 38.57 ? 95   ALA B N     1 
ATOM   3486  C  CA    . ALA C  1 96  ? -1.137  -54.060 23.352  1.00 38.08 ? 95   ALA B CA    1 
ATOM   3487  C  C     . ALA C  1 96  ? -2.084  -54.153 22.155  1.00 38.31 ? 95   ALA B C     1 
ATOM   3488  O  O     . ALA C  1 96  ? -3.119  -54.833 22.240  1.00 38.65 ? 95   ALA B O     1 
ATOM   3489  C  CB    . ALA C  1 96  ? -1.527  -52.898 24.284  1.00 37.57 ? 95   ALA B CB    1 
ATOM   3490  N  N     . LYS C  1 97  ? -1.750  -53.496 21.046  1.00 37.89 ? 96   LYS B N     1 
ATOM   3491  C  CA    . LYS C  1 97  ? -2.710  -53.374 19.924  1.00 37.80 ? 96   LYS B CA    1 
ATOM   3492  C  C     . LYS C  1 97  ? -2.182  -53.879 18.576  1.00 37.52 ? 96   LYS B C     1 
ATOM   3493  O  O     . LYS C  1 97  ? -2.792  -54.746 17.959  1.00 37.16 ? 96   LYS B O     1 
ATOM   3494  C  CB    . LYS C  1 97  ? -3.213  -51.934 19.756  1.00 37.38 ? 96   LYS B CB    1 
ATOM   3495  C  CG    . LYS C  1 97  ? -4.213  -51.802 18.597  1.00 38.04 ? 96   LYS B CG    1 
ATOM   3496  C  CD    . LYS C  1 97  ? -5.041  -50.508 18.585  1.00 38.17 ? 96   LYS B CD    1 
ATOM   3497  C  CE    . LYS C  1 97  ? -5.851  -50.433 17.292  1.00 38.30 ? 96   LYS B CE    1 
ATOM   3498  N  NZ    . LYS C  1 97  ? -6.685  -49.194 17.131  1.00 39.61 ? 96   LYS B NZ    1 
ATOM   3499  N  N     . TRP C  1 98  ? -1.071  -53.313 18.119  1.00 37.77 ? 97   TRP B N     1 
ATOM   3500  C  CA    . TRP C  1 98  ? -0.658  -53.473 16.718  1.00 37.78 ? 97   TRP B CA    1 
ATOM   3501  C  C     . TRP C  1 98  ? -0.115  -54.857 16.404  1.00 37.87 ? 97   TRP B C     1 
ATOM   3502  O  O     . TRP C  1 98  ? -0.496  -55.468 15.412  1.00 37.66 ? 97   TRP B O     1 
ATOM   3503  C  CB    . TRP C  1 98  ? 0.330   -52.384 16.305  1.00 37.37 ? 97   TRP B CB    1 
ATOM   3504  C  CG    . TRP C  1 98  ? -0.247  -51.041 16.495  1.00 35.72 ? 97   TRP B CG    1 
ATOM   3505  C  CD1   . TRP C  1 98  ? 0.159   -50.086 17.385  1.00 35.89 ? 97   TRP B CD1   1 
ATOM   3506  C  CD2   . TRP C  1 98  ? -1.385  -50.512 15.824  1.00 36.14 ? 97   TRP B CD2   1 
ATOM   3507  N  NE1   . TRP C  1 98  ? -0.661  -48.980 17.299  1.00 36.15 ? 97   TRP B NE1   1 
ATOM   3508  C  CE2   . TRP C  1 98  ? -1.620  -49.219 16.351  1.00 36.29 ? 97   TRP B CE2   1 
ATOM   3509  C  CE3   . TRP C  1 98  ? -2.244  -51.008 14.835  1.00 35.15 ? 97   TRP B CE3   1 
ATOM   3510  C  CZ2   . TRP C  1 98  ? -2.654  -48.405 15.890  1.00 37.00 ? 97   TRP B CZ2   1 
ATOM   3511  C  CZ3   . TRP C  1 98  ? -3.274  -50.213 14.397  1.00 36.32 ? 97   TRP B CZ3   1 
ATOM   3512  C  CH2   . TRP C  1 98  ? -3.487  -48.929 14.929  1.00 35.75 ? 97   TRP B CH2   1 
ATOM   3513  N  N     . TYR C  1 99  ? 0.749   -55.370 17.255  1.00 38.56 ? 98   TYR B N     1 
ATOM   3514  C  CA    . TYR C  1 99  ? 1.245   -56.725 17.068  1.00 38.72 ? 98   TYR B CA    1 
ATOM   3515  C  C     . TYR C  1 99  ? 0.100   -57.764 16.987  1.00 38.77 ? 98   TYR B C     1 
ATOM   3516  O  O     . TYR C  1 99  ? 0.025   -58.515 16.018  1.00 38.62 ? 98   TYR B O     1 
ATOM   3517  C  CB    . TYR C  1 99  ? 2.271   -57.049 18.151  1.00 39.49 ? 98   TYR B CB    1 
ATOM   3518  C  CG    . TYR C  1 99  ? 2.668   -58.505 18.289  1.00 40.59 ? 98   TYR B CG    1 
ATOM   3519  C  CD1   . TYR C  1 99  ? 3.282   -59.186 17.244  1.00 41.81 ? 98   TYR B CD1   1 
ATOM   3520  C  CD2   . TYR C  1 99  ? 2.478   -59.182 19.487  1.00 41.85 ? 98   TYR B CD2   1 
ATOM   3521  C  CE1   . TYR C  1 99  ? 3.680   -60.503 17.387  1.00 41.72 ? 98   TYR B CE1   1 
ATOM   3522  C  CE2   . TYR C  1 99  ? 2.866   -60.497 19.638  1.00 42.31 ? 98   TYR B CE2   1 
ATOM   3523  C  CZ    . TYR C  1 99  ? 3.469   -61.157 18.592  1.00 41.59 ? 98   TYR B CZ    1 
ATOM   3524  O  OH    . TYR C  1 99  ? 3.855   -62.480 18.757  1.00 41.92 ? 98   TYR B OH    1 
ATOM   3525  N  N     . PRO C  1 100 ? -0.789  -57.813 17.999  1.00 38.91 ? 99   PRO B N     1 
ATOM   3526  C  CA    . PRO C  1 100 ? -1.962  -58.699 17.952  1.00 38.82 ? 99   PRO B CA    1 
ATOM   3527  C  C     . PRO C  1 100 ? -2.895  -58.538 16.740  1.00 38.88 ? 99   PRO B C     1 
ATOM   3528  O  O     . PRO C  1 100 ? -3.353  -59.535 16.175  1.00 38.02 ? 99   PRO B O     1 
ATOM   3529  C  CB    . PRO C  1 100 ? -2.731  -58.334 19.231  1.00 38.90 ? 99   PRO B CB    1 
ATOM   3530  C  CG    . PRO C  1 100 ? -1.734  -57.747 20.142  1.00 39.08 ? 99   PRO B CG    1 
ATOM   3531  C  CD    . PRO C  1 100 ? -0.690  -57.096 19.288  1.00 39.02 ? 99   PRO B CD    1 
ATOM   3532  N  N     . GLU C  1 101 ? -3.206  -57.292 16.372  1.00 39.27 ? 100  GLU B N     1 
ATOM   3533  C  CA    . GLU C  1 101 ? -4.068  -57.026 15.221  1.00 39.25 ? 100  GLU B CA    1 
ATOM   3534  C  C     . GLU C  1 101 ? -3.433  -57.595 13.959  1.00 39.12 ? 100  GLU B C     1 
ATOM   3535  O  O     . GLU C  1 101 ? -4.057  -58.344 13.225  1.00 39.35 ? 100  GLU B O     1 
ATOM   3536  C  CB    . GLU C  1 101 ? -4.337  -55.523 15.035  1.00 39.18 ? 100  GLU B CB    1 
ATOM   3537  C  CG    . GLU C  1 101 ? -5.189  -55.253 13.795  1.00 39.08 ? 100  GLU B CG    1 
ATOM   3538  C  CD    . GLU C  1 101 ? -5.798  -53.869 13.765  1.00 39.48 ? 100  GLU B CD    1 
ATOM   3539  O  OE1   . GLU C  1 101 ? -6.378  -53.441 14.793  1.00 39.72 ? 100  GLU B OE1   1 
ATOM   3540  O  OE2   . GLU C  1 101 ? -5.705  -53.214 12.699  1.00 38.47 ? 100  GLU B OE2   1 
ATOM   3541  N  N     . VAL C  1 102 ? -2.184  -57.241 13.722  1.00 39.47 ? 101  VAL B N     1 
ATOM   3542  C  CA    . VAL C  1 102 ? -1.473  -57.703 12.527  1.00 39.36 ? 101  VAL B CA    1 
ATOM   3543  C  C     . VAL C  1 102 ? -1.409  -59.226 12.465  1.00 39.46 ? 101  VAL B C     1 
ATOM   3544  O  O     . VAL C  1 102 ? -1.736  -59.815 11.433  1.00 38.70 ? 101  VAL B O     1 
ATOM   3545  C  CB    . VAL C  1 102 ? -0.071  -57.068 12.450  1.00 39.47 ? 101  VAL B CB    1 
ATOM   3546  C  CG1   . VAL C  1 102 ? 0.848   -57.875 11.584  1.00 39.15 ? 101  VAL B CG1   1 
ATOM   3547  C  CG2   . VAL C  1 102 ? -0.189  -55.612 11.940  1.00 38.88 ? 101  VAL B CG2   1 
ATOM   3548  N  N     . ARG C  1 103 ? -1.029  -59.853 13.582  1.00 39.68 ? 102  ARG B N     1 
ATOM   3549  C  CA    . ARG C  1 103 ? -0.845  -61.295 13.635  1.00 39.82 ? 102  ARG B CA    1 
ATOM   3550  C  C     . ARG C  1 103 ? -2.185  -62.044 13.560  1.00 39.87 ? 102  ARG B C     1 
ATOM   3551  O  O     . ARG C  1 103 ? -2.250  -63.174 13.059  1.00 40.10 ? 102  ARG B O     1 
ATOM   3552  C  CB    . ARG C  1 103 ? -0.035  -61.705 14.872  1.00 39.90 ? 102  ARG B CB    1 
ATOM   3553  C  CG    . ARG C  1 103 ? 1.490   -61.484 14.723  1.00 40.54 ? 102  ARG B CG    1 
ATOM   3554  C  CD    . ARG C  1 103 ? 2.155   -62.644 13.971  1.00 40.61 ? 102  ARG B CD    1 
ATOM   3555  N  NE    . ARG C  1 103 ? 3.583   -62.439 13.679  1.00 39.33 ? 102  ARG B NE    1 
ATOM   3556  C  CZ    . ARG C  1 103 ? 4.062   -61.931 12.545  1.00 38.84 ? 102  ARG B CZ    1 
ATOM   3557  N  NH1   . ARG C  1 103 ? 3.243   -61.581 11.556  1.00 38.51 ? 102  ARG B NH1   1 
ATOM   3558  N  NH2   . ARG C  1 103 ? 5.371   -61.787 12.388  1.00 40.65 ? 102  ARG B NH2   1 
ATOM   3559  N  N     . HIS C  1 104 ? -3.256  -61.416 14.020  1.00 39.72 ? 103  HIS B N     1 
ATOM   3560  C  CA    . HIS C  1 104 ? -4.581  -62.011 13.862  1.00 40.02 ? 103  HIS B CA    1 
ATOM   3561  C  C     . HIS C  1 104 ? -4.918  -62.255 12.373  1.00 39.78 ? 103  HIS B C     1 
ATOM   3562  O  O     . HIS C  1 104 ? -5.460  -63.294 12.024  1.00 39.12 ? 103  HIS B O     1 
ATOM   3563  C  CB    . HIS C  1 104 ? -5.660  -61.136 14.514  1.00 40.22 ? 103  HIS B CB    1 
ATOM   3564  C  CG    . HIS C  1 104 ? -7.041  -61.691 14.372  1.00 41.48 ? 103  HIS B CG    1 
ATOM   3565  N  ND1   . HIS C  1 104 ? -7.478  -62.788 15.085  1.00 42.88 ? 103  HIS B ND1   1 
ATOM   3566  C  CD2   . HIS C  1 104 ? -8.078  -61.319 13.581  1.00 43.49 ? 103  HIS B CD2   1 
ATOM   3567  C  CE1   . HIS C  1 104 ? -8.727  -63.062 14.745  1.00 42.81 ? 103  HIS B CE1   1 
ATOM   3568  N  NE2   . HIS C  1 104 ? -9.115  -62.187 13.833  1.00 43.57 ? 103  HIS B NE2   1 
ATOM   3569  N  N     . HIS C  1 105 ? -4.571  -61.300 11.510  1.00 39.55 ? 104  HIS B N     1 
ATOM   3570  C  CA    . HIS C  1 105 ? -4.874  -61.394 10.072  1.00 39.50 ? 104  HIS B CA    1 
ATOM   3571  C  C     . HIS C  1 105 ? -3.763  -62.020 9.241   1.00 39.41 ? 104  HIS B C     1 
ATOM   3572  O  O     . HIS C  1 105 ? -4.041  -62.666 8.233   1.00 39.62 ? 104  HIS B O     1 
ATOM   3573  C  CB    . HIS C  1 105 ? -5.178  -59.996 9.528   1.00 39.78 ? 104  HIS B CB    1 
ATOM   3574  C  CG    . HIS C  1 105 ? -6.419  -59.399 10.114  1.00 39.28 ? 104  HIS B CG    1 
ATOM   3575  N  ND1   . HIS C  1 105 ? -6.392  -58.583 11.224  1.00 39.47 ? 104  HIS B ND1   1 
ATOM   3576  C  CD2   . HIS C  1 105 ? -7.722  -59.540 9.779   1.00 38.10 ? 104  HIS B CD2   1 
ATOM   3577  C  CE1   . HIS C  1 105 ? -7.624  -58.224 11.528  1.00 38.74 ? 104  HIS B CE1   1 
ATOM   3578  N  NE2   . HIS C  1 105 ? -8.452  -58.798 10.672  1.00 38.13 ? 104  HIS B NE2   1 
ATOM   3579  N  N     . CYS C  1 106 ? -2.521  -61.829 9.685   1.00 38.84 ? 105  CYS B N     1 
ATOM   3580  C  CA    . CYS C  1 106 ? -1.326  -62.176 8.927   1.00 39.18 ? 105  CYS B CA    1 
ATOM   3581  C  C     . CYS C  1 106 ? -0.316  -62.908 9.833   1.00 38.55 ? 105  CYS B C     1 
ATOM   3582  O  O     . CYS C  1 106 ? 0.685   -62.326 10.247  1.00 38.38 ? 105  CYS B O     1 
ATOM   3583  C  CB    . CYS C  1 106 ? -0.706  -60.895 8.347   1.00 38.76 ? 105  CYS B CB    1 
ATOM   3584  S  SG    . CYS C  1 106 ? -1.731  -60.000 7.129   1.00 41.75 ? 105  CYS B SG    1 
ATOM   3585  N  N     . PRO C  1 107 ? -0.580  -64.194 10.139  1.00 38.25 ? 106  PRO B N     1 
ATOM   3586  C  CA    . PRO C  1 107 ? 0.219   -64.922 11.141  1.00 38.09 ? 106  PRO B CA    1 
ATOM   3587  C  C     . PRO C  1 107 ? 1.730   -65.001 10.891  1.00 37.93 ? 106  PRO B C     1 
ATOM   3588  O  O     . PRO C  1 107 ? 2.493   -65.072 11.856  1.00 38.12 ? 106  PRO B O     1 
ATOM   3589  C  CB    . PRO C  1 107 ? -0.375  -66.341 11.123  1.00 38.02 ? 106  PRO B CB    1 
ATOM   3590  C  CG    . PRO C  1 107 ? -1.695  -66.230 10.435  1.00 38.42 ? 106  PRO B CG    1 
ATOM   3591  C  CD    . PRO C  1 107 ? -1.643  -65.032 9.548   1.00 38.14 ? 106  PRO B CD    1 
ATOM   3592  N  N     . HIS C  1 108 ? 2.163   -64.998 9.633   1.00 37.70 ? 107  HIS B N     1 
ATOM   3593  C  CA    . HIS C  1 108 ? 3.575   -65.299 9.306   1.00 37.95 ? 107  HIS B CA    1 
ATOM   3594  C  C     . HIS C  1 108 ? 4.331   -64.210 8.535   1.00 37.51 ? 107  HIS B C     1 
ATOM   3595  O  O     . HIS C  1 108 ? 5.505   -64.360 8.236   1.00 38.10 ? 107  HIS B O     1 
ATOM   3596  C  CB    . HIS C  1 108 ? 3.641   -66.621 8.532   1.00 38.39 ? 107  HIS B CB    1 
ATOM   3597  C  CG    . HIS C  1 108 ? 3.138   -67.791 9.317   1.00 39.62 ? 107  HIS B CG    1 
ATOM   3598  N  ND1   . HIS C  1 108 ? 3.743   -68.214 10.482  1.00 40.49 ? 107  HIS B ND1   1 
ATOM   3599  C  CD2   . HIS C  1 108 ? 2.068   -68.599 9.133   1.00 40.19 ? 107  HIS B CD2   1 
ATOM   3600  C  CE1   . HIS C  1 108 ? 3.073   -69.240 10.976  1.00 40.24 ? 107  HIS B CE1   1 
ATOM   3601  N  NE2   . HIS C  1 108 ? 2.054   -69.495 10.176  1.00 40.66 ? 107  HIS B NE2   1 
ATOM   3602  N  N     . THR C  1 109 ? 3.661   -63.117 8.220   1.00 37.28 ? 108  THR B N     1 
ATOM   3603  C  CA    . THR C  1 109 ? 4.274   -62.006 7.502   1.00 36.91 ? 108  THR B CA    1 
ATOM   3604  C  C     . THR C  1 109 ? 5.306   -61.281 8.378   1.00 36.91 ? 108  THR B C     1 
ATOM   3605  O  O     . THR C  1 109 ? 5.019   -60.958 9.528   1.00 36.73 ? 108  THR B O     1 
ATOM   3606  C  CB    . THR C  1 109 ? 3.204   -60.978 7.111   1.00 36.71 ? 108  THR B CB    1 
ATOM   3607  O  OG1   . THR C  1 109 ? 2.092   -61.649 6.514   1.00 35.52 ? 108  THR B OG1   1 
ATOM   3608  C  CG2   . THR C  1 109 ? 3.761   -59.957 6.156   1.00 37.38 ? 108  THR B CG2   1 
ATOM   3609  N  N     . PRO C  1 110 ? 6.501   -61.005 7.833   1.00 36.55 ? 109  PRO B N     1 
ATOM   3610  C  CA    . PRO C  1 110 ? 7.518   -60.299 8.631   1.00 36.41 ? 109  PRO B CA    1 
ATOM   3611  C  C     . PRO C  1 110 ? 7.128   -58.892 9.073   1.00 35.82 ? 109  PRO B C     1 
ATOM   3612  O  O     . PRO C  1 110 ? 6.488   -58.139 8.327   1.00 34.79 ? 109  PRO B O     1 
ATOM   3613  C  CB    . PRO C  1 110 ? 8.744   -60.244 7.705   1.00 36.17 ? 109  PRO B CB    1 
ATOM   3614  C  CG    . PRO C  1 110 ? 8.240   -60.567 6.349   1.00 37.24 ? 109  PRO B CG    1 
ATOM   3615  C  CD    . PRO C  1 110 ? 6.984   -61.356 6.488   1.00 36.71 ? 109  PRO B CD    1 
ATOM   3616  N  N     . ILE C  1 111 ? 7.560   -58.558 10.285  1.00 36.37 ? 110  ILE B N     1 
ATOM   3617  C  CA    . ILE C  1 111 ? 7.328   -57.255 10.914  1.00 36.30 ? 110  ILE B CA    1 
ATOM   3618  C  C     . ILE C  1 111 ? 8.654   -56.566 11.159  1.00 36.27 ? 110  ILE B C     1 
ATOM   3619  O  O     . ILE C  1 111 ? 9.575   -57.174 11.653  1.00 36.50 ? 110  ILE B O     1 
ATOM   3620  C  CB    . ILE C  1 111 ? 6.590   -57.440 12.256  1.00 36.65 ? 110  ILE B CB    1 
ATOM   3621  C  CG1   . ILE C  1 111 ? 5.181   -57.987 11.992  1.00 36.79 ? 110  ILE B CG1   1 
ATOM   3622  C  CG2   . ILE C  1 111 ? 6.522   -56.112 13.069  1.00 35.24 ? 110  ILE B CG2   1 
ATOM   3623  C  CD1   . ILE C  1 111 ? 4.387   -58.234 13.243  1.00 38.84 ? 110  ILE B CD1   1 
ATOM   3624  N  N     . LEU C  1 112 ? 8.759   -55.306 10.771  1.00 36.56 ? 111  LEU B N     1 
ATOM   3625  C  CA    . LEU C  1 112 ? 9.854   -54.449 11.225  1.00 37.44 ? 111  LEU B CA    1 
ATOM   3626  C  C     . LEU C  1 112 ? 9.267   -53.435 12.207  1.00 37.12 ? 111  LEU B C     1 
ATOM   3627  O  O     . LEU C  1 112 ? 8.244   -52.841 11.930  1.00 38.18 ? 111  LEU B O     1 
ATOM   3628  C  CB    . LEU C  1 112 ? 10.538  -53.723 10.061  1.00 37.36 ? 111  LEU B CB    1 
ATOM   3629  C  CG    . LEU C  1 112 ? 11.351  -54.608 9.122   1.00 38.42 ? 111  LEU B CG    1 
ATOM   3630  C  CD1   . LEU C  1 112 ? 10.443  -55.201 8.027   1.00 38.80 ? 111  LEU B CD1   1 
ATOM   3631  C  CD2   . LEU C  1 112 ? 12.531  -53.822 8.497   1.00 35.86 ? 111  LEU B CD2   1 
ATOM   3632  N  N     . LEU C  1 113 ? 9.905   -53.282 13.365  1.00 37.02 ? 112  LEU B N     1 
ATOM   3633  C  CA    . LEU C  1 113 ? 9.504   -52.286 14.360  1.00 36.80 ? 112  LEU B CA    1 
ATOM   3634  C  C     . LEU C  1 113 ? 10.302  -51.002 14.140  1.00 36.28 ? 112  LEU B C     1 
ATOM   3635  O  O     . LEU C  1 113 ? 11.532  -51.013 14.223  1.00 35.90 ? 112  LEU B O     1 
ATOM   3636  C  CB    . LEU C  1 113 ? 9.746   -52.813 15.789  1.00 37.14 ? 112  LEU B CB    1 
ATOM   3637  C  CG    . LEU C  1 113 ? 9.293   -51.856 16.907  1.00 37.35 ? 112  LEU B CG    1 
ATOM   3638  C  CD1   . LEU C  1 113 ? 7.768   -51.570 16.808  1.00 34.58 ? 112  LEU B CD1   1 
ATOM   3639  C  CD2   . LEU C  1 113 ? 9.670   -52.415 18.263  1.00 36.74 ? 112  LEU B CD2   1 
ATOM   3640  N  N     . VAL C  1 114 ? 9.600   -49.907 13.849  1.00 35.97 ? 113  VAL B N     1 
ATOM   3641  C  CA    . VAL C  1 114 ? 10.237  -48.623 13.549  1.00 35.74 ? 113  VAL B CA    1 
ATOM   3642  C  C     . VAL C  1 114 ? 9.923   -47.591 14.635  1.00 35.97 ? 113  VAL B C     1 
ATOM   3643  O  O     . VAL C  1 114 ? 8.750   -47.280 14.896  1.00 35.00 ? 113  VAL B O     1 
ATOM   3644  C  CB    . VAL C  1 114 ? 9.792   -48.078 12.166  1.00 36.36 ? 113  VAL B CB    1 
ATOM   3645  C  CG1   . VAL C  1 114 ? 10.490  -46.757 11.846  1.00 34.99 ? 113  VAL B CG1   1 
ATOM   3646  C  CG2   . VAL C  1 114 ? 10.069  -49.096 11.064  1.00 35.28 ? 113  VAL B CG2   1 
ATOM   3647  N  N     . GLY C  1 115 ? 10.974  -47.098 15.302  1.00 35.72 ? 114  GLY B N     1 
ATOM   3648  C  CA    . GLY C  1 115 ? 10.859  -45.951 16.201  1.00 35.90 ? 114  GLY B CA    1 
ATOM   3649  C  C     . GLY C  1 115 ? 10.989  -44.670 15.397  1.00 35.73 ? 114  GLY B C     1 
ATOM   3650  O  O     . GLY C  1 115 ? 11.987  -44.481 14.720  1.00 36.37 ? 114  GLY B O     1 
ATOM   3651  N  N     . THR C  1 116 ? 9.992   -43.792 15.454  1.00 36.44 ? 115  THR B N     1 
ATOM   3652  C  CA    . THR C  1 116 ? 9.981   -42.547 14.638  1.00 36.37 ? 115  THR B CA    1 
ATOM   3653  C  C     . THR C  1 116 ? 10.347  -41.290 15.443  1.00 36.06 ? 115  THR B C     1 
ATOM   3654  O  O     . THR C  1 116 ? 10.392  -41.311 16.684  1.00 35.03 ? 115  THR B O     1 
ATOM   3655  C  CB    . THR C  1 116 ? 8.587   -42.300 14.010  1.00 37.30 ? 115  THR B CB    1 
ATOM   3656  O  OG1   . THR C  1 116 ? 7.626   -42.097 15.049  1.00 37.85 ? 115  THR B OG1   1 
ATOM   3657  C  CG2   . THR C  1 116 ? 8.138   -43.476 13.152  1.00 38.17 ? 115  THR B CG2   1 
ATOM   3658  N  N     . LYS C  1 117 ? 10.618  -40.200 14.727  1.00 35.86 ? 116  LYS B N     1 
ATOM   3659  C  CA    . LYS C  1 117 ? 10.883  -38.883 15.336  1.00 35.69 ? 116  LYS B CA    1 
ATOM   3660  C  C     . LYS C  1 117 ? 12.179  -38.887 16.146  1.00 35.98 ? 116  LYS B C     1 
ATOM   3661  O  O     . LYS C  1 117 ? 12.256  -38.328 17.246  1.00 36.12 ? 116  LYS B O     1 
ATOM   3662  C  CB    . LYS C  1 117 ? 9.688   -38.402 16.187  1.00 35.75 ? 116  LYS B CB    1 
ATOM   3663  C  CG    . LYS C  1 117 ? 8.370   -38.392 15.425  1.00 35.44 ? 116  LYS B CG    1 
ATOM   3664  C  CD    . LYS C  1 117 ? 7.327   -37.598 16.164  1.00 35.60 ? 116  LYS B CD    1 
ATOM   3665  C  CE    . LYS C  1 117 ? 5.929   -37.883 15.669  1.00 36.06 ? 116  LYS B CE    1 
ATOM   3666  N  NZ    . LYS C  1 117 ? 4.875   -37.039 16.380  1.00 33.79 ? 116  LYS B NZ    1 
ATOM   3667  N  N     . LEU C  1 118 ? 13.201  -39.521 15.574  1.00 36.00 ? 117  LEU B N     1 
ATOM   3668  C  CA    . LEU C  1 118 ? 14.512  -39.632 16.214  1.00 35.95 ? 117  LEU B CA    1 
ATOM   3669  C  C     . LEU C  1 118 ? 15.111  -38.283 16.562  1.00 35.90 ? 117  LEU B C     1 
ATOM   3670  O  O     . LEU C  1 118 ? 15.838  -38.165 17.544  1.00 34.60 ? 117  LEU B O     1 
ATOM   3671  C  CB    . LEU C  1 118 ? 15.470  -40.410 15.327  1.00 35.86 ? 117  LEU B CB    1 
ATOM   3672  C  CG    . LEU C  1 118 ? 16.910  -40.624 15.822  1.00 35.98 ? 117  LEU B CG    1 
ATOM   3673  C  CD1   . LEU C  1 118 ? 17.002  -41.301 17.209  1.00 32.60 ? 117  LEU B CD1   1 
ATOM   3674  C  CD2   . LEU C  1 118 ? 17.626  -41.436 14.754  1.00 34.97 ? 117  LEU B CD2   1 
ATOM   3675  N  N     . ASP C  1 119 ? 14.800  -37.275 15.745  1.00 36.27 ? 118  ASP B N     1 
ATOM   3676  C  CA    . ASP C  1 119 ? 15.252  -35.892 15.988  1.00 37.15 ? 118  ASP B CA    1 
ATOM   3677  C  C     . ASP C  1 119 ? 14.702  -35.256 17.277  1.00 37.30 ? 118  ASP B C     1 
ATOM   3678  O  O     . ASP C  1 119 ? 15.287  -34.292 17.762  1.00 37.24 ? 118  ASP B O     1 
ATOM   3679  C  CB    . ASP C  1 119 ? 14.868  -34.995 14.804  1.00 37.07 ? 118  ASP B CB    1 
ATOM   3680  C  CG    . ASP C  1 119 ? 13.376  -34.960 14.582  1.00 38.30 ? 118  ASP B CG    1 
ATOM   3681  O  OD1   . ASP C  1 119 ? 12.810  -35.976 14.091  1.00 37.68 ? 118  ASP B OD1   1 
ATOM   3682  O  OD2   . ASP C  1 119 ? 12.767  -33.927 14.921  1.00 39.41 ? 118  ASP B OD2   1 
ATOM   3683  N  N     . LEU C  1 120 ? 13.591  -35.774 17.826  1.00 37.69 ? 119  LEU B N     1 
ATOM   3684  C  CA    . LEU C  1 120 ? 13.002  -35.210 19.061  1.00 37.74 ? 119  LEU B CA    1 
ATOM   3685  C  C     . LEU C  1 120 ? 13.535  -35.844 20.359  1.00 38.41 ? 119  LEU B C     1 
ATOM   3686  O  O     . LEU C  1 120 ? 13.195  -35.378 21.459  1.00 37.94 ? 119  LEU B O     1 
ATOM   3687  C  CB    . LEU C  1 120 ? 11.470  -35.301 19.032  1.00 38.06 ? 119  LEU B CB    1 
ATOM   3688  C  CG    . LEU C  1 120 ? 10.727  -34.477 17.981  1.00 37.72 ? 119  LEU B CG    1 
ATOM   3689  C  CD1   . LEU C  1 120 ? 9.221   -34.712 18.016  1.00 38.19 ? 119  LEU B CD1   1 
ATOM   3690  C  CD2   . LEU C  1 120 ? 11.052  -33.000 18.162  1.00 38.47 ? 119  LEU B CD2   1 
ATOM   3691  N  N     . ARG C  1 121 ? 14.380  -36.874 20.246  1.00 38.35 ? 120  ARG B N     1 
ATOM   3692  C  CA    . ARG C  1 121 ? 14.819  -37.624 21.421  1.00 38.79 ? 120  ARG B CA    1 
ATOM   3693  C  C     . ARG C  1 121 ? 15.727  -36.810 22.326  1.00 39.14 ? 120  ARG B C     1 
ATOM   3694  O  O     . ARG C  1 121 ? 15.688  -36.978 23.533  1.00 39.17 ? 120  ARG B O     1 
ATOM   3695  C  CB    . ARG C  1 121 ? 15.503  -38.940 21.039  1.00 38.42 ? 120  ARG B CB    1 
ATOM   3696  C  CG    . ARG C  1 121 ? 15.931  -39.781 22.263  1.00 37.40 ? 120  ARG B CG    1 
ATOM   3697  C  CD    . ARG C  1 121 ? 15.776  -41.287 22.009  1.00 36.10 ? 120  ARG B CD    1 
ATOM   3698  N  NE    . ARG C  1 121 ? 16.823  -41.783 21.133  1.00 35.10 ? 120  ARG B NE    1 
ATOM   3699  C  CZ    . ARG C  1 121 ? 16.940  -43.035 20.714  1.00 35.31 ? 120  ARG B CZ    1 
ATOM   3700  N  NH1   . ARG C  1 121 ? 16.097  -43.982 21.102  1.00 34.78 ? 120  ARG B NH1   1 
ATOM   3701  N  NH2   . ARG C  1 121 ? 17.947  -43.350 19.919  1.00 36.41 ? 120  ARG B NH2   1 
ATOM   3702  N  N     . ASP C  1 122 ? 16.540  -35.938 21.729  1.00 40.29 ? 121  ASP B N     1 
ATOM   3703  C  CA    . ASP C  1 122 ? 17.349  -34.958 22.459  1.00 40.49 ? 121  ASP B CA    1 
ATOM   3704  C  C     . ASP C  1 122 ? 16.717  -33.550 22.514  1.00 40.66 ? 121  ASP B C     1 
ATOM   3705  O  O     . ASP C  1 122 ? 17.352  -32.616 23.003  1.00 41.05 ? 121  ASP B O     1 
ATOM   3706  C  CB    . ASP C  1 122 ? 18.744  -34.884 21.836  1.00 40.77 ? 121  ASP B CB    1 
ATOM   3707  C  CG    . ASP C  1 122 ? 19.402  -36.255 21.723  1.00 41.17 ? 121  ASP B CG    1 
ATOM   3708  O  OD1   . ASP C  1 122 ? 19.850  -36.776 22.753  1.00 41.74 ? 121  ASP B OD1   1 
ATOM   3709  O  OD2   . ASP C  1 122 ? 19.448  -36.827 20.607  1.00 43.83 ? 121  ASP B OD2   1 
ATOM   3710  N  N     . ASP C  1 123 ? 15.482  -33.394 22.035  1.00 40.51 ? 122  ASP B N     1 
ATOM   3711  C  CA    . ASP C  1 123 ? 14.780  -32.104 22.130  1.00 40.73 ? 122  ASP B CA    1 
ATOM   3712  C  C     . ASP C  1 123 ? 14.381  -31.760 23.572  1.00 40.60 ? 122  ASP B C     1 
ATOM   3713  O  O     . ASP C  1 123 ? 13.605  -32.482 24.207  1.00 40.11 ? 122  ASP B O     1 
ATOM   3714  C  CB    . ASP C  1 123 ? 13.529  -32.055 21.255  1.00 40.30 ? 122  ASP B CB    1 
ATOM   3715  C  CG    . ASP C  1 123 ? 12.831  -30.691 21.315  1.00 40.62 ? 122  ASP B CG    1 
ATOM   3716  O  OD1   . ASP C  1 123 ? 13.399  -29.714 20.777  1.00 40.34 ? 122  ASP B OD1   1 
ATOM   3717  O  OD2   . ASP C  1 123 ? 11.723  -30.585 21.896  1.00 36.81 ? 122  ASP B OD2   1 
ATOM   3718  N  N     . LYS C  1 124 ? 14.895  -30.628 24.054  1.00 40.48 ? 123  LYS B N     1 
ATOM   3719  C  CA    . LYS C  1 124 ? 14.783  -30.240 25.457  1.00 40.55 ? 123  LYS B CA    1 
ATOM   3720  C  C     . LYS C  1 124 ? 13.323  -30.091 25.899  1.00 40.63 ? 123  LYS B C     1 
ATOM   3721  O  O     . LYS C  1 124 ? 12.916  -30.644 26.905  1.00 40.03 ? 123  LYS B O     1 
ATOM   3722  C  CB    . LYS C  1 124 ? 15.566  -28.943 25.712  1.00 40.43 ? 123  LYS B CB    1 
ATOM   3723  N  N     . ASP C  1 125 ? 12.530  -29.368 25.129  1.00 41.08 ? 124  ASP B N     1 
ATOM   3724  C  CA    . ASP C  1 125 ? 11.124  -29.191 25.479  1.00 42.11 ? 124  ASP B CA    1 
ATOM   3725  C  C     . ASP C  1 125 ? 10.324  -30.506 25.497  1.00 41.32 ? 124  ASP B C     1 
ATOM   3726  O  O     . ASP C  1 125 ? 9.483   -30.706 26.362  1.00 40.62 ? 124  ASP B O     1 
ATOM   3727  C  CB    . ASP C  1 125 ? 10.466  -28.173 24.552  1.00 42.85 ? 124  ASP B CB    1 
ATOM   3728  C  CG    . ASP C  1 125 ? 11.043  -26.767 24.738  1.00 46.76 ? 124  ASP B CG    1 
ATOM   3729  O  OD1   . ASP C  1 125 ? 10.481  -25.802 24.172  1.00 51.06 ? 124  ASP B OD1   1 
ATOM   3730  O  OD2   . ASP C  1 125 ? 12.074  -26.628 25.449  1.00 51.83 ? 124  ASP B OD2   1 
ATOM   3731  N  N     . THR C  1 126 ? 10.610  -31.401 24.561  1.00 41.08 ? 125  THR B N     1 
ATOM   3732  C  CA    . THR C  1 126 ? 9.988   -32.722 24.553  1.00 40.78 ? 125  THR B CA    1 
ATOM   3733  C  C     . THR C  1 126 ? 10.419  -33.543 25.787  1.00 39.85 ? 125  THR B C     1 
ATOM   3734  O  O     . THR C  1 126 ? 9.591   -34.152 26.445  1.00 39.29 ? 125  THR B O     1 
ATOM   3735  C  CB    . THR C  1 126 ? 10.310  -33.472 23.245  1.00 40.71 ? 125  THR B CB    1 
ATOM   3736  O  OG1   . THR C  1 126 ? 9.959   -32.638 22.126  1.00 41.71 ? 125  THR B OG1   1 
ATOM   3737  C  CG2   . THR C  1 126 ? 9.511   -34.763 23.169  1.00 40.76 ? 125  THR B CG2   1 
ATOM   3738  N  N     . ILE C  1 127 ? 11.705  -33.521 26.109  1.00 39.90 ? 126  ILE B N     1 
ATOM   3739  C  CA    . ILE C  1 127 ? 12.218  -34.245 27.273  1.00 39.61 ? 126  ILE B CA    1 
ATOM   3740  C  C     . ILE C  1 127 ? 11.516  -33.764 28.553  1.00 40.00 ? 126  ILE B C     1 
ATOM   3741  O  O     . ILE C  1 127 ? 11.165  -34.573 29.412  1.00 39.26 ? 126  ILE B O     1 
ATOM   3742  C  CB    . ILE C  1 127 ? 13.756  -34.122 27.373  1.00 39.71 ? 126  ILE B CB    1 
ATOM   3743  C  CG1   . ILE C  1 127 ? 14.409  -34.975 26.280  1.00 38.88 ? 126  ILE B CG1   1 
ATOM   3744  C  CG2   . ILE C  1 127 ? 14.276  -34.575 28.761  1.00 38.72 ? 126  ILE B CG2   1 
ATOM   3745  C  CD1   . ILE C  1 127 ? 15.849  -34.635 25.988  1.00 38.72 ? 126  ILE B CD1   1 
ATOM   3746  N  N     . GLU C  1 128 ? 11.293  -32.452 28.640  1.00 40.00 ? 127  GLU B N     1 
ATOM   3747  C  CA    . GLU C  1 128 ? 10.715  -31.833 29.815  1.00 40.62 ? 127  GLU B CA    1 
ATOM   3748  C  C     . GLU C  1 128 ? 9.236   -32.136 29.973  1.00 40.48 ? 127  GLU B C     1 
ATOM   3749  O  O     . GLU C  1 128 ? 8.800   -32.483 31.081  1.00 40.33 ? 127  GLU B O     1 
ATOM   3750  C  CB    . GLU C  1 128 ? 11.029  -30.320 29.863  1.00 40.08 ? 127  GLU B CB    1 
ATOM   3751  C  CG    . GLU C  1 128 ? 12.494  -30.108 30.337  1.00 41.69 ? 127  GLU B CG    1 
ATOM   3752  C  CD    . GLU C  1 128 ? 13.037  -28.687 30.203  1.00 42.87 ? 127  GLU B CD    1 
ATOM   3753  O  OE1   . GLU C  1 128 ? 12.275  -27.736 29.898  1.00 42.52 ? 127  GLU B OE1   1 
ATOM   3754  O  OE2   . GLU C  1 128 ? 14.274  -28.535 30.406  1.00 48.03 ? 127  GLU B OE2   1 
ATOM   3755  N  N     . ARG C  1 129 ? 8.462   -32.056 28.892  1.00 40.54 ? 128  ARG B N     1 
ATOM   3756  C  CA    . ARG C  1 129 ? 7.034   -32.423 28.989  1.00 40.73 ? 128  ARG B CA    1 
ATOM   3757  C  C     . ARG C  1 129 ? 6.883   -33.897 29.395  1.00 40.40 ? 128  ARG B C     1 
ATOM   3758  O  O     . ARG C  1 129 ? 5.954   -34.229 30.127  1.00 40.06 ? 128  ARG B O     1 
ATOM   3759  C  CB    . ARG C  1 129 ? 6.261   -32.182 27.696  1.00 40.77 ? 128  ARG B CB    1 
ATOM   3760  C  CG    . ARG C  1 129 ? 6.284   -30.762 27.206  1.00 41.91 ? 128  ARG B CG    1 
ATOM   3761  C  CD    . ARG C  1 129 ? 5.230   -30.528 26.144  1.00 44.31 ? 128  ARG B CD    1 
ATOM   3762  N  NE    . ARG C  1 129 ? 5.247   -31.527 25.072  1.00 44.78 ? 128  ARG B NE    1 
ATOM   3763  C  CZ    . ARG C  1 129 ? 5.952   -31.442 23.940  1.00 46.62 ? 128  ARG B CZ    1 
ATOM   3764  N  NH1   . ARG C  1 129 ? 5.861   -32.428 23.045  1.00 46.23 ? 128  ARG B NH1   1 
ATOM   3765  N  NH2   . ARG C  1 129 ? 6.754   -30.395 23.692  1.00 46.04 ? 128  ARG B NH2   1 
ATOM   3766  N  N     . LEU C  1 130 ? 7.785   -34.768 28.924  1.00 39.48 ? 129  LEU B N     1 
ATOM   3767  C  CA    . LEU C  1 130 ? 7.748   -36.184 29.308  1.00 39.47 ? 129  LEU B CA    1 
ATOM   3768  C  C     . LEU C  1 130 ? 8.104   -36.356 30.776  1.00 39.84 ? 129  LEU B C     1 
ATOM   3769  O  O     . LEU C  1 130 ? 7.430   -37.082 31.492  1.00 38.82 ? 129  LEU B O     1 
ATOM   3770  C  CB    . LEU C  1 130 ? 8.668   -37.052 28.429  1.00 38.78 ? 129  LEU B CB    1 
ATOM   3771  C  CG    . LEU C  1 130 ? 8.149   -37.392 27.021  1.00 37.94 ? 129  LEU B CG    1 
ATOM   3772  C  CD1   . LEU C  1 130 ? 9.258   -37.929 26.126  1.00 38.35 ? 129  LEU B CD1   1 
ATOM   3773  C  CD2   . LEU C  1 130 ? 6.954   -38.367 27.050  1.00 37.27 ? 129  LEU B CD2   1 
ATOM   3774  N  N     . ARG C  1 131 ? 9.160   -35.670 31.209  1.00 40.63 ? 130  ARG B N     1 
ATOM   3775  C  CA    . ARG C  1 131 ? 9.580   -35.648 32.614  1.00 41.67 ? 130  ARG B CA    1 
ATOM   3776  C  C     . ARG C  1 131 ? 8.485   -35.199 33.578  1.00 42.05 ? 130  ARG B C     1 
ATOM   3777  O  O     . ARG C  1 131 ? 8.401   -35.714 34.696  1.00 41.75 ? 130  ARG B O     1 
ATOM   3778  C  CB    . ARG C  1 131 ? 10.758  -34.707 32.777  1.00 41.74 ? 130  ARG B CB    1 
ATOM   3779  C  CG    . ARG C  1 131 ? 11.267  -34.575 34.183  1.00 43.01 ? 130  ARG B CG    1 
ATOM   3780  C  CD    . ARG C  1 131 ? 12.567  -33.846 34.166  1.00 45.45 ? 130  ARG B CD    1 
ATOM   3781  N  NE    . ARG C  1 131 ? 13.589  -34.595 33.434  1.00 46.63 ? 130  ARG B NE    1 
ATOM   3782  C  CZ    . ARG C  1 131 ? 14.640  -34.039 32.838  1.00 48.65 ? 130  ARG B CZ    1 
ATOM   3783  N  NH1   . ARG C  1 131 ? 14.811  -32.715 32.867  1.00 50.50 ? 130  ARG B NH1   1 
ATOM   3784  N  NH2   . ARG C  1 131 ? 15.524  -34.802 32.210  1.00 48.53 ? 130  ARG B NH2   1 
ATOM   3785  N  N     . ASP C  1 132 ? 7.684   -34.224 33.152  1.00 42.26 ? 131  ASP B N     1 
ATOM   3786  C  CA    . ASP C  1 132 ? 6.521   -33.780 33.910  1.00 43.02 ? 131  ASP B CA    1 
ATOM   3787  C  C     . ASP C  1 132 ? 5.542   -34.930 34.176  1.00 42.82 ? 131  ASP B C     1 
ATOM   3788  O  O     . ASP C  1 132 ? 4.760   -34.868 35.135  1.00 43.09 ? 131  ASP B O     1 
ATOM   3789  C  CB    . ASP C  1 132 ? 5.783   -32.631 33.186  1.00 43.26 ? 131  ASP B CB    1 
ATOM   3790  C  CG    . ASP C  1 132 ? 6.522   -31.283 33.265  1.00 46.08 ? 131  ASP B CG    1 
ATOM   3791  O  OD1   . ASP C  1 132 ? 7.446   -31.130 34.087  1.00 48.40 ? 131  ASP B OD1   1 
ATOM   3792  O  OD2   . ASP C  1 132 ? 6.158   -30.344 32.507  1.00 50.70 ? 131  ASP B OD2   1 
ATOM   3793  N  N     . LYS C  1 133 ? 5.562   -35.951 33.319  1.00 42.37 ? 132  LYS B N     1 
ATOM   3794  C  CA    . LYS C  1 133 ? 4.776   -37.174 33.519  1.00 42.33 ? 132  LYS B CA    1 
ATOM   3795  C  C     . LYS C  1 133 ? 5.586   -38.358 34.073  1.00 42.00 ? 132  LYS B C     1 
ATOM   3796  O  O     . LYS C  1 133 ? 5.128   -39.492 34.038  1.00 42.48 ? 132  LYS B O     1 
ATOM   3797  C  CB    . LYS C  1 133 ? 4.120   -37.594 32.191  1.00 42.26 ? 132  LYS B CB    1 
ATOM   3798  C  CG    . LYS C  1 133 ? 3.196   -36.539 31.610  1.00 41.49 ? 132  LYS B CG    1 
ATOM   3799  N  N     . LYS C  1 134 ? 6.774   -38.094 34.593  1.00 41.37 ? 133  LYS B N     1 
ATOM   3800  C  CA    . LYS C  1 134 ? 7.725   -39.145 34.992  1.00 40.89 ? 133  LYS B CA    1 
ATOM   3801  C  C     . LYS C  1 134 ? 8.037   -40.131 33.866  1.00 40.47 ? 133  LYS B C     1 
ATOM   3802  O  O     . LYS C  1 134 ? 8.362   -41.293 34.110  1.00 39.58 ? 133  LYS B O     1 
ATOM   3803  C  CB    . LYS C  1 134 ? 7.263   -39.870 36.262  1.00 40.76 ? 133  LYS B CB    1 
ATOM   3804  C  CG    . LYS C  1 134 ? 7.146   -38.927 37.455  1.00 40.95 ? 133  LYS B CG    1 
ATOM   3805  C  CD    . LYS C  1 134 ? 6.891   -39.659 38.762  1.00 40.14 ? 133  LYS B CD    1 
ATOM   3806  C  CE    . LYS C  1 134 ? 5.424   -40.048 38.940  1.00 38.26 ? 133  LYS B CE    1 
ATOM   3807  N  NZ    . LYS C  1 134 ? 5.247   -40.843 40.214  1.00 35.92 ? 133  LYS B NZ    1 
ATOM   3808  N  N     . LEU C  1 135 ? 7.990   -39.626 32.635  1.00 40.17 ? 134  LEU B N     1 
ATOM   3809  C  CA    . LEU C  1 135 ? 8.350   -40.403 31.447  1.00 39.30 ? 134  LEU B CA    1 
ATOM   3810  C  C     . LEU C  1 135 ? 9.635   -39.876 30.818  1.00 38.84 ? 134  LEU B C     1 
ATOM   3811  O  O     . LEU C  1 135 ? 10.123  -38.803 31.178  1.00 39.05 ? 134  LEU B O     1 
ATOM   3812  C  CB    . LEU C  1 135 ? 7.202   -40.381 30.449  1.00 38.78 ? 134  LEU B CB    1 
ATOM   3813  C  CG    . LEU C  1 135 ? 5.948   -41.139 30.903  1.00 38.27 ? 134  LEU B CG    1 
ATOM   3814  C  CD1   . LEU C  1 135 ? 4.868   -40.972 29.875  1.00 36.97 ? 134  LEU B CD1   1 
ATOM   3815  C  CD2   . LEU C  1 135 ? 6.247   -42.640 31.157  1.00 37.39 ? 134  LEU B CD2   1 
ATOM   3816  N  N     . ALA C  1 136 ? 10.193  -40.658 29.905  1.00 38.17 ? 135  ALA B N     1 
ATOM   3817  C  CA    . ALA C  1 136 ? 11.354  -40.249 29.116  1.00 37.94 ? 135  ALA B CA    1 
ATOM   3818  C  C     . ALA C  1 136 ? 11.238  -40.856 27.725  1.00 37.66 ? 135  ALA B C     1 
ATOM   3819  O  O     . ALA C  1 136 ? 10.409  -41.756 27.501  1.00 37.93 ? 135  ALA B O     1 
ATOM   3820  C  CB    . ALA C  1 136 ? 12.659  -40.693 29.787  1.00 37.15 ? 135  ALA B CB    1 
ATOM   3821  N  N     . PRO C  1 137 ? 12.012  -40.337 26.763  1.00 37.08 ? 136  PRO B N     1 
ATOM   3822  C  CA    . PRO C  1 137 ? 11.938  -40.938 25.427  1.00 37.37 ? 136  PRO B CA    1 
ATOM   3823  C  C     . PRO C  1 137 ? 12.369  -42.417 25.419  1.00 37.02 ? 136  PRO B C     1 
ATOM   3824  O  O     . PRO C  1 137 ? 13.107  -42.860 26.299  1.00 37.41 ? 136  PRO B O     1 
ATOM   3825  C  CB    . PRO C  1 137 ? 12.870  -40.045 24.599  1.00 37.08 ? 136  PRO B CB    1 
ATOM   3826  C  CG    . PRO C  1 137 ? 12.826  -38.734 25.328  1.00 36.97 ? 136  PRO B CG    1 
ATOM   3827  C  CD    . PRO C  1 137 ? 12.869  -39.145 26.762  1.00 36.91 ? 136  PRO B CD    1 
ATOM   3828  N  N     . ILE C  1 138 ? 11.882  -43.166 24.441  1.00 36.78 ? 137  ILE B N     1 
ATOM   3829  C  CA    . ILE C  1 138 ? 12.188  -44.595 24.335  1.00 36.61 ? 137  ILE B CA    1 
ATOM   3830  C  C     . ILE C  1 138 ? 13.637  -44.710 23.899  1.00 36.39 ? 137  ILE B C     1 
ATOM   3831  O  O     . ILE C  1 138 ? 14.052  -43.991 22.997  1.00 36.59 ? 137  ILE B O     1 
ATOM   3832  C  CB    . ILE C  1 138 ? 11.214  -45.314 23.355  1.00 35.97 ? 137  ILE B CB    1 
ATOM   3833  C  CG1   . ILE C  1 138 ? 9.738   -45.122 23.805  1.00 37.44 ? 137  ILE B CG1   1 
ATOM   3834  C  CG2   . ILE C  1 138 ? 11.478  -46.809 23.293  1.00 36.28 ? 137  ILE B CG2   1 
ATOM   3835  C  CD1   . ILE C  1 138 ? 9.457   -45.558 25.239  1.00 35.50 ? 137  ILE B CD1   1 
ATOM   3836  N  N     . THR C  1 139 ? 14.409  -45.571 24.566  1.00 36.46 ? 138  THR B N     1 
ATOM   3837  C  CA    . THR C  1 139 ? 15.812  -45.775 24.248  1.00 35.98 ? 138  THR B CA    1 
ATOM   3838  C  C     . THR C  1 139 ? 15.976  -46.929 23.258  1.00 36.18 ? 138  THR B C     1 
ATOM   3839  O  O     . THR C  1 139 ? 15.080  -47.742 23.092  1.00 35.98 ? 138  THR B O     1 
ATOM   3840  C  CB    . THR C  1 139 ? 16.652  -46.126 25.500  1.00 36.40 ? 138  THR B CB    1 
ATOM   3841  O  OG1   . THR C  1 139 ? 16.270  -47.416 25.983  1.00 36.29 ? 138  THR B OG1   1 
ATOM   3842  C  CG2   . THR C  1 139 ? 16.508  -45.076 26.621  1.00 36.68 ? 138  THR B CG2   1 
ATOM   3843  N  N     . TYR C  1 140 ? 17.149  -47.015 22.632  1.00 36.65 ? 139  TYR B N     1 
ATOM   3844  C  CA    . TYR C  1 140 ? 17.478  -48.122 21.720  1.00 37.23 ? 139  TYR B CA    1 
ATOM   3845  C  C     . TYR C  1 140 ? 17.381  -49.526 22.346  1.00 36.62 ? 139  TYR B C     1 
ATOM   3846  O  O     . TYR C  1 140 ? 16.759  -50.429 21.762  1.00 37.09 ? 139  TYR B O     1 
ATOM   3847  C  CB    . TYR C  1 140 ? 18.841  -47.904 21.046  1.00 38.00 ? 139  TYR B CB    1 
ATOM   3848  C  CG    . TYR C  1 140 ? 19.111  -48.943 19.987  1.00 40.12 ? 139  TYR B CG    1 
ATOM   3849  C  CD1   . TYR C  1 140 ? 19.852  -50.089 20.285  1.00 42.68 ? 139  TYR B CD1   1 
ATOM   3850  C  CD2   . TYR C  1 140 ? 18.595  -48.811 18.701  1.00 40.37 ? 139  TYR B CD2   1 
ATOM   3851  C  CE1   . TYR C  1 140 ? 20.066  -51.063 19.333  1.00 44.01 ? 139  TYR B CE1   1 
ATOM   3852  C  CE2   . TYR C  1 140 ? 18.805  -49.782 17.738  1.00 40.68 ? 139  TYR B CE2   1 
ATOM   3853  C  CZ    . TYR C  1 140 ? 19.535  -50.906 18.056  1.00 41.97 ? 139  TYR B CZ    1 
ATOM   3854  O  OH    . TYR C  1 140 ? 19.780  -51.888 17.111  1.00 43.42 ? 139  TYR B OH    1 
ATOM   3855  N  N     . PRO C  1 141 ? 17.988  -49.740 23.516  1.00 36.22 ? 140  PRO B N     1 
ATOM   3856  C  CA    . PRO C  1 141 ? 17.761  -51.047 24.148  1.00 36.11 ? 140  PRO B CA    1 
ATOM   3857  C  C     . PRO C  1 141 ? 16.279  -51.350 24.427  1.00 35.85 ? 140  PRO B C     1 
ATOM   3858  O  O     . PRO C  1 141 ? 15.836  -52.497 24.322  1.00 35.45 ? 140  PRO B O     1 
ATOM   3859  C  CB    . PRO C  1 141 ? 18.551  -50.941 25.457  1.00 36.32 ? 140  PRO B CB    1 
ATOM   3860  C  CG    . PRO C  1 141 ? 19.607  -49.900 25.186  1.00 35.93 ? 140  PRO B CG    1 
ATOM   3861  C  CD    . PRO C  1 141 ? 18.933  -48.908 24.292  1.00 36.33 ? 140  PRO B CD    1 
ATOM   3862  N  N     . GLN C  1 142 ? 15.516  -50.335 24.786  1.00 35.75 ? 141  GLN B N     1 
ATOM   3863  C  CA    . GLN C  1 142 ? 14.101  -50.545 25.075  1.00 35.45 ? 141  GLN B CA    1 
ATOM   3864  C  C     . GLN C  1 142 ? 13.383  -50.976 23.798  1.00 35.49 ? 141  GLN B C     1 
ATOM   3865  O  O     . GLN C  1 142 ? 12.581  -51.910 23.809  1.00 34.28 ? 141  GLN B O     1 
ATOM   3866  C  CB    . GLN C  1 142 ? 13.474  -49.306 25.707  1.00 35.26 ? 141  GLN B CB    1 
ATOM   3867  C  CG    . GLN C  1 142 ? 13.838  -49.137 27.175  1.00 35.09 ? 141  GLN B CG    1 
ATOM   3868  C  CD    . GLN C  1 142 ? 13.416  -47.790 27.767  1.00 35.16 ? 141  GLN B CD    1 
ATOM   3869  O  OE1   . GLN C  1 142 ? 12.929  -46.895 27.058  1.00 34.63 ? 141  GLN B OE1   1 
ATOM   3870  N  NE2   . GLN C  1 142 ? 13.614  -47.642 29.076  1.00 35.46 ? 141  GLN B NE2   1 
ATOM   3871  N  N     . GLY C  1 143 ? 13.721  -50.324 22.693  1.00 35.87 ? 142  GLY B N     1 
ATOM   3872  C  CA    . GLY C  1 143 ? 13.089  -50.620 21.419  1.00 36.18 ? 142  GLY B CA    1 
ATOM   3873  C  C     . GLY C  1 143 ? 13.451  -52.009 20.956  1.00 36.84 ? 142  GLY B C     1 
ATOM   3874  O  O     . GLY C  1 143 ? 12.588  -52.757 20.527  1.00 35.61 ? 142  GLY B O     1 
ATOM   3875  N  N     . LEU C  1 144 ? 14.746  -52.344 21.050  1.00 37.25 ? 143  LEU B N     1 
ATOM   3876  C  CA    . LEU C  1 144 ? 15.237  -53.644 20.659  1.00 38.08 ? 143  LEU B CA    1 
ATOM   3877  C  C     . LEU C  1 144 ? 14.551  -54.765 21.462  1.00 37.96 ? 143  LEU B C     1 
ATOM   3878  O  O     . LEU C  1 144 ? 14.135  -55.781 20.883  1.00 38.90 ? 143  LEU B O     1 
ATOM   3879  C  CB    . LEU C  1 144 ? 16.791  -53.699 20.788  1.00 38.53 ? 143  LEU B CB    1 
ATOM   3880  C  CG    . LEU C  1 144 ? 17.513  -54.831 20.047  1.00 40.33 ? 143  LEU B CG    1 
ATOM   3881  C  CD1   . LEU C  1 144 ? 17.250  -54.739 18.537  1.00 41.45 ? 143  LEU B CD1   1 
ATOM   3882  C  CD2   . LEU C  1 144 ? 19.016  -54.843 20.354  1.00 38.56 ? 143  LEU B CD2   1 
ATOM   3883  N  N     . ALA C  1 145 ? 14.400  -54.585 22.771  1.00 37.64 ? 144  ALA B N     1 
ATOM   3884  C  CA    . ALA C  1 145 ? 13.771  -55.622 23.621  1.00 37.38 ? 144  ALA B CA    1 
ATOM   3885  C  C     . ALA C  1 145 ? 12.316  -55.885 23.194  1.00 37.51 ? 144  ALA B C     1 
ATOM   3886  O  O     . ALA C  1 145 ? 11.874  -57.030 23.176  1.00 36.06 ? 144  ALA B O     1 
ATOM   3887  C  CB    . ALA C  1 145 ? 13.817  -55.228 25.093  1.00 36.90 ? 144  ALA B CB    1 
ATOM   3888  N  N     . MET C  1 146 ? 11.606  -54.811 22.855  1.00 37.25 ? 145  MET B N     1 
ATOM   3889  C  CA    . MET C  1 146 ? 10.221  -54.897 22.349  1.00 38.68 ? 145  MET B CA    1 
ATOM   3890  C  C     . MET C  1 146 ? 10.167  -55.599 20.990  1.00 38.90 ? 145  MET B C     1 
ATOM   3891  O  O     . MET C  1 146 ? 9.213   -56.329 20.684  1.00 39.33 ? 145  MET B O     1 
ATOM   3892  C  CB    . MET C  1 146 ? 9.627   -53.489 22.209  1.00 38.47 ? 145  MET B CB    1 
ATOM   3893  C  CG    . MET C  1 146 ? 8.189   -53.433 21.694  1.00 40.48 ? 145  MET B CG    1 
ATOM   3894  S  SD    . MET C  1 146 ? 7.028   -54.271 22.789  1.00 43.68 ? 145  MET B SD    1 
ATOM   3895  C  CE    . MET C  1 146 ? 6.638   -52.926 23.929  1.00 44.87 ? 145  MET B CE    1 
ATOM   3896  N  N     . ALA C  1 147 ? 11.187  -55.345 20.174  1.00 39.29 ? 146  ALA B N     1 
ATOM   3897  C  CA    . ALA C  1 147 ? 11.305  -55.940 18.849  1.00 39.39 ? 146  ALA B CA    1 
ATOM   3898  C  C     . ALA C  1 147 ? 11.400  -57.440 19.015  1.00 39.81 ? 146  ALA B C     1 
ATOM   3899  O  O     . ALA C  1 147 ? 10.654  -58.196 18.376  1.00 39.22 ? 146  ALA B O     1 
ATOM   3900  C  CB    . ALA C  1 147 ? 12.550  -55.376 18.117  1.00 38.71 ? 146  ALA B CB    1 
ATOM   3901  N  N     . ARG C  1 148 ? 12.296  -57.867 19.906  1.00 41.11 ? 147  ARG B N     1 
ATOM   3902  C  CA    . ARG C  1 148 ? 12.494  -59.300 20.211  1.00 42.36 ? 147  ARG B CA    1 
ATOM   3903  C  C     . ARG C  1 148 ? 11.240  -59.948 20.781  1.00 42.07 ? 147  ARG B C     1 
ATOM   3904  O  O     . ARG C  1 148 ? 10.908  -61.063 20.406  1.00 41.98 ? 147  ARG B O     1 
ATOM   3905  C  CB    . ARG C  1 148 ? 13.671  -59.481 21.156  1.00 42.69 ? 147  ARG B CB    1 
ATOM   3906  C  CG    . ARG C  1 148 ? 14.978  -59.168 20.448  1.00 44.78 ? 147  ARG B CG    1 
ATOM   3907  C  CD    . ARG C  1 148 ? 16.218  -59.186 21.342  1.00 46.72 ? 147  ARG B CD    1 
ATOM   3908  N  NE    . ARG C  1 148 ? 17.409  -58.951 20.510  1.00 50.40 ? 147  ARG B NE    1 
ATOM   3909  C  CZ    . ARG C  1 148 ? 18.626  -58.675 20.977  1.00 52.62 ? 147  ARG B CZ    1 
ATOM   3910  N  NH1   . ARG C  1 148 ? 18.841  -58.575 22.285  1.00 53.57 ? 147  ARG B NH1   1 
ATOM   3911  N  NH2   . ARG C  1 148 ? 19.640  -58.491 20.123  1.00 52.94 ? 147  ARG B NH2   1 
ATOM   3912  N  N     . GLU C  1 149 ? 10.531  -59.211 21.637  1.00 41.83 ? 148  GLU B N     1 
ATOM   3913  C  CA    . GLU C  1 149 ? 9.258   -59.638 22.225  1.00 42.39 ? 148  GLU B CA    1 
ATOM   3914  C  C     . GLU C  1 149 ? 8.206   -59.996 21.173  1.00 41.49 ? 148  GLU B C     1 
ATOM   3915  O  O     . GLU C  1 149 ? 7.542   -61.012 21.298  1.00 41.54 ? 148  GLU B O     1 
ATOM   3916  C  CB    . GLU C  1 149 ? 8.707   -58.515 23.116  1.00 42.88 ? 148  GLU B CB    1 
ATOM   3917  C  CG    . GLU C  1 149 ? 7.379   -58.786 23.813  1.00 46.36 ? 148  GLU B CG    1 
ATOM   3918  C  CD    . GLU C  1 149 ? 7.517   -59.198 25.285  1.00 50.92 ? 148  GLU B CD    1 
ATOM   3919  O  OE1   . GLU C  1 149 ? 8.570   -58.919 25.916  1.00 54.88 ? 148  GLU B OE1   1 
ATOM   3920  O  OE2   . GLU C  1 149 ? 6.549   -59.790 25.816  1.00 53.18 ? 148  GLU B OE2   1 
ATOM   3921  N  N     . ILE C  1 150 ? 8.043   -59.153 20.155  1.00 41.05 ? 149  ILE B N     1 
ATOM   3922  C  CA    . ILE C  1 150 ? 7.013   -59.373 19.133  1.00 40.22 ? 149  ILE B CA    1 
ATOM   3923  C  C     . ILE C  1 150 ? 7.470   -60.194 17.906  1.00 40.34 ? 149  ILE B C     1 
ATOM   3924  O  O     . ILE C  1 150 ? 6.706   -60.365 16.942  1.00 40.71 ? 149  ILE B O     1 
ATOM   3925  C  CB    . ILE C  1 150 ? 6.373   -58.040 18.685  1.00 40.44 ? 149  ILE B CB    1 
ATOM   3926  C  CG1   . ILE C  1 150 ? 7.338   -57.195 17.844  1.00 40.51 ? 149  ILE B CG1   1 
ATOM   3927  C  CG2   . ILE C  1 150 ? 5.877   -57.265 19.898  1.00 39.86 ? 149  ILE B CG2   1 
ATOM   3928  C  CD1   . ILE C  1 150 ? 6.723   -55.900 17.305  1.00 39.26 ? 149  ILE B CD1   1 
ATOM   3929  N  N     . GLY C  1 151 ? 8.698   -60.698 17.929  1.00 39.81 ? 150  GLY B N     1 
ATOM   3930  C  CA    . GLY C  1 151 ? 9.209   -61.535 16.835  1.00 40.29 ? 150  GLY B CA    1 
ATOM   3931  C  C     . GLY C  1 151 ? 9.459   -60.756 15.550  1.00 40.09 ? 150  GLY B C     1 
ATOM   3932  O  O     . GLY C  1 151 ? 9.204   -61.239 14.434  1.00 40.19 ? 150  GLY B O     1 
ATOM   3933  N  N     . SER C  1 152 ? 9.974   -59.550 15.724  1.00 39.83 ? 151  SER B N     1 
ATOM   3934  C  CA    . SER C  1 152 ? 10.264  -58.662 14.628  1.00 39.99 ? 151  SER B CA    1 
ATOM   3935  C  C     . SER C  1 152 ? 11.591  -59.079 13.987  1.00 39.66 ? 151  SER B C     1 
ATOM   3936  O  O     . SER C  1 152 ? 12.468  -59.622 14.653  1.00 39.45 ? 151  SER B O     1 
ATOM   3937  C  CB    . SER C  1 152 ? 10.346  -57.246 15.180  1.00 40.05 ? 151  SER B CB    1 
ATOM   3938  O  OG    . SER C  1 152 ? 10.308  -56.326 14.126  1.00 43.60 ? 151  SER B OG    1 
ATOM   3939  N  N     . VAL C  1 153 ? 11.739  -58.844 12.693  1.00 39.49 ? 152  VAL B N     1 
ATOM   3940  C  CA    . VAL C  1 153 ? 12.969  -59.202 12.002  1.00 39.59 ? 152  VAL B CA    1 
ATOM   3941  C  C     . VAL C  1 153 ? 14.050  -58.125 12.138  1.00 39.75 ? 152  VAL B C     1 
ATOM   3942  O  O     . VAL C  1 153 ? 15.236  -58.407 11.952  1.00 40.31 ? 152  VAL B O     1 
ATOM   3943  C  CB    . VAL C  1 153 ? 12.720  -59.528 10.506  1.00 39.57 ? 152  VAL B CB    1 
ATOM   3944  C  CG1   . VAL C  1 153 ? 11.650  -60.624 10.382  1.00 40.84 ? 152  VAL B CG1   1 
ATOM   3945  C  CG2   . VAL C  1 153 ? 12.337  -58.293 9.724   1.00 39.09 ? 152  VAL B CG2   1 
ATOM   3946  N  N     . LYS C  1 154 ? 13.654  -56.897 12.458  1.00 39.95 ? 153  LYS B N     1 
ATOM   3947  C  CA    . LYS C  1 154 ? 14.618  -55.802 12.607  1.00 40.00 ? 153  LYS B CA    1 
ATOM   3948  C  C     . LYS C  1 154 ? 13.982  -54.696 13.421  1.00 39.43 ? 153  LYS B C     1 
ATOM   3949  O  O     . LYS C  1 154 ? 12.775  -54.472 13.323  1.00 39.06 ? 153  LYS B O     1 
ATOM   3950  C  CB    . LYS C  1 154 ? 15.025  -55.250 11.227  1.00 40.67 ? 153  LYS B CB    1 
ATOM   3951  C  CG    . LYS C  1 154 ? 16.525  -54.971 11.050  1.00 41.88 ? 153  LYS B CG    1 
ATOM   3952  C  CD    . LYS C  1 154 ? 17.321  -56.239 10.760  1.00 43.72 ? 153  LYS B CD    1 
ATOM   3953  N  N     . TYR C  1 155 ? 14.791  -54.029 14.242  1.00 38.87 ? 154  TYR B N     1 
ATOM   3954  C  CA    . TYR C  1 155 ? 14.377  -52.803 14.937  1.00 38.59 ? 154  TYR B CA    1 
ATOM   3955  C  C     . TYR C  1 155 ? 15.171  -51.686 14.320  1.00 38.20 ? 154  TYR B C     1 
ATOM   3956  O  O     . TYR C  1 155 ? 16.391  -51.809 14.172  1.00 37.91 ? 154  TYR B O     1 
ATOM   3957  C  CB    . TYR C  1 155 ? 14.687  -52.833 16.441  1.00 39.20 ? 154  TYR B CB    1 
ATOM   3958  C  CG    . TYR C  1 155 ? 14.445  -51.487 17.117  1.00 38.48 ? 154  TYR B CG    1 
ATOM   3959  C  CD1   . TYR C  1 155 ? 13.190  -50.907 17.097  1.00 39.42 ? 154  TYR B CD1   1 
ATOM   3960  C  CD2   . TYR C  1 155 ? 15.473  -50.800 17.758  1.00 40.18 ? 154  TYR B CD2   1 
ATOM   3961  C  CE1   . TYR C  1 155 ? 12.947  -49.663 17.679  1.00 40.63 ? 154  TYR B CE1   1 
ATOM   3962  C  CE2   . TYR C  1 155 ? 15.239  -49.557 18.365  1.00 40.09 ? 154  TYR B CE2   1 
ATOM   3963  C  CZ    . TYR C  1 155 ? 13.978  -49.000 18.327  1.00 39.67 ? 154  TYR B CZ    1 
ATOM   3964  O  OH    . TYR C  1 155 ? 13.719  -47.781 18.915  1.00 38.27 ? 154  TYR B OH    1 
ATOM   3965  N  N     . LEU C  1 156 ? 14.484  -50.608 13.962  1.00 37.25 ? 155  LEU B N     1 
ATOM   3966  C  CA    . LEU C  1 156 ? 15.113  -49.460 13.333  1.00 37.34 ? 155  LEU B CA    1 
ATOM   3967  C  C     . LEU C  1 156 ? 14.569  -48.148 13.881  1.00 36.95 ? 155  LEU B C     1 
ATOM   3968  O  O     . LEU C  1 156 ? 13.386  -48.054 14.211  1.00 36.68 ? 155  LEU B O     1 
ATOM   3969  C  CB    . LEU C  1 156 ? 14.886  -49.519 11.823  1.00 37.81 ? 155  LEU B CB    1 
ATOM   3970  C  CG    . LEU C  1 156 ? 15.603  -50.670 11.112  1.00 37.78 ? 155  LEU B CG    1 
ATOM   3971  C  CD1   . LEU C  1 156 ? 15.124  -50.728 9.724   1.00 38.21 ? 155  LEU B CD1   1 
ATOM   3972  C  CD2   . LEU C  1 156 ? 17.115  -50.493 11.165  1.00 36.51 ? 155  LEU B CD2   1 
ATOM   3973  N  N     . GLU C  1 157 ? 15.445  -47.149 13.973  1.00 36.46 ? 156  GLU B N     1 
ATOM   3974  C  CA    . GLU C  1 157 ? 15.078  -45.800 14.422  1.00 36.31 ? 156  GLU B CA    1 
ATOM   3975  C  C     . GLU C  1 157 ? 15.311  -44.807 13.308  1.00 36.48 ? 156  GLU B C     1 
ATOM   3976  O  O     . GLU C  1 157 ? 16.279  -44.938 12.552  1.00 36.68 ? 156  GLU B O     1 
ATOM   3977  C  CB    . GLU C  1 157 ? 15.896  -45.400 15.668  1.00 36.29 ? 156  GLU B CB    1 
ATOM   3978  C  CG    . GLU C  1 157 ? 15.611  -46.298 16.878  1.00 35.09 ? 156  GLU B CG    1 
ATOM   3979  C  CD    . GLU C  1 157 ? 16.424  -45.961 18.114  1.00 35.83 ? 156  GLU B CD    1 
ATOM   3980  O  OE1   . GLU C  1 157 ? 17.546  -45.404 17.978  1.00 35.55 ? 156  GLU B OE1   1 
ATOM   3981  O  OE2   . GLU C  1 157 ? 15.961  -46.295 19.232  1.00 34.94 ? 156  GLU B OE2   1 
ATOM   3982  N  N     . CYS C  1 158 ? 14.420  -43.821 13.176  1.00 37.23 ? 157  CYS B N     1 
ATOM   3983  C  CA    . CYS C  1 158 ? 14.570  -42.832 12.121  1.00 36.89 ? 157  CYS B CA    1 
ATOM   3984  C  C     . CYS C  1 158 ? 13.867  -41.505 12.400  1.00 36.99 ? 157  CYS B C     1 
ATOM   3985  O  O     . CYS C  1 158 ? 12.961  -41.409 13.249  1.00 36.83 ? 157  CYS B O     1 
ATOM   3986  C  CB    . CYS C  1 158 ? 14.083  -43.421 10.783  1.00 37.10 ? 157  CYS B CB    1 
ATOM   3987  S  SG    . CYS C  1 158 ? 12.275  -43.599 10.646  1.00 38.47 ? 157  CYS B SG    1 
ATOM   3988  N  N     . SER C  1 159 ? 14.279  -40.496 11.639  1.00 36.59 ? 158  SER B N     1 
ATOM   3989  C  CA    . SER C  1 159 ? 13.550  -39.239 11.517  1.00 36.75 ? 158  SER B CA    1 
ATOM   3990  C  C     . SER C  1 159 ? 13.158  -39.026 10.070  1.00 36.81 ? 158  SER B C     1 
ATOM   3991  O  O     . SER C  1 159 ? 14.023  -38.894 9.216   1.00 37.30 ? 158  SER B O     1 
ATOM   3992  C  CB    . SER C  1 159 ? 14.398  -38.047 11.952  1.00 36.66 ? 158  SER B CB    1 
ATOM   3993  O  OG    . SER C  1 159 ? 13.691  -36.825 11.774  1.00 37.15 ? 158  SER B OG    1 
ATOM   3994  N  N     . ALA C  1 160 ? 11.861  -38.980 9.801   1.00 36.25 ? 159  ALA B N     1 
ATOM   3995  C  CA    . ALA C  1 160 ? 11.353  -38.568 8.488   1.00 36.70 ? 159  ALA B CA    1 
ATOM   3996  C  C     . ALA C  1 160 ? 11.711  -37.088 8.199   1.00 36.62 ? 159  ALA B C     1 
ATOM   3997  O  O     . ALA C  1 160 ? 11.875  -36.695 7.033   1.00 36.53 ? 159  ALA B O     1 
ATOM   3998  C  CB    . ALA C  1 160 ? 9.831   -38.795 8.407   1.00 36.31 ? 159  ALA B CB    1 
ATOM   3999  N  N     . LEU C  1 161 ? 11.870  -36.295 9.262   1.00 37.06 ? 160  LEU B N     1 
ATOM   4000  C  CA    . LEU C  1 161 ? 12.179  -34.878 9.132   1.00 37.13 ? 160  LEU B CA    1 
ATOM   4001  C  C     . LEU C  1 161 ? 13.593  -34.641 8.636   1.00 37.18 ? 160  LEU B C     1 
ATOM   4002  O  O     . LEU C  1 161 ? 13.786  -33.860 7.709   1.00 38.03 ? 160  LEU B O     1 
ATOM   4003  C  CB    . LEU C  1 161 ? 11.955  -34.118 10.452  1.00 37.39 ? 160  LEU B CB    1 
ATOM   4004  C  CG    . LEU C  1 161 ? 12.254  -32.599 10.402  1.00 37.43 ? 160  LEU B CG    1 
ATOM   4005  C  CD1   . LEU C  1 161 ? 11.219  -31.864 9.551   1.00 36.51 ? 160  LEU B CD1   1 
ATOM   4006  C  CD2   . LEU C  1 161 ? 12.381  -31.958 11.776  1.00 36.77 ? 160  LEU B CD2   1 
ATOM   4007  N  N     . THR C  1 162 ? 14.588  -35.272 9.262   1.00 37.19 ? 161  THR B N     1 
ATOM   4008  C  CA    . THR C  1 162 ? 15.984  -35.118 8.831   1.00 37.01 ? 161  THR B CA    1 
ATOM   4009  C  C     . THR C  1 162 ? 16.404  -36.184 7.825   1.00 37.43 ? 161  THR B C     1 
ATOM   4010  O  O     . THR C  1 162 ? 17.442  -36.037 7.177   1.00 36.70 ? 161  THR B O     1 
ATOM   4011  C  CB    . THR C  1 162 ? 16.974  -35.233 9.991   1.00 36.74 ? 161  THR B CB    1 
ATOM   4012  O  OG1   . THR C  1 162 ? 16.937  -36.568 10.493  1.00 36.03 ? 161  THR B OG1   1 
ATOM   4013  C  CG2   . THR C  1 162 ? 16.638  -34.253 11.089  1.00 36.95 ? 161  THR B CG2   1 
ATOM   4014  N  N     . GLN C  1 163 ? 15.603  -37.247 7.728   1.00 37.50 ? 162  GLN B N     1 
ATOM   4015  C  CA    . GLN C  1 163 ? 15.850  -38.424 6.880   1.00 38.02 ? 162  GLN B CA    1 
ATOM   4016  C  C     . GLN C  1 163 ? 16.939  -39.338 7.406   1.00 38.18 ? 162  GLN B C     1 
ATOM   4017  O  O     . GLN C  1 163 ? 17.324  -40.305 6.749   1.00 38.34 ? 162  GLN B O     1 
ATOM   4018  C  CB    . GLN C  1 163 ? 16.111  -38.043 5.424   1.00 38.20 ? 162  GLN B CB    1 
ATOM   4019  C  CG    . GLN C  1 163 ? 14.992  -37.238 4.826   1.00 37.98 ? 162  GLN B CG    1 
ATOM   4020  C  CD    . GLN C  1 163 ? 15.098  -37.153 3.322   1.00 38.64 ? 162  GLN B CD    1 
ATOM   4021  O  OE1   . GLN C  1 163 ? 16.150  -36.807 2.790   1.00 39.17 ? 162  GLN B OE1   1 
ATOM   4022  N  NE2   . GLN C  1 163 ? 14.010  -37.496 2.621   1.00 38.80 ? 162  GLN B NE2   1 
ATOM   4023  N  N     . ARG C  1 164 ? 17.406  -39.060 8.611   1.00 38.42 ? 163  ARG B N     1 
ATOM   4024  C  CA    . ARG C  1 164 ? 18.333  -39.945 9.264   1.00 38.14 ? 163  ARG B CA    1 
ATOM   4025  C  C     . ARG C  1 164 ? 17.699  -41.303 9.521   1.00 38.04 ? 163  ARG B C     1 
ATOM   4026  O  O     . ARG C  1 164 ? 16.649  -41.397 10.155  1.00 36.33 ? 163  ARG B O     1 
ATOM   4027  C  CB    . ARG C  1 164 ? 18.818  -39.353 10.586  1.00 38.40 ? 163  ARG B CB    1 
ATOM   4028  C  CG    . ARG C  1 164 ? 19.822  -40.253 11.225  1.00 39.06 ? 163  ARG B CG    1 
ATOM   4029  C  CD    . ARG C  1 164 ? 20.520  -39.615 12.378  1.00 41.61 ? 163  ARG B CD    1 
ATOM   4030  N  NE    . ARG C  1 164 ? 21.639  -40.449 12.818  1.00 42.27 ? 163  ARG B NE    1 
ATOM   4031  C  CZ    . ARG C  1 164 ? 22.343  -40.241 13.925  1.00 42.87 ? 163  ARG B CZ    1 
ATOM   4032  N  NH1   . ARG C  1 164 ? 22.053  -39.219 14.731  1.00 42.05 ? 163  ARG B NH1   1 
ATOM   4033  N  NH2   . ARG C  1 164 ? 23.355  -41.050 14.212  1.00 44.54 ? 163  ARG B NH2   1 
ATOM   4034  N  N     . GLY C  1 165 ? 18.351  -42.351 9.021   1.00 38.32 ? 164  GLY B N     1 
ATOM   4035  C  CA    . GLY C  1 165 ? 17.848  -43.727 9.170   1.00 38.47 ? 164  GLY B CA    1 
ATOM   4036  C  C     . GLY C  1 165 ? 16.641  -44.093 8.320   1.00 38.39 ? 164  GLY B C     1 
ATOM   4037  O  O     . GLY C  1 165 ? 16.210  -45.246 8.331   1.00 39.09 ? 164  GLY B O     1 
ATOM   4038  N  N     . LEU C  1 166 ? 16.104  -43.134 7.572   1.00 38.24 ? 165  LEU B N     1 
ATOM   4039  C  CA    . LEU C  1 166 ? 14.888  -43.342 6.761   1.00 38.11 ? 165  LEU B CA    1 
ATOM   4040  C  C     . LEU C  1 166 ? 15.063  -44.373 5.614   1.00 38.37 ? 165  LEU B C     1 
ATOM   4041  O  O     . LEU C  1 166 ? 14.352  -45.362 5.549   1.00 37.90 ? 165  LEU B O     1 
ATOM   4042  C  CB    . LEU C  1 166 ? 14.416  -41.989 6.205   1.00 38.20 ? 165  LEU B CB    1 
ATOM   4043  C  CG    . LEU C  1 166 ? 13.041  -41.911 5.558   1.00 38.36 ? 165  LEU B CG    1 
ATOM   4044  C  CD1   . LEU C  1 166 ? 11.971  -42.286 6.575   1.00 39.41 ? 165  LEU B CD1   1 
ATOM   4045  C  CD2   . LEU C  1 166 ? 12.785  -40.515 4.994   1.00 37.47 ? 165  LEU B CD2   1 
ATOM   4046  N  N     . LYS C  1 167 ? 16.031  -44.157 4.726   1.00 39.18 ? 166  LYS B N     1 
ATOM   4047  C  CA    . LYS C  1 167 ? 16.305  -45.122 3.646   1.00 39.41 ? 166  LYS B CA    1 
ATOM   4048  C  C     . LYS C  1 167 ? 16.582  -46.529 4.174   1.00 39.13 ? 166  LYS B C     1 
ATOM   4049  O  O     . LYS C  1 167 ? 16.199  -47.526 3.558   1.00 38.99 ? 166  LYS B O     1 
ATOM   4050  C  CB    . LYS C  1 167 ? 17.467  -44.666 2.767   1.00 39.32 ? 166  LYS B CB    1 
ATOM   4051  C  CG    . LYS C  1 167 ? 17.773  -45.646 1.620   1.00 40.31 ? 166  LYS B CG    1 
ATOM   4052  C  CD    . LYS C  1 167 ? 18.728  -45.068 0.562   1.00 40.53 ? 166  LYS B CD    1 
ATOM   4053  C  CE    . LYS C  1 167 ? 19.098  -46.116 -0.515  1.00 40.06 ? 166  LYS B CE    1 
ATOM   4054  N  NZ    . LYS C  1 167 ? 19.692  -47.359 0.065   1.00 39.51 ? 166  LYS B NZ    1 
ATOM   4055  N  N     . THR C  1 168 ? 17.226  -46.609 5.327   1.00 38.86 ? 167  THR B N     1 
ATOM   4056  C  CA    . THR C  1 168 ? 17.574  -47.896 5.913   1.00 38.81 ? 167  THR B CA    1 
ATOM   4057  C  C     . THR C  1 168 ? 16.356  -48.708 6.309   1.00 38.70 ? 167  THR B C     1 
ATOM   4058  O  O     . THR C  1 168 ? 16.383  -49.921 6.205   1.00 39.37 ? 167  THR B O     1 
ATOM   4059  C  CB    . THR C  1 168 ? 18.520  -47.681 7.110   1.00 39.01 ? 167  THR B CB    1 
ATOM   4060  O  OG1   . THR C  1 168 ? 19.616  -46.876 6.642   1.00 40.08 ? 167  THR B OG1   1 
ATOM   4061  C  CG2   . THR C  1 168 ? 19.050  -49.028 7.705   1.00 36.93 ? 167  THR B CG2   1 
ATOM   4062  N  N     . VAL C  1 169 ? 15.290  -48.042 6.739   1.00 38.35 ? 168  VAL B N     1 
ATOM   4063  C  CA    . VAL C  1 169 ? 14.034  -48.704 7.079   1.00 38.60 ? 168  VAL B CA    1 
ATOM   4064  C  C     . VAL C  1 169 ? 13.454  -49.469 5.886   1.00 38.78 ? 168  VAL B C     1 
ATOM   4065  O  O     . VAL C  1 169 ? 13.025  -50.624 6.006   1.00 38.59 ? 168  VAL B O     1 
ATOM   4066  C  CB    . VAL C  1 169 ? 12.951  -47.669 7.591   1.00 38.49 ? 168  VAL B CB    1 
ATOM   4067  C  CG1   . VAL C  1 169 ? 11.577  -48.289 7.624   1.00 38.92 ? 168  VAL B CG1   1 
ATOM   4068  C  CG2   . VAL C  1 169 ? 13.294  -47.132 8.976   1.00 37.88 ? 168  VAL B CG2   1 
ATOM   4069  N  N     . PHE C  1 170 ? 13.435  -48.807 4.732   1.00 38.81 ? 169  PHE B N     1 
ATOM   4070  C  CA    . PHE C  1 170 ? 12.862  -49.394 3.524   1.00 38.70 ? 169  PHE B CA    1 
ATOM   4071  C  C     . PHE C  1 170 ? 13.783  -50.403 2.860   1.00 39.09 ? 169  PHE B C     1 
ATOM   4072  O  O     . PHE C  1 170 ? 13.315  -51.424 2.348   1.00 38.78 ? 169  PHE B O     1 
ATOM   4073  C  CB    . PHE C  1 170 ? 12.420  -48.279 2.591   1.00 39.13 ? 169  PHE B CB    1 
ATOM   4074  C  CG    . PHE C  1 170 ? 11.298  -47.486 3.164   1.00 39.52 ? 169  PHE B CG    1 
ATOM   4075  C  CD1   . PHE C  1 170 ? 9.992   -47.960 3.067   1.00 40.14 ? 169  PHE B CD1   1 
ATOM   4076  C  CD2   . PHE C  1 170 ? 11.545  -46.316 3.884   1.00 39.80 ? 169  PHE B CD2   1 
ATOM   4077  C  CE1   . PHE C  1 170 ? 8.942   -47.256 3.637   1.00 40.03 ? 169  PHE B CE1   1 
ATOM   4078  C  CE2   . PHE C  1 170 ? 10.508  -45.609 4.457   1.00 40.48 ? 169  PHE B CE2   1 
ATOM   4079  C  CZ    . PHE C  1 170 ? 9.201   -46.075 4.339   1.00 40.32 ? 169  PHE B CZ    1 
ATOM   4080  N  N     . ASP C  1 171 ? 15.088  -50.133 2.899   1.00 39.20 ? 170  ASP B N     1 
ATOM   4081  C  CA    . ASP C  1 171 ? 16.066  -51.084 2.434   1.00 40.22 ? 170  ASP B CA    1 
ATOM   4082  C  C     . ASP C  1 171 ? 15.904  -52.392 3.218   1.00 40.30 ? 170  ASP B C     1 
ATOM   4083  O  O     . ASP C  1 171 ? 15.794  -53.471 2.626   1.00 40.13 ? 170  ASP B O     1 
ATOM   4084  C  CB    . ASP C  1 171 ? 17.491  -50.526 2.595   1.00 40.37 ? 170  ASP B CB    1 
ATOM   4085  C  CG    . ASP C  1 171 ? 17.789  -49.344 1.663   1.00 42.45 ? 170  ASP B CG    1 
ATOM   4086  O  OD1   . ASP C  1 171 ? 16.953  -48.964 0.798   1.00 42.20 ? 170  ASP B OD1   1 
ATOM   4087  O  OD2   . ASP C  1 171 ? 18.896  -48.782 1.814   1.00 46.97 ? 170  ASP B OD2   1 
ATOM   4088  N  N     . GLU C  1 172 ? 15.853  -52.278 4.544   1.00 40.87 ? 171  GLU B N     1 
ATOM   4089  C  CA    . GLU C  1 172 ? 15.667  -53.433 5.426   1.00 40.99 ? 171  GLU B CA    1 
ATOM   4090  C  C     . GLU C  1 172 ? 14.317  -54.107 5.231   1.00 40.84 ? 171  GLU B C     1 
ATOM   4091  O  O     . GLU C  1 172 ? 14.225  -55.347 5.303   1.00 40.98 ? 171  GLU B O     1 
ATOM   4092  C  CB    . GLU C  1 172 ? 15.839  -53.043 6.889   1.00 41.76 ? 171  GLU B CB    1 
ATOM   4093  C  CG    . GLU C  1 172 ? 17.294  -52.737 7.309   1.00 43.99 ? 171  GLU B CG    1 
ATOM   4094  C  CD    . GLU C  1 172 ? 18.235  -53.905 7.099   1.00 46.81 ? 171  GLU B CD    1 
ATOM   4095  O  OE1   . GLU C  1 172 ? 17.791  -55.068 7.254   1.00 50.35 ? 171  GLU B OE1   1 
ATOM   4096  O  OE2   . GLU C  1 172 ? 19.415  -53.663 6.757   1.00 48.77 ? 171  GLU B OE2   1 
ATOM   4097  N  N     . ALA C  1 173 ? 13.275  -53.314 4.968   1.00 40.16 ? 172  ALA B N     1 
ATOM   4098  C  CA    . ALA C  1 173 ? 11.948  -53.864 4.668   1.00 39.42 ? 172  ALA B CA    1 
ATOM   4099  C  C     . ALA C  1 173 ? 11.958  -54.692 3.387   1.00 39.49 ? 172  ALA B C     1 
ATOM   4100  O  O     . ALA C  1 173 ? 11.318  -55.740 3.317   1.00 39.22 ? 172  ALA B O     1 
ATOM   4101  C  CB    . ALA C  1 173 ? 10.912  -52.749 4.561   1.00 39.36 ? 172  ALA B CB    1 
ATOM   4102  N  N     . ILE C  1 174 ? 12.696  -54.220 2.381   1.00 39.14 ? 173  ILE B N     1 
ATOM   4103  C  CA    . ILE C  1 174 ? 12.807  -54.909 1.105   1.00 39.01 ? 173  ILE B CA    1 
ATOM   4104  C  C     . ILE C  1 174 ? 13.622  -56.181 1.270   1.00 38.89 ? 173  ILE B C     1 
ATOM   4105  O  O     . ILE C  1 174 ? 13.239  -57.231 0.777   1.00 38.34 ? 173  ILE B O     1 
ATOM   4106  C  CB    . ILE C  1 174 ? 13.443  -54.012 0.026   1.00 39.07 ? 173  ILE B CB    1 
ATOM   4107  C  CG1   . ILE C  1 174 ? 12.467  -52.905 -0.383  1.00 40.53 ? 173  ILE B CG1   1 
ATOM   4108  C  CG2   . ILE C  1 174 ? 13.861  -54.848 -1.206  1.00 38.50 ? 173  ILE B CG2   1 
ATOM   4109  C  CD1   . ILE C  1 174 ? 13.164  -51.627 -0.899  1.00 41.78 ? 173  ILE B CD1   1 
ATOM   4110  N  N     . ARG C  1 175 ? 14.730  -56.085 1.991   1.00 39.05 ? 174  ARG B N     1 
ATOM   4111  C  CA    . ARG C  1 175 ? 15.564  -57.247 2.267   1.00 39.80 ? 174  ARG B CA    1 
ATOM   4112  C  C     . ARG C  1 175 ? 14.828  -58.312 3.081   1.00 39.36 ? 174  ARG B C     1 
ATOM   4113  O  O     . ARG C  1 175 ? 15.041  -59.506 2.887   1.00 39.56 ? 174  ARG B O     1 
ATOM   4114  C  CB    . ARG C  1 175 ? 16.863  -56.811 2.942   1.00 40.24 ? 174  ARG B CB    1 
ATOM   4115  C  CG    . ARG C  1 175 ? 17.784  -56.025 1.988   1.00 43.87 ? 174  ARG B CG    1 
ATOM   4116  C  CD    . ARG C  1 175 ? 18.821  -56.927 1.320   1.00 48.65 ? 174  ARG B CD    1 
ATOM   4117  N  NE    . ARG C  1 175 ? 19.013  -56.719 -0.134  1.00 51.94 ? 174  ARG B NE    1 
ATOM   4118  C  CZ    . ARG C  1 175 ? 20.070  -56.125 -0.710  1.00 53.06 ? 174  ARG B CZ    1 
ATOM   4119  N  NH1   . ARG C  1 175 ? 20.147  -56.035 -2.026  1.00 51.65 ? 174  ARG B NH1   1 
ATOM   4120  N  NH2   . ARG C  1 175 ? 21.056  -55.603 0.011   1.00 55.97 ? 174  ARG B NH2   1 
ATOM   4121  N  N     . ALA C  1 176 ? 13.941  -57.894 3.972   1.00 39.25 ? 175  ALA B N     1 
ATOM   4122  C  CA    . ALA C  1 176 ? 13.092  -58.852 4.692   1.00 39.02 ? 175  ALA B CA    1 
ATOM   4123  C  C     . ALA C  1 176 ? 12.159  -59.661 3.755   1.00 39.09 ? 175  ALA B C     1 
ATOM   4124  O  O     . ALA C  1 176 ? 11.729  -60.771 4.103   1.00 39.03 ? 175  ALA B O     1 
ATOM   4125  C  CB    . ALA C  1 176 ? 12.294  -58.151 5.767   1.00 38.67 ? 175  ALA B CB    1 
ATOM   4126  N  N     . VAL C  1 177 ? 11.860  -59.114 2.577   1.00 39.03 ? 176  VAL B N     1 
ATOM   4127  C  CA    . VAL C  1 177 ? 11.105  -59.851 1.570   1.00 38.88 ? 176  VAL B CA    1 
ATOM   4128  C  C     . VAL C  1 177 ? 11.973  -60.637 0.562   1.00 39.42 ? 176  VAL B C     1 
ATOM   4129  O  O     . VAL C  1 177 ? 11.558  -61.699 0.124   1.00 39.29 ? 176  VAL B O     1 
ATOM   4130  C  CB    . VAL C  1 177 ? 10.151  -58.932 0.806   1.00 38.97 ? 176  VAL B CB    1 
ATOM   4131  C  CG1   . VAL C  1 177 ? 9.280   -59.746 -0.151  1.00 37.94 ? 176  VAL B CG1   1 
ATOM   4132  C  CG2   . VAL C  1 177 ? 9.302   -58.128 1.786   1.00 38.24 ? 176  VAL B CG2   1 
ATOM   4133  N  N     . LEU C  1 178 ? 13.169  -60.143 0.227   1.00 40.29 ? 177  LEU B N     1 
ATOM   4134  C  CA    . LEU C  1 178 ? 13.926  -60.633 -0.932  1.00 41.10 ? 177  LEU B CA    1 
ATOM   4135  C  C     . LEU C  1 178 ? 15.283  -61.303 -0.616  1.00 41.63 ? 177  LEU B C     1 
ATOM   4136  O  O     . LEU C  1 178 ? 15.909  -61.077 0.449   1.00 42.47 ? 177  LEU B O     1 
ATOM   4137  C  CB    . LEU C  1 178 ? 14.129  -59.477 -1.930  1.00 41.22 ? 177  LEU B CB    1 
ATOM   4138  C  CG    . LEU C  1 178 ? 12.900  -58.696 -2.436  1.00 41.68 ? 177  LEU B CG    1 
ATOM   4139  C  CD1   . LEU C  1 178 ? 13.259  -57.859 -3.667  1.00 40.87 ? 177  LEU B CD1   1 
ATOM   4140  C  CD2   . LEU C  1 178 ? 11.744  -59.602 -2.785  1.00 42.08 ? 177  LEU B CD2   1 
ATOM   4141  N  N     . MET D  1 2   ? 2.376   -33.170 47.147  1.00 46.73 ? 1    MET C N     1 
ATOM   4142  C  CA    . MET D  1 2   ? 3.779   -33.679 47.126  1.00 46.88 ? 1    MET C CA    1 
ATOM   4143  C  C     . MET D  1 2   ? 3.984   -34.683 45.987  1.00 46.14 ? 1    MET C C     1 
ATOM   4144  O  O     . MET D  1 2   ? 3.216   -35.642 45.835  1.00 46.16 ? 1    MET C O     1 
ATOM   4145  C  CB    . MET D  1 2   ? 4.128   -34.346 48.470  1.00 47.12 ? 1    MET C CB    1 
ATOM   4146  C  CG    . MET D  1 2   ? 5.601   -34.759 48.605  1.00 47.58 ? 1    MET C CG    1 
ATOM   4147  S  SD    . MET D  1 2   ? 6.120   -35.343 50.232  1.00 48.22 ? 1    MET C SD    1 
ATOM   4148  C  CE    . MET D  1 2   ? 5.445   -34.051 51.281  1.00 47.23 ? 1    MET C CE    1 
ATOM   4149  N  N     . GLN D  1 3   ? 5.029   -34.460 45.195  1.00 45.13 ? 2    GLN C N     1 
ATOM   4150  C  CA    . GLN D  1 3   ? 5.413   -35.405 44.156  1.00 44.48 ? 2    GLN C CA    1 
ATOM   4151  C  C     . GLN D  1 3   ? 5.826   -36.728 44.788  1.00 43.23 ? 2    GLN C C     1 
ATOM   4152  O  O     . GLN D  1 3   ? 6.454   -36.743 45.853  1.00 42.79 ? 2    GLN C O     1 
ATOM   4153  C  CB    . GLN D  1 3   ? 6.557   -34.850 43.313  1.00 44.81 ? 2    GLN C CB    1 
ATOM   4154  C  CG    . GLN D  1 3   ? 6.604   -35.453 41.912  1.00 47.21 ? 2    GLN C CG    1 
ATOM   4155  C  CD    . GLN D  1 3   ? 7.221   -34.523 40.874  1.00 50.26 ? 2    GLN C CD    1 
ATOM   4156  O  OE1   . GLN D  1 3   ? 7.751   -33.443 41.197  1.00 51.60 ? 2    GLN C OE1   1 
ATOM   4157  N  NE2   . GLN D  1 3   ? 7.154   -34.943 39.607  1.00 51.88 ? 2    GLN C NE2   1 
ATOM   4158  N  N     . ALA D  1 4   ? 5.451   -37.825 44.138  1.00 41.53 ? 3    ALA C N     1 
ATOM   4159  C  CA    . ALA D  1 4   ? 5.795   -39.158 44.605  1.00 40.85 ? 3    ALA C CA    1 
ATOM   4160  C  C     . ALA D  1 4   ? 6.567   -39.900 43.526  1.00 40.08 ? 3    ALA C C     1 
ATOM   4161  O  O     . ALA D  1 4   ? 6.387   -39.630 42.337  1.00 39.69 ? 3    ALA C O     1 
ATOM   4162  C  CB    . ALA D  1 4   ? 4.550   -39.927 44.986  1.00 40.32 ? 3    ALA C CB    1 
ATOM   4163  N  N     . ILE D  1 5   ? 7.440   -40.806 43.970  1.00 39.21 ? 4    ILE C N     1 
ATOM   4164  C  CA    . ILE D  1 5   ? 8.232   -41.681 43.122  1.00 38.70 ? 4    ILE C CA    1 
ATOM   4165  C  C     . ILE D  1 5   ? 7.964   -43.106 43.567  1.00 38.08 ? 4    ILE C C     1 
ATOM   4166  O  O     . ILE D  1 5   ? 8.102   -43.407 44.765  1.00 37.78 ? 4    ILE C O     1 
ATOM   4167  C  CB    . ILE D  1 5   ? 9.761   -41.434 43.303  1.00 39.03 ? 4    ILE C CB    1 
ATOM   4168  C  CG1   . ILE D  1 5   ? 10.152  -40.034 42.836  1.00 39.27 ? 4    ILE C CG1   1 
ATOM   4169  C  CG2   . ILE D  1 5   ? 10.601  -42.519 42.592  1.00 39.13 ? 4    ILE C CG2   1 
ATOM   4170  C  CD1   . ILE D  1 5   ? 11.638  -39.710 43.074  1.00 39.75 ? 4    ILE C CD1   1 
ATOM   4171  N  N     . LYS D  1 6   ? 7.577   -43.972 42.621  1.00 36.89 ? 5    LYS C N     1 
ATOM   4172  C  CA    . LYS D  1 6   ? 7.433   -45.391 42.885  1.00 36.84 ? 5    LYS C CA    1 
ATOM   4173  C  C     . LYS D  1 6   ? 8.670   -46.164 42.388  1.00 36.49 ? 5    LYS C C     1 
ATOM   4174  O  O     . LYS D  1 6   ? 8.899   -46.283 41.189  1.00 36.14 ? 5    LYS C O     1 
ATOM   4175  C  CB    . LYS D  1 6   ? 6.161   -45.968 42.265  1.00 36.31 ? 5    LYS C CB    1 
ATOM   4176  C  CG    . LYS D  1 6   ? 6.115   -47.501 42.361  1.00 36.63 ? 5    LYS C CG    1 
ATOM   4177  C  CD    . LYS D  1 6   ? 4.777   -48.051 41.927  1.00 37.53 ? 5    LYS C CD    1 
ATOM   4178  C  CE    . LYS D  1 6   ? 4.780   -49.564 41.950  1.00 35.80 ? 5    LYS C CE    1 
ATOM   4179  N  NZ    . LYS D  1 6   ? 3.474   -50.127 41.484  1.00 37.25 ? 5    LYS C NZ    1 
ATOM   4180  N  N     . CYS D  1 7   ? 9.431   -46.696 43.336  1.00 37.10 ? 6    CYS C N     1 
ATOM   4181  C  CA    . CYS D  1 7   ? 10.679  -47.411 43.087  1.00 37.02 ? 6    CYS C CA    1 
ATOM   4182  C  C     . CYS D  1 7   ? 10.591  -48.873 43.570  1.00 37.46 ? 6    CYS C C     1 
ATOM   4183  O  O     . CYS D  1 7   ? 10.334  -49.138 44.753  1.00 38.31 ? 6    CYS C O     1 
ATOM   4184  C  CB    . CYS D  1 7   ? 11.809  -46.691 43.810  1.00 37.47 ? 6    CYS C CB    1 
ATOM   4185  S  SG    . CYS D  1 7   ? 13.357  -47.634 43.913  1.00 39.12 ? 6    CYS C SG    1 
ATOM   4186  N  N     . VAL D  1 8   ? 10.811  -49.820 42.660  1.00 36.98 ? 7    VAL C N     1 
ATOM   4187  C  CA    . VAL D  1 8   ? 10.595  -51.230 42.947  1.00 36.72 ? 7    VAL C CA    1 
ATOM   4188  C  C     . VAL D  1 8   ? 11.928  -51.959 42.926  1.00 36.19 ? 7    VAL C C     1 
ATOM   4189  O  O     . VAL D  1 8   ? 12.755  -51.751 42.041  1.00 37.11 ? 7    VAL C O     1 
ATOM   4190  C  CB    . VAL D  1 8   ? 9.594   -51.890 41.946  1.00 36.39 ? 7    VAL C CB    1 
ATOM   4191  C  CG1   . VAL D  1 8   ? 9.442   -53.401 42.244  1.00 34.94 ? 7    VAL C CG1   1 
ATOM   4192  C  CG2   . VAL D  1 8   ? 8.268   -51.178 41.977  1.00 37.15 ? 7    VAL C CG2   1 
ATOM   4193  N  N     . VAL D  1 9   ? 12.172  -52.758 43.950  1.00 36.30 ? 8    VAL C N     1 
ATOM   4194  C  CA    . VAL D  1 9   ? 13.454  -53.423 44.104  1.00 36.16 ? 8    VAL C CA    1 
ATOM   4195  C  C     . VAL D  1 9   ? 13.273  -54.918 43.900  1.00 36.30 ? 8    VAL C C     1 
ATOM   4196  O  O     . VAL D  1 9   ? 12.416  -55.526 44.549  1.00 36.40 ? 8    VAL C O     1 
ATOM   4197  C  CB    . VAL D  1 9   ? 14.048  -53.115 45.503  1.00 36.82 ? 8    VAL C CB    1 
ATOM   4198  C  CG1   . VAL D  1 9   ? 15.454  -53.615 45.602  1.00 35.73 ? 8    VAL C CG1   1 
ATOM   4199  C  CG2   . VAL D  1 9   ? 14.000  -51.584 45.786  1.00 34.90 ? 8    VAL C CG2   1 
ATOM   4200  N  N     . VAL D  1 10  ? 14.092  -55.502 43.015  1.00 35.99 ? 9    VAL C N     1 
ATOM   4201  C  CA    . VAL D  1 10  ? 14.042  -56.917 42.663  1.00 35.66 ? 9    VAL C CA    1 
ATOM   4202  C  C     . VAL D  1 10  ? 15.446  -57.538 42.588  1.00 36.38 ? 9    VAL C C     1 
ATOM   4203  O  O     . VAL D  1 10  ? 16.437  -56.826 42.427  1.00 35.59 ? 9    VAL C O     1 
ATOM   4204  C  CB    . VAL D  1 10  ? 13.323  -57.131 41.297  1.00 36.13 ? 9    VAL C CB    1 
ATOM   4205  C  CG1   . VAL D  1 10  ? 11.981  -56.431 41.293  1.00 35.98 ? 9    VAL C CG1   1 
ATOM   4206  C  CG2   . VAL D  1 10  ? 14.189  -56.612 40.125  1.00 35.46 ? 9    VAL C CG2   1 
ATOM   4207  N  N     . GLY D  1 11  ? 15.515  -58.871 42.717  1.00 36.64 ? 10   GLY C N     1 
ATOM   4208  C  CA    . GLY D  1 11  ? 16.790  -59.602 42.665  1.00 36.09 ? 10   GLY C CA    1 
ATOM   4209  C  C     . GLY D  1 11  ? 16.761  -60.944 43.380  1.00 36.08 ? 10   GLY C C     1 
ATOM   4210  O  O     . GLY D  1 11  ? 15.804  -61.279 44.050  1.00 35.69 ? 10   GLY C O     1 
ATOM   4211  N  N     . ASP D  1 12  ? 17.834  -61.719 43.254  1.00 36.65 ? 11   ASP C N     1 
ATOM   4212  C  CA    . ASP D  1 12  ? 17.877  -63.049 43.866  1.00 37.24 ? 11   ASP C CA    1 
ATOM   4213  C  C     . ASP D  1 12  ? 17.746  -63.004 45.376  1.00 37.74 ? 11   ASP C C     1 
ATOM   4214  O  O     . ASP D  1 12  ? 18.113  -62.022 46.018  1.00 37.54 ? 11   ASP C O     1 
ATOM   4215  C  CB    . ASP D  1 12  ? 19.175  -63.778 43.529  1.00 37.66 ? 11   ASP C CB    1 
ATOM   4216  C  CG    . ASP D  1 12  ? 19.105  -64.513 42.236  1.00 37.99 ? 11   ASP C CG    1 
ATOM   4217  O  OD1   . ASP D  1 12  ? 18.110  -64.364 41.509  1.00 39.11 ? 11   ASP C OD1   1 
ATOM   4218  O  OD2   . ASP D  1 12  ? 20.057  -65.264 41.945  1.00 39.61 ? 11   ASP C OD2   1 
ATOM   4219  N  N     . GLY D  1 13  ? 17.207  -64.093 45.927  1.00 38.53 ? 12   GLY C N     1 
ATOM   4220  C  CA    . GLY D  1 13  ? 17.299  -64.385 47.344  1.00 38.35 ? 12   GLY C CA    1 
ATOM   4221  C  C     . GLY D  1 13  ? 18.711  -64.182 47.865  1.00 38.30 ? 12   GLY C C     1 
ATOM   4222  O  O     . GLY D  1 13  ? 19.702  -64.327 47.135  1.00 38.93 ? 12   GLY C O     1 
ATOM   4223  N  N     . ALA D  1 14  ? 18.784  -63.819 49.144  1.00 38.67 ? 13   ALA C N     1 
ATOM   4224  C  CA    . ALA D  1 14  ? 20.030  -63.550 49.874  1.00 37.86 ? 13   ALA C CA    1 
ATOM   4225  C  C     . ALA D  1 14  ? 20.931  -62.422 49.343  1.00 37.85 ? 13   ALA C C     1 
ATOM   4226  O  O     . ALA D  1 14  ? 22.067  -62.281 49.816  1.00 37.57 ? 13   ALA C O     1 
ATOM   4227  C  CB    . ALA D  1 14  ? 20.829  -64.846 50.014  1.00 37.62 ? 13   ALA C CB    1 
ATOM   4228  N  N     . VAL D  1 15  ? 20.457  -61.598 48.402  1.00 37.73 ? 14   VAL C N     1 
ATOM   4229  C  CA    . VAL D  1 15  ? 21.338  -60.564 47.820  1.00 37.13 ? 14   VAL C CA    1 
ATOM   4230  C  C     . VAL D  1 15  ? 21.460  -59.290 48.650  1.00 37.17 ? 14   VAL C C     1 
ATOM   4231  O  O     . VAL D  1 15  ? 22.456  -58.591 48.517  1.00 37.47 ? 14   VAL C O     1 
ATOM   4232  C  CB    . VAL D  1 15  ? 20.999  -60.181 46.322  1.00 37.92 ? 14   VAL C CB    1 
ATOM   4233  C  CG1   . VAL D  1 15  ? 20.844  -61.409 45.448  1.00 36.55 ? 14   VAL C CG1   1 
ATOM   4234  C  CG2   . VAL D  1 15  ? 19.802  -59.242 46.207  1.00 35.81 ? 14   VAL C CG2   1 
ATOM   4235  N  N     . GLY D  1 16  ? 20.455  -58.965 49.464  1.00 36.65 ? 15   GLY C N     1 
ATOM   4236  C  CA    . GLY D  1 16  ? 20.509  -57.786 50.329  1.00 36.79 ? 15   GLY C CA    1 
ATOM   4237  C  C     . GLY D  1 16  ? 19.545  -56.634 50.037  1.00 36.77 ? 15   GLY C C     1 
ATOM   4238  O  O     . GLY D  1 16  ? 19.788  -55.500 50.457  1.00 36.47 ? 15   GLY C O     1 
ATOM   4239  N  N     . LYS D  1 17  ? 18.435  -56.930 49.360  1.00 36.92 ? 16   LYS C N     1 
ATOM   4240  C  CA    . LYS D  1 17  ? 17.441  -55.924 49.005  1.00 36.82 ? 16   LYS C CA    1 
ATOM   4241  C  C     . LYS D  1 17  ? 16.808  -55.300 50.230  1.00 36.82 ? 16   LYS C C     1 
ATOM   4242  O  O     . LYS D  1 17  ? 16.638  -54.089 50.298  1.00 37.18 ? 16   LYS C O     1 
ATOM   4243  C  CB    . LYS D  1 17  ? 16.343  -56.535 48.129  1.00 37.38 ? 16   LYS C CB    1 
ATOM   4244  C  CG    . LYS D  1 17  ? 16.811  -57.174 46.813  1.00 36.78 ? 16   LYS C CG    1 
ATOM   4245  C  CD    . LYS D  1 17  ? 15.618  -57.810 46.110  1.00 36.22 ? 16   LYS C CD    1 
ATOM   4246  C  CE    . LYS D  1 17  ? 15.092  -59.070 46.802  1.00 35.63 ? 16   LYS C CE    1 
ATOM   4247  N  NZ    . LYS D  1 17  ? 16.113  -60.191 46.860  1.00 37.46 ? 16   LYS C NZ    1 
ATOM   4248  N  N     . THR D  1 18  ? 16.467  -56.108 51.224  1.00 36.90 ? 17   THR C N     1 
ATOM   4249  C  CA    . THR D  1 18  ? 15.798  -55.539 52.409  1.00 36.45 ? 17   THR C CA    1 
ATOM   4250  C  C     . THR D  1 18  ? 16.755  -54.708 53.266  1.00 36.86 ? 17   THR C C     1 
ATOM   4251  O  O     . THR D  1 18  ? 16.390  -53.622 53.741  1.00 35.22 ? 17   THR C O     1 
ATOM   4252  C  CB    . THR D  1 18  ? 15.079  -56.630 53.200  1.00 36.05 ? 17   THR C CB    1 
ATOM   4253  O  OG1   . THR D  1 18  ? 14.098  -57.219 52.339  1.00 34.22 ? 17   THR C OG1   1 
ATOM   4254  C  CG2   . THR D  1 18  ? 14.375  -56.070 54.437  1.00 36.05 ? 17   THR C CG2   1 
ATOM   4255  N  N     . CYS D  1 19  ? 17.975  -55.214 53.457  1.00 36.92 ? 18   CYS C N     1 
ATOM   4256  C  CA    . CYS D  1 19  ? 18.968  -54.512 54.270  1.00 37.43 ? 18   CYS C CA    1 
ATOM   4257  C  C     . CYS D  1 19  ? 19.298  -53.145 53.638  1.00 37.71 ? 18   CYS C C     1 
ATOM   4258  O  O     . CYS D  1 19  ? 19.425  -52.141 54.330  1.00 37.24 ? 18   CYS C O     1 
ATOM   4259  C  CB    . CYS D  1 19  ? 20.239  -55.359 54.425  1.00 37.81 ? 18   CYS C CB    1 
ATOM   4260  S  SG    . CYS D  1 19  ? 20.098  -56.719 55.619  1.00 40.40 ? 18   CYS C SG    1 
ATOM   4261  N  N     . LEU D  1 20  ? 19.409  -53.142 52.313  1.00 38.10 ? 19   LEU C N     1 
ATOM   4262  C  CA    . LEU D  1 20  ? 19.572  -51.931 51.517  1.00 38.78 ? 19   LEU C CA    1 
ATOM   4263  C  C     . LEU D  1 20  ? 18.499  -50.874 51.830  1.00 37.76 ? 19   LEU C C     1 
ATOM   4264  O  O     . LEU D  1 20  ? 18.803  -49.733 52.192  1.00 36.90 ? 19   LEU C O     1 
ATOM   4265  C  CB    . LEU D  1 20  ? 19.499  -52.329 50.030  1.00 39.38 ? 19   LEU C CB    1 
ATOM   4266  C  CG    . LEU D  1 20  ? 19.691  -51.266 48.951  1.00 41.06 ? 19   LEU C CG    1 
ATOM   4267  C  CD1   . LEU D  1 20  ? 21.164  -50.933 48.870  1.00 44.38 ? 19   LEU C CD1   1 
ATOM   4268  C  CD2   . LEU D  1 20  ? 19.161  -51.750 47.606  1.00 40.32 ? 19   LEU C CD2   1 
ATOM   4269  N  N     . LEU D  1 21  ? 17.241  -51.271 51.685  1.00 37.26 ? 20   LEU C N     1 
ATOM   4270  C  CA    . LEU D  1 21  ? 16.129  -50.365 51.934  1.00 37.35 ? 20   LEU C CA    1 
ATOM   4271  C  C     . LEU D  1 21  ? 16.078  -49.885 53.393  1.00 36.69 ? 20   LEU C C     1 
ATOM   4272  O  O     . LEU D  1 21  ? 15.901  -48.694 53.671  1.00 36.46 ? 20   LEU C O     1 
ATOM   4273  C  CB    . LEU D  1 21  ? 14.814  -51.025 51.536  1.00 37.00 ? 20   LEU C CB    1 
ATOM   4274  C  CG    . LEU D  1 21  ? 14.706  -51.275 50.030  1.00 38.20 ? 20   LEU C CG    1 
ATOM   4275  C  CD1   . LEU D  1 21  ? 13.431  -52.103 49.688  1.00 38.81 ? 20   LEU C CD1   1 
ATOM   4276  C  CD2   . LEU D  1 21  ? 14.768  -49.943 49.219  1.00 36.89 ? 20   LEU C CD2   1 
ATOM   4277  N  N     . ILE D  1 22  ? 16.252  -50.819 54.315  1.00 36.30 ? 21   ILE C N     1 
ATOM   4278  C  CA    . ILE D  1 22  ? 16.178  -50.508 55.729  1.00 35.99 ? 21   ILE C CA    1 
ATOM   4279  C  C     . ILE D  1 22  ? 17.419  -49.699 56.189  1.00 35.78 ? 21   ILE C C     1 
ATOM   4280  O  O     . ILE D  1 22  ? 17.284  -48.763 56.970  1.00 35.92 ? 21   ILE C O     1 
ATOM   4281  C  CB    . ILE D  1 22  ? 15.931  -51.807 56.561  1.00 36.17 ? 21   ILE C CB    1 
ATOM   4282  C  CG1   . ILE D  1 22  ? 14.606  -52.465 56.121  1.00 36.37 ? 21   ILE C CG1   1 
ATOM   4283  C  CG2   . ILE D  1 22  ? 15.949  -51.532 58.105  1.00 34.26 ? 21   ILE C CG2   1 
ATOM   4284  C  CD1   . ILE D  1 22  ? 13.442  -51.503 56.048  1.00 35.51 ? 21   ILE C CD1   1 
ATOM   4285  N  N     . SER D  1 23  ? 18.602  -50.014 55.672  1.00 35.74 ? 22   SER C N     1 
ATOM   4286  C  CA    . SER D  1 23  ? 19.805  -49.244 56.032  1.00 35.49 ? 22   SER C CA    1 
ATOM   4287  C  C     . SER D  1 23  ? 19.665  -47.797 55.585  1.00 35.99 ? 22   SER C C     1 
ATOM   4288  O  O     . SER D  1 23  ? 20.126  -46.889 56.278  1.00 34.92 ? 22   SER C O     1 
ATOM   4289  C  CB    . SER D  1 23  ? 21.074  -49.826 55.420  1.00 35.27 ? 22   SER C CB    1 
ATOM   4290  O  OG    . SER D  1 23  ? 22.253  -49.207 55.959  1.00 34.12 ? 22   SER C OG    1 
ATOM   4291  N  N     . TYR D  1 24  ? 19.037  -47.595 54.424  1.00 36.03 ? 23   TYR C N     1 
ATOM   4292  C  CA    . TYR D  1 24  ? 18.900  -46.265 53.841  1.00 36.46 ? 23   TYR C CA    1 
ATOM   4293  C  C     . TYR D  1 24  ? 17.841  -45.429 54.557  1.00 36.68 ? 23   TYR C C     1 
ATOM   4294  O  O     . TYR D  1 24  ? 18.092  -44.292 54.943  1.00 35.87 ? 23   TYR C O     1 
ATOM   4295  C  CB    . TYR D  1 24  ? 18.565  -46.375 52.346  1.00 36.75 ? 23   TYR C CB    1 
ATOM   4296  C  CG    . TYR D  1 24  ? 18.177  -45.065 51.708  1.00 36.52 ? 23   TYR C CG    1 
ATOM   4297  C  CD1   . TYR D  1 24  ? 19.110  -44.044 51.536  1.00 37.77 ? 23   TYR C CD1   1 
ATOM   4298  C  CD2   . TYR D  1 24  ? 16.879  -44.847 51.273  1.00 36.45 ? 23   TYR C CD2   1 
ATOM   4299  C  CE1   . TYR D  1 24  ? 18.752  -42.843 50.948  1.00 36.71 ? 23   TYR C CE1   1 
ATOM   4300  C  CE2   . TYR D  1 24  ? 16.522  -43.665 50.679  1.00 36.65 ? 23   TYR C CE2   1 
ATOM   4301  C  CZ    . TYR D  1 24  ? 17.456  -42.667 50.528  1.00 36.58 ? 23   TYR C CZ    1 
ATOM   4302  O  OH    . TYR D  1 24  ? 17.068  -41.490 49.944  1.00 39.15 ? 23   TYR C OH    1 
ATOM   4303  N  N     . THR D  1 25  ? 16.665  -46.023 54.749  1.00 37.31 ? 24   THR C N     1 
ATOM   4304  C  CA    . THR D  1 25  ? 15.526  -45.320 55.329  1.00 37.56 ? 24   THR C CA    1 
ATOM   4305  C  C     . THR D  1 25  ? 15.592  -45.082 56.824  1.00 37.94 ? 24   THR C C     1 
ATOM   4306  O  O     . THR D  1 25  ? 15.100  -44.050 57.316  1.00 38.33 ? 24   THR C O     1 
ATOM   4307  C  CB    . THR D  1 25  ? 14.211  -46.016 54.984  1.00 37.75 ? 24   THR C CB    1 
ATOM   4308  O  OG1   . THR D  1 25  ? 14.226  -47.375 55.432  1.00 37.86 ? 24   THR C OG1   1 
ATOM   4309  C  CG2   . THR D  1 25  ? 14.013  -45.976 53.484  1.00 37.05 ? 24   THR C CG2   1 
ATOM   4310  N  N     . THR D  1 26  ? 16.213  -46.008 57.546  1.00 38.17 ? 25   THR C N     1 
ATOM   4311  C  CA    . THR D  1 26  ? 16.217  -45.961 58.995  1.00 38.23 ? 25   THR C CA    1 
ATOM   4312  C  C     . THR D  1 26  ? 17.601  -45.904 59.634  1.00 38.51 ? 25   THR C C     1 
ATOM   4313  O  O     . THR D  1 26  ? 17.683  -45.750 60.837  1.00 38.61 ? 25   THR C O     1 
ATOM   4314  C  CB    . THR D  1 26  ? 15.476  -47.183 59.577  1.00 38.20 ? 25   THR C CB    1 
ATOM   4315  O  OG1   . THR D  1 26  ? 16.275  -48.360 59.403  1.00 39.12 ? 25   THR C OG1   1 
ATOM   4316  C  CG2   . THR D  1 26  ? 14.156  -47.362 58.899  1.00 35.86 ? 25   THR C CG2   1 
ATOM   4317  N  N     . ASN D  1 27  ? 18.666  -46.035 58.847  1.00 38.79 ? 26   ASN C N     1 
ATOM   4318  C  CA    . ASN D  1 27  ? 20.041  -46.097 59.361  1.00 39.45 ? 26   ASN C CA    1 
ATOM   4319  C  C     . ASN D  1 27  ? 20.387  -47.241 60.323  1.00 39.23 ? 26   ASN C C     1 
ATOM   4320  O  O     . ASN D  1 27  ? 21.283  -47.105 61.169  1.00 39.10 ? 26   ASN C O     1 
ATOM   4321  C  CB    . ASN D  1 27  ? 20.470  -44.755 59.956  1.00 39.91 ? 26   ASN C CB    1 
ATOM   4322  C  CG    . ASN D  1 27  ? 21.561  -44.113 59.154  1.00 43.08 ? 26   ASN C CG    1 
ATOM   4323  O  OD1   . ASN D  1 27  ? 21.312  -43.590 58.057  1.00 48.58 ? 26   ASN C OD1   1 
ATOM   4324  N  ND2   . ASN D  1 27  ? 22.794  -44.179 59.662  1.00 45.36 ? 26   ASN C ND2   1 
ATOM   4325  N  N     . ALA D  1 28  ? 19.711  -48.372 60.154  1.00 38.68 ? 27   ALA C N     1 
ATOM   4326  C  CA    . ALA D  1 28  ? 20.041  -49.593 60.873  1.00 38.48 ? 27   ALA C CA    1 
ATOM   4327  C  C     . ALA D  1 28  ? 20.174  -50.771 59.888  1.00 38.15 ? 27   ALA C C     1 
ATOM   4328  O  O     . ALA D  1 28  ? 19.466  -50.850 58.867  1.00 37.85 ? 27   ALA C O     1 
ATOM   4329  C  CB    . ALA D  1 28  ? 18.998  -49.896 61.933  1.00 38.18 ? 27   ALA C CB    1 
ATOM   4330  N  N     . PHE D  1 29  ? 21.138  -51.635 60.185  1.00 37.56 ? 28   PHE C N     1 
ATOM   4331  C  CA    . PHE D  1 29  ? 21.344  -52.874 59.468  1.00 37.63 ? 28   PHE C CA    1 
ATOM   4332  C  C     . PHE D  1 29  ? 20.589  -53.948 60.261  1.00 37.54 ? 28   PHE C C     1 
ATOM   4333  O  O     . PHE D  1 29  ? 20.915  -54.194 61.411  1.00 36.88 ? 28   PHE C O     1 
ATOM   4334  C  CB    . PHE D  1 29  ? 22.850  -53.191 59.398  1.00 36.96 ? 28   PHE C CB    1 
ATOM   4335  C  CG    . PHE D  1 29  ? 23.182  -54.376 58.539  1.00 36.82 ? 28   PHE C CG    1 
ATOM   4336  C  CD1   . PHE D  1 29  ? 23.228  -54.256 57.161  1.00 36.01 ? 28   PHE C CD1   1 
ATOM   4337  C  CD2   . PHE D  1 29  ? 23.456  -55.613 59.104  1.00 36.59 ? 28   PHE C CD2   1 
ATOM   4338  C  CE1   . PHE D  1 29  ? 23.517  -55.353 56.359  1.00 35.78 ? 28   PHE C CE1   1 
ATOM   4339  C  CE2   . PHE D  1 29  ? 23.751  -56.710 58.312  1.00 35.45 ? 28   PHE C CE2   1 
ATOM   4340  C  CZ    . PHE D  1 29  ? 23.781  -56.587 56.945  1.00 35.36 ? 28   PHE C CZ    1 
ATOM   4341  N  N     . PRO D  1 30  ? 19.550  -54.566 59.664  1.00 38.49 ? 29   PRO C N     1 
ATOM   4342  C  CA    . PRO D  1 30  ? 18.821  -55.610 60.380  1.00 38.88 ? 29   PRO C CA    1 
ATOM   4343  C  C     . PRO D  1 30  ? 19.738  -56.701 60.954  1.00 39.39 ? 29   PRO C C     1 
ATOM   4344  O  O     . PRO D  1 30  ? 20.691  -57.113 60.306  1.00 39.48 ? 29   PRO C O     1 
ATOM   4345  C  CB    . PRO D  1 30  ? 17.915  -56.185 59.300  1.00 39.02 ? 29   PRO C CB    1 
ATOM   4346  C  CG    . PRO D  1 30  ? 17.670  -55.062 58.380  1.00 38.70 ? 29   PRO C CG    1 
ATOM   4347  C  CD    . PRO D  1 30  ? 18.979  -54.333 58.328  1.00 38.33 ? 29   PRO C CD    1 
ATOM   4348  N  N     . GLY D  1 31  ? 19.453  -57.145 62.170  1.00 40.10 ? 30   GLY C N     1 
ATOM   4349  C  CA    . GLY D  1 31  ? 20.288  -58.129 62.851  1.00 40.44 ? 30   GLY C CA    1 
ATOM   4350  C  C     . GLY D  1 31  ? 19.990  -59.593 62.521  1.00 41.03 ? 30   GLY C C     1 
ATOM   4351  O  O     . GLY D  1 31  ? 20.693  -60.488 62.976  1.00 41.38 ? 30   GLY C O     1 
ATOM   4352  N  N     . GLU D  1 32  ? 18.928  -59.839 61.776  1.00 41.11 ? 31   GLU C N     1 
ATOM   4353  C  CA    . GLU D  1 32  ? 18.528  -61.193 61.407  1.00 41.82 ? 31   GLU C CA    1 
ATOM   4354  C  C     . GLU D  1 32  ? 18.234  -61.210 59.937  1.00 40.32 ? 31   GLU C C     1 
ATOM   4355  O  O     . GLU D  1 32  ? 17.777  -60.210 59.384  1.00 40.19 ? 31   GLU C O     1 
ATOM   4356  C  CB    . GLU D  1 32  ? 17.271  -61.633 62.165  1.00 42.15 ? 31   GLU C CB    1 
ATOM   4357  C  CG    . GLU D  1 32  ? 17.566  -62.514 63.346  1.00 44.56 ? 31   GLU C CG    1 
ATOM   4358  C  CD    . GLU D  1 32  ? 16.322  -63.130 63.955  1.00 44.90 ? 31   GLU C CD    1 
ATOM   4359  O  OE1   . GLU D  1 32  ? 15.430  -62.364 64.384  1.00 50.80 ? 31   GLU C OE1   1 
ATOM   4360  O  OE2   . GLU D  1 32  ? 16.261  -64.385 64.031  1.00 49.87 ? 31   GLU C OE2   1 
ATOM   4361  N  N     . TYR D  1 33  ? 18.525  -62.349 59.318  1.00 39.14 ? 32   TYR C N     1 
ATOM   4362  C  CA    . TYR D  1 33  ? 18.215  -62.608 57.924  1.00 37.70 ? 32   TYR C CA    1 
ATOM   4363  C  C     . TYR D  1 33  ? 16.847  -63.259 57.899  1.00 37.40 ? 32   TYR C C     1 
ATOM   4364  O  O     . TYR D  1 33  ? 16.717  -64.420 58.273  1.00 36.23 ? 32   TYR C O     1 
ATOM   4365  C  CB    . TYR D  1 33  ? 19.284  -63.543 57.317  1.00 37.92 ? 32   TYR C CB    1 
ATOM   4366  C  CG    . TYR D  1 33  ? 18.939  -64.145 55.961  1.00 36.31 ? 32   TYR C CG    1 
ATOM   4367  C  CD1   . TYR D  1 33  ? 18.121  -63.476 55.070  1.00 36.04 ? 32   TYR C CD1   1 
ATOM   4368  C  CD2   . TYR D  1 33  ? 19.477  -65.377 55.563  1.00 36.48 ? 32   TYR C CD2   1 
ATOM   4369  C  CE1   . TYR D  1 33  ? 17.824  -64.007 53.836  1.00 36.42 ? 32   TYR C CE1   1 
ATOM   4370  C  CE2   . TYR D  1 33  ? 19.178  -65.922 54.313  1.00 37.17 ? 32   TYR C CE2   1 
ATOM   4371  C  CZ    . TYR D  1 33  ? 18.351  -65.228 53.466  1.00 36.18 ? 32   TYR C CZ    1 
ATOM   4372  O  OH    . TYR D  1 33  ? 18.033  -65.738 52.251  1.00 37.54 ? 32   TYR C OH    1 
ATOM   4373  N  N     . ILE D  1 34  ? 15.834  -62.488 57.461  1.00 37.12 ? 33   ILE C N     1 
ATOM   4374  C  CA    . ILE D  1 34  ? 14.452  -62.958 57.323  1.00 36.69 ? 33   ILE C CA    1 
ATOM   4375  C  C     . ILE D  1 34  ? 13.947  -62.673 55.906  1.00 35.98 ? 33   ILE C C     1 
ATOM   4376  O  O     . ILE D  1 34  ? 13.725  -61.511 55.565  1.00 35.67 ? 33   ILE C O     1 
ATOM   4377  C  CB    . ILE D  1 34  ? 13.508  -62.262 58.357  1.00 37.10 ? 33   ILE C CB    1 
ATOM   4378  C  CG1   . ILE D  1 34  ? 14.040  -62.498 59.783  1.00 38.21 ? 33   ILE C CG1   1 
ATOM   4379  C  CG2   . ILE D  1 34  ? 12.036  -62.759 58.196  1.00 36.34 ? 33   ILE C CG2   1 
ATOM   4380  C  CD1   . ILE D  1 34  ? 13.244  -61.848 60.836  1.00 39.84 ? 33   ILE C CD1   1 
ATOM   4381  N  N     . PRO D  1 35  ? 13.818  -63.721 55.057  1.00 35.23 ? 34   PRO C N     1 
ATOM   4382  C  CA    . PRO D  1 35  ? 13.288  -63.501 53.695  1.00 35.32 ? 34   PRO C CA    1 
ATOM   4383  C  C     . PRO D  1 35  ? 11.938  -62.772 53.605  1.00 35.65 ? 34   PRO C C     1 
ATOM   4384  O  O     . PRO D  1 35  ? 11.059  -62.982 54.432  1.00 35.91 ? 34   PRO C O     1 
ATOM   4385  C  CB    . PRO D  1 35  ? 13.205  -64.926 53.112  1.00 35.37 ? 34   PRO C CB    1 
ATOM   4386  C  CG    . PRO D  1 35  ? 14.387  -65.669 53.842  1.00 34.58 ? 34   PRO C CG    1 
ATOM   4387  C  CD    . PRO D  1 35  ? 14.271  -65.119 55.251  1.00 35.11 ? 34   PRO C CD    1 
ATOM   4388  N  N     . THR D  1 36  ? 11.814  -61.936 52.575  1.00 35.96 ? 35   THR C N     1 
ATOM   4389  C  CA    . THR D  1 36  ? 10.636  -61.108 52.302  1.00 36.43 ? 35   THR C CA    1 
ATOM   4390  C  C     . THR D  1 36  ? 9.602   -61.876 51.512  1.00 35.99 ? 35   THR C C     1 
ATOM   4391  O  O     . THR D  1 36  ? 9.956   -62.703 50.648  1.00 35.70 ? 35   THR C O     1 
ATOM   4392  C  CB    . THR D  1 36  ? 11.074  -59.893 51.460  1.00 36.67 ? 35   THR C CB    1 
ATOM   4393  O  OG1   . THR D  1 36  ? 12.127  -59.211 52.160  1.00 38.01 ? 35   THR C OG1   1 
ATOM   4394  C  CG2   . THR D  1 36  ? 9.936   -58.939 51.159  1.00 36.17 ? 35   THR C CG2   1 
ATOM   4395  N  N     . VAL D  1 37  ? 8.331   -61.596 51.817  1.00 35.72 ? 36   VAL C N     1 
ATOM   4396  C  CA    . VAL D  1 37  ? 7.203   -61.983 50.971  1.00 35.40 ? 36   VAL C CA    1 
ATOM   4397  C  C     . VAL D  1 37  ? 6.793   -60.742 50.156  1.00 35.91 ? 36   VAL C C     1 
ATOM   4398  O  O     . VAL D  1 37  ? 6.962   -60.734 48.946  1.00 36.78 ? 36   VAL C O     1 
ATOM   4399  C  CB    . VAL D  1 37  ? 6.002   -62.538 51.782  1.00 34.90 ? 36   VAL C CB    1 
ATOM   4400  C  CG1   . VAL D  1 37  ? 4.882   -62.976 50.852  1.00 34.43 ? 36   VAL C CG1   1 
ATOM   4401  C  CG2   . VAL D  1 37  ? 6.423   -63.708 52.644  1.00 35.55 ? 36   VAL C CG2   1 
ATOM   4402  N  N     . PHE D  1 38  ? 6.240   -59.711 50.815  1.00 35.71 ? 37   PHE C N     1 
ATOM   4403  C  CA    . PHE D  1 38  ? 6.206   -58.366 50.246  1.00 35.44 ? 37   PHE C CA    1 
ATOM   4404  C  C     . PHE D  1 38  ? 6.118   -57.308 51.331  1.00 35.59 ? 37   PHE C C     1 
ATOM   4405  O  O     . PHE D  1 38  ? 5.462   -57.502 52.349  1.00 36.77 ? 37   PHE C O     1 
ATOM   4406  C  CB    . PHE D  1 38  ? 5.070   -58.189 49.245  1.00 35.15 ? 37   PHE C CB    1 
ATOM   4407  C  CG    . PHE D  1 38  ? 4.911   -56.783 48.794  1.00 34.75 ? 37   PHE C CG    1 
ATOM   4408  C  CD1   . PHE D  1 38  ? 5.794   -56.239 47.877  1.00 34.86 ? 37   PHE C CD1   1 
ATOM   4409  C  CD2   . PHE D  1 38  ? 3.920   -55.975 49.333  1.00 32.75 ? 37   PHE C CD2   1 
ATOM   4410  C  CE1   . PHE D  1 38  ? 5.677   -54.892 47.478  1.00 35.54 ? 37   PHE C CE1   1 
ATOM   4411  C  CE2   . PHE D  1 38  ? 3.793   -54.647 48.943  1.00 35.09 ? 37   PHE C CE2   1 
ATOM   4412  C  CZ    . PHE D  1 38  ? 4.676   -54.102 48.018  1.00 35.91 ? 37   PHE C CZ    1 
ATOM   4413  N  N     . ASP D  1 39  ? 6.812   -56.199 51.131  1.00 35.67 ? 38   ASP C N     1 
ATOM   4414  C  CA    . ASP D  1 39  ? 6.732   -55.062 52.041  1.00 36.01 ? 38   ASP C CA    1 
ATOM   4415  C  C     . ASP D  1 39  ? 6.784   -53.752 51.256  1.00 36.32 ? 38   ASP C C     1 
ATOM   4416  O  O     . ASP D  1 39  ? 7.497   -53.652 50.291  1.00 35.90 ? 38   ASP C O     1 
ATOM   4417  C  CB    . ASP D  1 39  ? 7.872   -55.072 53.058  1.00 35.73 ? 38   ASP C CB    1 
ATOM   4418  C  CG    . ASP D  1 39  ? 7.746   -56.180 54.084  1.00 35.70 ? 38   ASP C CG    1 
ATOM   4419  O  OD1   . ASP D  1 39  ? 6.930   -56.050 55.005  1.00 35.88 ? 38   ASP C OD1   1 
ATOM   4420  O  OD2   . ASP D  1 39  ? 8.509   -57.165 53.996  1.00 38.53 ? 38   ASP C OD2   1 
ATOM   4421  N  N     . ASN D  1 40  ? 6.036   -52.755 51.709  1.00 37.05 ? 39   ASN C N     1 
ATOM   4422  C  CA    . ASN D  1 40  ? 6.051   -51.429 51.115  1.00 37.93 ? 39   ASN C CA    1 
ATOM   4423  C  C     . ASN D  1 40  ? 6.406   -50.404 52.199  1.00 38.44 ? 39   ASN C C     1 
ATOM   4424  O  O     . ASN D  1 40  ? 5.722   -50.293 53.220  1.00 37.48 ? 39   ASN C O     1 
ATOM   4425  C  CB    . ASN D  1 40  ? 4.690   -51.122 50.472  1.00 38.15 ? 39   ASN C CB    1 
ATOM   4426  C  CG    . ASN D  1 40  ? 4.596   -49.713 49.849  1.00 38.85 ? 39   ASN C CG    1 
ATOM   4427  O  OD1   . ASN D  1 40  ? 3.693   -48.948 50.179  1.00 41.46 ? 39   ASN C OD1   1 
ATOM   4428  N  ND2   . ASN D  1 40  ? 5.478   -49.398 48.937  1.00 38.70 ? 39   ASN C ND2   1 
ATOM   4429  N  N     . TYR D  1 41  ? 7.498   -49.682 51.965  1.00 38.72 ? 40   TYR C N     1 
ATOM   4430  C  CA    . TYR D  1 41  ? 7.926   -48.588 52.831  1.00 39.21 ? 40   TYR C CA    1 
ATOM   4431  C  C     . TYR D  1 41  ? 7.746   -47.252 52.131  1.00 39.09 ? 40   TYR C C     1 
ATOM   4432  O  O     . TYR D  1 41  ? 7.725   -47.197 50.915  1.00 38.93 ? 40   TYR C O     1 
ATOM   4433  C  CB    . TYR D  1 41  ? 9.409   -48.727 53.179  1.00 39.22 ? 40   TYR C CB    1 
ATOM   4434  C  CG    . TYR D  1 41  ? 9.854   -50.150 53.403  1.00 40.45 ? 40   TYR C CG    1 
ATOM   4435  C  CD1   . TYR D  1 41  ? 10.854  -50.717 52.626  1.00 41.56 ? 40   TYR C CD1   1 
ATOM   4436  C  CD2   . TYR D  1 41  ? 9.274   -50.923 54.396  1.00 39.11 ? 40   TYR C CD2   1 
ATOM   4437  C  CE1   . TYR D  1 41  ? 11.272  -52.026 52.848  1.00 43.34 ? 40   TYR C CE1   1 
ATOM   4438  C  CE2   . TYR D  1 41  ? 9.665   -52.206 54.613  1.00 40.78 ? 40   TYR C CE2   1 
ATOM   4439  C  CZ    . TYR D  1 41  ? 10.664  -52.764 53.856  1.00 41.71 ? 40   TYR C CZ    1 
ATOM   4440  O  OH    . TYR D  1 41  ? 11.035  -54.066 54.099  1.00 41.45 ? 40   TYR C OH    1 
ATOM   4441  N  N     . SER D  1 42  ? 7.644   -46.194 52.933  1.00 39.52 ? 41   SER C N     1 
ATOM   4442  C  CA    A SER D  1 42  ? 7.588   -44.807 52.485  0.50 39.79 ? 41   SER C CA    1 
ATOM   4443  C  CA    B SER D  1 42  ? 7.684   -44.844 52.411  0.50 39.60 ? 41   SER C CA    1 
ATOM   4444  C  C     . SER D  1 42  ? 8.616   -43.999 53.265  1.00 39.82 ? 41   SER C C     1 
ATOM   4445  O  O     . SER D  1 42  ? 8.776   -44.236 54.456  1.00 39.38 ? 41   SER C O     1 
ATOM   4446  C  CB    A SER D  1 42  ? 6.204   -44.211 52.778  0.50 39.82 ? 41   SER C CB    1 
ATOM   4447  C  CB    B SER D  1 42  ? 6.288   -44.222 52.343  0.50 39.74 ? 41   SER C CB    1 
ATOM   4448  O  OG    A SER D  1 42  ? 5.412   -44.108 51.610  0.50 41.39 ? 41   SER C OG    1 
ATOM   4449  O  OG    B SER D  1 42  ? 5.880   -43.707 53.588  0.50 39.65 ? 41   SER C OG    1 
ATOM   4450  N  N     . ALA D  1 43  ? 9.256   -43.035 52.605  1.00 39.74 ? 42   ALA C N     1 
ATOM   4451  C  CA    . ALA D  1 43  ? 10.086  -42.034 53.253  1.00 39.87 ? 42   ALA C CA    1 
ATOM   4452  C  C     . ALA D  1 43  ? 9.963   -40.692 52.504  1.00 40.19 ? 42   ALA C C     1 
ATOM   4453  O  O     . ALA D  1 43  ? 9.699   -40.652 51.293  1.00 39.72 ? 42   ALA C O     1 
ATOM   4454  C  CB    . ALA D  1 43  ? 11.543  -42.476 53.310  1.00 39.18 ? 42   ALA C CB    1 
ATOM   4455  N  N     . ASN D  1 44  ? 10.158  -39.607 53.244  1.00 40.67 ? 43   ASN C N     1 
ATOM   4456  C  CA    . ASN D  1 44  ? 10.251  -38.282 52.670  1.00 41.50 ? 43   ASN C CA    1 
ATOM   4457  C  C     . ASN D  1 44  ? 11.702  -37.999 52.345  1.00 41.44 ? 43   ASN C C     1 
ATOM   4458  O  O     . ASN D  1 44  ? 12.592  -38.423 53.079  1.00 41.30 ? 43   ASN C O     1 
ATOM   4459  C  CB    . ASN D  1 44  ? 9.744   -37.222 53.651  1.00 41.83 ? 43   ASN C CB    1 
ATOM   4460  C  CG    . ASN D  1 44  ? 8.262   -36.967 53.531  1.00 44.09 ? 43   ASN C CG    1 
ATOM   4461  O  OD1   . ASN D  1 44  ? 7.656   -37.203 52.483  1.00 49.32 ? 43   ASN C OD1   1 
ATOM   4462  N  ND2   . ASN D  1 44  ? 7.666   -36.457 54.605  1.00 47.09 ? 43   ASN C ND2   1 
ATOM   4463  N  N     . VAL D  1 45  ? 11.927  -37.316 51.226  1.00 41.64 ? 44   VAL C N     1 
ATOM   4464  C  CA    . VAL D  1 45  ? 13.243  -36.786 50.854  1.00 41.87 ? 44   VAL C CA    1 
ATOM   4465  C  C     . VAL D  1 45  ? 13.075  -35.371 50.309  1.00 42.45 ? 44   VAL C C     1 
ATOM   4466  O  O     . VAL D  1 45  ? 12.084  -35.069 49.646  1.00 42.26 ? 44   VAL C O     1 
ATOM   4467  C  CB    . VAL D  1 45  ? 13.941  -37.667 49.787  1.00 41.85 ? 44   VAL C CB    1 
ATOM   4468  C  CG1   . VAL D  1 45  ? 15.401  -37.235 49.588  1.00 40.51 ? 44   VAL C CG1   1 
ATOM   4469  C  CG2   . VAL D  1 45  ? 13.856  -39.115 50.179  1.00 41.01 ? 44   VAL C CG2   1 
ATOM   4470  N  N     . MET D  1 46  ? 14.035  -34.500 50.605  1.00 43.03 ? 45   MET C N     1 
ATOM   4471  C  CA    . MET D  1 46  ? 14.024  -33.138 50.071  1.00 43.61 ? 45   MET C CA    1 
ATOM   4472  C  C     . MET D  1 46  ? 14.890  -33.094 48.814  1.00 43.53 ? 45   MET C C     1 
ATOM   4473  O  O     . MET D  1 46  ? 16.079  -33.399 48.876  1.00 43.19 ? 45   MET C O     1 
ATOM   4474  C  CB    . MET D  1 46  ? 14.535  -32.145 51.114  1.00 43.83 ? 45   MET C CB    1 
ATOM   4475  C  CG    . MET D  1 46  ? 13.929  -30.758 50.997  1.00 45.81 ? 45   MET C CG    1 
ATOM   4476  S  SD    . MET D  1 46  ? 12.182  -30.625 51.474  1.00 49.15 ? 45   MET C SD    1 
ATOM   4477  C  CE    . MET D  1 46  ? 11.918  -32.119 52.399  1.00 43.63 ? 45   MET C CE    1 
ATOM   4478  N  N     . VAL D  1 47  ? 14.275  -32.743 47.684  1.00 43.70 ? 46   VAL C N     1 
ATOM   4479  C  CA    . VAL D  1 47  ? 14.941  -32.691 46.380  1.00 43.97 ? 46   VAL C CA    1 
ATOM   4480  C  C     . VAL D  1 47  ? 14.925  -31.259 45.859  1.00 44.40 ? 46   VAL C C     1 
ATOM   4481  O  O     . VAL D  1 47  ? 13.869  -30.736 45.510  1.00 44.27 ? 46   VAL C O     1 
ATOM   4482  C  CB    . VAL D  1 47  ? 14.240  -33.601 45.353  1.00 43.94 ? 46   VAL C CB    1 
ATOM   4483  C  CG1   . VAL D  1 47  ? 14.991  -33.601 44.030  1.00 44.08 ? 46   VAL C CG1   1 
ATOM   4484  C  CG2   . VAL D  1 47  ? 14.132  -35.013 45.889  1.00 43.86 ? 46   VAL C CG2   1 
ATOM   4485  N  N     . ASP D  1 48  ? 16.099  -30.632 45.830  1.00 45.17 ? 47   ASP C N     1 
ATOM   4486  C  CA    . ASP D  1 48  ? 16.251  -29.232 45.412  1.00 45.96 ? 47   ASP C CA    1 
ATOM   4487  C  C     . ASP D  1 48  ? 15.197  -28.339 46.076  1.00 45.95 ? 47   ASP C C     1 
ATOM   4488  O  O     . ASP D  1 48  ? 14.506  -27.566 45.407  1.00 45.76 ? 47   ASP C O     1 
ATOM   4489  C  CB    . ASP D  1 48  ? 16.174  -29.097 43.877  1.00 46.43 ? 47   ASP C CB    1 
ATOM   4490  C  CG    . ASP D  1 48  ? 17.127  -30.045 43.144  1.00 48.25 ? 47   ASP C CG    1 
ATOM   4491  O  OD1   . ASP D  1 48  ? 18.303  -30.165 43.559  1.00 50.41 ? 47   ASP C OD1   1 
ATOM   4492  O  OD2   . ASP D  1 48  ? 16.687  -30.681 42.154  1.00 51.28 ? 47   ASP C OD2   1 
ATOM   4493  N  N     . GLY D  1 49  ? 15.065  -28.471 47.393  1.00 45.97 ? 48   GLY C N     1 
ATOM   4494  C  CA    . GLY D  1 49  ? 14.147  -27.641 48.164  1.00 46.05 ? 48   GLY C CA    1 
ATOM   4495  C  C     . GLY D  1 49  ? 12.697  -28.087 48.205  1.00 46.04 ? 48   GLY C C     1 
ATOM   4496  O  O     . GLY D  1 49  ? 11.917  -27.526 48.967  1.00 46.38 ? 48   GLY C O     1 
ATOM   4497  N  N     . LYS D  1 50  ? 12.333  -29.094 47.410  1.00 45.97 ? 49   LYS C N     1 
ATOM   4498  C  CA    . LYS D  1 50  ? 10.949  -29.578 47.331  1.00 45.47 ? 49   LYS C CA    1 
ATOM   4499  C  C     . LYS D  1 50  ? 10.837  -30.974 47.929  1.00 45.06 ? 49   LYS C C     1 
ATOM   4500  O  O     . LYS D  1 50  ? 11.652  -31.849 47.638  1.00 43.96 ? 49   LYS C O     1 
ATOM   4501  C  CB    . LYS D  1 50  ? 10.466  -29.616 45.879  1.00 45.65 ? 49   LYS C CB    1 
ATOM   4502  N  N     . PRO D  1 51  ? 9.809   -31.193 48.765  1.00 44.56 ? 50   PRO C N     1 
ATOM   4503  C  CA    . PRO D  1 51  ? 9.655   -32.498 49.381  1.00 44.22 ? 50   PRO C CA    1 
ATOM   4504  C  C     . PRO D  1 51  ? 9.145   -33.531 48.375  1.00 43.54 ? 50   PRO C C     1 
ATOM   4505  O  O     . PRO D  1 51  ? 8.298   -33.224 47.538  1.00 42.99 ? 50   PRO C O     1 
ATOM   4506  C  CB    . PRO D  1 51  ? 8.630   -32.234 50.488  1.00 44.05 ? 50   PRO C CB    1 
ATOM   4507  C  CG    . PRO D  1 51  ? 7.811   -31.129 49.970  1.00 44.13 ? 50   PRO C CG    1 
ATOM   4508  C  CD    . PRO D  1 51  ? 8.731   -30.268 49.156  1.00 44.48 ? 50   PRO C CD    1 
ATOM   4509  N  N     . VAL D  1 52  ? 9.685   -34.739 48.451  1.00 43.18 ? 51   VAL C N     1 
ATOM   4510  C  CA    . VAL D  1 52  ? 9.255   -35.841 47.584  1.00 42.75 ? 51   VAL C CA    1 
ATOM   4511  C  C     . VAL D  1 52  ? 8.948   -37.079 48.432  1.00 42.74 ? 51   VAL C C     1 
ATOM   4512  O  O     . VAL D  1 52  ? 9.667   -37.388 49.380  1.00 41.98 ? 51   VAL C O     1 
ATOM   4513  C  CB    . VAL D  1 52  ? 10.326  -36.166 46.514  1.00 42.78 ? 51   VAL C CB    1 
ATOM   4514  C  CG1   . VAL D  1 52  ? 9.873   -37.324 45.633  1.00 41.98 ? 51   VAL C CG1   1 
ATOM   4515  C  CG2   . VAL D  1 52  ? 10.618  -34.937 45.664  1.00 42.93 ? 51   VAL C CG2   1 
ATOM   4516  N  N     . ASN D  1 53  ? 7.855   -37.760 48.100  1.00 43.00 ? 52   ASN C N     1 
ATOM   4517  C  CA    . ASN D  1 53  ? 7.466   -38.989 48.776  1.00 43.29 ? 52   ASN C CA    1 
ATOM   4518  C  C     . ASN D  1 53  ? 8.019   -40.183 47.993  1.00 42.71 ? 52   ASN C C     1 
ATOM   4519  O  O     . ASN D  1 53  ? 7.554   -40.504 46.899  1.00 42.19 ? 52   ASN C O     1 
ATOM   4520  C  CB    . ASN D  1 53  ? 5.931   -39.066 48.921  1.00 43.89 ? 52   ASN C CB    1 
ATOM   4521  C  CG    . ASN D  1 53  ? 5.438   -40.432 49.466  1.00 46.37 ? 52   ASN C CG    1 
ATOM   4522  O  OD1   . ASN D  1 53  ? 6.155   -41.126 50.186  1.00 48.98 ? 52   ASN C OD1   1 
ATOM   4523  N  ND2   . ASN D  1 53  ? 4.202   -40.802 49.120  1.00 48.92 ? 52   ASN C ND2   1 
ATOM   4524  N  N     . LEU D  1 54  ? 9.035   -40.819 48.561  1.00 42.13 ? 53   LEU C N     1 
ATOM   4525  C  CA    . LEU D  1 54  ? 9.687   -41.962 47.942  1.00 41.86 ? 53   LEU C CA    1 
ATOM   4526  C  C     . LEU D  1 54  ? 9.028   -43.250 48.426  1.00 41.16 ? 53   LEU C C     1 
ATOM   4527  O  O     . LEU D  1 54  ? 9.178   -43.631 49.583  1.00 41.64 ? 53   LEU C O     1 
ATOM   4528  C  CB    . LEU D  1 54  ? 11.189  -41.963 48.272  1.00 41.66 ? 53   LEU C CB    1 
ATOM   4529  C  CG    . LEU D  1 54  ? 12.040  -43.119 47.736  1.00 42.87 ? 53   LEU C CG    1 
ATOM   4530  C  CD1   . LEU D  1 54  ? 11.857  -43.342 46.212  1.00 43.46 ? 53   LEU C CD1   1 
ATOM   4531  C  CD2   . LEU D  1 54  ? 13.512  -42.908 48.080  1.00 41.87 ? 53   LEU C CD2   1 
ATOM   4532  N  N     . GLY D  1 55  ? 8.294   -43.904 47.531  1.00 40.63 ? 54   GLY C N     1 
ATOM   4533  C  CA    . GLY D  1 55  ? 7.671   -45.206 47.800  1.00 40.13 ? 54   GLY C CA    1 
ATOM   4534  C  C     . GLY D  1 55  ? 8.550   -46.358 47.340  1.00 40.20 ? 54   GLY C C     1 
ATOM   4535  O  O     . GLY D  1 55  ? 9.040   -46.374 46.200  1.00 39.93 ? 54   GLY C O     1 
ATOM   4536  N  N     . LEU D  1 56  ? 8.751   -47.320 48.237  1.00 39.72 ? 55   LEU C N     1 
ATOM   4537  C  CA    . LEU D  1 56  ? 9.730   -48.369 48.044  1.00 39.20 ? 55   LEU C CA    1 
ATOM   4538  C  C     . LEU D  1 56  ? 9.009   -49.687 48.136  1.00 39.07 ? 55   LEU C C     1 
ATOM   4539  O  O     . LEU D  1 56  ? 8.280   -49.944 49.078  1.00 38.58 ? 55   LEU C O     1 
ATOM   4540  C  CB    . LEU D  1 56  ? 10.833  -48.266 49.087  1.00 39.65 ? 55   LEU C CB    1 
ATOM   4541  C  CG    . LEU D  1 56  ? 11.673  -46.974 49.021  1.00 40.07 ? 55   LEU C CG    1 
ATOM   4542  C  CD1   . LEU D  1 56  ? 12.413  -46.729 50.352  1.00 41.50 ? 55   LEU C CD1   1 
ATOM   4543  C  CD2   . LEU D  1 56  ? 12.666  -46.935 47.833  1.00 36.71 ? 55   LEU C CD2   1 
ATOM   4544  N  N     . TRP D  1 57  ? 9.182   -50.511 47.118  1.00 39.31 ? 56   TRP C N     1 
ATOM   4545  C  CA    . TRP D  1 57  ? 8.455   -51.748 47.014  1.00 39.44 ? 56   TRP C CA    1 
ATOM   4546  C  C     . TRP D  1 57  ? 9.479   -52.861 47.132  1.00 39.44 ? 56   TRP C C     1 
ATOM   4547  O  O     . TRP D  1 57  ? 10.306  -53.058 46.238  1.00 39.04 ? 56   TRP C O     1 
ATOM   4548  C  CB    . TRP D  1 57  ? 7.658   -51.741 45.705  1.00 40.58 ? 56   TRP C CB    1 
ATOM   4549  C  CG    . TRP D  1 57  ? 6.622   -50.610 45.676  1.00 41.76 ? 56   TRP C CG    1 
ATOM   4550  C  CD1   . TRP D  1 57  ? 6.854   -49.249 45.845  1.00 43.03 ? 56   TRP C CD1   1 
ATOM   4551  C  CD2   . TRP D  1 57  ? 5.216   -50.738 45.498  1.00 42.37 ? 56   TRP C CD2   1 
ATOM   4552  N  NE1   . TRP D  1 57  ? 5.678   -48.553 45.787  1.00 42.33 ? 56   TRP C NE1   1 
ATOM   4553  C  CE2   . TRP D  1 57  ? 4.660   -49.438 45.565  1.00 42.07 ? 56   TRP C CE2   1 
ATOM   4554  C  CE3   . TRP D  1 57  ? 4.376   -51.819 45.274  1.00 42.58 ? 56   TRP C CE3   1 
ATOM   4555  C  CZ2   . TRP D  1 57  ? 3.307   -49.196 45.399  1.00 43.00 ? 56   TRP C CZ2   1 
ATOM   4556  C  CZ3   . TRP D  1 57  ? 3.027   -51.587 45.118  1.00 44.07 ? 56   TRP C CZ3   1 
ATOM   4557  C  CH2   . TRP D  1 57  ? 2.497   -50.285 45.186  1.00 43.70 ? 56   TRP C CH2   1 
ATOM   4558  N  N     . ASP D  1 58  ? 9.458   -53.548 48.282  1.00 39.21 ? 57   ASP C N     1 
ATOM   4559  C  CA    . ASP D  1 58  ? 10.449  -54.573 48.615  1.00 39.02 ? 57   ASP C CA    1 
ATOM   4560  C  C     . ASP D  1 58  ? 9.904   -55.948 48.227  1.00 38.58 ? 57   ASP C C     1 
ATOM   4561  O  O     . ASP D  1 58  ? 8.941   -56.439 48.840  1.00 38.37 ? 57   ASP C O     1 
ATOM   4562  C  CB    . ASP D  1 58  ? 10.763  -54.505 50.128  1.00 39.83 ? 57   ASP C CB    1 
ATOM   4563  C  CG    . ASP D  1 58  ? 12.027  -55.255 50.513  1.00 40.32 ? 57   ASP C CG    1 
ATOM   4564  O  OD1   . ASP D  1 58  ? 12.731  -55.767 49.624  1.00 44.02 ? 57   ASP C OD1   1 
ATOM   4565  O  OD2   . ASP D  1 58  ? 12.326  -55.334 51.728  1.00 42.78 ? 57   ASP C OD2   1 
ATOM   4566  N  N     . THR D  1 59  ? 10.490  -56.558 47.196  1.00 37.54 ? 58   THR C N     1 
ATOM   4567  C  CA    . THR D  1 59  ? 9.937   -57.791 46.626  1.00 37.05 ? 58   THR C CA    1 
ATOM   4568  C  C     . THR D  1 59  ? 10.683  -59.026 47.071  1.00 37.14 ? 58   THR C C     1 
ATOM   4569  O  O     . THR D  1 59  ? 11.785  -58.935 47.632  1.00 38.08 ? 58   THR C O     1 
ATOM   4570  C  CB    . THR D  1 59  ? 9.883   -57.752 45.068  1.00 36.99 ? 58   THR C CB    1 
ATOM   4571  O  OG1   . THR D  1 59  ? 11.212  -57.868 44.525  1.00 36.34 ? 58   THR C OG1   1 
ATOM   4572  C  CG2   . THR D  1 59  ? 9.197   -56.466 44.589  1.00 35.25 ? 58   THR C CG2   1 
ATOM   4573  N  N     . ALA D  1 60  ? 10.074  -60.182 46.817  1.00 37.03 ? 59   ALA C N     1 
ATOM   4574  C  CA    . ALA D  1 60  ? 10.632  -61.483 47.197  1.00 37.60 ? 59   ALA C CA    1 
ATOM   4575  C  C     . ALA D  1 60  ? 11.627  -62.043 46.173  1.00 37.58 ? 59   ALA C C     1 
ATOM   4576  O  O     . ALA D  1 60  ? 11.278  -62.258 45.021  1.00 38.32 ? 59   ALA C O     1 
ATOM   4577  C  CB    . ALA D  1 60  ? 9.516   -62.489 47.401  1.00 36.52 ? 59   ALA C CB    1 
ATOM   4578  N  N     . GLY D  1 61  ? 12.852  -62.301 46.603  1.00 37.91 ? 60   GLY C N     1 
ATOM   4579  C  CA    . GLY D  1 61  ? 13.816  -63.072 45.793  1.00 37.72 ? 60   GLY C CA    1 
ATOM   4580  C  C     . GLY D  1 61  ? 13.467  -64.540 45.588  1.00 37.94 ? 60   GLY C C     1 
ATOM   4581  O  O     . GLY D  1 61  ? 13.805  -65.101 44.571  1.00 38.50 ? 60   GLY C O     1 
ATOM   4582  N  N     . GLN D  1 62  ? 12.801  -65.168 46.555  1.00 38.74 ? 61   GLN C N     1 
ATOM   4583  C  CA    . GLN D  1 62  ? 12.309  -66.555 46.413  1.00 38.96 ? 61   GLN C CA    1 
ATOM   4584  C  C     . GLN D  1 62  ? 11.421  -66.767 45.181  1.00 38.98 ? 61   GLN C C     1 
ATOM   4585  O  O     . GLN D  1 62  ? 10.424  -66.080 44.989  1.00 38.76 ? 61   GLN C O     1 
ATOM   4586  C  CB    . GLN D  1 62  ? 11.486  -66.977 47.633  1.00 38.82 ? 61   GLN C CB    1 
ATOM   4587  C  CG    . GLN D  1 62  ? 12.265  -67.108 48.933  1.00 40.04 ? 61   GLN C CG    1 
ATOM   4588  C  CD    . GLN D  1 62  ? 11.333  -67.264 50.112  1.00 39.40 ? 61   GLN C CD    1 
ATOM   4589  O  OE1   . GLN D  1 62  ? 10.979  -66.282 50.777  1.00 41.50 ? 61   GLN C OE1   1 
ATOM   4590  N  NE2   . GLN D  1 62  ? 10.899  -68.494 50.357  1.00 38.88 ? 61   GLN C NE2   1 
ATOM   4591  N  N     . GLU D  1 63  ? 11.786  -67.760 44.385  1.00 39.15 ? 62   GLU C N     1 
ATOM   4592  C  CA    . GLU D  1 63  ? 11.057  -68.147 43.181  1.00 40.01 ? 62   GLU C CA    1 
ATOM   4593  C  C     . GLU D  1 63  ? 9.624   -68.594 43.512  1.00 39.82 ? 62   GLU C C     1 
ATOM   4594  O  O     . GLU D  1 63  ? 8.704   -68.420 42.707  1.00 39.34 ? 62   GLU C O     1 
ATOM   4595  C  CB    . GLU D  1 63  ? 11.858  -69.262 42.464  1.00 40.59 ? 62   GLU C CB    1 
ATOM   4596  C  CG    . GLU D  1 63  ? 11.160  -69.971 41.294  1.00 42.35 ? 62   GLU C CG    1 
ATOM   4597  N  N     . ASP D  1 64  ? 9.417   -69.124 44.722  1.00 39.83 ? 63   ASP C N     1 
ATOM   4598  C  CA    . ASP D  1 64  ? 8.076   -69.542 45.164  1.00 39.57 ? 63   ASP C CA    1 
ATOM   4599  C  C     . ASP D  1 64  ? 7.046   -68.411 45.206  1.00 39.12 ? 63   ASP C C     1 
ATOM   4600  O  O     . ASP D  1 64  ? 5.833   -68.661 45.161  1.00 38.26 ? 63   ASP C O     1 
ATOM   4601  C  CB    . ASP D  1 64  ? 8.166   -70.216 46.538  1.00 40.43 ? 63   ASP C CB    1 
ATOM   4602  C  CG    . ASP D  1 64  ? 8.754   -71.635 46.459  1.00 42.99 ? 63   ASP C CG    1 
ATOM   4603  O  OD1   . ASP D  1 64  ? 8.889   -72.307 47.516  1.00 45.53 ? 63   ASP C OD1   1 
ATOM   4604  O  OD2   . ASP D  1 64  ? 9.064   -72.080 45.327  1.00 45.70 ? 63   ASP C OD2   1 
ATOM   4605  N  N     . TYR D  1 65  ? 7.517   -67.173 45.316  1.00 38.72 ? 64   TYR C N     1 
ATOM   4606  C  CA    . TYR D  1 65  ? 6.620   -65.998 45.240  1.00 38.76 ? 64   TYR C CA    1 
ATOM   4607  C  C     . TYR D  1 65  ? 6.717   -65.281 43.885  1.00 38.59 ? 64   TYR C C     1 
ATOM   4608  O  O     . TYR D  1 65  ? 6.449   -64.080 43.780  1.00 38.07 ? 64   TYR C O     1 
ATOM   4609  C  CB    . TYR D  1 65  ? 6.886   -65.047 46.417  1.00 38.76 ? 64   TYR C CB    1 
ATOM   4610  C  CG    . TYR D  1 65  ? 6.513   -65.685 47.737  1.00 38.20 ? 64   TYR C CG    1 
ATOM   4611  C  CD1   . TYR D  1 65  ? 7.445   -65.844 48.754  1.00 37.86 ? 64   TYR C CD1   1 
ATOM   4612  C  CD2   . TYR D  1 65  ? 5.224   -66.153 47.948  1.00 38.95 ? 64   TYR C CD2   1 
ATOM   4613  C  CE1   . TYR D  1 65  ? 7.091   -66.450 49.962  1.00 37.86 ? 64   TYR C CE1   1 
ATOM   4614  C  CE2   . TYR D  1 65  ? 4.857   -66.754 49.139  1.00 39.70 ? 64   TYR C CE2   1 
ATOM   4615  C  CZ    . TYR D  1 65  ? 5.794   -66.900 50.143  1.00 38.72 ? 64   TYR C CZ    1 
ATOM   4616  O  OH    . TYR D  1 65  ? 5.410   -67.520 51.306  1.00 38.55 ? 64   TYR C OH    1 
ATOM   4617  N  N     . ASP D  1 66  ? 7.063   -66.050 42.849  1.00 38.36 ? 65   ASP C N     1 
ATOM   4618  C  CA    . ASP D  1 66  ? 7.086   -65.552 41.472  1.00 38.76 ? 65   ASP C CA    1 
ATOM   4619  C  C     . ASP D  1 66  ? 5.730   -64.983 41.011  1.00 38.39 ? 65   ASP C C     1 
ATOM   4620  O  O     . ASP D  1 66  ? 5.696   -64.036 40.271  1.00 38.34 ? 65   ASP C O     1 
ATOM   4621  C  CB    . ASP D  1 66  ? 7.524   -66.649 40.494  1.00 38.60 ? 65   ASP C CB    1 
ATOM   4622  C  CG    . ASP D  1 66  ? 9.044   -66.758 40.337  1.00 38.38 ? 65   ASP C CG    1 
ATOM   4623  O  OD1   . ASP D  1 66  ? 9.812   -65.926 40.882  1.00 36.97 ? 65   ASP C OD1   1 
ATOM   4624  O  OD2   . ASP D  1 66  ? 9.475   -67.696 39.616  1.00 40.57 ? 65   ASP C OD2   1 
ATOM   4625  N  N     . ARG D  1 67  ? 4.632   -65.567 41.448  1.00 38.59 ? 66   ARG C N     1 
ATOM   4626  C  CA    . ARG D  1 67  ? 3.311   -65.117 41.015  1.00 39.21 ? 66   ARG C CA    1 
ATOM   4627  C  C     . ARG D  1 67  ? 2.847   -63.849 41.731  1.00 39.11 ? 66   ARG C C     1 
ATOM   4628  O  O     . ARG D  1 67  ? 1.998   -63.112 41.218  1.00 40.14 ? 66   ARG C O     1 
ATOM   4629  C  CB    . ARG D  1 67  ? 2.289   -66.255 41.130  1.00 39.30 ? 66   ARG C CB    1 
ATOM   4630  C  CG    . ARG D  1 67  ? 2.601   -67.440 40.148  1.00 40.67 ? 66   ARG C CG    1 
ATOM   4631  C  CD    . ARG D  1 67  ? 1.386   -68.329 39.785  1.00 39.91 ? 66   ARG C CD    1 
ATOM   4632  N  N     . LEU D  1 68  ? 3.392   -63.579 42.910  1.00 38.88 ? 67   LEU C N     1 
ATOM   4633  C  CA    . LEU D  1 68  ? 3.042   -62.366 43.633  1.00 38.66 ? 67   LEU C CA    1 
ATOM   4634  C  C     . LEU D  1 68  ? 3.845   -61.171 43.117  1.00 38.57 ? 67   LEU C C     1 
ATOM   4635  O  O     . LEU D  1 68  ? 3.342   -60.049 43.127  1.00 37.79 ? 67   LEU C O     1 
ATOM   4636  C  CB    . LEU D  1 68  ? 3.277   -62.555 45.138  1.00 39.00 ? 67   LEU C CB    1 
ATOM   4637  C  CG    . LEU D  1 68  ? 2.803   -61.471 46.115  1.00 39.17 ? 67   LEU C CG    1 
ATOM   4638  C  CD1   . LEU D  1 68  ? 1.304   -61.476 46.250  1.00 36.58 ? 67   LEU C CD1   1 
ATOM   4639  C  CD2   . LEU D  1 68  ? 3.454   -61.639 47.490  1.00 38.39 ? 67   LEU C CD2   1 
ATOM   4640  N  N     . ARG D  1 69  ? 5.092   -61.401 42.691  1.00 38.15 ? 68   ARG C N     1 
ATOM   4641  C  CA    . ARG D  1 69  ? 6.004   -60.295 42.439  1.00 38.59 ? 68   ARG C CA    1 
ATOM   4642  C  C     . ARG D  1 69  ? 5.462   -59.289 41.403  1.00 38.57 ? 68   ARG C C     1 
ATOM   4643  O  O     . ARG D  1 69  ? 5.378   -58.075 41.677  1.00 39.07 ? 68   ARG C O     1 
ATOM   4644  C  CB    . ARG D  1 69  ? 7.410   -60.795 42.072  1.00 38.99 ? 68   ARG C CB    1 
ATOM   4645  C  CG    . ARG D  1 69  ? 8.501   -59.745 42.276  1.00 38.73 ? 68   ARG C CG    1 
ATOM   4646  C  CD    . ARG D  1 69  ? 9.855   -60.207 41.814  1.00 39.14 ? 68   ARG C CD    1 
ATOM   4647  N  NE    . ARG D  1 69  ? 10.214  -61.478 42.459  1.00 39.07 ? 68   ARG C NE    1 
ATOM   4648  C  CZ    . ARG D  1 69  ? 10.055  -62.685 41.915  1.00 39.12 ? 68   ARG C CZ    1 
ATOM   4649  N  NH1   . ARG D  1 69  ? 9.557   -62.827 40.692  1.00 36.71 ? 68   ARG C NH1   1 
ATOM   4650  N  NH2   . ARG D  1 69  ? 10.396  -63.772 42.616  1.00 40.55 ? 68   ARG C NH2   1 
ATOM   4651  N  N     . PRO D  1 70  ? 5.051   -59.774 40.232  1.00 38.29 ? 69   PRO C N     1 
ATOM   4652  C  CA    . PRO D  1 70  ? 4.553   -58.839 39.238  1.00 38.44 ? 69   PRO C CA    1 
ATOM   4653  C  C     . PRO D  1 70  ? 3.423   -57.885 39.644  1.00 38.01 ? 69   PRO C C     1 
ATOM   4654  O  O     . PRO D  1 70  ? 3.172   -56.932 38.901  1.00 38.30 ? 69   PRO C O     1 
ATOM   4655  C  CB    . PRO D  1 70  ? 4.082   -59.767 38.110  1.00 38.42 ? 69   PRO C CB    1 
ATOM   4656  C  CG    . PRO D  1 70  ? 4.983   -60.962 38.243  1.00 38.72 ? 69   PRO C CG    1 
ATOM   4657  C  CD    . PRO D  1 70  ? 5.055   -61.156 39.712  1.00 38.49 ? 69   PRO C CD    1 
ATOM   4658  N  N     . LEU D  1 71  ? 2.742   -58.113 40.773  1.00 38.01 ? 70   LEU C N     1 
ATOM   4659  C  CA    . LEU D  1 71  ? 1.626   -57.215 41.179  1.00 37.78 ? 70   LEU C CA    1 
ATOM   4660  C  C     . LEU D  1 71  ? 2.163   -55.845 41.621  1.00 37.74 ? 70   LEU C C     1 
ATOM   4661  O  O     . LEU D  1 71  ? 1.446   -54.846 41.640  1.00 36.90 ? 70   LEU C O     1 
ATOM   4662  C  CB    . LEU D  1 71  ? 0.801   -57.843 42.299  1.00 38.01 ? 70   LEU C CB    1 
ATOM   4663  C  CG    . LEU D  1 71  ? 0.081   -59.162 42.022  1.00 37.85 ? 70   LEU C CG    1 
ATOM   4664  C  CD1   . LEU D  1 71  ? -0.833  -59.520 43.193  1.00 37.14 ? 70   LEU C CD1   1 
ATOM   4665  C  CD2   . LEU D  1 71  ? -0.723  -59.068 40.725  1.00 39.88 ? 70   LEU C CD2   1 
ATOM   4666  N  N     . SER D  1 72  ? 3.447   -55.818 41.963  1.00 37.84 ? 71   SER C N     1 
ATOM   4667  C  CA    A SER D  1 72  ? 4.134   -54.595 42.354  0.50 37.91 ? 71   SER C CA    1 
ATOM   4668  C  CA    B SER D  1 72  ? 4.093   -54.579 42.353  0.50 38.18 ? 71   SER C CA    1 
ATOM   4669  C  C     . SER D  1 72  ? 4.496   -53.735 41.143  1.00 38.11 ? 71   SER C C     1 
ATOM   4670  O  O     . SER D  1 72  ? 4.833   -52.578 41.299  1.00 38.40 ? 71   SER C O     1 
ATOM   4671  C  CB    A SER D  1 72  ? 5.412   -54.923 43.138  0.50 37.92 ? 71   SER C CB    1 
ATOM   4672  C  CB    B SER D  1 72  ? 5.315   -54.879 43.208  0.50 38.22 ? 71   SER C CB    1 
ATOM   4673  O  OG    A SER D  1 72  ? 5.139   -55.422 44.440  0.50 37.28 ? 71   SER C OG    1 
ATOM   4674  O  OG    B SER D  1 72  ? 6.185   -55.754 42.523  0.50 39.14 ? 71   SER C OG    1 
ATOM   4675  N  N     . TYR D  1 73  ? 4.433   -54.300 39.936  1.00 38.18 ? 72   TYR C N     1 
ATOM   4676  C  CA    . TYR D  1 73  ? 5.011   -53.624 38.765  1.00 38.23 ? 72   TYR C CA    1 
ATOM   4677  C  C     . TYR D  1 73  ? 4.236   -52.463 38.111  1.00 38.06 ? 72   TYR C C     1 
ATOM   4678  O  O     . TYR D  1 73  ? 4.854   -51.493 37.717  1.00 37.71 ? 72   TYR C O     1 
ATOM   4679  C  CB    . TYR D  1 73  ? 5.436   -54.631 37.696  1.00 38.61 ? 72   TYR C CB    1 
ATOM   4680  C  CG    . TYR D  1 73  ? 6.487   -55.651 38.121  1.00 38.36 ? 72   TYR C CG    1 
ATOM   4681  C  CD1   . TYR D  1 73  ? 7.316   -55.432 39.226  1.00 38.90 ? 72   TYR C CD1   1 
ATOM   4682  C  CD2   . TYR D  1 73  ? 6.688   -56.809 37.380  1.00 37.97 ? 72   TYR C CD2   1 
ATOM   4683  C  CE1   . TYR D  1 73  ? 8.275   -56.348 39.595  1.00 38.58 ? 72   TYR C CE1   1 
ATOM   4684  C  CE2   . TYR D  1 73  ? 7.660   -57.737 37.740  1.00 37.93 ? 72   TYR C CE2   1 
ATOM   4685  C  CZ    . TYR D  1 73  ? 8.445   -57.503 38.856  1.00 38.77 ? 72   TYR C CZ    1 
ATOM   4686  O  OH    . TYR D  1 73  ? 9.425   -58.391 39.237  1.00 39.43 ? 72   TYR C OH    1 
ATOM   4687  N  N     . PRO D  1 74  ? 2.901   -52.563 37.963  1.00 38.33 ? 73   PRO C N     1 
ATOM   4688  C  CA    . PRO D  1 74  ? 2.225   -51.465 37.258  1.00 38.20 ? 73   PRO C CA    1 
ATOM   4689  C  C     . PRO D  1 74  ? 2.531   -50.084 37.849  1.00 38.22 ? 73   PRO C C     1 
ATOM   4690  O  O     . PRO D  1 74  ? 2.569   -49.936 39.062  1.00 37.75 ? 73   PRO C O     1 
ATOM   4691  C  CB    . PRO D  1 74  ? 0.735   -51.828 37.386  1.00 38.26 ? 73   PRO C CB    1 
ATOM   4692  C  CG    . PRO D  1 74  ? 0.760   -53.339 37.462  1.00 38.12 ? 73   PRO C CG    1 
ATOM   4693  C  CD    . PRO D  1 74  ? 1.954   -53.629 38.333  1.00 38.20 ? 73   PRO C CD    1 
ATOM   4694  N  N     . GLN D  1 75  ? 2.797   -49.126 36.958  1.00 38.43 ? 74   GLN C N     1 
ATOM   4695  C  CA    . GLN D  1 75  ? 3.081   -47.706 37.271  1.00 39.05 ? 74   GLN C CA    1 
ATOM   4696  C  C     . GLN D  1 75  ? 4.383   -47.469 38.023  1.00 37.71 ? 74   GLN C C     1 
ATOM   4697  O  O     . GLN D  1 75  ? 4.521   -46.482 38.725  1.00 36.88 ? 74   GLN C O     1 
ATOM   4698  C  CB    . GLN D  1 75  ? 1.914   -47.040 38.024  1.00 39.66 ? 74   GLN C CB    1 
ATOM   4699  C  CG    . GLN D  1 75  ? 0.676   -46.792 37.191  1.00 43.39 ? 74   GLN C CG    1 
ATOM   4700  C  CD    . GLN D  1 75  ? -0.249  -47.988 37.151  1.00 48.57 ? 74   GLN C CD    1 
ATOM   4701  O  OE1   . GLN D  1 75  ? -0.759  -48.443 38.204  1.00 50.64 ? 74   GLN C OE1   1 
ATOM   4702  N  NE2   . GLN D  1 75  ? -0.489  -48.509 35.935  1.00 50.41 ? 74   GLN C NE2   1 
ATOM   4703  N  N     . THR D  1 76  ? 5.356   -48.361 37.859  1.00 36.85 ? 75   THR C N     1 
ATOM   4704  C  CA    . THR D  1 76  ? 6.615   -48.176 38.526  1.00 35.57 ? 75   THR C CA    1 
ATOM   4705  C  C     . THR D  1 76  ? 7.332   -47.017 37.849  1.00 35.69 ? 75   THR C C     1 
ATOM   4706  O  O     . THR D  1 76  ? 7.239   -46.833 36.623  1.00 34.76 ? 75   THR C O     1 
ATOM   4707  C  CB    . THR D  1 76  ? 7.487   -49.455 38.501  1.00 35.99 ? 75   THR C CB    1 
ATOM   4708  O  OG1   . THR D  1 76  ? 6.793   -50.522 39.159  1.00 34.48 ? 75   THR C OG1   1 
ATOM   4709  C  CG2   . THR D  1 76  ? 8.787   -49.205 39.226  1.00 32.37 ? 75   THR C CG2   1 
ATOM   4710  N  N     . ASP D  1 77  ? 8.031   -46.218 38.641  1.00 35.35 ? 76   ASP C N     1 
ATOM   4711  C  CA    . ASP D  1 77  ? 8.782   -45.103 38.066  1.00 35.36 ? 76   ASP C CA    1 
ATOM   4712  C  C     . ASP D  1 77  ? 10.218  -45.518 37.802  1.00 34.81 ? 76   ASP C C     1 
ATOM   4713  O  O     . ASP D  1 77  ? 10.830  -45.047 36.849  1.00 34.36 ? 76   ASP C O     1 
ATOM   4714  C  CB    . ASP D  1 77  ? 8.713   -43.862 38.957  1.00 35.18 ? 76   ASP C CB    1 
ATOM   4715  C  CG    . ASP D  1 77  ? 7.296   -43.296 39.069  1.00 35.96 ? 76   ASP C CG    1 
ATOM   4716  O  OD1   . ASP D  1 77  ? 6.641   -43.042 38.023  1.00 36.15 ? 76   ASP C OD1   1 
ATOM   4717  O  OD2   . ASP D  1 77  ? 6.858   -43.055 40.205  1.00 34.67 ? 76   ASP C OD2   1 
ATOM   4718  N  N     . VAL D  1 78  ? 10.756  -46.392 38.647  1.00 34.99 ? 77   VAL C N     1 
ATOM   4719  C  CA    . VAL D  1 78  ? 12.149  -46.819 38.518  1.00 34.86 ? 77   VAL C CA    1 
ATOM   4720  C  C     . VAL D  1 78  ? 12.356  -48.160 39.209  1.00 35.37 ? 77   VAL C C     1 
ATOM   4721  O  O     . VAL D  1 78  ? 11.721  -48.427 40.222  1.00 35.41 ? 77   VAL C O     1 
ATOM   4722  C  CB    . VAL D  1 78  ? 13.105  -45.742 39.089  1.00 35.10 ? 77   VAL C CB    1 
ATOM   4723  C  CG1   . VAL D  1 78  ? 12.840  -45.477 40.572  1.00 34.90 ? 77   VAL C CG1   1 
ATOM   4724  C  CG2   . VAL D  1 78  ? 14.614  -46.096 38.827  1.00 34.45 ? 77   VAL C CG2   1 
ATOM   4725  N  N     . PHE D  1 79  ? 13.220  -49.004 38.635  1.00 35.55 ? 78   PHE C N     1 
ATOM   4726  C  CA    . PHE D  1 79  ? 13.594  -50.281 39.230  1.00 35.75 ? 78   PHE C CA    1 
ATOM   4727  C  C     . PHE D  1 79  ? 15.051  -50.281 39.650  1.00 36.43 ? 78   PHE C C     1 
ATOM   4728  O  O     . PHE D  1 79  ? 15.904  -49.733 38.965  1.00 36.34 ? 78   PHE C O     1 
ATOM   4729  C  CB    . PHE D  1 79  ? 13.446  -51.434 38.219  1.00 35.86 ? 78   PHE C CB    1 
ATOM   4730  C  CG    . PHE D  1 79  ? 12.027  -51.798 37.898  1.00 35.41 ? 78   PHE C CG    1 
ATOM   4731  C  CD1   . PHE D  1 79  ? 11.374  -51.235 36.813  1.00 35.30 ? 78   PHE C CD1   1 
ATOM   4732  C  CD2   . PHE D  1 79  ? 11.352  -52.740 38.663  1.00 35.14 ? 78   PHE C CD2   1 
ATOM   4733  C  CE1   . PHE D  1 79  ? 10.044  -51.580 36.528  1.00 35.47 ? 78   PHE C CE1   1 
ATOM   4734  C  CE2   . PHE D  1 79  ? 10.052  -53.098 38.365  1.00 35.41 ? 78   PHE C CE2   1 
ATOM   4735  C  CZ    . PHE D  1 79  ? 9.398   -52.511 37.300  1.00 34.44 ? 78   PHE C CZ    1 
ATOM   4736  N  N     . LEU D  1 80  ? 15.321  -50.950 40.770  1.00 36.72 ? 79   LEU C N     1 
ATOM   4737  C  CA    . LEU D  1 80  ? 16.640  -51.353 41.120  1.00 36.97 ? 79   LEU C CA    1 
ATOM   4738  C  C     . LEU D  1 80  ? 16.698  -52.874 40.969  1.00 36.87 ? 79   LEU C C     1 
ATOM   4739  O  O     . LEU D  1 80  ? 15.991  -53.605 41.673  1.00 37.20 ? 79   LEU C O     1 
ATOM   4740  C  CB    . LEU D  1 80  ? 16.959  -50.973 42.563  1.00 37.22 ? 79   LEU C CB    1 
ATOM   4741  C  CG    . LEU D  1 80  ? 16.736  -49.547 43.038  1.00 37.12 ? 79   LEU C CG    1 
ATOM   4742  C  CD1   . LEU D  1 80  ? 17.272  -49.420 44.467  1.00 37.38 ? 79   LEU C CD1   1 
ATOM   4743  C  CD2   . LEU D  1 80  ? 17.383  -48.523 42.115  1.00 38.34 ? 79   LEU C CD2   1 
ATOM   4744  N  N     . ILE D  1 81  ? 17.541  -53.354 40.069  1.00 36.83 ? 80   ILE C N     1 
ATOM   4745  C  CA    . ILE D  1 81  ? 17.821  -54.798 39.991  1.00 36.82 ? 80   ILE C CA    1 
ATOM   4746  C  C     . ILE D  1 81  ? 19.083  -55.016 40.795  1.00 37.41 ? 80   ILE C C     1 
ATOM   4747  O  O     . ILE D  1 81  ? 20.125  -54.405 40.496  1.00 37.59 ? 80   ILE C O     1 
ATOM   4748  C  CB    . ILE D  1 81  ? 18.009  -55.312 38.543  1.00 36.60 ? 80   ILE C CB    1 
ATOM   4749  C  CG1   . ILE D  1 81  ? 16.696  -55.252 37.757  1.00 36.37 ? 80   ILE C CG1   1 
ATOM   4750  C  CG2   . ILE D  1 81  ? 18.538  -56.772 38.545  1.00 36.77 ? 80   ILE C CG2   1 
ATOM   4751  C  CD1   . ILE D  1 81  ? 16.863  -55.443 36.263  1.00 36.54 ? 80   ILE C CD1   1 
ATOM   4752  N  N     . CYS D  1 82  ? 18.993  -55.855 41.829  1.00 37.71 ? 81   CYS C N     1 
ATOM   4753  C  CA    . CYS D  1 82  ? 20.126  -56.088 42.728  1.00 38.66 ? 81   CYS C CA    1 
ATOM   4754  C  C     . CYS D  1 82  ? 20.747  -57.489 42.523  1.00 37.89 ? 81   CYS C C     1 
ATOM   4755  O  O     . CYS D  1 82  ? 20.031  -58.486 42.304  1.00 38.28 ? 81   CYS C O     1 
ATOM   4756  C  CB    . CYS D  1 82  ? 19.689  -55.905 44.182  1.00 38.53 ? 81   CYS C CB    1 
ATOM   4757  S  SG    . CYS D  1 82  ? 18.953  -54.279 44.518  1.00 44.43 ? 81   CYS C SG    1 
ATOM   4758  N  N     . PHE D  1 83  ? 22.076  -57.535 42.560  1.00 36.61 ? 82   PHE C N     1 
ATOM   4759  C  CA    . PHE D  1 83  ? 22.818  -58.801 42.696  1.00 36.10 ? 82   PHE C CA    1 
ATOM   4760  C  C     . PHE D  1 83  ? 23.889  -58.580 43.770  1.00 35.31 ? 82   PHE C C     1 
ATOM   4761  O  O     . PHE D  1 83  ? 24.318  -57.459 43.973  1.00 35.06 ? 82   PHE C O     1 
ATOM   4762  C  CB    . PHE D  1 83  ? 23.433  -59.216 41.349  1.00 35.20 ? 82   PHE C CB    1 
ATOM   4763  C  CG    . PHE D  1 83  ? 24.555  -58.342 40.919  1.00 34.39 ? 82   PHE C CG    1 
ATOM   4764  C  CD1   . PHE D  1 83  ? 24.311  -57.143 40.268  1.00 33.24 ? 82   PHE C CD1   1 
ATOM   4765  C  CD2   . PHE D  1 83  ? 25.868  -58.668 41.246  1.00 33.61 ? 82   PHE C CD2   1 
ATOM   4766  C  CE1   . PHE D  1 83  ? 25.360  -56.309 39.904  1.00 32.90 ? 82   PHE C CE1   1 
ATOM   4767  C  CE2   . PHE D  1 83  ? 26.905  -57.841 40.892  1.00 33.07 ? 82   PHE C CE2   1 
ATOM   4768  C  CZ    . PHE D  1 83  ? 26.650  -56.658 40.217  1.00 33.75 ? 82   PHE C CZ    1 
ATOM   4769  N  N     . SER D  1 84  ? 24.310  -59.644 44.452  1.00 35.65 ? 83   SER C N     1 
ATOM   4770  C  CA    . SER D  1 84  ? 25.411  -59.561 45.407  1.00 35.13 ? 83   SER C CA    1 
ATOM   4771  C  C     . SER D  1 84  ? 26.750  -59.631 44.670  1.00 35.19 ? 83   SER C C     1 
ATOM   4772  O  O     . SER D  1 84  ? 26.952  -60.502 43.816  1.00 34.29 ? 83   SER C O     1 
ATOM   4773  C  CB    . SER D  1 84  ? 25.343  -60.673 46.454  1.00 36.14 ? 83   SER C CB    1 
ATOM   4774  O  OG    . SER D  1 84  ? 26.586  -60.802 47.168  1.00 33.85 ? 83   SER C OG    1 
ATOM   4775  N  N     . LEU D  1 85  ? 27.659  -58.717 45.016  1.00 34.84 ? 84   LEU C N     1 
ATOM   4776  C  CA    . LEU D  1 85  ? 28.978  -58.664 44.398  1.00 35.37 ? 84   LEU C CA    1 
ATOM   4777  C  C     . LEU D  1 85  ? 29.814  -59.913 44.725  1.00 35.26 ? 84   LEU C C     1 
ATOM   4778  O  O     . LEU D  1 85  ? 30.855  -60.110 44.122  1.00 34.80 ? 84   LEU C O     1 
ATOM   4779  C  CB    . LEU D  1 85  ? 29.745  -57.393 44.824  1.00 35.57 ? 84   LEU C CB    1 
ATOM   4780  C  CG    . LEU D  1 85  ? 29.287  -56.028 44.282  1.00 37.00 ? 84   LEU C CG    1 
ATOM   4781  C  CD1   . LEU D  1 85  ? 29.914  -54.854 45.050  1.00 36.10 ? 84   LEU C CD1   1 
ATOM   4782  C  CD2   . LEU D  1 85  ? 29.584  -55.923 42.795  1.00 37.87 ? 84   LEU C CD2   1 
ATOM   4783  N  N     . VAL D  1 86  ? 29.367  -60.721 45.694  1.00 35.28 ? 85   VAL C N     1 
ATOM   4784  C  CA    . VAL D  1 86  ? 30.039  -61.972 46.051  1.00 35.79 ? 85   VAL C CA    1 
ATOM   4785  C  C     . VAL D  1 86  ? 29.199  -63.210 45.737  1.00 35.76 ? 85   VAL C C     1 
ATOM   4786  O  O     . VAL D  1 86  ? 29.501  -64.303 46.210  1.00 35.74 ? 85   VAL C O     1 
ATOM   4787  C  CB    . VAL D  1 86  ? 30.495  -61.970 47.538  1.00 35.79 ? 85   VAL C CB    1 
ATOM   4788  C  CG1   . VAL D  1 86  ? 31.505  -60.856 47.753  1.00 34.94 ? 85   VAL C CG1   1 
ATOM   4789  C  CG2   . VAL D  1 86  ? 29.284  -61.808 48.484  1.00 35.89 ? 85   VAL C CG2   1 
ATOM   4790  N  N     . SER D  1 87  ? 28.154  -63.045 44.926  1.00 36.43 ? 86   SER C N     1 
ATOM   4791  C  CA    . SER D  1 87  ? 27.437  -64.191 44.356  1.00 36.58 ? 86   SER C CA    1 
ATOM   4792  C  C     . SER D  1 87  ? 27.308  -64.063 42.826  1.00 36.94 ? 86   SER C C     1 
ATOM   4793  O  O     . SER D  1 87  ? 26.375  -63.439 42.321  1.00 37.51 ? 86   SER C O     1 
ATOM   4794  C  CB    . SER D  1 87  ? 26.072  -64.378 45.016  1.00 36.41 ? 86   SER C CB    1 
ATOM   4795  O  OG    . SER D  1 87  ? 25.286  -65.261 44.250  1.00 35.76 ? 86   SER C OG    1 
ATOM   4796  N  N     . PRO D  1 88  ? 28.281  -64.614 42.090  1.00 37.13 ? 87   PRO C N     1 
ATOM   4797  C  CA    . PRO D  1 88  ? 28.210  -64.794 40.638  1.00 37.20 ? 87   PRO C CA    1 
ATOM   4798  C  C     . PRO D  1 88  ? 26.853  -65.302 40.106  1.00 37.15 ? 87   PRO C C     1 
ATOM   4799  O  O     . PRO D  1 88  ? 26.366  -64.820 39.071  1.00 36.44 ? 87   PRO C O     1 
ATOM   4800  C  CB    . PRO D  1 88  ? 29.331  -65.810 40.364  1.00 37.45 ? 87   PRO C CB    1 
ATOM   4801  C  CG    . PRO D  1 88  ? 30.382  -65.485 41.405  1.00 37.24 ? 87   PRO C CG    1 
ATOM   4802  C  CD    . PRO D  1 88  ? 29.599  -65.019 42.633  1.00 37.29 ? 87   PRO C CD    1 
ATOM   4803  N  N     . ALA D  1 89  ? 26.253  -66.254 40.814  1.00 36.71 ? 88   ALA C N     1 
ATOM   4804  C  CA    . ALA D  1 89  ? 24.939  -66.779 40.434  1.00 36.93 ? 88   ALA C CA    1 
ATOM   4805  C  C     . ALA D  1 89  ? 23.856  -65.674 40.417  1.00 36.83 ? 88   ALA C C     1 
ATOM   4806  O  O     . ALA D  1 89  ? 23.040  -65.601 39.479  1.00 36.48 ? 88   ALA C O     1 
ATOM   4807  C  CB    . ALA D  1 89  ? 24.542  -67.931 41.364  1.00 36.77 ? 88   ALA C CB    1 
ATOM   4808  N  N     . SER D  1 90  ? 23.867  -64.805 41.428  1.00 36.51 ? 89   SER C N     1 
ATOM   4809  C  CA    . SER D  1 90  ? 22.898  -63.723 41.502  1.00 36.68 ? 89   SER C CA    1 
ATOM   4810  C  C     . SER D  1 90  ? 23.147  -62.742 40.355  1.00 37.15 ? 89   SER C C     1 
ATOM   4811  O  O     . SER D  1 90  ? 22.209  -62.160 39.827  1.00 37.36 ? 89   SER C O     1 
ATOM   4812  C  CB    . SER D  1 90  ? 22.934  -63.009 42.861  1.00 36.50 ? 89   SER C CB    1 
ATOM   4813  O  OG    . SER D  1 90  ? 24.135  -62.268 43.052  1.00 38.74 ? 89   SER C OG    1 
ATOM   4814  N  N     . PHE D  1 91  ? 24.414  -62.578 39.976  1.00 37.47 ? 90   PHE C N     1 
ATOM   4815  C  CA    . PHE D  1 91  ? 24.808  -61.698 38.886  1.00 38.01 ? 90   PHE C CA    1 
ATOM   4816  C  C     . PHE D  1 91  ? 24.256  -62.199 37.558  1.00 38.48 ? 90   PHE C C     1 
ATOM   4817  O  O     . PHE D  1 91  ? 23.601  -61.451 36.834  1.00 38.97 ? 90   PHE C O     1 
ATOM   4818  C  CB    . PHE D  1 91  ? 26.331  -61.651 38.810  1.00 38.15 ? 90   PHE C CB    1 
ATOM   4819  C  CG    . PHE D  1 91  ? 26.878  -60.705 37.768  1.00 39.12 ? 90   PHE C CG    1 
ATOM   4820  C  CD1   . PHE D  1 91  ? 26.511  -59.371 37.755  1.00 38.86 ? 90   PHE C CD1   1 
ATOM   4821  C  CD2   . PHE D  1 91  ? 27.810  -61.149 36.833  1.00 38.61 ? 90   PHE C CD2   1 
ATOM   4822  C  CE1   . PHE D  1 91  ? 27.042  -58.502 36.824  1.00 39.34 ? 90   PHE C CE1   1 
ATOM   4823  C  CE2   . PHE D  1 91  ? 28.332  -60.282 35.879  1.00 39.10 ? 90   PHE C CE2   1 
ATOM   4824  C  CZ    . PHE D  1 91  ? 27.962  -58.953 35.885  1.00 37.66 ? 90   PHE C CZ    1 
ATOM   4825  N  N     . GLU D  1 92  ? 24.524  -63.465 37.246  1.00 38.55 ? 91   GLU C N     1 
ATOM   4826  C  CA    . GLU D  1 92  ? 24.064  -64.070 36.003  1.00 38.61 ? 91   GLU C CA    1 
ATOM   4827  C  C     . GLU D  1 92  ? 22.544  -64.065 35.905  1.00 38.78 ? 91   GLU C C     1 
ATOM   4828  O  O     . GLU D  1 92  ? 21.987  -64.001 34.795  1.00 38.62 ? 91   GLU C O     1 
ATOM   4829  C  CB    . GLU D  1 92  ? 24.612  -65.497 35.850  1.00 38.80 ? 91   GLU C CB    1 
ATOM   4830  C  CG    . GLU D  1 92  ? 25.988  -65.565 35.076  1.00 40.70 ? 91   GLU C CG    1 
ATOM   4831  N  N     . ASN D  1 93  ? 21.869  -64.129 37.054  1.00 38.68 ? 92   ASN C N     1 
ATOM   4832  C  CA    . ASN D  1 93  ? 20.395  -64.093 37.056  1.00 38.70 ? 92   ASN C CA    1 
ATOM   4833  C  C     . ASN D  1 93  ? 19.827  -62.726 36.727  1.00 38.49 ? 92   ASN C C     1 
ATOM   4834  O  O     . ASN D  1 93  ? 18.637  -62.615 36.445  1.00 39.33 ? 92   ASN C O     1 
ATOM   4835  C  CB    . ASN D  1 93  ? 19.803  -64.585 38.380  1.00 38.85 ? 92   ASN C CB    1 
ATOM   4836  C  CG    . ASN D  1 93  ? 19.618  -66.076 38.431  1.00 38.46 ? 92   ASN C CG    1 
ATOM   4837  O  OD1   . ASN D  1 93  ? 19.391  -66.734 37.414  1.00 42.34 ? 92   ASN C OD1   1 
ATOM   4838  N  ND2   . ASN D  1 93  ? 19.716  -66.629 39.631  1.00 39.90 ? 92   ASN C ND2   1 
ATOM   4839  N  N     . VAL D  1 94  ? 20.647  -61.681 36.774  1.00 38.45 ? 93   VAL C N     1 
ATOM   4840  C  CA    . VAL D  1 94  ? 20.243  -60.385 36.207  1.00 38.40 ? 93   VAL C CA    1 
ATOM   4841  C  C     . VAL D  1 94  ? 19.901  -60.511 34.722  1.00 38.59 ? 93   VAL C C     1 
ATOM   4842  O  O     . VAL D  1 94  ? 18.897  -59.993 34.258  1.00 39.46 ? 93   VAL C O     1 
ATOM   4843  C  CB    . VAL D  1 94  ? 21.332  -59.306 36.369  1.00 38.07 ? 93   VAL C CB    1 
ATOM   4844  C  CG1   . VAL D  1 94  ? 20.957  -58.049 35.570  1.00 36.90 ? 93   VAL C CG1   1 
ATOM   4845  C  CG2   . VAL D  1 94  ? 21.534  -58.989 37.851  1.00 36.79 ? 93   VAL C CG2   1 
ATOM   4846  N  N     . ARG D  1 95  ? 20.750  -61.196 33.983  1.00 39.44 ? 94   ARG C N     1 
ATOM   4847  C  CA    . ARG D  1 95  ? 20.509  -61.473 32.570  1.00 40.12 ? 94   ARG C CA    1 
ATOM   4848  C  C     . ARG D  1 95  ? 19.432  -62.548 32.393  1.00 39.36 ? 94   ARG C C     1 
ATOM   4849  O  O     . ARG D  1 95  ? 18.537  -62.412 31.566  1.00 39.27 ? 94   ARG C O     1 
ATOM   4850  C  CB    . ARG D  1 95  ? 21.807  -61.939 31.921  1.00 40.95 ? 94   ARG C CB    1 
ATOM   4851  C  CG    . ARG D  1 95  ? 21.731  -62.049 30.427  1.00 44.05 ? 94   ARG C CG    1 
ATOM   4852  C  CD    . ARG D  1 95  ? 22.836  -62.912 29.885  1.00 47.27 ? 94   ARG C CD    1 
ATOM   4853  N  NE    . ARG D  1 95  ? 24.106  -62.200 29.726  1.00 49.17 ? 94   ARG C NE    1 
ATOM   4854  C  CZ    . ARG D  1 95  ? 25.176  -62.360 30.505  1.00 50.54 ? 94   ARG C CZ    1 
ATOM   4855  N  NH1   . ARG D  1 95  ? 25.151  -63.199 31.534  1.00 51.78 ? 94   ARG C NH1   1 
ATOM   4856  N  NH2   . ARG D  1 95  ? 26.285  -61.676 30.251  1.00 49.69 ? 94   ARG C NH2   1 
ATOM   4857  N  N     . ALA D  1 96  ? 19.526  -63.608 33.179  1.00 38.67 ? 95   ALA C N     1 
ATOM   4858  C  CA    . ALA D  1 96  ? 18.699  -64.784 32.967  1.00 38.76 ? 95   ALA C CA    1 
ATOM   4859  C  C     . ALA D  1 96  ? 17.257  -64.605 33.454  1.00 38.76 ? 95   ALA C C     1 
ATOM   4860  O  O     . ALA D  1 96  ? 16.356  -65.233 32.902  1.00 39.21 ? 95   ALA C O     1 
ATOM   4861  C  CB    . ALA D  1 96  ? 19.346  -66.043 33.608  1.00 38.48 ? 95   ALA C CB    1 
ATOM   4862  N  N     . LYS D  1 97  ? 17.031  -63.742 34.444  1.00 38.20 ? 96   LYS C N     1 
ATOM   4863  C  CA    . LYS D  1 97  ? 15.701  -63.639 35.065  1.00 38.48 ? 96   LYS C CA    1 
ATOM   4864  C  C     . LYS D  1 97  ? 15.155  -62.218 35.291  1.00 37.80 ? 96   LYS C C     1 
ATOM   4865  O  O     . LYS D  1 97  ? 14.038  -61.922 34.891  1.00 37.14 ? 96   LYS C O     1 
ATOM   4866  C  CB    . LYS D  1 97  ? 15.689  -64.399 36.406  1.00 38.36 ? 96   LYS C CB    1 
ATOM   4867  C  CG    . LYS D  1 97  ? 14.366  -64.247 37.155  1.00 39.09 ? 96   LYS C CG    1 
ATOM   4868  C  CD    . LYS D  1 97  ? 14.102  -65.320 38.217  1.00 39.07 ? 96   LYS C CD    1 
ATOM   4869  C  CE    . LYS D  1 97  ? 12.662  -65.142 38.775  1.00 38.94 ? 96   LYS C CE    1 
ATOM   4870  N  NZ    . LYS D  1 97  ? 12.355  -66.048 39.901  1.00 36.85 ? 96   LYS C NZ    1 
ATOM   4871  N  N     . TRP D  1 98  ? 15.929  -61.358 35.948  1.00 37.91 ? 97   TRP C N     1 
ATOM   4872  C  CA    . TRP D  1 98  ? 15.389  -60.100 36.476  1.00 37.78 ? 97   TRP C CA    1 
ATOM   4873  C  C     . TRP D  1 98  ? 15.134  -59.057 35.396  1.00 37.91 ? 97   TRP C C     1 
ATOM   4874  O  O     . TRP D  1 98  ? 14.060  -58.462 35.352  1.00 36.84 ? 97   TRP C O     1 
ATOM   4875  C  CB    . TRP D  1 98  ? 16.278  -59.567 37.615  1.00 38.24 ? 97   TRP C CB    1 
ATOM   4876  C  CG    . TRP D  1 98  ? 16.342  -60.559 38.716  1.00 37.68 ? 97   TRP C CG    1 
ATOM   4877  C  CD1   . TRP D  1 98  ? 17.437  -61.264 39.143  1.00 38.93 ? 97   TRP C CD1   1 
ATOM   4878  C  CD2   . TRP D  1 98  ? 15.226  -61.050 39.472  1.00 38.40 ? 97   TRP C CD2   1 
ATOM   4879  N  NE1   . TRP D  1 98  ? 17.067  -62.144 40.148  1.00 38.13 ? 97   TRP C NE1   1 
ATOM   4880  C  CE2   . TRP D  1 98  ? 15.717  -62.033 40.361  1.00 38.89 ? 97   TRP C CE2   1 
ATOM   4881  C  CE3   . TRP D  1 98  ? 13.857  -60.751 39.481  1.00 38.46 ? 97   TRP C CE3   1 
ATOM   4882  C  CZ2   . TRP D  1 98  ? 14.888  -62.699 41.272  1.00 39.38 ? 97   TRP C CZ2   1 
ATOM   4883  C  CZ3   . TRP D  1 98  ? 13.030  -61.432 40.371  1.00 39.27 ? 97   TRP C CZ3   1 
ATOM   4884  C  CH2   . TRP D  1 98  ? 13.554  -62.393 41.260  1.00 38.24 ? 97   TRP C CH2   1 
ATOM   4885  N  N     . TYR D  1 99  ? 16.100  -58.859 34.508  1.00 38.26 ? 98   TYR C N     1 
ATOM   4886  C  CA    . TYR D  1 99  ? 15.898  -57.940 33.389  1.00 38.39 ? 98   TYR C CA    1 
ATOM   4887  C  C     . TYR D  1 99  ? 14.712  -58.343 32.472  1.00 38.10 ? 98   TYR C C     1 
ATOM   4888  O  O     . TYR D  1 99  ? 13.839  -57.522 32.217  1.00 38.38 ? 98   TYR C O     1 
ATOM   4889  C  CB    . TYR D  1 99  ? 17.198  -57.740 32.605  1.00 38.95 ? 98   TYR C CB    1 
ATOM   4890  C  CG    . TYR D  1 99  ? 17.025  -56.988 31.309  1.00 38.89 ? 98   TYR C CG    1 
ATOM   4891  C  CD1   . TYR D  1 99  ? 16.427  -55.741 31.294  1.00 39.47 ? 98   TYR C CD1   1 
ATOM   4892  C  CD2   . TYR D  1 99  ? 17.471  -57.512 30.116  1.00 39.42 ? 98   TYR C CD2   1 
ATOM   4893  C  CE1   . TYR D  1 99  ? 16.269  -55.038 30.119  1.00 40.77 ? 98   TYR C CE1   1 
ATOM   4894  C  CE2   . TYR D  1 99  ? 17.329  -56.805 28.917  1.00 39.94 ? 98   TYR C CE2   1 
ATOM   4895  C  CZ    . TYR D  1 99  ? 16.726  -55.571 28.935  1.00 40.24 ? 98   TYR C CZ    1 
ATOM   4896  O  OH    . TYR D  1 99  ? 16.557  -54.848 27.787  1.00 40.83 ? 98   TYR C OH    1 
ATOM   4897  N  N     . PRO D  1 100 ? 14.676  -59.593 31.979  1.00 38.21 ? 99   PRO C N     1 
ATOM   4898  C  CA    . PRO D  1 100 ? 13.552  -60.014 31.159  1.00 38.53 ? 99   PRO C CA    1 
ATOM   4899  C  C     . PRO D  1 100 ? 12.207  -59.798 31.832  1.00 38.72 ? 99   PRO C C     1 
ATOM   4900  O  O     . PRO D  1 100 ? 11.266  -59.370 31.190  1.00 38.03 ? 99   PRO C O     1 
ATOM   4901  C  CB    . PRO D  1 100 ? 13.801  -61.514 30.973  1.00 39.08 ? 99   PRO C CB    1 
ATOM   4902  C  CG    . PRO D  1 100 ? 15.237  -61.665 31.083  1.00 38.35 ? 99   PRO C CG    1 
ATOM   4903  C  CD    . PRO D  1 100 ? 15.683  -60.665 32.092  1.00 38.39 ? 99   PRO C CD    1 
ATOM   4904  N  N     . GLU D  1 101 ? 12.137  -60.091 33.126  1.00 39.06 ? 100  GLU C N     1 
ATOM   4905  C  CA    . GLU D  1 101 ? 10.885  -60.031 33.845  1.00 39.57 ? 100  GLU C CA    1 
ATOM   4906  C  C     . GLU D  1 101 ? 10.445  -58.579 33.992  1.00 39.43 ? 100  GLU C C     1 
ATOM   4907  O  O     . GLU D  1 101 ? 9.342   -58.224 33.630  1.00 39.31 ? 100  GLU C O     1 
ATOM   4908  C  CB    . GLU D  1 101 ? 11.012  -60.709 35.203  1.00 39.42 ? 100  GLU C CB    1 
ATOM   4909  C  CG    . GLU D  1 101 ? 9.766   -60.575 36.059  1.00 40.24 ? 100  GLU C CG    1 
ATOM   4910  C  CD    . GLU D  1 101 ? 9.835   -61.422 37.317  1.00 40.96 ? 100  GLU C CD    1 
ATOM   4911  O  OE1   . GLU D  1 101 ? 10.163  -62.629 37.199  1.00 41.40 ? 100  GLU C OE1   1 
ATOM   4912  O  OE2   . GLU D  1 101 ? 9.566   -60.868 38.410  1.00 41.19 ? 100  GLU C OE2   1 
ATOM   4913  N  N     . VAL D  1 102 ? 11.335  -57.745 34.497  1.00 39.55 ? 101  VAL C N     1 
ATOM   4914  C  CA    . VAL D  1 102 ? 11.049  -56.329 34.678  1.00 39.95 ? 101  VAL C CA    1 
ATOM   4915  C  C     . VAL D  1 102 ? 10.603  -55.666 33.355  1.00 39.78 ? 101  VAL C C     1 
ATOM   4916  O  O     . VAL D  1 102 ? 9.570   -54.993 33.289  1.00 39.42 ? 101  VAL C O     1 
ATOM   4917  C  CB    . VAL D  1 102 ? 12.282  -55.629 35.311  1.00 40.15 ? 101  VAL C CB    1 
ATOM   4918  C  CG1   . VAL D  1 102 ? 12.338  -54.156 34.977  1.00 40.80 ? 101  VAL C CG1   1 
ATOM   4919  C  CG2   . VAL D  1 102 ? 12.270  -55.863 36.793  1.00 41.12 ? 101  VAL C CG2   1 
ATOM   4920  N  N     . ARG D  1 103 ? 11.344  -55.933 32.294  1.00 39.70 ? 102  ARG C N     1 
ATOM   4921  C  CA    . ARG D  1 103 ? 11.161  -55.226 31.030  1.00 39.98 ? 102  ARG C CA    1 
ATOM   4922  C  C     . ARG D  1 103 ? 9.908   -55.728 30.304  1.00 39.99 ? 102  ARG C C     1 
ATOM   4923  O  O     . ARG D  1 103 ? 9.213   -54.959 29.638  1.00 39.59 ? 102  ARG C O     1 
ATOM   4924  C  CB    . ARG D  1 103 ? 12.444  -55.369 30.205  1.00 40.25 ? 102  ARG C CB    1 
ATOM   4925  C  CG    . ARG D  1 103 ? 12.507  -54.617 28.892  1.00 41.73 ? 102  ARG C CG    1 
ATOM   4926  C  CD    . ARG D  1 103 ? 12.240  -53.113 28.998  1.00 41.21 ? 102  ARG C CD    1 
ATOM   4927  N  NE    . ARG D  1 103 ? 13.383  -52.300 29.407  1.00 41.07 ? 102  ARG C NE    1 
ATOM   4928  C  CZ    . ARG D  1 103 ? 13.412  -51.498 30.471  1.00 41.14 ? 102  ARG C CZ    1 
ATOM   4929  N  NH1   . ARG D  1 103 ? 12.375  -51.408 31.300  1.00 41.69 ? 102  ARG C NH1   1 
ATOM   4930  N  NH2   . ARG D  1 103 ? 14.506  -50.794 30.725  1.00 41.75 ? 102  ARG C NH2   1 
ATOM   4931  N  N     . HIS D  1 104 ? 9.589   -57.006 30.494  1.00 40.00 ? 103  HIS C N     1 
ATOM   4932  C  CA    . HIS D  1 104 ? 8.333   -57.573 30.025  1.00 40.14 ? 103  HIS C CA    1 
ATOM   4933  C  C     . HIS D  1 104 ? 7.112   -56.866 30.614  1.00 39.87 ? 103  HIS C C     1 
ATOM   4934  O  O     . HIS D  1 104 ? 6.131   -56.616 29.919  1.00 39.09 ? 103  HIS C O     1 
ATOM   4935  C  CB    . HIS D  1 104 ? 8.251   -59.049 30.401  1.00 40.40 ? 103  HIS C CB    1 
ATOM   4936  C  CG    . HIS D  1 104 ? 6.980   -59.700 29.972  1.00 41.32 ? 103  HIS C CG    1 
ATOM   4937  N  ND1   . HIS D  1 104 ? 6.729   -60.039 28.656  1.00 43.05 ? 103  HIS C ND1   1 
ATOM   4938  C  CD2   . HIS D  1 104 ? 5.882   -60.063 30.675  1.00 42.31 ? 103  HIS C CD2   1 
ATOM   4939  C  CE1   . HIS D  1 104 ? 5.526   -60.584 28.571  1.00 43.46 ? 103  HIS C CE1   1 
ATOM   4940  N  NE2   . HIS D  1 104 ? 4.990   -60.606 29.780  1.00 44.44 ? 103  HIS C NE2   1 
ATOM   4941  N  N     . HIS D  1 105 ? 7.144   -56.586 31.906  1.00 39.36 ? 104  HIS C N     1 
ATOM   4942  C  CA    . HIS D  1 105 ? 5.990   -55.956 32.530  1.00 39.57 ? 104  HIS C CA    1 
ATOM   4943  C  C     . HIS D  1 105 ? 6.019   -54.442 32.327  1.00 39.26 ? 104  HIS C C     1 
ATOM   4944  O  O     . HIS D  1 105 ? 4.983   -53.830 32.119  1.00 39.85 ? 104  HIS C O     1 
ATOM   4945  C  CB    . HIS D  1 105 ? 5.897   -56.354 34.002  1.00 40.12 ? 104  HIS C CB    1 
ATOM   4946  C  CG    . HIS D  1 105 ? 5.564   -57.801 34.203  1.00 40.88 ? 104  HIS C CG    1 
ATOM   4947  N  ND1   . HIS D  1 105 ? 4.277   -58.284 34.121  1.00 41.59 ? 104  HIS C ND1   1 
ATOM   4948  C  CD2   . HIS D  1 105 ? 6.352   -58.874 34.455  1.00 41.96 ? 104  HIS C CD2   1 
ATOM   4949  C  CE1   . HIS D  1 105 ? 4.286   -59.590 34.313  1.00 41.49 ? 104  HIS C CE1   1 
ATOM   4950  N  NE2   . HIS D  1 105 ? 5.530   -59.971 34.523  1.00 40.43 ? 104  HIS C NE2   1 
ATOM   4951  N  N     . CYS D  1 106 ? 7.213   -53.861 32.330  1.00 39.28 ? 105  CYS C N     1 
ATOM   4952  C  CA    . CYS D  1 106 ? 7.408   -52.407 32.205  1.00 39.32 ? 105  CYS C CA    1 
ATOM   4953  C  C     . CYS D  1 106 ? 8.433   -52.061 31.100  1.00 38.19 ? 105  CYS C C     1 
ATOM   4954  O  O     . CYS D  1 106 ? 9.583   -51.789 31.396  1.00 38.14 ? 105  CYS C O     1 
ATOM   4955  C  CB    . CYS D  1 106 ? 7.887   -51.829 33.540  1.00 39.58 ? 105  CYS C CB    1 
ATOM   4956  S  SG    . CYS D  1 106 ? 6.819   -52.191 34.921  1.00 40.69 ? 105  CYS C SG    1 
ATOM   4957  N  N     . PRO D  1 107 ? 7.995   -52.032 29.833  1.00 36.97 ? 106  PRO C N     1 
ATOM   4958  C  CA    . PRO D  1 107 ? 8.890   -51.903 28.690  1.00 36.62 ? 106  PRO C CA    1 
ATOM   4959  C  C     . PRO D  1 107 ? 9.755   -50.642 28.614  1.00 36.58 ? 106  PRO C C     1 
ATOM   4960  O  O     . PRO D  1 107 ? 10.770  -50.654 27.911  1.00 35.32 ? 106  PRO C O     1 
ATOM   4961  C  CB    . PRO D  1 107 ? 7.935   -51.938 27.502  1.00 36.83 ? 106  PRO C CB    1 
ATOM   4962  C  CG    . PRO D  1 107 ? 6.714   -52.570 28.014  1.00 36.95 ? 106  PRO C CG    1 
ATOM   4963  C  CD    . PRO D  1 107 ? 6.595   -52.170 29.415  1.00 36.45 ? 106  PRO C CD    1 
ATOM   4964  N  N     . HIS D  1 108 ? 9.359   -49.559 29.303  1.00 36.49 ? 107  HIS C N     1 
ATOM   4965  C  CA    . HIS D  1 108 ? 10.099  -48.301 29.187  1.00 36.18 ? 107  HIS C CA    1 
ATOM   4966  C  C     . HIS D  1 108 ? 10.482  -47.655 30.514  1.00 36.06 ? 107  HIS C C     1 
ATOM   4967  O  O     . HIS D  1 108 ? 10.830  -46.486 30.557  1.00 36.68 ? 107  HIS C O     1 
ATOM   4968  C  CB    . HIS D  1 108 ? 9.343   -47.330 28.277  1.00 35.88 ? 107  HIS C CB    1 
ATOM   4969  C  CG    . HIS D  1 108 ? 7.962   -46.997 28.750  1.00 35.53 ? 107  HIS C CG    1 
ATOM   4970  N  ND1   . HIS D  1 108 ? 7.712   -46.022 29.690  1.00 37.28 ? 107  HIS C ND1   1 
ATOM   4971  C  CD2   . HIS D  1 108 ? 6.758   -47.517 28.421  1.00 36.37 ? 107  HIS C CD2   1 
ATOM   4972  C  CE1   . HIS D  1 108 ? 6.410   -45.952 29.916  1.00 38.56 ? 107  HIS C CE1   1 
ATOM   4973  N  NE2   . HIS D  1 108 ? 5.808   -46.849 29.158  1.00 37.51 ? 107  HIS C NE2   1 
ATOM   4974  N  N     . THR D  1 109 ? 10.480  -48.429 31.590  1.00 36.14 ? 108  THR C N     1 
ATOM   4975  C  CA    . THR D  1 109 ? 10.806  -47.892 32.905  1.00 35.84 ? 108  THR C CA    1 
ATOM   4976  C  C     . THR D  1 109 ? 12.310  -47.963 33.114  1.00 35.93 ? 108  THR C C     1 
ATOM   4977  O  O     . THR D  1 109 ? 12.934  -48.977 32.777  1.00 35.83 ? 108  THR C O     1 
ATOM   4978  C  CB    . THR D  1 109 ? 10.018  -48.631 34.003  1.00 36.13 ? 108  THR C CB    1 
ATOM   4979  O  OG1   . THR D  1 109 ? 8.630   -48.570 33.676  1.00 32.98 ? 108  THR C OG1   1 
ATOM   4980  C  CG2   . THR D  1 109 ? 10.247  -48.006 35.391  1.00 35.82 ? 108  THR C CG2   1 
ATOM   4981  N  N     . PRO D  1 110 ? 12.924  -46.868 33.595  1.00 35.69 ? 109  PRO C N     1 
ATOM   4982  C  CA    . PRO D  1 110 ? 14.386  -46.899 33.806  1.00 35.50 ? 109  PRO C CA    1 
ATOM   4983  C  C     . PRO D  1 110 ? 14.819  -47.924 34.868  1.00 35.57 ? 109  PRO C C     1 
ATOM   4984  O  O     . PRO D  1 110 ? 14.074  -48.164 35.813  1.00 34.62 ? 109  PRO C O     1 
ATOM   4985  C  CB    . PRO D  1 110 ? 14.707  -45.458 34.257  1.00 35.52 ? 109  PRO C CB    1 
ATOM   4986  C  CG    . PRO D  1 110 ? 13.436  -44.960 34.843  1.00 35.08 ? 109  PRO C CG    1 
ATOM   4987  C  CD    . PRO D  1 110 ? 12.365  -45.559 33.956  1.00 35.68 ? 109  PRO C CD    1 
ATOM   4988  N  N     . ILE D  1 111 ? 16.007  -48.525 34.670  1.00 35.73 ? 110  ILE C N     1 
ATOM   4989  C  CA    . ILE D  1 111 ? 16.569  -49.538 35.551  1.00 36.10 ? 110  ILE C CA    1 
ATOM   4990  C  C     . ILE D  1 111 ? 17.981  -49.127 36.015  1.00 36.89 ? 110  ILE C C     1 
ATOM   4991  O  O     . ILE D  1 111 ? 18.833  -48.760 35.188  1.00 35.82 ? 110  ILE C O     1 
ATOM   4992  C  CB    . ILE D  1 111 ? 16.782  -50.895 34.827  1.00 36.23 ? 110  ILE C CB    1 
ATOM   4993  C  CG1   . ILE D  1 111 ? 15.490  -51.446 34.222  1.00 37.39 ? 110  ILE C CG1   1 
ATOM   4994  C  CG2   . ILE D  1 111 ? 17.404  -51.915 35.785  1.00 35.83 ? 110  ILE C CG2   1 
ATOM   4995  C  CD1   . ILE D  1 111 ? 15.728  -52.704 33.325  1.00 36.64 ? 110  ILE C CD1   1 
ATOM   4996  N  N     . LEU D  1 112 ? 18.220  -49.228 37.326  1.00 37.02 ? 111  LEU C N     1 
ATOM   4997  C  CA    . LEU D  1 112 ? 19.555  -49.104 37.880  1.00 37.06 ? 111  LEU C CA    1 
ATOM   4998  C  C     . LEU D  1 112 ? 20.018  -50.500 38.249  1.00 36.96 ? 111  LEU C C     1 
ATOM   4999  O  O     . LEU D  1 112 ? 19.256  -51.275 38.822  1.00 37.49 ? 111  LEU C O     1 
ATOM   5000  C  CB    . LEU D  1 112 ? 19.560  -48.185 39.104  1.00 37.17 ? 111  LEU C CB    1 
ATOM   5001  C  CG    . LEU D  1 112 ? 19.450  -46.691 38.781  1.00 37.14 ? 111  LEU C CG    1 
ATOM   5002  C  CD1   . LEU D  1 112 ? 18.041  -46.338 38.317  1.00 40.38 ? 111  LEU C CD1   1 
ATOM   5003  C  CD2   . LEU D  1 112 ? 19.832  -45.844 39.992  1.00 37.49 ? 111  LEU C CD2   1 
ATOM   5004  N  N     . LEU D  1 113 ? 21.256  -50.835 37.899  1.00 37.41 ? 112  LEU C N     1 
ATOM   5005  C  CA    . LEU D  1 113 ? 21.831  -52.101 38.312  1.00 36.79 ? 112  LEU C CA    1 
ATOM   5006  C  C     . LEU D  1 113 ? 22.676  -51.845 39.558  1.00 36.96 ? 112  LEU C C     1 
ATOM   5007  O  O     . LEU D  1 113 ? 23.586  -51.011 39.545  1.00 36.99 ? 112  LEU C O     1 
ATOM   5008  C  CB    . LEU D  1 113 ? 22.649  -52.721 37.186  1.00 36.89 ? 112  LEU C CB    1 
ATOM   5009  C  CG    . LEU D  1 113 ? 23.225  -54.110 37.528  1.00 36.12 ? 112  LEU C CG    1 
ATOM   5010  C  CD1   . LEU D  1 113 ? 22.107  -55.133 37.672  1.00 34.36 ? 112  LEU C CD1   1 
ATOM   5011  C  CD2   . LEU D  1 113 ? 24.233  -54.538 36.479  1.00 36.27 ? 112  LEU C CD2   1 
ATOM   5012  N  N     . VAL D  1 114 ? 22.368  -52.577 40.631  1.00 37.02 ? 113  VAL C N     1 
ATOM   5013  C  CA    . VAL D  1 114 ? 22.927  -52.317 41.942  1.00 37.16 ? 113  VAL C CA    1 
ATOM   5014  C  C     . VAL D  1 114 ? 23.668  -53.558 42.432  1.00 37.68 ? 113  VAL C C     1 
ATOM   5015  O  O     . VAL D  1 114 ? 23.083  -54.652 42.585  1.00 37.26 ? 113  VAL C O     1 
ATOM   5016  C  CB    . VAL D  1 114 ? 21.828  -51.877 42.980  1.00 37.58 ? 113  VAL C CB    1 
ATOM   5017  C  CG1   . VAL D  1 114 ? 22.467  -51.543 44.340  1.00 39.84 ? 113  VAL C CG1   1 
ATOM   5018  C  CG2   . VAL D  1 114 ? 21.036  -50.683 42.464  1.00 36.01 ? 113  VAL C CG2   1 
ATOM   5019  N  N     . GLY D  1 115 ? 24.969  -53.376 42.639  1.00 37.28 ? 114  GLY C N     1 
ATOM   5020  C  CA    . GLY D  1 115 ? 25.817  -54.387 43.254  1.00 37.64 ? 114  GLY C CA    1 
ATOM   5021  C  C     . GLY D  1 115 ? 25.859  -54.181 44.762  1.00 37.60 ? 114  GLY C C     1 
ATOM   5022  O  O     . GLY D  1 115 ? 26.332  -53.151 45.240  1.00 38.52 ? 114  GLY C O     1 
ATOM   5023  N  N     . THR D  1 116 ? 25.364  -55.159 45.512  1.00 37.22 ? 115  THR C N     1 
ATOM   5024  C  CA    . THR D  1 116 ? 25.290  -55.070 46.963  1.00 36.77 ? 115  THR C CA    1 
ATOM   5025  C  C     . THR D  1 116 ? 26.458  -55.813 47.611  1.00 36.29 ? 115  THR C C     1 
ATOM   5026  O  O     . THR D  1 116 ? 27.145  -56.579 46.957  1.00 36.35 ? 115  THR C O     1 
ATOM   5027  C  CB    . THR D  1 116 ? 24.048  -55.752 47.474  1.00 36.64 ? 115  THR C CB    1 
ATOM   5028  O  OG1   . THR D  1 116 ? 24.072  -57.127 47.056  1.00 36.01 ? 115  THR C OG1   1 
ATOM   5029  C  CG2   . THR D  1 116 ? 22.782  -55.047 46.967  1.00 38.15 ? 115  THR C CG2   1 
ATOM   5030  N  N     . LYS D  1 117 ? 26.609  -55.611 48.916  1.00 36.01 ? 116  LYS C N     1 
ATOM   5031  C  CA    . LYS D  1 117 ? 27.610  -56.276 49.771  1.00 35.49 ? 116  LYS C CA    1 
ATOM   5032  C  C     . LYS D  1 117 ? 29.034  -55.911 49.362  1.00 35.61 ? 116  LYS C C     1 
ATOM   5033  O  O     . LYS D  1 117 ? 29.937  -56.748 49.401  1.00 35.18 ? 116  LYS C O     1 
ATOM   5034  C  CB    . LYS D  1 117 ? 27.412  -57.809 49.805  1.00 35.28 ? 116  LYS C CB    1 
ATOM   5035  C  CG    . LYS D  1 117 ? 26.026  -58.253 50.254  1.00 34.59 ? 116  LYS C CG    1 
ATOM   5036  C  CD    . LYS D  1 117 ? 25.967  -59.749 50.519  1.00 34.41 ? 116  LYS C CD    1 
ATOM   5037  C  CE    . LYS D  1 117 ? 24.534  -60.238 50.593  1.00 31.91 ? 116  LYS C CE    1 
ATOM   5038  N  NZ    . LYS D  1 117 ? 24.466  -61.612 51.163  1.00 30.30 ? 116  LYS C NZ    1 
ATOM   5039  N  N     . LEU D  1 118 ? 29.222  -54.646 48.994  1.00 35.61 ? 117  LEU C N     1 
ATOM   5040  C  CA    . LEU D  1 118 ? 30.536  -54.119 48.661  1.00 36.34 ? 117  LEU C CA    1 
ATOM   5041  C  C     . LEU D  1 118 ? 31.613  -54.424 49.730  1.00 36.43 ? 117  LEU C C     1 
ATOM   5042  O  O     . LEU D  1 118 ? 32.778  -54.675 49.405  1.00 36.70 ? 117  LEU C O     1 
ATOM   5043  C  CB    . LEU D  1 118 ? 30.442  -52.605 48.394  1.00 36.40 ? 117  LEU C CB    1 
ATOM   5044  C  CG    . LEU D  1 118 ? 31.734  -51.894 47.966  1.00 36.08 ? 117  LEU C CG    1 
ATOM   5045  C  CD1   . LEU D  1 118 ? 32.288  -52.450 46.645  1.00 35.12 ? 117  LEU C CD1   1 
ATOM   5046  C  CD2   . LEU D  1 118 ? 31.503  -50.385 47.876  1.00 36.11 ? 117  LEU C CD2   1 
ATOM   5047  N  N     . ASP D  1 119 ? 31.228  -54.416 50.997  1.00 36.87 ? 118  ASP C N     1 
ATOM   5048  C  CA    . ASP D  1 119 ? 32.166  -54.750 52.078  1.00 36.97 ? 118  ASP C CA    1 
ATOM   5049  C  C     . ASP D  1 119 ? 32.758  -56.166 51.998  1.00 37.06 ? 118  ASP C C     1 
ATOM   5050  O  O     . ASP D  1 119 ? 33.840  -56.403 52.504  1.00 37.11 ? 118  ASP C O     1 
ATOM   5051  C  CB    . ASP D  1 119 ? 31.507  -54.553 53.444  1.00 37.25 ? 118  ASP C CB    1 
ATOM   5052  C  CG    . ASP D  1 119 ? 30.304  -55.451 53.660  1.00 37.13 ? 118  ASP C CG    1 
ATOM   5053  O  OD1   . ASP D  1 119 ? 29.307  -55.290 52.940  1.00 38.60 ? 118  ASP C OD1   1 
ATOM   5054  O  OD2   . ASP D  1 119 ? 30.348  -56.298 54.570  1.00 36.99 ? 118  ASP C OD2   1 
ATOM   5055  N  N     . LEU D  1 120 ? 32.067  -57.107 51.364  1.00 37.36 ? 119  LEU C N     1 
ATOM   5056  C  CA    . LEU D  1 120 ? 32.580  -58.481 51.278  1.00 37.57 ? 119  LEU C CA    1 
ATOM   5057  C  C     . LEU D  1 120 ? 33.523  -58.723 50.085  1.00 38.17 ? 119  LEU C C     1 
ATOM   5058  O  O     . LEU D  1 120 ? 34.257  -59.704 50.076  1.00 38.11 ? 119  LEU C O     1 
ATOM   5059  C  CB    . LEU D  1 120 ? 31.429  -59.485 51.258  1.00 37.10 ? 119  LEU C CB    1 
ATOM   5060  C  CG    . LEU D  1 120 ? 30.564  -59.539 52.521  1.00 37.30 ? 119  LEU C CG    1 
ATOM   5061  C  CD1   . LEU D  1 120 ? 29.413  -60.512 52.325  1.00 35.75 ? 119  LEU C CD1   1 
ATOM   5062  C  CD2   . LEU D  1 120 ? 31.388  -59.898 53.760  1.00 35.27 ? 119  LEU C CD2   1 
ATOM   5063  N  N     . ARG D  1 121 ? 33.510  -57.834 49.091  1.00 38.98 ? 120  ARG C N     1 
ATOM   5064  C  CA    . ARG D  1 121 ? 34.420  -57.947 47.958  1.00 39.49 ? 120  ARG C CA    1 
ATOM   5065  C  C     . ARG D  1 121 ? 35.887  -57.767 48.379  1.00 40.40 ? 120  ARG C C     1 
ATOM   5066  O  O     . ARG D  1 121 ? 36.776  -58.413 47.817  1.00 40.08 ? 120  ARG C O     1 
ATOM   5067  C  CB    . ARG D  1 121 ? 34.061  -56.944 46.859  1.00 39.20 ? 120  ARG C CB    1 
ATOM   5068  C  CG    . ARG D  1 121 ? 34.894  -57.114 45.608  1.00 38.83 ? 120  ARG C CG    1 
ATOM   5069  C  CD    . ARG D  1 121 ? 34.285  -56.397 44.417  1.00 39.27 ? 120  ARG C CD    1 
ATOM   5070  N  NE    . ARG D  1 121 ? 34.476  -54.949 44.504  1.00 38.14 ? 120  ARG C NE    1 
ATOM   5071  C  CZ    . ARG D  1 121 ? 34.065  -54.080 43.589  1.00 36.92 ? 120  ARG C CZ    1 
ATOM   5072  N  NH1   . ARG D  1 121 ? 33.428  -54.489 42.509  1.00 36.63 ? 120  ARG C NH1   1 
ATOM   5073  N  NH2   . ARG D  1 121 ? 34.280  -52.793 43.766  1.00 36.96 ? 120  ARG C NH2   1 
ATOM   5074  N  N     . ASP D  1 122 ? 36.129  -56.891 49.354  1.00 41.13 ? 121  ASP C N     1 
ATOM   5075  C  CA    . ASP D  1 122 ? 37.468  -56.697 49.910  1.00 42.00 ? 121  ASP C CA    1 
ATOM   5076  C  C     . ASP D  1 122 ? 37.736  -57.591 51.125  1.00 42.30 ? 121  ASP C C     1 
ATOM   5077  O  O     . ASP D  1 122 ? 38.826  -57.556 51.688  1.00 43.25 ? 121  ASP C O     1 
ATOM   5078  C  CB    . ASP D  1 122 ? 37.686  -55.223 50.288  1.00 42.13 ? 121  ASP C CB    1 
ATOM   5079  N  N     . ASP D  1 123 ? 36.760  -58.391 51.527  1.00 42.40 ? 122  ASP C N     1 
ATOM   5080  C  CA    . ASP D  1 123 ? 36.931  -59.316 52.648  1.00 42.65 ? 122  ASP C CA    1 
ATOM   5081  C  C     . ASP D  1 123 ? 37.734  -60.531 52.201  1.00 42.68 ? 122  ASP C C     1 
ATOM   5082  O  O     . ASP D  1 123 ? 37.290  -61.283 51.334  1.00 42.55 ? 122  ASP C O     1 
ATOM   5083  C  CB    . ASP D  1 123 ? 35.573  -59.768 53.175  1.00 42.66 ? 122  ASP C CB    1 
ATOM   5084  C  CG    . ASP D  1 123 ? 35.686  -60.644 54.398  1.00 43.00 ? 122  ASP C CG    1 
ATOM   5085  O  OD1   . ASP D  1 123 ? 36.143  -60.124 55.442  1.00 44.17 ? 122  ASP C OD1   1 
ATOM   5086  O  OD2   . ASP D  1 123 ? 35.310  -61.841 54.316  1.00 41.30 ? 122  ASP C OD2   1 
ATOM   5087  N  N     . LYS D  1 124 ? 38.895  -60.723 52.820  1.00 42.46 ? 123  LYS C N     1 
ATOM   5088  C  CA    . LYS D  1 124 ? 39.862  -61.745 52.412  1.00 42.67 ? 123  LYS C CA    1 
ATOM   5089  C  C     . LYS D  1 124 ? 39.334  -63.183 52.483  1.00 42.48 ? 123  LYS C C     1 
ATOM   5090  O  O     . LYS D  1 124 ? 39.651  -64.005 51.619  1.00 42.44 ? 123  LYS C O     1 
ATOM   5091  C  CB    . LYS D  1 124 ? 41.146  -61.644 53.264  1.00 42.13 ? 123  LYS C CB    1 
ATOM   5092  N  N     . ASP D  1 125 ? 38.562  -63.493 53.523  1.00 42.43 ? 124  ASP C N     1 
ATOM   5093  C  CA    . ASP D  1 125 ? 38.070  -64.850 53.711  1.00 42.16 ? 124  ASP C CA    1 
ATOM   5094  C  C     . ASP D  1 125 ? 36.999  -65.158 52.678  1.00 41.93 ? 124  ASP C C     1 
ATOM   5095  O  O     . ASP D  1 125 ? 36.938  -66.270 52.167  1.00 41.96 ? 124  ASP C O     1 
ATOM   5096  C  CB    . ASP D  1 125 ? 37.508  -65.034 55.114  1.00 42.47 ? 124  ASP C CB    1 
ATOM   5097  C  CG    . ASP D  1 125 ? 38.578  -65.031 56.195  1.00 43.53 ? 124  ASP C CG    1 
ATOM   5098  O  OD1   . ASP D  1 125 ? 39.771  -65.296 55.902  1.00 47.35 ? 124  ASP C OD1   1 
ATOM   5099  O  OD2   . ASP D  1 125 ? 38.212  -64.776 57.362  1.00 44.56 ? 124  ASP C OD2   1 
ATOM   5100  N  N     . THR D  1 126 ? 36.142  -64.179 52.398  1.00 41.46 ? 125  THR C N     1 
ATOM   5101  C  CA    . THR D  1 126 ? 35.130  -64.290 51.341  1.00 41.27 ? 125  THR C CA    1 
ATOM   5102  C  C     . THR D  1 126 ? 35.780  -64.563 49.999  1.00 40.94 ? 125  THR C C     1 
ATOM   5103  O  O     . THR D  1 126 ? 35.383  -65.478 49.283  1.00 40.84 ? 125  THR C O     1 
ATOM   5104  C  CB    . THR D  1 126 ? 34.274  -63.010 51.252  1.00 41.08 ? 125  THR C CB    1 
ATOM   5105  O  OG1   . THR D  1 126 ? 33.438  -62.931 52.411  1.00 41.36 ? 125  THR C OG1   1 
ATOM   5106  C  CG2   . THR D  1 126 ? 33.390  -63.008 50.002  1.00 41.20 ? 125  THR C CG2   1 
ATOM   5107  N  N     . ILE D  1 127 ? 36.807  -63.780 49.685  1.00 41.08 ? 126  ILE C N     1 
ATOM   5108  C  CA    . ILE D  1 127 ? 37.607  -63.986 48.472  1.00 40.47 ? 126  ILE C CA    1 
ATOM   5109  C  C     . ILE D  1 127 ? 38.149  -65.421 48.398  1.00 40.44 ? 126  ILE C C     1 
ATOM   5110  O  O     . ILE D  1 127 ? 38.036  -66.073 47.366  1.00 40.35 ? 126  ILE C O     1 
ATOM   5111  C  CB    . ILE D  1 127 ? 38.762  -62.951 48.366  1.00 40.66 ? 126  ILE C CB    1 
ATOM   5112  C  CG1   . ILE D  1 127 ? 38.206  -61.541 48.090  1.00 40.43 ? 126  ILE C CG1   1 
ATOM   5113  C  CG2   . ILE D  1 127 ? 39.717  -63.333 47.270  1.00 39.55 ? 126  ILE C CG2   1 
ATOM   5114  C  CD1   . ILE D  1 127 ? 39.256  -60.402 48.206  1.00 39.57 ? 126  ILE C CD1   1 
ATOM   5115  N  N     . GLU D  1 128 ? 38.708  -65.917 49.493  1.00 40.65 ? 127  GLU C N     1 
ATOM   5116  C  CA    . GLU D  1 128 ? 39.267  -67.275 49.533  1.00 40.86 ? 127  GLU C CA    1 
ATOM   5117  C  C     . GLU D  1 128 ? 38.184  -68.372 49.434  1.00 40.84 ? 127  GLU C C     1 
ATOM   5118  O  O     . GLU D  1 128 ? 38.375  -69.394 48.775  1.00 40.80 ? 127  GLU C O     1 
ATOM   5119  C  CB    . GLU D  1 128 ? 40.132  -67.467 50.796  1.00 40.65 ? 127  GLU C CB    1 
ATOM   5120  N  N     . ARG D  1 129 ? 37.053  -68.164 50.090  1.00 41.18 ? 128  ARG C N     1 
ATOM   5121  C  CA    . ARG D  1 129 ? 35.935  -69.102 49.998  1.00 41.56 ? 128  ARG C CA    1 
ATOM   5122  C  C     . ARG D  1 129 ? 35.396  -69.231 48.575  1.00 41.89 ? 128  ARG C C     1 
ATOM   5123  O  O     . ARG D  1 129 ? 34.997  -70.326 48.159  1.00 42.01 ? 128  ARG C O     1 
ATOM   5124  C  CB    . ARG D  1 129 ? 34.815  -68.684 50.941  1.00 41.59 ? 128  ARG C CB    1 
ATOM   5125  C  CG    . ARG D  1 129 ? 35.082  -69.022 52.420  1.00 41.74 ? 128  ARG C CG    1 
ATOM   5126  C  CD    . ARG D  1 129 ? 33.786  -68.913 53.243  1.00 42.52 ? 128  ARG C CD    1 
ATOM   5127  N  NE    . ARG D  1 129 ? 33.472  -67.533 53.596  1.00 41.46 ? 128  ARG C NE    1 
ATOM   5128  C  CZ    . ARG D  1 129 ? 34.009  -66.878 54.622  1.00 42.75 ? 128  ARG C CZ    1 
ATOM   5129  N  NH1   . ARG D  1 129 ? 34.897  -67.455 55.435  1.00 42.70 ? 128  ARG C NH1   1 
ATOM   5130  N  NH2   . ARG D  1 129 ? 33.647  -65.624 54.849  1.00 44.27 ? 128  ARG C NH2   1 
ATOM   5131  N  N     . LEU D  1 130 ? 35.385  -68.119 47.835  1.00 41.73 ? 129  LEU C N     1 
ATOM   5132  C  CA    . LEU D  1 130 ? 34.993  -68.140 46.420  1.00 41.85 ? 129  LEU C CA    1 
ATOM   5133  C  C     . LEU D  1 130 ? 36.031  -68.866 45.559  1.00 42.29 ? 129  LEU C C     1 
ATOM   5134  O  O     . LEU D  1 130 ? 35.683  -69.652 44.672  1.00 42.30 ? 129  LEU C O     1 
ATOM   5135  C  CB    . LEU D  1 130 ? 34.765  -66.713 45.904  1.00 41.94 ? 129  LEU C CB    1 
ATOM   5136  C  CG    . LEU D  1 130 ? 33.493  -66.002 46.413  1.00 41.65 ? 129  LEU C CG    1 
ATOM   5137  C  CD1   . LEU D  1 130 ? 33.460  -64.531 45.979  1.00 40.84 ? 129  LEU C CD1   1 
ATOM   5138  C  CD2   . LEU D  1 130 ? 32.248  -66.724 45.924  1.00 41.56 ? 129  LEU C CD2   1 
ATOM   5139  N  N     . ARG D  1 131 ? 37.303  -68.597 45.831  1.00 42.22 ? 130  ARG C N     1 
ATOM   5140  C  CA    . ARG D  1 131 ? 38.407  -69.241 45.118  1.00 42.84 ? 130  ARG C CA    1 
ATOM   5141  C  C     . ARG D  1 131 ? 38.338  -70.769 45.201  1.00 42.98 ? 130  ARG C C     1 
ATOM   5142  O  O     . ARG D  1 131 ? 38.617  -71.447 44.229  1.00 42.78 ? 130  ARG C O     1 
ATOM   5143  C  CB    . ARG D  1 131 ? 39.746  -68.740 45.658  1.00 42.40 ? 130  ARG C CB    1 
ATOM   5144  N  N     . ASP D  1 132 ? 37.935  -71.303 46.348  1.00 43.79 ? 131  ASP C N     1 
ATOM   5145  C  CA    . ASP D  1 132 ? 37.824  -72.759 46.524  1.00 44.50 ? 131  ASP C CA    1 
ATOM   5146  C  C     . ASP D  1 132 ? 36.708  -73.389 45.684  1.00 44.26 ? 131  ASP C C     1 
ATOM   5147  O  O     . ASP D  1 132 ? 36.754  -74.589 45.406  1.00 44.38 ? 131  ASP C O     1 
ATOM   5148  C  CB    . ASP D  1 132 ? 37.626  -73.122 48.002  1.00 45.03 ? 131  ASP C CB    1 
ATOM   5149  C  CG    . ASP D  1 132 ? 38.881  -72.868 48.858  1.00 47.39 ? 131  ASP C CG    1 
ATOM   5150  O  OD1   . ASP D  1 132 ? 40.016  -73.232 48.447  1.00 47.68 ? 131  ASP C OD1   1 
ATOM   5151  O  OD2   . ASP D  1 132 ? 38.708  -72.303 49.966  1.00 51.63 ? 131  ASP C OD2   1 
ATOM   5152  N  N     . LYS D  1 133 ? 35.717  -72.584 45.296  1.00 43.63 ? 132  LYS C N     1 
ATOM   5153  C  CA    . LYS D  1 133 ? 34.654  -73.009 44.380  1.00 43.33 ? 132  LYS C CA    1 
ATOM   5154  C  C     . LYS D  1 133 ? 34.852  -72.431 42.971  1.00 42.93 ? 132  LYS C C     1 
ATOM   5155  O  O     . LYS D  1 133 ? 33.886  -72.280 42.228  1.00 42.79 ? 132  LYS C O     1 
ATOM   5156  C  CB    . LYS D  1 133 ? 33.280  -72.587 44.928  1.00 43.24 ? 132  LYS C CB    1 
ATOM   5157  C  CG    . LYS D  1 133 ? 32.902  -73.241 46.251  1.00 43.27 ? 132  LYS C CG    1 
ATOM   5158  N  N     . LYS D  1 134 ? 36.105  -72.138 42.611  1.00 42.53 ? 133  LYS C N     1 
ATOM   5159  C  CA    . LYS D  1 134 ? 36.480  -71.604 41.290  1.00 42.23 ? 133  LYS C CA    1 
ATOM   5160  C  C     . LYS D  1 134 ? 35.621  -70.394 40.898  1.00 41.89 ? 133  LYS C C     1 
ATOM   5161  O  O     . LYS D  1 134 ? 35.101  -70.310 39.778  1.00 42.33 ? 133  LYS C O     1 
ATOM   5162  C  CB    . LYS D  1 134 ? 36.420  -72.700 40.214  1.00 42.05 ? 133  LYS C CB    1 
ATOM   5163  N  N     . LEU D  1 135 ? 35.480  -69.466 41.838  1.00 41.14 ? 134  LEU C N     1 
ATOM   5164  C  CA    . LEU D  1 135 ? 34.718  -68.252 41.630  1.00 40.43 ? 134  LEU C CA    1 
ATOM   5165  C  C     . LEU D  1 135 ? 35.466  -67.038 42.158  1.00 39.84 ? 134  LEU C C     1 
ATOM   5166  O  O     . LEU D  1 135 ? 36.373  -67.153 42.975  1.00 39.34 ? 134  LEU C O     1 
ATOM   5167  C  CB    . LEU D  1 135 ? 33.380  -68.355 42.358  1.00 40.66 ? 134  LEU C CB    1 
ATOM   5168  C  CG    . LEU D  1 135 ? 32.395  -69.398 41.846  1.00 41.11 ? 134  LEU C CG    1 
ATOM   5169  C  CD1   . LEU D  1 135 ? 31.271  -69.571 42.853  1.00 42.94 ? 134  LEU C CD1   1 
ATOM   5170  C  CD2   . LEU D  1 135 ? 31.859  -68.979 40.490  1.00 41.79 ? 134  LEU C CD2   1 
ATOM   5171  N  N     . ALA D  1 136 ? 35.043  -65.859 41.716  1.00 39.46 ? 135  ALA C N     1 
ATOM   5172  C  CA    . ALA D  1 136 ? 35.594  -64.617 42.235  1.00 38.73 ? 135  ALA C CA    1 
ATOM   5173  C  C     . ALA D  1 136 ? 34.527  -63.537 42.303  1.00 38.11 ? 135  ALA C C     1 
ATOM   5174  O  O     . ALA D  1 136 ? 33.553  -63.563 41.542  1.00 37.99 ? 135  ALA C O     1 
ATOM   5175  C  CB    . ALA D  1 136 ? 36.760  -64.166 41.373  1.00 38.72 ? 135  ALA C CB    1 
ATOM   5176  N  N     . PRO D  1 137 ? 34.709  -62.567 43.213  1.00 37.50 ? 136  PRO C N     1 
ATOM   5177  C  CA    . PRO D  1 137 ? 33.767  -61.445 43.308  1.00 37.03 ? 136  PRO C CA    1 
ATOM   5178  C  C     . PRO D  1 137 ? 33.604  -60.701 41.982  1.00 36.91 ? 136  PRO C C     1 
ATOM   5179  O  O     . PRO D  1 137 ? 34.496  -60.693 41.154  1.00 37.39 ? 136  PRO C O     1 
ATOM   5180  C  CB    . PRO D  1 137 ? 34.408  -60.521 44.341  1.00 37.35 ? 136  PRO C CB    1 
ATOM   5181  C  CG    . PRO D  1 137 ? 35.404  -61.370 45.098  1.00 36.68 ? 136  PRO C CG    1 
ATOM   5182  C  CD    . PRO D  1 137 ? 35.824  -62.465 44.175  1.00 37.08 ? 136  PRO C CD    1 
ATOM   5183  N  N     . ILE D  1 138 ? 32.451  -60.088 41.783  1.00 37.14 ? 137  ILE C N     1 
ATOM   5184  C  CA    . ILE D  1 138 ? 32.177  -59.347 40.560  1.00 36.64 ? 137  ILE C CA    1 
ATOM   5185  C  C     . ILE D  1 138 ? 32.965  -58.051 40.680  1.00 36.81 ? 137  ILE C C     1 
ATOM   5186  O  O     . ILE D  1 138 ? 32.915  -57.388 41.706  1.00 36.93 ? 137  ILE C O     1 
ATOM   5187  C  CB    . ILE D  1 138 ? 30.654  -59.049 40.404  1.00 36.17 ? 137  ILE C CB    1 
ATOM   5188  C  CG1   . ILE D  1 138 ? 29.827  -60.332 40.530  1.00 35.97 ? 137  ILE C CG1   1 
ATOM   5189  C  CG2   . ILE D  1 138 ? 30.360  -58.332 39.093  1.00 35.38 ? 137  ILE C CG2   1 
ATOM   5190  C  CD1   . ILE D  1 138 ? 30.126  -61.413 39.531  1.00 36.81 ? 137  ILE C CD1   1 
ATOM   5191  N  N     . THR D  1 139 ? 33.730  -57.730 39.645  1.00 37.34 ? 138  THR C N     1 
ATOM   5192  C  CA    . THR D  1 139 ? 34.509  -56.497 39.589  1.00 37.43 ? 138  THR C CA    1 
ATOM   5193  C  C     . THR D  1 139 ? 33.643  -55.366 39.040  1.00 37.55 ? 138  THR C C     1 
ATOM   5194  O  O     . THR D  1 139 ? 32.594  -55.611 38.447  1.00 38.16 ? 138  THR C O     1 
ATOM   5195  C  CB    . THR D  1 139 ? 35.675  -56.651 38.637  1.00 37.55 ? 138  THR C CB    1 
ATOM   5196  O  OG1   . THR D  1 139 ? 35.148  -56.889 37.325  1.00 37.59 ? 138  THR C OG1   1 
ATOM   5197  C  CG2   . THR D  1 139 ? 36.601  -57.797 39.063  1.00 37.07 ? 138  THR C CG2   1 
ATOM   5198  N  N     . TYR D  1 140 ? 34.080  -54.129 39.240  1.00 37.52 ? 139  TYR C N     1 
ATOM   5199  C  CA    . TYR D  1 140 ? 33.342  -52.979 38.743  1.00 37.52 ? 139  TYR C CA    1 
ATOM   5200  C  C     . TYR D  1 140 ? 33.123  -53.038 37.219  1.00 37.36 ? 139  TYR C C     1 
ATOM   5201  O  O     . TYR D  1 140 ? 32.009  -52.787 36.752  1.00 38.29 ? 139  TYR C O     1 
ATOM   5202  C  CB    . TYR D  1 140 ? 34.011  -51.658 39.164  1.00 37.79 ? 139  TYR C CB    1 
ATOM   5203  C  CG    . TYR D  1 140 ? 33.271  -50.459 38.667  1.00 38.03 ? 139  TYR C CG    1 
ATOM   5204  C  CD1   . TYR D  1 140 ? 33.459  -49.993 37.372  1.00 39.51 ? 139  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR D  1 140 ? 32.352  -49.805 39.469  1.00 37.97 ? 139  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR D  1 140 ? 32.760  -48.897 36.894  1.00 39.53 ? 139  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR D  1 140 ? 31.645  -48.709 38.993  1.00 38.84 ? 139  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR D  1 140 ? 31.854  -48.264 37.709  1.00 38.79 ? 139  TYR C CZ    1 
ATOM   5209  O  OH    . TYR D  1 140 ? 31.155  -47.182 37.227  1.00 39.31 ? 139  TYR C OH    1 
ATOM   5210  N  N     . PRO D  1 141 ? 34.174  -53.345 36.438  1.00 37.20 ? 140  PRO C N     1 
ATOM   5211  C  CA    . PRO D  1 141 ? 34.050  -53.489 34.988  1.00 37.07 ? 140  PRO C CA    1 
ATOM   5212  C  C     . PRO D  1 141 ? 33.066  -54.554 34.527  1.00 37.11 ? 140  PRO C C     1 
ATOM   5213  O  O     . PRO D  1 141 ? 32.396  -54.383 33.504  1.00 38.23 ? 140  PRO C O     1 
ATOM   5214  C  CB    . PRO D  1 141 ? 35.474  -53.878 34.551  1.00 37.01 ? 140  PRO C CB    1 
ATOM   5215  C  CG    . PRO D  1 141 ? 36.343  -53.367 35.583  1.00 37.01 ? 140  PRO C CG    1 
ATOM   5216  C  CD    . PRO D  1 141 ? 35.578  -53.508 36.860  1.00 37.23 ? 140  PRO C CD    1 
ATOM   5217  N  N     . GLN D  1 142 ? 32.991  -55.656 35.255  1.00 37.06 ? 141  GLN C N     1 
ATOM   5218  C  CA    . GLN D  1 142 ? 32.013  -56.690 34.951  1.00 37.15 ? 141  GLN C CA    1 
ATOM   5219  C  C     . GLN D  1 142 ? 30.593  -56.204 35.222  1.00 37.12 ? 141  GLN C C     1 
ATOM   5220  O  O     . GLN D  1 142 ? 29.711  -56.384 34.388  1.00 37.69 ? 141  GLN C O     1 
ATOM   5221  C  CB    . GLN D  1 142 ? 32.301  -57.951 35.758  1.00 37.03 ? 141  GLN C CB    1 
ATOM   5222  C  CG    . GLN D  1 142 ? 33.464  -58.768 35.221  1.00 37.26 ? 141  GLN C CG    1 
ATOM   5223  C  CD    . GLN D  1 142 ? 33.885  -59.873 36.174  1.00 37.70 ? 141  GLN C CD    1 
ATOM   5224  O  OE1   . GLN D  1 142 ? 33.410  -59.941 37.300  1.00 36.95 ? 141  GLN C OE1   1 
ATOM   5225  N  NE2   . GLN D  1 142 ? 34.798  -60.736 35.725  1.00 37.39 ? 141  GLN C NE2   1 
ATOM   5226  N  N     . GLY D  1 143 ? 30.362  -55.606 36.382  1.00 37.10 ? 142  GLY C N     1 
ATOM   5227  C  CA    . GLY D  1 143 ? 29.039  -55.034 36.696  1.00 37.11 ? 142  GLY C CA    1 
ATOM   5228  C  C     . GLY D  1 143 ? 28.598  -53.995 35.659  1.00 37.42 ? 142  GLY C C     1 
ATOM   5229  O  O     . GLY D  1 143 ? 27.480  -54.035 35.133  1.00 36.94 ? 142  GLY C O     1 
ATOM   5230  N  N     . LEU D  1 144 ? 29.501  -53.071 35.345  1.00 37.64 ? 143  LEU C N     1 
ATOM   5231  C  CA    . LEU D  1 144 ? 29.250  -52.049 34.337  1.00 37.60 ? 143  LEU C CA    1 
ATOM   5232  C  C     . LEU D  1 144 ? 28.983  -52.635 32.944  1.00 37.69 ? 143  LEU C C     1 
ATOM   5233  O  O     . LEU D  1 144 ? 28.262  -52.030 32.166  1.00 38.19 ? 143  LEU C O     1 
ATOM   5234  C  CB    . LEU D  1 144 ? 30.431  -51.067 34.301  1.00 37.72 ? 143  LEU C CB    1 
ATOM   5235  C  CG    . LEU D  1 144 ? 30.345  -49.893 33.335  1.00 37.93 ? 143  LEU C CG    1 
ATOM   5236  C  CD1   . LEU D  1 144 ? 29.231  -48.945 33.755  1.00 38.13 ? 143  LEU C CD1   1 
ATOM   5237  C  CD2   . LEU D  1 144 ? 31.703  -49.181 33.217  1.00 37.88 ? 143  LEU C CD2   1 
ATOM   5238  N  N     . ALA D  1 145 ? 29.565  -53.787 32.609  1.00 37.76 ? 144  ALA C N     1 
ATOM   5239  C  CA    . ALA D  1 145 ? 29.284  -54.418 31.310  1.00 38.05 ? 144  ALA C CA    1 
ATOM   5240  C  C     . ALA D  1 145 ? 27.895  -55.049 31.293  1.00 38.30 ? 144  ALA C C     1 
ATOM   5241  O  O     . ALA D  1 145 ? 27.222  -55.049 30.267  1.00 38.72 ? 144  ALA C O     1 
ATOM   5242  C  CB    . ALA D  1 145 ? 30.345  -55.453 30.943  1.00 37.64 ? 144  ALA C CB    1 
ATOM   5243  N  N     . MET D  1 146 ? 27.463  -55.574 32.434  1.00 39.03 ? 145  MET C N     1 
ATOM   5244  C  CA    . MET D  1 146 ? 26.121  -56.141 32.574  1.00 39.09 ? 145  MET C CA    1 
ATOM   5245  C  C     . MET D  1 146 ? 25.067  -55.038 32.536  1.00 39.37 ? 145  MET C C     1 
ATOM   5246  O  O     . MET D  1 146 ? 24.017  -55.204 31.912  1.00 39.92 ? 145  MET C O     1 
ATOM   5247  C  CB    . MET D  1 146 ? 26.037  -56.951 33.868  1.00 39.22 ? 145  MET C CB    1 
ATOM   5248  C  CG    . MET D  1 146 ? 24.693  -57.582 34.179  1.00 40.53 ? 145  MET C CG    1 
ATOM   5249  S  SD    . MET D  1 146 ? 24.189  -58.916 33.069  1.00 42.97 ? 145  MET C SD    1 
ATOM   5250  C  CE    . MET D  1 146 ? 25.123  -60.298 33.736  1.00 42.94 ? 145  MET C CE    1 
ATOM   5251  N  N     . ALA D  1 147 ? 25.359  -53.916 33.190  1.00 39.36 ? 146  ALA C N     1 
ATOM   5252  C  CA    . ALA D  1 147 ? 24.476  -52.772 33.203  1.00 39.52 ? 146  ALA C CA    1 
ATOM   5253  C  C     . ALA D  1 147 ? 24.241  -52.278 31.791  1.00 40.23 ? 146  ALA C C     1 
ATOM   5254  O  O     . ALA D  1 147 ? 23.106  -51.995 31.412  1.00 40.93 ? 146  ALA C O     1 
ATOM   5255  C  CB    . ALA D  1 147 ? 25.052  -51.651 34.062  1.00 39.14 ? 146  ALA C CB    1 
ATOM   5256  N  N     . ARG D  1 148 ? 25.310  -52.193 31.007  1.00 41.16 ? 147  ARG C N     1 
ATOM   5257  C  CA    . ARG D  1 148 ? 25.212  -51.745 29.611  1.00 41.56 ? 147  ARG C CA    1 
ATOM   5258  C  C     . ARG D  1 148 ? 24.438  -52.707 28.724  1.00 41.36 ? 147  ARG C C     1 
ATOM   5259  O  O     . ARG D  1 148 ? 23.665  -52.287 27.858  1.00 41.38 ? 147  ARG C O     1 
ATOM   5260  C  CB    . ARG D  1 148 ? 26.608  -51.504 29.046  1.00 41.92 ? 147  ARG C CB    1 
ATOM   5261  C  CG    . ARG D  1 148 ? 27.226  -50.278 29.636  1.00 43.10 ? 147  ARG C CG    1 
ATOM   5262  C  CD    . ARG D  1 148 ? 28.630  -50.021 29.172  1.00 45.47 ? 147  ARG C CD    1 
ATOM   5263  N  NE    . ARG D  1 148 ? 29.055  -48.703 29.647  1.00 46.88 ? 147  ARG C NE    1 
ATOM   5264  C  CZ    . ARG D  1 148 ? 30.316  -48.307 29.797  1.00 47.60 ? 147  ARG C CZ    1 
ATOM   5265  N  NH1   . ARG D  1 148 ? 31.329  -49.116 29.509  1.00 49.09 ? 147  ARG C NH1   1 
ATOM   5266  N  NH2   . ARG D  1 148 ? 30.567  -47.083 30.244  1.00 47.41 ? 147  ARG C NH2   1 
ATOM   5267  N  N     . GLU D  1 149 ? 24.645  -53.998 28.959  1.00 41.30 ? 148  GLU C N     1 
ATOM   5268  C  CA    . GLU D  1 149 ? 23.957  -55.047 28.224  1.00 40.80 ? 148  GLU C CA    1 
ATOM   5269  C  C     . GLU D  1 149 ? 22.449  -54.962 28.438  1.00 40.24 ? 148  GLU C C     1 
ATOM   5270  O  O     . GLU D  1 149 ? 21.676  -55.174 27.514  1.00 40.11 ? 148  GLU C O     1 
ATOM   5271  C  CB    . GLU D  1 149 ? 24.467  -56.405 28.686  1.00 41.02 ? 148  GLU C CB    1 
ATOM   5272  C  CG    . GLU D  1 149 ? 23.972  -57.541 27.848  1.00 43.58 ? 148  GLU C CG    1 
ATOM   5273  C  CD    . GLU D  1 149 ? 24.299  -58.885 28.439  1.00 47.32 ? 148  GLU C CD    1 
ATOM   5274  O  OE1   . GLU D  1 149 ? 25.459  -59.108 28.863  1.00 49.64 ? 148  GLU C OE1   1 
ATOM   5275  O  OE2   . GLU D  1 149 ? 23.386  -59.728 28.467  1.00 51.13 ? 148  GLU C OE2   1 
ATOM   5276  N  N     . ILE D  1 150 ? 22.024  -54.652 29.657  1.00 39.57 ? 149  ILE C N     1 
ATOM   5277  C  CA    . ILE D  1 150 ? 20.590  -54.478 29.928  1.00 38.88 ? 149  ILE C CA    1 
ATOM   5278  C  C     . ILE D  1 150 ? 20.088  -53.040 29.749  1.00 38.81 ? 149  ILE C C     1 
ATOM   5279  O  O     . ILE D  1 150 ? 18.935  -52.759 30.057  1.00 39.15 ? 149  ILE C O     1 
ATOM   5280  C  CB    . ILE D  1 150 ? 20.197  -55.023 31.323  1.00 38.76 ? 149  ILE C CB    1 
ATOM   5281  C  CG1   . ILE D  1 150 ? 20.687  -54.106 32.453  1.00 39.27 ? 149  ILE C CG1   1 
ATOM   5282  C  CG2   . ILE D  1 150 ? 20.699  -56.470 31.468  1.00 37.48 ? 149  ILE C CG2   1 
ATOM   5283  C  CD1   . ILE D  1 150 ? 20.182  -54.509 33.862  1.00 37.59 ? 149  ILE C CD1   1 
ATOM   5284  N  N     . GLY D  1 151 ? 20.931  -52.138 29.251  1.00 38.53 ? 150  GLY C N     1 
ATOM   5285  C  CA    . GLY D  1 151 ? 20.510  -50.747 29.034  1.00 39.00 ? 150  GLY C CA    1 
ATOM   5286  C  C     . GLY D  1 151 ? 20.106  -50.013 30.304  1.00 39.17 ? 150  GLY C C     1 
ATOM   5287  O  O     . GLY D  1 151 ? 19.120  -49.283 30.332  1.00 39.49 ? 150  GLY C O     1 
ATOM   5288  N  N     . SER D  1 152 ? 20.877  -50.216 31.360  1.00 39.27 ? 151  SER C N     1 
ATOM   5289  C  CA    . SER D  1 152 ? 20.655  -49.546 32.634  1.00 39.72 ? 151  SER C CA    1 
ATOM   5290  C  C     . SER D  1 152 ? 21.116  -48.086 32.561  1.00 39.68 ? 151  SER C C     1 
ATOM   5291  O  O     . SER D  1 152 ? 22.070  -47.746 31.849  1.00 39.49 ? 151  SER C O     1 
ATOM   5292  C  CB    . SER D  1 152 ? 21.410  -50.277 33.745  1.00 39.92 ? 151  SER C CB    1 
ATOM   5293  O  OG    . SER D  1 152 ? 21.347  -49.569 34.965  1.00 42.32 ? 151  SER C OG    1 
ATOM   5294  N  N     . VAL D  1 153 ? 20.424  -47.230 33.302  1.00 39.69 ? 152  VAL C N     1 
ATOM   5295  C  CA    A VAL D  1 153 ? 20.731  -45.804 33.394  0.50 39.70 ? 152  VAL C CA    1 
ATOM   5296  C  CA    B VAL D  1 153 ? 20.783  -45.816 33.321  0.50 39.52 ? 152  VAL C CA    1 
ATOM   5297  C  C     . VAL D  1 153 ? 22.020  -45.571 34.183  1.00 39.40 ? 152  VAL C C     1 
ATOM   5298  O  O     . VAL D  1 153 ? 22.724  -44.590 33.977  1.00 39.55 ? 152  VAL C O     1 
ATOM   5299  C  CB    A VAL D  1 153 ? 19.576  -45.049 34.105  0.50 39.49 ? 152  VAL C CB    1 
ATOM   5300  C  CB    B VAL D  1 153 ? 19.616  -44.916 33.779  0.50 39.39 ? 152  VAL C CB    1 
ATOM   5301  C  CG1   A VAL D  1 153 ? 19.884  -43.562 34.218  0.50 39.35 ? 152  VAL C CG1   1 
ATOM   5302  C  CG1   B VAL D  1 153 ? 18.465  -45.004 32.775  0.50 39.67 ? 152  VAL C CG1   1 
ATOM   5303  C  CG2   A VAL D  1 153 ? 18.252  -45.271 33.367  0.50 40.41 ? 152  VAL C CG2   1 
ATOM   5304  C  CG2   B VAL D  1 153 ? 19.158  -45.280 35.175  0.50 38.34 ? 152  VAL C CG2   1 
ATOM   5305  N  N     . LYS D  1 154 ? 22.314  -46.482 35.105  1.00 39.79 ? 153  LYS C N     1 
ATOM   5306  C  CA    . LYS D  1 154 ? 23.428  -46.307 36.026  1.00 39.76 ? 153  LYS C CA    1 
ATOM   5307  C  C     . LYS D  1 154 ? 23.826  -47.639 36.629  1.00 39.46 ? 153  LYS C C     1 
ATOM   5308  O  O     . LYS D  1 154 ? 22.958  -48.380 37.052  1.00 39.97 ? 153  LYS C O     1 
ATOM   5309  C  CB    . LYS D  1 154 ? 22.967  -45.390 37.164  1.00 40.35 ? 153  LYS C CB    1 
ATOM   5310  C  CG    . LYS D  1 154 ? 24.075  -44.818 38.068  1.00 42.29 ? 153  LYS C CG    1 
ATOM   5311  C  CD    . LYS D  1 154 ? 24.438  -43.399 37.666  1.00 44.83 ? 153  LYS C CD    1 
ATOM   5312  C  CE    . LYS D  1 154 ? 25.915  -43.076 37.886  1.00 46.75 ? 153  LYS C CE    1 
ATOM   5313  N  NZ    . LYS D  1 154 ? 26.338  -41.935 36.994  1.00 47.92 ? 153  LYS C NZ    1 
ATOM   5314  N  N     . TYR D  1 155 ? 25.131  -47.940 36.687  1.00 39.29 ? 154  TYR C N     1 
ATOM   5315  C  CA    . TYR D  1 155 ? 25.628  -49.032 37.538  1.00 38.74 ? 154  TYR C CA    1 
ATOM   5316  C  C     . TYR D  1 155 ? 26.161  -48.412 38.830  1.00 38.78 ? 154  TYR C C     1 
ATOM   5317  O  O     . TYR D  1 155 ? 26.968  -47.465 38.784  1.00 37.65 ? 154  TYR C O     1 
ATOM   5318  C  CB    . TYR D  1 155 ? 26.726  -49.831 36.842  1.00 39.02 ? 154  TYR C CB    1 
ATOM   5319  C  CG    . TYR D  1 155 ? 27.386  -50.873 37.717  1.00 39.23 ? 154  TYR C CG    1 
ATOM   5320  C  CD1   . TYR D  1 155 ? 26.677  -51.970 38.175  1.00 39.18 ? 154  TYR C CD1   1 
ATOM   5321  C  CD2   . TYR D  1 155 ? 28.726  -50.763 38.072  1.00 38.52 ? 154  TYR C CD2   1 
ATOM   5322  C  CE1   . TYR D  1 155 ? 27.274  -52.920 38.965  1.00 39.50 ? 154  TYR C CE1   1 
ATOM   5323  C  CE2   . TYR D  1 155 ? 29.327  -51.701 38.854  1.00 38.59 ? 154  TYR C CE2   1 
ATOM   5324  C  CZ    . TYR D  1 155 ? 28.609  -52.781 39.302  1.00 39.29 ? 154  TYR C CZ    1 
ATOM   5325  O  OH    . TYR D  1 155 ? 29.223  -53.729 40.096  1.00 39.20 ? 154  TYR C OH    1 
ATOM   5326  N  N     . LEU D  1 156 ? 25.691  -48.948 39.969  1.00 38.50 ? 155  LEU C N     1 
ATOM   5327  C  CA    . LEU D  1 156 ? 26.101  -48.497 41.306  1.00 38.57 ? 155  LEU C CA    1 
ATOM   5328  C  C     . LEU D  1 156 ? 26.452  -49.663 42.226  1.00 38.26 ? 155  LEU C C     1 
ATOM   5329  O  O     . LEU D  1 156 ? 25.806  -50.711 42.194  1.00 37.92 ? 155  LEU C O     1 
ATOM   5330  C  CB    . LEU D  1 156 ? 24.985  -47.678 41.955  1.00 39.07 ? 155  LEU C CB    1 
ATOM   5331  C  CG    . LEU D  1 156 ? 24.763  -46.312 41.320  1.00 39.51 ? 155  LEU C CG    1 
ATOM   5332  C  CD1   . LEU D  1 156 ? 23.415  -45.747 41.750  1.00 42.55 ? 155  LEU C CD1   1 
ATOM   5333  C  CD2   . LEU D  1 156 ? 25.902  -45.356 41.661  1.00 41.80 ? 155  LEU C CD2   1 
ATOM   5334  N  N     . GLU D  1 157 ? 27.483  -49.462 43.038  1.00 38.06 ? 156  GLU C N     1 
ATOM   5335  C  CA    . GLU D  1 157 ? 27.930  -50.448 44.021  1.00 38.06 ? 156  GLU C CA    1 
ATOM   5336  C  C     . GLU D  1 157 ? 27.841  -49.833 45.410  1.00 38.09 ? 156  GLU C C     1 
ATOM   5337  O  O     . GLU D  1 157 ? 28.215  -48.667 45.599  1.00 37.84 ? 156  GLU C O     1 
ATOM   5338  C  CB    . GLU D  1 157 ? 29.375  -50.867 43.736  1.00 37.68 ? 156  GLU C CB    1 
ATOM   5339  C  CG    . GLU D  1 157 ? 29.553  -51.579 42.407  1.00 38.23 ? 156  GLU C CG    1 
ATOM   5340  C  CD    . GLU D  1 157 ? 30.997  -51.982 42.125  1.00 38.13 ? 156  GLU C CD    1 
ATOM   5341  O  OE1   . GLU D  1 157 ? 31.926  -51.297 42.589  1.00 38.36 ? 156  GLU C OE1   1 
ATOM   5342  O  OE2   . GLU D  1 157 ? 31.191  -52.994 41.434  1.00 37.99 ? 156  GLU C OE2   1 
ATOM   5343  N  N     . CYS D  1 158 ? 27.348  -50.617 46.374  1.00 38.07 ? 157  CYS C N     1 
ATOM   5344  C  CA    . CYS D  1 158 ? 27.206  -50.159 47.747  1.00 38.11 ? 157  CYS C CA    1 
ATOM   5345  C  C     . CYS D  1 158 ? 27.262  -51.313 48.745  1.00 37.90 ? 157  CYS C C     1 
ATOM   5346  O  O     . CYS D  1 158 ? 27.176  -52.498 48.377  1.00 37.78 ? 157  CYS C O     1 
ATOM   5347  C  CB    . CYS D  1 158 ? 25.869  -49.439 47.930  1.00 38.61 ? 157  CYS C CB    1 
ATOM   5348  S  SG    . CYS D  1 158 ? 24.388  -50.547 47.822  1.00 41.39 ? 157  CYS C SG    1 
ATOM   5349  N  N     . SER D  1 159 ? 27.383  -50.932 50.015  1.00 37.34 ? 158  SER C N     1 
ATOM   5350  C  CA    . SER D  1 159 ? 27.216  -51.831 51.139  1.00 36.65 ? 158  SER C CA    1 
ATOM   5351  C  C     . SER D  1 159 ? 26.132  -51.264 52.050  1.00 36.52 ? 158  SER C C     1 
ATOM   5352  O  O     . SER D  1 159 ? 26.213  -50.106 52.483  1.00 36.47 ? 158  SER C O     1 
ATOM   5353  C  CB    . SER D  1 159 ? 28.534  -51.958 51.903  1.00 36.63 ? 158  SER C CB    1 
ATOM   5354  O  OG    . SER D  1 159 ? 28.397  -52.795 53.037  1.00 35.13 ? 158  SER C OG    1 
ATOM   5355  N  N     . ALA D  1 160 ? 25.107  -52.067 52.332  1.00 36.13 ? 159  ALA C N     1 
ATOM   5356  C  CA    . ALA D  1 160 ? 24.093  -51.684 53.325  1.00 36.47 ? 159  ALA C CA    1 
ATOM   5357  C  C     . ALA D  1 160 ? 24.684  -51.662 54.746  1.00 36.55 ? 159  ALA C C     1 
ATOM   5358  O  O     . ALA D  1 160 ? 24.212  -50.928 55.624  1.00 36.52 ? 159  ALA C O     1 
ATOM   5359  C  CB    . ALA D  1 160 ? 22.878  -52.626 53.257  1.00 35.89 ? 159  ALA C CB    1 
ATOM   5360  N  N     . LEU D  1 161 ? 25.718  -52.474 54.964  1.00 36.92 ? 160  LEU C N     1 
ATOM   5361  C  CA    . LEU D  1 161 ? 26.339  -52.603 56.269  1.00 36.86 ? 160  LEU C CA    1 
ATOM   5362  C  C     . LEU D  1 161 ? 27.156  -51.349 56.628  1.00 37.32 ? 160  LEU C C     1 
ATOM   5363  O  O     . LEU D  1 161 ? 26.976  -50.778 57.720  1.00 37.56 ? 160  LEU C O     1 
ATOM   5364  C  CB    . LEU D  1 161 ? 27.208  -53.867 56.304  1.00 36.65 ? 160  LEU C CB    1 
ATOM   5365  C  CG    . LEU D  1 161 ? 27.888  -54.210 57.642  1.00 37.81 ? 160  LEU C CG    1 
ATOM   5366  C  CD1   . LEU D  1 161 ? 26.885  -54.519 58.770  1.00 35.10 ? 160  LEU C CD1   1 
ATOM   5367  C  CD2   . LEU D  1 161 ? 28.879  -55.375 57.455  1.00 37.54 ? 160  LEU C CD2   1 
ATOM   5368  N  N     . THR D  1 162 ? 28.048  -50.930 55.724  1.00 37.06 ? 161  THR C N     1 
ATOM   5369  C  CA    . THR D  1 162 ? 28.927  -49.784 55.966  1.00 37.00 ? 161  THR C CA    1 
ATOM   5370  C  C     . THR D  1 162 ? 28.304  -48.475 55.480  1.00 36.99 ? 161  THR C C     1 
ATOM   5371  O  O     . THR D  1 162 ? 28.794  -47.387 55.821  1.00 35.40 ? 161  THR C O     1 
ATOM   5372  C  CB    . THR D  1 162 ? 30.336  -49.955 55.298  1.00 36.87 ? 161  THR C CB    1 
ATOM   5373  O  OG1   . THR D  1 162 ? 30.244  -49.738 53.890  1.00 36.90 ? 161  THR C OG1   1 
ATOM   5374  C  CG2   . THR D  1 162 ? 30.907  -51.351 55.565  1.00 38.06 ? 161  THR C CG2   1 
ATOM   5375  N  N     . GLN D  1 163 ? 27.232  -48.600 54.681  1.00 37.33 ? 162  GLN C N     1 
ATOM   5376  C  CA    . GLN D  1 163 ? 26.584  -47.474 53.998  1.00 37.50 ? 162  GLN C CA    1 
ATOM   5377  C  C     . GLN D  1 163 ? 27.459  -46.822 52.927  1.00 37.90 ? 162  GLN C C     1 
ATOM   5378  O  O     . GLN D  1 163 ? 27.098  -45.768 52.388  1.00 37.98 ? 162  GLN C O     1 
ATOM   5379  C  CB    . GLN D  1 163 ? 26.059  -46.431 54.986  1.00 37.48 ? 162  GLN C CB    1 
ATOM   5380  C  CG    . GLN D  1 163 ? 25.200  -47.054 56.057  1.00 38.86 ? 162  GLN C CG    1 
ATOM   5381  C  CD    . GLN D  1 163 ? 24.229  -46.079 56.718  1.00 40.64 ? 162  GLN C CD    1 
ATOM   5382  O  OE1   . GLN D  1 163 ? 23.016  -46.301 56.721  1.00 42.63 ? 162  GLN C OE1   1 
ATOM   5383  N  NE2   . GLN D  1 163 ? 24.757  -45.013 57.284  1.00 40.75 ? 162  GLN C NE2   1 
ATOM   5384  N  N     . ARG D  1 164 ? 28.577  -47.460 52.585  1.00 38.38 ? 163  ARG C N     1 
ATOM   5385  C  CA    . ARG D  1 164 ? 29.422  -46.979 51.488  1.00 38.77 ? 163  ARG C CA    1 
ATOM   5386  C  C     . ARG D  1 164 ? 28.620  -47.124 50.201  1.00 38.56 ? 163  ARG C C     1 
ATOM   5387  O  O     . ARG D  1 164 ? 28.119  -48.214 49.904  1.00 38.80 ? 163  ARG C O     1 
ATOM   5388  C  CB    . ARG D  1 164 ? 30.732  -47.775 51.389  1.00 38.66 ? 163  ARG C CB    1 
ATOM   5389  C  CG    . ARG D  1 164 ? 31.753  -47.185 50.367  1.00 39.33 ? 163  ARG C CG    1 
ATOM   5390  C  CD    . ARG D  1 164 ? 33.099  -47.946 50.346  1.00 40.28 ? 163  ARG C CD    1 
ATOM   5391  N  N     . GLY D  1 165 ? 28.450  -46.012 49.490  1.00 38.07 ? 164  GLY C N     1 
ATOM   5392  C  CA    . GLY D  1 165 ? 27.710  -45.978 48.230  1.00 38.54 ? 164  GLY C CA    1 
ATOM   5393  C  C     . GLY D  1 165 ? 26.186  -45.967 48.307  1.00 38.06 ? 164  GLY C C     1 
ATOM   5394  O  O     . GLY D  1 165 ? 25.515  -45.940 47.277  1.00 38.52 ? 164  GLY C O     1 
ATOM   5395  N  N     . LEU D  1 166 ? 25.639  -45.976 49.519  1.00 38.21 ? 165  LEU C N     1 
ATOM   5396  C  CA    . LEU D  1 166 ? 24.219  -46.295 49.735  1.00 38.17 ? 165  LEU C CA    1 
ATOM   5397  C  C     . LEU D  1 166 ? 23.257  -45.152 49.402  1.00 38.02 ? 165  LEU C C     1 
ATOM   5398  O  O     . LEU D  1 166 ? 22.271  -45.337 48.680  1.00 36.83 ? 165  LEU C O     1 
ATOM   5399  C  CB    . LEU D  1 166 ? 24.015  -46.703 51.185  1.00 38.56 ? 165  LEU C CB    1 
ATOM   5400  C  CG    . LEU D  1 166 ? 22.638  -47.212 51.593  1.00 38.80 ? 165  LEU C CG    1 
ATOM   5401  C  CD1   . LEU D  1 166 ? 22.165  -48.336 50.656  1.00 38.41 ? 165  LEU C CD1   1 
ATOM   5402  C  CD2   . LEU D  1 166 ? 22.722  -47.671 53.059  1.00 37.70 ? 165  LEU C CD2   1 
ATOM   5403  N  N     . LYS D  1 167 ? 23.541  -43.973 49.939  1.00 38.15 ? 166  LYS C N     1 
ATOM   5404  C  CA    . LYS D  1 167 ? 22.721  -42.801 49.625  1.00 38.56 ? 166  LYS C CA    1 
ATOM   5405  C  C     . LYS D  1 167 ? 22.748  -42.519 48.127  1.00 38.48 ? 166  LYS C C     1 
ATOM   5406  O  O     . LYS D  1 167 ? 21.725  -42.188 47.554  1.00 38.78 ? 166  LYS C O     1 
ATOM   5407  C  CB    . LYS D  1 167 ? 23.176  -41.578 50.413  1.00 38.44 ? 166  LYS C CB    1 
ATOM   5408  C  CG    . LYS D  1 167 ? 22.310  -40.378 50.217  1.00 38.82 ? 166  LYS C CG    1 
ATOM   5409  C  CD    . LYS D  1 167 ? 22.721  -39.238 51.115  1.00 39.80 ? 166  LYS C CD    1 
ATOM   5410  C  CE    . LYS D  1 167 ? 21.815  -38.022 50.873  1.00 41.13 ? 166  LYS C CE    1 
ATOM   5411  N  NZ    . LYS D  1 167 ? 22.052  -37.374 49.568  1.00 39.90 ? 166  LYS C NZ    1 
ATOM   5412  N  N     . THR D  1 168 ? 23.907  -42.684 47.491  1.00 38.41 ? 167  THR C N     1 
ATOM   5413  C  CA    . THR D  1 168 ? 24.005  -42.471 46.046  1.00 38.53 ? 167  THR C CA    1 
ATOM   5414  C  C     . THR D  1 168 ? 23.026  -43.333 45.224  1.00 38.63 ? 167  THR C C     1 
ATOM   5415  O  O     . THR D  1 168 ? 22.452  -42.846 44.252  1.00 38.78 ? 167  THR C O     1 
ATOM   5416  C  CB    . THR D  1 168 ? 25.469  -42.634 45.556  1.00 38.71 ? 167  THR C CB    1 
ATOM   5417  O  OG1   . THR D  1 168 ? 26.271  -41.653 46.220  1.00 39.02 ? 167  THR C OG1   1 
ATOM   5418  C  CG2   . THR D  1 168 ? 25.592  -42.438 44.055  1.00 37.23 ? 167  THR C CG2   1 
ATOM   5419  N  N     . VAL D  1 169 ? 22.812  -44.589 45.634  1.00 38.50 ? 168  VAL C N     1 
ATOM   5420  C  CA    . VAL D  1 169 ? 21.854  -45.478 44.960  1.00 38.08 ? 168  VAL C CA    1 
ATOM   5421  C  C     . VAL D  1 169 ? 20.501  -44.782 44.822  1.00 38.59 ? 168  VAL C C     1 
ATOM   5422  O  O     . VAL D  1 169 ? 19.873  -44.789 43.749  1.00 38.23 ? 168  VAL C O     1 
ATOM   5423  C  CB    . VAL D  1 169 ? 21.645  -46.837 45.711  1.00 37.75 ? 168  VAL C CB    1 
ATOM   5424  C  CG1   . VAL D  1 169 ? 20.451  -47.611 45.131  1.00 36.72 ? 168  VAL C CG1   1 
ATOM   5425  C  CG2   . VAL D  1 169 ? 22.885  -47.704 45.649  1.00 37.87 ? 168  VAL C CG2   1 
ATOM   5426  N  N     . PHE D  1 170 ? 20.052  -44.186 45.917  1.00 38.62 ? 169  PHE C N     1 
ATOM   5427  C  CA    . PHE D  1 170 ? 18.728  -43.617 45.958  1.00 39.03 ? 169  PHE C CA    1 
ATOM   5428  C  C     . PHE D  1 170 ? 18.693  -42.201 45.395  1.00 39.28 ? 169  PHE C C     1 
ATOM   5429  O  O     . PHE D  1 170 ? 17.725  -41.833 44.740  1.00 39.10 ? 169  PHE C O     1 
ATOM   5430  C  CB    . PHE D  1 170 ? 18.160  -43.724 47.372  1.00 39.00 ? 169  PHE C CB    1 
ATOM   5431  C  CG    . PHE D  1 170 ? 17.925  -45.132 47.783  1.00 39.31 ? 169  PHE C CG    1 
ATOM   5432  C  CD1   . PHE D  1 170 ? 16.741  -45.763 47.462  1.00 39.46 ? 169  PHE C CD1   1 
ATOM   5433  C  CD2   . PHE D  1 170 ? 18.936  -45.867 48.411  1.00 38.69 ? 169  PHE C CD2   1 
ATOM   5434  C  CE1   . PHE D  1 170 ? 16.539  -47.091 47.809  1.00 40.19 ? 169  PHE C CE1   1 
ATOM   5435  C  CE2   . PHE D  1 170 ? 18.751  -47.184 48.752  1.00 39.06 ? 169  PHE C CE2   1 
ATOM   5436  C  CZ    . PHE D  1 170 ? 17.549  -47.809 48.460  1.00 40.28 ? 169  PHE C CZ    1 
ATOM   5437  N  N     . ASP D  1 171 ? 19.760  -41.427 45.604  1.00 39.77 ? 170  ASP C N     1 
ATOM   5438  C  CA    . ASP D  1 171 ? 19.902  -40.134 44.927  1.00 39.80 ? 170  ASP C CA    1 
ATOM   5439  C  C     . ASP D  1 171 ? 19.780  -40.325 43.414  1.00 39.75 ? 170  ASP C C     1 
ATOM   5440  O  O     . ASP D  1 171 ? 19.092  -39.562 42.736  1.00 39.28 ? 170  ASP C O     1 
ATOM   5441  C  CB    . ASP D  1 171 ? 21.262  -39.483 45.252  1.00 40.35 ? 170  ASP C CB    1 
ATOM   5442  C  CG    . ASP D  1 171 ? 21.359  -38.973 46.709  1.00 41.75 ? 170  ASP C CG    1 
ATOM   5443  O  OD1   . ASP D  1 171 ? 20.349  -39.031 47.456  1.00 43.62 ? 170  ASP C OD1   1 
ATOM   5444  O  OD2   . ASP D  1 171 ? 22.449  -38.500 47.096  1.00 43.54 ? 170  ASP C OD2   1 
ATOM   5445  N  N     . GLU D  1 172 ? 20.464  -41.336 42.886  1.00 39.62 ? 171  GLU C N     1 
ATOM   5446  C  CA    . GLU D  1 172 ? 20.477  -41.596 41.448  1.00 39.84 ? 171  GLU C CA    1 
ATOM   5447  C  C     . GLU D  1 172 ? 19.143  -42.159 40.957  1.00 39.35 ? 171  GLU C C     1 
ATOM   5448  O  O     . GLU D  1 172 ? 18.672  -41.809 39.866  1.00 38.99 ? 171  GLU C O     1 
ATOM   5449  C  CB    . GLU D  1 172 ? 21.646  -42.521 41.075  1.00 40.23 ? 171  GLU C CB    1 
ATOM   5450  C  CG    . GLU D  1 172 ? 23.045  -41.856 41.266  1.00 41.58 ? 171  GLU C CG    1 
ATOM   5451  C  CD    . GLU D  1 172 ? 23.204  -40.529 40.493  1.00 43.69 ? 171  GLU C CD    1 
ATOM   5452  O  OE1   . GLU D  1 172 ? 22.731  -40.442 39.335  1.00 45.92 ? 171  GLU C OE1   1 
ATOM   5453  O  OE2   . GLU D  1 172 ? 23.796  -39.569 41.050  1.00 46.39 ? 171  GLU C OE2   1 
ATOM   5454  N  N     . ALA D  1 173 ? 18.528  -43.017 41.762  1.00 38.83 ? 172  ALA C N     1 
ATOM   5455  C  CA    . ALA D  1 173 ? 17.163  -43.491 41.473  1.00 38.35 ? 172  ALA C CA    1 
ATOM   5456  C  C     . ALA D  1 173 ? 16.212  -42.302 41.333  1.00 38.13 ? 172  ALA C C     1 
ATOM   5457  O  O     . ALA D  1 173 ? 15.416  -42.238 40.402  1.00 38.02 ? 172  ALA C O     1 
ATOM   5458  C  CB    . ALA D  1 173 ? 16.698  -44.417 42.549  1.00 37.54 ? 172  ALA C CB    1 
ATOM   5459  N  N     . ILE D  1 174 ? 16.316  -41.347 42.254  1.00 37.73 ? 173  ILE C N     1 
ATOM   5460  C  CA    . ILE D  1 174 ? 15.448  -40.175 42.240  1.00 37.29 ? 173  ILE C CA    1 
ATOM   5461  C  C     . ILE D  1 174 ? 15.680  -39.332 40.982  1.00 37.39 ? 173  ILE C C     1 
ATOM   5462  O  O     . ILE D  1 174 ? 14.737  -38.946 40.294  1.00 37.03 ? 173  ILE C O     1 
ATOM   5463  C  CB    . ILE D  1 174 ? 15.654  -39.322 43.517  1.00 37.04 ? 173  ILE C CB    1 
ATOM   5464  C  CG1   . ILE D  1 174 ? 15.089  -40.057 44.739  1.00 36.69 ? 173  ILE C CG1   1 
ATOM   5465  C  CG2   . ILE D  1 174 ? 15.007  -37.962 43.365  1.00 36.82 ? 173  ILE C CG2   1 
ATOM   5466  C  CD1   . ILE D  1 174 ? 15.492  -39.451 46.070  1.00 36.10 ? 173  ILE C CD1   1 
ATOM   5467  N  N     . ARG D  1 175 ? 16.947  -39.059 40.694  1.00 37.69 ? 174  ARG C N     1 
ATOM   5468  C  CA    . ARG D  1 175 ? 17.362  -38.321 39.505  1.00 38.05 ? 174  ARG C CA    1 
ATOM   5469  C  C     . ARG D  1 175 ? 16.920  -38.988 38.205  1.00 37.89 ? 174  ARG C C     1 
ATOM   5470  O  O     . ARG D  1 175 ? 16.624  -38.295 37.231  1.00 37.19 ? 174  ARG C O     1 
ATOM   5471  C  CB    . ARG D  1 175 ? 18.896  -38.161 39.481  1.00 37.97 ? 174  ARG C CB    1 
ATOM   5472  C  CG    . ARG D  1 175 ? 19.415  -37.102 40.436  1.00 38.75 ? 174  ARG C CG    1 
ATOM   5473  C  CD    . ARG D  1 175 ? 20.917  -36.810 40.251  1.00 39.35 ? 174  ARG C CD    1 
ATOM   5474  N  N     . ALA D  1 176 ? 16.907  -40.324 38.189  1.00 37.54 ? 175  ALA C N     1 
ATOM   5475  C  CA    . ALA D  1 176 ? 16.490  -41.106 37.017  1.00 37.44 ? 175  ALA C CA    1 
ATOM   5476  C  C     . ALA D  1 176 ? 15.030  -40.866 36.657  1.00 37.62 ? 175  ALA C C     1 
ATOM   5477  O  O     . ALA D  1 176 ? 14.613  -41.106 35.516  1.00 37.78 ? 175  ALA C O     1 
ATOM   5478  C  CB    . ALA D  1 176 ? 16.706  -42.611 37.280  1.00 36.66 ? 175  ALA C CB    1 
ATOM   5479  N  N     . VAL D  1 177 ? 14.260  -40.417 37.649  1.00 37.81 ? 176  VAL C N     1 
ATOM   5480  C  CA    . VAL D  1 177 ? 12.825  -40.163 37.512  1.00 37.51 ? 176  VAL C CA    1 
ATOM   5481  C  C     . VAL D  1 177 ? 12.566  -38.658 37.358  1.00 37.96 ? 176  VAL C C     1 
ATOM   5482  O  O     . VAL D  1 177 ? 11.819  -38.255 36.465  1.00 36.88 ? 176  VAL C O     1 
ATOM   5483  C  CB    . VAL D  1 177 ? 12.055  -40.739 38.742  1.00 37.54 ? 176  VAL C CB    1 
ATOM   5484  C  CG1   . VAL D  1 177 ? 10.530  -40.434 38.674  1.00 37.65 ? 176  VAL C CG1   1 
ATOM   5485  C  CG2   . VAL D  1 177 ? 12.318  -42.263 38.894  1.00 35.21 ? 176  VAL C CG2   1 
ATOM   5486  N  N     . LEU D  1 178 ? 13.195  -37.837 38.205  1.00 38.53 ? 177  LEU C N     1 
ATOM   5487  C  CA    . LEU D  1 178 ? 12.892  -36.396 38.257  1.00 39.52 ? 177  LEU C CA    1 
ATOM   5488  C  C     . LEU D  1 178 ? 13.838  -35.473 37.497  1.00 40.33 ? 177  LEU C C     1 
ATOM   5489  O  O     . LEU D  1 178 ? 13.466  -34.347 37.237  1.00 39.96 ? 177  LEU C O     1 
ATOM   5490  C  CB    . LEU D  1 178 ? 12.847  -35.911 39.696  1.00 39.49 ? 177  LEU C CB    1 
ATOM   5491  C  CG    . LEU D  1 178 ? 11.876  -36.612 40.630  1.00 39.69 ? 177  LEU C CG    1 
ATOM   5492  C  CD1   . LEU D  1 178 ? 12.039  -36.014 42.033  1.00 39.06 ? 177  LEU C CD1   1 
ATOM   5493  C  CD2   . LEU D  1 178 ? 10.442  -36.494 40.107  1.00 39.10 ? 177  LEU C CD2   1 
ATOM   5494  N  N     . GLY D  1 179 ? 15.049  -35.938 37.183  1.00 41.15 ? 178  GLY C N     1 
ATOM   5495  C  CA    . GLY D  1 179 ? 16.045  -35.150 36.456  1.00 42.30 ? 178  GLY C CA    1 
ATOM   5496  C  C     . GLY D  1 179 ? 17.210  -34.684 37.324  1.00 43.47 ? 178  GLY C C     1 
ATOM   5497  O  O     . GLY D  1 179 ? 17.234  -34.934 38.531  1.00 44.42 ? 178  GLY C O     1 
ATOM   5498  O  OXT   . GLY D  1 179 ? 18.177  -34.040 36.865  1.00 44.47 ? 178  GLY C OXT   1 
ATOM   5499  N  N     . MET E  1 2   ? 2.517   -29.031 62.556  1.00 48.73 ? 1    MET G N     1 
ATOM   5500  C  CA    . MET E  1 2   ? 3.856   -29.236 63.216  1.00 49.01 ? 1    MET G CA    1 
ATOM   5501  C  C     . MET E  1 2   ? 4.313   -30.699 63.144  1.00 47.89 ? 1    MET G C     1 
ATOM   5502  O  O     . MET E  1 2   ? 3.530   -31.612 63.391  1.00 48.80 ? 1    MET G O     1 
ATOM   5503  C  CB    . MET E  1 2   ? 3.839   -28.772 64.684  1.00 49.23 ? 1    MET G CB    1 
ATOM   5504  C  CG    . MET E  1 2   ? 5.198   -28.933 65.425  1.00 49.59 ? 1    MET G CG    1 
ATOM   5505  S  SD    . MET E  1 2   ? 5.284   -28.326 67.149  1.00 50.91 ? 1    MET G SD    1 
ATOM   5506  C  CE    . MET E  1 2   ? 4.890   -26.582 66.956  1.00 50.39 ? 1    MET G CE    1 
ATOM   5507  N  N     . GLN E  1 3   ? 5.579   -30.908 62.789  1.00 46.09 ? 2    GLN G N     1 
ATOM   5508  C  CA    . GLN E  1 3   ? 6.179   -32.232 62.781  1.00 45.12 ? 2    GLN G CA    1 
ATOM   5509  C  C     . GLN E  1 3   ? 6.049   -32.829 64.184  1.00 44.03 ? 2    GLN G C     1 
ATOM   5510  O  O     . GLN E  1 3   ? 6.384   -32.167 65.176  1.00 43.54 ? 2    GLN G O     1 
ATOM   5511  C  CB    . GLN E  1 3   ? 7.659   -32.127 62.380  1.00 45.37 ? 2    GLN G CB    1 
ATOM   5512  C  CG    . GLN E  1 3   ? 8.459   -33.433 62.402  1.00 46.65 ? 2    GLN G CG    1 
ATOM   5513  C  CD    . GLN E  1 3   ? 8.103   -34.377 61.252  1.00 48.22 ? 2    GLN G CD    1 
ATOM   5514  O  OE1   . GLN E  1 3   ? 7.642   -35.515 61.470  1.00 49.04 ? 2    GLN G OE1   1 
ATOM   5515  N  NE2   . GLN E  1 3   ? 8.302   -33.908 60.029  1.00 47.63 ? 2    GLN G NE2   1 
ATOM   5516  N  N     . ALA E  1 4   ? 5.543   -34.061 64.267  1.00 42.59 ? 3    ALA G N     1 
ATOM   5517  C  CA    . ALA E  1 4   ? 5.445   -34.759 65.548  1.00 42.04 ? 3    ALA G CA    1 
ATOM   5518  C  C     . ALA E  1 4   ? 6.239   -36.033 65.452  1.00 41.48 ? 3    ALA G C     1 
ATOM   5519  O  O     . ALA E  1 4   ? 6.421   -36.557 64.358  1.00 42.14 ? 3    ALA G O     1 
ATOM   5520  C  CB    . ALA E  1 4   ? 3.992   -35.053 65.916  1.00 42.13 ? 3    ALA G CB    1 
ATOM   5521  N  N     . ILE E  1 5   ? 6.745   -36.506 66.586  1.00 40.54 ? 4    ILE G N     1 
ATOM   5522  C  CA    . ILE E  1 5   ? 7.454   -37.776 66.653  1.00 40.04 ? 4    ILE G CA    1 
ATOM   5523  C  C     . ILE E  1 5   ? 6.773   -38.622 67.714  1.00 39.23 ? 4    ILE G C     1 
ATOM   5524  O  O     . ILE E  1 5   ? 6.357   -38.112 68.734  1.00 39.44 ? 4    ILE G O     1 
ATOM   5525  C  CB    . ILE E  1 5   ? 8.945   -37.564 67.014  1.00 40.05 ? 4    ILE G CB    1 
ATOM   5526  C  CG1   . ILE E  1 5   ? 9.618   -36.673 65.958  1.00 40.73 ? 4    ILE G CG1   1 
ATOM   5527  C  CG2   . ILE E  1 5   ? 9.672   -38.903 67.188  1.00 39.74 ? 4    ILE G CG2   1 
ATOM   5528  C  CD1   . ILE E  1 5   ? 11.136  -36.439 66.198  1.00 40.97 ? 4    ILE G CD1   1 
ATOM   5529  N  N     . LYS E  1 6   ? 6.629   -39.916 67.450  1.00 38.65 ? 5    LYS G N     1 
ATOM   5530  C  CA    . LYS E  1 6   ? 6.094   -40.834 68.419  1.00 37.98 ? 5    LYS G CA    1 
ATOM   5531  C  C     . LYS E  1 6   ? 7.211   -41.765 68.819  1.00 37.87 ? 5    LYS G C     1 
ATOM   5532  O  O     . LYS E  1 6   ? 7.662   -42.600 68.019  1.00 37.00 ? 5    LYS G O     1 
ATOM   5533  C  CB    . LYS E  1 6   ? 4.921   -41.629 67.861  1.00 38.01 ? 5    LYS G CB    1 
ATOM   5534  C  CG    . LYS E  1 6   ? 4.380   -42.650 68.884  1.00 38.36 ? 5    LYS G CG    1 
ATOM   5535  C  CD    . LYS E  1 6   ? 3.133   -43.357 68.396  1.00 37.92 ? 5    LYS G CD    1 
ATOM   5536  C  CE    . LYS E  1 6   ? 2.828   -44.580 69.271  1.00 36.44 ? 5    LYS G CE    1 
ATOM   5537  N  NZ    . LYS E  1 6   ? 1.646   -45.326 68.813  1.00 33.50 ? 5    LYS G NZ    1 
ATOM   5538  N  N     . CYS E  1 7   ? 7.664   -41.594 70.058  1.00 38.32 ? 6    CYS G N     1 
ATOM   5539  C  CA    . CYS E  1 7   ? 8.721   -42.398 70.645  1.00 38.03 ? 6    CYS G CA    1 
ATOM   5540  C  C     . CYS E  1 7   ? 8.131   -43.289 71.731  1.00 37.77 ? 6    CYS G C     1 
ATOM   5541  O  O     . CYS E  1 7   ? 7.526   -42.784 72.663  1.00 38.16 ? 6    CYS G O     1 
ATOM   5542  C  CB    . CYS E  1 7   ? 9.784   -41.483 71.241  1.00 38.53 ? 6    CYS G CB    1 
ATOM   5543  S  SG    . CYS E  1 7   ? 11.141  -42.330 72.052  1.00 40.12 ? 6    CYS G SG    1 
ATOM   5544  N  N     . VAL E  1 8   ? 8.326   -44.610 71.612  1.00 37.18 ? 7    VAL G N     1 
ATOM   5545  C  CA    . VAL E  1 8   ? 7.803   -45.574 72.576  1.00 36.33 ? 7    VAL G CA    1 
ATOM   5546  C  C     . VAL E  1 8   ? 8.965   -46.207 73.355  1.00 36.80 ? 7    VAL G C     1 
ATOM   5547  O  O     . VAL E  1 8   ? 9.933   -46.681 72.773  1.00 36.56 ? 7    VAL G O     1 
ATOM   5548  C  CB    . VAL E  1 8   ? 6.950   -46.650 71.850  1.00 36.21 ? 7    VAL G CB    1 
ATOM   5549  C  CG1   . VAL E  1 8   ? 6.498   -47.781 72.817  1.00 33.94 ? 7    VAL G CG1   1 
ATOM   5550  C  CG2   . VAL E  1 8   ? 5.748   -45.987 71.153  1.00 34.25 ? 7    VAL G CG2   1 
ATOM   5551  N  N     . VAL E  1 9   ? 8.869   -46.194 74.677  1.00 37.09 ? 8    VAL G N     1 
ATOM   5552  C  CA    . VAL E  1 9   ? 9.959   -46.675 75.542  1.00 36.45 ? 8    VAL G CA    1 
ATOM   5553  C  C     . VAL E  1 9   ? 9.550   -48.001 76.208  1.00 36.34 ? 8    VAL G C     1 
ATOM   5554  O  O     . VAL E  1 9   ? 8.480   -48.094 76.821  1.00 35.55 ? 8    VAL G O     1 
ATOM   5555  C  CB    . VAL E  1 9   ? 10.340  -45.590 76.550  1.00 36.80 ? 8    VAL G CB    1 
ATOM   5556  C  CG1   . VAL E  1 9   ? 11.660  -45.941 77.301  1.00 36.87 ? 8    VAL G CG1   1 
ATOM   5557  C  CG2   . VAL E  1 9   ? 10.467  -44.219 75.796  1.00 35.43 ? 8    VAL G CG2   1 
ATOM   5558  N  N     . VAL E  1 10  ? 10.370  -49.037 76.002  1.00 36.08 ? 9    VAL G N     1 
ATOM   5559  C  CA    . VAL E  1 10  ? 10.099  -50.378 76.540  1.00 36.19 ? 9    VAL G CA    1 
ATOM   5560  C  C     . VAL E  1 10  ? 11.312  -50.983 77.240  1.00 36.40 ? 9    VAL G C     1 
ATOM   5561  O  O     . VAL E  1 10  ? 12.460  -50.610 76.975  1.00 35.86 ? 9    VAL G O     1 
ATOM   5562  C  CB    . VAL E  1 10  ? 9.570   -51.372 75.431  1.00 36.56 ? 9    VAL G CB    1 
ATOM   5563  C  CG1   . VAL E  1 10  ? 8.461   -50.697 74.581  1.00 35.91 ? 9    VAL G CG1   1 
ATOM   5564  C  CG2   . VAL E  1 10  ? 10.709  -51.929 74.558  1.00 35.23 ? 9    VAL G CG2   1 
ATOM   5565  N  N     . GLY E  1 11  ? 11.050  -51.930 78.139  1.00 36.76 ? 10   GLY G N     1 
ATOM   5566  C  CA    . GLY E  1 11  ? 12.116  -52.629 78.852  1.00 36.45 ? 10   GLY G CA    1 
ATOM   5567  C  C     . GLY E  1 11  ? 11.638  -53.218 80.172  1.00 37.15 ? 10   GLY G C     1 
ATOM   5568  O  O     . GLY E  1 11  ? 10.529  -52.924 80.644  1.00 37.44 ? 10   GLY G O     1 
ATOM   5569  N  N     . ASP E  1 12  ? 12.504  -54.012 80.787  1.00 37.12 ? 11   ASP G N     1 
ATOM   5570  C  CA    . ASP E  1 12  ? 12.184  -54.711 82.024  1.00 37.43 ? 11   ASP G CA    1 
ATOM   5571  C  C     . ASP E  1 12  ? 11.744  -53.778 83.138  1.00 37.68 ? 11   ASP G C     1 
ATOM   5572  O  O     . ASP E  1 12  ? 12.033  -52.577 83.133  1.00 37.79 ? 11   ASP G O     1 
ATOM   5573  C  CB    . ASP E  1 12  ? 13.401  -55.504 82.516  1.00 37.33 ? 11   ASP G CB    1 
ATOM   5574  C  CG    . ASP E  1 12  ? 13.531  -56.860 81.865  1.00 37.60 ? 11   ASP G CG    1 
ATOM   5575  O  OD1   . ASP E  1 12  ? 12.796  -57.179 80.900  1.00 38.23 ? 11   ASP G OD1   1 
ATOM   5576  O  OD2   . ASP E  1 12  ? 14.373  -57.632 82.363  1.00 36.34 ? 11   ASP G OD2   1 
ATOM   5577  N  N     . GLY E  1 13  ? 11.053  -54.351 84.111  1.00 37.64 ? 12   GLY G N     1 
ATOM   5578  C  CA    . GLY E  1 13  ? 10.747  -53.632 85.322  1.00 38.12 ? 12   GLY G CA    1 
ATOM   5579  C  C     . GLY E  1 13  ? 12.034  -53.174 85.972  1.00 37.92 ? 12   GLY G C     1 
ATOM   5580  O  O     . GLY E  1 13  ? 13.101  -53.769 85.755  1.00 39.14 ? 12   GLY G O     1 
ATOM   5581  N  N     . ALA E  1 14  ? 11.930  -52.092 86.724  1.00 37.61 ? 13   ALA G N     1 
ATOM   5582  C  CA    . ALA E  1 14  ? 13.041  -51.497 87.463  1.00 37.89 ? 13   ALA G CA    1 
ATOM   5583  C  C     . ALA E  1 14  ? 14.245  -50.981 86.658  1.00 37.71 ? 13   ALA G C     1 
ATOM   5584  O  O     . ALA E  1 14  ? 15.257  -50.671 87.271  1.00 38.48 ? 13   ALA G O     1 
ATOM   5585  C  CB    . ALA E  1 14  ? 13.524  -52.492 88.538  1.00 37.17 ? 13   ALA G CB    1 
ATOM   5586  N  N     . VAL E  1 15  ? 14.162  -50.838 85.331  1.00 37.90 ? 14   VAL G N     1 
ATOM   5587  C  CA    . VAL E  1 15  ? 15.354  -50.452 84.556  1.00 37.12 ? 14   VAL G CA    1 
ATOM   5588  C  C     . VAL E  1 15  ? 15.575  -48.947 84.487  1.00 36.96 ? 14   VAL G C     1 
ATOM   5589  O  O     . VAL E  1 15  ? 16.709  -48.523 84.256  1.00 36.62 ? 14   VAL G O     1 
ATOM   5590  C  CB    . VAL E  1 15  ? 15.451  -51.083 83.104  1.00 37.27 ? 14   VAL G CB    1 
ATOM   5591  C  CG1   . VAL E  1 15  ? 15.353  -52.589 83.164  1.00 37.20 ? 14   VAL G CG1   1 
ATOM   5592  C  CG2   . VAL E  1 15  ? 14.408  -50.508 82.142  1.00 37.59 ? 14   VAL G CG2   1 
ATOM   5593  N  N     . GLY E  1 16  ? 14.521  -48.144 84.659  1.00 36.07 ? 15   GLY G N     1 
ATOM   5594  C  CA    . GLY E  1 16  ? 14.682  -46.684 84.724  1.00 35.91 ? 15   GLY G CA    1 
ATOM   5595  C  C     . GLY E  1 16  ? 14.114  -45.886 83.565  1.00 36.37 ? 15   GLY G C     1 
ATOM   5596  O  O     . GLY E  1 16  ? 14.564  -44.762 83.316  1.00 36.62 ? 15   GLY G O     1 
ATOM   5597  N  N     . LYS E  1 17  ? 13.119  -46.459 82.879  1.00 36.24 ? 16   LYS G N     1 
ATOM   5598  C  CA    . LYS E  1 17  ? 12.449  -45.835 81.757  1.00 36.81 ? 16   LYS G CA    1 
ATOM   5599  C  C     . LYS E  1 17  ? 11.804  -44.511 82.141  1.00 37.02 ? 16   LYS G C     1 
ATOM   5600  O  O     . LYS E  1 17  ? 11.968  -43.505 81.444  1.00 38.19 ? 16   LYS G O     1 
ATOM   5601  C  CB    . LYS E  1 17  ? 11.351  -46.767 81.168  1.00 36.27 ? 16   LYS G CB    1 
ATOM   5602  C  CG    . LYS E  1 17  ? 11.882  -48.108 80.664  1.00 36.96 ? 16   LYS G CG    1 
ATOM   5603  C  CD    . LYS E  1 17  ? 10.791  -49.037 80.132  1.00 36.75 ? 16   LYS G CD    1 
ATOM   5604  C  CE    . LYS E  1 17  ? 9.826   -49.588 81.201  1.00 36.70 ? 16   LYS G CE    1 
ATOM   5605  N  NZ    . LYS E  1 17  ? 10.455  -50.445 82.230  1.00 35.43 ? 16   LYS G NZ    1 
ATOM   5606  N  N     . THR E  1 18  ? 11.020  -44.533 83.211  1.00 37.59 ? 17   THR G N     1 
ATOM   5607  C  CA    . THR E  1 18  ? 10.270  -43.366 83.645  1.00 37.01 ? 17   THR G CA    1 
ATOM   5608  C  C     . THR E  1 18  ? 11.188  -42.277 84.132  1.00 37.26 ? 17   THR G C     1 
ATOM   5609  O  O     . THR E  1 18  ? 10.999  -41.096 83.794  1.00 36.96 ? 17   THR G O     1 
ATOM   5610  C  CB    . THR E  1 18  ? 9.272   -43.733 84.729  1.00 37.08 ? 17   THR G CB    1 
ATOM   5611  O  OG1   . THR E  1 18  ? 8.260   -44.540 84.128  1.00 37.90 ? 17   THR G OG1   1 
ATOM   5612  C  CG2   . THR E  1 18  ? 8.641   -42.496 85.350  1.00 34.00 ? 17   THR G CG2   1 
ATOM   5613  N  N     . CYS E  1 19  ? 12.200  -42.664 84.898  1.00 37.57 ? 18   CYS G N     1 
ATOM   5614  C  CA    . CYS E  1 19  ? 13.156  -41.681 85.414  1.00 37.79 ? 18   CYS G CA    1 
ATOM   5615  C  C     . CYS E  1 19  ? 13.857  -40.988 84.265  1.00 38.22 ? 18   CYS G C     1 
ATOM   5616  O  O     . CYS E  1 19  ? 13.992  -39.761 84.270  1.00 39.01 ? 18   CYS G O     1 
ATOM   5617  C  CB    . CYS E  1 19  ? 14.165  -42.315 86.362  1.00 37.67 ? 18   CYS G CB    1 
ATOM   5618  S  SG    . CYS E  1 19  ? 13.512  -42.604 88.012  1.00 37.91 ? 18   CYS G SG    1 
ATOM   5619  N  N     . LEU E  1 20  ? 14.283  -41.773 83.283  1.00 38.24 ? 19   LEU G N     1 
ATOM   5620  C  CA    . LEU E  1 20  ? 14.960  -41.254 82.093  1.00 38.86 ? 19   LEU G CA    1 
ATOM   5621  C  C     . LEU E  1 20  ? 14.069  -40.224 81.384  1.00 38.08 ? 19   LEU G C     1 
ATOM   5622  O  O     . LEU E  1 20  ? 14.502  -39.134 81.059  1.00 37.96 ? 19   LEU G O     1 
ATOM   5623  C  CB    . LEU E  1 20  ? 15.311  -42.436 81.172  1.00 39.90 ? 19   LEU G CB    1 
ATOM   5624  C  CG    . LEU E  1 20  ? 15.563  -42.247 79.679  1.00 41.75 ? 19   LEU G CG    1 
ATOM   5625  C  CD1   . LEU E  1 20  ? 17.041  -42.316 79.395  1.00 44.05 ? 19   LEU G CD1   1 
ATOM   5626  C  CD2   . LEU E  1 20  ? 14.817  -43.307 78.892  1.00 43.55 ? 19   LEU G CD2   1 
ATOM   5627  N  N     . LEU E  1 21  ? 12.805  -40.571 81.201  1.00 37.67 ? 20   LEU G N     1 
ATOM   5628  C  CA    . LEU E  1 21  ? 11.853  -39.704 80.504  1.00 37.16 ? 20   LEU G CA    1 
ATOM   5629  C  C     . LEU E  1 21  ? 11.584  -38.411 81.280  1.00 36.69 ? 20   LEU G C     1 
ATOM   5630  O  O     . LEU E  1 21  ? 11.556  -37.314 80.706  1.00 36.59 ? 20   LEU G O     1 
ATOM   5631  C  CB    . LEU E  1 21  ? 10.541  -40.450 80.255  1.00 36.61 ? 20   LEU G CB    1 
ATOM   5632  C  CG    . LEU E  1 21  ? 10.562  -41.465 79.108  1.00 37.19 ? 20   LEU G CG    1 
ATOM   5633  C  CD1   . LEU E  1 21  ? 9.228   -42.272 78.994  1.00 36.12 ? 20   LEU G CD1   1 
ATOM   5634  C  CD2   . LEU E  1 21  ? 10.893  -40.783 77.788  1.00 34.54 ? 20   LEU G CD2   1 
ATOM   5635  N  N     . ILE E  1 22  ? 11.394  -38.553 82.582  1.00 35.92 ? 21   ILE G N     1 
ATOM   5636  C  CA    . ILE E  1 22  ? 11.073  -37.418 83.428  1.00 36.01 ? 21   ILE G CA    1 
ATOM   5637  C  C     . ILE E  1 22  ? 12.295  -36.549 83.711  1.00 36.03 ? 21   ILE G C     1 
ATOM   5638  O  O     . ILE E  1 22  ? 12.189  -35.306 83.793  1.00 35.97 ? 21   ILE G O     1 
ATOM   5639  C  CB    . ILE E  1 22  ? 10.381  -37.862 84.724  1.00 36.09 ? 21   ILE G CB    1 
ATOM   5640  C  CG1   . ILE E  1 22  ? 9.067   -38.573 84.373  1.00 36.27 ? 21   ILE G CG1   1 
ATOM   5641  C  CG2   . ILE E  1 22  ? 10.145  -36.641 85.676  1.00 34.16 ? 21   ILE G CG2   1 
ATOM   5642  C  CD1   . ILE E  1 22  ? 8.113   -37.720 83.505  1.00 37.83 ? 21   ILE G CD1   1 
ATOM   5643  N  N     . SER E  1 23  ? 13.453  -37.184 83.840  1.00 35.94 ? 22   SER G N     1 
ATOM   5644  C  CA    . SER E  1 23  ? 14.666  -36.432 83.980  1.00 36.12 ? 22   SER G CA    1 
ATOM   5645  C  C     . SER E  1 23  ? 14.882  -35.537 82.758  1.00 36.73 ? 22   SER G C     1 
ATOM   5646  O  O     . SER E  1 23  ? 15.199  -34.359 82.900  1.00 36.36 ? 22   SER G O     1 
ATOM   5647  C  CB    . SER E  1 23  ? 15.854  -37.354 84.202  1.00 36.41 ? 22   SER G CB    1 
ATOM   5648  O  OG    . SER E  1 23  ? 16.996  -36.568 84.470  1.00 34.40 ? 22   SER G OG    1 
ATOM   5649  N  N     . TYR E  1 24  ? 14.676  -36.097 81.562  1.00 37.57 ? 23   TYR G N     1 
ATOM   5650  C  CA    . TYR E  1 24  ? 14.870  -35.367 80.303  1.00 37.69 ? 23   TYR G CA    1 
ATOM   5651  C  C     . TYR E  1 24  ? 13.879  -34.230 80.124  1.00 38.26 ? 23   TYR G C     1 
ATOM   5652  O  O     . TYR E  1 24  ? 14.265  -33.116 79.781  1.00 37.65 ? 23   TYR G O     1 
ATOM   5653  C  CB    . TYR E  1 24  ? 14.729  -36.329 79.124  1.00 37.93 ? 23   TYR G CB    1 
ATOM   5654  C  CG    . TYR E  1 24  ? 14.738  -35.661 77.758  1.00 37.57 ? 23   TYR G CG    1 
ATOM   5655  C  CD1   . TYR E  1 24  ? 15.893  -35.058 77.261  1.00 38.21 ? 23   TYR G CD1   1 
ATOM   5656  C  CD2   . TYR E  1 24  ? 13.591  -35.652 76.960  1.00 36.79 ? 23   TYR G CD2   1 
ATOM   5657  C  CE1   . TYR E  1 24  ? 15.901  -34.443 75.998  1.00 37.48 ? 23   TYR G CE1   1 
ATOM   5658  C  CE2   . TYR E  1 24  ? 13.581  -35.044 75.723  1.00 36.37 ? 23   TYR G CE2   1 
ATOM   5659  C  CZ    . TYR E  1 24  ? 14.734  -34.444 75.239  1.00 37.61 ? 23   TYR G CZ    1 
ATOM   5660  O  OH    . TYR E  1 24  ? 14.721  -33.850 73.992  1.00 37.25 ? 23   TYR G OH    1 
ATOM   5661  N  N     . THR E  1 25  ? 12.596  -34.537 80.332  1.00 38.70 ? 24   THR G N     1 
ATOM   5662  C  CA    . THR E  1 25  ? 11.522  -33.589 80.040  1.00 39.14 ? 24   THR G CA    1 
ATOM   5663  C  C     . THR E  1 25  ? 11.346  -32.520 81.128  1.00 38.80 ? 24   THR G C     1 
ATOM   5664  O  O     . THR E  1 25  ? 10.952  -31.401 80.827  1.00 38.16 ? 24   THR G O     1 
ATOM   5665  C  CB    . THR E  1 25  ? 10.182  -34.296 79.781  1.00 39.13 ? 24   THR G CB    1 
ATOM   5666  O  OG1   . THR E  1 25  ? 9.890   -35.186 80.858  1.00 40.49 ? 24   THR G OG1   1 
ATOM   5667  C  CG2   . THR E  1 25  ? 10.218  -35.100 78.484  1.00 39.70 ? 24   THR G CG2   1 
ATOM   5668  N  N     . THR E  1 26  ? 11.630  -32.854 82.381  1.00 38.98 ? 25   THR G N     1 
ATOM   5669  C  CA    . THR E  1 26  ? 11.412  -31.893 83.472  1.00 38.99 ? 25   THR G CA    1 
ATOM   5670  C  C     . THR E  1 26  ? 12.662  -31.522 84.254  1.00 39.08 ? 25   THR G C     1 
ATOM   5671  O  O     . THR E  1 26  ? 12.605  -30.644 85.088  1.00 39.56 ? 25   THR G O     1 
ATOM   5672  C  CB    . THR E  1 26  ? 10.354  -32.427 84.464  1.00 38.94 ? 25   THR G CB    1 
ATOM   5673  O  OG1   . THR E  1 26  ? 10.844  -33.608 85.106  1.00 39.33 ? 25   THR G OG1   1 
ATOM   5674  C  CG2   . THR E  1 26  ? 9.065   -32.776 83.747  1.00 38.53 ? 25   THR G CG2   1 
ATOM   5675  N  N     . ASN E  1 27  ? 13.788  -32.170 83.981  1.00 39.71 ? 26   ASN G N     1 
ATOM   5676  C  CA    . ASN E  1 27  ? 15.010  -32.036 84.800  1.00 40.36 ? 26   ASN G CA    1 
ATOM   5677  C  C     . ASN E  1 27  ? 14.821  -32.361 86.276  1.00 39.83 ? 26   ASN G C     1 
ATOM   5678  O  O     . ASN E  1 27  ? 15.506  -31.804 87.120  1.00 40.00 ? 26   ASN G O     1 
ATOM   5679  C  CB    . ASN E  1 27  ? 15.670  -30.654 84.632  1.00 40.79 ? 26   ASN G CB    1 
ATOM   5680  C  CG    . ASN E  1 27  ? 16.049  -30.369 83.199  1.00 43.18 ? 26   ASN G CG    1 
ATOM   5681  O  OD1   . ASN E  1 27  ? 16.411  -31.278 82.446  1.00 48.99 ? 26   ASN G OD1   1 
ATOM   5682  N  ND2   . ASN E  1 27  ? 15.968  -29.107 82.804  1.00 47.71 ? 26   ASN G ND2   1 
ATOM   5683  N  N     . ALA E  1 28  ? 13.918  -33.291 86.572  1.00 39.12 ? 27   ALA G N     1 
ATOM   5684  C  CA    . ALA E  1 28  ? 13.756  -33.798 87.929  1.00 39.11 ? 27   ALA G CA    1 
ATOM   5685  C  C     . ALA E  1 28  ? 13.968  -35.309 87.928  1.00 38.49 ? 27   ALA G C     1 
ATOM   5686  O  O     . ALA E  1 28  ? 13.516  -35.996 87.015  1.00 38.35 ? 27   ALA G O     1 
ATOM   5687  C  CB    . ALA E  1 28  ? 12.376  -33.449 88.482  1.00 38.62 ? 27   ALA G CB    1 
ATOM   5688  N  N     . PHE E  1 29  ? 14.688  -35.806 88.932  1.00 38.38 ? 28   PHE G N     1 
ATOM   5689  C  CA    . PHE E  1 29  ? 14.801  -37.244 89.167  1.00 38.09 ? 28   PHE G CA    1 
ATOM   5690  C  C     . PHE E  1 29  ? 13.720  -37.623 90.174  1.00 38.27 ? 28   PHE G C     1 
ATOM   5691  O  O     . PHE E  1 29  ? 13.716  -37.133 91.288  1.00 37.99 ? 28   PHE G O     1 
ATOM   5692  C  CB    . PHE E  1 29  ? 16.185  -37.611 89.707  1.00 37.32 ? 28   PHE G CB    1 
ATOM   5693  C  CG    . PHE E  1 29  ? 16.438  -39.101 89.773  1.00 36.11 ? 28   PHE G CG    1 
ATOM   5694  C  CD1   . PHE E  1 29  ? 16.783  -39.806 88.639  1.00 34.66 ? 28   PHE G CD1   1 
ATOM   5695  C  CD2   . PHE E  1 29  ? 16.333  -39.789 90.977  1.00 35.59 ? 28   PHE G CD2   1 
ATOM   5696  C  CE1   . PHE E  1 29  ? 17.017  -41.163 88.692  1.00 35.30 ? 28   PHE G CE1   1 
ATOM   5697  C  CE2   . PHE E  1 29  ? 16.568  -41.148 91.042  1.00 35.68 ? 28   PHE G CE2   1 
ATOM   5698  C  CZ    . PHE E  1 29  ? 16.903  -41.846 89.896  1.00 35.06 ? 28   PHE G CZ    1 
ATOM   5699  N  N     . PRO E  1 30  ? 12.766  -38.469 89.770  1.00 39.14 ? 29   PRO G N     1 
ATOM   5700  C  CA    . PRO E  1 30  ? 11.719  -38.865 90.717  1.00 39.33 ? 29   PRO G CA    1 
ATOM   5701  C  C     . PRO E  1 30  ? 12.265  -39.400 92.032  1.00 39.38 ? 29   PRO G C     1 
ATOM   5702  O  O     . PRO E  1 30  ? 13.219  -40.161 92.031  1.00 39.20 ? 29   PRO G O     1 
ATOM   5703  C  CB    . PRO E  1 30  ? 10.963  -39.946 89.960  1.00 39.55 ? 29   PRO G CB    1 
ATOM   5704  C  CG    . PRO E  1 30  ? 11.142  -39.570 88.542  1.00 39.48 ? 29   PRO G CG    1 
ATOM   5705  C  CD    . PRO E  1 30  ? 12.550  -39.066 88.442  1.00 39.09 ? 29   PRO G CD    1 
ATOM   5706  N  N     . GLY E  1 31  ? 11.674  -38.960 93.137  1.00 39.85 ? 30   GLY G N     1 
ATOM   5707  C  CA    . GLY E  1 31  ? 12.130  -39.341 94.465  1.00 40.56 ? 30   GLY G CA    1 
ATOM   5708  C  C     . GLY E  1 31  ? 11.743  -40.755 94.864  1.00 40.70 ? 30   GLY G C     1 
ATOM   5709  O  O     . GLY E  1 31  ? 12.434  -41.386 95.670  1.00 41.52 ? 30   GLY G O     1 
ATOM   5710  N  N     . GLU E  1 32  ? 10.629  -41.239 94.318  1.00 40.19 ? 31   GLU G N     1 
ATOM   5711  C  CA    . GLU E  1 32  ? 10.064  -42.533 94.692  1.00 40.31 ? 31   GLU G CA    1 
ATOM   5712  C  C     . GLU E  1 32  ? 10.043  -43.451 93.484  1.00 39.43 ? 31   GLU G C     1 
ATOM   5713  O  O     . GLU E  1 32  ? 9.835   -43.008 92.361  1.00 39.70 ? 31   GLU G O     1 
ATOM   5714  C  CB    . GLU E  1 32  ? 8.632   -42.374 95.211  1.00 40.40 ? 31   GLU G CB    1 
ATOM   5715  C  CG    . GLU E  1 32  ? 8.503   -42.252 96.696  1.00 41.39 ? 31   GLU G CG    1 
ATOM   5716  C  CD    . GLU E  1 32  ? 7.061   -42.397 97.179  1.00 41.49 ? 31   GLU G CD    1 
ATOM   5717  O  OE1   . GLU E  1 32  ? 6.205   -41.581 96.743  1.00 43.39 ? 31   GLU G OE1   1 
ATOM   5718  O  OE2   . GLU E  1 32  ? 6.798   -43.313 98.000  1.00 42.36 ? 31   GLU G OE2   1 
ATOM   5719  N  N     . TYR E  1 33  ? 10.306  -44.727 93.722  1.00 38.65 ? 32   TYR G N     1 
ATOM   5720  C  CA    . TYR E  1 33  ? 10.134  -45.760 92.702  1.00 38.00 ? 32   TYR G CA    1 
ATOM   5721  C  C     . TYR E  1 33  ? 8.651   -46.199 92.661  1.00 37.41 ? 32   TYR G C     1 
ATOM   5722  O  O     . TYR E  1 33  ? 8.125   -46.802 93.605  1.00 36.86 ? 32   TYR G O     1 
ATOM   5723  C  CB    . TYR E  1 33  ? 11.082  -46.934 92.979  1.00 37.92 ? 32   TYR G CB    1 
ATOM   5724  C  CG    . TYR E  1 33  ? 10.838  -48.188 92.165  1.00 37.53 ? 32   TYR G CG    1 
ATOM   5725  C  CD1   . TYR E  1 33  ? 10.426  -48.137 90.828  1.00 37.55 ? 32   TYR G CD1   1 
ATOM   5726  C  CD2   . TYR E  1 33  ? 11.018  -49.423 92.733  1.00 37.47 ? 32   TYR G CD2   1 
ATOM   5727  C  CE1   . TYR E  1 33  ? 10.218  -49.291 90.102  1.00 37.06 ? 32   TYR G CE1   1 
ATOM   5728  C  CE2   . TYR E  1 33  ? 10.802  -50.579 92.010  1.00 38.57 ? 32   TYR G CE2   1 
ATOM   5729  C  CZ    . TYR E  1 33  ? 10.398  -50.510 90.707  1.00 37.44 ? 32   TYR G CZ    1 
ATOM   5730  O  OH    . TYR E  1 33  ? 10.202  -51.697 90.037  1.00 38.61 ? 32   TYR G OH    1 
ATOM   5731  N  N     . ILE E  1 34  ? 7.994   -45.860 91.551  1.00 37.29 ? 33   ILE G N     1 
ATOM   5732  C  CA    . ILE E  1 34  ? 6.586   -46.141 91.333  1.00 36.69 ? 33   ILE G CA    1 
ATOM   5733  C  C     . ILE E  1 34  ? 6.403   -46.742 89.940  1.00 36.37 ? 33   ILE G C     1 
ATOM   5734  O  O     . ILE E  1 34  ? 6.385   -46.017 88.938  1.00 36.41 ? 33   ILE G O     1 
ATOM   5735  C  CB    . ILE E  1 34  ? 5.726   -44.853 91.447  1.00 37.01 ? 33   ILE G CB    1 
ATOM   5736  C  CG1   . ILE E  1 34  ? 5.964   -44.137 92.779  1.00 37.02 ? 33   ILE G CG1   1 
ATOM   5737  C  CG2   . ILE E  1 34  ? 4.246   -45.176 91.252  1.00 35.99 ? 33   ILE G CG2   1 
ATOM   5738  C  CD1   . ILE E  1 34  ? 5.097   -42.854 92.946  1.00 36.76 ? 33   ILE G CD1   1 
ATOM   5739  N  N     . PRO E  1 35  ? 6.283   -48.086 89.856  1.00 36.10 ? 34   PRO G N     1 
ATOM   5740  C  CA    . PRO E  1 35  ? 6.042   -48.704 88.537  1.00 35.45 ? 34   PRO G CA    1 
ATOM   5741  C  C     . PRO E  1 35  ? 4.898   -48.062 87.737  1.00 35.47 ? 34   PRO G C     1 
ATOM   5742  O  O     . PRO E  1 35  ? 3.909   -47.560 88.315  1.00 34.99 ? 34   PRO G O     1 
ATOM   5743  C  CB    . PRO E  1 35  ? 5.741   -50.161 88.885  1.00 35.16 ? 34   PRO G CB    1 
ATOM   5744  C  CG    . PRO E  1 35  ? 6.485   -50.385 90.168  1.00 35.62 ? 34   PRO G CG    1 
ATOM   5745  C  CD    . PRO E  1 35  ? 6.375   -49.094 90.928  1.00 35.17 ? 34   PRO G CD    1 
ATOM   5746  N  N     . THR E  1 36  ? 5.068   -48.090 86.420  1.00 35.13 ? 35   THR G N     1 
ATOM   5747  C  CA    . THR E  1 36  ? 4.115   -47.541 85.447  1.00 35.37 ? 35   THR G CA    1 
ATOM   5748  C  C     . THR E  1 36  ? 3.098   -48.563 85.010  1.00 35.24 ? 35   THR G C     1 
ATOM   5749  O  O     . THR E  1 36  ? 3.418   -49.752 84.872  1.00 35.44 ? 35   THR G O     1 
ATOM   5750  C  CB    . THR E  1 36  ? 4.850   -47.110 84.173  1.00 35.30 ? 35   THR G CB    1 
ATOM   5751  O  OG1   . THR E  1 36  ? 5.862   -46.177 84.541  1.00 35.15 ? 35   THR G OG1   1 
ATOM   5752  C  CG2   . THR E  1 36  ? 3.895   -46.500 83.110  1.00 33.88 ? 35   THR G CG2   1 
ATOM   5753  N  N     . VAL E  1 37  ? 1.871   -48.096 84.792  1.00 34.93 ? 36   VAL G N     1 
ATOM   5754  C  CA    . VAL E  1 37  ? 0.876   -48.864 84.021  1.00 34.74 ? 36   VAL G CA    1 
ATOM   5755  C  C     . VAL E  1 37  ? 0.892   -48.391 82.560  1.00 34.66 ? 36   VAL G C     1 
ATOM   5756  O  O     . VAL E  1 37  ? 1.137   -49.162 81.657  1.00 34.85 ? 36   VAL G O     1 
ATOM   5757  C  CB    . VAL E  1 37  ? -0.561  -48.722 84.608  1.00 34.32 ? 36   VAL G CB    1 
ATOM   5758  C  CG1   . VAL E  1 37  ? -1.529  -49.581 83.816  1.00 32.54 ? 36   VAL G CG1   1 
ATOM   5759  C  CG2   . VAL E  1 37  ? -0.575  -49.096 86.077  1.00 33.50 ? 36   VAL G CG2   1 
ATOM   5760  N  N     . PHE E  1 38  ? 0.602   -47.112 82.345  1.00 35.26 ? 37   PHE G N     1 
ATOM   5761  C  CA    . PHE E  1 38  ? 0.935   -46.442 81.095  1.00 35.45 ? 37   PHE G CA    1 
ATOM   5762  C  C     . PHE E  1 38  ? 0.870   -44.942 81.272  1.00 36.01 ? 37   PHE G C     1 
ATOM   5763  O  O     . PHE E  1 38  ? -0.010  -44.412 81.943  1.00 36.17 ? 37   PHE G O     1 
ATOM   5764  C  CB    . PHE E  1 38  ? 0.016   -46.845 79.929  1.00 35.78 ? 37   PHE G CB    1 
ATOM   5765  C  CG    . PHE E  1 38  ? 0.233   -46.017 78.704  1.00 35.24 ? 37   PHE G CG    1 
ATOM   5766  C  CD1   . PHE E  1 38  ? 1.375   -46.179 77.947  1.00 34.55 ? 37   PHE G CD1   1 
ATOM   5767  C  CD2   . PHE E  1 38  ? -0.668  -45.021 78.351  1.00 36.20 ? 37   PHE G CD2   1 
ATOM   5768  C  CE1   . PHE E  1 38  ? 1.606   -45.376 76.810  1.00 36.49 ? 37   PHE G CE1   1 
ATOM   5769  C  CE2   . PHE E  1 38  ? -0.451  -44.214 77.214  1.00 35.48 ? 37   PHE G CE2   1 
ATOM   5770  C  CZ    . PHE E  1 38  ? 0.692   -44.391 76.457  1.00 35.67 ? 37   PHE G CZ    1 
ATOM   5771  N  N     . ASP E  1 39  ? 1.797   -44.250 80.638  1.00 36.70 ? 38   ASP G N     1 
ATOM   5772  C  CA    . ASP E  1 39  ? 1.805   -42.810 80.678  1.00 37.22 ? 38   ASP G CA    1 
ATOM   5773  C  C     . ASP E  1 39  ? 2.230   -42.235 79.345  1.00 37.93 ? 38   ASP G C     1 
ATOM   5774  O  O     . ASP E  1 39  ? 3.117   -42.780 78.682  1.00 38.09 ? 38   ASP G O     1 
ATOM   5775  C  CB    . ASP E  1 39  ? 2.738   -42.343 81.784  1.00 37.23 ? 38   ASP G CB    1 
ATOM   5776  C  CG    . ASP E  1 39  ? 2.133   -42.538 83.161  1.00 37.02 ? 38   ASP G CG    1 
ATOM   5777  O  OD1   . ASP E  1 39  ? 1.252   -41.740 83.534  1.00 37.19 ? 38   ASP G OD1   1 
ATOM   5778  O  OD2   . ASP E  1 39  ? 2.531   -43.499 83.855  1.00 38.38 ? 38   ASP G OD2   1 
ATOM   5779  N  N     . ASN E  1 40  ? 1.597   -41.123 78.966  1.00 38.39 ? 39   ASN G N     1 
ATOM   5780  C  CA    . ASN E  1 40  ? 1.937   -40.425 77.737  1.00 38.82 ? 39   ASN G CA    1 
ATOM   5781  C  C     . ASN E  1 40  ? 2.311   -38.979 78.074  1.00 38.73 ? 39   ASN G C     1 
ATOM   5782  O  O     . ASN E  1 40  ? 1.524   -38.269 78.702  1.00 37.82 ? 39   ASN G O     1 
ATOM   5783  C  CB    . ASN E  1 40  ? 0.748   -40.493 76.760  1.00 39.21 ? 39   ASN G CB    1 
ATOM   5784  C  CG    . ASN E  1 40  ? 1.067   -39.955 75.364  1.00 40.58 ? 39   ASN G CG    1 
ATOM   5785  O  OD1   . ASN E  1 40  ? 0.347   -39.120 74.861  1.00 43.97 ? 39   ASN G OD1   1 
ATOM   5786  N  ND2   . ASN E  1 40  ? 2.115   -40.463 74.728  1.00 44.53 ? 39   ASN G ND2   1 
ATOM   5787  N  N     . TYR E  1 41  ? 3.523   -38.577 77.667  1.00 38.68 ? 40   TYR G N     1 
ATOM   5788  C  CA    . TYR E  1 41  ? 4.025   -37.222 77.878  1.00 38.76 ? 40   TYR G CA    1 
ATOM   5789  C  C     . TYR E  1 41  ? 4.352   -36.597 76.529  1.00 39.18 ? 40   TYR G C     1 
ATOM   5790  O  O     . TYR E  1 41  ? 4.714   -37.302 75.581  1.00 38.50 ? 40   TYR G O     1 
ATOM   5791  C  CB    . TYR E  1 41  ? 5.318   -37.190 78.724  1.00 38.42 ? 40   TYR G CB    1 
ATOM   5792  C  CG    . TYR E  1 41  ? 5.375   -38.179 79.866  1.00 38.59 ? 40   TYR G CG    1 
ATOM   5793  C  CD1   . TYR E  1 41  ? 6.337   -39.180 79.884  1.00 37.62 ? 40   TYR G CD1   1 
ATOM   5794  C  CD2   . TYR E  1 41  ? 4.465   -38.124 80.919  1.00 37.30 ? 40   TYR G CD2   1 
ATOM   5795  C  CE1   . TYR E  1 41  ? 6.395   -40.096 80.912  1.00 38.44 ? 40   TYR G CE1   1 
ATOM   5796  C  CE2   . TYR E  1 41  ? 4.509   -39.059 81.952  1.00 38.24 ? 40   TYR G CE2   1 
ATOM   5797  C  CZ    . TYR E  1 41  ? 5.488   -40.041 81.940  1.00 37.59 ? 40   TYR G CZ    1 
ATOM   5798  O  OH    . TYR E  1 41  ? 5.562   -40.988 82.942  1.00 38.95 ? 40   TYR G OH    1 
ATOM   5799  N  N     . SER E  1 42  ? 4.236   -35.275 76.466  1.00 39.69 ? 41   SER G N     1 
ATOM   5800  C  CA    A SER E  1 42  ? 4.636   -34.481 75.301  0.50 40.01 ? 41   SER G CA    1 
ATOM   5801  C  CA    B SER E  1 42  ? 4.699   -34.531 75.299  0.50 39.61 ? 41   SER G CA    1 
ATOM   5802  C  C     . SER E  1 42  ? 5.629   -33.400 75.712  1.00 39.86 ? 41   SER G C     1 
ATOM   5803  O  O     . SER E  1 42  ? 5.547   -32.889 76.836  1.00 39.89 ? 41   SER G O     1 
ATOM   5804  C  CB    A SER E  1 42  ? 3.420   -33.780 74.691  0.50 40.04 ? 41   SER G CB    1 
ATOM   5805  C  CB    B SER E  1 42  ? 3.526   -33.984 74.481  0.50 39.61 ? 41   SER G CB    1 
ATOM   5806  O  OG    A SER E  1 42  ? 2.570   -34.697 74.032  0.50 42.10 ? 41   SER G OG    1 
ATOM   5807  O  OG    B SER E  1 42  ? 2.800   -32.997 75.183  0.50 39.17 ? 41   SER G OG    1 
ATOM   5808  N  N     . ALA E  1 43  ? 6.535   -33.045 74.792  1.00 40.18 ? 42   ALA G N     1 
ATOM   5809  C  CA    . ALA E  1 43  ? 7.427   -31.870 74.924  1.00 40.33 ? 42   ALA G CA    1 
ATOM   5810  C  C     . ALA E  1 43  ? 7.739   -31.281 73.539  1.00 40.72 ? 42   ALA G C     1 
ATOM   5811  O  O     . ALA E  1 43  ? 7.779   -31.989 72.529  1.00 40.49 ? 42   ALA G O     1 
ATOM   5812  C  CB    . ALA E  1 43  ? 8.730   -32.217 75.665  1.00 39.71 ? 42   ALA G CB    1 
ATOM   5813  N  N     . ASN E  1 44  ? 7.948   -29.973 73.506  1.00 41.52 ? 43   ASN G N     1 
ATOM   5814  C  CA    . ASN E  1 44  ? 8.470   -29.293 72.333  1.00 42.16 ? 43   ASN G CA    1 
ATOM   5815  C  C     . ASN E  1 44  ? 9.997   -29.279 72.335  1.00 42.22 ? 43   ASN G C     1 
ATOM   5816  O  O     . ASN E  1 44  ? 10.632  -29.121 73.379  1.00 42.21 ? 43   ASN G O     1 
ATOM   5817  C  CB    . ASN E  1 44  ? 7.949   -27.864 72.272  1.00 42.77 ? 43   ASN G CB    1 
ATOM   5818  C  CG    . ASN E  1 44  ? 6.452   -27.808 72.038  1.00 45.51 ? 43   ASN G CG    1 
ATOM   5819  O  OD1   . ASN E  1 44  ? 5.892   -28.623 71.281  1.00 50.80 ? 43   ASN G OD1   1 
ATOM   5820  N  ND2   . ASN E  1 44  ? 5.791   -26.853 72.681  1.00 46.05 ? 43   ASN G ND2   1 
ATOM   5821  N  N     . VAL E  1 45  ? 10.570  -29.477 71.156  1.00 42.10 ? 44   VAL G N     1 
ATOM   5822  C  CA    . VAL E  1 45  ? 11.995  -29.341 70.940  1.00 42.31 ? 44   VAL G CA    1 
ATOM   5823  C  C     . VAL E  1 45  ? 12.202  -28.561 69.649  1.00 42.62 ? 44   VAL G C     1 
ATOM   5824  O  O     . VAL E  1 45  ? 11.420  -28.680 68.700  1.00 42.17 ? 44   VAL G O     1 
ATOM   5825  C  CB    . VAL E  1 45  ? 12.672  -30.717 70.833  1.00 42.45 ? 44   VAL G CB    1 
ATOM   5826  C  CG1   . VAL E  1 45  ? 13.963  -30.608 70.092  1.00 42.72 ? 44   VAL G CG1   1 
ATOM   5827  C  CG2   . VAL E  1 45  ? 12.916  -31.296 72.226  1.00 42.91 ? 44   VAL G CG2   1 
ATOM   5828  N  N     . MET E  1 46  ? 13.261  -27.762 69.622  1.00 43.28 ? 45   MET G N     1 
ATOM   5829  C  CA    . MET E  1 46  ? 13.631  -27.015 68.431  1.00 43.84 ? 45   MET G CA    1 
ATOM   5830  C  C     . MET E  1 46  ? 14.715  -27.799 67.689  1.00 43.62 ? 45   MET G C     1 
ATOM   5831  O  O     . MET E  1 46  ? 15.807  -27.994 68.208  1.00 43.08 ? 45   MET G O     1 
ATOM   5832  C  CB    . MET E  1 46  ? 14.125  -25.623 68.825  1.00 44.43 ? 45   MET G CB    1 
ATOM   5833  C  CG    . MET E  1 46  ? 13.520  -24.497 67.995  1.00 46.93 ? 45   MET G CG    1 
ATOM   5834  S  SD    . MET E  1 46  ? 11.714  -24.346 68.163  1.00 51.46 ? 45   MET G SD    1 
ATOM   5835  C  CE    . MET E  1 46  ? 11.395  -23.435 66.653  1.00 47.20 ? 45   MET G CE    1 
ATOM   5836  N  N     . VAL E  1 47  ? 14.407  -28.260 66.484  1.00 43.68 ? 46   VAL G N     1 
ATOM   5837  C  CA    . VAL E  1 47  ? 15.358  -29.037 65.703  1.00 44.14 ? 46   VAL G CA    1 
ATOM   5838  C  C     . VAL E  1 47  ? 15.785  -28.244 64.486  1.00 44.71 ? 46   VAL G C     1 
ATOM   5839  O  O     . VAL E  1 47  ? 14.985  -28.025 63.572  1.00 45.01 ? 46   VAL G O     1 
ATOM   5840  C  CB    . VAL E  1 47  ? 14.756  -30.374 65.266  1.00 44.39 ? 46   VAL G CB    1 
ATOM   5841  C  CG1   . VAL E  1 47  ? 15.727  -31.138 64.354  1.00 44.60 ? 46   VAL G CG1   1 
ATOM   5842  C  CG2   . VAL E  1 47  ? 14.370  -31.199 66.498  1.00 43.11 ? 46   VAL G CG2   1 
ATOM   5843  N  N     . ASP E  1 48  ? 17.045  -27.807 64.490  1.00 45.26 ? 47   ASP G N     1 
ATOM   5844  C  CA    . ASP E  1 48  ? 17.611  -27.001 63.414  1.00 45.98 ? 47   ASP G CA    1 
ATOM   5845  C  C     . ASP E  1 48  ? 16.686  -25.827 63.069  1.00 46.12 ? 47   ASP G C     1 
ATOM   5846  O  O     . ASP E  1 48  ? 16.453  -25.519 61.904  1.00 46.43 ? 47   ASP G O     1 
ATOM   5847  C  CB    . ASP E  1 48  ? 17.903  -27.883 62.183  1.00 46.10 ? 47   ASP G CB    1 
ATOM   5848  C  CG    . ASP E  1 48  ? 18.868  -29.021 62.500  1.00 47.91 ? 47   ASP G CG    1 
ATOM   5849  O  OD1   . ASP E  1 48  ? 19.549  -28.937 63.548  1.00 50.24 ? 47   ASP G OD1   1 
ATOM   5850  O  OD2   . ASP E  1 48  ? 18.946  -30.005 61.727  1.00 49.05 ? 47   ASP G OD2   1 
ATOM   5851  N  N     . GLY E  1 49  ? 16.140  -25.191 64.098  1.00 46.30 ? 48   GLY G N     1 
ATOM   5852  C  CA    . GLY E  1 49  ? 15.350  -23.996 63.906  1.00 46.49 ? 48   GLY G CA    1 
ATOM   5853  C  C     . GLY E  1 49  ? 13.875  -24.236 63.672  1.00 46.66 ? 48   GLY G C     1 
ATOM   5854  O  O     . GLY E  1 49  ? 13.111  -23.276 63.626  1.00 47.06 ? 48   GLY G O     1 
ATOM   5855  N  N     . LYS E  1 50  ? 13.466  -25.500 63.543  1.00 46.64 ? 49   LYS G N     1 
ATOM   5856  C  CA    . LYS E  1 50  ? 12.047  -25.854 63.397  1.00 46.38 ? 49   LYS G CA    1 
ATOM   5857  C  C     . LYS E  1 50  ? 11.479  -26.561 64.650  1.00 45.60 ? 49   LYS G C     1 
ATOM   5858  O  O     . LYS E  1 50  ? 12.140  -27.415 65.237  1.00 45.05 ? 49   LYS G O     1 
ATOM   5859  C  CB    . LYS E  1 50  ? 11.854  -26.740 62.160  1.00 46.67 ? 49   LYS G CB    1 
ATOM   5860  C  CG    . LYS E  1 50  ? 12.113  -26.023 60.814  1.00 48.19 ? 49   LYS G CG    1 
ATOM   5861  C  CD    . LYS E  1 50  ? 13.488  -26.342 60.206  1.00 49.59 ? 49   LYS G CD    1 
ATOM   5862  N  N     . PRO E  1 51  ? 10.238  -26.211 65.051  1.00 44.94 ? 50   PRO G N     1 
ATOM   5863  C  CA    . PRO E  1 51  ? 9.602   -26.820 66.207  1.00 44.44 ? 50   PRO G CA    1 
ATOM   5864  C  C     . PRO E  1 51  ? 9.051   -28.216 65.919  1.00 44.06 ? 50   PRO G C     1 
ATOM   5865  O  O     . PRO E  1 51  ? 8.430   -28.440 64.882  1.00 43.62 ? 50   PRO G O     1 
ATOM   5866  C  CB    . PRO E  1 51  ? 8.461   -25.852 66.518  1.00 44.58 ? 50   PRO G CB    1 
ATOM   5867  C  CG    . PRO E  1 51  ? 8.073   -25.305 65.213  1.00 44.32 ? 50   PRO G CG    1 
ATOM   5868  C  CD    . PRO E  1 51  ? 9.355   -25.207 64.420  1.00 45.20 ? 50   PRO G CD    1 
ATOM   5869  N  N     . VAL E  1 52  ? 9.277   -29.134 66.853  1.00 43.45 ? 51   VAL G N     1 
ATOM   5870  C  CA    . VAL E  1 52  ? 8.874   -30.529 66.719  1.00 43.45 ? 51   VAL G CA    1 
ATOM   5871  C  C     . VAL E  1 52  ? 8.136   -30.918 67.987  1.00 43.16 ? 51   VAL G C     1 
ATOM   5872  O  O     . VAL E  1 52  ? 8.574   -30.575 69.066  1.00 43.16 ? 51   VAL G O     1 
ATOM   5873  C  CB    . VAL E  1 52  ? 10.127  -31.421 66.538  1.00 43.23 ? 51   VAL G CB    1 
ATOM   5874  C  CG1   . VAL E  1 52  ? 9.792   -32.908 66.661  1.00 44.20 ? 51   VAL G CG1   1 
ATOM   5875  C  CG2   . VAL E  1 52  ? 10.805  -31.111 65.205  1.00 43.99 ? 51   VAL G CG2   1 
ATOM   5876  N  N     . ASN E  1 53  ? 7.007   -31.603 67.873  1.00 43.40 ? 52   ASN G N     1 
ATOM   5877  C  CA    . ASN E  1 53  ? 6.358   -32.147 69.058  1.00 43.41 ? 52   ASN G CA    1 
ATOM   5878  C  C     . ASN E  1 53  ? 6.788   -33.579 69.326  1.00 42.74 ? 52   ASN G C     1 
ATOM   5879  O  O     . ASN E  1 53  ? 6.601   -34.465 68.493  1.00 42.51 ? 52   ASN G O     1 
ATOM   5880  C  CB    . ASN E  1 53  ? 4.838   -32.091 68.963  1.00 44.02 ? 52   ASN G CB    1 
ATOM   5881  C  CG    . ASN E  1 53  ? 4.165   -32.479 70.288  1.00 46.60 ? 52   ASN G CG    1 
ATOM   5882  O  OD1   . ASN E  1 53  ? 3.657   -33.593 70.437  1.00 51.15 ? 52   ASN G OD1   1 
ATOM   5883  N  ND2   . ASN E  1 53  ? 4.202   -31.565 71.273  1.00 50.93 ? 52   ASN G ND2   1 
ATOM   5884  N  N     . LEU E  1 54  ? 7.347   -33.803 70.510  1.00 42.44 ? 53   LEU G N     1 
ATOM   5885  C  CA    . LEU E  1 54  ? 7.837   -35.112 70.893  1.00 42.58 ? 53   LEU G CA    1 
ATOM   5886  C  C     . LEU E  1 54  ? 6.805   -35.796 71.780  1.00 42.17 ? 53   LEU G C     1 
ATOM   5887  O  O     . LEU E  1 54  ? 6.513   -35.324 72.864  1.00 42.76 ? 53   LEU G O     1 
ATOM   5888  C  CB    . LEU E  1 54  ? 9.188   -34.994 71.599  1.00 42.45 ? 53   LEU G CB    1 
ATOM   5889  C  CG    . LEU E  1 54  ? 9.921   -36.290 71.971  1.00 43.16 ? 53   LEU G CG    1 
ATOM   5890  C  CD1   . LEU E  1 54  ? 10.038  -37.299 70.791  1.00 42.46 ? 53   LEU G CD1   1 
ATOM   5891  C  CD2   . LEU E  1 54  ? 11.303  -35.936 72.535  1.00 42.41 ? 53   LEU G CD2   1 
ATOM   5892  N  N     . GLY E  1 55  ? 6.234   -36.888 71.291  1.00 41.45 ? 54   GLY G N     1 
ATOM   5893  C  CA    . GLY E  1 55  ? 5.308   -37.700 72.068  1.00 40.84 ? 54   GLY G CA    1 
ATOM   5894  C  C     . GLY E  1 55  ? 6.088   -38.833 72.707  1.00 40.68 ? 54   GLY G C     1 
ATOM   5895  O  O     . GLY E  1 55  ? 6.841   -39.551 72.030  1.00 40.80 ? 54   GLY G O     1 
ATOM   5896  N  N     . LEU E  1 56  ? 5.907   -39.013 74.005  1.00 39.83 ? 55   LEU G N     1 
ATOM   5897  C  CA    . LEU E  1 56  ? 6.621   -40.050 74.717  1.00 39.73 ? 55   LEU G CA    1 
ATOM   5898  C  C     . LEU E  1 56  ? 5.632   -41.034 75.340  1.00 39.48 ? 55   LEU G C     1 
ATOM   5899  O  O     . LEU E  1 56  ? 4.766   -40.668 76.152  1.00 39.05 ? 55   LEU G O     1 
ATOM   5900  C  CB    . LEU E  1 56  ? 7.562   -39.432 75.770  1.00 39.80 ? 55   LEU G CB    1 
ATOM   5901  C  CG    . LEU E  1 56  ? 8.570   -38.409 75.206  1.00 40.02 ? 55   LEU G CG    1 
ATOM   5902  C  CD1   . LEU E  1 56  ? 9.323   -37.693 76.314  1.00 39.75 ? 55   LEU G CD1   1 
ATOM   5903  C  CD2   . LEU E  1 56  ? 9.536   -39.046 74.253  1.00 38.07 ? 55   LEU G CD2   1 
ATOM   5904  N  N     . TRP E  1 57  ? 5.776   -42.291 74.937  1.00 39.48 ? 56   TRP G N     1 
ATOM   5905  C  CA    . TRP E  1 57  ? 4.879   -43.361 75.356  1.00 39.34 ? 56   TRP G CA    1 
ATOM   5906  C  C     . TRP E  1 57  ? 5.649   -44.263 76.319  1.00 38.30 ? 56   TRP G C     1 
ATOM   5907  O  O     . TRP E  1 57  ? 6.493   -45.043 75.920  1.00 37.31 ? 56   TRP G O     1 
ATOM   5908  C  CB    . TRP E  1 57  ? 4.327   -44.096 74.126  1.00 40.07 ? 56   TRP G CB    1 
ATOM   5909  C  CG    . TRP E  1 57  ? 3.608   -43.141 73.181  1.00 41.05 ? 56   TRP G CG    1 
ATOM   5910  C  CD1   . TRP E  1 57  ? 4.111   -41.979 72.620  1.00 42.06 ? 56   TRP G CD1   1 
ATOM   5911  C  CD2   . TRP E  1 57  ? 2.280   -43.258 72.709  1.00 41.52 ? 56   TRP G CD2   1 
ATOM   5912  N  NE1   . TRP E  1 57  ? 3.166   -41.370 71.836  1.00 41.84 ? 56   TRP G NE1   1 
ATOM   5913  C  CE2   . TRP E  1 57  ? 2.029   -42.141 71.865  1.00 42.83 ? 56   TRP G CE2   1 
ATOM   5914  C  CE3   . TRP E  1 57  ? 1.273   -44.195 72.905  1.00 41.63 ? 56   TRP G CE3   1 
ATOM   5915  C  CZ2   . TRP E  1 57  ? 0.813   -41.952 71.229  1.00 42.26 ? 56   TRP G CZ2   1 
ATOM   5916  C  CZ3   . TRP E  1 57  ? 0.060   -44.004 72.273  1.00 42.40 ? 56   TRP G CZ3   1 
ATOM   5917  C  CH2   . TRP E  1 57  ? -0.159  -42.898 71.438  1.00 42.78 ? 56   TRP G CH2   1 
ATOM   5918  N  N     . ASP E  1 58  ? 5.354   -44.094 77.601  1.00 38.21 ? 57   ASP G N     1 
ATOM   5919  C  CA    . ASP E  1 58  ? 6.114   -44.697 78.696  1.00 37.98 ? 57   ASP G CA    1 
ATOM   5920  C  C     . ASP E  1 58  ? 5.365   -45.968 79.099  1.00 37.64 ? 57   ASP G C     1 
ATOM   5921  O  O     . ASP E  1 58  ? 4.269   -45.882 79.662  1.00 37.26 ? 57   ASP G O     1 
ATOM   5922  C  CB    . ASP E  1 58  ? 6.168   -43.701 79.863  1.00 38.05 ? 57   ASP G CB    1 
ATOM   5923  C  CG    . ASP E  1 58  ? 7.032   -44.178 81.044  1.00 38.33 ? 57   ASP G CG    1 
ATOM   5924  O  OD1   . ASP E  1 58  ? 7.735   -45.217 80.940  1.00 37.75 ? 57   ASP G OD1   1 
ATOM   5925  O  OD2   . ASP E  1 58  ? 6.998   -43.475 82.088  1.00 37.38 ? 57   ASP G OD2   1 
ATOM   5926  N  N     . THR E  1 59  ? 5.939   -47.136 78.804  1.00 37.53 ? 58   THR G N     1 
ATOM   5927  C  CA    . THR E  1 59  ? 5.217   -48.402 78.981  1.00 37.44 ? 58   THR G CA    1 
ATOM   5928  C  C     . THR E  1 59  ? 5.586   -49.100 80.289  1.00 37.46 ? 58   THR G C     1 
ATOM   5929  O  O     . THR E  1 59  ? 6.542   -48.722 80.980  1.00 38.55 ? 58   THR G O     1 
ATOM   5930  C  CB    . THR E  1 59  ? 5.444   -49.376 77.759  1.00 37.66 ? 58   THR G CB    1 
ATOM   5931  O  OG1   . THR E  1 59  ? 6.812   -49.818 77.709  1.00 38.70 ? 58   THR G OG1   1 
ATOM   5932  C  CG2   . THR E  1 59  ? 5.084   -48.685 76.453  1.00 35.63 ? 58   THR G CG2   1 
ATOM   5933  N  N     . ALA E  1 60  ? 4.824   -50.130 80.616  1.00 37.81 ? 59   ALA G N     1 
ATOM   5934  C  CA    . ALA E  1 60  ? 5.053   -50.931 81.816  1.00 37.62 ? 59   ALA G CA    1 
ATOM   5935  C  C     . ALA E  1 60  ? 6.068   -52.051 81.566  1.00 38.06 ? 59   ALA G C     1 
ATOM   5936  O  O     . ALA E  1 60  ? 5.947   -52.809 80.612  1.00 38.12 ? 59   ALA G O     1 
ATOM   5937  C  CB    . ALA E  1 60  ? 3.720   -51.533 82.303  1.00 37.78 ? 59   ALA G CB    1 
ATOM   5938  N  N     . GLY E  1 61  ? 7.070   -52.160 82.437  1.00 38.29 ? 60   GLY G N     1 
ATOM   5939  C  CA    . GLY E  1 61  ? 7.965   -53.287 82.403  1.00 37.94 ? 60   GLY G CA    1 
ATOM   5940  C  C     . GLY E  1 61  ? 7.387   -54.508 83.073  1.00 38.50 ? 60   GLY G C     1 
ATOM   5941  O  O     . GLY E  1 61  ? 7.843   -55.615 82.795  1.00 38.76 ? 60   GLY G O     1 
ATOM   5942  N  N     . GLN E  1 62  ? 6.406   -54.334 83.969  1.00 39.01 ? 61   GLN G N     1 
ATOM   5943  C  CA    . GLN E  1 62  ? 5.755   -55.487 84.630  1.00 39.24 ? 61   GLN G CA    1 
ATOM   5944  C  C     . GLN E  1 62  ? 5.091   -56.398 83.590  1.00 39.41 ? 61   GLN G C     1 
ATOM   5945  O  O     . GLN E  1 62  ? 4.309   -55.929 82.762  1.00 38.89 ? 61   GLN G O     1 
ATOM   5946  C  CB    . GLN E  1 62  ? 4.662   -55.040 85.618  1.00 39.49 ? 61   GLN G CB    1 
ATOM   5947  C  CG    . GLN E  1 62  ? 5.117   -54.195 86.819  1.00 39.89 ? 61   GLN G CG    1 
ATOM   5948  C  CD    . GLN E  1 62  ? 3.937   -53.496 87.517  1.00 39.62 ? 61   GLN G CD    1 
ATOM   5949  O  OE1   . GLN E  1 62  ? 3.209   -54.113 88.297  1.00 39.35 ? 61   GLN G OE1   1 
ATOM   5950  N  NE2   . GLN E  1 62  ? 3.753   -52.203 87.234  1.00 39.07 ? 61   GLN G NE2   1 
ATOM   5951  N  N     . GLU E  1 63  ? 5.383   -57.693 83.632  1.00 39.92 ? 62   GLU G N     1 
ATOM   5952  C  CA    . GLU E  1 63  ? 4.771   -58.619 82.676  1.00 40.84 ? 62   GLU G CA    1 
ATOM   5953  C  C     . GLU E  1 63  ? 3.259   -58.822 82.898  1.00 40.01 ? 62   GLU G C     1 
ATOM   5954  O  O     . GLU E  1 63  ? 2.559   -59.247 81.984  1.00 39.72 ? 62   GLU G O     1 
ATOM   5955  C  CB    . GLU E  1 63  ? 5.523   -59.952 82.627  1.00 41.01 ? 62   GLU G CB    1 
ATOM   5956  C  CG    . GLU E  1 63  ? 5.361   -60.811 83.816  1.00 43.38 ? 62   GLU G CG    1 
ATOM   5957  C  CD    . GLU E  1 63  ? 6.225   -62.064 83.738  1.00 44.60 ? 62   GLU G CD    1 
ATOM   5958  O  OE1   . GLU E  1 63  ? 7.242   -62.117 84.480  1.00 49.03 ? 62   GLU G OE1   1 
ATOM   5959  O  OE2   . GLU E  1 63  ? 5.891   -62.972 82.928  1.00 48.49 ? 62   GLU G OE2   1 
ATOM   5960  N  N     . ASP E  1 64  ? 2.751   -58.488 84.085  1.00 39.73 ? 63   ASP G N     1 
ATOM   5961  C  CA    . ASP E  1 64  ? 1.293   -58.454 84.309  1.00 39.52 ? 63   ASP G CA    1 
ATOM   5962  C  C     . ASP E  1 64  ? 0.578   -57.487 83.355  1.00 38.90 ? 63   ASP G C     1 
ATOM   5963  O  O     . ASP E  1 64  ? -0.608  -57.669 83.052  1.00 39.19 ? 63   ASP G O     1 
ATOM   5964  C  CB    . ASP E  1 64  ? 0.961   -58.053 85.754  1.00 39.63 ? 63   ASP G CB    1 
ATOM   5965  C  CG    . ASP E  1 64  ? 1.009   -59.231 86.733  1.00 40.14 ? 63   ASP G CG    1 
ATOM   5966  O  OD1   . ASP E  1 64  ? 1.370   -60.363 86.336  1.00 39.61 ? 63   ASP G OD1   1 
ATOM   5967  O  OD2   . ASP E  1 64  ? 0.667   -59.000 87.908  1.00 40.44 ? 63   ASP G OD2   1 
ATOM   5968  N  N     . TYR E  1 65  ? 1.294   -56.486 82.863  1.00 38.57 ? 64   TYR G N     1 
ATOM   5969  C  CA    . TYR E  1 65  ? 0.704   -55.539 81.893  1.00 38.37 ? 64   TYR G CA    1 
ATOM   5970  C  C     . TYR E  1 65  ? 1.047   -55.838 80.438  1.00 38.21 ? 64   TYR G C     1 
ATOM   5971  O  O     . TYR E  1 65  ? 0.883   -54.980 79.572  1.00 37.73 ? 64   TYR G O     1 
ATOM   5972  C  CB    . TYR E  1 65  ? 1.032   -54.088 82.295  1.00 38.00 ? 64   TYR G CB    1 
ATOM   5973  C  CG    . TYR E  1 65  ? 0.289   -53.706 83.564  1.00 37.68 ? 64   TYR G CG    1 
ATOM   5974  C  CD1   . TYR E  1 65  ? 0.964   -53.335 84.725  1.00 38.37 ? 64   TYR G CD1   1 
ATOM   5975  C  CD2   . TYR E  1 65  ? -1.096  -53.769 83.611  1.00 38.63 ? 64   TYR G CD2   1 
ATOM   5976  C  CE1   . TYR E  1 65  ? 0.265   -53.015 85.899  1.00 38.26 ? 64   TYR G CE1   1 
ATOM   5977  C  CE2   . TYR E  1 65  ? -1.800  -53.464 84.769  1.00 38.72 ? 64   TYR G CE2   1 
ATOM   5978  C  CZ    . TYR E  1 65  ? -1.126  -53.089 85.908  1.00 38.13 ? 64   TYR G CZ    1 
ATOM   5979  O  OH    . TYR E  1 65  ? -1.857  -52.799 87.032  1.00 37.50 ? 64   TYR G OH    1 
ATOM   5980  N  N     . ASP E  1 66  ? 1.494   -57.068 80.174  1.00 38.63 ? 65   ASP G N     1 
ATOM   5981  C  CA    . ASP E  1 66  ? 1.780   -57.521 78.818  1.00 38.88 ? 65   ASP G CA    1 
ATOM   5982  C  C     . ASP E  1 66  ? 0.647   -57.200 77.832  1.00 38.64 ? 65   ASP G C     1 
ATOM   5983  O  O     . ASP E  1 66  ? 0.919   -56.766 76.738  1.00 38.39 ? 65   ASP G O     1 
ATOM   5984  C  CB    . ASP E  1 66  ? 2.128   -59.027 78.783  1.00 39.37 ? 65   ASP G CB    1 
ATOM   5985  C  CG    . ASP E  1 66  ? 3.635   -59.325 79.103  1.00 41.46 ? 65   ASP G CG    1 
ATOM   5986  O  OD1   . ASP E  1 66  ? 4.492   -58.400 79.154  1.00 40.86 ? 65   ASP G OD1   1 
ATOM   5987  O  OD2   . ASP E  1 66  ? 3.969   -60.521 79.284  1.00 42.97 ? 65   ASP G OD2   1 
ATOM   5988  N  N     . ARG E  1 67  ? -0.614  -57.381 78.228  1.00 38.90 ? 66   ARG G N     1 
ATOM   5989  C  CA    . ARG E  1 67  ? -1.750  -57.163 77.331  1.00 39.33 ? 66   ARG G CA    1 
ATOM   5990  C  C     . ARG E  1 67  ? -1.976  -55.697 76.957  1.00 38.76 ? 66   ARG G C     1 
ATOM   5991  O  O     . ARG E  1 67  ? -2.585  -55.400 75.934  1.00 38.87 ? 66   ARG G O     1 
ATOM   5992  C  CB    . ARG E  1 67  ? -3.042  -57.734 77.932  1.00 39.69 ? 66   ARG G CB    1 
ATOM   5993  C  CG    . ARG E  1 67  ? -3.591  -57.000 79.175  1.00 40.56 ? 66   ARG G CG    1 
ATOM   5994  C  CD    . ARG E  1 67  ? -4.701  -57.864 79.779  1.00 42.14 ? 66   ARG G CD    1 
ATOM   5995  N  NE    . ARG E  1 67  ? -5.582  -57.211 80.753  1.00 44.02 ? 66   ARG G NE    1 
ATOM   5996  C  CZ    . ARG E  1 67  ? -5.290  -57.015 82.042  1.00 46.83 ? 66   ARG G CZ    1 
ATOM   5997  N  NH1   . ARG E  1 67  ? -4.101  -57.366 82.540  1.00 47.52 ? 66   ARG G NH1   1 
ATOM   5998  N  NH2   . ARG E  1 67  ? -6.191  -56.441 82.842  1.00 46.98 ? 66   ARG G NH2   1 
ATOM   5999  N  N     . LEU E  1 68  ? -1.492  -54.779 77.781  1.00 38.34 ? 67   LEU G N     1 
ATOM   6000  C  CA    . LEU E  1 68  ? -1.669  -53.377 77.515  1.00 37.66 ? 67   LEU G CA    1 
ATOM   6001  C  C     . LEU E  1 68  ? -0.550  -52.828 76.613  1.00 37.95 ? 67   LEU G C     1 
ATOM   6002  O  O     . LEU E  1 68  ? -0.793  -51.958 75.764  1.00 37.12 ? 67   LEU G O     1 
ATOM   6003  C  CB    . LEU E  1 68  ? -1.723  -52.607 78.844  1.00 37.87 ? 67   LEU G CB    1 
ATOM   6004  C  CG    . LEU E  1 68  ? -2.158  -51.148 78.794  1.00 37.04 ? 67   LEU G CG    1 
ATOM   6005  C  CD1   . LEU E  1 68  ? -3.645  -51.045 78.403  1.00 37.16 ? 67   LEU G CD1   1 
ATOM   6006  C  CD2   . LEU E  1 68  ? -1.895  -50.444 80.113  1.00 36.36 ? 67   LEU G CD2   1 
ATOM   6007  N  N     . ARG E  1 69  ? 0.668   -53.330 76.789  1.00 38.07 ? 68   ARG G N     1 
ATOM   6008  C  CA    . ARG E  1 69  ? 1.838   -52.711 76.163  1.00 38.51 ? 68   ARG G CA    1 
ATOM   6009  C  C     . ARG E  1 69  ? 1.721   -52.481 74.658  1.00 39.08 ? 68   ARG G C     1 
ATOM   6010  O  O     . ARG E  1 69  ? 1.921   -51.348 74.193  1.00 39.45 ? 68   ARG G O     1 
ATOM   6011  C  CB    . ARG E  1 69  ? 3.109   -53.494 76.483  1.00 39.41 ? 68   ARG G CB    1 
ATOM   6012  C  CG    . ARG E  1 69  ? 4.393   -52.694 76.249  1.00 39.02 ? 68   ARG G CG    1 
ATOM   6013  C  CD    . ARG E  1 69  ? 5.608   -53.480 76.650  1.00 40.00 ? 68   ARG G CD    1 
ATOM   6014  N  NE    . ARG E  1 69  ? 5.456   -54.002 78.003  1.00 39.98 ? 68   ARG G NE    1 
ATOM   6015  C  CZ    . ARG E  1 69  ? 5.135   -55.247 78.321  1.00 39.52 ? 68   ARG G CZ    1 
ATOM   6016  N  NH1   . ARG E  1 69  ? 4.943   -56.161 77.386  1.00 40.38 ? 68   ARG G NH1   1 
ATOM   6017  N  NH2   . ARG E  1 69  ? 5.029   -55.586 79.607  1.00 41.92 ? 68   ARG G NH2   1 
ATOM   6018  N  N     . PRO E  1 70  ? 1.345   -53.524 73.894  1.00 39.04 ? 69   PRO G N     1 
ATOM   6019  C  CA    . PRO E  1 70  ? 1.368   -53.398 72.440  1.00 39.42 ? 69   PRO G CA    1 
ATOM   6020  C  C     . PRO E  1 70  ? 0.344   -52.426 71.842  1.00 39.18 ? 69   PRO G C     1 
ATOM   6021  O  O     . PRO E  1 70  ? 0.427   -52.131 70.651  1.00 38.81 ? 69   PRO G O     1 
ATOM   6022  C  CB    . PRO E  1 70  ? 1.078   -54.834 71.960  1.00 39.72 ? 69   PRO G CB    1 
ATOM   6023  C  CG    . PRO E  1 70  ? 1.325   -55.718 73.198  1.00 39.87 ? 69   PRO G CG    1 
ATOM   6024  C  CD    . PRO E  1 70  ? 0.880   -54.861 74.304  1.00 39.17 ? 69   PRO G CD    1 
ATOM   6025  N  N     . LEU E  1 71  ? -0.608  -51.951 72.646  1.00 38.98 ? 70   LEU G N     1 
ATOM   6026  C  CA    . LEU E  1 71  ? -1.537  -50.922 72.182  1.00 38.91 ? 70   LEU G CA    1 
ATOM   6027  C  C     . LEU E  1 71  ? -0.818  -49.607 71.902  1.00 38.51 ? 70   LEU G C     1 
ATOM   6028  O  O     . LEU E  1 71  ? -1.382  -48.732 71.242  1.00 38.04 ? 70   LEU G O     1 
ATOM   6029  C  CB    . LEU E  1 71  ? -2.661  -50.697 73.196  1.00 39.37 ? 70   LEU G CB    1 
ATOM   6030  C  CG    . LEU E  1 71  ? -3.626  -51.870 73.454  1.00 40.35 ? 70   LEU G CG    1 
ATOM   6031  C  CD1   . LEU E  1 71  ? -4.807  -51.403 74.299  1.00 40.14 ? 70   LEU G CD1   1 
ATOM   6032  C  CD2   . LEU E  1 71  ? -4.111  -52.470 72.137  1.00 38.51 ? 70   LEU G CD2   1 
ATOM   6033  N  N     . SER E  1 72  ? 0.411   -49.468 72.412  1.00 38.05 ? 71   SER G N     1 
ATOM   6034  C  CA    A SER E  1 72  ? 1.256   -48.304 72.139  0.50 37.84 ? 71   SER G CA    1 
ATOM   6035  C  CA    B SER E  1 72  ? 1.218   -48.287 72.121  0.50 38.37 ? 71   SER G CA    1 
ATOM   6036  C  C     . SER E  1 72  ? 2.014   -48.422 70.808  1.00 38.21 ? 71   SER G C     1 
ATOM   6037  O  O     . SER E  1 72  ? 2.558   -47.437 70.308  1.00 38.10 ? 71   SER G O     1 
ATOM   6038  C  CB    A SER E  1 72  ? 2.273   -48.093 73.275  0.50 37.59 ? 71   SER G CB    1 
ATOM   6039  C  CB    B SER E  1 72  ? 2.151   -47.962 73.301  0.50 38.24 ? 71   SER G CB    1 
ATOM   6040  O  OG    A SER E  1 72  ? 1.647   -47.674 74.474  0.50 35.48 ? 71   SER G OG    1 
ATOM   6041  O  OG    B SER E  1 72  ? 3.114   -48.975 73.500  0.50 39.40 ? 71   SER G OG    1 
ATOM   6042  N  N     . TYR E  1 73  ? 2.066   -49.629 70.234  1.00 38.31 ? 72   TYR G N     1 
ATOM   6043  C  CA    . TYR E  1 73  ? 2.964   -49.891 69.087  1.00 38.41 ? 72   TYR G CA    1 
ATOM   6044  C  C     . TYR E  1 73  ? 2.554   -49.307 67.700  1.00 38.59 ? 72   TYR G C     1 
ATOM   6045  O  O     . TYR E  1 73  ? 3.405   -48.770 66.993  1.00 38.22 ? 72   TYR G O     1 
ATOM   6046  C  CB    . TYR E  1 73  ? 3.308   -51.392 69.004  1.00 38.46 ? 72   TYR G CB    1 
ATOM   6047  C  CG    . TYR E  1 73  ? 4.041   -51.956 70.222  1.00 38.54 ? 72   TYR G CG    1 
ATOM   6048  C  CD1   . TYR E  1 73  ? 4.612   -51.124 71.191  1.00 37.98 ? 72   TYR G CD1   1 
ATOM   6049  C  CD2   . TYR E  1 73  ? 4.188   -53.334 70.391  1.00 39.21 ? 72   TYR G CD2   1 
ATOM   6050  C  CE1   . TYR E  1 73  ? 5.277   -51.639 72.275  1.00 37.76 ? 72   TYR G CE1   1 
ATOM   6051  C  CE2   . TYR E  1 73  ? 4.852   -53.860 71.492  1.00 37.26 ? 72   TYR G CE2   1 
ATOM   6052  C  CZ    . TYR E  1 73  ? 5.394   -53.007 72.426  1.00 38.55 ? 72   TYR G CZ    1 
ATOM   6053  O  OH    . TYR E  1 73  ? 6.067   -53.510 73.518  1.00 37.85 ? 72   TYR G OH    1 
ATOM   6054  N  N     . PRO E  1 74  ? 1.264   -49.379 67.317  1.00 39.05 ? 73   PRO G N     1 
ATOM   6055  C  CA    . PRO E  1 74  ? 0.896   -48.860 65.982  1.00 39.07 ? 73   PRO G CA    1 
ATOM   6056  C  C     . PRO E  1 74  ? 1.393   -47.439 65.684  1.00 39.34 ? 73   PRO G C     1 
ATOM   6057  O  O     . PRO E  1 74  ? 1.195   -46.524 66.493  1.00 39.67 ? 73   PRO G O     1 
ATOM   6058  C  CB    . PRO E  1 74  ? -0.634  -48.932 66.000  1.00 39.11 ? 73   PRO G CB    1 
ATOM   6059  C  CG    . PRO E  1 74  ? -0.925  -50.093 66.908  1.00 38.86 ? 73   PRO G CG    1 
ATOM   6060  C  CD    . PRO E  1 74  ? 0.091   -49.942 68.012  1.00 39.23 ? 73   PRO G CD    1 
ATOM   6061  N  N     . GLN E  1 75  ? 2.048   -47.287 64.529  1.00 39.71 ? 74   GLN G N     1 
ATOM   6062  C  CA    . GLN E  1 75  ? 2.571   -46.011 64.019  1.00 40.36 ? 74   GLN G CA    1 
ATOM   6063  C  C     . GLN E  1 75  ? 3.639   -45.365 64.901  1.00 39.42 ? 74   GLN G C     1 
ATOM   6064  O  O     . GLN E  1 75  ? 3.725   -44.148 64.984  1.00 39.59 ? 74   GLN G O     1 
ATOM   6065  C  CB    . GLN E  1 75  ? 1.450   -44.999 63.767  1.00 41.03 ? 74   GLN G CB    1 
ATOM   6066  C  CG    . GLN E  1 75  ? 0.508   -45.350 62.615  1.00 45.29 ? 74   GLN G CG    1 
ATOM   6067  C  CD    . GLN E  1 75  ? -0.880  -45.673 63.107  1.00 51.23 ? 74   GLN G CD    1 
ATOM   6068  O  OE1   . GLN E  1 75  ? -1.488  -44.870 63.831  1.00 55.59 ? 74   GLN G OE1   1 
ATOM   6069  N  NE2   . GLN E  1 75  ? -1.395  -46.857 62.734  1.00 54.10 ? 74   GLN G NE2   1 
ATOM   6070  N  N     . THR E  1 76  ? 4.454   -46.181 65.553  1.00 38.48 ? 75   THR G N     1 
ATOM   6071  C  CA    . THR E  1 76  ? 5.588   -45.674 66.302  1.00 37.84 ? 75   THR G CA    1 
ATOM   6072  C  C     . THR E  1 76  ? 6.612   -45.150 65.301  1.00 37.69 ? 75   THR G C     1 
ATOM   6073  O  O     . THR E  1 76  ? 6.799   -45.733 64.222  1.00 37.70 ? 75   THR G O     1 
ATOM   6074  C  CB    . THR E  1 76  ? 6.177   -46.758 67.190  1.00 37.70 ? 75   THR G CB    1 
ATOM   6075  O  OG1   . THR E  1 76  ? 5.176   -47.133 68.130  1.00 37.96 ? 75   THR G OG1   1 
ATOM   6076  C  CG2   . THR E  1 76  ? 7.418   -46.266 67.938  1.00 37.17 ? 75   THR G CG2   1 
ATOM   6077  N  N     . ASP E  1 77  ? 7.225   -44.021 65.620  1.00 37.19 ? 76   ASP G N     1 
ATOM   6078  C  CA    . ASP E  1 77  ? 8.307   -43.513 64.784  1.00 37.12 ? 76   ASP G CA    1 
ATOM   6079  C  C     . ASP E  1 77  ? 9.663   -44.077 65.225  1.00 36.55 ? 76   ASP G C     1 
ATOM   6080  O  O     . ASP E  1 77  ? 10.516  -44.360 64.385  1.00 37.15 ? 76   ASP G O     1 
ATOM   6081  C  CB    . ASP E  1 77  ? 8.321   -41.987 64.777  1.00 36.86 ? 76   ASP G CB    1 
ATOM   6082  C  CG    . ASP E  1 77  ? 7.138   -41.405 64.031  1.00 38.49 ? 76   ASP G CG    1 
ATOM   6083  O  OD1   . ASP E  1 77  ? 6.885   -41.813 62.859  1.00 38.20 ? 76   ASP G OD1   1 
ATOM   6084  O  OD2   . ASP E  1 77  ? 6.464   -40.528 64.619  1.00 40.74 ? 76   ASP G OD2   1 
ATOM   6085  N  N     . VAL E  1 78  ? 9.853   -44.264 66.524  1.00 36.56 ? 77   VAL G N     1 
ATOM   6086  C  CA    . VAL E  1 78  ? 11.141  -44.729 67.072  1.00 36.20 ? 77   VAL G CA    1 
ATOM   6087  C  C     . VAL E  1 78  ? 10.927  -45.393 68.443  1.00 36.62 ? 77   VAL G C     1 
ATOM   6088  O  O     . VAL E  1 78  ? 10.114  -44.914 69.236  1.00 35.93 ? 77   VAL G O     1 
ATOM   6089  C  CB    . VAL E  1 78  ? 12.143  -43.542 67.161  1.00 36.30 ? 77   VAL G CB    1 
ATOM   6090  C  CG1   . VAL E  1 78  ? 11.596  -42.421 68.079  1.00 35.53 ? 77   VAL G CG1   1 
ATOM   6091  C  CG2   . VAL E  1 78  ? 13.526  -43.992 67.597  1.00 36.24 ? 77   VAL G CG2   1 
ATOM   6092  N  N     . PHE E  1 79  ? 11.616  -46.521 68.679  1.00 36.65 ? 78   PHE G N     1 
ATOM   6093  C  CA    . PHE E  1 79  ? 11.577  -47.237 69.959  1.00 36.84 ? 78   PHE G CA    1 
ATOM   6094  C  C     . PHE E  1 79  ? 12.889  -47.083 70.726  1.00 37.25 ? 78   PHE G C     1 
ATOM   6095  O  O     . PHE E  1 79  ? 13.965  -47.096 70.123  1.00 37.44 ? 78   PHE G O     1 
ATOM   6096  C  CB    . PHE E  1 79  ? 11.397  -48.737 69.754  1.00 37.11 ? 78   PHE G CB    1 
ATOM   6097  C  CG    . PHE E  1 79  ? 10.018  -49.154 69.351  1.00 36.87 ? 78   PHE G CG    1 
ATOM   6098  C  CD1   . PHE E  1 79  ? 9.692   -49.307 68.011  1.00 37.23 ? 78   PHE G CD1   1 
ATOM   6099  C  CD2   . PHE E  1 79  ? 9.065   -49.463 70.315  1.00 36.81 ? 78   PHE G CD2   1 
ATOM   6100  C  CE1   . PHE E  1 79  ? 8.415   -49.714 67.632  1.00 37.92 ? 78   PHE G CE1   1 
ATOM   6101  C  CE2   . PHE E  1 79  ? 7.797   -49.875 69.957  1.00 37.07 ? 78   PHE G CE2   1 
ATOM   6102  C  CZ    . PHE E  1 79  ? 7.463   -49.996 68.620  1.00 37.85 ? 78   PHE G CZ    1 
ATOM   6103  N  N     . LEU E  1 80  ? 12.792  -46.955 72.051  1.00 37.37 ? 79   LEU G N     1 
ATOM   6104  C  CA    . LEU E  1 80  ? 13.941  -47.131 72.937  1.00 36.87 ? 79   LEU G CA    1 
ATOM   6105  C  C     . LEU E  1 80  ? 13.693  -48.413 73.688  1.00 36.82 ? 79   LEU G C     1 
ATOM   6106  O  O     . LEU E  1 80  ? 12.701  -48.526 74.402  1.00 37.12 ? 79   LEU G O     1 
ATOM   6107  C  CB    . LEU E  1 80  ? 14.085  -45.976 73.934  1.00 37.03 ? 79   LEU G CB    1 
ATOM   6108  C  CG    . LEU E  1 80  ? 13.944  -44.562 73.367  1.00 35.44 ? 79   LEU G CG    1 
ATOM   6109  C  CD1   . LEU E  1 80  ? 14.138  -43.537 74.471  1.00 34.02 ? 79   LEU G CD1   1 
ATOM   6110  C  CD2   . LEU E  1 80  ? 14.919  -44.348 72.231  1.00 35.91 ? 79   LEU G CD2   1 
ATOM   6111  N  N     . ILE E  1 81  ? 14.563  -49.396 73.481  1.00 36.66 ? 80   ILE G N     1 
ATOM   6112  C  CA    . ILE E  1 81  ? 14.574  -50.597 74.292  1.00 36.36 ? 80   ILE G CA    1 
ATOM   6113  C  C     . ILE E  1 81  ? 15.613  -50.330 75.338  1.00 36.34 ? 80   ILE G C     1 
ATOM   6114  O  O     . ILE E  1 81  ? 16.781  -50.113 75.004  1.00 36.61 ? 80   ILE G O     1 
ATOM   6115  C  CB    . ILE E  1 81  ? 14.945  -51.864 73.479  1.00 36.04 ? 80   ILE G CB    1 
ATOM   6116  C  CG1   . ILE E  1 81  ? 13.953  -52.062 72.331  1.00 36.30 ? 80   ILE G CG1   1 
ATOM   6117  C  CG2   . ILE E  1 81  ? 14.958  -53.117 74.388  1.00 36.05 ? 80   ILE G CG2   1 
ATOM   6118  C  CD1   . ILE E  1 81  ? 14.129  -53.369 71.554  1.00 35.61 ? 80   ILE G CD1   1 
ATOM   6119  N  N     . CYS E  1 82  ? 15.197  -50.338 76.603  1.00 36.73 ? 81   CYS G N     1 
ATOM   6120  C  CA    . CYS E  1 82  ? 16.102  -50.022 77.724  1.00 37.07 ? 81   CYS G CA    1 
ATOM   6121  C  C     . CYS E  1 82  ? 16.453  -51.242 78.555  1.00 36.69 ? 81   CYS G C     1 
ATOM   6122  O  O     . CYS E  1 82  ? 15.635  -52.146 78.733  1.00 35.84 ? 81   CYS G O     1 
ATOM   6123  C  CB    . CYS E  1 82  ? 15.476  -48.968 78.641  1.00 37.21 ? 81   CYS G CB    1 
ATOM   6124  S  SG    . CYS E  1 82  ? 14.879  -47.493 77.753  1.00 40.39 ? 81   CYS G SG    1 
ATOM   6125  N  N     . PHE E  1 83  ? 17.684  -51.243 79.066  1.00 36.58 ? 82   PHE G N     1 
ATOM   6126  C  CA    . PHE E  1 83  ? 18.126  -52.193 80.077  1.00 36.18 ? 82   PHE G CA    1 
ATOM   6127  C  C     . PHE E  1 83  ? 19.046  -51.462 81.042  1.00 35.95 ? 82   PHE G C     1 
ATOM   6128  O  O     . PHE E  1 83  ? 19.665  -50.472 80.671  1.00 35.94 ? 82   PHE G O     1 
ATOM   6129  C  CB    . PHE E  1 83  ? 18.832  -53.411 79.433  1.00 35.98 ? 82   PHE G CB    1 
ATOM   6130  C  CG    . PHE E  1 83  ? 20.191  -53.113 78.914  1.00 35.63 ? 82   PHE G CG    1 
ATOM   6131  C  CD1   . PHE E  1 83  ? 20.370  -52.631 77.630  1.00 36.58 ? 82   PHE G CD1   1 
ATOM   6132  C  CD2   . PHE E  1 83  ? 21.294  -53.269 79.721  1.00 35.54 ? 82   PHE G CD2   1 
ATOM   6133  C  CE1   . PHE E  1 83  ? 21.628  -52.317 77.162  1.00 35.73 ? 82   PHE G CE1   1 
ATOM   6134  C  CE2   . PHE E  1 83  ? 22.543  -52.983 79.256  1.00 35.81 ? 82   PHE G CE2   1 
ATOM   6135  C  CZ    . PHE E  1 83  ? 22.713  -52.497 77.973  1.00 36.72 ? 82   PHE G CZ    1 
ATOM   6136  N  N     . SER E  1 84  ? 19.120  -51.957 82.277  1.00 36.26 ? 83   SER G N     1 
ATOM   6137  C  CA    . SER E  1 84  ? 20.077  -51.454 83.269  1.00 36.05 ? 83   SER G CA    1 
ATOM   6138  C  C     . SER E  1 84  ? 21.490  -52.042 83.079  1.00 35.99 ? 83   SER G C     1 
ATOM   6139  O  O     . SER E  1 84  ? 21.693  -53.258 83.041  1.00 35.90 ? 83   SER G O     1 
ATOM   6140  C  CB    . SER E  1 84  ? 19.571  -51.738 84.687  1.00 36.10 ? 83   SER G CB    1 
ATOM   6141  O  OG    . SER E  1 84  ? 20.503  -51.309 85.653  1.00 35.80 ? 83   SER G OG    1 
ATOM   6142  N  N     . LEU E  1 85  ? 22.469  -51.154 82.994  1.00 35.99 ? 84   LEU G N     1 
ATOM   6143  C  CA    . LEU E  1 85  ? 23.877  -51.552 82.909  1.00 35.71 ? 84   LEU G CA    1 
ATOM   6144  C  C     . LEU E  1 85  ? 24.366  -52.369 84.117  1.00 35.65 ? 84   LEU G C     1 
ATOM   6145  O  O     . LEU E  1 85  ? 25.417  -53.006 84.041  1.00 35.44 ? 84   LEU G O     1 
ATOM   6146  C  CB    . LEU E  1 85  ? 24.749  -50.306 82.714  1.00 35.43 ? 84   LEU G CB    1 
ATOM   6147  C  CG    . LEU E  1 85  ? 24.584  -49.632 81.348  1.00 34.72 ? 84   LEU G CG    1 
ATOM   6148  C  CD1   . LEU E  1 85  ? 25.089  -48.200 81.370  1.00 32.48 ? 84   LEU G CD1   1 
ATOM   6149  C  CD2   . LEU E  1 85  ? 25.306  -50.470 80.280  1.00 33.74 ? 84   LEU G CD2   1 
ATOM   6150  N  N     . VAL E  1 86  ? 23.594  -52.378 85.211  1.00 35.81 ? 85   VAL G N     1 
ATOM   6151  C  CA    . VAL E  1 86  ? 23.923  -53.192 86.400  1.00 35.60 ? 85   VAL G CA    1 
ATOM   6152  C  C     . VAL E  1 86  ? 22.915  -54.323 86.700  1.00 35.93 ? 85   VAL G C     1 
ATOM   6153  O  O     . VAL E  1 86  ? 22.897  -54.894 87.798  1.00 36.24 ? 85   VAL G O     1 
ATOM   6154  C  CB    . VAL E  1 86  ? 24.183  -52.295 87.640  1.00 35.64 ? 85   VAL G CB    1 
ATOM   6155  C  CG1   . VAL E  1 86  ? 25.478  -51.521 87.428  1.00 34.81 ? 85   VAL G CG1   1 
ATOM   6156  C  CG2   . VAL E  1 86  ? 23.013  -51.342 87.916  1.00 34.23 ? 85   VAL G CG2   1 
ATOM   6157  N  N     . SER E  1 87  ? 22.127  -54.675 85.689  1.00 36.62 ? 86   SER G N     1 
ATOM   6158  C  CA    . SER E  1 87  ? 21.270  -55.860 85.701  1.00 36.77 ? 86   SER G CA    1 
ATOM   6159  C  C     . SER E  1 87  ? 21.550  -56.679 84.424  1.00 37.47 ? 86   SER G C     1 
ATOM   6160  O  O     . SER E  1 87  ? 21.011  -56.398 83.347  1.00 37.90 ? 86   SER G O     1 
ATOM   6161  C  CB    . SER E  1 87  ? 19.793  -55.447 85.770  1.00 36.97 ? 86   SER G CB    1 
ATOM   6162  O  OG    . SER E  1 87  ? 18.918  -56.560 85.733  1.00 36.24 ? 86   SER G OG    1 
ATOM   6163  N  N     . PRO E  1 88  ? 22.450  -57.657 84.523  1.00 37.66 ? 87   PRO G N     1 
ATOM   6164  C  CA    . PRO E  1 88  ? 22.603  -58.621 83.438  1.00 37.76 ? 87   PRO G CA    1 
ATOM   6165  C  C     . PRO E  1 88  ? 21.295  -59.281 82.962  1.00 37.92 ? 87   PRO G C     1 
ATOM   6166  O  O     . PRO E  1 88  ? 21.163  -59.567 81.771  1.00 38.62 ? 87   PRO G O     1 
ATOM   6167  C  CB    . PRO E  1 88  ? 23.552  -59.653 84.041  1.00 38.10 ? 87   PRO G CB    1 
ATOM   6168  C  CG    . PRO E  1 88  ? 24.384  -58.844 85.042  1.00 37.34 ? 87   PRO G CG    1 
ATOM   6169  C  CD    . PRO E  1 88  ? 23.426  -57.875 85.612  1.00 37.41 ? 87   PRO G CD    1 
ATOM   6170  N  N     . ALA E  1 89  ? 20.347  -59.533 83.865  1.00 37.86 ? 88   ALA G N     1 
ATOM   6171  C  CA    . ALA E  1 89  ? 19.072  -60.167 83.473  1.00 37.43 ? 88   ALA G CA    1 
ATOM   6172  C  C     . ALA E  1 89  ? 18.243  -59.265 82.563  1.00 37.29 ? 88   ALA G C     1 
ATOM   6173  O  O     . ALA E  1 89  ? 17.659  -59.733 81.581  1.00 37.73 ? 88   ALA G O     1 
ATOM   6174  C  CB    . ALA E  1 89  ? 18.270  -60.592 84.700  1.00 37.18 ? 88   ALA G CB    1 
ATOM   6175  N  N     . SER E  1 90  ? 18.199  -57.972 82.860  1.00 37.10 ? 89   SER G N     1 
ATOM   6176  C  CA    . SER E  1 90  ? 17.460  -57.019 82.007  1.00 36.86 ? 89   SER G CA    1 
ATOM   6177  C  C     . SER E  1 90  ? 18.035  -56.973 80.584  1.00 36.93 ? 89   SER G C     1 
ATOM   6178  O  O     . SER E  1 90  ? 17.285  -56.866 79.592  1.00 36.70 ? 89   SER G O     1 
ATOM   6179  C  CB    . SER E  1 90  ? 17.440  -55.613 82.631  1.00 36.62 ? 89   SER G CB    1 
ATOM   6180  O  OG    . SER E  1 90  ? 18.700  -54.979 82.494  1.00 35.92 ? 89   SER G OG    1 
ATOM   6181  N  N     . PHE E  1 91  ? 19.364  -57.036 80.520  1.00 37.00 ? 90   PHE G N     1 
ATOM   6182  C  CA    . PHE E  1 91  ? 20.143  -57.102 79.284  1.00 37.34 ? 90   PHE G CA    1 
ATOM   6183  C  C     . PHE E  1 91  ? 19.810  -58.366 78.500  1.00 37.81 ? 90   PHE G C     1 
ATOM   6184  O  O     . PHE E  1 91  ? 19.529  -58.294 77.305  1.00 37.37 ? 90   PHE G O     1 
ATOM   6185  C  CB    . PHE E  1 91  ? 21.639  -57.091 79.625  1.00 37.51 ? 90   PHE G CB    1 
ATOM   6186  C  CG    . PHE E  1 91  ? 22.548  -56.974 78.437  1.00 36.67 ? 90   PHE G CG    1 
ATOM   6187  C  CD1   . PHE E  1 91  ? 22.438  -55.900 77.554  1.00 38.18 ? 90   PHE G CD1   1 
ATOM   6188  C  CD2   . PHE E  1 91  ? 23.546  -57.912 78.222  1.00 37.67 ? 90   PHE G CD2   1 
ATOM   6189  C  CE1   . PHE E  1 91  ? 23.281  -55.786 76.455  1.00 36.88 ? 90   PHE G CE1   1 
ATOM   6190  C  CE2   . PHE E  1 91  ? 24.408  -57.798 77.131  1.00 37.67 ? 90   PHE G CE2   1 
ATOM   6191  C  CZ    . PHE E  1 91  ? 24.276  -56.738 76.254  1.00 37.89 ? 90   PHE G CZ    1 
ATOM   6192  N  N     . GLU E  1 92  ? 19.829  -59.516 79.180  1.00 38.35 ? 91   GLU G N     1 
ATOM   6193  C  CA    . GLU E  1 92  ? 19.410  -60.787 78.553  1.00 38.80 ? 91   GLU G CA    1 
ATOM   6194  C  C     . GLU E  1 92  ? 18.024  -60.663 77.933  1.00 38.66 ? 91   GLU G C     1 
ATOM   6195  O  O     . GLU E  1 92  ? 17.774  -61.220 76.868  1.00 38.18 ? 91   GLU G O     1 
ATOM   6196  C  CB    . GLU E  1 92  ? 19.395  -61.941 79.558  1.00 39.02 ? 91   GLU G CB    1 
ATOM   6197  C  CG    . GLU E  1 92  ? 20.643  -62.804 79.531  1.00 41.08 ? 91   GLU G CG    1 
ATOM   6198  N  N     . ASN E  1 93  ? 17.143  -59.921 78.606  1.00 38.51 ? 92   ASN G N     1 
ATOM   6199  C  CA    . ASN E  1 93  ? 15.747  -59.774 78.173  1.00 38.68 ? 92   ASN G CA    1 
ATOM   6200  C  C     . ASN E  1 93  ? 15.541  -58.910 76.947  1.00 38.48 ? 92   ASN G C     1 
ATOM   6201  O  O     . ASN E  1 93  ? 14.491  -59.017 76.305  1.00 38.20 ? 92   ASN G O     1 
ATOM   6202  C  CB    . ASN E  1 93  ? 14.853  -59.293 79.329  1.00 38.47 ? 92   ASN G CB    1 
ATOM   6203  C  CG    . ASN E  1 93  ? 14.408  -60.434 80.212  1.00 40.03 ? 92   ASN G CG    1 
ATOM   6204  O  OD1   . ASN E  1 93  ? 14.260  -61.562 79.732  1.00 41.28 ? 92   ASN G OD1   1 
ATOM   6205  N  ND2   . ASN E  1 93  ? 14.221  -60.168 81.506  1.00 40.13 ? 92   ASN G ND2   1 
ATOM   6206  N  N     . VAL E  1 94  ? 16.521  -58.061 76.620  1.00 38.09 ? 93   VAL G N     1 
ATOM   6207  C  CA    . VAL E  1 94  ? 16.497  -57.360 75.335  1.00 38.11 ? 93   VAL G CA    1 
ATOM   6208  C  C     . VAL E  1 94  ? 16.368  -58.377 74.216  1.00 38.65 ? 93   VAL G C     1 
ATOM   6209  O  O     . VAL E  1 94  ? 15.566  -58.210 73.316  1.00 39.16 ? 93   VAL G O     1 
ATOM   6210  C  CB    . VAL E  1 94  ? 17.765  -56.519 75.094  1.00 38.52 ? 93   VAL G CB    1 
ATOM   6211  C  CG1   . VAL E  1 94  ? 17.754  -55.905 73.665  1.00 36.24 ? 93   VAL G CG1   1 
ATOM   6212  C  CG2   . VAL E  1 94  ? 17.892  -55.422 76.163  1.00 37.49 ? 93   VAL G CG2   1 
ATOM   6213  N  N     . ARG E  1 95  ? 17.154  -59.446 74.319  1.00 39.35 ? 94   ARG G N     1 
ATOM   6214  C  CA    . ARG E  1 95  ? 17.201  -60.509 73.334  1.00 40.17 ? 94   ARG G CA    1 
ATOM   6215  C  C     . ARG E  1 95  ? 15.992  -61.420 73.476  1.00 39.70 ? 94   ARG G C     1 
ATOM   6216  O  O     . ARG E  1 95  ? 15.358  -61.748 72.495  1.00 39.26 ? 94   ARG G O     1 
ATOM   6217  C  CB    . ARG E  1 95  ? 18.493  -61.313 73.518  1.00 40.22 ? 94   ARG G CB    1 
ATOM   6218  C  CG    . ARG E  1 95  ? 18.675  -62.476 72.557  1.00 42.53 ? 94   ARG G CG    1 
ATOM   6219  C  CD    . ARG E  1 95  ? 19.855  -63.370 72.970  1.00 42.24 ? 94   ARG G CD    1 
ATOM   6220  N  NE    . ARG E  1 95  ? 21.145  -62.723 72.704  1.00 43.38 ? 94   ARG G NE    1 
ATOM   6221  C  CZ    . ARG E  1 95  ? 22.104  -62.527 73.606  1.00 44.83 ? 94   ARG G CZ    1 
ATOM   6222  N  NH1   . ARG E  1 95  ? 21.984  -62.952 74.864  1.00 45.10 ? 94   ARG G NH1   1 
ATOM   6223  N  NH2   . ARG E  1 95  ? 23.217  -61.921 73.231  1.00 44.84 ? 94   ARG G NH2   1 
ATOM   6224  N  N     . ALA E  1 96  ? 15.671  -61.808 74.712  1.00 39.75 ? 95   ALA G N     1 
ATOM   6225  C  CA    . ALA E  1 96  ? 14.641  -62.820 74.963  1.00 39.40 ? 95   ALA G CA    1 
ATOM   6226  C  C     . ALA E  1 96  ? 13.203  -62.301 74.851  1.00 39.15 ? 95   ALA G C     1 
ATOM   6227  O  O     . ALA E  1 96  ? 12.303  -63.064 74.475  1.00 39.20 ? 95   ALA G O     1 
ATOM   6228  C  CB    . ALA E  1 96  ? 14.861  -63.469 76.335  1.00 39.31 ? 95   ALA G CB    1 
ATOM   6229  N  N     . LYS E  1 97  ? 12.981  -61.028 75.189  1.00 38.46 ? 96   LYS G N     1 
ATOM   6230  C  CA    . LYS E  1 97  ? 11.619  -60.485 75.257  1.00 38.24 ? 96   LYS G CA    1 
ATOM   6231  C  C     . LYS E  1 97  ? 11.399  -59.227 74.412  1.00 37.63 ? 96   LYS G C     1 
ATOM   6232  O  O     . LYS E  1 97  ? 10.463  -59.182 73.641  1.00 37.13 ? 96   LYS G O     1 
ATOM   6233  C  CB    . LYS E  1 97  ? 11.201  -60.221 76.710  1.00 37.96 ? 96   LYS G CB    1 
ATOM   6234  C  CG    . LYS E  1 97  ? 9.845   -59.523 76.837  1.00 38.46 ? 96   LYS G CG    1 
ATOM   6235  C  CD    . LYS E  1 97  ? 9.255   -59.608 78.214  1.00 38.98 ? 96   LYS G CD    1 
ATOM   6236  C  CE    . LYS E  1 97  ? 7.770   -59.241 78.197  1.00 39.35 ? 96   LYS G CE    1 
ATOM   6237  N  NZ    . LYS E  1 97  ? 7.165   -59.319 79.544  1.00 38.64 ? 96   LYS G NZ    1 
ATOM   6238  N  N     . TRP E  1 98  ? 12.248  -58.213 74.544  1.00 37.63 ? 97   TRP G N     1 
ATOM   6239  C  CA    . TRP E  1 98  ? 11.911  -56.893 73.975  1.00 37.61 ? 97   TRP G CA    1 
ATOM   6240  C  C     . TRP E  1 98  ? 12.063  -56.798 72.476  1.00 38.00 ? 97   TRP G C     1 
ATOM   6241  O  O     . TRP E  1 98  ? 11.166  -56.295 71.807  1.00 37.71 ? 97   TRP G O     1 
ATOM   6242  C  CB    . TRP E  1 98  ? 12.650  -55.773 74.703  1.00 37.70 ? 97   TRP G CB    1 
ATOM   6243  C  CG    . TRP E  1 98  ? 12.298  -55.852 76.139  1.00 37.69 ? 97   TRP G CG    1 
ATOM   6244  C  CD1   . TRP E  1 98  ? 13.118  -56.194 77.165  1.00 38.06 ? 97   TRP G CD1   1 
ATOM   6245  C  CD2   . TRP E  1 98  ? 10.994  -55.709 76.691  1.00 37.99 ? 97   TRP G CD2   1 
ATOM   6246  N  NE1   . TRP E  1 98  ? 12.417  -56.216 78.341  1.00 37.92 ? 97   TRP G NE1   1 
ATOM   6247  C  CE2   . TRP E  1 98  ? 11.102  -55.930 78.075  1.00 38.67 ? 97   TRP G CE2   1 
ATOM   6248  C  CE3   . TRP E  1 98  ? 9.740   -55.399 76.151  1.00 37.93 ? 97   TRP G CE3   1 
ATOM   6249  C  CZ2   . TRP E  1 98  ? 10.006  -55.862 78.926  1.00 36.91 ? 97   TRP G CZ2   1 
ATOM   6250  C  CZ3   . TRP E  1 98  ? 8.661   -55.317 76.993  1.00 37.87 ? 97   TRP G CZ3   1 
ATOM   6251  C  CH2   . TRP E  1 98  ? 8.798   -55.547 78.369  1.00 38.31 ? 97   TRP G CH2   1 
ATOM   6252  N  N     . TYR E  1 99  ? 13.177  -57.301 71.953  1.00 38.30 ? 98   TYR G N     1 
ATOM   6253  C  CA    . TYR E  1 99  ? 13.398  -57.321 70.503  1.00 38.60 ? 98   TYR G CA    1 
ATOM   6254  C  C     . TYR E  1 99  ? 12.343  -58.183 69.804  1.00 38.21 ? 98   TYR G C     1 
ATOM   6255  O  O     . TYR E  1 99  ? 11.695  -57.717 68.869  1.00 37.71 ? 98   TYR G O     1 
ATOM   6256  C  CB    . TYR E  1 99  ? 14.824  -57.775 70.163  1.00 39.03 ? 98   TYR G CB    1 
ATOM   6257  C  CG    . TYR E  1 99  ? 15.021  -58.206 68.733  1.00 39.50 ? 98   TYR G CG    1 
ATOM   6258  C  CD1   . TYR E  1 99  ? 15.136  -57.270 67.709  1.00 41.01 ? 98   TYR G CD1   1 
ATOM   6259  C  CD2   . TYR E  1 99  ? 15.098  -59.549 68.400  1.00 41.24 ? 98   TYR G CD2   1 
ATOM   6260  C  CE1   . TYR E  1 99  ? 15.335  -57.667 66.384  1.00 40.88 ? 98   TYR G CE1   1 
ATOM   6261  C  CE2   . TYR E  1 99  ? 15.275  -59.957 67.082  1.00 42.26 ? 98   TYR G CE2   1 
ATOM   6262  C  CZ    . TYR E  1 99  ? 15.402  -59.004 66.075  1.00 41.21 ? 98   TYR G CZ    1 
ATOM   6263  O  OH    . TYR E  1 99  ? 15.593  -59.406 64.763  1.00 41.43 ? 98   TYR G OH    1 
ATOM   6264  N  N     . PRO E  1 100 ? 12.146  -59.433 70.260  1.00 38.11 ? 99   PRO G N     1 
ATOM   6265  C  CA    . PRO E  1 100 ? 11.102  -60.180 69.583  1.00 38.43 ? 99   PRO G CA    1 
ATOM   6266  C  C     . PRO E  1 100 ? 9.742   -59.492 69.715  1.00 38.29 ? 99   PRO G C     1 
ATOM   6267  O  O     . PRO E  1 100 ? 9.001   -59.423 68.736  1.00 38.45 ? 99   PRO G O     1 
ATOM   6268  C  CB    . PRO E  1 100 ? 11.125  -61.553 70.273  1.00 38.38 ? 99   PRO G CB    1 
ATOM   6269  C  CG    . PRO E  1 100 ? 12.404  -61.630 70.980  1.00 38.22 ? 99   PRO G CG    1 
ATOM   6270  C  CD    . PRO E  1 100 ? 12.799  -60.228 71.310  1.00 38.11 ? 99   PRO G CD    1 
ATOM   6271  N  N     . GLU E  1 101 ? 9.423   -58.957 70.886  1.00 38.46 ? 100  GLU G N     1 
ATOM   6272  C  CA    . GLU E  1 101 ? 8.090   -58.353 71.070  1.00 38.93 ? 100  GLU G CA    1 
ATOM   6273  C  C     . GLU E  1 101 ? 7.845   -57.139 70.153  1.00 38.88 ? 100  GLU G C     1 
ATOM   6274  O  O     . GLU E  1 101 ? 6.828   -57.084 69.464  1.00 38.71 ? 100  GLU G O     1 
ATOM   6275  C  CB    . GLU E  1 101 ? 7.797   -57.978 72.532  1.00 39.14 ? 100  GLU G CB    1 
ATOM   6276  C  CG    . GLU E  1 101 ? 6.444   -57.250 72.659  1.00 39.78 ? 100  GLU G CG    1 
ATOM   6277  C  CD    . GLU E  1 101 ? 5.903   -57.088 74.062  1.00 39.62 ? 100  GLU G CD    1 
ATOM   6278  O  OE1   . GLU E  1 101 ? 5.882   -58.081 74.831  1.00 41.01 ? 100  GLU G OE1   1 
ATOM   6279  O  OE2   . GLU E  1 101 ? 5.452   -55.957 74.367  1.00 37.50 ? 100  GLU G OE2   1 
ATOM   6280  N  N     . VAL E  1 102 ? 8.765   -56.171 70.164  1.00 38.92 ? 101  VAL G N     1 
ATOM   6281  C  CA    . VAL E  1 102 ? 8.640   -54.967 69.332  1.00 38.67 ? 101  VAL G CA    1 
ATOM   6282  C  C     . VAL E  1 102 ? 8.611   -55.384 67.850  1.00 39.37 ? 101  VAL G C     1 
ATOM   6283  O  O     . VAL E  1 102 ? 7.788   -54.894 67.059  1.00 38.87 ? 101  VAL G O     1 
ATOM   6284  C  CB    . VAL E  1 102 ? 9.798   -53.962 69.612  1.00 38.40 ? 101  VAL G CB    1 
ATOM   6285  C  CG1   . VAL E  1 102 ? 9.901   -52.877 68.541  1.00 37.41 ? 101  VAL G CG1   1 
ATOM   6286  C  CG2   . VAL E  1 102 ? 9.632   -53.333 70.981  1.00 38.39 ? 101  VAL G CG2   1 
ATOM   6287  N  N     . ARG E  1 103 ? 9.490   -56.316 67.480  1.00 39.51 ? 102  ARG G N     1 
ATOM   6288  C  CA    . ARG E  1 103 ? 9.642   -56.675 66.083  1.00 39.67 ? 102  ARG G CA    1 
ATOM   6289  C  C     . ARG E  1 103 ? 8.454   -57.444 65.509  1.00 39.93 ? 102  ARG G C     1 
ATOM   6290  O  O     . ARG E  1 103 ? 8.163   -57.331 64.308  1.00 39.54 ? 102  ARG G O     1 
ATOM   6291  C  CB    . ARG E  1 103 ? 10.979  -57.380 65.842  1.00 39.63 ? 102  ARG G CB    1 
ATOM   6292  C  CG    . ARG E  1 103 ? 12.135  -56.382 65.775  1.00 40.61 ? 102  ARG G CG    1 
ATOM   6293  C  CD    . ARG E  1 103 ? 12.105  -55.605 64.452  1.00 41.97 ? 102  ARG G CD    1 
ATOM   6294  N  NE    . ARG E  1 103 ? 13.199  -54.645 64.323  1.00 42.19 ? 102  ARG G NE    1 
ATOM   6295  C  CZ    . ARG E  1 103 ? 13.067  -53.315 64.314  1.00 42.57 ? 102  ARG G CZ    1 
ATOM   6296  N  NH1   . ARG E  1 103 ? 11.880  -52.739 64.445  1.00 41.45 ? 102  ARG G NH1   1 
ATOM   6297  N  NH2   . ARG E  1 103 ? 14.152  -52.553 64.181  1.00 42.76 ? 102  ARG G NH2   1 
ATOM   6298  N  N     . HIS E  1 104 ? 7.763   -58.196 66.368  1.00 40.12 ? 103  HIS G N     1 
ATOM   6299  C  CA    . HIS E  1 104 ? 6.486   -58.839 66.007  1.00 40.05 ? 103  HIS G CA    1 
ATOM   6300  C  C     . HIS E  1 104 ? 5.438   -57.838 65.546  1.00 39.65 ? 103  HIS G C     1 
ATOM   6301  O  O     . HIS E  1 104 ? 4.585   -58.152 64.723  1.00 38.73 ? 103  HIS G O     1 
ATOM   6302  C  CB    . HIS E  1 104 ? 5.906   -59.614 67.195  1.00 40.30 ? 103  HIS G CB    1 
ATOM   6303  C  CG    . HIS E  1 104 ? 4.617   -60.316 66.888  1.00 42.15 ? 103  HIS G CG    1 
ATOM   6304  N  ND1   . HIS E  1 104 ? 4.566   -61.508 66.197  1.00 43.50 ? 103  HIS G ND1   1 
ATOM   6305  C  CD2   . HIS E  1 104 ? 3.330   -59.988 67.167  1.00 42.92 ? 103  HIS G CD2   1 
ATOM   6306  C  CE1   . HIS E  1 104 ? 3.305   -61.883 66.066  1.00 44.12 ? 103  HIS G CE1   1 
ATOM   6307  N  NE2   . HIS E  1 104 ? 2.537   -60.977 66.644  1.00 43.83 ? 103  HIS G NE2   1 
ATOM   6308  N  N     . HIS E  1 105 ? 5.480   -56.642 66.116  1.00 39.39 ? 104  HIS G N     1 
ATOM   6309  C  CA    . HIS E  1 105 ? 4.470   -55.636 65.823  1.00 39.73 ? 104  HIS G CA    1 
ATOM   6310  C  C     . HIS E  1 105 ? 4.957   -54.622 64.793  1.00 39.26 ? 104  HIS G C     1 
ATOM   6311  O  O     . HIS E  1 105 ? 4.197   -54.169 63.936  1.00 39.42 ? 104  HIS G O     1 
ATOM   6312  C  CB    . HIS E  1 105 ? 4.032   -54.951 67.120  1.00 39.65 ? 104  HIS G CB    1 
ATOM   6313  C  CG    . HIS E  1 105 ? 3.206   -55.827 68.006  1.00 40.61 ? 104  HIS G CG    1 
ATOM   6314  N  ND1   . HIS E  1 105 ? 3.754   -56.615 68.999  1.00 42.88 ? 104  HIS G ND1   1 
ATOM   6315  C  CD2   . HIS E  1 105 ? 1.872   -56.059 68.037  1.00 41.66 ? 104  HIS G CD2   1 
ATOM   6316  C  CE1   . HIS E  1 105 ? 2.790   -57.287 69.609  1.00 41.68 ? 104  HIS G CE1   1 
ATOM   6317  N  NE2   . HIS E  1 105 ? 1.639   -56.967 69.046  1.00 41.37 ? 104  HIS G NE2   1 
ATOM   6318  N  N     . CYS E  1 106 ? 6.233   -54.289 64.879  1.00 38.98 ? 105  CYS G N     1 
ATOM   6319  C  CA    . CYS E  1 106 ? 6.844   -53.278 64.031  1.00 38.89 ? 105  CYS G CA    1 
ATOM   6320  C  C     . CYS E  1 106 ? 8.127   -53.860 63.455  1.00 38.20 ? 105  CYS G C     1 
ATOM   6321  O  O     . CYS E  1 106 ? 9.166   -53.771 64.087  1.00 37.94 ? 105  CYS G O     1 
ATOM   6322  C  CB    . CYS E  1 106 ? 7.148   -52.040 64.866  1.00 38.96 ? 105  CYS G CB    1 
ATOM   6323  S  SG    . CYS E  1 106 ? 5.709   -51.327 65.717  1.00 40.41 ? 105  CYS G SG    1 
ATOM   6324  N  N     . PRO E  1 107 ? 8.034   -54.531 62.289  1.00 37.96 ? 106  PRO G N     1 
ATOM   6325  C  CA    . PRO E  1 107 ? 9.190   -55.225 61.714  1.00 37.72 ? 106  PRO G CA    1 
ATOM   6326  C  C     . PRO E  1 107 ? 10.486  -54.444 61.431  1.00 37.58 ? 106  PRO G C     1 
ATOM   6327  O  O     . PRO E  1 107 ? 11.543  -55.073 61.438  1.00 37.64 ? 106  PRO G O     1 
ATOM   6328  C  CB    . PRO E  1 107 ? 8.617   -55.858 60.437  1.00 37.65 ? 106  PRO G CB    1 
ATOM   6329  C  CG    . PRO E  1 107 ? 7.196   -56.079 60.757  1.00 37.73 ? 106  PRO G CG    1 
ATOM   6330  C  CD    . PRO E  1 107 ? 6.812   -54.823 61.509  1.00 37.80 ? 106  PRO G CD    1 
ATOM   6331  N  N     . HIS E  1 108 ? 10.430  -53.133 61.196  1.00 37.16 ? 107  HIS G N     1 
ATOM   6332  C  CA    . HIS E  1 108 ? 11.644  -52.339 60.875  1.00 36.71 ? 107  HIS G CA    1 
ATOM   6333  C  C     . HIS E  1 108 ? 11.695  -50.928 61.466  1.00 36.46 ? 107  HIS G C     1 
ATOM   6334  O  O     . HIS E  1 108 ? 12.608  -50.162 61.179  1.00 36.26 ? 107  HIS G O     1 
ATOM   6335  C  CB    . HIS E  1 108 ? 11.827  -52.233 59.355  1.00 36.47 ? 107  HIS G CB    1 
ATOM   6336  C  CG    . HIS E  1 108 ? 11.891  -53.562 58.669  1.00 35.84 ? 107  HIS G CG    1 
ATOM   6337  N  ND1   . HIS E  1 108 ? 12.962  -54.422 58.812  1.00 36.13 ? 107  HIS G ND1   1 
ATOM   6338  C  CD2   . HIS E  1 108 ? 11.003  -54.195 57.867  1.00 35.04 ? 107  HIS G CD2   1 
ATOM   6339  C  CE1   . HIS E  1 108 ? 12.735  -55.522 58.113  1.00 36.55 ? 107  HIS G CE1   1 
ATOM   6340  N  NE2   . HIS E  1 108 ? 11.550  -55.414 57.538  1.00 36.15 ? 107  HIS G NE2   1 
ATOM   6341  N  N     . THR E  1 109 ? 10.731  -50.577 62.294  1.00 36.61 ? 108  THR G N     1 
ATOM   6342  C  CA    . THR E  1 109 ? 10.730  -49.265 62.930  1.00 36.75 ? 108  THR G CA    1 
ATOM   6343  C  C     . THR E  1 109 ? 12.062  -49.122 63.669  1.00 36.86 ? 108  THR G C     1 
ATOM   6344  O  O     . THR E  1 109 ? 12.504  -50.068 64.336  1.00 36.65 ? 108  THR G O     1 
ATOM   6345  C  CB    . THR E  1 109 ? 9.561   -49.147 63.906  1.00 36.68 ? 108  THR G CB    1 
ATOM   6346  O  OG1   . THR E  1 109 ? 8.360   -49.392 63.179  1.00 37.01 ? 108  THR G OG1   1 
ATOM   6347  C  CG2   . THR E  1 109 ? 9.496   -47.741 64.603  1.00 36.83 ? 108  THR G CG2   1 
ATOM   6348  N  N     . PRO E  1 110 ? 12.722  -47.960 63.517  1.00 36.79 ? 109  PRO G N     1 
ATOM   6349  C  CA    . PRO E  1 110 ? 14.009  -47.757 64.190  1.00 37.01 ? 109  PRO G CA    1 
ATOM   6350  C  C     . PRO E  1 110 ? 13.968  -48.031 65.705  1.00 36.98 ? 109  PRO G C     1 
ATOM   6351  O  O     . PRO E  1 110 ? 13.029  -47.611 66.409  1.00 36.77 ? 109  PRO G O     1 
ATOM   6352  C  CB    . PRO E  1 110 ? 14.354  -46.296 63.902  1.00 36.83 ? 109  PRO G CB    1 
ATOM   6353  C  CG    . PRO E  1 110 ? 13.264  -45.757 63.075  1.00 37.14 ? 109  PRO G CG    1 
ATOM   6354  C  CD    . PRO E  1 110 ? 12.327  -46.812 62.685  1.00 36.60 ? 109  PRO G CD    1 
ATOM   6355  N  N     . ILE E  1 111 ? 14.968  -48.772 66.168  1.00 36.87 ? 110  ILE G N     1 
ATOM   6356  C  CA    . ILE E  1 111 ? 15.172  -49.033 67.582  1.00 36.53 ? 110  ILE G CA    1 
ATOM   6357  C  C     . ILE E  1 111 ? 16.507  -48.427 68.010  1.00 36.79 ? 110  ILE G C     1 
ATOM   6358  O  O     . ILE E  1 111 ? 17.535  -48.666 67.369  1.00 36.20 ? 110  ILE G O     1 
ATOM   6359  C  CB    . ILE E  1 111 ? 15.238  -50.533 67.862  1.00 36.48 ? 110  ILE G CB    1 
ATOM   6360  C  CG1   . ILE E  1 111 ? 13.931  -51.226 67.479  1.00 36.45 ? 110  ILE G CG1   1 
ATOM   6361  C  CG2   . ILE E  1 111 ? 15.603  -50.818 69.343  1.00 36.20 ? 110  ILE G CG2   1 
ATOM   6362  C  CD1   . ILE E  1 111 ? 14.018  -52.778 67.593  1.00 36.59 ? 110  ILE G CD1   1 
ATOM   6363  N  N     . LEU E  1 112 ? 16.495  -47.659 69.102  1.00 37.31 ? 111  LEU G N     1 
ATOM   6364  C  CA    . LEU E  1 112 ? 17.739  -47.341 69.827  1.00 37.43 ? 111  LEU G CA    1 
ATOM   6365  C  C     . LEU E  1 112 ? 17.829  -48.231 71.083  1.00 37.22 ? 111  LEU G C     1 
ATOM   6366  O  O     . LEU E  1 112 ? 16.857  -48.390 71.821  1.00 37.56 ? 111  LEU G O     1 
ATOM   6367  C  CB    . LEU E  1 112 ? 17.806  -45.847 70.197  1.00 37.61 ? 111  LEU G CB    1 
ATOM   6368  C  CG    . LEU E  1 112 ? 18.144  -44.843 69.081  1.00 37.76 ? 111  LEU G CG    1 
ATOM   6369  C  CD1   . LEU E  1 112 ? 17.113  -44.840 67.992  1.00 40.43 ? 111  LEU G CD1   1 
ATOM   6370  C  CD2   . LEU E  1 112 ? 18.280  -43.440 69.611  1.00 38.60 ? 111  LEU G CD2   1 
ATOM   6371  N  N     . LEU E  1 113 ? 18.997  -48.824 71.307  1.00 36.82 ? 112  LEU G N     1 
ATOM   6372  C  CA    . LEU E  1 113 ? 19.250  -49.599 72.514  1.00 36.02 ? 112  LEU G CA    1 
ATOM   6373  C  C     . LEU E  1 113 ? 19.856  -48.680 73.565  1.00 35.62 ? 112  LEU G C     1 
ATOM   6374  O  O     . LEU E  1 113 ? 20.950  -48.154 73.371  1.00 35.19 ? 112  LEU G O     1 
ATOM   6375  C  CB    . LEU E  1 113 ? 20.203  -50.750 72.213  1.00 35.39 ? 112  LEU G CB    1 
ATOM   6376  C  CG    . LEU E  1 113 ? 20.564  -51.677 73.377  1.00 35.38 ? 112  LEU G CG    1 
ATOM   6377  C  CD1   . LEU E  1 113 ? 19.346  -52.286 74.052  1.00 33.79 ? 112  LEU G CD1   1 
ATOM   6378  C  CD2   . LEU E  1 113 ? 21.459  -52.751 72.849  1.00 33.87 ? 112  LEU G CD2   1 
ATOM   6379  N  N     . VAL E  1 114 ? 19.140  -48.490 74.672  1.00 35.32 ? 113  VAL G N     1 
ATOM   6380  C  CA    . VAL E  1 114 ? 19.600  -47.628 75.744  1.00 35.39 ? 113  VAL G CA    1 
ATOM   6381  C  C     . VAL E  1 114 ? 20.036  -48.427 76.998  1.00 35.68 ? 113  VAL G C     1 
ATOM   6382  O  O     . VAL E  1 114 ? 19.243  -49.138 77.612  1.00 35.14 ? 113  VAL G O     1 
ATOM   6383  C  CB    . VAL E  1 114 ? 18.500  -46.614 76.113  1.00 35.85 ? 113  VAL G CB    1 
ATOM   6384  C  CG1   . VAL E  1 114 ? 19.009  -45.616 77.201  1.00 34.66 ? 113  VAL G CG1   1 
ATOM   6385  C  CG2   . VAL E  1 114 ? 18.018  -45.905 74.839  1.00 35.55 ? 113  VAL G CG2   1 
ATOM   6386  N  N     . GLY E  1 115 ? 21.300  -48.289 77.372  1.00 35.55 ? 114  GLY G N     1 
ATOM   6387  C  CA    . GLY E  1 115 ? 21.791  -48.809 78.654  1.00 35.54 ? 114  GLY G CA    1 
ATOM   6388  C  C     . GLY E  1 115 ? 21.654  -47.731 79.718  1.00 35.92 ? 114  GLY G C     1 
ATOM   6389  O  O     . GLY E  1 115 ? 22.286  -46.668 79.604  1.00 35.43 ? 114  GLY G O     1 
ATOM   6390  N  N     . THR E  1 116 ? 20.833  -48.004 80.746  1.00 35.51 ? 115  THR G N     1 
ATOM   6391  C  CA    . THR E  1 116 ? 20.534  -47.038 81.789  1.00 36.06 ? 115  THR G CA    1 
ATOM   6392  C  C     . THR E  1 116 ? 21.385  -47.220 83.065  1.00 36.02 ? 115  THR G C     1 
ATOM   6393  O  O     . THR E  1 116 ? 22.082  -48.210 83.228  1.00 37.10 ? 115  THR G O     1 
ATOM   6394  C  CB    . THR E  1 116 ? 19.052  -47.124 82.183  1.00 36.42 ? 115  THR G CB    1 
ATOM   6395  O  OG1   . THR E  1 116 ? 18.806  -48.404 82.786  1.00 36.32 ? 115  THR G OG1   1 
ATOM   6396  C  CG2   . THR E  1 116 ? 18.165  -46.955 80.958  1.00 35.62 ? 115  THR G CG2   1 
ATOM   6397  N  N     . LYS E  1 117 ? 21.307  -46.236 83.953  1.00 36.05 ? 116  LYS G N     1 
ATOM   6398  C  CA    . LYS E  1 117 ? 22.009  -46.234 85.242  1.00 35.90 ? 116  LYS G CA    1 
ATOM   6399  C  C     . LYS E  1 117 ? 23.550  -46.326 85.081  1.00 35.74 ? 116  LYS G C     1 
ATOM   6400  O  O     . LYS E  1 117 ? 24.219  -47.076 85.770  1.00 34.97 ? 116  LYS G O     1 
ATOM   6401  C  CB    . LYS E  1 117 ? 21.468  -47.334 86.173  1.00 36.22 ? 116  LYS G CB    1 
ATOM   6402  C  CG    . LYS E  1 117 ? 19.933  -47.372 86.340  1.00 36.55 ? 116  LYS G CG    1 
ATOM   6403  C  CD    . LYS E  1 117 ? 19.511  -48.476 87.291  1.00 35.56 ? 116  LYS G CD    1 
ATOM   6404  C  CE    . LYS E  1 117 ? 18.007  -48.556 87.425  1.00 35.78 ? 116  LYS G CE    1 
ATOM   6405  N  NZ    . LYS E  1 117 ? 17.571  -49.561 88.439  1.00 35.87 ? 116  LYS G NZ    1 
ATOM   6406  N  N     . LEU E  1 118 ? 24.089  -45.529 84.162  1.00 36.30 ? 117  LEU G N     1 
ATOM   6407  C  CA    . LEU E  1 118 ? 25.527  -45.463 83.911  1.00 36.46 ? 117  LEU G CA    1 
ATOM   6408  C  C     . LEU E  1 118 ? 26.305  -45.115 85.185  1.00 36.44 ? 117  LEU G C     1 
ATOM   6409  O  O     . LEU E  1 118 ? 27.430  -45.570 85.385  1.00 36.65 ? 117  LEU G O     1 
ATOM   6410  C  CB    . LEU E  1 118 ? 25.819  -44.429 82.814  1.00 36.51 ? 117  LEU G CB    1 
ATOM   6411  C  CG    . LEU E  1 118 ? 27.266  -44.129 82.390  1.00 36.88 ? 117  LEU G CG    1 
ATOM   6412  C  CD1   . LEU E  1 118 ? 27.970  -45.362 81.831  1.00 37.29 ? 117  LEU G CD1   1 
ATOM   6413  C  CD2   . LEU E  1 118 ? 27.281  -42.980 81.382  1.00 37.01 ? 117  LEU G CD2   1 
ATOM   6414  N  N     . ASP E  1 119 ? 25.700  -44.309 86.047  1.00 36.76 ? 118  ASP G N     1 
ATOM   6415  C  CA    . ASP E  1 119 ? 26.359  -43.856 87.276  1.00 37.15 ? 118  ASP G CA    1 
ATOM   6416  C  C     . ASP E  1 119 ? 26.657  -44.983 88.274  1.00 37.21 ? 118  ASP G C     1 
ATOM   6417  O  O     . ASP E  1 119 ? 27.447  -44.795 89.177  1.00 37.01 ? 118  ASP G O     1 
ATOM   6418  C  CB    . ASP E  1 119 ? 25.491  -42.808 87.956  1.00 37.10 ? 118  ASP G CB    1 
ATOM   6419  C  CG    . ASP E  1 119 ? 24.111  -43.341 88.269  1.00 37.71 ? 118  ASP G CG    1 
ATOM   6420  O  OD1   . ASP E  1 119 ? 23.314  -43.513 87.309  1.00 38.03 ? 118  ASP G OD1   1 
ATOM   6421  O  OD2   . ASP E  1 119 ? 23.848  -43.619 89.455  1.00 35.21 ? 118  ASP G OD2   1 
ATOM   6422  N  N     . LEU E  1 120 ? 25.995  -46.128 88.123  1.00 38.01 ? 119  LEU G N     1 
ATOM   6423  C  CA    . LEU E  1 120 ? 26.213  -47.275 88.993  1.00 38.53 ? 119  LEU G CA    1 
ATOM   6424  C  C     . LEU E  1 120 ? 27.264  -48.249 88.465  1.00 39.08 ? 119  LEU G C     1 
ATOM   6425  O  O     . LEU E  1 120 ? 27.758  -49.086 89.219  1.00 38.90 ? 119  LEU G O     1 
ATOM   6426  C  CB    . LEU E  1 120 ? 24.890  -48.008 89.243  1.00 38.87 ? 119  LEU G CB    1 
ATOM   6427  C  CG    . LEU E  1 120 ? 23.880  -47.260 90.122  1.00 38.77 ? 119  LEU G CG    1 
ATOM   6428  C  CD1   . LEU E  1 120 ? 22.620  -48.074 90.312  1.00 38.54 ? 119  LEU G CD1   1 
ATOM   6429  C  CD2   . LEU E  1 120 ? 24.507  -46.898 91.468  1.00 37.06 ? 119  LEU G CD2   1 
ATOM   6430  N  N     . ARG E  1 121 ? 27.632  -48.141 87.189  1.00 39.86 ? 120  ARG G N     1 
ATOM   6431  C  CA    . ARG E  1 121 ? 28.621  -49.061 86.621  1.00 40.24 ? 120  ARG G CA    1 
ATOM   6432  C  C     . ARG E  1 121 ? 29.981  -48.945 87.286  1.00 40.89 ? 120  ARG G C     1 
ATOM   6433  O  O     . ARG E  1 121 ? 30.682  -49.950 87.415  1.00 41.37 ? 120  ARG G O     1 
ATOM   6434  C  CB    . ARG E  1 121 ? 28.778  -48.865 85.122  1.00 40.18 ? 120  ARG G CB    1 
ATOM   6435  C  CG    . ARG E  1 121 ? 29.740  -49.891 84.508  1.00 39.94 ? 120  ARG G CG    1 
ATOM   6436  C  CD    . ARG E  1 121 ? 29.495  -50.088 83.019  1.00 37.96 ? 120  ARG G CD    1 
ATOM   6437  N  NE    . ARG E  1 121 ? 29.927  -48.915 82.278  1.00 37.15 ? 120  ARG G NE    1 
ATOM   6438  C  CZ    . ARG E  1 121 ? 29.627  -48.675 81.011  1.00 37.84 ? 120  ARG G CZ    1 
ATOM   6439  N  NH1   . ARG E  1 121 ? 28.905  -49.546 80.310  1.00 37.67 ? 120  ARG G NH1   1 
ATOM   6440  N  NH2   . ARG E  1 121 ? 30.059  -47.560 80.442  1.00 37.57 ? 120  ARG G NH2   1 
ATOM   6441  N  N     . ASP E  1 122 ? 30.336  -47.724 87.704  1.00 41.75 ? 121  ASP G N     1 
ATOM   6442  C  CA    . ASP E  1 122 ? 31.603  -47.432 88.401  1.00 42.21 ? 121  ASP G CA    1 
ATOM   6443  C  C     . ASP E  1 122 ? 31.462  -47.434 89.933  1.00 42.47 ? 121  ASP G C     1 
ATOM   6444  O  O     . ASP E  1 122 ? 32.434  -47.186 90.655  1.00 42.72 ? 121  ASP G O     1 
ATOM   6445  C  CB    . ASP E  1 122 ? 32.148  -46.061 87.948  1.00 42.27 ? 121  ASP G CB    1 
ATOM   6446  N  N     . ASP E  1 123 ? 30.255  -47.694 90.424  1.00 42.39 ? 122  ASP G N     1 
ATOM   6447  C  CA    . ASP E  1 123 ? 29.962  -47.641 91.847  1.00 42.26 ? 122  ASP G CA    1 
ATOM   6448  C  C     . ASP E  1 123 ? 30.616  -48.842 92.514  1.00 41.92 ? 122  ASP G C     1 
ATOM   6449  O  O     . ASP E  1 123 ? 30.275  -49.989 92.208  1.00 41.61 ? 122  ASP G O     1 
ATOM   6450  C  CB    . ASP E  1 123 ? 28.441  -47.667 92.048  1.00 42.47 ? 122  ASP G CB    1 
ATOM   6451  C  CG    . ASP E  1 123 ? 28.032  -47.506 93.491  1.00 43.22 ? 122  ASP G CG    1 
ATOM   6452  O  OD1   . ASP E  1 123 ? 28.057  -46.347 93.993  1.00 43.67 ? 122  ASP G OD1   1 
ATOM   6453  O  OD2   . ASP E  1 123 ? 27.665  -48.535 94.108  1.00 42.38 ? 122  ASP G OD2   1 
ATOM   6454  N  N     . LYS E  1 124 ? 31.556  -48.575 93.417  1.00 41.51 ? 123  LYS G N     1 
ATOM   6455  C  CA    . LYS E  1 124 ? 32.348  -49.632 94.043  1.00 41.61 ? 123  LYS G CA    1 
ATOM   6456  C  C     . LYS E  1 124 ? 31.469  -50.712 94.677  1.00 41.37 ? 123  LYS G C     1 
ATOM   6457  O  O     . LYS E  1 124 ? 31.745  -51.901 94.524  1.00 40.84 ? 123  LYS G O     1 
ATOM   6458  C  CB    . LYS E  1 124 ? 33.321  -49.055 95.092  1.00 41.37 ? 123  LYS G CB    1 
ATOM   6459  N  N     . ASP E  1 125 ? 30.405  -50.294 95.362  1.00 41.59 ? 124  ASP G N     1 
ATOM   6460  C  CA    . ASP E  1 125 ? 29.540  -51.229 96.080  1.00 41.61 ? 124  ASP G CA    1 
ATOM   6461  C  C     . ASP E  1 125 ? 28.690  -52.074 95.143  1.00 41.28 ? 124  ASP G C     1 
ATOM   6462  O  O     . ASP E  1 125 ? 28.506  -53.271 95.372  1.00 41.29 ? 124  ASP G O     1 
ATOM   6463  C  CB    . ASP E  1 125 ? 28.660  -50.488 97.090  1.00 41.89 ? 124  ASP G CB    1 
ATOM   6464  C  CG    . ASP E  1 125 ? 29.447  -49.984 98.324  1.00 43.33 ? 124  ASP G CG    1 
ATOM   6465  O  OD1   . ASP E  1 125 ? 30.568  -50.474 98.597  1.00 43.18 ? 124  ASP G OD1   1 
ATOM   6466  O  OD2   . ASP E  1 125 ? 28.924  -49.093 99.035  1.00 45.44 ? 124  ASP G OD2   1 
ATOM   6467  N  N     . THR E  1 126 ? 28.175  -51.454 94.089  1.00 40.98 ? 125  THR G N     1 
ATOM   6468  C  CA    . THR E  1 126 ? 27.446  -52.170 93.048  1.00 40.56 ? 125  THR G CA    1 
ATOM   6469  C  C     . THR E  1 126 ? 28.322  -53.245 92.394  1.00 40.62 ? 125  THR G C     1 
ATOM   6470  O  O     . THR E  1 126 ? 27.876  -54.365 92.176  1.00 40.52 ? 125  THR G O     1 
ATOM   6471  C  CB    . THR E  1 126 ? 26.920  -51.193 91.986  1.00 40.47 ? 125  THR G CB    1 
ATOM   6472  O  OG1   . THR E  1 126 ? 25.979  -50.310 92.603  1.00 39.54 ? 125  THR G OG1   1 
ATOM   6473  C  CG2   . THR E  1 126 ? 26.228  -51.939 90.834  1.00 40.65 ? 125  THR G CG2   1 
ATOM   6474  N  N     . ILE E  1 127 ? 29.579  -52.903 92.118  1.00 40.54 ? 126  ILE G N     1 
ATOM   6475  C  CA    . ILE E  1 127 ? 30.513  -53.845 91.528  1.00 40.45 ? 126  ILE G CA    1 
ATOM   6476  C  C     . ILE E  1 127 ? 30.722  -55.056 92.446  1.00 40.71 ? 126  ILE G C     1 
ATOM   6477  O  O     . ILE E  1 127 ? 30.820  -56.176 91.960  1.00 40.77 ? 126  ILE G O     1 
ATOM   6478  C  CB    . ILE E  1 127 ? 31.874  -53.169 91.186  1.00 40.49 ? 126  ILE G CB    1 
ATOM   6479  C  CG1   . ILE E  1 127 ? 31.691  -52.086 90.112  1.00 40.77 ? 126  ILE G CG1   1 
ATOM   6480  C  CG2   . ILE E  1 127 ? 32.883  -54.198 90.669  1.00 40.88 ? 126  ILE G CG2   1 
ATOM   6481  C  CD1   . ILE E  1 127 ? 32.925  -51.265 89.837  1.00 40.00 ? 126  ILE G CD1   1 
ATOM   6482  N  N     . GLU E  1 128 ? 30.779  -54.831 93.762  1.00 40.89 ? 127  GLU G N     1 
ATOM   6483  C  CA    . GLU E  1 128 ? 31.005  -55.911 94.738  1.00 41.07 ? 127  GLU G CA    1 
ATOM   6484  C  C     . GLU E  1 128 ? 29.799  -56.823 94.895  1.00 41.09 ? 127  GLU G C     1 
ATOM   6485  O  O     . GLU E  1 128 ? 29.935  -58.039 94.988  1.00 40.89 ? 127  GLU G O     1 
ATOM   6486  C  CB    . GLU E  1 128 ? 31.371  -55.343 96.114  1.00 41.14 ? 127  GLU G CB    1 
ATOM   6487  N  N     . ARG E  1 129 ? 28.620  -56.221 94.944  1.00 41.65 ? 128  ARG G N     1 
ATOM   6488  C  CA    . ARG E  1 129 ? 27.380  -56.972 95.076  1.00 41.87 ? 128  ARG G CA    1 
ATOM   6489  C  C     . ARG E  1 129 ? 27.127  -57.852 93.869  1.00 41.72 ? 128  ARG G C     1 
ATOM   6490  O  O     . ARG E  1 129 ? 26.633  -58.971 94.016  1.00 41.64 ? 128  ARG G O     1 
ATOM   6491  C  CB    . ARG E  1 129 ? 26.201  -56.026 95.298  1.00 41.85 ? 128  ARG G CB    1 
ATOM   6492  C  CG    . ARG E  1 129 ? 26.251  -55.354 96.674  1.00 42.74 ? 128  ARG G CG    1 
ATOM   6493  C  CD    . ARG E  1 129 ? 24.896  -54.828 97.123  1.00 43.05 ? 128  ARG G CD    1 
ATOM   6494  N  NE    . ARG E  1 129 ? 24.554  -53.560 96.487  1.00 43.37 ? 128  ARG G NE    1 
ATOM   6495  C  CZ    . ARG E  1 129 ? 24.975  -52.361 96.887  1.00 42.90 ? 128  ARG G CZ    1 
ATOM   6496  N  NH1   . ARG E  1 129 ? 24.572  -51.281 96.225  1.00 42.61 ? 128  ARG G NH1   1 
ATOM   6497  N  NH2   . ARG E  1 129 ? 25.789  -52.227 97.932  1.00 41.03 ? 128  ARG G NH2   1 
ATOM   6498  N  N     . LEU E  1 130 ? 27.456  -57.347 92.682  1.00 41.73 ? 129  LEU G N     1 
ATOM   6499  C  CA    . LEU E  1 130 ? 27.390  -58.158 91.467  1.00 41.76 ? 129  LEU G CA    1 
ATOM   6500  C  C     . LEU E  1 130 ? 28.429  -59.284 91.532  1.00 41.97 ? 129  LEU G C     1 
ATOM   6501  O  O     . LEU E  1 130 ? 28.111  -60.445 91.257  1.00 41.67 ? 129  LEU G O     1 
ATOM   6502  C  CB    . LEU E  1 130 ? 27.582  -57.293 90.220  1.00 42.03 ? 129  LEU G CB    1 
ATOM   6503  C  CG    . LEU E  1 130 ? 26.323  -56.516 89.791  1.00 41.72 ? 129  LEU G CG    1 
ATOM   6504  C  CD1   . LEU E  1 130 ? 26.644  -55.363 88.851  1.00 40.93 ? 129  LEU G CD1   1 
ATOM   6505  C  CD2   . LEU E  1 130 ? 25.330  -57.455 89.139  1.00 40.82 ? 129  LEU G CD2   1 
ATOM   6506  N  N     . ARG E  1 131 ? 29.652  -58.944 91.939  1.00 42.28 ? 130  ARG G N     1 
ATOM   6507  C  CA    . ARG E  1 131 ? 30.746  -59.917 92.013  1.00 42.63 ? 130  ARG G CA    1 
ATOM   6508  C  C     . ARG E  1 131 ? 30.381  -61.089 92.917  1.00 43.02 ? 130  ARG G C     1 
ATOM   6509  O  O     . ARG E  1 131 ? 30.701  -62.231 92.612  1.00 42.76 ? 130  ARG G O     1 
ATOM   6510  C  CB    . ARG E  1 131 ? 32.049  -59.261 92.499  1.00 42.86 ? 130  ARG G CB    1 
ATOM   6511  N  N     . ASP E  1 132 ? 29.695  -60.798 94.018  1.00 43.67 ? 131  ASP G N     1 
ATOM   6512  C  CA    . ASP E  1 132 ? 29.209  -61.829 94.934  1.00 44.26 ? 131  ASP G CA    1 
ATOM   6513  C  C     . ASP E  1 132 ? 28.285  -62.844 94.238  1.00 44.03 ? 131  ASP G C     1 
ATOM   6514  O  O     . ASP E  1 132 ? 28.333  -64.029 94.543  1.00 44.08 ? 131  ASP G O     1 
ATOM   6515  C  CB    . ASP E  1 132 ? 28.489  -61.183 96.130  1.00 44.68 ? 131  ASP G CB    1 
ATOM   6516  C  CG    . ASP E  1 132 ? 29.449  -60.475 97.095  1.00 46.63 ? 131  ASP G CG    1 
ATOM   6517  O  OD1   . ASP E  1 132 ? 30.674  -60.788 97.073  1.00 49.81 ? 131  ASP G OD1   1 
ATOM   6518  O  OD2   . ASP E  1 132 ? 28.974  -59.619 97.889  1.00 46.98 ? 131  ASP G OD2   1 
ATOM   6519  N  N     . LYS E  1 133 ? 27.474  -62.385 93.287  1.00 43.68 ? 132  LYS G N     1 
ATOM   6520  C  CA    . LYS E  1 133 ? 26.587  -63.269 92.520  1.00 43.41 ? 132  LYS G CA    1 
ATOM   6521  C  C     . LYS E  1 133 ? 27.257  -63.783 91.239  1.00 43.12 ? 132  LYS G C     1 
ATOM   6522  O  O     . LYS E  1 133 ? 26.585  -64.295 90.343  1.00 43.27 ? 132  LYS G O     1 
ATOM   6523  C  CB    . LYS E  1 133 ? 25.279  -62.535 92.168  1.00 43.42 ? 132  LYS G CB    1 
ATOM   6524  C  CG    . LYS E  1 133 ? 24.450  -62.090 93.361  1.00 43.58 ? 132  LYS G CG    1 
ATOM   6525  N  N     . LYS E  1 134 ? 28.581  -63.665 91.167  1.00 42.86 ? 133  LYS G N     1 
ATOM   6526  C  CA    . LYS E  1 134 ? 29.351  -63.975 89.956  1.00 42.64 ? 133  LYS G CA    1 
ATOM   6527  C  C     . LYS E  1 134 ? 28.850  -63.208 88.711  1.00 42.25 ? 133  LYS G C     1 
ATOM   6528  O  O     . LYS E  1 134 ? 28.876  -63.727 87.587  1.00 42.58 ? 133  LYS G O     1 
ATOM   6529  C  CB    . LYS E  1 134 ? 29.384  -65.489 89.700  1.00 42.92 ? 133  LYS G CB    1 
ATOM   6530  N  N     . LEU E  1 135 ? 28.415  -61.970 88.916  1.00 41.54 ? 134  LEU G N     1 
ATOM   6531  C  CA    . LEU E  1 135 ? 27.992  -61.102 87.810  1.00 41.17 ? 134  LEU G CA    1 
ATOM   6532  C  C     . LEU E  1 135 ? 28.903  -59.872 87.679  1.00 40.43 ? 134  LEU G C     1 
ATOM   6533  O  O     . LEU E  1 135 ? 29.748  -59.602 88.542  1.00 40.35 ? 134  LEU G O     1 
ATOM   6534  C  CB    . LEU E  1 135 ? 26.545  -60.654 88.012  1.00 41.17 ? 134  LEU G CB    1 
ATOM   6535  C  CG    . LEU E  1 135 ? 25.464  -61.747 88.056  1.00 41.82 ? 134  LEU G CG    1 
ATOM   6536  C  CD1   . LEU E  1 135 ? 24.143  -61.169 88.551  1.00 42.68 ? 134  LEU G CD1   1 
ATOM   6537  C  CD2   . LEU E  1 135 ? 25.281  -62.411 86.692  1.00 44.16 ? 134  LEU G CD2   1 
ATOM   6538  N  N     . ALA E  1 136 ? 28.722  -59.129 86.596  1.00 39.48 ? 135  ALA G N     1 
ATOM   6539  C  CA    . ALA E  1 136 ? 29.429  -57.880 86.402  1.00 39.01 ? 135  ALA G CA    1 
ATOM   6540  C  C     . ALA E  1 136 ? 28.534  -56.934 85.623  1.00 38.77 ? 135  ALA G C     1 
ATOM   6541  O  O     . ALA E  1 136 ? 27.621  -57.376 84.924  1.00 39.19 ? 135  ALA G O     1 
ATOM   6542  C  CB    . ALA E  1 136 ? 30.755  -58.108 85.648  1.00 38.95 ? 135  ALA G CB    1 
ATOM   6543  N  N     . PRO E  1 137 ? 28.780  -55.622 85.749  1.00 37.87 ? 136  PRO G N     1 
ATOM   6544  C  CA    . PRO E  1 137 ? 28.081  -54.668 84.895  1.00 37.37 ? 136  PRO G CA    1 
ATOM   6545  C  C     . PRO E  1 137 ? 28.309  -54.935 83.404  1.00 37.09 ? 136  PRO G C     1 
ATOM   6546  O  O     . PRO E  1 137 ? 29.341  -55.482 83.007  1.00 36.97 ? 136  PRO G O     1 
ATOM   6547  C  CB    . PRO E  1 137 ? 28.697  -53.325 85.289  1.00 37.37 ? 136  PRO G CB    1 
ATOM   6548  C  CG    . PRO E  1 137 ? 29.337  -53.553 86.614  1.00 37.25 ? 136  PRO G CG    1 
ATOM   6549  C  CD    . PRO E  1 137 ? 29.711  -54.972 86.686  1.00 37.38 ? 136  PRO G CD    1 
ATOM   6550  N  N     . ILE E  1 138 ? 27.338  -54.542 82.593  1.00 36.96 ? 137  ILE G N     1 
ATOM   6551  C  CA    . ILE E  1 138 ? 27.408  -54.679 81.157  1.00 36.68 ? 137  ILE G CA    1 
ATOM   6552  C  C     . ILE E  1 138 ? 28.382  -53.636 80.669  1.00 36.57 ? 137  ILE G C     1 
ATOM   6553  O  O     . ILE E  1 138 ? 28.270  -52.480 81.030  1.00 36.44 ? 137  ILE G O     1 
ATOM   6554  C  CB    . ILE E  1 138 ? 26.008  -54.463 80.526  1.00 37.01 ? 137  ILE G CB    1 
ATOM   6555  C  CG1   . ILE E  1 138 ? 25.056  -55.580 80.975  1.00 37.96 ? 137  ILE G CG1   1 
ATOM   6556  C  CG2   . ILE E  1 138 ? 26.073  -54.379 79.008  1.00 37.03 ? 137  ILE G CG2   1 
ATOM   6557  C  CD1   . ILE E  1 138 ? 25.659  -57.035 80.930  1.00 36.78 ? 137  ILE G CD1   1 
ATOM   6558  N  N     . THR E  1 139 ? 29.371  -54.051 79.886  1.00 36.45 ? 138  THR G N     1 
ATOM   6559  C  CA    . THR E  1 139 ? 30.337  -53.105 79.360  1.00 36.51 ? 138  THR G CA    1 
ATOM   6560  C  C     . THR E  1 139 ? 29.853  -52.499 78.055  1.00 36.65 ? 138  THR G C     1 
ATOM   6561  O  O     . THR E  1 139 ? 28.902  -52.981 77.422  1.00 36.32 ? 138  THR G O     1 
ATOM   6562  C  CB    . THR E  1 139 ? 31.687  -53.761 79.115  1.00 36.44 ? 138  THR G CB    1 
ATOM   6563  O  OG1   . THR E  1 139 ? 31.546  -54.733 78.074  1.00 37.57 ? 138  THR G OG1   1 
ATOM   6564  C  CG2   . THR E  1 139 ? 32.201  -54.415 80.385  1.00 35.06 ? 138  THR G CG2   1 
ATOM   6565  N  N     . TYR E  1 140 ? 30.546  -51.454 77.635  1.00 37.17 ? 139  TYR G N     1 
ATOM   6566  C  CA    . TYR E  1 140 ? 30.201  -50.776 76.403  1.00 37.42 ? 139  TYR G CA    1 
ATOM   6567  C  C     . TYR E  1 140 ? 30.270  -51.686 75.152  1.00 37.62 ? 139  TYR G C     1 
ATOM   6568  O  O     . TYR E  1 140 ? 29.317  -51.694 74.348  1.00 37.19 ? 139  TYR G O     1 
ATOM   6569  C  CB    . TYR E  1 140 ? 31.037  -49.509 76.253  1.00 37.95 ? 139  TYR G CB    1 
ATOM   6570  C  CG    . TYR E  1 140 ? 30.683  -48.757 75.032  1.00 38.67 ? 139  TYR G CG    1 
ATOM   6571  C  CD1   . TYR E  1 140 ? 31.348  -48.993 73.835  1.00 39.66 ? 139  TYR G CD1   1 
ATOM   6572  C  CD2   . TYR E  1 140 ? 29.656  -47.836 75.047  1.00 39.51 ? 139  TYR G CD2   1 
ATOM   6573  C  CE1   . TYR E  1 140 ? 31.006  -48.311 72.687  1.00 40.34 ? 139  TYR G CE1   1 
ATOM   6574  C  CE2   . TYR E  1 140 ? 29.310  -47.137 73.905  1.00 39.83 ? 139  TYR G CE2   1 
ATOM   6575  C  CZ    . TYR E  1 140 ? 29.980  -47.382 72.737  1.00 39.56 ? 139  TYR G CZ    1 
ATOM   6576  O  OH    . TYR E  1 140 ? 29.638  -46.693 71.616  1.00 40.97 ? 139  TYR G OH    1 
ATOM   6577  N  N     . PRO E  1 141 ? 31.377  -52.448 74.978  1.00 37.26 ? 140  PRO G N     1 
ATOM   6578  C  CA    . PRO E  1 141 ? 31.456  -53.422 73.869  1.00 37.42 ? 140  PRO G CA    1 
ATOM   6579  C  C     . PRO E  1 141 ? 30.317  -54.455 73.839  1.00 37.53 ? 140  PRO G C     1 
ATOM   6580  O  O     . PRO E  1 141 ? 29.875  -54.849 72.751  1.00 37.66 ? 140  PRO G O     1 
ATOM   6581  C  CB    . PRO E  1 141 ? 32.794  -54.144 74.107  1.00 37.21 ? 140  PRO G CB    1 
ATOM   6582  C  CG    . PRO E  1 141 ? 33.589  -53.249 74.977  1.00 37.16 ? 140  PRO G CG    1 
ATOM   6583  C  CD    . PRO E  1 141 ? 32.620  -52.411 75.773  1.00 37.48 ? 140  PRO G CD    1 
ATOM   6584  N  N     . GLN E  1 142 ? 29.862  -54.893 75.014  1.00 37.33 ? 141  GLN G N     1 
ATOM   6585  C  CA    . GLN E  1 142 ? 28.755  -55.834 75.105  1.00 37.52 ? 141  GLN G CA    1 
ATOM   6586  C  C     . GLN E  1 142 ? 27.459  -55.200 74.645  1.00 37.61 ? 141  GLN G C     1 
ATOM   6587  O  O     . GLN E  1 142 ? 26.684  -55.818 73.896  1.00 37.79 ? 141  GLN G O     1 
ATOM   6588  C  CB    . GLN E  1 142 ? 28.581  -56.341 76.532  1.00 37.97 ? 141  GLN G CB    1 
ATOM   6589  C  CG    . GLN E  1 142 ? 29.570  -57.404 76.927  1.00 39.24 ? 141  GLN G CG    1 
ATOM   6590  C  CD    . GLN E  1 142 ? 29.493  -57.744 78.392  1.00 42.03 ? 141  GLN G CD    1 
ATOM   6591  O  OE1   . GLN E  1 142 ? 29.610  -56.873 79.255  1.00 42.87 ? 141  GLN G OE1   1 
ATOM   6592  N  NE2   . GLN E  1 142 ? 29.295  -59.018 78.686  1.00 44.91 ? 141  GLN G NE2   1 
ATOM   6593  N  N     . GLY E  1 143 ? 27.208  -53.974 75.095  1.00 37.46 ? 142  GLY G N     1 
ATOM   6594  C  CA    . GLY E  1 143 ? 25.993  -53.267 74.705  1.00 37.63 ? 142  GLY G CA    1 
ATOM   6595  C  C     . GLY E  1 143 ? 25.907  -53.048 73.209  1.00 37.62 ? 142  GLY G C     1 
ATOM   6596  O  O     . GLY E  1 143 ? 24.848  -53.192 72.594  1.00 37.63 ? 142  GLY G O     1 
ATOM   6597  N  N     . LEU E  1 144 ? 27.052  -52.722 72.637  1.00 38.24 ? 143  LEU G N     1 
ATOM   6598  C  CA    . LEU E  1 144 ? 27.205  -52.516 71.213  1.00 38.34 ? 143  LEU G CA    1 
ATOM   6599  C  C     . LEU E  1 144 ? 26.981  -53.810 70.416  1.00 38.37 ? 143  LEU G C     1 
ATOM   6600  O  O     . LEU E  1 144 ? 26.381  -53.775 69.340  1.00 38.37 ? 143  LEU G O     1 
ATOM   6601  C  CB    . LEU E  1 144 ? 28.605  -51.952 70.950  1.00 38.43 ? 143  LEU G CB    1 
ATOM   6602  C  CG    . LEU E  1 144 ? 28.877  -51.108 69.707  1.00 40.00 ? 143  LEU G CG    1 
ATOM   6603  C  CD1   . LEU E  1 144 ? 27.616  -50.417 69.130  1.00 40.80 ? 143  LEU G CD1   1 
ATOM   6604  C  CD2   . LEU E  1 144 ? 29.921  -50.071 70.054  1.00 40.93 ? 143  LEU G CD2   1 
ATOM   6605  N  N     . ALA E  1 145 ? 27.487  -54.934 70.921  1.00 37.64 ? 144  ALA G N     1 
ATOM   6606  C  CA    . ALA E  1 145 ? 27.255  -56.230 70.289  1.00 37.77 ? 144  ALA G CA    1 
ATOM   6607  C  C     . ALA E  1 145 ? 25.757  -56.574 70.271  1.00 38.00 ? 144  ALA G C     1 
ATOM   6608  O  O     . ALA E  1 145 ? 25.195  -56.971 69.232  1.00 37.15 ? 144  ALA G O     1 
ATOM   6609  C  CB    . ALA E  1 145 ? 28.058  -57.329 71.007  1.00 38.00 ? 144  ALA G CB    1 
ATOM   6610  N  N     . MET E  1 146 ? 25.113  -56.403 71.425  1.00 38.14 ? 145  MET G N     1 
ATOM   6611  C  CA    . MET E  1 146 ? 23.678  -56.585 71.525  1.00 38.53 ? 145  MET G CA    1 
ATOM   6612  C  C     . MET E  1 146 ? 22.984  -55.664 70.533  1.00 38.47 ? 145  MET G C     1 
ATOM   6613  O  O     . MET E  1 146 ? 22.049  -56.076 69.875  1.00 38.74 ? 145  MET G O     1 
ATOM   6614  C  CB    . MET E  1 146 ? 23.190  -56.324 72.964  1.00 38.64 ? 145  MET G CB    1 
ATOM   6615  C  CG    . MET E  1 146 ? 21.717  -56.616 73.213  1.00 38.84 ? 145  MET G CG    1 
ATOM   6616  S  SD    . MET E  1 146 ? 21.280  -58.358 72.925  1.00 38.63 ? 145  MET G SD    1 
ATOM   6617  C  CE    . MET E  1 146 ? 21.613  -59.060 74.536  1.00 36.83 ? 145  MET G CE    1 
ATOM   6618  N  N     . ALA E  1 147 ? 23.455  -54.425 70.426  1.00 38.90 ? 146  ALA G N     1 
ATOM   6619  C  CA    . ALA E  1 147 ? 22.865  -53.439 69.514  1.00 39.10 ? 146  ALA G CA    1 
ATOM   6620  C  C     . ALA E  1 147 ? 22.870  -53.934 68.059  1.00 39.03 ? 146  ALA G C     1 
ATOM   6621  O  O     . ALA E  1 147 ? 21.877  -53.825 67.361  1.00 38.86 ? 146  ALA G O     1 
ATOM   6622  C  CB    . ALA E  1 147 ? 23.601  -52.114 69.632  1.00 39.05 ? 146  ALA G CB    1 
ATOM   6623  N  N     . ARG E  1 148 ? 23.991  -54.493 67.627  1.00 39.74 ? 147  ARG G N     1 
ATOM   6624  C  CA    . ARG E  1 148 ? 24.132  -55.074 66.290  1.00 40.27 ? 147  ARG G CA    1 
ATOM   6625  C  C     . ARG E  1 148 ? 23.233  -56.290 66.100  1.00 40.25 ? 147  ARG G C     1 
ATOM   6626  O  O     . ARG E  1 148 ? 22.644  -56.478 65.034  1.00 40.05 ? 147  ARG G O     1 
ATOM   6627  C  CB    . ARG E  1 148 ? 25.589  -55.504 66.043  1.00 40.71 ? 147  ARG G CB    1 
ATOM   6628  C  CG    . ARG E  1 148 ? 26.608  -54.370 66.058  1.00 42.02 ? 147  ARG G CG    1 
ATOM   6629  C  CD    . ARG E  1 148 ? 27.898  -54.812 65.433  1.00 45.33 ? 147  ARG G CD    1 
ATOM   6630  N  NE    . ARG E  1 148 ? 28.581  -55.874 66.174  1.00 46.91 ? 147  ARG G NE    1 
ATOM   6631  C  CZ    . ARG E  1 148 ? 29.517  -55.683 67.106  1.00 47.95 ? 147  ARG G CZ    1 
ATOM   6632  N  NH1   . ARG E  1 148 ? 30.060  -56.733 67.703  1.00 47.15 ? 147  ARG G NH1   1 
ATOM   6633  N  NH2   . ARG E  1 148 ? 29.910  -54.460 67.452  1.00 48.83 ? 147  ARG G NH2   1 
ATOM   6634  N  N     . GLU E  1 149 ? 23.149  -57.116 67.140  1.00 40.33 ? 148  GLU G N     1 
ATOM   6635  C  CA    . GLU E  1 149 ? 22.359  -58.344 67.110  1.00 40.60 ? 148  GLU G CA    1 
ATOM   6636  C  C     . GLU E  1 149 ? 20.876  -58.062 66.883  1.00 39.52 ? 148  GLU G C     1 
ATOM   6637  O  O     . GLU E  1 149 ? 20.201  -58.800 66.185  1.00 39.16 ? 148  GLU G O     1 
ATOM   6638  C  CB    . GLU E  1 149 ? 22.538  -59.110 68.418  1.00 40.68 ? 148  GLU G CB    1 
ATOM   6639  C  CG    . GLU E  1 149 ? 21.922  -60.497 68.399  1.00 42.29 ? 148  GLU G CG    1 
ATOM   6640  C  CD    . GLU E  1 149 ? 22.038  -61.227 69.736  1.00 42.79 ? 148  GLU G CD    1 
ATOM   6641  O  OE1   . GLU E  1 149 ? 23.124  -61.182 70.370  1.00 42.85 ? 148  GLU G OE1   1 
ATOM   6642  O  OE2   . GLU E  1 149 ? 21.024  -61.848 70.136  1.00 45.47 ? 148  GLU G OE2   1 
ATOM   6643  N  N     . ILE E  1 150 ? 20.381  -56.978 67.469  1.00 38.98 ? 149  ILE G N     1 
ATOM   6644  C  CA    . ILE E  1 150 ? 18.965  -56.633 67.364  1.00 38.13 ? 149  ILE G CA    1 
ATOM   6645  C  C     . ILE E  1 150 ? 18.675  -55.597 66.269  1.00 38.04 ? 149  ILE G C     1 
ATOM   6646  O  O     . ILE E  1 150 ? 17.549  -55.075 66.184  1.00 38.24 ? 149  ILE G O     1 
ATOM   6647  C  CB    . ILE E  1 150 ? 18.393  -56.207 68.758  1.00 38.15 ? 149  ILE G CB    1 
ATOM   6648  C  CG1   . ILE E  1 150 ? 18.879  -54.815 69.186  1.00 37.84 ? 149  ILE G CG1   1 
ATOM   6649  C  CG2   . ILE E  1 150 ? 18.730  -57.292 69.814  1.00 36.54 ? 149  ILE G CG2   1 
ATOM   6650  C  CD1   . ILE E  1 150 ? 18.072  -54.217 70.325  1.00 37.31 ? 149  ILE G CD1   1 
ATOM   6651  N  N     . GLY E  1 151 ? 19.678  -55.300 65.436  1.00 37.42 ? 150  GLY G N     1 
ATOM   6652  C  CA    . GLY E  1 151 ? 19.499  -54.371 64.318  1.00 37.51 ? 150  GLY G CA    1 
ATOM   6653  C  C     . GLY E  1 151 ? 19.108  -52.965 64.760  1.00 37.56 ? 150  GLY G C     1 
ATOM   6654  O  O     . GLY E  1 151 ? 18.237  -52.330 64.182  1.00 37.30 ? 150  GLY G O     1 
ATOM   6655  N  N     . SER E  1 152 ? 19.789  -52.491 65.788  1.00 37.52 ? 151  SER G N     1 
ATOM   6656  C  CA    . SER E  1 152 ? 19.555  -51.183 66.370  1.00 37.86 ? 151  SER G CA    1 
ATOM   6657  C  C     . SER E  1 152 ? 20.229  -50.082 65.540  1.00 37.79 ? 151  SER G C     1 
ATOM   6658  O  O     . SER E  1 152 ? 21.261  -50.306 64.911  1.00 37.52 ? 151  SER G O     1 
ATOM   6659  C  CB    . SER E  1 152 ? 20.092  -51.177 67.810  1.00 37.37 ? 151  SER G CB    1 
ATOM   6660  O  OG    . SER E  1 152 ? 20.048  -49.878 68.366  1.00 40.22 ? 151  SER G OG    1 
ATOM   6661  N  N     . VAL E  1 153 ? 19.625  -48.896 65.542  1.00 37.65 ? 152  VAL G N     1 
ATOM   6662  C  CA    . VAL E  1 153 ? 20.212  -47.715 64.897  1.00 37.72 ? 152  VAL G CA    1 
ATOM   6663  C  C     . VAL E  1 153 ? 21.479  -47.281 65.634  1.00 38.24 ? 152  VAL G C     1 
ATOM   6664  O  O     . VAL E  1 153 ? 22.498  -46.985 65.010  1.00 38.48 ? 152  VAL G O     1 
ATOM   6665  C  CB    . VAL E  1 153 ? 19.213  -46.516 64.863  1.00 37.03 ? 152  VAL G CB    1 
ATOM   6666  C  CG1   . VAL E  1 153 ? 19.867  -45.271 64.311  1.00 37.32 ? 152  VAL G CG1   1 
ATOM   6667  C  CG2   . VAL E  1 153 ? 17.986  -46.852 64.048  1.00 36.47 ? 152  VAL G CG2   1 
ATOM   6668  N  N     . LYS E  1 154 ? 21.406  -47.272 66.962  1.00 38.80 ? 153  LYS G N     1 
ATOM   6669  C  CA    . LYS E  1 154 ? 22.477  -46.729 67.809  1.00 39.27 ? 153  LYS G CA    1 
ATOM   6670  C  C     . LYS E  1 154 ? 22.398  -47.402 69.191  1.00 38.67 ? 153  LYS G C     1 
ATOM   6671  O  O     . LYS E  1 154 ? 21.306  -47.723 69.654  1.00 38.99 ? 153  LYS G O     1 
ATOM   6672  C  CB    . LYS E  1 154 ? 22.288  -45.205 67.935  1.00 39.47 ? 153  LYS G CB    1 
ATOM   6673  C  CG    . LYS E  1 154 ? 23.543  -44.338 67.726  1.00 41.19 ? 153  LYS G CG    1 
ATOM   6674  C  CD    . LYS E  1 154 ? 23.662  -43.819 66.296  1.00 42.76 ? 153  LYS G CD    1 
ATOM   6675  N  N     . TYR E  1 155 ? 23.547  -47.639 69.821  1.00 38.21 ? 154  TYR G N     1 
ATOM   6676  C  CA    . TYR E  1 155 ? 23.620  -48.030 71.217  1.00 37.64 ? 154  TYR G CA    1 
ATOM   6677  C  C     . TYR E  1 155 ? 24.103  -46.830 72.001  1.00 37.75 ? 154  TYR G C     1 
ATOM   6678  O  O     . TYR E  1 155 ? 25.165  -46.260 71.688  1.00 38.24 ? 154  TYR G O     1 
ATOM   6679  C  CB    . TYR E  1 155 ? 24.593  -49.195 71.432  1.00 37.46 ? 154  TYR G CB    1 
ATOM   6680  C  CG    . TYR E  1 155 ? 24.897  -49.454 72.897  1.00 36.54 ? 154  TYR G CG    1 
ATOM   6681  C  CD1   . TYR E  1 155 ? 23.881  -49.820 73.770  1.00 36.73 ? 154  TYR G CD1   1 
ATOM   6682  C  CD2   . TYR E  1 155 ? 26.193  -49.317 73.417  1.00 36.03 ? 154  TYR G CD2   1 
ATOM   6683  C  CE1   . TYR E  1 155 ? 24.137  -50.059 75.099  1.00 36.05 ? 154  TYR G CE1   1 
ATOM   6684  C  CE2   . TYR E  1 155 ? 26.450  -49.545 74.760  1.00 35.18 ? 154  TYR G CE2   1 
ATOM   6685  C  CZ    . TYR E  1 155 ? 25.411  -49.926 75.592  1.00 35.81 ? 154  TYR G CZ    1 
ATOM   6686  O  OH    . TYR E  1 155 ? 25.609  -50.160 76.936  1.00 36.22 ? 154  TYR G OH    1 
ATOM   6687  N  N     . LEU E  1 156 ? 23.346  -46.473 73.030  1.00 37.28 ? 155  LEU G N     1 
ATOM   6688  C  CA    . LEU E  1 156 ? 23.617  -45.291 73.850  1.00 37.35 ? 155  LEU G CA    1 
ATOM   6689  C  C     . LEU E  1 156 ? 23.554  -45.646 75.330  1.00 37.37 ? 155  LEU G C     1 
ATOM   6690  O  O     . LEU E  1 156 ? 22.746  -46.477 75.752  1.00 37.41 ? 155  LEU G O     1 
ATOM   6691  C  CB    . LEU E  1 156 ? 22.598  -44.173 73.550  1.00 36.99 ? 155  LEU G CB    1 
ATOM   6692  C  CG    . LEU E  1 156 ? 22.661  -43.664 72.112  1.00 36.61 ? 155  LEU G CG    1 
ATOM   6693  C  CD1   . LEU E  1 156 ? 21.533  -42.729 71.824  1.00 35.29 ? 155  LEU G CD1   1 
ATOM   6694  C  CD2   . LEU E  1 156 ? 24.028  -43.014 71.787  1.00 34.62 ? 155  LEU G CD2   1 
ATOM   6695  N  N     . GLU E  1 157 ? 24.413  -44.994 76.108  1.00 37.63 ? 156  GLU G N     1 
ATOM   6696  C  CA    . GLU E  1 157 ? 24.459  -45.175 77.566  1.00 37.78 ? 156  GLU G CA    1 
ATOM   6697  C  C     . GLU E  1 157 ? 24.203  -43.857 78.259  1.00 37.49 ? 156  GLU G C     1 
ATOM   6698  O  O     . GLU E  1 157 ? 24.656  -42.796 77.812  1.00 36.96 ? 156  GLU G O     1 
ATOM   6699  C  CB    . GLU E  1 157 ? 25.821  -45.696 78.002  1.00 37.38 ? 156  GLU G CB    1 
ATOM   6700  C  CG    . GLU E  1 157 ? 26.182  -47.047 77.406  1.00 38.44 ? 156  GLU G CG    1 
ATOM   6701  C  CD    . GLU E  1 157 ? 27.498  -47.559 77.898  1.00 38.35 ? 156  GLU G CD    1 
ATOM   6702  O  OE1   . GLU E  1 157 ? 28.359  -46.719 78.230  1.00 40.08 ? 156  GLU G OE1   1 
ATOM   6703  O  OE2   . GLU E  1 157 ? 27.688  -48.794 77.924  1.00 39.08 ? 156  GLU G OE2   1 
ATOM   6704  N  N     . CYS E  1 158 ? 23.502  -43.931 79.377  1.00 37.88 ? 157  CYS G N     1 
ATOM   6705  C  CA    . CYS E  1 158 ? 23.144  -42.732 80.097  1.00 37.98 ? 157  CYS G CA    1 
ATOM   6706  C  C     . CYS E  1 158 ? 22.787  -42.988 81.546  1.00 37.92 ? 157  CYS G C     1 
ATOM   6707  O  O     . CYS E  1 158 ? 22.648  -44.153 81.981  1.00 38.04 ? 157  CYS G O     1 
ATOM   6708  C  CB    . CYS E  1 158 ? 21.978  -42.017 79.397  1.00 38.49 ? 157  CYS G CB    1 
ATOM   6709  S  SG    . CYS E  1 158 ? 20.339  -42.732 79.659  1.00 38.48 ? 157  CYS G SG    1 
ATOM   6710  N  N     . SER E  1 159 ? 22.661  -41.869 82.269  1.00 37.53 ? 158  SER G N     1 
ATOM   6711  C  CA    . SER E  1 159 ? 22.189  -41.818 83.647  1.00 37.08 ? 158  SER G CA    1 
ATOM   6712  C  C     . SER E  1 159 ? 21.067  -40.788 83.727  1.00 36.64 ? 158  SER G C     1 
ATOM   6713  O  O     . SER E  1 159 ? 21.280  -39.603 83.451  1.00 36.48 ? 158  SER G O     1 
ATOM   6714  C  CB    . SER E  1 159 ? 23.346  -41.438 84.594  1.00 36.92 ? 158  SER G CB    1 
ATOM   6715  O  OG    . SER E  1 159 ? 22.908  -41.309 85.938  1.00 35.90 ? 158  SER G OG    1 
ATOM   6716  N  N     . ALA E  1 160 ? 19.868  -41.234 84.088  1.00 36.53 ? 159  ALA G N     1 
ATOM   6717  C  CA    . ALA E  1 160 ? 18.781  -40.300 84.389  1.00 36.50 ? 159  ALA G CA    1 
ATOM   6718  C  C     . ALA E  1 160 ? 19.207  -39.417 85.572  1.00 36.14 ? 159  ALA G C     1 
ATOM   6719  O  O     . ALA E  1 160 ? 18.885  -38.222 85.619  1.00 35.86 ? 159  ALA G O     1 
ATOM   6720  C  CB    . ALA E  1 160 ? 17.481  -41.032 84.693  1.00 36.06 ? 159  ALA G CB    1 
ATOM   6721  N  N     . LEU E  1 161 ? 19.975  -40.007 86.490  1.00 36.07 ? 160  LEU G N     1 
ATOM   6722  C  CA    . LEU E  1 161 ? 20.319  -39.372 87.763  1.00 35.90 ? 160  LEU G CA    1 
ATOM   6723  C  C     . LEU E  1 161 ? 21.296  -38.195 87.590  1.00 36.23 ? 160  LEU G C     1 
ATOM   6724  O  O     . LEU E  1 161 ? 21.051  -37.087 88.101  1.00 35.83 ? 160  LEU G O     1 
ATOM   6725  C  CB    . LEU E  1 161 ? 20.873  -40.424 88.742  1.00 35.87 ? 160  LEU G CB    1 
ATOM   6726  C  CG    . LEU E  1 161 ? 21.379  -39.915 90.101  1.00 36.06 ? 160  LEU G CG    1 
ATOM   6727  C  CD1   . LEU E  1 161 ? 20.238  -39.365 90.927  1.00 38.25 ? 160  LEU G CD1   1 
ATOM   6728  C  CD2   . LEU E  1 161 ? 22.143  -40.997 90.861  1.00 35.62 ? 160  LEU G CD2   1 
ATOM   6729  N  N     . THR E  1 162 ? 22.399  -38.434 86.883  1.00 36.60 ? 161  THR G N     1 
ATOM   6730  C  CA    . THR E  1 162 ? 23.405  -37.387 86.656  1.00 36.72 ? 161  THR G CA    1 
ATOM   6731  C  C     . THR E  1 162 ? 23.148  -36.630 85.344  1.00 37.26 ? 161  THR G C     1 
ATOM   6732  O  O     . THR E  1 162 ? 23.669  -35.535 85.158  1.00 36.80 ? 161  THR G O     1 
ATOM   6733  C  CB    . THR E  1 162 ? 24.842  -37.956 86.682  1.00 36.90 ? 161  THR G CB    1 
ATOM   6734  O  OG1   . THR E  1 162 ? 25.038  -38.834 85.565  1.00 36.35 ? 161  THR G OG1   1 
ATOM   6735  C  CG2   . THR E  1 162 ? 25.098  -38.721 88.005  1.00 35.60 ? 161  THR G CG2   1 
ATOM   6736  N  N     . GLN E  1 163 ? 22.317  -37.216 84.471  1.00 37.97 ? 162  GLN G N     1 
ATOM   6737  C  CA    . GLN E  1 163 ? 22.002  -36.689 83.129  1.00 38.57 ? 162  GLN G CA    1 
ATOM   6738  C  C     . GLN E  1 163 ? 23.167  -36.874 82.154  1.00 39.10 ? 162  GLN G C     1 
ATOM   6739  O  O     . GLN E  1 163 ? 23.129  -36.379 81.024  1.00 39.24 ? 162  GLN G O     1 
ATOM   6740  C  CB    . GLN E  1 163 ? 21.511  -35.228 83.172  1.00 38.75 ? 162  GLN G CB    1 
ATOM   6741  C  CG    . GLN E  1 163 ? 20.314  -35.008 84.128  1.00 38.63 ? 162  GLN G CG    1 
ATOM   6742  C  CD    . GLN E  1 163 ? 19.467  -33.791 83.759  1.00 39.82 ? 162  GLN G CD    1 
ATOM   6743  O  OE1   . GLN E  1 163 ? 19.981  -32.683 83.631  1.00 41.98 ? 162  GLN G OE1   1 
ATOM   6744  N  NE2   . GLN E  1 163 ? 18.165  -34.001 83.578  1.00 39.98 ? 162  GLN G NE2   1 
ATOM   6745  N  N     . ARG E  1 164 ? 24.190  -37.619 82.567  1.00 39.64 ? 163  ARG G N     1 
ATOM   6746  C  CA    . ARG E  1 164 ? 25.287  -37.925 81.668  1.00 40.67 ? 163  ARG G CA    1 
ATOM   6747  C  C     . ARG E  1 164 ? 24.751  -38.759 80.510  1.00 39.54 ? 163  ARG G C     1 
ATOM   6748  O  O     . ARG E  1 164 ? 24.143  -39.800 80.724  1.00 39.08 ? 163  ARG G O     1 
ATOM   6749  C  CB    . ARG E  1 164 ? 26.405  -38.681 82.381  1.00 40.89 ? 163  ARG G CB    1 
ATOM   6750  C  CG    . ARG E  1 164 ? 27.693  -38.691 81.557  1.00 43.72 ? 163  ARG G CG    1 
ATOM   6751  C  CD    . ARG E  1 164 ? 28.877  -39.409 82.231  1.00 45.27 ? 163  ARG G CD    1 
ATOM   6752  N  NE    . ARG E  1 164 ? 29.884  -39.749 81.213  1.00 49.46 ? 163  ARG G NE    1 
ATOM   6753  C  CZ    . ARG E  1 164 ? 30.777  -40.738 81.307  1.00 50.77 ? 163  ARG G CZ    1 
ATOM   6754  N  NH1   . ARG E  1 164 ? 30.838  -41.515 82.388  1.00 51.86 ? 163  ARG G NH1   1 
ATOM   6755  N  NH2   . ARG E  1 164 ? 31.625  -40.949 80.302  1.00 51.42 ? 163  ARG G NH2   1 
ATOM   6756  N  N     . GLY E  1 165 ? 24.933  -38.262 79.290  1.00 39.12 ? 164  GLY G N     1 
ATOM   6757  C  CA    . GLY E  1 165 ? 24.522  -38.980 78.081  1.00 38.90 ? 164  GLY G CA    1 
ATOM   6758  C  C     . GLY E  1 165 ? 23.038  -38.952 77.801  1.00 38.79 ? 164  GLY G C     1 
ATOM   6759  O  O     . GLY E  1 165 ? 22.570  -39.582 76.838  1.00 39.50 ? 164  GLY G O     1 
ATOM   6760  N  N     . LEU E  1 166 ? 22.292  -38.192 78.598  1.00 38.32 ? 165  LEU G N     1 
ATOM   6761  C  CA    . LEU E  1 166 ? 20.833  -38.261 78.582  1.00 38.07 ? 165  LEU G CA    1 
ATOM   6762  C  C     . LEU E  1 166 ? 20.197  -37.514 77.402  1.00 38.73 ? 165  LEU G C     1 
ATOM   6763  O  O     . LEU E  1 166 ? 19.328  -38.066 76.693  1.00 38.51 ? 165  LEU G O     1 
ATOM   6764  C  CB    . LEU E  1 166 ? 20.274  -37.712 79.900  1.00 38.19 ? 165  LEU G CB    1 
ATOM   6765  C  CG    . LEU E  1 166 ? 18.743  -37.727 80.037  1.00 38.05 ? 165  LEU G CG    1 
ATOM   6766  C  CD1   . LEU E  1 166 ? 18.190  -39.148 79.971  1.00 36.94 ? 165  LEU G CD1   1 
ATOM   6767  C  CD2   . LEU E  1 166 ? 18.301  -37.004 81.307  1.00 37.33 ? 165  LEU G CD2   1 
ATOM   6768  N  N     . LYS E  1 167 ? 20.606  -36.255 77.212  1.00 38.90 ? 166  LYS G N     1 
ATOM   6769  C  CA    . LYS E  1 167 ? 20.132  -35.457 76.085  1.00 38.87 ? 166  LYS G CA    1 
ATOM   6770  C  C     . LYS E  1 167 ? 20.483  -36.117 74.767  1.00 38.78 ? 166  LYS G C     1 
ATOM   6771  O  O     . LYS E  1 167 ? 19.670  -36.121 73.845  1.00 38.99 ? 166  LYS G O     1 
ATOM   6772  C  CB    . LYS E  1 167 ? 20.683  -34.014 76.118  1.00 39.14 ? 166  LYS G CB    1 
ATOM   6773  C  CG    . LYS E  1 167 ? 20.122  -33.139 74.975  1.00 39.09 ? 166  LYS G CG    1 
ATOM   6774  C  CD    . LYS E  1 167 ? 20.421  -31.668 75.154  1.00 38.88 ? 166  LYS G CD    1 
ATOM   6775  C  CE    . LYS E  1 167 ? 19.912  -30.816 73.967  1.00 38.33 ? 166  LYS G CE    1 
ATOM   6776  N  NZ    . LYS E  1 167 ? 20.544  -31.194 72.648  1.00 36.83 ? 166  LYS G NZ    1 
ATOM   6777  N  N     . THR E  1 168 ? 21.690  -36.677 74.684  1.00 38.96 ? 167  THR G N     1 
ATOM   6778  C  CA    . THR E  1 168 ? 22.122  -37.458 73.521  1.00 38.62 ? 167  THR G CA    1 
ATOM   6779  C  C     . THR E  1 168 ? 21.137  -38.564 73.135  1.00 38.49 ? 167  THR G C     1 
ATOM   6780  O  O     . THR E  1 168 ? 20.865  -38.748 71.956  1.00 38.41 ? 167  THR G O     1 
ATOM   6781  C  CB    . THR E  1 168 ? 23.484  -38.102 73.761  1.00 38.75 ? 167  THR G CB    1 
ATOM   6782  O  OG1   . THR E  1 168 ? 24.454  -37.067 73.911  1.00 40.08 ? 167  THR G OG1   1 
ATOM   6783  C  CG2   . THR E  1 168 ? 23.886  -39.031 72.593  1.00 38.25 ? 167  THR G CG2   1 
ATOM   6784  N  N     . VAL E  1 169 ? 20.607  -39.300 74.110  1.00 38.54 ? 168  VAL G N     1 
ATOM   6785  C  CA    . VAL E  1 169 ? 19.622  -40.361 73.806  1.00 38.17 ? 168  VAL G CA    1 
ATOM   6786  C  C     . VAL E  1 169 ? 18.491  -39.785 72.981  1.00 38.34 ? 168  VAL G C     1 
ATOM   6787  O  O     . VAL E  1 169 ? 18.109  -40.342 71.954  1.00 37.68 ? 168  VAL G O     1 
ATOM   6788  C  CB    . VAL E  1 169 ? 19.002  -41.003 75.069  1.00 38.30 ? 168  VAL G CB    1 
ATOM   6789  C  CG1   . VAL E  1 169 ? 17.756  -41.873 74.699  1.00 36.93 ? 168  VAL G CG1   1 
ATOM   6790  C  CG2   . VAL E  1 169 ? 20.041  -41.825 75.850  1.00 37.37 ? 168  VAL G CG2   1 
ATOM   6791  N  N     . PHE E  1 170 ? 17.960  -38.658 73.443  1.00 38.65 ? 169  PHE G N     1 
ATOM   6792  C  CA    . PHE E  1 170 ? 16.795  -38.070 72.818  1.00 38.73 ? 169  PHE G CA    1 
ATOM   6793  C  C     . PHE E  1 170 ? 17.116  -37.292 71.552  1.00 38.92 ? 169  PHE G C     1 
ATOM   6794  O  O     . PHE E  1 170 ? 16.280  -37.248 70.644  1.00 38.86 ? 169  PHE G O     1 
ATOM   6795  C  CB    . PHE E  1 170 ? 15.997  -37.257 73.841  1.00 38.77 ? 169  PHE G CB    1 
ATOM   6796  C  CG    . PHE E  1 170 ? 15.299  -38.120 74.838  1.00 37.93 ? 169  PHE G CG    1 
ATOM   6797  C  CD1   . PHE E  1 170 ? 14.091  -38.732 74.519  1.00 38.35 ? 169  PHE G CD1   1 
ATOM   6798  C  CD2   . PHE E  1 170 ? 15.877  -38.387 76.070  1.00 39.18 ? 169  PHE G CD2   1 
ATOM   6799  C  CE1   . PHE E  1 170 ? 13.446  -39.572 75.427  1.00 37.40 ? 169  PHE G CE1   1 
ATOM   6800  C  CE2   . PHE E  1 170 ? 15.242  -39.233 76.997  1.00 38.82 ? 169  PHE G CE2   1 
ATOM   6801  C  CZ    . PHE E  1 170 ? 14.019  -39.817 76.677  1.00 38.48 ? 169  PHE G CZ    1 
ATOM   6802  N  N     . ASP E  1 171 ? 18.316  -36.710 71.477  1.00 39.13 ? 170  ASP G N     1 
ATOM   6803  C  CA    . ASP E  1 171 ? 18.795  -36.081 70.244  1.00 39.40 ? 170  ASP G CA    1 
ATOM   6804  C  C     . ASP E  1 171 ? 18.882  -37.129 69.136  1.00 39.53 ? 170  ASP G C     1 
ATOM   6805  O  O     . ASP E  1 171 ? 18.481  -36.877 67.989  1.00 38.78 ? 170  ASP G O     1 
ATOM   6806  C  CB    . ASP E  1 171 ? 20.191  -35.445 70.429  1.00 39.73 ? 170  ASP G CB    1 
ATOM   6807  C  CG    . ASP E  1 171 ? 20.165  -34.134 71.221  1.00 40.48 ? 170  ASP G CG    1 
ATOM   6808  O  OD1   . ASP E  1 171 ? 19.088  -33.691 71.693  1.00 42.72 ? 170  ASP G OD1   1 
ATOM   6809  O  OD2   . ASP E  1 171 ? 21.253  -33.543 71.381  1.00 43.10 ? 170  ASP G OD2   1 
ATOM   6810  N  N     . GLU E  1 172 ? 19.439  -38.289 69.490  1.00 39.70 ? 171  GLU G N     1 
ATOM   6811  C  CA    . GLU E  1 172 ? 19.623  -39.376 68.543  1.00 40.41 ? 171  GLU G CA    1 
ATOM   6812  C  C     . GLU E  1 172 ? 18.284  -39.991 68.116  1.00 39.78 ? 171  GLU G C     1 
ATOM   6813  O  O     . GLU E  1 172 ? 18.087  -40.331 66.953  1.00 39.85 ? 171  GLU G O     1 
ATOM   6814  C  CB    . GLU E  1 172 ? 20.566  -40.447 69.115  1.00 41.01 ? 171  GLU G CB    1 
ATOM   6815  C  CG    . GLU E  1 172 ? 22.044  -40.056 69.140  1.00 43.02 ? 171  GLU G CG    1 
ATOM   6816  C  CD    . GLU E  1 172 ? 22.606  -39.704 67.775  1.00 47.07 ? 171  GLU G CD    1 
ATOM   6817  O  OE1   . GLU E  1 172 ? 22.308  -40.403 66.776  1.00 49.34 ? 171  GLU G OE1   1 
ATOM   6818  O  OE2   . GLU E  1 172 ? 23.352  -38.696 67.698  1.00 52.20 ? 171  GLU G OE2   1 
ATOM   6819  N  N     . ALA E  1 173 ? 17.364  -40.104 69.062  1.00 39.35 ? 172  ALA G N     1 
ATOM   6820  C  CA    . ALA E  1 173 ? 16.020  -40.579 68.764  1.00 39.07 ? 172  ALA G CA    1 
ATOM   6821  C  C     . ALA E  1 173 ? 15.389  -39.681 67.721  1.00 38.79 ? 172  ALA G C     1 
ATOM   6822  O  O     . ALA E  1 173 ? 14.840  -40.159 66.734  1.00 39.82 ? 172  ALA G O     1 
ATOM   6823  C  CB    . ALA E  1 173 ? 15.159  -40.629 70.032  1.00 38.40 ? 172  ALA G CB    1 
ATOM   6824  N  N     . ILE E  1 174 ? 15.499  -38.378 67.934  1.00 38.86 ? 173  ILE G N     1 
ATOM   6825  C  CA    . ILE E  1 174 ? 14.931  -37.384 67.027  1.00 38.75 ? 173  ILE G CA    1 
ATOM   6826  C  C     . ILE E  1 174 ? 15.580  -37.475 65.631  1.00 39.17 ? 173  ILE G C     1 
ATOM   6827  O  O     . ILE E  1 174 ? 14.883  -37.546 64.622  1.00 39.55 ? 173  ILE G O     1 
ATOM   6828  C  CB    . ILE E  1 174 ? 15.055  -35.953 67.642  1.00 38.85 ? 173  ILE G CB    1 
ATOM   6829  C  CG1   . ILE E  1 174 ? 14.176  -35.855 68.902  1.00 38.47 ? 173  ILE G CG1   1 
ATOM   6830  C  CG2   . ILE E  1 174 ? 14.694  -34.850 66.608  1.00 37.84 ? 173  ILE G CG2   1 
ATOM   6831  C  CD1   . ILE E  1 174 ? 14.431  -34.628 69.775  1.00 38.20 ? 173  ILE G CD1   1 
ATOM   6832  N  N     . ARG E  1 175 ? 16.908  -37.506 65.583  1.00 39.45 ? 174  ARG G N     1 
ATOM   6833  C  CA    . ARG E  1 175 ? 17.648  -37.653 64.318  1.00 39.83 ? 174  ARG G CA    1 
ATOM   6834  C  C     . ARG E  1 175 ? 17.337  -38.970 63.592  1.00 39.73 ? 174  ARG G C     1 
ATOM   6835  O  O     . ARG E  1 175 ? 17.410  -39.035 62.354  1.00 39.30 ? 174  ARG G O     1 
ATOM   6836  C  CB    . ARG E  1 175 ? 19.161  -37.595 64.567  1.00 40.32 ? 174  ARG G CB    1 
ATOM   6837  C  CG    . ARG E  1 175 ? 19.694  -36.251 65.034  1.00 41.49 ? 174  ARG G CG    1 
ATOM   6838  C  CD    . ARG E  1 175 ? 19.870  -35.306 63.900  1.00 44.26 ? 174  ARG G CD    1 
ATOM   6839  N  NE    . ARG E  1 175 ? 20.273  -33.987 64.381  1.00 46.18 ? 174  ARG G NE    1 
ATOM   6840  C  CZ    . ARG E  1 175 ? 19.834  -32.826 63.884  1.00 46.48 ? 174  ARG G CZ    1 
ATOM   6841  N  NH1   . ARG E  1 175 ? 18.959  -32.789 62.879  1.00 46.61 ? 174  ARG G NH1   1 
ATOM   6842  N  NH2   . ARG E  1 175 ? 20.268  -31.687 64.415  1.00 45.25 ? 174  ARG G NH2   1 
ATOM   6843  N  N     . ALA E  1 176 ? 17.020  -40.014 64.366  1.00 39.45 ? 175  ALA G N     1 
ATOM   6844  C  CA    . ALA E  1 176 ? 16.663  -41.311 63.797  1.00 39.29 ? 175  ALA G CA    1 
ATOM   6845  C  C     . ALA E  1 176 ? 15.413  -41.212 62.932  1.00 38.86 ? 175  ALA G C     1 
ATOM   6846  O  O     . ALA E  1 176 ? 15.283  -41.932 61.953  1.00 39.09 ? 175  ALA G O     1 
ATOM   6847  C  CB    . ALA E  1 176 ? 16.470  -42.361 64.896  1.00 39.41 ? 175  ALA G CB    1 
ATOM   6848  N  N     . VAL E  1 177 ? 14.508  -40.308 63.291  1.00 38.99 ? 176  VAL G N     1 
ATOM   6849  C  CA    . VAL E  1 177 ? 13.245  -40.116 62.564  1.00 38.73 ? 176  VAL G CA    1 
ATOM   6850  C  C     . VAL E  1 177 ? 13.387  -38.998 61.521  1.00 39.51 ? 176  VAL G C     1 
ATOM   6851  O  O     . VAL E  1 177 ? 12.927  -39.156 60.393  1.00 38.81 ? 176  VAL G O     1 
ATOM   6852  C  CB    . VAL E  1 177 ? 12.063  -39.834 63.550  1.00 38.62 ? 176  VAL G CB    1 
ATOM   6853  C  CG1   . VAL E  1 177 ? 10.727  -39.693 62.807  1.00 37.81 ? 176  VAL G CG1   1 
ATOM   6854  C  CG2   . VAL E  1 177 ? 11.977  -40.951 64.603  1.00 36.97 ? 176  VAL G CG2   1 
ATOM   6855  N  N     . LEU E  1 178 ? 14.055  -37.901 61.884  1.00 40.22 ? 177  LEU G N     1 
ATOM   6856  C  CA    . LEU E  1 178 ? 14.103  -36.708 61.028  1.00 41.71 ? 177  LEU G CA    1 
ATOM   6857  C  C     . LEU E  1 178 ? 15.350  -36.547 60.168  1.00 43.00 ? 177  LEU G C     1 
ATOM   6858  O  O     . LEU E  1 178 ? 15.361  -35.690 59.287  1.00 42.99 ? 177  LEU G O     1 
ATOM   6859  C  CB    . LEU E  1 178 ? 13.935  -35.441 61.871  1.00 41.59 ? 177  LEU G CB    1 
ATOM   6860  C  CG    . LEU E  1 178 ? 12.606  -35.269 62.598  1.00 41.88 ? 177  LEU G CG    1 
ATOM   6861  C  CD1   . LEU E  1 178 ? 12.519  -33.832 63.076  1.00 41.79 ? 177  LEU G CD1   1 
ATOM   6862  C  CD2   . LEU E  1 178 ? 11.416  -35.634 61.702  1.00 41.02 ? 177  LEU G CD2   1 
ATOM   6863  N  N     . GLY E  1 179 ? 16.381  -37.351 60.415  1.00 45.31 ? 178  GLY G N     1 
ATOM   6864  C  CA    . GLY E  1 179 ? 17.643  -37.253 59.665  1.00 47.12 ? 178  GLY G CA    1 
ATOM   6865  C  C     . GLY E  1 179 ? 18.639  -36.324 60.346  1.00 48.53 ? 178  GLY G C     1 
ATOM   6866  O  O     . GLY E  1 179 ? 18.571  -35.099 60.250  1.00 49.34 ? 178  GLY G O     1 
ATOM   6867  O  OXT   . GLY E  1 179 ? 19.554  -36.775 61.049  1.00 50.68 ? 178  GLY G OXT   1 
ATOM   6868  N  N     . SER F  1 1   ? -0.536  -24.626 81.274  1.00 43.09 ? 0    SER D N     1 
ATOM   6869  C  CA    . SER F  1 1   ? -1.551  -23.561 81.427  1.00 43.45 ? 0    SER D CA    1 
ATOM   6870  C  C     . SER F  1 1   ? -2.773  -23.921 80.611  1.00 43.13 ? 0    SER D C     1 
ATOM   6871  O  O     . SER F  1 1   ? -2.764  -24.944 79.918  1.00 42.87 ? 0    SER D O     1 
ATOM   6872  C  CB    . SER F  1 1   ? -0.978  -22.220 80.962  1.00 43.93 ? 0    SER D CB    1 
ATOM   6873  O  OG    . SER F  1 1   ? -0.169  -22.407 79.813  1.00 45.26 ? 0    SER D OG    1 
ATOM   6874  N  N     . MET F  1 2   ? -3.809  -23.084 80.701  1.00 42.52 ? 1    MET D N     1 
ATOM   6875  C  CA    . MET F  1 2   ? -5.049  -23.247 79.942  1.00 42.46 ? 1    MET D CA    1 
ATOM   6876  C  C     . MET F  1 2   ? -4.805  -23.383 78.447  1.00 42.47 ? 1    MET D C     1 
ATOM   6877  O  O     . MET F  1 2   ? -3.873  -22.792 77.894  1.00 41.93 ? 1    MET D O     1 
ATOM   6878  C  CB    . MET F  1 2   ? -5.966  -22.033 80.140  1.00 42.77 ? 1    MET D CB    1 
ATOM   6879  N  N     . GLN F  1 3   ? -5.672  -24.152 77.800  1.00 42.70 ? 2    GLN D N     1 
ATOM   6880  C  CA    . GLN F  1 3   ? -5.629  -24.301 76.359  1.00 42.85 ? 2    GLN D CA    1 
ATOM   6881  C  C     . GLN F  1 3   ? -5.880  -22.915 75.768  1.00 42.47 ? 2    GLN D C     1 
ATOM   6882  O  O     . GLN F  1 3   ? -6.842  -22.241 76.142  1.00 42.07 ? 2    GLN D O     1 
ATOM   6883  C  CB    . GLN F  1 3   ? -6.675  -25.325 75.869  1.00 43.24 ? 2    GLN D CB    1 
ATOM   6884  C  CG    . GLN F  1 3   ? -6.166  -26.318 74.812  1.00 43.55 ? 2    GLN D CG    1 
ATOM   6885  N  N     . ALA F  1 4   ? -4.965  -22.486 74.901  1.00 41.89 ? 3    ALA D N     1 
ATOM   6886  C  CA    . ALA F  1 4   ? -5.082  -21.235 74.176  1.00 41.38 ? 3    ALA D CA    1 
ATOM   6887  C  C     . ALA F  1 4   ? -4.856  -21.490 72.688  1.00 40.88 ? 3    ALA D C     1 
ATOM   6888  O  O     . ALA F  1 4   ? -4.120  -22.411 72.305  1.00 41.02 ? 3    ALA D O     1 
ATOM   6889  C  CB    . ALA F  1 4   ? -4.077  -20.217 74.705  1.00 41.41 ? 3    ALA D CB    1 
ATOM   6890  N  N     . ILE F  1 5   ? -5.511  -20.687 71.858  1.00 40.01 ? 4    ILE D N     1 
ATOM   6891  C  CA    . ILE F  1 5   ? -5.334  -20.746 70.415  1.00 39.16 ? 4    ILE D CA    1 
ATOM   6892  C  C     . ILE F  1 5   ? -5.073  -19.348 69.882  1.00 38.57 ? 4    ILE D C     1 
ATOM   6893  O  O     . ILE F  1 5   ? -5.848  -18.430 70.140  1.00 38.53 ? 4    ILE D O     1 
ATOM   6894  C  CB    . ILE F  1 5   ? -6.592  -21.291 69.716  1.00 39.27 ? 4    ILE D CB    1 
ATOM   6895  C  CG1   . ILE F  1 5   ? -6.778  -22.780 70.025  1.00 39.34 ? 4    ILE D CG1   1 
ATOM   6896  C  CG2   . ILE F  1 5   ? -6.504  -21.071 68.218  1.00 37.50 ? 4    ILE D CG2   1 
ATOM   6897  C  CD1   . ILE F  1 5   ? -8.216  -23.229 69.911  1.00 39.80 ? 4    ILE D CD1   1 
ATOM   6898  N  N     . LYS F  1 6   ? -3.982  -19.201 69.139  1.00 38.02 ? 5    LYS D N     1 
ATOM   6899  C  CA    . LYS F  1 6   ? -3.697  -17.982 68.410  1.00 37.59 ? 5    LYS D CA    1 
ATOM   6900  C  C     . LYS F  1 6   ? -4.220  -18.102 66.968  1.00 37.73 ? 5    LYS D C     1 
ATOM   6901  O  O     . LYS F  1 6   ? -3.793  -18.976 66.192  1.00 37.28 ? 5    LYS D O     1 
ATOM   6902  C  CB    . LYS F  1 6   ? -2.199  -17.685 68.413  1.00 37.66 ? 5    LYS D CB    1 
ATOM   6903  C  CG    . LYS F  1 6   ? -1.839  -16.379 67.697  1.00 37.71 ? 5    LYS D CG    1 
ATOM   6904  C  CD    . LYS F  1 6   ? -0.357  -16.083 67.787  1.00 36.98 ? 5    LYS D CD    1 
ATOM   6905  C  CE    . LYS F  1 6   ? 0.045   -14.997 66.815  1.00 35.63 ? 5    LYS D CE    1 
ATOM   6906  N  NZ    . LYS F  1 6   ? 1.344   -14.388 67.189  1.00 34.57 ? 5    LYS D NZ    1 
ATOM   6907  N  N     . CYS F  1 7   ? -5.137  -17.204 66.621  1.00 37.41 ? 6    CYS D N     1 
ATOM   6908  C  CA    . CYS F  1 7   ? -5.772  -17.205 65.319  1.00 37.49 ? 6    CYS D CA    1 
ATOM   6909  C  C     . CYS F  1 7   ? -5.472  -15.884 64.604  1.00 37.23 ? 6    CYS D C     1 
ATOM   6910  O  O     . CYS F  1 7   ? -5.878  -14.825 65.085  1.00 37.46 ? 6    CYS D O     1 
ATOM   6911  C  CB    . CYS F  1 7   ? -7.278  -17.388 65.476  1.00 37.38 ? 6    CYS D CB    1 
ATOM   6912  S  SG    . CYS F  1 7   ? -8.168  -17.251 63.925  1.00 38.82 ? 6    CYS D SG    1 
ATOM   6913  N  N     . VAL F  1 8   ? -4.737  -15.948 63.491  1.00 36.67 ? 7    VAL D N     1 
ATOM   6914  C  CA    . VAL F  1 8   ? -4.410  -14.743 62.710  1.00 36.31 ? 7    VAL D CA    1 
ATOM   6915  C  C     . VAL F  1 8   ? -5.278  -14.676 61.455  1.00 35.96 ? 7    VAL D C     1 
ATOM   6916  O  O     . VAL F  1 8   ? -5.458  -15.659 60.744  1.00 35.20 ? 7    VAL D O     1 
ATOM   6917  C  CB    . VAL F  1 8   ? -2.893  -14.663 62.346  1.00 36.31 ? 7    VAL D CB    1 
ATOM   6918  C  CG1   . VAL F  1 8   ? -2.620  -13.509 61.378  1.00 35.04 ? 7    VAL D CG1   1 
ATOM   6919  C  CG2   . VAL F  1 8   ? -2.044  -14.513 63.605  1.00 35.32 ? 7    VAL D CG2   1 
ATOM   6920  N  N     . VAL F  1 9   ? -5.833  -13.493 61.216  1.00 36.36 ? 8    VAL D N     1 
ATOM   6921  C  CA    . VAL F  1 9   ? -6.786  -13.250 60.141  1.00 35.67 ? 8    VAL D CA    1 
ATOM   6922  C  C     . VAL F  1 9   ? -6.127  -12.308 59.123  1.00 35.78 ? 8    VAL D C     1 
ATOM   6923  O  O     . VAL F  1 9   ? -5.684  -11.196 59.465  1.00 35.27 ? 8    VAL D O     1 
ATOM   6924  C  CB    . VAL F  1 9   ? -8.105  -12.639 60.720  1.00 36.53 ? 8    VAL D CB    1 
ATOM   6925  C  CG1   . VAL F  1 9   ? -9.148  -12.353 59.614  1.00 35.83 ? 8    VAL D CG1   1 
ATOM   6926  C  CG2   . VAL F  1 9   ? -8.702  -13.572 61.793  1.00 34.45 ? 8    VAL D CG2   1 
ATOM   6927  N  N     . VAL F  1 10  ? -6.049  -12.764 57.874  1.00 35.54 ? 9    VAL D N     1 
ATOM   6928  C  CA    . VAL F  1 10  ? -5.424  -12.002 56.810  1.00 35.47 ? 9    VAL D CA    1 
ATOM   6929  C  C     . VAL F  1 10  ? -6.304  -12.014 55.561  1.00 36.16 ? 9    VAL D C     1 
ATOM   6930  O  O     . VAL F  1 10  ? -7.228  -12.808 55.458  1.00 36.70 ? 9    VAL D O     1 
ATOM   6931  C  CB    . VAL F  1 10  ? -3.982  -12.539 56.507  1.00 35.56 ? 9    VAL D CB    1 
ATOM   6932  C  CG1   . VAL F  1 10  ? -3.179  -12.675 57.803  1.00 33.57 ? 9    VAL D CG1   1 
ATOM   6933  C  CG2   . VAL F  1 10  ? -4.016  -13.881 55.778  1.00 34.37 ? 9    VAL D CG2   1 
ATOM   6934  N  N     . GLY F  1 11  ? -6.016  -11.111 54.630  1.00 36.09 ? 10   GLY D N     1 
ATOM   6935  C  CA    . GLY F  1 11  ? -6.803  -10.938 53.419  1.00 35.82 ? 10   GLY D CA    1 
ATOM   6936  C  C     . GLY F  1 11  ? -6.800  -9.473  52.984  1.00 36.09 ? 10   GLY D C     1 
ATOM   6937  O  O     . GLY F  1 11  ? -6.387  -8.570  53.745  1.00 35.17 ? 10   GLY D O     1 
ATOM   6938  N  N     . ASP F  1 12  ? -7.285  -9.247  51.769  1.00 35.66 ? 11   ASP D N     1 
ATOM   6939  C  CA    . ASP F  1 12  ? -7.253  -7.934  51.152  1.00 36.49 ? 11   ASP D CA    1 
ATOM   6940  C  C     . ASP F  1 12  ? -7.999  -6.860  51.925  1.00 36.73 ? 11   ASP D C     1 
ATOM   6941  O  O     . ASP F  1 12  ? -8.845  -7.142  52.776  1.00 37.19 ? 11   ASP D O     1 
ATOM   6942  C  CB    . ASP F  1 12  ? -7.867  -7.999  49.747  1.00 36.78 ? 11   ASP D CB    1 
ATOM   6943  C  CG    . ASP F  1 12  ? -6.861  -8.359  48.667  1.00 37.47 ? 11   ASP D CG    1 
ATOM   6944  O  OD1   . ASP F  1 12  ? -5.708  -8.811  48.973  1.00 38.49 ? 11   ASP D OD1   1 
ATOM   6945  O  OD2   . ASP F  1 12  ? -7.257  -8.171  47.490  1.00 38.55 ? 11   ASP D OD2   1 
ATOM   6946  N  N     . GLY F  1 13  ? -7.703  -5.616  51.585  1.00 36.92 ? 12   GLY D N     1 
ATOM   6947  C  CA    . GLY F  1 13  ? -8.522  -4.493  52.032  1.00 37.57 ? 12   GLY D CA    1 
ATOM   6948  C  C     . GLY F  1 13  ? -9.990  -4.713  51.678  1.00 37.95 ? 12   GLY D C     1 
ATOM   6949  O  O     . GLY F  1 13  ? -10.315 -5.457  50.732  1.00 38.47 ? 12   GLY D O     1 
ATOM   6950  N  N     . ALA F  1 14  ? -10.846 -4.082  52.479  1.00 37.77 ? 13   ALA D N     1 
ATOM   6951  C  CA    . ALA F  1 14  ? -12.307 -4.131  52.401  1.00 37.79 ? 13   ALA D CA    1 
ATOM   6952  C  C     . ALA F  1 14  ? -13.015 -5.511  52.353  1.00 37.49 ? 13   ALA D C     1 
ATOM   6953  O  O     . ALA F  1 14  ? -14.177 -5.569  51.992  1.00 37.45 ? 13   ALA D O     1 
ATOM   6954  C  CB    . ALA F  1 14  ? -12.793 -3.203  51.256  1.00 37.53 ? 13   ALA D CB    1 
ATOM   6955  N  N     . VAL F  1 15  ? -12.367 -6.608  52.756  1.00 38.03 ? 14   VAL D N     1 
ATOM   6956  C  CA    . VAL F  1 15  ? -12.997 -7.929  52.614  1.00 37.29 ? 14   VAL D CA    1 
ATOM   6957  C  C     . VAL F  1 15  ? -13.911 -8.298  53.786  1.00 37.38 ? 14   VAL D C     1 
ATOM   6958  O  O     . VAL F  1 15  ? -14.839 -9.089  53.605  1.00 37.49 ? 14   VAL D O     1 
ATOM   6959  C  CB    . VAL F  1 15  ? -11.991 -9.092  52.271  1.00 37.67 ? 14   VAL D CB    1 
ATOM   6960  C  CG1   . VAL F  1 15  ? -11.034 -8.666  51.147  1.00 37.04 ? 14   VAL D CG1   1 
ATOM   6961  C  CG2   . VAL F  1 15  ? -11.241 -9.598  53.496  1.00 38.01 ? 14   VAL D CG2   1 
ATOM   6962  N  N     . GLY F  1 16  ? -13.668 -7.713  54.964  1.00 37.00 ? 15   GLY D N     1 
ATOM   6963  C  CA    . GLY F  1 16  ? -14.551 -7.850  56.118  1.00 36.48 ? 15   GLY D CA    1 
ATOM   6964  C  C     . GLY F  1 16  ? -13.974 -8.611  57.297  1.00 36.64 ? 15   GLY D C     1 
ATOM   6965  O  O     . GLY F  1 16  ? -14.734 -9.156  58.090  1.00 35.98 ? 15   GLY D O     1 
ATOM   6966  N  N     . LYS F  1 17  ? -12.633 -8.645  57.385  1.00 36.62 ? 16   LYS D N     1 
ATOM   6967  C  CA    . LYS F  1 17  ? -11.881 -9.268  58.483  1.00 36.48 ? 16   LYS D CA    1 
ATOM   6968  C  C     . LYS F  1 17  ? -12.274 -8.752  59.860  1.00 36.79 ? 16   LYS D C     1 
ATOM   6969  O  O     . LYS F  1 17  ? -12.539 -9.538  60.782  1.00 37.79 ? 16   LYS D O     1 
ATOM   6970  C  CB    . LYS F  1 17  ? -10.355 -9.056  58.297  1.00 36.22 ? 16   LYS D CB    1 
ATOM   6971  C  CG    . LYS F  1 17  ? -9.785  -9.663  57.010  1.00 35.91 ? 16   LYS D CG    1 
ATOM   6972  C  CD    . LYS F  1 17  ? -8.264  -9.516  56.879  1.00 36.12 ? 16   LYS D CD    1 
ATOM   6973  C  CE    . LYS F  1 17  ? -7.779  -8.066  56.677  1.00 35.40 ? 16   LYS D CE    1 
ATOM   6974  N  NZ    . LYS F  1 17  ? -8.325  -7.444  55.443  1.00 36.16 ? 16   LYS D NZ    1 
ATOM   6975  N  N     . THR F  1 18  ? -12.309 -7.436  60.022  1.00 36.28 ? 17   THR D N     1 
ATOM   6976  C  CA    . THR F  1 18  ? -12.607 -6.868  61.329  1.00 35.89 ? 17   THR D CA    1 
ATOM   6977  C  C     . THR F  1 18  ? -14.081 -7.113  61.738  1.00 36.47 ? 17   THR D C     1 
ATOM   6978  O  O     . THR F  1 18  ? -14.355 -7.568  62.854  1.00 35.47 ? 17   THR D O     1 
ATOM   6979  C  CB    . THR F  1 18  ? -12.230 -5.392  61.360  1.00 35.45 ? 17   THR D CB    1 
ATOM   6980  O  OG1   . THR F  1 18  ? -10.810 -5.295  61.176  1.00 33.33 ? 17   THR D OG1   1 
ATOM   6981  C  CG2   . THR F  1 18  ? -12.626 -4.746  62.695  1.00 34.00 ? 17   THR D CG2   1 
ATOM   6982  N  N     . CYS F  1 19  ? -15.007 -6.845  60.813  1.00 36.69 ? 18   CYS D N     1 
ATOM   6983  C  CA    . CYS F  1 19  ? -16.425 -7.112  61.039  1.00 37.26 ? 18   CYS D CA    1 
ATOM   6984  C  C     . CYS F  1 19  ? -16.679 -8.566  61.410  1.00 37.15 ? 18   CYS D C     1 
ATOM   6985  O  O     . CYS F  1 19  ? -17.467 -8.858  62.294  1.00 37.31 ? 18   CYS D O     1 
ATOM   6986  C  CB    . CYS F  1 19  ? -17.252 -6.748  59.806  1.00 37.02 ? 18   CYS D CB    1 
ATOM   6987  S  SG    . CYS F  1 19  ? -17.449 -4.985  59.626  1.00 37.85 ? 18   CYS D SG    1 
ATOM   6988  N  N     . LEU F  1 20  ? -15.987 -9.458  60.729  1.00 37.60 ? 19   LEU D N     1 
ATOM   6989  C  CA    . LEU F  1 20  ? -16.015 -10.880 61.033  1.00 38.02 ? 19   LEU D CA    1 
ATOM   6990  C  C     . LEU F  1 20  ? -15.654 -11.111 62.499  1.00 37.52 ? 19   LEU D C     1 
ATOM   6991  O  O     . LEU F  1 20  ? -16.350 -11.822 63.225  1.00 37.60 ? 19   LEU D O     1 
ATOM   6992  C  CB    . LEU F  1 20  ? -15.005 -11.573 60.097  1.00 38.64 ? 19   LEU D CB    1 
ATOM   6993  C  CG    . LEU F  1 20  ? -14.726 -13.070 60.116  1.00 38.89 ? 19   LEU D CG    1 
ATOM   6994  C  CD1   . LEU F  1 20  ? -15.671 -13.769 59.154  1.00 39.85 ? 19   LEU D CD1   1 
ATOM   6995  C  CD2   . LEU F  1 20  ? -13.279 -13.301 59.721  1.00 38.87 ? 19   LEU D CD2   1 
ATOM   6996  N  N     . LEU F  1 21  ? -14.555 -10.521 62.942  1.00 37.63 ? 20   LEU D N     1 
ATOM   6997  C  CA    . LEU F  1 21  ? -14.062 -10.788 64.302  1.00 37.55 ? 20   LEU D CA    1 
ATOM   6998  C  C     . LEU F  1 21  ? -14.983 -10.187 65.381  1.00 37.68 ? 20   LEU D C     1 
ATOM   6999  O  O     . LEU F  1 21  ? -15.258 -10.834 66.414  1.00 37.71 ? 20   LEU D O     1 
ATOM   7000  C  CB    . LEU F  1 21  ? -12.615 -10.308 64.461  1.00 37.47 ? 20   LEU D CB    1 
ATOM   7001  C  CG    . LEU F  1 21  ? -11.612 -11.149 63.657  1.00 37.57 ? 20   LEU D CG    1 
ATOM   7002  C  CD1   . LEU F  1 21  ? -10.286 -10.416 63.472  1.00 36.18 ? 20   LEU D CD1   1 
ATOM   7003  C  CD2   . LEU F  1 21  ? -11.418 -12.565 64.268  1.00 36.71 ? 20   LEU D CD2   1 
ATOM   7004  N  N     . ILE F  1 22  ? -15.474 -8.976  65.117  1.00 37.04 ? 21   ILE D N     1 
ATOM   7005  C  CA    . ILE F  1 22  ? -16.316 -8.248  66.063  1.00 36.84 ? 21   ILE D CA    1 
ATOM   7006  C  C     . ILE F  1 22  ? -17.732 -8.833  66.133  1.00 36.93 ? 21   ILE D C     1 
ATOM   7007  O  O     . ILE F  1 22  ? -18.286 -9.024  67.213  1.00 36.41 ? 21   ILE D O     1 
ATOM   7008  C  CB    . ILE F  1 22  ? -16.394 -6.730  65.693  1.00 37.29 ? 21   ILE D CB    1 
ATOM   7009  C  CG1   . ILE F  1 22  ? -15.033 -6.055  65.918  1.00 36.97 ? 21   ILE D CG1   1 
ATOM   7010  C  CG2   . ILE F  1 22  ? -17.534 -5.999  66.480  1.00 36.21 ? 21   ILE D CG2   1 
ATOM   7011  C  CD1   . ILE F  1 22  ? -14.451 -6.244  67.330  1.00 37.85 ? 21   ILE D CD1   1 
ATOM   7012  N  N     . SER F  1 23  ? -18.315 -9.114  64.974  1.00 37.11 ? 22   SER D N     1 
ATOM   7013  C  CA    . SER F  1 23  ? -19.600 -9.791  64.920  1.00 37.03 ? 22   SER D CA    1 
ATOM   7014  C  C     . SER F  1 23  ? -19.576 -11.130 65.683  1.00 37.17 ? 22   SER D C     1 
ATOM   7015  O  O     . SER F  1 23  ? -20.507 -11.460 66.424  1.00 37.26 ? 22   SER D O     1 
ATOM   7016  C  CB    . SER F  1 23  ? -20.031 -9.983  63.465  1.00 36.53 ? 22   SER D CB    1 
ATOM   7017  O  OG    . SER F  1 23  ? -21.316 -10.550 63.426  1.00 36.93 ? 22   SER D OG    1 
ATOM   7018  N  N     . TYR F  1 24  ? -18.513 -11.904 65.506  1.00 37.42 ? 23   TYR D N     1 
ATOM   7019  C  CA    . TYR F  1 24  ? -18.395 -13.177 66.204  1.00 37.42 ? 23   TYR D CA    1 
ATOM   7020  C  C     . TYR F  1 24  ? -18.288 -12.965 67.711  1.00 37.92 ? 23   TYR D C     1 
ATOM   7021  O  O     . TYR F  1 24  ? -19.066 -13.525 68.482  1.00 38.19 ? 23   TYR D O     1 
ATOM   7022  C  CB    . TYR F  1 24  ? -17.180 -13.958 65.679  1.00 37.57 ? 23   TYR D CB    1 
ATOM   7023  C  CG    . TYR F  1 24  ? -16.847 -15.195 66.473  1.00 37.47 ? 23   TYR D CG    1 
ATOM   7024  C  CD1   . TYR F  1 24  ? -17.762 -16.236 66.584  1.00 36.91 ? 23   TYR D CD1   1 
ATOM   7025  C  CD2   . TYR F  1 24  ? -15.613 -15.326 67.115  1.00 37.85 ? 23   TYR D CD2   1 
ATOM   7026  C  CE1   . TYR F  1 24  ? -17.467 -17.375 67.304  1.00 37.11 ? 23   TYR D CE1   1 
ATOM   7027  C  CE2   . TYR F  1 24  ? -15.301 -16.464 67.839  1.00 36.75 ? 23   TYR D CE2   1 
ATOM   7028  C  CZ    . TYR F  1 24  ? -16.241 -17.488 67.937  1.00 37.60 ? 23   TYR D CZ    1 
ATOM   7029  O  OH    . TYR F  1 24  ? -15.959 -18.633 68.649  1.00 37.47 ? 23   TYR D OH    1 
ATOM   7030  N  N     . THR F  1 25  ? -17.331 -12.145 68.135  1.00 38.33 ? 24   THR D N     1 
ATOM   7031  C  CA    . THR F  1 25  ? -17.045 -11.978 69.564  1.00 38.45 ? 24   THR D CA    1 
ATOM   7032  C  C     . THR F  1 25  ? -18.071 -11.117 70.331  1.00 38.75 ? 24   THR D C     1 
ATOM   7033  O  O     . THR F  1 25  ? -18.276 -11.335 71.520  1.00 38.46 ? 24   THR D O     1 
ATOM   7034  C  CB    . THR F  1 25  ? -15.644 -11.352 69.802  1.00 38.41 ? 24   THR D CB    1 
ATOM   7035  O  OG1   . THR F  1 25  ? -15.573 -10.067 69.167  1.00 38.60 ? 24   THR D OG1   1 
ATOM   7036  C  CG2   . THR F  1 25  ? -14.543 -12.261 69.277  1.00 38.12 ? 24   THR D CG2   1 
ATOM   7037  N  N     . THR F  1 26  ? -18.693 -10.145 69.674  1.00 38.83 ? 25   THR D N     1 
ATOM   7038  C  CA    . THR F  1 26  ? -19.575 -9.199  70.383  1.00 39.50 ? 25   THR D CA    1 
ATOM   7039  C  C     . THR F  1 26  ? -21.041 -9.236  69.959  1.00 39.66 ? 25   THR D C     1 
ATOM   7040  O  O     . THR F  1 26  ? -21.879 -8.603  70.601  1.00 40.48 ? 25   THR D O     1 
ATOM   7041  C  CB    . THR F  1 26  ? -19.095 -7.730  70.223  1.00 39.26 ? 25   THR D CB    1 
ATOM   7042  O  OG1   . THR F  1 26  ? -19.291 -7.299  68.868  1.00 39.83 ? 25   THR D OG1   1 
ATOM   7043  C  CG2   . THR F  1 26  ? -17.630 -7.589  70.585  1.00 39.99 ? 25   THR D CG2   1 
ATOM   7044  N  N     . ASN F  1 27  ? -21.351 -9.953  68.887  1.00 39.97 ? 26   ASN D N     1 
ATOM   7045  C  CA    . ASN F  1 27  ? -22.689 -9.954  68.287  1.00 40.33 ? 26   ASN D CA    1 
ATOM   7046  C  C     . ASN F  1 27  ? -23.169 -8.584  67.823  1.00 40.10 ? 26   ASN D C     1 
ATOM   7047  O  O     . ASN F  1 27  ? -24.367 -8.348  67.722  1.00 40.63 ? 26   ASN D O     1 
ATOM   7048  C  CB    . ASN F  1 27  ? -23.728 -10.600 69.216  1.00 40.47 ? 26   ASN D CB    1 
ATOM   7049  C  CG    . ASN F  1 27  ? -23.650 -12.111 69.219  1.00 42.14 ? 26   ASN D CG    1 
ATOM   7050  O  OD1   . ASN F  1 27  ? -23.329 -12.743 68.196  1.00 43.37 ? 26   ASN D OD1   1 
ATOM   7051  N  ND2   . ASN F  1 27  ? -23.958 -12.709 70.372  1.00 42.94 ? 26   ASN D ND2   1 
ATOM   7052  N  N     . ALA F  1 28  ? -22.228 -7.700  67.512  1.00 40.00 ? 27   ALA D N     1 
ATOM   7053  C  CA    . ALA F  1 28  ? -22.536 -6.366  67.010  1.00 39.87 ? 27   ALA D CA    1 
ATOM   7054  C  C     . ALA F  1 28  ? -21.778 -6.184  65.728  1.00 39.39 ? 27   ALA D C     1 
ATOM   7055  O  O     . ALA F  1 28  ? -20.691 -6.723  65.585  1.00 40.07 ? 27   ALA D O     1 
ATOM   7056  C  CB    . ALA F  1 28  ? -22.126 -5.292  68.025  1.00 40.18 ? 27   ALA D CB    1 
ATOM   7057  N  N     . PHE F  1 29  ? -22.365 -5.455  64.784  1.00 39.15 ? 28   PHE D N     1 
ATOM   7058  C  CA    . PHE F  1 29  ? -21.724 -5.175  63.500  1.00 38.89 ? 28   PHE D CA    1 
ATOM   7059  C  C     . PHE F  1 29  ? -21.245 -3.729  63.546  1.00 39.19 ? 28   PHE D C     1 
ATOM   7060  O  O     . PHE F  1 29  ? -22.040 -2.843  63.805  1.00 38.85 ? 28   PHE D O     1 
ATOM   7061  C  CB    . PHE F  1 29  ? -22.708 -5.361  62.346  1.00 38.42 ? 28   PHE D CB    1 
ATOM   7062  C  CG    . PHE F  1 29  ? -22.059 -5.363  60.996  1.00 37.73 ? 28   PHE D CG    1 
ATOM   7063  C  CD1   . PHE F  1 29  ? -21.466 -6.511  60.500  1.00 37.39 ? 28   PHE D CD1   1 
ATOM   7064  C  CD2   . PHE F  1 29  ? -22.026 -4.212  60.223  1.00 37.07 ? 28   PHE D CD2   1 
ATOM   7065  C  CE1   . PHE F  1 29  ? -20.858 -6.512  59.269  1.00 36.61 ? 28   PHE D CE1   1 
ATOM   7066  C  CE2   . PHE F  1 29  ? -21.438 -4.213  58.988  1.00 35.68 ? 28   PHE D CE2   1 
ATOM   7067  C  CZ    . PHE F  1 29  ? -20.850 -5.358  58.515  1.00 37.00 ? 28   PHE D CZ    1 
ATOM   7068  N  N     . PRO F  1 30  ? -19.939 -3.494  63.331  1.00 39.81 ? 29   PRO D N     1 
ATOM   7069  C  CA    . PRO F  1 30  ? -19.395 -2.123  63.362  1.00 40.22 ? 29   PRO D CA    1 
ATOM   7070  C  C     . PRO F  1 30  ? -20.119 -1.161  62.415  1.00 40.40 ? 29   PRO D C     1 
ATOM   7071  O  O     . PRO F  1 30  ? -20.384 -1.501  61.271  1.00 40.36 ? 29   PRO D O     1 
ATOM   7072  C  CB    . PRO F  1 30  ? -17.941 -2.314  62.933  1.00 40.20 ? 29   PRO D CB    1 
ATOM   7073  C  CG    . PRO F  1 30  ? -17.627 -3.743  63.306  1.00 39.87 ? 29   PRO D CG    1 
ATOM   7074  C  CD    . PRO F  1 30  ? -18.889 -4.501  63.079  1.00 39.67 ? 29   PRO D CD    1 
ATOM   7075  N  N     . GLY F  1 31  ? -20.439 0.024   62.914  1.00 40.81 ? 30   GLY D N     1 
ATOM   7076  C  CA    . GLY F  1 31  ? -21.267 0.970   62.187  1.00 41.43 ? 30   GLY D CA    1 
ATOM   7077  C  C     . GLY F  1 31  ? -20.499 1.800   61.179  1.00 41.56 ? 30   GLY D C     1 
ATOM   7078  O  O     . GLY F  1 31  ? -21.101 2.488   60.361  1.00 42.20 ? 30   GLY D O     1 
ATOM   7079  N  N     . GLU F  1 32  ? -19.171 1.753   61.251  1.00 41.68 ? 31   GLU D N     1 
ATOM   7080  C  CA    . GLU F  1 32  ? -18.315 2.505   60.342  1.00 41.34 ? 31   GLU D CA    1 
ATOM   7081  C  C     . GLU F  1 32  ? -17.339 1.553   59.719  1.00 40.84 ? 31   GLU D C     1 
ATOM   7082  O  O     . GLU F  1 32  ? -17.035 0.495   60.296  1.00 40.62 ? 31   GLU D O     1 
ATOM   7083  C  CB    . GLU F  1 32  ? -17.528 3.590   61.097  1.00 41.86 ? 31   GLU D CB    1 
ATOM   7084  C  CG    . GLU F  1 32  ? -18.356 4.798   61.549  1.00 42.53 ? 31   GLU D CG    1 
ATOM   7085  N  N     . TYR F  1 33  ? -16.845 1.936   58.540  1.00 39.43 ? 32   TYR D N     1 
ATOM   7086  C  CA    . TYR F  1 33  ? -15.754 1.238   57.893  1.00 38.49 ? 32   TYR D CA    1 
ATOM   7087  C  C     . TYR F  1 33  ? -14.457 2.003   58.154  1.00 37.42 ? 32   TYR D C     1 
ATOM   7088  O  O     . TYR F  1 33  ? -14.220 3.058   57.569  1.00 37.00 ? 32   TYR D O     1 
ATOM   7089  C  CB    . TYR F  1 33  ? -16.051 1.076   56.393  1.00 38.53 ? 32   TYR D CB    1 
ATOM   7090  C  CG    . TYR F  1 33  ? -14.887 0.650   55.531  1.00 38.38 ? 32   TYR D CG    1 
ATOM   7091  C  CD1   . TYR F  1 33  ? -13.917 -0.228  55.997  1.00 38.28 ? 32   TYR D CD1   1 
ATOM   7092  C  CD2   . TYR F  1 33  ? -14.763 1.128   54.238  1.00 38.34 ? 32   TYR D CD2   1 
ATOM   7093  C  CE1   . TYR F  1 33  ? -12.845 -0.601  55.198  1.00 38.56 ? 32   TYR D CE1   1 
ATOM   7094  C  CE2   . TYR F  1 33  ? -13.696 0.738   53.422  1.00 39.84 ? 32   TYR D CE2   1 
ATOM   7095  C  CZ    . TYR F  1 33  ? -12.745 -0.123  53.908  1.00 38.40 ? 32   TYR D CZ    1 
ATOM   7096  O  OH    . TYR F  1 33  ? -11.690 -0.486  53.095  1.00 38.71 ? 32   TYR D OH    1 
ATOM   7097  N  N     . ILE F  1 34  ? -13.648 1.464   59.059  1.00 36.54 ? 33   ILE D N     1 
ATOM   7098  C  CA    . ILE F  1 34  ? -12.317 1.998   59.414  1.00 36.17 ? 33   ILE D CA    1 
ATOM   7099  C  C     . ILE F  1 34  ? -11.236 0.923   59.189  1.00 35.98 ? 33   ILE D C     1 
ATOM   7100  O  O     . ILE F  1 34  ? -11.179 -0.077  59.925  1.00 36.11 ? 33   ILE D O     1 
ATOM   7101  C  CB    . ILE F  1 34  ? -12.282 2.470   60.904  1.00 36.46 ? 33   ILE D CB    1 
ATOM   7102  C  CG1   . ILE F  1 34  ? -13.422 3.467   61.179  1.00 36.68 ? 33   ILE D CG1   1 
ATOM   7103  C  CG2   . ILE F  1 34  ? -10.944 3.125   61.253  1.00 35.77 ? 33   ILE D CG2   1 
ATOM   7104  C  CD1   . ILE F  1 34  ? -13.542 3.933   62.639  1.00 36.21 ? 33   ILE D CD1   1 
ATOM   7105  N  N     . PRO F  1 35  ? -10.406 1.085   58.146  1.00 35.93 ? 34   PRO D N     1 
ATOM   7106  C  CA    . PRO F  1 35  ? -9.292  0.160   57.912  1.00 35.88 ? 34   PRO D CA    1 
ATOM   7107  C  C     . PRO F  1 35  ? -8.342  -0.049  59.128  1.00 36.12 ? 34   PRO D C     1 
ATOM   7108  O  O     . PRO F  1 35  ? -8.065  0.893   59.888  1.00 36.02 ? 34   PRO D O     1 
ATOM   7109  C  CB    . PRO F  1 35  ? -8.551  0.800   56.737  1.00 36.11 ? 34   PRO D CB    1 
ATOM   7110  C  CG    . PRO F  1 35  ? -9.599  1.616   56.035  1.00 35.66 ? 34   PRO D CG    1 
ATOM   7111  C  CD    . PRO F  1 35  ? -10.504 2.109   57.086  1.00 36.30 ? 34   PRO D CD    1 
ATOM   7112  N  N     . THR F  1 36  ? -7.862  -1.282  59.275  1.00 35.59 ? 35   THR D N     1 
ATOM   7113  C  CA    . THR F  1 36  ? -7.065  -1.727  60.429  1.00 35.89 ? 35   THR D CA    1 
ATOM   7114  C  C     . THR F  1 36  ? -5.571  -1.514  60.184  1.00 35.71 ? 35   THR D C     1 
ATOM   7115  O  O     . THR F  1 36  ? -5.077  -1.753  59.080  1.00 36.11 ? 35   THR D O     1 
ATOM   7116  C  CB    . THR F  1 36  ? -7.294  -3.240  60.689  1.00 35.71 ? 35   THR D CB    1 
ATOM   7117  O  OG1   . THR F  1 36  ? -8.689  -3.476  60.873  1.00 36.61 ? 35   THR D OG1   1 
ATOM   7118  C  CG2   . THR F  1 36  ? -6.523  -3.763  61.922  1.00 34.52 ? 35   THR D CG2   1 
ATOM   7119  N  N     . VAL F  1 37  ? -4.852  -1.077  61.208  1.00 35.29 ? 36   VAL D N     1 
ATOM   7120  C  CA    . VAL F  1 37  ? -3.387  -1.136  61.173  1.00 34.99 ? 36   VAL D CA    1 
ATOM   7121  C  C     . VAL F  1 37  ? -3.011  -2.457  61.857  1.00 35.06 ? 36   VAL D C     1 
ATOM   7122  O  O     . VAL F  1 37  ? -2.396  -3.352  61.249  1.00 34.31 ? 36   VAL D O     1 
ATOM   7123  C  CB    . VAL F  1 37  ? -2.761  0.125   61.849  1.00 34.80 ? 36   VAL D CB    1 
ATOM   7124  C  CG1   . VAL F  1 37  ? -1.259  0.079   61.829  1.00 35.17 ? 36   VAL D CG1   1 
ATOM   7125  C  CG2   . VAL F  1 37  ? -3.255  1.379   61.159  1.00 33.67 ? 36   VAL D CG2   1 
ATOM   7126  N  N     . PHE F  1 38  ? -3.392  -2.573  63.127  1.00 35.14 ? 37   PHE D N     1 
ATOM   7127  C  CA    . PHE F  1 38  ? -3.357  -3.855  63.833  1.00 35.33 ? 37   PHE D CA    1 
ATOM   7128  C  C     . PHE F  1 38  ? -4.208  -3.786  65.078  1.00 36.10 ? 37   PHE D C     1 
ATOM   7129  O  O     . PHE F  1 38  ? -4.149  -2.790  65.828  1.00 36.63 ? 37   PHE D O     1 
ATOM   7130  C  CB    . PHE F  1 38  ? -1.933  -4.301  64.233  1.00 34.62 ? 37   PHE D CB    1 
ATOM   7131  C  CG    . PHE F  1 38  ? -1.932  -5.503  65.141  1.00 33.77 ? 37   PHE D CG    1 
ATOM   7132  C  CD1   . PHE F  1 38  ? -2.153  -6.775  64.624  1.00 33.63 ? 37   PHE D CD1   1 
ATOM   7133  C  CD2   . PHE F  1 38  ? -1.780  -5.361  66.513  1.00 33.19 ? 37   PHE D CD2   1 
ATOM   7134  C  CE1   . PHE F  1 38  ? -2.205  -7.888  65.448  1.00 32.51 ? 37   PHE D CE1   1 
ATOM   7135  C  CE2   . PHE F  1 38  ? -1.819  -6.471  67.353  1.00 33.39 ? 37   PHE D CE2   1 
ATOM   7136  C  CZ    . PHE F  1 38  ? -2.036  -7.744  66.814  1.00 33.37 ? 37   PHE D CZ    1 
ATOM   7137  N  N     . ASP F  1 39  ? -4.978  -4.849  65.308  1.00 36.63 ? 38   ASP D N     1 
ATOM   7138  C  CA    . ASP F  1 39  ? -5.773  -4.988  66.526  1.00 36.97 ? 38   ASP D CA    1 
ATOM   7139  C  C     . ASP F  1 39  ? -5.777  -6.417  67.027  1.00 37.41 ? 38   ASP D C     1 
ATOM   7140  O  O     . ASP F  1 39  ? -5.729  -7.352  66.241  1.00 37.23 ? 38   ASP D O     1 
ATOM   7141  C  CB    . ASP F  1 39  ? -7.200  -4.514  66.299  1.00 37.03 ? 38   ASP D CB    1 
ATOM   7142  C  CG    . ASP F  1 39  ? -7.288  -3.007  66.163  1.00 36.79 ? 38   ASP D CG    1 
ATOM   7143  O  OD1   . ASP F  1 39  ? -7.341  -2.312  67.201  1.00 38.17 ? 38   ASP D OD1   1 
ATOM   7144  O  OD2   . ASP F  1 39  ? -7.286  -2.532  65.011  1.00 39.23 ? 38   ASP D OD2   1 
ATOM   7145  N  N     . ASN F  1 40  ? -5.817  -6.558  68.348  1.00 37.98 ? 39   ASN D N     1 
ATOM   7146  C  CA    . ASN F  1 40  ? -5.821  -7.855  69.014  1.00 38.48 ? 39   ASN D CA    1 
ATOM   7147  C  C     . ASN F  1 40  ? -7.023  -7.925  69.923  1.00 38.69 ? 39   ASN D C     1 
ATOM   7148  O  O     . ASN F  1 40  ? -7.265  -7.002  70.711  1.00 39.01 ? 39   ASN D O     1 
ATOM   7149  C  CB    . ASN F  1 40  ? -4.546  -8.023  69.831  1.00 39.10 ? 39   ASN D CB    1 
ATOM   7150  C  CG    . ASN F  1 40  ? -4.427  -9.394  70.453  1.00 40.08 ? 39   ASN D CG    1 
ATOM   7151  O  OD1   . ASN F  1 40  ? -4.314  -9.519  71.661  1.00 40.94 ? 39   ASN D OD1   1 
ATOM   7152  N  ND2   . ASN F  1 40  ? -4.476  -10.429 69.627  1.00 42.31 ? 39   ASN D ND2   1 
ATOM   7153  N  N     . TYR F  1 41  ? -7.785  -9.011  69.796  1.00 39.11 ? 40   TYR D N     1 
ATOM   7154  C  CA    . TYR F  1 41  ? -8.941  -9.278  70.642  1.00 39.18 ? 40   TYR D CA    1 
ATOM   7155  C  C     . TYR F  1 41  ? -8.752  -10.595 71.369  1.00 39.24 ? 40   TYR D C     1 
ATOM   7156  O  O     . TYR F  1 41  ? -8.046  -11.462 70.885  1.00 39.07 ? 40   TYR D O     1 
ATOM   7157  C  CB    . TYR F  1 41  ? -10.213 -9.355  69.806  1.00 39.51 ? 40   TYR D CB    1 
ATOM   7158  C  CG    . TYR F  1 41  ? -10.319 -8.295  68.737  1.00 39.80 ? 40   TYR D CG    1 
ATOM   7159  C  CD1   . TYR F  1 41  ? -10.309 -8.642  67.390  1.00 40.32 ? 40   TYR D CD1   1 
ATOM   7160  C  CD2   . TYR F  1 41  ? -10.429 -6.956  69.065  1.00 39.82 ? 40   TYR D CD2   1 
ATOM   7161  C  CE1   . TYR F  1 41  ? -10.410 -7.674  66.385  1.00 40.92 ? 40   TYR D CE1   1 
ATOM   7162  C  CE2   . TYR F  1 41  ? -10.524 -5.973  68.060  1.00 40.94 ? 40   TYR D CE2   1 
ATOM   7163  C  CZ    . TYR F  1 41  ? -10.510 -6.348  66.727  1.00 39.93 ? 40   TYR D CZ    1 
ATOM   7164  O  OH    . TYR F  1 41  ? -10.619 -5.410  65.719  1.00 42.21 ? 40   TYR D OH    1 
ATOM   7165  N  N     . SER F  1 42  ? -9.379  -10.724 72.534  1.00 39.65 ? 41   SER D N     1 
ATOM   7166  C  CA    . SER F  1 42  ? -9.460  -11.998 73.265  1.00 40.12 ? 41   SER D CA    1 
ATOM   7167  C  C     . SER F  1 42  ? -10.904 -12.335 73.520  1.00 40.08 ? 41   SER D C     1 
ATOM   7168  O  O     . SER F  1 42  ? -11.737 -11.440 73.616  1.00 40.16 ? 41   SER D O     1 
ATOM   7169  C  CB    . SER F  1 42  ? -8.768  -11.927 74.622  1.00 40.03 ? 41   SER D CB    1 
ATOM   7170  O  OG    . SER F  1 42  ? -7.671  -11.048 74.573  1.00 41.96 ? 41   SER D OG    1 
ATOM   7171  N  N     . ALA F  1 43  ? -11.178 -13.633 73.633  1.00 40.37 ? 42   ALA D N     1 
ATOM   7172  C  CA    . ALA F  1 43  ? -12.468 -14.155 74.083  1.00 40.37 ? 42   ALA D CA    1 
ATOM   7173  C  C     . ALA F  1 43  ? -12.235 -15.547 74.651  1.00 40.76 ? 42   ALA D C     1 
ATOM   7174  O  O     . ALA F  1 43  ? -11.245 -16.196 74.324  1.00 40.13 ? 42   ALA D O     1 
ATOM   7175  C  CB    . ALA F  1 43  ? -13.460 -14.225 72.932  1.00 40.29 ? 42   ALA D CB    1 
ATOM   7176  N  N     . ASN F  1 44  ? -13.148 -15.999 75.499  1.00 41.45 ? 43   ASN D N     1 
ATOM   7177  C  CA    . ASN F  1 44  ? -13.145 -17.381 75.946  1.00 42.12 ? 43   ASN D CA    1 
ATOM   7178  C  C     . ASN F  1 44  ? -14.263 -18.170 75.288  1.00 42.23 ? 43   ASN D C     1 
ATOM   7179  O  O     . ASN F  1 44  ? -15.361 -17.654 75.075  1.00 42.28 ? 43   ASN D O     1 
ATOM   7180  C  CB    . ASN F  1 44  ? -13.263 -17.459 77.463  1.00 42.47 ? 43   ASN D CB    1 
ATOM   7181  C  CG    . ASN F  1 44  ? -11.970 -17.075 78.165  1.00 43.93 ? 43   ASN D CG    1 
ATOM   7182  O  OD1   . ASN F  1 44  ? -10.948 -17.769 78.048  1.00 46.13 ? 43   ASN D OD1   1 
ATOM   7183  N  ND2   . ASN F  1 44  ? -12.008 -15.976 78.908  1.00 44.60 ? 43   ASN D ND2   1 
ATOM   7184  N  N     . VAL F  1 45  ? -13.947 -19.418 74.948  1.00 42.47 ? 44   VAL D N     1 
ATOM   7185  C  CA    . VAL F  1 45  ? -14.911 -20.382 74.440  1.00 42.68 ? 44   VAL D CA    1 
ATOM   7186  C  C     . VAL F  1 45  ? -14.784 -21.686 75.237  1.00 43.10 ? 44   VAL D C     1 
ATOM   7187  O  O     . VAL F  1 45  ? -13.694 -22.071 75.638  1.00 42.82 ? 44   VAL D O     1 
ATOM   7188  C  CB    . VAL F  1 45  ? -14.683 -20.639 72.940  1.00 42.81 ? 44   VAL D CB    1 
ATOM   7189  C  CG1   . VAL F  1 45  ? -15.266 -21.968 72.519  1.00 42.96 ? 44   VAL D CG1   1 
ATOM   7190  C  CG2   . VAL F  1 45  ? -15.270 -19.478 72.106  1.00 42.77 ? 44   VAL D CG2   1 
ATOM   7191  N  N     . MET F  1 46  ? -15.913 -22.335 75.493  1.00 43.50 ? 45   MET D N     1 
ATOM   7192  C  CA    . MET F  1 46  ? -15.917 -23.641 76.114  1.00 44.05 ? 45   MET D CA    1 
ATOM   7193  C  C     . MET F  1 46  ? -15.908 -24.702 75.023  1.00 43.93 ? 45   MET D C     1 
ATOM   7194  O  O     . MET F  1 46  ? -16.837 -24.769 74.218  1.00 43.86 ? 45   MET D O     1 
ATOM   7195  C  CB    . MET F  1 46  ? -17.153 -23.804 76.998  1.00 44.61 ? 45   MET D CB    1 
ATOM   7196  C  CG    . MET F  1 46  ? -17.158 -22.905 78.233  1.00 45.65 ? 45   MET D CG    1 
ATOM   7197  S  SD    . MET F  1 46  ? -16.115 -23.514 79.578  1.00 49.38 ? 45   MET D SD    1 
ATOM   7198  C  CE    . MET F  1 46  ? -16.814 -25.139 79.904  1.00 47.20 ? 45   MET D CE    1 
ATOM   7199  N  N     . VAL F  1 47  ? -14.849 -25.508 74.994  1.00 44.03 ? 46   VAL D N     1 
ATOM   7200  C  CA    . VAL F  1 47  ? -14.717 -26.607 74.036  1.00 44.24 ? 46   VAL D CA    1 
ATOM   7201  C  C     . VAL F  1 47  ? -14.926 -27.943 74.743  1.00 44.82 ? 46   VAL D C     1 
ATOM   7202  O  O     . VAL F  1 47  ? -14.058 -28.405 75.498  1.00 45.01 ? 46   VAL D O     1 
ATOM   7203  C  CB    . VAL F  1 47  ? -13.347 -26.594 73.331  1.00 44.20 ? 46   VAL D CB    1 
ATOM   7204  C  CG1   . VAL F  1 47  ? -13.223 -27.790 72.391  1.00 43.83 ? 46   VAL D CG1   1 
ATOM   7205  C  CG2   . VAL F  1 47  ? -13.162 -25.284 72.559  1.00 43.37 ? 46   VAL D CG2   1 
ATOM   7206  N  N     . ASP F  1 48  ? -16.082 -28.554 74.486  1.00 45.38 ? 47   ASP D N     1 
ATOM   7207  C  CA    . ASP F  1 48  ? -16.523 -29.746 75.211  1.00 45.90 ? 47   ASP D CA    1 
ATOM   7208  C  C     . ASP F  1 48  ? -16.189 -30.040 76.684  1.00 46.18 ? 47   ASP D C     1 
ATOM   7209  O  O     . ASP F  1 48  ? -15.593 -31.058 77.005  1.00 46.43 ? 47   ASP D O     1 
ATOM   7210  C  CB    . ASP F  1 48  ? -17.002 -30.920 74.341  1.00 46.30 ? 47   ASP D CB    1 
ATOM   7211  N  N     . GLY F  1 49  ? -16.554 -29.106 77.559  1.00 46.40 ? 48   GLY D N     1 
ATOM   7212  C  CA    . GLY F  1 49  ? -16.251 -29.210 78.986  1.00 46.40 ? 48   GLY D CA    1 
ATOM   7213  C  C     . GLY F  1 49  ? -15.062 -28.376 79.446  1.00 46.44 ? 48   GLY D C     1 
ATOM   7214  O  O     . GLY F  1 49  ? -14.942 -28.071 80.636  1.00 46.85 ? 48   GLY D O     1 
ATOM   7215  N  N     . LYS F  1 50  ? -14.190 -27.992 78.517  1.00 46.27 ? 49   LYS D N     1 
ATOM   7216  C  CA    . LYS F  1 50  ? -12.931 -27.328 78.863  1.00 45.99 ? 49   LYS D CA    1 
ATOM   7217  C  C     . LYS F  1 50  ? -12.866 -25.887 78.338  1.00 45.58 ? 49   LYS D C     1 
ATOM   7218  O  O     . LYS F  1 50  ? -13.185 -25.636 77.173  1.00 45.31 ? 49   LYS D O     1 
ATOM   7219  C  CB    . LYS F  1 50  ? -11.754 -28.137 78.303  1.00 46.07 ? 49   LYS D CB    1 
ATOM   7220  N  N     . PRO F  1 51  ? -12.437 -24.934 79.195  1.00 45.05 ? 50   PRO D N     1 
ATOM   7221  C  CA    . PRO F  1 51  ? -12.305 -23.553 78.742  1.00 44.53 ? 50   PRO D CA    1 
ATOM   7222  C  C     . PRO F  1 51  ? -11.123 -23.379 77.802  1.00 44.03 ? 50   PRO D C     1 
ATOM   7223  O  O     . PRO F  1 51  ? -10.085 -23.994 78.000  1.00 43.92 ? 50   PRO D O     1 
ATOM   7224  C  CB    . PRO F  1 51  ? -12.082 -22.768 80.040  1.00 44.48 ? 50   PRO D CB    1 
ATOM   7225  C  CG    . PRO F  1 51  ? -11.495 -23.747 80.987  1.00 44.69 ? 50   PRO D CG    1 
ATOM   7226  C  CD    . PRO F  1 51  ? -12.047 -25.093 80.611  1.00 45.04 ? 50   PRO D CD    1 
ATOM   7227  N  N     . VAL F  1 52  ? -11.296 -22.548 76.785  1.00 43.64 ? 51   VAL D N     1 
ATOM   7228  C  CA    . VAL F  1 52  ? -10.235 -22.249 75.828  1.00 43.50 ? 51   VAL D CA    1 
ATOM   7229  C  C     . VAL F  1 52  ? -10.139 -20.734 75.593  1.00 43.45 ? 51   VAL D C     1 
ATOM   7230  O  O     . VAL F  1 52  ? -11.122 -20.094 75.210  1.00 43.20 ? 51   VAL D O     1 
ATOM   7231  C  CB    . VAL F  1 52  ? -10.488 -22.954 74.477  1.00 43.36 ? 51   VAL D CB    1 
ATOM   7232  C  CG1   . VAL F  1 52  ? -9.420  -22.568 73.462  1.00 43.28 ? 51   VAL D CG1   1 
ATOM   7233  C  CG2   . VAL F  1 52  ? -10.542 -24.469 74.663  1.00 43.33 ? 51   VAL D CG2   1 
ATOM   7234  N  N     . ASN F  1 53  ? -8.953  -20.174 75.825  1.00 43.57 ? 52   ASN D N     1 
ATOM   7235  C  CA    . ASN F  1 53  ? -8.696  -18.769 75.541  1.00 43.80 ? 52   ASN D CA    1 
ATOM   7236  C  C     . ASN F  1 53  ? -8.407  -18.573 74.059  1.00 43.28 ? 52   ASN D C     1 
ATOM   7237  O  O     . ASN F  1 53  ? -7.475  -19.152 73.513  1.00 43.22 ? 52   ASN D O     1 
ATOM   7238  C  CB    . ASN F  1 53  ? -7.523  -18.236 76.369  1.00 44.12 ? 52   ASN D CB    1 
ATOM   7239  C  CG    . ASN F  1 53  ? -7.343  -16.718 76.228  1.00 46.62 ? 52   ASN D CG    1 
ATOM   7240  O  OD1   . ASN F  1 53  ? -8.288  -15.980 75.893  1.00 49.02 ? 52   ASN D OD1   1 
ATOM   7241  N  ND2   . ASN F  1 53  ? -6.127  -16.245 76.491  1.00 49.38 ? 52   ASN D ND2   1 
ATOM   7242  N  N     . LEU F  1 54  ? -9.219  -17.747 73.422  1.00 42.85 ? 53   LEU D N     1 
ATOM   7243  C  CA    . LEU F  1 54  ? -9.094  -17.462 72.006  1.00 42.91 ? 53   LEU D CA    1 
ATOM   7244  C  C     . LEU F  1 54  ? -8.386  -16.114 71.817  1.00 41.78 ? 53   LEU D C     1 
ATOM   7245  O  O     . LEU F  1 54  ? -8.868  -15.099 72.290  1.00 41.45 ? 53   LEU D O     1 
ATOM   7246  C  CB    . LEU F  1 54  ? -10.490 -17.425 71.387  1.00 42.94 ? 53   LEU D CB    1 
ATOM   7247  C  CG    . LEU F  1 54  ? -10.595 -17.765 69.917  1.00 44.56 ? 53   LEU D CG    1 
ATOM   7248  C  CD1   . LEU F  1 54  ? -9.958  -19.122 69.680  1.00 46.41 ? 53   LEU D CD1   1 
ATOM   7249  C  CD2   . LEU F  1 54  ? -12.068 -17.757 69.480  1.00 44.49 ? 53   LEU D CD2   1 
ATOM   7250  N  N     . GLY F  1 55  ? -7.230  -16.137 71.151  1.00 41.04 ? 54   GLY D N     1 
ATOM   7251  C  CA    . GLY F  1 55  ? -6.497  -14.929 70.773  1.00 40.53 ? 54   GLY D CA    1 
ATOM   7252  C  C     . GLY F  1 55  ? -6.673  -14.641 69.289  1.00 40.06 ? 54   GLY D C     1 
ATOM   7253  O  O     . GLY F  1 55  ? -6.297  -15.458 68.446  1.00 39.63 ? 54   GLY D O     1 
ATOM   7254  N  N     . LEU F  1 56  ? -7.251  -13.484 68.982  1.00 39.43 ? 55   LEU D N     1 
ATOM   7255  C  CA    . LEU F  1 56  ? -7.592  -13.098 67.618  1.00 39.10 ? 55   LEU D CA    1 
ATOM   7256  C  C     . LEU F  1 56  ? -6.792  -11.869 67.186  1.00 39.13 ? 55   LEU D C     1 
ATOM   7257  O  O     . LEU F  1 56  ? -6.953  -10.769 67.734  1.00 38.91 ? 55   LEU D O     1 
ATOM   7258  C  CB    . LEU F  1 56  ? -9.080  -12.811 67.513  1.00 39.12 ? 55   LEU D CB    1 
ATOM   7259  C  CG    . LEU F  1 56  ? -10.016 -13.968 67.878  1.00 39.58 ? 55   LEU D CG    1 
ATOM   7260  C  CD1   . LEU F  1 56  ? -11.404 -13.434 68.200  1.00 39.57 ? 55   LEU D CD1   1 
ATOM   7261  C  CD2   . LEU F  1 56  ? -10.075 -14.986 66.739  1.00 39.51 ? 55   LEU D CD2   1 
ATOM   7262  N  N     . TRP F  1 57  ? -5.932  -12.082 66.197  1.00 38.94 ? 56   TRP D N     1 
ATOM   7263  C  CA    . TRP F  1 57  ? -5.029  -11.067 65.701  1.00 39.42 ? 56   TRP D CA    1 
ATOM   7264  C  C     . TRP F  1 57  ? -5.565  -10.519 64.355  1.00 38.94 ? 56   TRP D C     1 
ATOM   7265  O  O     . TRP F  1 57  ? -5.598  -11.209 63.342  1.00 38.45 ? 56   TRP D O     1 
ATOM   7266  C  CB    . TRP F  1 57  ? -3.627  -11.668 65.578  1.00 40.00 ? 56   TRP D CB    1 
ATOM   7267  C  CG    . TRP F  1 57  ? -3.083  -12.155 66.914  1.00 40.63 ? 56   TRP D CG    1 
ATOM   7268  C  CD1   . TRP F  1 57  ? -3.686  -13.029 67.779  1.00 40.96 ? 56   TRP D CD1   1 
ATOM   7269  C  CD2   . TRP F  1 57  ? -1.837  -11.798 67.519  1.00 40.93 ? 56   TRP D CD2   1 
ATOM   7270  N  NE1   . TRP F  1 57  ? -2.898  -13.234 68.881  1.00 41.94 ? 56   TRP D NE1   1 
ATOM   7271  C  CE2   . TRP F  1 57  ? -1.753  -12.493 68.747  1.00 41.81 ? 56   TRP D CE2   1 
ATOM   7272  C  CE3   . TRP F  1 57  ? -0.778  -10.974 67.138  1.00 41.40 ? 56   TRP D CE3   1 
ATOM   7273  C  CZ2   . TRP F  1 57  ? -0.652  -12.384 69.599  1.00 41.54 ? 56   TRP D CZ2   1 
ATOM   7274  C  CZ3   . TRP F  1 57  ? 0.325   -10.857 67.991  1.00 41.33 ? 56   TRP D CZ3   1 
ATOM   7275  C  CH2   . TRP F  1 57  ? 0.372   -11.554 69.209  1.00 41.82 ? 56   TRP D CH2   1 
ATOM   7276  N  N     . ASP F  1 58  ? -6.001  -9.266  64.380  1.00 38.61 ? 57   ASP D N     1 
ATOM   7277  C  CA    . ASP F  1 58  ? -6.706  -8.649  63.258  1.00 38.06 ? 57   ASP D CA    1 
ATOM   7278  C  C     . ASP F  1 58  ? -5.727  -7.765  62.499  1.00 37.66 ? 57   ASP D C     1 
ATOM   7279  O  O     . ASP F  1 58  ? -5.362  -6.687  62.974  1.00 37.25 ? 57   ASP D O     1 
ATOM   7280  C  CB    . ASP F  1 58  ? -7.882  -7.838  63.796  1.00 38.14 ? 57   ASP D CB    1 
ATOM   7281  C  CG    . ASP F  1 58  ? -8.737  -7.237  62.696  1.00 38.40 ? 57   ASP D CG    1 
ATOM   7282  O  OD1   . ASP F  1 58  ? -8.534  -7.581  61.510  1.00 39.86 ? 57   ASP D OD1   1 
ATOM   7283  O  OD2   . ASP F  1 58  ? -9.623  -6.423  63.027  1.00 38.92 ? 57   ASP D OD2   1 
ATOM   7284  N  N     . THR F  1 59  ? -5.307  -8.238  61.327  1.00 37.31 ? 58   THR D N     1 
ATOM   7285  C  CA    . THR F  1 59  ? -4.251  -7.591  60.543  1.00 37.25 ? 58   THR D CA    1 
ATOM   7286  C  C     . THR F  1 59  ? -4.756  -6.634  59.443  1.00 37.23 ? 58   THR D C     1 
ATOM   7287  O  O     . THR F  1 59  ? -5.966  -6.570  59.126  1.00 36.33 ? 58   THR D O     1 
ATOM   7288  C  CB    . THR F  1 59  ? -3.293  -8.648  59.908  1.00 37.42 ? 58   THR D CB    1 
ATOM   7289  O  OG1   . THR F  1 59  ? -3.960  -9.366  58.857  1.00 38.58 ? 58   THR D OG1   1 
ATOM   7290  C  CG2   . THR F  1 59  ? -2.773  -9.621  60.968  1.00 36.42 ? 58   THR D CG2   1 
ATOM   7291  N  N     . ALA F  1 60  ? -3.799  -5.889  58.881  1.00 36.86 ? 59   ALA D N     1 
ATOM   7292  C  CA    . ALA F  1 60  ? -4.071  -4.851  57.883  1.00 36.68 ? 59   ALA D CA    1 
ATOM   7293  C  C     . ALA F  1 60  ? -4.063  -5.439  56.491  1.00 36.69 ? 59   ALA D C     1 
ATOM   7294  O  O     . ALA F  1 60  ? -3.041  -5.984  56.057  1.00 36.58 ? 59   ALA D O     1 
ATOM   7295  C  CB    . ALA F  1 60  ? -3.023  -3.744  57.969  1.00 35.69 ? 59   ALA D CB    1 
ATOM   7296  N  N     . GLY F  1 61  ? -5.197  -5.339  55.802  1.00 36.68 ? 60   GLY D N     1 
ATOM   7297  C  CA    . GLY F  1 61  ? -5.271  -5.585  54.358  1.00 37.24 ? 60   GLY D CA    1 
ATOM   7298  C  C     . GLY F  1 61  ? -4.551  -4.582  53.449  1.00 37.66 ? 60   GLY D C     1 
ATOM   7299  O  O     . GLY F  1 61  ? -4.171  -4.923  52.311  1.00 37.93 ? 60   GLY D O     1 
ATOM   7300  N  N     . GLN F  1 62  ? -4.347  -3.349  53.919  1.00 37.65 ? 61   GLN D N     1 
ATOM   7301  C  CA    . GLN F  1 62  ? -3.615  -2.371  53.117  1.00 37.31 ? 61   GLN D CA    1 
ATOM   7302  C  C     . GLN F  1 62  ? -2.171  -2.819  52.897  1.00 38.06 ? 61   GLN D C     1 
ATOM   7303  O  O     . GLN F  1 62  ? -1.440  -3.103  53.856  1.00 37.36 ? 61   GLN D O     1 
ATOM   7304  C  CB    . GLN F  1 62  ? -3.595  -0.989  53.774  1.00 37.52 ? 61   GLN D CB    1 
ATOM   7305  C  CG    . GLN F  1 62  ? -4.921  -0.251  53.874  1.00 37.06 ? 61   GLN D CG    1 
ATOM   7306  C  CD    . GLN F  1 62  ? -4.800  0.949   54.808  1.00 36.35 ? 61   GLN D CD    1 
ATOM   7307  O  OE1   . GLN F  1 62  ? -5.055  0.840   56.004  1.00 35.91 ? 61   GLN D OE1   1 
ATOM   7308  N  NE2   . GLN F  1 62  ? -4.339  2.071   54.278  1.00 34.42 ? 61   GLN D NE2   1 
ATOM   7309  N  N     . GLU F  1 63  ? -1.781  -2.884  51.624  1.00 38.69 ? 62   GLU D N     1 
ATOM   7310  C  CA    . GLU F  1 63  ? -0.395  -3.099  51.186  1.00 39.31 ? 62   GLU D CA    1 
ATOM   7311  C  C     . GLU F  1 63  ? 0.632   -2.261  51.926  1.00 38.89 ? 62   GLU D C     1 
ATOM   7312  O  O     . GLU F  1 63  ? 1.737   -2.721  52.172  1.00 38.34 ? 62   GLU D O     1 
ATOM   7313  C  CB    . GLU F  1 63  ? -0.241  -2.638  49.747  1.00 40.10 ? 62   GLU D CB    1 
ATOM   7314  C  CG    . GLU F  1 63  ? -0.595  -3.596  48.695  1.00 43.39 ? 62   GLU D CG    1 
ATOM   7315  C  CD    . GLU F  1 63  ? -0.359  -2.982  47.340  1.00 46.97 ? 62   GLU D CD    1 
ATOM   7316  O  OE1   . GLU F  1 63  ? -0.958  -1.922  47.056  1.00 49.79 ? 62   GLU D OE1   1 
ATOM   7317  O  OE2   . GLU F  1 63  ? 0.447   -3.545  46.569  1.00 52.60 ? 62   GLU D OE2   1 
ATOM   7318  N  N     . ASP F  1 64  ? 0.284   -1.000  52.186  1.00 38.55 ? 63   ASP D N     1 
ATOM   7319  C  CA    . ASP F  1 64  ? 1.191   -0.039  52.824  1.00 38.54 ? 63   ASP D CA    1 
ATOM   7320  C  C     . ASP F  1 64  ? 1.681   -0.513  54.190  1.00 38.37 ? 63   ASP D C     1 
ATOM   7321  O  O     . ASP F  1 64  ? 2.731   -0.065  54.662  1.00 37.78 ? 63   ASP D O     1 
ATOM   7322  C  CB    . ASP F  1 64  ? 0.518   1.324   52.982  1.00 38.28 ? 63   ASP D CB    1 
ATOM   7323  C  CG    . ASP F  1 64  ? 0.404   2.078   51.677  1.00 38.49 ? 63   ASP D CG    1 
ATOM   7324  O  OD1   . ASP F  1 64  ? 0.834   1.563   50.623  1.00 38.33 ? 63   ASP D OD1   1 
ATOM   7325  O  OD2   . ASP F  1 64  ? -0.122  3.209   51.707  1.00 39.69 ? 63   ASP D OD2   1 
ATOM   7326  N  N     . TYR F  1 65  ? 0.910   -1.409  54.810  1.00 38.22 ? 64   TYR D N     1 
ATOM   7327  C  CA    . TYR F  1 65  ? 1.290   -2.019  56.075  1.00 38.19 ? 64   TYR D CA    1 
ATOM   7328  C  C     . TYR F  1 65  ? 1.805   -3.437  55.939  1.00 38.14 ? 64   TYR D C     1 
ATOM   7329  O  O     . TYR F  1 65  ? 1.842   -4.177  56.930  1.00 38.61 ? 64   TYR D O     1 
ATOM   7330  C  CB    . TYR F  1 65  ? 0.129   -1.937  57.073  1.00 38.40 ? 64   TYR D CB    1 
ATOM   7331  C  CG    . TYR F  1 65  ? -0.194  -0.499  57.447  1.00 38.87 ? 64   TYR D CG    1 
ATOM   7332  C  CD1   . TYR F  1 65  ? -1.441  0.055   57.174  1.00 39.54 ? 64   TYR D CD1   1 
ATOM   7333  C  CD2   . TYR F  1 65  ? 0.759   0.305   58.062  1.00 38.97 ? 64   TYR D CD2   1 
ATOM   7334  C  CE1   . TYR F  1 65  ? -1.732  1.390   57.517  1.00 40.26 ? 64   TYR D CE1   1 
ATOM   7335  C  CE2   . TYR F  1 65  ? 0.486   1.636   58.392  1.00 40.40 ? 64   TYR D CE2   1 
ATOM   7336  C  CZ    . TYR F  1 65  ? -0.766  2.171   58.130  1.00 39.03 ? 64   TYR D CZ    1 
ATOM   7337  O  OH    . TYR F  1 65  ? -1.039  3.483   58.461  1.00 38.37 ? 64   TYR D OH    1 
ATOM   7338  N  N     . ASP F  1 66  ? 2.253   -3.803  54.735  1.00 37.85 ? 65   ASP D N     1 
ATOM   7339  C  CA    . ASP F  1 66  ? 3.010   -5.037  54.532  1.00 37.64 ? 65   ASP D CA    1 
ATOM   7340  C  C     . ASP F  1 66  ? 4.099   -5.271  55.592  1.00 37.61 ? 65   ASP D C     1 
ATOM   7341  O  O     . ASP F  1 66  ? 4.288   -6.393  56.039  1.00 37.68 ? 65   ASP D O     1 
ATOM   7342  C  CB    . ASP F  1 66  ? 3.688   -5.029  53.163  1.00 37.28 ? 65   ASP D CB    1 
ATOM   7343  C  CG    . ASP F  1 66  ? 2.754   -5.446  52.028  1.00 37.35 ? 65   ASP D CG    1 
ATOM   7344  O  OD1   . ASP F  1 66  ? 1.614   -5.868  52.295  1.00 36.09 ? 65   ASP D OD1   1 
ATOM   7345  O  OD2   . ASP F  1 66  ? 3.169   -5.344  50.849  1.00 37.50 ? 65   ASP D OD2   1 
ATOM   7346  N  N     . ARG F  1 67  ? 4.823   -4.228  55.985  1.00 37.40 ? 66   ARG D N     1 
ATOM   7347  C  CA    . ARG F  1 67  ? 5.989   -4.423  56.871  1.00 37.40 ? 66   ARG D CA    1 
ATOM   7348  C  C     . ARG F  1 67  ? 5.597   -4.753  58.309  1.00 37.14 ? 66   ARG D C     1 
ATOM   7349  O  O     . ARG F  1 67  ? 6.377   -5.324  59.041  1.00 37.11 ? 66   ARG D O     1 
ATOM   7350  C  CB    . ARG F  1 67  ? 6.931   -3.212  56.829  1.00 37.35 ? 66   ARG D CB    1 
ATOM   7351  C  CG    . ARG F  1 67  ? 6.380   -1.947  57.493  1.00 37.26 ? 66   ARG D CG    1 
ATOM   7352  C  CD    . ARG F  1 67  ? 7.301   -0.778  57.238  1.00 36.89 ? 66   ARG D CD    1 
ATOM   7353  N  NE    . ARG F  1 67  ? 6.872   0.446   57.906  1.00 36.00 ? 66   ARG D NE    1 
ATOM   7354  C  CZ    . ARG F  1 67  ? 5.922   1.274   57.467  1.00 35.76 ? 66   ARG D CZ    1 
ATOM   7355  N  NH1   . ARG F  1 67  ? 5.242   1.033   56.341  1.00 35.51 ? 66   ARG D NH1   1 
ATOM   7356  N  NH2   . ARG F  1 67  ? 5.656   2.366   58.170  1.00 36.50 ? 66   ARG D NH2   1 
ATOM   7357  N  N     . LEU F  1 68  ? 4.382   -4.390  58.710  1.00 37.27 ? 67   LEU D N     1 
ATOM   7358  C  CA    . LEU F  1 68  ? 3.911   -4.675  60.051  1.00 36.79 ? 67   LEU D CA    1 
ATOM   7359  C  C     . LEU F  1 68  ? 3.357   -6.093  60.160  1.00 37.24 ? 67   LEU D C     1 
ATOM   7360  O  O     . LEU F  1 68  ? 3.455   -6.716  61.220  1.00 37.08 ? 67   LEU D O     1 
ATOM   7361  C  CB    . LEU F  1 68  ? 2.832   -3.670  60.456  1.00 36.34 ? 67   LEU D CB    1 
ATOM   7362  C  CG    . LEU F  1 68  ? 2.325   -3.728  61.904  1.00 35.58 ? 67   LEU D CG    1 
ATOM   7363  C  CD1   . LEU F  1 68  ? 3.423   -3.319  62.890  1.00 31.68 ? 67   LEU D CD1   1 
ATOM   7364  C  CD2   . LEU F  1 68  ? 1.056   -2.838  62.063  1.00 32.08 ? 67   LEU D CD2   1 
ATOM   7365  N  N     . ARG F  1 69  ? 2.773   -6.601  59.078  1.00 37.12 ? 68   ARG D N     1 
ATOM   7366  C  CA    . ARG F  1 69  ? 1.946   -7.810  59.167  1.00 37.48 ? 68   ARG D CA    1 
ATOM   7367  C  C     . ARG F  1 69  ? 2.657   -9.049  59.729  1.00 37.68 ? 68   ARG D C     1 
ATOM   7368  O  O     . ARG F  1 69  ? 2.119   -9.688  60.617  1.00 37.76 ? 68   ARG D O     1 
ATOM   7369  C  CB    . ARG F  1 69  ? 1.281   -8.138  57.822  1.00 37.62 ? 68   ARG D CB    1 
ATOM   7370  C  CG    . ARG F  1 69  ? -0.011  -8.948  57.975  1.00 37.49 ? 68   ARG D CG    1 
ATOM   7371  C  CD    . ARG F  1 69  ? -0.775  -9.108  56.662  1.00 36.50 ? 68   ARG D CD    1 
ATOM   7372  N  NE    . ARG F  1 69  ? -0.915  -7.819  55.988  1.00 36.20 ? 68   ARG D NE    1 
ATOM   7373  C  CZ    . ARG F  1 69  ? -0.196  -7.398  54.945  1.00 34.99 ? 68   ARG D CZ    1 
ATOM   7374  N  NH1   . ARG F  1 69  ? 0.779   -8.139  54.431  1.00 33.92 ? 68   ARG D NH1   1 
ATOM   7375  N  NH2   . ARG F  1 69  ? -0.437  -6.196  54.439  1.00 35.12 ? 68   ARG D NH2   1 
ATOM   7376  N  N     . PRO F  1 70  ? 3.872   -9.368  59.240  1.00 38.02 ? 69   PRO D N     1 
ATOM   7377  C  CA    . PRO F  1 70  ? 4.600   -10.555 59.698  1.00 38.53 ? 69   PRO D CA    1 
ATOM   7378  C  C     . PRO F  1 70  ? 4.845   -10.648 61.200  1.00 38.61 ? 69   PRO D C     1 
ATOM   7379  O  O     . PRO F  1 70  ? 5.005   -11.754 61.715  1.00 38.89 ? 69   PRO D O     1 
ATOM   7380  C  CB    . PRO F  1 70  ? 5.956   -10.433 58.985  1.00 38.52 ? 69   PRO D CB    1 
ATOM   7381  C  CG    . PRO F  1 70  ? 5.669   -9.653  57.791  1.00 38.25 ? 69   PRO D CG    1 
ATOM   7382  C  CD    . PRO F  1 70  ? 4.649   -8.645  58.226  1.00 38.08 ? 69   PRO D CD    1 
ATOM   7383  N  N     . LEU F  1 71  ? 4.909   -9.504  61.881  1.00 38.55 ? 70   LEU D N     1 
ATOM   7384  C  CA    . LEU F  1 71  ? 5.091   -9.471  63.336  1.00 38.56 ? 70   LEU D CA    1 
ATOM   7385  C  C     . LEU F  1 71  ? 3.985   -10.216 64.092  1.00 38.34 ? 70   LEU D C     1 
ATOM   7386  O  O     . LEU F  1 71  ? 4.193   -10.652 65.215  1.00 38.39 ? 70   LEU D O     1 
ATOM   7387  C  CB    . LEU F  1 71  ? 5.182   -8.024  63.834  1.00 38.50 ? 70   LEU D CB    1 
ATOM   7388  C  CG    . LEU F  1 71  ? 6.552   -7.333  63.790  1.00 39.37 ? 70   LEU D CG    1 
ATOM   7389  C  CD1   . LEU F  1 71  ? 7.389   -7.727  62.572  1.00 40.07 ? 70   LEU D CD1   1 
ATOM   7390  C  CD2   . LEU F  1 71  ? 6.375   -5.826  63.862  1.00 38.92 ? 70   LEU D CD2   1 
ATOM   7391  N  N     . SER F  1 72  ? 2.812   -10.361 63.478  1.00 38.31 ? 71   SER D N     1 
ATOM   7392  C  CA    A SER F  1 72  ? 1.712   -11.129 64.059  0.50 38.09 ? 71   SER D CA    1 
ATOM   7393  C  CA    B SER F  1 72  ? 1.743   -11.126 64.109  0.50 38.26 ? 71   SER D CA    1 
ATOM   7394  C  C     . SER F  1 72  ? 1.869   -12.642 63.888  1.00 38.12 ? 71   SER D C     1 
ATOM   7395  O  O     . SER F  1 72  ? 1.118   -13.408 64.479  1.00 38.10 ? 71   SER D O     1 
ATOM   7396  C  CB    A SER F  1 72  ? 0.380   -10.709 63.422  0.50 38.00 ? 71   SER D CB    1 
ATOM   7397  C  CB    B SER F  1 72  ? 0.369   -10.616 63.648  0.50 38.21 ? 71   SER D CB    1 
ATOM   7398  O  OG    A SER F  1 72  ? -0.010  -9.411  63.824  0.50 37.33 ? 71   SER D OG    1 
ATOM   7399  O  OG    B SER F  1 72  ? 0.225   -10.669 62.242  0.50 38.47 ? 71   SER D OG    1 
ATOM   7400  N  N     . TYR F  1 73  ? 2.830   -13.087 63.076  1.00 37.96 ? 72   TYR D N     1 
ATOM   7401  C  CA    . TYR F  1 73  ? 2.829   -14.497 62.620  1.00 37.92 ? 72   TYR D CA    1 
ATOM   7402  C  C     . TYR F  1 73  ? 3.519   -15.574 63.486  1.00 38.04 ? 72   TYR D C     1 
ATOM   7403  O  O     . TYR F  1 73  ? 3.066   -16.715 63.488  1.00 37.52 ? 72   TYR D O     1 
ATOM   7404  C  CB    . TYR F  1 73  ? 3.386   -14.610 61.196  1.00 38.10 ? 72   TYR D CB    1 
ATOM   7405  C  CG    . TYR F  1 73  ? 2.624   -13.889 60.091  1.00 37.42 ? 72   TYR D CG    1 
ATOM   7406  C  CD1   . TYR F  1 73  ? 1.302   -13.456 60.244  1.00 38.50 ? 72   TYR D CD1   1 
ATOM   7407  C  CD2   . TYR F  1 73  ? 3.228   -13.689 58.864  1.00 38.27 ? 72   TYR D CD2   1 
ATOM   7408  C  CE1   . TYR F  1 73  ? 0.635   -12.822 59.201  1.00 37.82 ? 72   TYR D CE1   1 
ATOM   7409  C  CE2   . TYR F  1 73  ? 2.574   -13.067 57.823  1.00 37.95 ? 72   TYR D CE2   1 
ATOM   7410  C  CZ    . TYR F  1 73  ? 1.287   -12.632 57.984  1.00 38.23 ? 72   TYR D CZ    1 
ATOM   7411  O  OH    . TYR F  1 73  ? 0.670   -12.005 56.913  1.00 38.15 ? 72   TYR D OH    1 
ATOM   7412  N  N     . PRO F  1 74  ? 4.632   -15.246 64.164  1.00 38.20 ? 73   PRO D N     1 
ATOM   7413  C  CA    . PRO F  1 74  ? 5.256   -16.286 64.986  1.00 38.54 ? 73   PRO D CA    1 
ATOM   7414  C  C     . PRO F  1 74  ? 4.316   -16.868 66.053  1.00 38.59 ? 73   PRO D C     1 
ATOM   7415  O  O     . PRO F  1 74  ? 3.482   -16.147 66.627  1.00 38.51 ? 73   PRO D O     1 
ATOM   7416  C  CB    . PRO F  1 74  ? 6.446   -15.566 65.627  1.00 38.55 ? 73   PRO D CB    1 
ATOM   7417  C  CG    . PRO F  1 74  ? 6.723   -14.421 64.737  1.00 38.75 ? 73   PRO D CG    1 
ATOM   7418  C  CD    . PRO F  1 74  ? 5.400   -13.992 64.199  1.00 38.32 ? 73   PRO D CD    1 
ATOM   7419  N  N     . GLN F  1 75  ? 4.441   -18.176 66.266  1.00 38.70 ? 74   GLN D N     1 
ATOM   7420  C  CA    . GLN F  1 75  ? 3.625   -18.933 67.227  1.00 38.91 ? 74   GLN D CA    1 
ATOM   7421  C  C     . GLN F  1 75  ? 2.098   -18.942 66.922  1.00 38.08 ? 74   GLN D C     1 
ATOM   7422  O  O     . GLN F  1 75  ? 1.281   -19.170 67.813  1.00 38.03 ? 74   GLN D O     1 
ATOM   7423  C  CB    . GLN F  1 75  ? 3.935   -18.482 68.675  1.00 39.40 ? 74   GLN D CB    1 
ATOM   7424  C  CG    . GLN F  1 75  ? 5.268   -19.069 69.262  1.00 41.76 ? 74   GLN D CG    1 
ATOM   7425  C  CD    . GLN F  1 75  ? 6.532   -18.484 68.618  1.00 44.33 ? 74   GLN D CD    1 
ATOM   7426  O  OE1   . GLN F  1 75  ? 6.562   -17.317 68.217  1.00 48.01 ? 74   GLN D OE1   1 
ATOM   7427  N  NE2   . GLN F  1 75  ? 7.573   -19.294 68.517  1.00 45.77 ? 74   GLN D NE2   1 
ATOM   7428  N  N     . THR F  1 76  ? 1.727   -18.746 65.657  1.00 37.29 ? 75   THR D N     1 
ATOM   7429  C  CA    . THR F  1 76  ? 0.325   -18.847 65.224  1.00 36.55 ? 75   THR D CA    1 
ATOM   7430  C  C     . THR F  1 76  ? -0.155  -20.297 65.154  1.00 36.33 ? 75   THR D C     1 
ATOM   7431  O  O     . THR F  1 76  ? 0.596   -21.183 64.733  1.00 35.58 ? 75   THR D O     1 
ATOM   7432  C  CB    . THR F  1 76  ? 0.120   -18.193 63.846  1.00 36.57 ? 75   THR D CB    1 
ATOM   7433  O  OG1   . THR F  1 76  ? 0.590   -16.845 63.890  1.00 36.30 ? 75   THR D OG1   1 
ATOM   7434  C  CG2   . THR F  1 76  ? -1.356  -18.181 63.456  1.00 35.76 ? 75   THR D CG2   1 
ATOM   7435  N  N     . ASP F  1 77  ? -1.409  -20.525 65.563  1.00 36.18 ? 76   ASP D N     1 
ATOM   7436  C  CA    . ASP F  1 77  ? -2.007  -21.873 65.564  1.00 36.81 ? 76   ASP D CA    1 
ATOM   7437  C  C     . ASP F  1 77  ? -2.882  -22.136 64.328  1.00 36.32 ? 76   ASP D C     1 
ATOM   7438  O  O     . ASP F  1 77  ? -2.972  -23.256 63.832  1.00 36.17 ? 76   ASP D O     1 
ATOM   7439  C  CB    . ASP F  1 77  ? -2.826  -22.106 66.833  1.00 36.88 ? 76   ASP D CB    1 
ATOM   7440  C  CG    . ASP F  1 77  ? -1.964  -22.146 68.089  1.00 38.36 ? 76   ASP D CG    1 
ATOM   7441  O  OD1   . ASP F  1 77  ? -1.064  -23.006 68.188  1.00 39.12 ? 76   ASP D OD1   1 
ATOM   7442  O  OD2   . ASP F  1 77  ? -2.196  -21.308 68.993  1.00 40.41 ? 76   ASP D OD2   1 
ATOM   7443  N  N     . VAL F  1 78  ? -3.534  -21.101 63.829  1.00 36.45 ? 77   VAL D N     1 
ATOM   7444  C  CA    . VAL F  1 78  ? -4.357  -21.253 62.660  1.00 35.99 ? 77   VAL D CA    1 
ATOM   7445  C  C     . VAL F  1 78  ? -4.495  -19.908 61.983  1.00 36.18 ? 77   VAL D C     1 
ATOM   7446  O  O     . VAL F  1 78  ? -4.512  -18.871 62.646  1.00 36.40 ? 77   VAL D O     1 
ATOM   7447  C  CB    . VAL F  1 78  ? -5.742  -21.865 63.038  1.00 35.86 ? 77   VAL D CB    1 
ATOM   7448  C  CG1   . VAL F  1 78  ? -6.437  -21.025 64.089  1.00 35.77 ? 77   VAL D CG1   1 
ATOM   7449  C  CG2   . VAL F  1 78  ? -6.625  -22.066 61.796  1.00 35.67 ? 77   VAL D CG2   1 
ATOM   7450  N  N     . PHE F  1 79  ? -4.556  -19.934 60.656  1.00 36.63 ? 78   PHE D N     1 
ATOM   7451  C  CA    . PHE F  1 79  ? -4.847  -18.736 59.862  1.00 36.82 ? 78   PHE D CA    1 
ATOM   7452  C  C     . PHE F  1 79  ? -6.237  -18.847 59.256  1.00 36.77 ? 78   PHE D C     1 
ATOM   7453  O  O     . PHE F  1 79  ? -6.675  -19.934 58.845  1.00 36.41 ? 78   PHE D O     1 
ATOM   7454  C  CB    . PHE F  1 79  ? -3.821  -18.550 58.727  1.00 36.67 ? 78   PHE D CB    1 
ATOM   7455  C  CG    . PHE F  1 79  ? -2.472  -18.090 59.194  1.00 37.21 ? 78   PHE D CG    1 
ATOM   7456  C  CD1   . PHE F  1 79  ? -1.520  -19.015 59.631  1.00 38.44 ? 78   PHE D CD1   1 
ATOM   7457  C  CD2   . PHE F  1 79  ? -2.152  -16.730 59.207  1.00 37.69 ? 78   PHE D CD2   1 
ATOM   7458  C  CE1   . PHE F  1 79  ? -0.265  -18.588 60.067  1.00 38.44 ? 78   PHE D CE1   1 
ATOM   7459  C  CE2   . PHE F  1 79  ? -0.908  -16.291 59.636  1.00 36.89 ? 78   PHE D CE2   1 
ATOM   7460  C  CZ    . PHE F  1 79  ? 0.039   -17.221 60.078  1.00 38.18 ? 78   PHE D CZ    1 
ATOM   7461  N  N     . LEU F  1 80  ? -6.923  -17.714 59.237  1.00 37.24 ? 79   LEU D N     1 
ATOM   7462  C  CA    . LEU F  1 80  ? -8.027  -17.479 58.325  1.00 37.29 ? 79   LEU D CA    1 
ATOM   7463  C  C     . LEU F  1 80  ? -7.485  -16.580 57.210  1.00 37.06 ? 79   LEU D C     1 
ATOM   7464  O  O     . LEU F  1 80  ? -7.032  -15.469 57.470  1.00 36.72 ? 79   LEU D O     1 
ATOM   7465  C  CB    . LEU F  1 80  ? -9.193  -16.793 59.032  1.00 37.40 ? 79   LEU D CB    1 
ATOM   7466  C  CG    . LEU F  1 80  ? -9.747  -17.406 60.322  1.00 38.03 ? 79   LEU D CG    1 
ATOM   7467  C  CD1   . LEU F  1 80  ? -10.978 -16.621 60.800  1.00 38.85 ? 79   LEU D CD1   1 
ATOM   7468  C  CD2   . LEU F  1 80  ? -10.063 -18.902 60.161  1.00 37.64 ? 79   LEU D CD2   1 
ATOM   7469  N  N     . ILE F  1 81  ? -7.453  -17.105 55.987  1.00 36.80 ? 80   ILE D N     1 
ATOM   7470  C  CA    . ILE F  1 81  ? -7.254  -16.276 54.806  1.00 36.97 ? 80   ILE D CA    1 
ATOM   7471  C  C     . ILE F  1 81  ? -8.661  -15.984 54.279  1.00 37.04 ? 80   ILE D C     1 
ATOM   7472  O  O     . ILE F  1 81  ? -9.414  -16.912 53.951  1.00 36.62 ? 80   ILE D O     1 
ATOM   7473  C  CB    . ILE F  1 81  ? -6.373  -16.951 53.738  1.00 37.05 ? 80   ILE D CB    1 
ATOM   7474  C  CG1   . ILE F  1 81  ? -4.947  -17.174 54.284  1.00 37.04 ? 80   ILE D CG1   1 
ATOM   7475  C  CG2   . ILE F  1 81  ? -6.351  -16.104 52.472  1.00 37.32 ? 80   ILE D CG2   1 
ATOM   7476  C  CD1   . ILE F  1 81  ? -3.921  -17.795 53.281  1.00 36.76 ? 80   ILE D CD1   1 
ATOM   7477  N  N     . CYS F  1 82  ? -9.020  -14.701 54.258  1.00 37.49 ? 81   CYS D N     1 
ATOM   7478  C  CA    . CYS F  1 82  ? -10.372 -14.242 53.876  1.00 37.71 ? 81   CYS D CA    1 
ATOM   7479  C  C     . CYS F  1 82  ? -10.394 -13.527 52.519  1.00 37.59 ? 81   CYS D C     1 
ATOM   7480  O  O     . CYS F  1 82  ? -9.398  -12.916 52.077  1.00 38.60 ? 81   CYS D O     1 
ATOM   7481  C  CB    . CYS F  1 82  ? -10.937 -13.289 54.938  1.00 37.75 ? 81   CYS D CB    1 
ATOM   7482  S  SG    . CYS F  1 82  ? -10.903 -13.899 56.648  1.00 39.66 ? 81   CYS D SG    1 
ATOM   7483  N  N     . PHE F  1 83  ? -11.533 -13.621 51.846  1.00 36.96 ? 82   PHE D N     1 
ATOM   7484  C  CA    . PHE F  1 83  ? -11.780 -12.880 50.610  1.00 36.62 ? 82   PHE D CA    1 
ATOM   7485  C  C     . PHE F  1 83  ? -13.265 -12.633 50.579  1.00 36.22 ? 82   PHE D C     1 
ATOM   7486  O  O     . PHE F  1 83  ? -14.021 -13.381 51.183  1.00 36.55 ? 82   PHE D O     1 
ATOM   7487  C  CB    . PHE F  1 83  ? -11.321 -13.665 49.370  1.00 36.69 ? 82   PHE D CB    1 
ATOM   7488  C  CG    . PHE F  1 83  ? -12.172 -14.876 49.062  1.00 37.05 ? 82   PHE D CG    1 
ATOM   7489  C  CD1   . PHE F  1 83  ? -11.838 -16.126 49.565  1.00 36.08 ? 82   PHE D CD1   1 
ATOM   7490  C  CD2   . PHE F  1 83  ? -13.312 -14.752 48.265  1.00 36.80 ? 82   PHE D CD2   1 
ATOM   7491  C  CE1   . PHE F  1 83  ? -12.631 -17.242 49.282  1.00 36.11 ? 82   PHE D CE1   1 
ATOM   7492  C  CE2   . PHE F  1 83  ? -14.117 -15.852 47.971  1.00 36.36 ? 82   PHE D CE2   1 
ATOM   7493  C  CZ    . PHE F  1 83  ? -13.773 -17.105 48.472  1.00 36.35 ? 82   PHE D CZ    1 
ATOM   7494  N  N     . SER F  1 84  ? -13.669 -11.563 49.908  1.00 36.40 ? 83   SER D N     1 
ATOM   7495  C  CA    . SER F  1 84  ? -15.082 -11.237 49.756  1.00 36.12 ? 83   SER D CA    1 
ATOM   7496  C  C     . SER F  1 84  ? -15.613 -12.044 48.587  1.00 35.91 ? 83   SER D C     1 
ATOM   7497  O  O     . SER F  1 84  ? -14.963 -12.134 47.557  1.00 34.77 ? 83   SER D O     1 
ATOM   7498  C  CB    . SER F  1 84  ? -15.280 -9.742  49.499  1.00 35.77 ? 83   SER D CB    1 
ATOM   7499  O  OG    . SER F  1 84  ? -16.640 -9.437  49.247  1.00 35.94 ? 83   SER D OG    1 
ATOM   7500  N  N     . LEU F  1 85  ? -16.801 -12.623 48.763  1.00 36.17 ? 84   LEU D N     1 
ATOM   7501  C  CA    . LEU F  1 85  ? -17.444 -13.398 47.712  1.00 36.06 ? 84   LEU D CA    1 
ATOM   7502  C  C     . LEU F  1 85  ? -17.984 -12.484 46.627  1.00 36.29 ? 84   LEU D C     1 
ATOM   7503  O  O     . LEU F  1 85  ? -18.371 -12.962 45.565  1.00 37.05 ? 84   LEU D O     1 
ATOM   7504  C  CB    . LEU F  1 85  ? -18.578 -14.273 48.276  1.00 36.21 ? 84   LEU D CB    1 
ATOM   7505  C  CG    . LEU F  1 85  ? -18.224 -15.419 49.239  1.00 35.59 ? 84   LEU D CG    1 
ATOM   7506  C  CD1   . LEU F  1 85  ? -19.450 -15.835 50.036  1.00 33.53 ? 84   LEU D CD1   1 
ATOM   7507  C  CD2   . LEU F  1 85  ? -17.578 -16.640 48.485  1.00 36.12 ? 84   LEU D CD2   1 
ATOM   7508  N  N     . VAL F  1 86  ? -18.032 -11.176 46.875  1.00 36.71 ? 85   VAL D N     1 
ATOM   7509  C  CA    . VAL F  1 86  ? -18.444 -10.221 45.825  1.00 36.29 ? 85   VAL D CA    1 
ATOM   7510  C  C     . VAL F  1 86  ? -17.269 -9.365  45.300  1.00 36.65 ? 85   VAL D C     1 
ATOM   7511  O  O     . VAL F  1 86  ? -17.496 -8.377  44.610  1.00 36.40 ? 85   VAL D O     1 
ATOM   7512  C  CB    . VAL F  1 86  ? -19.676 -9.353  46.263  1.00 37.21 ? 85   VAL D CB    1 
ATOM   7513  C  CG1   . VAL F  1 86  ? -20.912 -10.266 46.447  1.00 36.26 ? 85   VAL D CG1   1 
ATOM   7514  C  CG2   . VAL F  1 86  ? -19.378 -8.522  47.522  1.00 35.82 ? 85   VAL D CG2   1 
ATOM   7515  N  N     . SER F  1 87  ? -16.032 -9.776  45.606  1.00 36.91 ? 86   SER D N     1 
ATOM   7516  C  CA    . SER F  1 87  ? -14.801 -9.209  44.994  1.00 37.80 ? 86   SER D CA    1 
ATOM   7517  C  C     . SER F  1 87  ? -13.844 -10.288 44.446  1.00 37.56 ? 86   SER D C     1 
ATOM   7518  O  O     . SER F  1 87  ? -13.036 -10.859 45.198  1.00 38.36 ? 86   SER D O     1 
ATOM   7519  C  CB    . SER F  1 87  ? -14.030 -8.353  46.000  1.00 37.89 ? 86   SER D CB    1 
ATOM   7520  O  OG    . SER F  1 87  ? -12.832 -7.888  45.402  1.00 40.32 ? 86   SER D OG    1 
ATOM   7521  N  N     . PRO F  1 88  ? -13.952 -10.599 43.146  1.00 37.21 ? 87   PRO D N     1 
ATOM   7522  C  CA    . PRO F  1 88  ? -13.027 -11.528 42.517  1.00 37.53 ? 87   PRO D CA    1 
ATOM   7523  C  C     . PRO F  1 88  ? -11.558 -11.127 42.571  1.00 37.21 ? 87   PRO D C     1 
ATOM   7524  O  O     . PRO F  1 88  ? -10.710 -12.007 42.534  1.00 38.22 ? 87   PRO D O     1 
ATOM   7525  C  CB    . PRO F  1 88  ? -13.530 -11.588 41.069  1.00 37.57 ? 87   PRO D CB    1 
ATOM   7526  C  CG    . PRO F  1 88  ? -14.944 -11.244 41.164  1.00 36.78 ? 87   PRO D CG    1 
ATOM   7527  C  CD    . PRO F  1 88  ? -15.003 -10.184 42.202  1.00 37.12 ? 87   PRO D CD    1 
ATOM   7528  N  N     . ALA F  1 89  ? -11.255 -9.835  42.666  1.00 37.17 ? 88   ALA D N     1 
ATOM   7529  C  CA    . ALA F  1 89  ? -9.874  -9.389  42.836  1.00 37.14 ? 88   ALA D CA    1 
ATOM   7530  C  C     . ALA F  1 89  ? -9.299  -9.909  44.161  1.00 37.26 ? 88   ALA D C     1 
ATOM   7531  O  O     . ALA F  1 89  ? -8.164  -10.388 44.198  1.00 37.48 ? 88   ALA D O     1 
ATOM   7532  C  CB    . ALA F  1 89  ? -9.774  -7.882  42.757  1.00 37.26 ? 88   ALA D CB    1 
ATOM   7533  N  N     . SER F  1 90  ? -10.095 -9.864  45.226  1.00 37.46 ? 89   SER D N     1 
ATOM   7534  C  CA    . SER F  1 90  ? -9.624  -10.312 46.556  1.00 37.58 ? 89   SER D CA    1 
ATOM   7535  C  C     . SER F  1 90  ? -9.439  -11.816 46.621  1.00 37.02 ? 89   SER D C     1 
ATOM   7536  O  O     . SER F  1 90  ? -8.599  -12.297 47.376  1.00 36.86 ? 89   SER D O     1 
ATOM   7537  C  CB    . SER F  1 90  ? -10.558 -9.849  47.680  1.00 37.89 ? 89   SER D CB    1 
ATOM   7538  O  OG    . SER F  1 90  ? -11.810 -10.523 47.670  1.00 38.95 ? 89   SER D OG    1 
ATOM   7539  N  N     . PHE F  1 91  ? -10.239 -12.536 45.828  1.00 36.98 ? 90   PHE D N     1 
ATOM   7540  C  CA    . PHE F  1 91  ? -10.199 -13.994 45.702  1.00 36.88 ? 90   PHE D CA    1 
ATOM   7541  C  C     . PHE F  1 91  ? -8.923  -14.409 44.979  1.00 37.69 ? 90   PHE D C     1 
ATOM   7542  O  O     . PHE F  1 91  ? -8.250  -15.302 45.427  1.00 37.88 ? 90   PHE D O     1 
ATOM   7543  C  CB    . PHE F  1 91  ? -11.441 -14.469 44.942  1.00 36.58 ? 90   PHE D CB    1 
ATOM   7544  C  CG    . PHE F  1 91  ? -11.517 -15.958 44.703  1.00 35.13 ? 90   PHE D CG    1 
ATOM   7545  C  CD1   . PHE F  1 91  ? -11.441 -16.862 45.757  1.00 35.21 ? 90   PHE D CD1   1 
ATOM   7546  C  CD2   . PHE F  1 91  ? -11.759 -16.445 43.414  1.00 35.96 ? 90   PHE D CD2   1 
ATOM   7547  C  CE1   . PHE F  1 91  ? -11.553 -18.252 45.532  1.00 34.59 ? 90   PHE D CE1   1 
ATOM   7548  C  CE2   . PHE F  1 91  ? -11.869 -17.818 43.165  1.00 34.87 ? 90   PHE D CE2   1 
ATOM   7549  C  CZ    . PHE F  1 91  ? -11.761 -18.727 44.230  1.00 35.77 ? 90   PHE D CZ    1 
ATOM   7550  N  N     . GLU F  1 92  ? -8.611  -13.748 43.861  1.00 38.57 ? 91   GLU D N     1 
ATOM   7551  C  CA    . GLU F  1 92  ? -7.345  -13.934 43.145  1.00 38.77 ? 91   GLU D CA    1 
ATOM   7552  C  C     . GLU F  1 92  ? -6.136  -13.707 44.063  1.00 38.87 ? 91   GLU D C     1 
ATOM   7553  O  O     . GLU F  1 92  ? -5.182  -14.455 43.996  1.00 39.37 ? 91   GLU D O     1 
ATOM   7554  C  CB    . GLU F  1 92  ? -7.246  -12.983 41.941  1.00 38.97 ? 91   GLU D CB    1 
ATOM   7555  C  CG    . GLU F  1 92  ? -8.102  -13.356 40.703  1.00 39.97 ? 91   GLU D CG    1 
ATOM   7556  C  CD    . GLU F  1 92  ? -7.893  -12.382 39.497  1.00 39.56 ? 91   GLU D CD    1 
ATOM   7557  N  N     . ASN F  1 93  ? -6.177  -12.689 44.918  1.00 38.83 ? 92   ASN D N     1 
ATOM   7558  C  CA    . ASN F  1 93  ? -5.055  -12.397 45.827  1.00 39.13 ? 92   ASN D CA    1 
ATOM   7559  C  C     . ASN F  1 93  ? -4.862  -13.415 46.957  1.00 38.75 ? 92   ASN D C     1 
ATOM   7560  O  O     . ASN F  1 93  ? -3.806  -13.469 47.577  1.00 38.46 ? 92   ASN D O     1 
ATOM   7561  C  CB    . ASN F  1 93  ? -5.185  -10.975 46.392  1.00 39.63 ? 92   ASN D CB    1 
ATOM   7562  C  CG    . ASN F  1 93  ? -4.813  -9.918  45.369  1.00 41.04 ? 92   ASN D CG    1 
ATOM   7563  O  OD1   . ASN F  1 93  ? -3.785  -10.039 44.695  1.00 43.37 ? 92   ASN D OD1   1 
ATOM   7564  N  ND2   . ASN F  1 93  ? -5.652  -8.880  45.231  1.00 43.81 ? 92   ASN D ND2   1 
ATOM   7565  N  N     . VAL F  1 94  ? -5.864  -14.248 47.209  1.00 38.60 ? 93   VAL D N     1 
ATOM   7566  C  CA    . VAL F  1 94  ? -5.645  -15.440 48.036  1.00 38.41 ? 93   VAL D CA    1 
ATOM   7567  C  C     . VAL F  1 94  ? -4.415  -16.232 47.545  1.00 39.00 ? 93   VAL D C     1 
ATOM   7568  O  O     . VAL F  1 94  ? -3.558  -16.638 48.341  1.00 38.38 ? 93   VAL D O     1 
ATOM   7569  C  CB    . VAL F  1 94  ? -6.865  -16.369 48.011  1.00 38.42 ? 93   VAL D CB    1 
ATOM   7570  C  CG1   . VAL F  1 94  ? -6.554  -17.699 48.671  1.00 37.81 ? 93   VAL D CG1   1 
ATOM   7571  C  CG2   . VAL F  1 94  ? -8.067  -15.683 48.661  1.00 36.93 ? 93   VAL D CG2   1 
ATOM   7572  N  N     . ARG F  1 95  ? -4.338  -16.453 46.238  1.00 39.46 ? 94   ARG D N     1 
ATOM   7573  C  CA    . ARG F  1 95  ? -3.265  -17.267 45.675  1.00 40.85 ? 94   ARG D CA    1 
ATOM   7574  C  C     . ARG F  1 95  ? -2.057  -16.395 45.336  1.00 39.94 ? 94   ARG D C     1 
ATOM   7575  O  O     . ARG F  1 95  ? -0.927  -16.821 45.528  1.00 40.71 ? 94   ARG D O     1 
ATOM   7576  C  CB    . ARG F  1 95  ? -3.752  -18.044 44.446  1.00 41.71 ? 94   ARG D CB    1 
ATOM   7577  C  CG    . ARG F  1 95  ? -2.814  -19.169 44.005  1.00 45.54 ? 94   ARG D CG    1 
ATOM   7578  C  CD    . ARG F  1 95  ? -2.824  -19.370 42.488  1.00 52.29 ? 94   ARG D CD    1 
ATOM   7579  N  NE    . ARG F  1 95  ? -4.001  -20.124 42.033  1.00 55.65 ? 94   ARG D NE    1 
ATOM   7580  C  CZ    . ARG F  1 95  ? -4.702  -19.886 40.916  1.00 57.19 ? 94   ARG D CZ    1 
ATOM   7581  N  NH1   . ARG F  1 95  ? -4.388  -18.889 40.081  1.00 57.95 ? 94   ARG D NH1   1 
ATOM   7582  N  NH2   . ARG F  1 95  ? -5.760  -20.648 40.646  1.00 57.93 ? 94   ARG D NH2   1 
ATOM   7583  N  N     . ALA F  1 96  ? -2.300  -15.181 44.844  1.00 39.32 ? 95   ALA D N     1 
ATOM   7584  C  CA    . ALA F  1 96  ? -1.220  -14.270 44.470  1.00 38.91 ? 95   ALA D CA    1 
ATOM   7585  C  C     . ALA F  1 96  ? -0.462  -13.752 45.685  1.00 38.71 ? 95   ALA D C     1 
ATOM   7586  O  O     . ALA F  1 96  ? 0.774   -13.694 45.655  1.00 38.91 ? 95   ALA D O     1 
ATOM   7587  C  CB    . ALA F  1 96  ? -1.740  -13.107 43.644  1.00 38.22 ? 95   ALA D CB    1 
ATOM   7588  N  N     . LYS F  1 97  ? -1.174  -13.413 46.756  1.00 37.93 ? 96   LYS D N     1 
ATOM   7589  C  CA    . LYS F  1 97  ? -0.525  -12.778 47.912  1.00 37.67 ? 96   LYS D CA    1 
ATOM   7590  C  C     . LYS F  1 97  ? -0.576  -13.596 49.216  1.00 37.36 ? 96   LYS D C     1 
ATOM   7591  O  O     . LYS F  1 97  ? 0.449   -13.865 49.835  1.00 36.25 ? 96   LYS D O     1 
ATOM   7592  C  CB    . LYS F  1 97  ? -1.108  -11.379 48.157  1.00 37.10 ? 96   LYS D CB    1 
ATOM   7593  C  CG    . LYS F  1 97  ? -0.443  -10.652 49.311  1.00 36.54 ? 96   LYS D CG    1 
ATOM   7594  C  CD    . LYS F  1 97  ? -0.411  -9.151  49.095  1.00 37.30 ? 96   LYS D CD    1 
ATOM   7595  C  CE    . LYS F  1 97  ? 0.080   -8.440  50.349  1.00 37.13 ? 96   LYS D CE    1 
ATOM   7596  N  NZ    . LYS F  1 97  ? 0.166   -6.970  50.189  1.00 36.52 ? 96   LYS D NZ    1 
ATOM   7597  N  N     . TRP F  1 98  ? -1.769  -13.977 49.640  1.00 37.19 ? 97   TRP D N     1 
ATOM   7598  C  CA    . TRP F  1 98  ? -1.947  -14.364 51.026  1.00 37.44 ? 97   TRP D CA    1 
ATOM   7599  C  C     . TRP F  1 98  ? -1.393  -15.734 51.349  1.00 37.58 ? 97   TRP D C     1 
ATOM   7600  O  O     . TRP F  1 98  ? -0.709  -15.907 52.355  1.00 36.99 ? 97   TRP D O     1 
ATOM   7601  C  CB    . TRP F  1 98  ? -3.399  -14.216 51.433  1.00 37.77 ? 97   TRP D CB    1 
ATOM   7602  C  CG    . TRP F  1 98  ? -3.841  -12.792 51.292  1.00 37.28 ? 97   TRP D CG    1 
ATOM   7603  C  CD1   . TRP F  1 98  ? -4.796  -12.318 50.462  1.00 37.14 ? 97   TRP D CD1   1 
ATOM   7604  C  CD2   . TRP F  1 98  ? -3.284  -11.660 51.963  1.00 36.66 ? 97   TRP D CD2   1 
ATOM   7605  N  NE1   . TRP F  1 98  ? -4.895  -10.952 50.583  1.00 37.59 ? 97   TRP D NE1   1 
ATOM   7606  C  CE2   . TRP F  1 98  ? -3.976  -10.522 51.501  1.00 37.02 ? 97   TRP D CE2   1 
ATOM   7607  C  CE3   . TRP F  1 98  ? -2.262  -11.496 52.913  1.00 36.96 ? 97   TRP D CE3   1 
ATOM   7608  C  CZ2   . TRP F  1 98  ? -3.703  -9.237  51.972  1.00 37.68 ? 97   TRP D CZ2   1 
ATOM   7609  C  CZ3   . TRP F  1 98  ? -1.976  -10.211 53.371  1.00 36.99 ? 97   TRP D CZ3   1 
ATOM   7610  C  CH2   . TRP F  1 98  ? -2.691  -9.102  52.901  1.00 37.75 ? 97   TRP D CH2   1 
ATOM   7611  N  N     . TYR F  1 99  ? -1.655  -16.701 50.483  1.00 38.17 ? 98   TYR D N     1 
ATOM   7612  C  CA    . TYR F  1 99  ? -1.145  -18.048 50.691  1.00 37.96 ? 98   TYR D CA    1 
ATOM   7613  C  C     . TYR F  1 99  ? 0.381   -18.016 50.726  1.00 38.06 ? 98   TYR D C     1 
ATOM   7614  O  O     . TYR F  1 99  ? 0.967   -18.438 51.712  1.00 37.98 ? 98   TYR D O     1 
ATOM   7615  C  CB    . TYR F  1 99  ? -1.711  -19.012 49.643  1.00 38.68 ? 98   TYR D CB    1 
ATOM   7616  C  CG    . TYR F  1 99  ? -1.091  -20.404 49.614  1.00 39.53 ? 98   TYR D CG    1 
ATOM   7617  C  CD1   . TYR F  1 99  ? -1.036  -21.197 50.751  1.00 39.55 ? 98   TYR D CD1   1 
ATOM   7618  C  CD2   . TYR F  1 99  ? -0.602  -20.932 48.433  1.00 41.03 ? 98   TYR D CD2   1 
ATOM   7619  C  CE1   . TYR F  1 99  ? -0.501  -22.484 50.707  1.00 40.06 ? 98   TYR D CE1   1 
ATOM   7620  C  CE2   . TYR F  1 99  ? -0.048  -22.217 48.380  1.00 40.53 ? 98   TYR D CE2   1 
ATOM   7621  C  CZ    . TYR F  1 99  ? -0.003  -22.981 49.514  1.00 39.93 ? 98   TYR D CZ    1 
ATOM   7622  O  OH    . TYR F  1 99  ? 0.546   -24.247 49.440  1.00 41.27 ? 98   TYR D OH    1 
ATOM   7623  N  N     . PRO F  1 100 ? 1.031   -17.488 49.677  1.00 38.15 ? 99   PRO D N     1 
ATOM   7624  C  CA    . PRO F  1 100 ? 2.490   -17.408 49.702  1.00 38.57 ? 99   PRO D CA    1 
ATOM   7625  C  C     . PRO F  1 100 ? 3.065   -16.697 50.949  1.00 38.88 ? 99   PRO D C     1 
ATOM   7626  O  O     . PRO F  1 100 ? 3.964   -17.235 51.600  1.00 38.42 ? 99   PRO D O     1 
ATOM   7627  C  CB    . PRO F  1 100 ? 2.804   -16.627 48.426  1.00 38.45 ? 99   PRO D CB    1 
ATOM   7628  C  CG    . PRO F  1 100 ? 1.748   -16.962 47.533  1.00 38.92 ? 99   PRO D CG    1 
ATOM   7629  C  CD    . PRO F  1 100 ? 0.512   -16.978 48.399  1.00 38.70 ? 99   PRO D CD    1 
ATOM   7630  N  N     . GLU F  1 101 ? 2.530   -15.521 51.282  1.00 38.86 ? 100  GLU D N     1 
ATOM   7631  C  CA    . GLU F  1 101 ? 2.988   -14.768 52.459  1.00 39.56 ? 100  GLU D CA    1 
ATOM   7632  C  C     . GLU F  1 101 ? 2.906   -15.582 53.757  1.00 39.26 ? 100  GLU D C     1 
ATOM   7633  O  O     . GLU F  1 101 ? 3.885   -15.710 54.473  1.00 39.39 ? 100  GLU D O     1 
ATOM   7634  C  CB    . GLU F  1 101 ? 2.192   -13.462 52.632  1.00 38.96 ? 100  GLU D CB    1 
ATOM   7635  C  CG    . GLU F  1 101 ? 2.600   -12.705 53.893  1.00 40.62 ? 100  GLU D CG    1 
ATOM   7636  C  CD    . GLU F  1 101 ? 2.208   -11.228 53.904  1.00 41.01 ? 100  GLU D CD    1 
ATOM   7637  O  OE1   . GLU F  1 101 ? 2.381   -10.522 52.876  1.00 43.96 ? 100  GLU D OE1   1 
ATOM   7638  O  OE2   . GLU F  1 101 ? 1.759   -10.769 54.976  1.00 43.12 ? 100  GLU D OE2   1 
ATOM   7639  N  N     . VAL F  1 102 ? 1.723   -16.098 54.065  1.00 39.27 ? 101  VAL D N     1 
ATOM   7640  C  CA    . VAL F  1 102 ? 1.526   -16.928 55.264  1.00 39.60 ? 101  VAL D CA    1 
ATOM   7641  C  C     . VAL F  1 102 ? 2.479   -18.116 55.281  1.00 39.41 ? 101  VAL D C     1 
ATOM   7642  O  O     . VAL F  1 102 ? 3.159   -18.383 56.280  1.00 39.38 ? 101  VAL D O     1 
ATOM   7643  C  CB    . VAL F  1 102 ? 0.052   -17.445 55.344  1.00 39.58 ? 101  VAL D CB    1 
ATOM   7644  C  CG1   . VAL F  1 102 ? -0.041  -18.708 56.179  1.00 39.15 ? 101  VAL D CG1   1 
ATOM   7645  C  CG2   . VAL F  1 102 ? -0.842  -16.351 55.890  1.00 39.68 ? 101  VAL D CG2   1 
ATOM   7646  N  N     . ARG F  1 103 ? 2.549   -18.800 54.145  1.00 39.56 ? 102  ARG D N     1 
ATOM   7647  C  CA    . ARG F  1 103 ? 3.265   -20.057 54.030  1.00 39.61 ? 102  ARG D CA    1 
ATOM   7648  C  C     . ARG F  1 103 ? 4.795   -19.858 54.032  1.00 39.76 ? 102  ARG D C     1 
ATOM   7649  O  O     . ARG F  1 103 ? 5.552   -20.758 54.420  1.00 40.06 ? 102  ARG D O     1 
ATOM   7650  C  CB    . ARG F  1 103 ? 2.743   -20.795 52.791  1.00 39.80 ? 102  ARG D CB    1 
ATOM   7651  C  CG    . ARG F  1 103 ? 2.855   -22.307 52.787  1.00 40.89 ? 102  ARG D CG    1 
ATOM   7652  C  CD    . ARG F  1 103 ? 2.443   -23.000 54.096  1.00 41.14 ? 102  ARG D CD    1 
ATOM   7653  N  NE    . ARG F  1 103 ? 1.136   -23.673 54.095  1.00 40.08 ? 102  ARG D NE    1 
ATOM   7654  C  CZ    . ARG F  1 103 ? 0.275   -23.647 55.118  1.00 41.12 ? 102  ARG D CZ    1 
ATOM   7655  N  NH1   . ARG F  1 103 ? 0.552   -22.949 56.219  1.00 41.06 ? 102  ARG D NH1   1 
ATOM   7656  N  NH2   . ARG F  1 103 ? -0.884  -24.298 55.043  1.00 40.83 ? 102  ARG D NH2   1 
ATOM   7657  N  N     . HIS F  1 104 ? 5.251   -18.667 53.652  1.00 39.82 ? 103  HIS D N     1 
ATOM   7658  C  CA    . HIS F  1 104 ? 6.668   -18.303 53.784  1.00 39.56 ? 103  HIS D CA    1 
ATOM   7659  C  C     . HIS F  1 104 ? 7.075   -18.210 55.254  1.00 39.35 ? 103  HIS D C     1 
ATOM   7660  O  O     . HIS F  1 104 ? 8.145   -18.657 55.636  1.00 39.36 ? 103  HIS D O     1 
ATOM   7661  C  CB    . HIS F  1 104 ? 6.935   -16.962 53.093  1.00 39.85 ? 103  HIS D CB    1 
ATOM   7662  C  CG    . HIS F  1 104 ? 8.318   -16.434 53.307  1.00 40.21 ? 103  HIS D CG    1 
ATOM   7663  N  ND1   . HIS F  1 104 ? 9.439   -17.039 52.772  1.00 41.88 ? 103  HIS D ND1   1 
ATOM   7664  C  CD2   . HIS F  1 104 ? 8.767   -15.365 54.007  1.00 40.85 ? 103  HIS D CD2   1 
ATOM   7665  C  CE1   . HIS F  1 104 ? 10.518  -16.370 53.139  1.00 41.00 ? 103  HIS D CE1   1 
ATOM   7666  N  NE2   . HIS F  1 104 ? 10.140  -15.349 53.888  1.00 41.59 ? 103  HIS D NE2   1 
ATOM   7667  N  N     . HIS F  1 105 ? 6.215   -17.627 56.079  1.00 39.35 ? 104  HIS D N     1 
ATOM   7668  C  CA    . HIS F  1 105 ? 6.510   -17.438 57.506  1.00 39.35 ? 104  HIS D CA    1 
ATOM   7669  C  C     . HIS F  1 105 ? 6.137   -18.624 58.409  1.00 39.10 ? 104  HIS D C     1 
ATOM   7670  O  O     . HIS F  1 105 ? 6.704   -18.782 59.484  1.00 39.08 ? 104  HIS D O     1 
ATOM   7671  C  CB    . HIS F  1 105 ? 5.793   -16.182 58.016  1.00 39.04 ? 104  HIS D CB    1 
ATOM   7672  C  CG    . HIS F  1 105 ? 6.401   -14.902 57.527  1.00 39.23 ? 104  HIS D CG    1 
ATOM   7673  N  ND1   . HIS F  1 105 ? 5.929   -14.227 56.418  1.00 39.20 ? 104  HIS D ND1   1 
ATOM   7674  C  CD2   . HIS F  1 105 ? 7.433   -14.167 58.005  1.00 38.47 ? 104  HIS D CD2   1 
ATOM   7675  C  CE1   . HIS F  1 105 ? 6.649   -13.135 56.234  1.00 38.97 ? 104  HIS D CE1   1 
ATOM   7676  N  NE2   . HIS F  1 105 ? 7.576   -13.081 57.177  1.00 39.01 ? 104  HIS D NE2   1 
ATOM   7677  N  N     . CYS F  1 106 ? 5.169   -19.420 57.970  1.00 38.86 ? 105  CYS D N     1 
ATOM   7678  C  CA    . CYS F  1 106 ? 4.552   -20.462 58.774  1.00 38.98 ? 105  CYS D CA    1 
ATOM   7679  C  C     . CYS F  1 106 ? 4.257   -21.660 57.856  1.00 38.57 ? 105  CYS D C     1 
ATOM   7680  O  O     . CYS F  1 106 ? 3.126   -21.831 57.386  1.00 38.34 ? 105  CYS D O     1 
ATOM   7681  C  CB    . CYS F  1 106 ? 3.242   -19.948 59.383  1.00 39.23 ? 105  CYS D CB    1 
ATOM   7682  S  SG    . CYS F  1 106 ? 3.400   -18.585 60.565  1.00 41.23 ? 105  CYS D SG    1 
ATOM   7683  N  N     . PRO F  1 107 ? 5.283   -22.466 57.564  1.00 37.99 ? 106  PRO D N     1 
ATOM   7684  C  CA    . PRO F  1 107 ? 5.153   -23.539 56.587  1.00 37.88 ? 106  PRO D CA    1 
ATOM   7685  C  C     . PRO F  1 107 ? 4.081   -24.593 56.869  1.00 37.80 ? 106  PRO D C     1 
ATOM   7686  O  O     . PRO F  1 107 ? 3.550   -25.173 55.929  1.00 37.85 ? 106  PRO D O     1 
ATOM   7687  C  CB    . PRO F  1 107 ? 6.532   -24.187 56.609  1.00 37.95 ? 106  PRO D CB    1 
ATOM   7688  C  CG    . PRO F  1 107 ? 7.445   -23.121 57.108  1.00 38.13 ? 106  PRO D CG    1 
ATOM   7689  C  CD    . PRO F  1 107 ? 6.646   -22.392 58.115  1.00 38.06 ? 106  PRO D CD    1 
ATOM   7690  N  N     . HIS F  1 108 ? 3.764   -24.860 58.130  1.00 37.63 ? 107  HIS D N     1 
ATOM   7691  C  CA    . HIS F  1 108 ? 2.872   -25.981 58.432  1.00 37.69 ? 107  HIS D CA    1 
ATOM   7692  C  C     . HIS F  1 108 ? 1.641   -25.632 59.258  1.00 37.19 ? 107  HIS D C     1 
ATOM   7693  O  O     . HIS F  1 108 ? 0.945   -26.521 59.728  1.00 37.01 ? 107  HIS D O     1 
ATOM   7694  C  CB    . HIS F  1 108 ? 3.668   -27.088 59.115  1.00 38.07 ? 107  HIS D CB    1 
ATOM   7695  C  CG    . HIS F  1 108 ? 4.852   -27.539 58.318  1.00 39.53 ? 107  HIS D CG    1 
ATOM   7696  N  ND1   . HIS F  1 108 ? 6.145   -27.197 58.651  1.00 40.50 ? 107  HIS D ND1   1 
ATOM   7697  C  CD2   . HIS F  1 108 ? 4.934   -28.267 57.178  1.00 40.67 ? 107  HIS D CD2   1 
ATOM   7698  C  CE1   . HIS F  1 108 ? 6.977   -27.717 57.762  1.00 41.89 ? 107  HIS D CE1   1 
ATOM   7699  N  NE2   . HIS F  1 108 ? 6.267   -28.368 56.857  1.00 41.61 ? 107  HIS D NE2   1 
ATOM   7700  N  N     . THR F  1 109 ? 1.360   -24.348 59.419  1.00 36.94 ? 108  THR D N     1 
ATOM   7701  C  CA    . THR F  1 109 ? 0.208   -23.926 60.204  1.00 36.79 ? 108  THR D CA    1 
ATOM   7702  C  C     . THR F  1 109 ? -1.054  -24.101 59.366  1.00 36.75 ? 108  THR D C     1 
ATOM   7703  O  O     . THR F  1 109 ? -1.060  -23.751 58.194  1.00 36.55 ? 108  THR D O     1 
ATOM   7704  C  CB    . THR F  1 109 ? 0.356   -22.462 60.652  1.00 36.89 ? 108  THR D CB    1 
ATOM   7705  O  OG1   . THR F  1 109 ? 1.561   -22.341 61.414  1.00 35.74 ? 108  THR D OG1   1 
ATOM   7706  C  CG2   . THR F  1 109 ? -0.857  -22.004 61.490  1.00 35.96 ? 108  THR D CG2   1 
ATOM   7707  N  N     . PRO F  1 110 ? -2.120  -24.675 59.954  1.00 36.92 ? 109  PRO D N     1 
ATOM   7708  C  CA    . PRO F  1 110 ? -3.382  -24.809 59.216  1.00 36.89 ? 109  PRO D CA    1 
ATOM   7709  C  C     . PRO F  1 110 ? -4.009  -23.501 58.745  1.00 36.99 ? 109  PRO D C     1 
ATOM   7710  O  O     . PRO F  1 110 ? -4.103  -22.527 59.499  1.00 36.91 ? 109  PRO D O     1 
ATOM   7711  C  CB    . PRO F  1 110 ? -4.317  -25.526 60.197  1.00 37.23 ? 109  PRO D CB    1 
ATOM   7712  C  CG    . PRO F  1 110 ? -3.622  -25.588 61.488  1.00 37.37 ? 109  PRO D CG    1 
ATOM   7713  C  CD    . PRO F  1 110 ? -2.180  -25.271 61.296  1.00 36.80 ? 109  PRO D CD    1 
ATOM   7714  N  N     . ILE F  1 111 ? -4.438  -23.515 57.488  1.00 37.04 ? 110  ILE D N     1 
ATOM   7715  C  CA    . ILE F  1 111 ? -5.128  -22.419 56.853  1.00 37.05 ? 110  ILE D CA    1 
ATOM   7716  C  C     . ILE F  1 111 ? -6.582  -22.842 56.616  1.00 36.92 ? 110  ILE D C     1 
ATOM   7717  O  O     . ILE F  1 111 ? -6.857  -23.941 56.141  1.00 36.83 ? 110  ILE D O     1 
ATOM   7718  C  CB    . ILE F  1 111 ? -4.452  -22.058 55.510  1.00 37.28 ? 110  ILE D CB    1 
ATOM   7719  C  CG1   . ILE F  1 111 ? -2.998  -21.642 55.742  1.00 38.04 ? 110  ILE D CG1   1 
ATOM   7720  C  CG2   . ILE F  1 111 ? -5.177  -20.914 54.798  1.00 37.10 ? 110  ILE D CG2   1 
ATOM   7721  C  CD1   . ILE F  1 111 ? -2.181  -21.491 54.448  1.00 37.13 ? 110  ILE D CD1   1 
ATOM   7722  N  N     . LEU F  1 112 ? -7.508  -21.979 57.004  1.00 36.70 ? 111  LEU D N     1 
ATOM   7723  C  CA    . LEU F  1 112 ? -8.893  -22.121 56.625  1.00 36.56 ? 111  LEU D CA    1 
ATOM   7724  C  C     . LEU F  1 112 ? -9.103  -21.014 55.609  1.00 36.50 ? 111  LEU D C     1 
ATOM   7725  O  O     . LEU F  1 112 ? -8.682  -19.882 55.850  1.00 36.92 ? 111  LEU D O     1 
ATOM   7726  C  CB    . LEU F  1 112 ? -9.822  -21.919 57.823  1.00 36.45 ? 111  LEU D CB    1 
ATOM   7727  C  CG    . LEU F  1 112 ? -10.036 -23.128 58.722  1.00 37.24 ? 111  LEU D CG    1 
ATOM   7728  C  CD1   . LEU F  1 112 ? -8.972  -23.151 59.780  1.00 37.81 ? 111  LEU D CD1   1 
ATOM   7729  C  CD2   . LEU F  1 112 ? -11.414 -23.088 59.357  1.00 38.58 ? 111  LEU D CD2   1 
ATOM   7730  N  N     . LEU F  1 113 ? -9.711  -21.327 54.473  1.00 35.66 ? 112  LEU D N     1 
ATOM   7731  C  CA    . LEU F  1 113 ? -10.081 -20.276 53.510  1.00 35.37 ? 112  LEU D CA    1 
ATOM   7732  C  C     . LEU F  1 113 ? -11.522 -19.838 53.792  1.00 35.23 ? 112  LEU D C     1 
ATOM   7733  O  O     . LEU F  1 113 ? -12.433 -20.671 53.809  1.00 35.22 ? 112  LEU D O     1 
ATOM   7734  C  CB    . LEU F  1 113 ? -9.937  -20.780 52.071  1.00 35.26 ? 112  LEU D CB    1 
ATOM   7735  C  CG    . LEU F  1 113 ? -10.300 -19.821 50.922  1.00 35.37 ? 112  LEU D CG    1 
ATOM   7736  C  CD1   . LEU F  1 113 ? -9.397  -18.578 50.929  1.00 33.04 ? 112  LEU D CD1   1 
ATOM   7737  C  CD2   . LEU F  1 113 ? -10.218 -20.554 49.584  1.00 34.17 ? 112  LEU D CD2   1 
ATOM   7738  N  N     . VAL F  1 114 ? -11.724 -18.544 54.022  1.00 35.09 ? 113  VAL D N     1 
ATOM   7739  C  CA    . VAL F  1 114 ? -13.036 -18.033 54.396  1.00 35.37 ? 113  VAL D CA    1 
ATOM   7740  C  C     . VAL F  1 114 ? -13.534 -17.028 53.358  1.00 36.11 ? 113  VAL D C     1 
ATOM   7741  O  O     . VAL F  1 114 ? -12.799 -16.105 52.975  1.00 35.67 ? 113  VAL D O     1 
ATOM   7742  C  CB    . VAL F  1 114 ? -12.989 -17.365 55.781  1.00 35.64 ? 113  VAL D CB    1 
ATOM   7743  C  CG1   . VAL F  1 114 ? -14.377 -16.883 56.202  1.00 35.11 ? 113  VAL D CG1   1 
ATOM   7744  C  CG2   . VAL F  1 114 ? -12.416 -18.340 56.811  1.00 34.73 ? 113  VAL D CG2   1 
ATOM   7745  N  N     . GLY F  1 115 ? -14.771 -17.236 52.888  1.00 36.22 ? 114  GLY D N     1 
ATOM   7746  C  CA    . GLY F  1 115 ? -15.417 -16.332 51.962  1.00 36.19 ? 114  GLY D CA    1 
ATOM   7747  C  C     . GLY F  1 115 ? -16.425 -15.507 52.736  1.00 36.48 ? 114  GLY D C     1 
ATOM   7748  O  O     . GLY F  1 115 ? -17.282 -16.066 53.402  1.00 36.40 ? 114  GLY D O     1 
ATOM   7749  N  N     . THR F  1 116 ? -16.318 -14.177 52.641  1.00 36.67 ? 115  THR D N     1 
ATOM   7750  C  CA    . THR F  1 116 ? -17.081 -13.243 53.481  1.00 36.35 ? 115  THR D CA    1 
ATOM   7751  C  C     . THR F  1 116 ? -18.196 -12.580 52.690  1.00 36.15 ? 115  THR D C     1 
ATOM   7752  O  O     . THR F  1 116 ? -18.267 -12.719 51.480  1.00 36.56 ? 115  THR D O     1 
ATOM   7753  C  CB    . THR F  1 116 ? -16.149 -12.129 54.054  1.00 36.79 ? 115  THR D CB    1 
ATOM   7754  O  OG1   . THR F  1 116 ? -15.574 -11.390 52.975  1.00 37.32 ? 115  THR D OG1   1 
ATOM   7755  C  CG2   . THR F  1 116 ? -15.020 -12.716 54.921  1.00 34.68 ? 115  THR D CG2   1 
ATOM   7756  N  N     . LYS F  1 117 ? -19.077 -11.865 53.380  1.00 36.24 ? 116  LYS D N     1 
ATOM   7757  C  CA    . LYS F  1 117 ? -20.162 -11.135 52.726  1.00 36.13 ? 116  LYS D CA    1 
ATOM   7758  C  C     . LYS F  1 117 ? -21.107 -12.058 51.928  1.00 36.15 ? 116  LYS D C     1 
ATOM   7759  O  O     . LYS F  1 117 ? -21.591 -11.703 50.847  1.00 35.36 ? 116  LYS D O     1 
ATOM   7760  C  CB    . LYS F  1 117 ? -19.594 -10.007 51.835  1.00 36.24 ? 116  LYS D CB    1 
ATOM   7761  C  CG    . LYS F  1 117 ? -18.610 -9.104  52.556  1.00 35.81 ? 116  LYS D CG    1 
ATOM   7762  C  CD    . LYS F  1 117 ? -18.369 -7.829  51.774  1.00 35.89 ? 116  LYS D CD    1 
ATOM   7763  C  CE    . LYS F  1 117 ? -17.303 -6.942  52.399  1.00 34.84 ? 116  LYS D CE    1 
ATOM   7764  N  NZ    . LYS F  1 117 ? -17.099 -5.655  51.634  1.00 32.84 ? 116  LYS D NZ    1 
ATOM   7765  N  N     . LEU F  1 118 ? -21.359 -13.246 52.480  1.00 36.17 ? 117  LEU D N     1 
ATOM   7766  C  CA    . LEU F  1 118 ? -22.303 -14.203 51.896  1.00 35.86 ? 117  LEU D CA    1 
ATOM   7767  C  C     . LEU F  1 118 ? -23.667 -13.569 51.594  1.00 36.58 ? 117  LEU D C     1 
ATOM   7768  O  O     . LEU F  1 118 ? -24.323 -13.941 50.620  1.00 36.70 ? 117  LEU D O     1 
ATOM   7769  C  CB    . LEU F  1 118 ? -22.473 -15.402 52.823  1.00 35.66 ? 117  LEU D CB    1 
ATOM   7770  C  CG    . LEU F  1 118 ? -23.342 -16.602 52.401  1.00 35.88 ? 117  LEU D CG    1 
ATOM   7771  C  CD1   . LEU F  1 118 ? -23.020 -17.151 51.014  1.00 33.49 ? 117  LEU D CD1   1 
ATOM   7772  C  CD2   . LEU F  1 118 ? -23.213 -17.695 53.465  1.00 34.37 ? 117  LEU D CD2   1 
ATOM   7773  N  N     . ASP F  1 119 ? -24.078 -12.589 52.398  1.00 36.74 ? 118  ASP D N     1 
ATOM   7774  C  CA    . ASP F  1 119 ? -25.374 -11.936 52.188  1.00 37.34 ? 118  ASP D CA    1 
ATOM   7775  C  C     . ASP F  1 119 ? -25.460 -11.107 50.898  1.00 37.44 ? 118  ASP D C     1 
ATOM   7776  O  O     . ASP F  1 119 ? -26.562 -10.723 50.492  1.00 36.36 ? 118  ASP D O     1 
ATOM   7777  C  CB    . ASP F  1 119 ? -25.714 -11.027 53.367  1.00 37.32 ? 118  ASP D CB    1 
ATOM   7778  C  CG    . ASP F  1 119 ? -24.739 -9.877  53.493  1.00 38.61 ? 118  ASP D CG    1 
ATOM   7779  O  OD1   . ASP F  1 119 ? -23.616 -10.140 53.979  1.00 37.23 ? 118  ASP D OD1   1 
ATOM   7780  O  OD2   . ASP F  1 119 ? -25.089 -8.741  53.080  1.00 38.95 ? 118  ASP D OD2   1 
ATOM   7781  N  N     . LEU F  1 120 ? -24.312 -10.804 50.281  1.00 37.68 ? 119  LEU D N     1 
ATOM   7782  C  CA    . LEU F  1 120 ? -24.298 -10.020 49.041  1.00 38.46 ? 119  LEU D CA    1 
ATOM   7783  C  C     . LEU F  1 120 ? -24.293 -10.886 47.783  1.00 38.87 ? 119  LEU D C     1 
ATOM   7784  O  O     . LEU F  1 120 ? -24.560 -10.383 46.695  1.00 38.56 ? 119  LEU D O     1 
ATOM   7785  C  CB    . LEU F  1 120 ? -23.091 -9.080  49.008  1.00 38.43 ? 119  LEU D CB    1 
ATOM   7786  C  CG    . LEU F  1 120 ? -23.087 -7.967  50.054  1.00 39.42 ? 119  LEU D CG    1 
ATOM   7787  C  CD1   . LEU F  1 120 ? -21.866 -7.074  49.875  1.00 40.27 ? 119  LEU D CD1   1 
ATOM   7788  C  CD2   . LEU F  1 120 ? -24.391 -7.158  50.007  1.00 38.86 ? 119  LEU D CD2   1 
ATOM   7789  N  N     . ARG F  1 121 ? -23.996 -12.177 47.923  1.00 39.43 ? 120  ARG D N     1 
ATOM   7790  C  CA    . ARG F  1 121 ? -23.900 -13.050 46.748  1.00 40.04 ? 120  ARG D CA    1 
ATOM   7791  C  C     . ARG F  1 121 ? -25.173 -13.038 45.895  1.00 40.58 ? 120  ARG D C     1 
ATOM   7792  O  O     . ARG F  1 121 ? -25.089 -13.076 44.678  1.00 40.21 ? 120  ARG D O     1 
ATOM   7793  C  CB    . ARG F  1 121 ? -23.534 -14.486 47.128  1.00 40.04 ? 120  ARG D CB    1 
ATOM   7794  C  CG    . ARG F  1 121 ? -23.288 -15.392 45.886  1.00 40.27 ? 120  ARG D CG    1 
ATOM   7795  C  CD    . ARG F  1 121 ? -22.208 -16.452 46.173  1.00 39.90 ? 120  ARG D CD    1 
ATOM   7796  N  NE    . ARG F  1 121 ? -22.741 -17.518 47.010  1.00 38.18 ? 120  ARG D NE    1 
ATOM   7797  C  CZ    . ARG F  1 121 ? -22.033 -18.522 47.499  1.00 37.72 ? 120  ARG D CZ    1 
ATOM   7798  N  NH1   . ARG F  1 121 ? -20.737 -18.627 47.244  1.00 37.02 ? 120  ARG D NH1   1 
ATOM   7799  N  NH2   . ARG F  1 121 ? -22.634 -19.430 48.253  1.00 38.62 ? 120  ARG D NH2   1 
ATOM   7800  N  N     . ASP F  1 122 ? -26.336 -12.969 46.540  1.00 41.72 ? 121  ASP D N     1 
ATOM   7801  C  CA    . ASP F  1 122 ? -27.622 -12.954 45.833  1.00 42.51 ? 121  ASP D CA    1 
ATOM   7802  C  C     . ASP F  1 122 ? -28.250 -11.557 45.776  1.00 42.90 ? 121  ASP D C     1 
ATOM   7803  O  O     . ASP F  1 122 ? -29.450 -11.413 45.503  1.00 43.87 ? 121  ASP D O     1 
ATOM   7804  C  CB    . ASP F  1 122 ? -28.590 -13.971 46.473  1.00 42.93 ? 121  ASP D CB    1 
ATOM   7805  N  N     . ASP F  1 123 ? -27.439 -10.528 46.001  1.00 42.92 ? 122  ASP D N     1 
ATOM   7806  C  CA    . ASP F  1 123 ? -27.908 -9.146  46.005  1.00 42.98 ? 122  ASP D CA    1 
ATOM   7807  C  C     . ASP F  1 123 ? -27.929 -8.563  44.584  1.00 43.18 ? 122  ASP D C     1 
ATOM   7808  O  O     . ASP F  1 123 ? -26.876 -8.349  43.969  1.00 42.64 ? 122  ASP D O     1 
ATOM   7809  C  CB    . ASP F  1 123 ? -27.014 -8.294  46.905  1.00 43.09 ? 122  ASP D CB    1 
ATOM   7810  C  CG    . ASP F  1 123 ? -27.380 -6.831  46.887  1.00 43.76 ? 122  ASP D CG    1 
ATOM   7811  O  OD1   . ASP F  1 123 ? -28.445 -6.485  47.420  1.00 44.83 ? 122  ASP D OD1   1 
ATOM   7812  O  OD2   . ASP F  1 123 ? -26.588 -6.010  46.361  1.00 45.57 ? 122  ASP D OD2   1 
ATOM   7813  N  N     . LYS F  1 124 ? -29.135 -8.253  44.103  1.00 43.25 ? 123  LYS D N     1 
ATOM   7814  C  CA    . LYS F  1 124 ? -29.354 -7.795  42.728  1.00 43.11 ? 123  LYS D CA    1 
ATOM   7815  C  C     . LYS F  1 124 ? -28.384 -6.703  42.330  1.00 43.09 ? 123  LYS D C     1 
ATOM   7816  O  O     . LYS F  1 124 ? -27.721 -6.804  41.303  1.00 43.68 ? 123  LYS D O     1 
ATOM   7817  C  CB    . LYS F  1 124 ? -30.797 -7.290  42.536  1.00 43.19 ? 123  LYS D CB    1 
ATOM   7818  N  N     . ASP F  1 125 ? -28.296 -5.656  43.136  1.00 42.67 ? 124  ASP D N     1 
ATOM   7819  C  CA    . ASP F  1 125 ? -27.490 -4.505  42.773  1.00 42.59 ? 124  ASP D CA    1 
ATOM   7820  C  C     . ASP F  1 125 ? -26.026 -4.884  42.665  1.00 42.37 ? 124  ASP D C     1 
ATOM   7821  O  O     . ASP F  1 125 ? -25.317 -4.379  41.791  1.00 42.18 ? 124  ASP D O     1 
ATOM   7822  C  CB    . ASP F  1 125 ? -27.625 -3.387  43.799  1.00 42.85 ? 124  ASP D CB    1 
ATOM   7823  C  CG    . ASP F  1 125 ? -29.028 -2.768  43.828  1.00 45.31 ? 124  ASP D CG    1 
ATOM   7824  O  OD1   . ASP F  1 125 ? -29.946 -3.282  43.144  1.00 45.37 ? 124  ASP D OD1   1 
ATOM   7825  O  OD2   . ASP F  1 125 ? -29.185 -1.758  44.548  1.00 47.06 ? 124  ASP D OD2   1 
ATOM   7826  N  N     . THR F  1 126 ? -25.568 -5.745  43.579  1.00 41.63 ? 125  THR D N     1 
ATOM   7827  C  CA    . THR F  1 126 ? -24.173 -6.146  43.596  1.00 41.14 ? 125  THR D CA    1 
ATOM   7828  C  C     . THR F  1 126 ? -23.842 -7.021  42.381  1.00 41.06 ? 125  THR D C     1 
ATOM   7829  O  O     . THR F  1 126 ? -22.816 -6.838  41.736  1.00 41.22 ? 125  THR D O     1 
ATOM   7830  C  CB    . THR F  1 126 ? -23.813 -6.891  44.915  1.00 41.33 ? 125  THR D CB    1 
ATOM   7831  O  OG1   . THR F  1 126 ? -23.951 -5.985  46.024  1.00 39.98 ? 125  THR D OG1   1 
ATOM   7832  C  CG2   . THR F  1 126 ? -22.387 -7.427  44.845  1.00 39.36 ? 125  THR D CG2   1 
ATOM   7833  N  N     . ILE F  1 127 ? -24.712 -7.975  42.087  1.00 41.17 ? 126  ILE D N     1 
ATOM   7834  C  CA    . ILE F  1 127 ? -24.603 -8.790  40.880  1.00 41.22 ? 126  ILE D CA    1 
ATOM   7835  C  C     . ILE F  1 127 ? -24.469 -7.940  39.604  1.00 41.68 ? 126  ILE D C     1 
ATOM   7836  O  O     . ILE F  1 127 ? -23.641 -8.245  38.732  1.00 41.59 ? 126  ILE D O     1 
ATOM   7837  C  CB    . ILE F  1 127 ? -25.829 -9.714  40.736  1.00 41.24 ? 126  ILE D CB    1 
ATOM   7838  C  CG1   . ILE F  1 127 ? -25.751 -10.840 41.779  1.00 40.98 ? 126  ILE D CG1   1 
ATOM   7839  C  CG2   . ILE F  1 127 ? -25.927 -10.258 39.304  1.00 40.49 ? 126  ILE D CG2   1 
ATOM   7840  C  CD1   . ILE F  1 127 ? -27.082 -11.571 42.022  1.00 41.35 ? 126  ILE D CD1   1 
ATOM   7841  N  N     . GLU F  1 128 ? -25.265 -6.874  39.510  1.00 41.54 ? 127  GLU D N     1 
ATOM   7842  C  CA    . GLU F  1 128 ? -25.300 -6.026  38.309  1.00 41.81 ? 127  GLU D CA    1 
ATOM   7843  C  C     . GLU F  1 128 ? -24.010 -5.225  38.116  1.00 42.10 ? 127  GLU D C     1 
ATOM   7844  O  O     . GLU F  1 128 ? -23.544 -5.049  36.996  1.00 42.48 ? 127  GLU D O     1 
ATOM   7845  C  CB    . GLU F  1 128 ? -26.508 -5.082  38.341  1.00 42.22 ? 127  GLU D CB    1 
ATOM   7846  N  N     . ARG F  1 129 ? -23.412 -4.760  39.201  1.00 42.58 ? 128  ARG D N     1 
ATOM   7847  C  CA    . ARG F  1 129 ? -22.183 -3.969  39.098  1.00 42.94 ? 128  ARG D CA    1 
ATOM   7848  C  C     . ARG F  1 129 ? -21.033 -4.863  38.689  1.00 42.60 ? 128  ARG D C     1 
ATOM   7849  O  O     . ARG F  1 129 ? -20.182 -4.468  37.878  1.00 42.40 ? 128  ARG D O     1 
ATOM   7850  C  CB    . ARG F  1 129 ? -21.857 -3.272  40.416  1.00 43.37 ? 128  ARG D CB    1 
ATOM   7851  C  CG    . ARG F  1 129 ? -22.993 -2.400  40.920  1.00 46.73 ? 128  ARG D CG    1 
ATOM   7852  C  CD    . ARG F  1 129 ? -22.471 -1.238  41.735  1.00 51.71 ? 128  ARG D CD    1 
ATOM   7853  N  NE    . ARG F  1 129 ? -21.644 -1.697  42.857  1.00 53.78 ? 128  ARG D NE    1 
ATOM   7854  C  CZ    . ARG F  1 129 ? -22.122 -2.143  44.018  1.00 53.79 ? 128  ARG D CZ    1 
ATOM   7855  N  NH1   . ARG F  1 129 ? -21.267 -2.540  44.959  1.00 52.84 ? 128  ARG D NH1   1 
ATOM   7856  N  NH2   . ARG F  1 129 ? -23.442 -2.200  44.240  1.00 53.39 ? 128  ARG D NH2   1 
ATOM   7857  N  N     . LEU F  1 130 ? -21.021 -6.074  39.241  1.00 42.15 ? 129  LEU D N     1 
ATOM   7858  C  CA    . LEU F  1 130 ? -20.019 -7.066  38.854  1.00 42.06 ? 129  LEU D CA    1 
ATOM   7859  C  C     . LEU F  1 130 ? -20.211 -7.390  37.373  1.00 41.77 ? 129  LEU D C     1 
ATOM   7860  O  O     . LEU F  1 130 ? -19.258 -7.392  36.620  1.00 40.95 ? 129  LEU D O     1 
ATOM   7861  C  CB    . LEU F  1 130 ? -20.086 -8.318  39.744  1.00 41.50 ? 129  LEU D CB    1 
ATOM   7862  C  CG    . LEU F  1 130 ? -19.470 -8.249  41.150  1.00 41.43 ? 129  LEU D CG    1 
ATOM   7863  C  CD1   . LEU F  1 130 ? -19.709 -9.569  41.877  1.00 40.11 ? 129  LEU D CD1   1 
ATOM   7864  C  CD2   . LEU F  1 130 ? -17.944 -7.921  41.144  1.00 40.18 ? 129  LEU D CD2   1 
ATOM   7865  N  N     . ARG F  1 131 ? -21.454 -7.609  36.966  1.00 42.41 ? 130  ARG D N     1 
ATOM   7866  C  CA    . ARG F  1 131 ? -21.789 -7.902  35.571  1.00 43.39 ? 130  ARG D CA    1 
ATOM   7867  C  C     . ARG F  1 131 ? -21.298 -6.843  34.592  1.00 43.66 ? 130  ARG D C     1 
ATOM   7868  O  O     . ARG F  1 131 ? -20.782 -7.178  33.523  1.00 42.90 ? 130  ARG D O     1 
ATOM   7869  C  CB    . ARG F  1 131 ? -23.298 -8.053  35.400  1.00 44.06 ? 130  ARG D CB    1 
ATOM   7870  C  CG    . ARG F  1 131 ? -23.705 -8.552  34.030  1.00 46.27 ? 130  ARG D CG    1 
ATOM   7871  C  CD    . ARG F  1 131 ? -24.642 -9.731  34.158  1.00 49.89 ? 130  ARG D CD    1 
ATOM   7872  N  NE    . ARG F  1 131 ? -25.903 -9.336  34.784  1.00 51.88 ? 130  ARG D NE    1 
ATOM   7873  C  CZ    . ARG F  1 131 ? -26.733 -10.157 35.432  1.00 52.52 ? 130  ARG D CZ    1 
ATOM   7874  N  NH1   . ARG F  1 131 ? -27.841 -9.658  35.961  1.00 52.90 ? 130  ARG D NH1   1 
ATOM   7875  N  NH2   . ARG F  1 131 ? -26.465 -11.459 35.574  1.00 52.69 ? 130  ARG D NH2   1 
ATOM   7876  N  N     . ASP F  1 132 ? -21.465 -5.573  34.962  1.00 44.19 ? 131  ASP D N     1 
ATOM   7877  C  CA    . ASP F  1 132 ? -20.950 -4.450  34.162  1.00 44.86 ? 131  ASP D CA    1 
ATOM   7878  C  C     . ASP F  1 132 ? -19.437 -4.524  33.924  1.00 44.42 ? 131  ASP D C     1 
ATOM   7879  O  O     . ASP F  1 132 ? -18.959 -4.022  32.910  1.00 44.41 ? 131  ASP D O     1 
ATOM   7880  C  CB    . ASP F  1 132 ? -21.335 -3.107  34.801  1.00 45.41 ? 131  ASP D CB    1 
ATOM   7881  C  CG    . ASP F  1 132 ? -22.811 -2.757  34.582  1.00 48.73 ? 131  ASP D CG    1 
ATOM   7882  O  OD1   . ASP F  1 132 ? -23.628 -3.675  34.284  1.00 50.72 ? 131  ASP D OD1   1 
ATOM   7883  O  OD2   . ASP F  1 132 ? -23.161 -1.554  34.696  1.00 53.72 ? 131  ASP D OD2   1 
ATOM   7884  N  N     . LYS F  1 133 ? -18.695 -5.160  34.837  1.00 43.60 ? 132  LYS D N     1 
ATOM   7885  C  CA    . LYS F  1 133 ? -17.283 -5.482  34.605  1.00 43.25 ? 132  LYS D CA    1 
ATOM   7886  C  C     . LYS F  1 133 ? -17.056 -6.915  34.050  1.00 42.75 ? 132  LYS D C     1 
ATOM   7887  O  O     . LYS F  1 133 ? -15.922 -7.420  34.059  1.00 42.52 ? 132  LYS D O     1 
ATOM   7888  C  CB    . LYS F  1 133 ? -16.475 -5.296  35.904  1.00 43.31 ? 132  LYS D CB    1 
ATOM   7889  C  CG    . LYS F  1 133 ? -16.568 -3.889  36.522  1.00 44.17 ? 132  LYS D CG    1 
ATOM   7890  N  N     . LYS F  1 134 ? -18.118 -7.549  33.544  1.00 41.76 ? 133  LYS D N     1 
ATOM   7891  C  CA    . LYS F  1 134 ? -18.083 -8.957  33.114  1.00 41.10 ? 133  LYS D CA    1 
ATOM   7892  C  C     . LYS F  1 134 ? -17.612 -9.931  34.215  1.00 40.63 ? 133  LYS D C     1 
ATOM   7893  O  O     . LYS F  1 134 ? -16.877 -10.869 33.949  1.00 39.87 ? 133  LYS D O     1 
ATOM   7894  C  CB    . LYS F  1 134 ? -17.235 -9.127  31.840  1.00 41.03 ? 133  LYS D CB    1 
ATOM   7895  C  CG    . LYS F  1 134 ? -17.779 -8.354  30.635  1.00 40.03 ? 133  LYS D CG    1 
ATOM   7896  C  CD    . LYS F  1 134 ? -17.001 -8.637  29.352  1.00 39.60 ? 133  LYS D CD    1 
ATOM   7897  C  CE    . LYS F  1 134 ? -15.634 -7.963  29.307  1.00 38.56 ? 133  LYS D CE    1 
ATOM   7898  N  NZ    . LYS F  1 134 ? -14.922 -8.243  28.005  1.00 38.26 ? 133  LYS D NZ    1 
ATOM   7899  N  N     . LEU F  1 135 ? -18.076 -9.695  35.438  1.00 40.11 ? 134  LEU D N     1 
ATOM   7900  C  CA    . LEU F  1 135 ? -17.709 -10.504 36.610  1.00 39.65 ? 134  LEU D CA    1 
ATOM   7901  C  C     . LEU F  1 135 ? -18.965 -10.971 37.338  1.00 39.27 ? 134  LEU D C     1 
ATOM   7902  O  O     . LEU F  1 135 ? -20.057 -10.489 37.065  1.00 38.88 ? 134  LEU D O     1 
ATOM   7903  C  CB    . LEU F  1 135 ? -16.863 -9.680  37.575  1.00 39.43 ? 134  LEU D CB    1 
ATOM   7904  C  CG    . LEU F  1 135 ? -15.470 -9.259  37.121  1.00 39.61 ? 134  LEU D CG    1 
ATOM   7905  C  CD1   . LEU F  1 135 ? -14.903 -8.267  38.123  1.00 40.17 ? 134  LEU D CD1   1 
ATOM   7906  C  CD2   . LEU F  1 135 ? -14.540 -10.468 36.943  1.00 39.76 ? 134  LEU D CD2   1 
ATOM   7907  N  N     . ALA F  1 136 ? -18.804 -11.898 38.272  1.00 38.66 ? 135  ALA D N     1 
ATOM   7908  C  CA    . ALA F  1 136 ? -19.911 -12.316 39.140  1.00 38.47 ? 135  ALA D CA    1 
ATOM   7909  C  C     . ALA F  1 136 ? -19.364 -12.709 40.503  1.00 37.81 ? 135  ALA D C     1 
ATOM   7910  O  O     . ALA F  1 136 ? -18.155 -12.815 40.670  1.00 37.91 ? 135  ALA D O     1 
ATOM   7911  C  CB    . ALA F  1 136 ? -20.656 -13.468 38.527  1.00 38.57 ? 135  ALA D CB    1 
ATOM   7912  N  N     . PRO F  1 137 ? -20.241 -12.894 41.497  1.00 37.19 ? 136  PRO D N     1 
ATOM   7913  C  CA    . PRO F  1 137 ? -19.733 -13.416 42.772  1.00 37.18 ? 136  PRO D CA    1 
ATOM   7914  C  C     . PRO F  1 137 ? -19.055 -14.773 42.648  1.00 36.66 ? 136  PRO D C     1 
ATOM   7915  O  O     . PRO F  1 137 ? -19.391 -15.570 41.763  1.00 36.48 ? 136  PRO D O     1 
ATOM   7916  C  CB    . PRO F  1 137 ? -20.997 -13.534 43.620  1.00 37.32 ? 136  PRO D CB    1 
ATOM   7917  C  CG    . PRO F  1 137 ? -21.890 -12.466 43.065  1.00 37.05 ? 136  PRO D CG    1 
ATOM   7918  C  CD    . PRO F  1 137 ? -21.676 -12.592 41.588  1.00 37.43 ? 136  PRO D CD    1 
ATOM   7919  N  N     . ILE F  1 138 ? -18.107 -15.017 43.540  1.00 35.66 ? 137  ILE D N     1 
ATOM   7920  C  CA    . ILE F  1 138 ? -17.470 -16.304 43.633  1.00 35.45 ? 137  ILE D CA    1 
ATOM   7921  C  C     . ILE F  1 138 ? -18.516 -17.317 44.093  1.00 35.20 ? 137  ILE D C     1 
ATOM   7922  O  O     . ILE F  1 138 ? -19.178 -17.106 45.090  1.00 35.81 ? 137  ILE D O     1 
ATOM   7923  C  CB    . ILE F  1 138 ? -16.297 -16.294 44.628  1.00 34.36 ? 137  ILE D CB    1 
ATOM   7924  C  CG1   . ILE F  1 138 ? -15.284 -15.189 44.271  1.00 34.55 ? 137  ILE D CG1   1 
ATOM   7925  C  CG2   . ILE F  1 138 ? -15.661 -17.672 44.716  1.00 35.10 ? 137  ILE D CG2   1 
ATOM   7926  C  CD1   . ILE F  1 138 ? -15.080 -14.921 42.796  1.00 32.43 ? 137  ILE D CD1   1 
ATOM   7927  N  N     . THR F  1 139 ? -18.636 -18.403 43.346  1.00 35.01 ? 138  THR D N     1 
ATOM   7928  C  CA    . THR F  1 139 ? -19.513 -19.507 43.678  1.00 34.97 ? 138  THR D CA    1 
ATOM   7929  C  C     . THR F  1 139 ? -18.830 -20.472 44.653  1.00 35.73 ? 138  THR D C     1 
ATOM   7930  O  O     . THR F  1 139 ? -17.605 -20.490 44.786  1.00 35.57 ? 138  THR D O     1 
ATOM   7931  C  CB    . THR F  1 139 ? -19.872 -20.319 42.424  1.00 34.44 ? 138  THR D CB    1 
ATOM   7932  O  OG1   . THR F  1 139 ? -18.706 -21.008 41.982  1.00 32.58 ? 138  THR D OG1   1 
ATOM   7933  C  CG2   . THR F  1 139 ? -20.404 -19.436 41.300  1.00 33.11 ? 138  THR D CG2   1 
ATOM   7934  N  N     . TYR F  1 140 ? -19.640 -21.288 45.320  1.00 36.47 ? 139  TYR D N     1 
ATOM   7935  C  CA    . TYR F  1 140 ? -19.123 -22.311 46.214  1.00 36.88 ? 139  TYR D CA    1 
ATOM   7936  C  C     . TYR F  1 140 ? -18.106 -23.244 45.534  1.00 36.68 ? 139  TYR D C     1 
ATOM   7937  O  O     . TYR F  1 140 ? -17.032 -23.453 46.075  1.00 36.74 ? 139  TYR D O     1 
ATOM   7938  C  CB    . TYR F  1 140 ? -20.269 -23.100 46.859  1.00 37.47 ? 139  TYR D CB    1 
ATOM   7939  C  CG    . TYR F  1 140 ? -19.806 -24.039 47.940  1.00 38.27 ? 139  TYR D CG    1 
ATOM   7940  C  CD1   . TYR F  1 140 ? -19.546 -25.381 47.666  1.00 39.94 ? 139  TYR D CD1   1 
ATOM   7941  C  CD2   . TYR F  1 140 ? -19.609 -23.584 49.234  1.00 37.98 ? 139  TYR D CD2   1 
ATOM   7942  C  CE1   . TYR F  1 140 ? -19.101 -26.245 48.668  1.00 40.37 ? 139  TYR D CE1   1 
ATOM   7943  C  CE2   . TYR F  1 140 ? -19.165 -24.434 50.233  1.00 39.68 ? 139  TYR D CE2   1 
ATOM   7944  C  CZ    . TYR F  1 140 ? -18.908 -25.756 49.949  1.00 39.68 ? 139  TYR D CZ    1 
ATOM   7945  O  OH    . TYR F  1 140 ? -18.467 -26.584 50.957  1.00 40.56 ? 139  TYR D OH    1 
ATOM   7946  N  N     . PRO F  1 141 ? -18.429 -23.806 44.344  1.00 36.84 ? 140  PRO D N     1 
ATOM   7947  C  CA    . PRO F  1 141 ? -17.409 -24.657 43.704  1.00 36.75 ? 140  PRO D CA    1 
ATOM   7948  C  C     . PRO F  1 141 ? -16.073 -23.952 43.413  1.00 36.83 ? 140  PRO D C     1 
ATOM   7949  O  O     . PRO F  1 141 ? -15.008 -24.584 43.504  1.00 36.75 ? 140  PRO D O     1 
ATOM   7950  C  CB    . PRO F  1 141 ? -18.097 -25.115 42.403  1.00 36.82 ? 140  PRO D CB    1 
ATOM   7951  C  CG    . PRO F  1 141 ? -19.558 -25.015 42.695  1.00 36.41 ? 140  PRO D CG    1 
ATOM   7952  C  CD    . PRO F  1 141 ? -19.676 -23.787 43.553  1.00 36.55 ? 140  PRO D CD    1 
ATOM   7953  N  N     . GLN F  1 142 ? -16.132 -22.666 43.075  1.00 36.51 ? 141  GLN D N     1 
ATOM   7954  C  CA    . GLN F  1 142 ? -14.931 -21.875 42.807  1.00 36.51 ? 141  GLN D CA    1 
ATOM   7955  C  C     . GLN F  1 142 ? -14.077 -21.698 44.063  1.00 36.41 ? 141  GLN D C     1 
ATOM   7956  O  O     . GLN F  1 142 ? -12.850 -21.884 44.029  1.00 36.32 ? 141  GLN D O     1 
ATOM   7957  C  CB    . GLN F  1 142 ? -15.306 -20.505 42.197  1.00 36.50 ? 141  GLN D CB    1 
ATOM   7958  C  CG    . GLN F  1 142 ? -15.807 -20.620 40.763  1.00 36.01 ? 141  GLN D CG    1 
ATOM   7959  C  CD    . GLN F  1 142 ? -16.351 -19.324 40.166  1.00 36.01 ? 141  GLN D CD    1 
ATOM   7960  O  OE1   . GLN F  1 142 ? -16.539 -18.327 40.850  1.00 33.83 ? 141  GLN D OE1   1 
ATOM   7961  N  NE2   . GLN F  1 142 ? -16.617 -19.354 38.866  1.00 34.76 ? 141  GLN D NE2   1 
ATOM   7962  N  N     . GLY F  1 143 ? -14.727 -21.349 45.168  1.00 36.68 ? 142  GLY D N     1 
ATOM   7963  C  CA    . GLY F  1 143 ? -14.045 -21.214 46.457  1.00 36.96 ? 142  GLY D CA    1 
ATOM   7964  C  C     . GLY F  1 143 ? -13.419 -22.508 46.929  1.00 37.13 ? 142  GLY D C     1 
ATOM   7965  O  O     . GLY F  1 143 ? -12.264 -22.534 47.353  1.00 37.24 ? 142  GLY D O     1 
ATOM   7966  N  N     . LEU F  1 144 ? -14.179 -23.591 46.854  1.00 37.72 ? 143  LEU D N     1 
ATOM   7967  C  CA    . LEU F  1 144 ? -13.677 -24.910 47.255  1.00 37.93 ? 143  LEU D CA    1 
ATOM   7968  C  C     . LEU F  1 144 ? -12.449 -25.336 46.437  1.00 37.90 ? 143  LEU D C     1 
ATOM   7969  O  O     . LEU F  1 144 ? -11.500 -25.909 46.975  1.00 38.15 ? 143  LEU D O     1 
ATOM   7970  C  CB    . LEU F  1 144 ? -14.800 -25.948 47.119  1.00 38.28 ? 143  LEU D CB    1 
ATOM   7971  C  CG    . LEU F  1 144 ? -14.536 -27.375 47.605  1.00 38.32 ? 143  LEU D CG    1 
ATOM   7972  C  CD1   . LEU F  1 144 ? -14.493 -27.438 49.134  1.00 38.84 ? 143  LEU D CD1   1 
ATOM   7973  C  CD2   . LEU F  1 144 ? -15.622 -28.292 47.061  1.00 38.29 ? 143  LEU D CD2   1 
ATOM   7974  N  N     . ALA F  1 145 ? -12.471 -25.060 45.136  1.00 37.79 ? 144  ALA D N     1 
ATOM   7975  C  CA    . ALA F  1 145 ? -11.342 -25.360 44.259  1.00 37.74 ? 144  ALA D CA    1 
ATOM   7976  C  C     . ALA F  1 145 ? -10.089 -24.582 44.674  1.00 37.69 ? 144  ALA D C     1 
ATOM   7977  O  O     . ALA F  1 145 ? -8.981  -25.114 44.652  1.00 36.98 ? 144  ALA D O     1 
ATOM   7978  C  CB    . ALA F  1 145 ? -11.704 -25.032 42.814  1.00 37.78 ? 144  ALA D CB    1 
ATOM   7979  N  N     . MET F  1 146 ? -10.279 -23.312 45.021  1.00 37.68 ? 145  MET D N     1 
ATOM   7980  C  CA    . MET F  1 146 ? -9.203  -22.468 45.522  1.00 38.48 ? 145  MET D CA    1 
ATOM   7981  C  C     . MET F  1 146 ? -8.675  -23.027 46.844  1.00 38.63 ? 145  MET D C     1 
ATOM   7982  O  O     . MET F  1 146 ? -7.470  -23.090 47.052  1.00 39.30 ? 145  MET D O     1 
ATOM   7983  C  CB    . MET F  1 146 ? -9.697  -21.028 45.706  1.00 38.54 ? 145  MET D CB    1 
ATOM   7984  C  CG    . MET F  1 146 ? -8.629  -20.033 46.199  1.00 40.15 ? 145  MET D CG    1 
ATOM   7985  S  SD    . MET F  1 146 ? -7.208  -19.837 45.072  1.00 39.99 ? 145  MET D SD    1 
ATOM   7986  C  CE    . MET F  1 146 ? -7.842  -18.628 43.908  1.00 40.75 ? 145  MET D CE    1 
ATOM   7987  N  N     . ALA F  1 147 ? -9.577  -23.445 47.725  1.00 38.99 ? 146  ALA D N     1 
ATOM   7988  C  CA    . ALA F  1 147 ? -9.179  -24.025 49.022  1.00 39.18 ? 146  ALA D CA    1 
ATOM   7989  C  C     . ALA F  1 147 ? -8.313  -25.254 48.834  1.00 39.84 ? 146  ALA D C     1 
ATOM   7990  O  O     . ALA F  1 147 ? -7.322  -25.446 49.554  1.00 39.35 ? 146  ALA D O     1 
ATOM   7991  C  CB    . ALA F  1 147 ? -10.398 -24.370 49.849  1.00 38.62 ? 146  ALA D CB    1 
ATOM   7992  N  N     . ARG F  1 148 ? -8.694  -26.096 47.875  1.00 40.61 ? 147  ARG D N     1 
ATOM   7993  C  CA    . ARG F  1 148 ? -7.945  -27.317 47.597  1.00 42.12 ? 147  ARG D CA    1 
ATOM   7994  C  C     . ARG F  1 148 ? -6.575  -27.010 47.024  1.00 41.61 ? 147  ARG D C     1 
ATOM   7995  O  O     . ARG F  1 148 ? -5.599  -27.637 47.391  1.00 41.64 ? 147  ARG D O     1 
ATOM   7996  C  CB    . ARG F  1 148 ? -8.720  -28.232 46.654  1.00 42.31 ? 147  ARG D CB    1 
ATOM   7997  C  CG    . ARG F  1 148 ? -9.780  -29.055 47.363  1.00 44.37 ? 147  ARG D CG    1 
ATOM   7998  C  CD    . ARG F  1 148 ? -10.587 -29.895 46.382  1.00 46.22 ? 147  ARG D CD    1 
ATOM   7999  N  NE    . ARG F  1 148 ? -11.777 -30.454 47.035  1.00 50.38 ? 147  ARG D NE    1 
ATOM   8000  C  CZ    . ARG F  1 148 ? -12.974 -30.612 46.461  1.00 51.26 ? 147  ARG D CZ    1 
ATOM   8001  N  NH1   . ARG F  1 148 ? -13.187 -30.245 45.196  1.00 52.64 ? 147  ARG D NH1   1 
ATOM   8002  N  NH2   . ARG F  1 148 ? -13.976 -31.133 47.167  1.00 51.25 ? 147  ARG D NH2   1 
ATOM   8003  N  N     . GLU F  1 149 ? -6.515  -26.026 46.135  1.00 41.87 ? 148  GLU D N     1 
ATOM   8004  C  CA    . GLU F  1 149 ? -5.266  -25.582 45.537  1.00 41.94 ? 148  GLU D CA    1 
ATOM   8005  C  C     . GLU F  1 149 ? -4.256  -25.137 46.595  1.00 41.07 ? 148  GLU D C     1 
ATOM   8006  O  O     . GLU F  1 149 ? -3.086  -25.499 46.520  1.00 41.34 ? 148  GLU D O     1 
ATOM   8007  C  CB    . GLU F  1 149 ? -5.531  -24.452 44.532  1.00 42.67 ? 148  GLU D CB    1 
ATOM   8008  C  CG    . GLU F  1 149 ? -4.271  -23.755 43.997  1.00 45.97 ? 148  GLU D CG    1 
ATOM   8009  C  CD    . GLU F  1 149 ? -4.168  -23.794 42.478  1.00 51.05 ? 148  GLU D CD    1 
ATOM   8010  O  OE1   . GLU F  1 149 ? -5.194  -23.564 41.805  1.00 54.94 ? 148  GLU D OE1   1 
ATOM   8011  O  OE2   . GLU F  1 149 ? -3.059  -24.070 41.957  1.00 53.29 ? 148  GLU D OE2   1 
ATOM   8012  N  N     . ILE F  1 150 ? -4.702  -24.370 47.584  1.00 40.21 ? 149  ILE D N     1 
ATOM   8013  C  CA    . ILE F  1 150 ? -3.779  -23.868 48.607  1.00 39.19 ? 149  ILE D CA    1 
ATOM   8014  C  C     . ILE F  1 150 ? -3.597  -24.849 49.786  1.00 39.10 ? 149  ILE D C     1 
ATOM   8015  O  O     . ILE F  1 150 ? -2.785  -24.615 50.675  1.00 39.42 ? 149  ILE D O     1 
ATOM   8016  C  CB    . ILE F  1 150 ? -4.157  -22.447 49.082  1.00 38.40 ? 149  ILE D CB    1 
ATOM   8017  C  CG1   . ILE F  1 150 ? -5.483  -22.426 49.854  1.00 39.35 ? 149  ILE D CG1   1 
ATOM   8018  C  CG2   . ILE F  1 150 ? -4.208  -21.510 47.893  1.00 38.23 ? 149  ILE D CG2   1 
ATOM   8019  C  CD1   . ILE F  1 150 ? -5.780  -21.057 50.569  1.00 37.63 ? 149  ILE D CD1   1 
ATOM   8020  N  N     . GLY F  1 151 ? -4.334  -25.952 49.777  1.00 38.93 ? 150  GLY D N     1 
ATOM   8021  C  CA    . GLY F  1 151 ? -4.215  -26.960 50.821  1.00 39.07 ? 150  GLY D CA    1 
ATOM   8022  C  C     . GLY F  1 151 ? -4.878  -26.517 52.108  1.00 39.01 ? 150  GLY D C     1 
ATOM   8023  O  O     . GLY F  1 151 ? -4.441  -26.866 53.188  1.00 38.91 ? 150  GLY D O     1 
ATOM   8024  N  N     . SER F  1 152 ? -5.951  -25.750 51.981  1.00 39.21 ? 151  SER D N     1 
ATOM   8025  C  CA    . SER F  1 152 ? -6.733  -25.328 53.121  1.00 39.20 ? 151  SER D CA    1 
ATOM   8026  C  C     . SER F  1 152 ? -7.369  -26.566 53.747  1.00 39.45 ? 151  SER D C     1 
ATOM   8027  O  O     . SER F  1 152 ? -7.727  -27.526 53.052  1.00 39.18 ? 151  SER D O     1 
ATOM   8028  C  CB    . SER F  1 152 ? -7.798  -24.326 52.666  1.00 39.51 ? 151  SER D CB    1 
ATOM   8029  O  OG    . SER F  1 152 ? -8.588  -23.893 53.751  1.00 41.31 ? 151  SER D OG    1 
ATOM   8030  N  N     . VAL F  1 153 ? -7.476  -26.558 55.072  1.00 39.59 ? 152  VAL D N     1 
ATOM   8031  C  CA    . VAL F  1 153 ? -8.111  -27.650 55.803  1.00 39.73 ? 152  VAL D CA    1 
ATOM   8032  C  C     . VAL F  1 153 ? -9.637  -27.553 55.686  1.00 39.46 ? 152  VAL D C     1 
ATOM   8033  O  O     . VAL F  1 153 ? -10.349 -28.527 55.919  1.00 39.44 ? 152  VAL D O     1 
ATOM   8034  C  CB    . VAL F  1 153 ? -7.692  -27.641 57.298  1.00 39.92 ? 152  VAL D CB    1 
ATOM   8035  C  CG1   . VAL F  1 153 ? -8.501  -28.660 58.096  1.00 40.69 ? 152  VAL D CG1   1 
ATOM   8036  C  CG2   . VAL F  1 153 ? -6.195  -27.929 57.435  1.00 40.44 ? 152  VAL D CG2   1 
ATOM   8037  N  N     . LYS F  1 154 ? -10.143 -26.381 55.331  1.00 39.26 ? 153  LYS D N     1 
ATOM   8038  C  CA    . LYS F  1 154 ? -11.582 -26.204 55.177  1.00 39.42 ? 153  LYS D CA    1 
ATOM   8039  C  C     . LYS F  1 154 ? -11.871 -24.936 54.384  1.00 38.96 ? 153  LYS D C     1 
ATOM   8040  O  O     . LYS F  1 154 ? -11.159 -23.949 54.536  1.00 38.59 ? 153  LYS D O     1 
ATOM   8041  C  CB    . LYS F  1 154 ? -12.242 -26.127 56.562  1.00 39.85 ? 153  LYS D CB    1 
ATOM   8042  C  CG    . LYS F  1 154 ? -13.692 -26.589 56.626  1.00 40.51 ? 153  LYS D CG    1 
ATOM   8043  C  CD    . LYS F  1 154 ? -13.825 -28.079 56.782  1.00 40.48 ? 153  LYS D CD    1 
ATOM   8044  N  N     . TYR F  1 155 ? -12.897 -24.982 53.527  1.00 38.55 ? 154  TYR D N     1 
ATOM   8045  C  CA    . TYR F  1 155 ? -13.454 -23.772 52.888  1.00 38.06 ? 154  TYR D CA    1 
ATOM   8046  C  C     . TYR F  1 155 ? -14.814 -23.470 53.498  1.00 37.79 ? 154  TYR D C     1 
ATOM   8047  O  O     . TYR F  1 155 ? -15.674 -24.353 53.591  1.00 37.52 ? 154  TYR D O     1 
ATOM   8048  C  CB    . TYR F  1 155 ? -13.621 -23.954 51.376  1.00 38.01 ? 154  TYR D CB    1 
ATOM   8049  C  CG    . TYR F  1 155 ? -14.412 -22.826 50.709  1.00 37.70 ? 154  TYR D CG    1 
ATOM   8050  C  CD1   . TYR F  1 155 ? -13.918 -21.516 50.695  1.00 36.81 ? 154  TYR D CD1   1 
ATOM   8051  C  CD2   . TYR F  1 155 ? -15.652 -23.066 50.113  1.00 37.54 ? 154  TYR D CD2   1 
ATOM   8052  C  CE1   . TYR F  1 155 ? -14.625 -20.476 50.083  1.00 37.22 ? 154  TYR D CE1   1 
ATOM   8053  C  CE2   . TYR F  1 155 ? -16.371 -22.027 49.499  1.00 38.52 ? 154  TYR D CE2   1 
ATOM   8054  C  CZ    . TYR F  1 155 ? -15.845 -20.728 49.496  1.00 37.13 ? 154  TYR D CZ    1 
ATOM   8055  O  OH    . TYR F  1 155 ? -16.530 -19.690 48.907  1.00 36.79 ? 154  TYR D OH    1 
ATOM   8056  N  N     . LEU F  1 156 ? -15.007 -22.232 53.929  1.00 37.98 ? 155  LEU D N     1 
ATOM   8057  C  CA    . LEU F  1 156 ? -16.261 -21.850 54.580  1.00 37.96 ? 155  LEU D CA    1 
ATOM   8058  C  C     . LEU F  1 156 ? -16.762 -20.506 54.051  1.00 38.07 ? 155  LEU D C     1 
ATOM   8059  O  O     . LEU F  1 156 ? -15.969 -19.644 53.665  1.00 39.00 ? 155  LEU D O     1 
ATOM   8060  C  CB    . LEU F  1 156 ? -16.081 -21.814 56.102  1.00 37.76 ? 155  LEU D CB    1 
ATOM   8061  C  CG    . LEU F  1 156 ? -15.684 -23.138 56.786  1.00 37.87 ? 155  LEU D CG    1 
ATOM   8062  C  CD1   . LEU F  1 156 ? -15.228 -22.899 58.213  1.00 36.66 ? 155  LEU D CD1   1 
ATOM   8063  C  CD2   . LEU F  1 156 ? -16.806 -24.187 56.756  1.00 35.29 ? 155  LEU D CD2   1 
ATOM   8064  N  N     . GLU F  1 157 ? -18.080 -20.347 53.998  1.00 37.81 ? 156  GLU D N     1 
ATOM   8065  C  CA    . GLU F  1 157 ? -18.680 -19.084 53.595  1.00 37.73 ? 156  GLU D CA    1 
ATOM   8066  C  C     . GLU F  1 157 ? -19.471 -18.515 54.774  1.00 37.27 ? 156  GLU D C     1 
ATOM   8067  O  O     . GLU F  1 157 ? -20.125 -19.264 55.515  1.00 36.99 ? 156  GLU D O     1 
ATOM   8068  C  CB    . GLU F  1 157 ? -19.545 -19.282 52.342  1.00 37.78 ? 156  GLU D CB    1 
ATOM   8069  C  CG    . GLU F  1 157 ? -18.698 -19.660 51.115  1.00 37.89 ? 156  GLU D CG    1 
ATOM   8070  C  CD    . GLU F  1 157 ? -19.506 -20.078 49.883  1.00 38.19 ? 156  GLU D CD    1 
ATOM   8071  O  OE1   . GLU F  1 157 ? -20.709 -20.407 50.012  1.00 37.54 ? 156  GLU D OE1   1 
ATOM   8072  O  OE2   . GLU F  1 157 ? -18.927 -20.079 48.776  1.00 38.30 ? 156  GLU D OE2   1 
ATOM   8073  N  N     . CYS F  1 158 ? -19.379 -17.199 54.975  1.00 37.30 ? 157  CYS D N     1 
ATOM   8074  C  CA    . CYS F  1 158 ? -20.143 -16.539 56.039  1.00 36.94 ? 157  CYS D CA    1 
ATOM   8075  C  C     . CYS F  1 158 ? -20.537 -15.091 55.736  1.00 36.66 ? 157  CYS D C     1 
ATOM   8076  O  O     . CYS F  1 158 ? -19.949 -14.435 54.887  1.00 36.31 ? 157  CYS D O     1 
ATOM   8077  C  CB    . CYS F  1 158 ? -19.350 -16.592 57.355  1.00 36.90 ? 157  CYS D CB    1 
ATOM   8078  S  SG    . CYS F  1 158 ? -17.865 -15.545 57.395  1.00 36.84 ? 157  CYS D SG    1 
ATOM   8079  N  N     . SER F  1 159 ? -21.556 -14.617 56.445  1.00 36.68 ? 158  SER D N     1 
ATOM   8080  C  CA    . SER F  1 159 ? -21.836 -13.193 56.563  1.00 36.75 ? 158  SER D CA    1 
ATOM   8081  C  C     . SER F  1 159 ? -21.603 -12.764 58.002  1.00 36.08 ? 158  SER D C     1 
ATOM   8082  O  O     . SER F  1 159 ? -22.176 -13.322 58.923  1.00 36.47 ? 158  SER D O     1 
ATOM   8083  C  CB    . SER F  1 159 ? -23.273 -12.887 56.154  1.00 37.16 ? 158  SER D CB    1 
ATOM   8084  O  OG    . SER F  1 159 ? -23.595 -11.514 56.298  1.00 37.08 ? 158  SER D OG    1 
ATOM   8085  N  N     . ALA F  1 160 ? -20.743 -11.778 58.193  1.00 35.89 ? 159  ALA D N     1 
ATOM   8086  C  CA    . ALA F  1 160 ? -20.605 -11.131 59.498  1.00 35.92 ? 159  ALA D CA    1 
ATOM   8087  C  C     . ALA F  1 160 ? -21.882 -10.364 59.820  1.00 35.88 ? 159  ALA D C     1 
ATOM   8088  O  O     . ALA F  1 160 ? -22.281 -10.272 60.985  1.00 36.45 ? 159  ALA D O     1 
ATOM   8089  C  CB    . ALA F  1 160 ? -19.421 -10.192 59.511  1.00 35.13 ? 159  ALA D CB    1 
ATOM   8090  N  N     . LEU F  1 161 ? -22.509 -9.810  58.785  1.00 36.02 ? 160  LEU D N     1 
ATOM   8091  C  CA    . LEU F  1 161 ? -23.716 -9.013  58.946  1.00 36.40 ? 160  LEU D CA    1 
ATOM   8092  C  C     . LEU F  1 161 ? -24.890 -9.834  59.479  1.00 36.50 ? 160  LEU D C     1 
ATOM   8093  O  O     . LEU F  1 161 ? -25.432 -9.502  60.514  1.00 37.59 ? 160  LEU D O     1 
ATOM   8094  C  CB    . LEU F  1 161 ? -24.083 -8.344  57.621  1.00 36.25 ? 160  LEU D CB    1 
ATOM   8095  C  CG    . LEU F  1 161 ? -25.273 -7.403  57.612  1.00 35.85 ? 160  LEU D CG    1 
ATOM   8096  C  CD1   . LEU F  1 161 ? -25.034 -6.161  58.474  1.00 35.90 ? 160  LEU D CD1   1 
ATOM   8097  C  CD2   . LEU F  1 161 ? -25.559 -7.025  56.188  1.00 36.36 ? 160  LEU D CD2   1 
ATOM   8098  N  N     . THR F  1 162 ? -25.293 -10.889 58.772  1.00 37.16 ? 161  THR D N     1 
ATOM   8099  C  CA    . THR F  1 162 ? -26.392 -11.747 59.235  1.00 37.02 ? 161  THR D CA    1 
ATOM   8100  C  C     . THR F  1 162 ? -25.959 -12.810 60.248  1.00 37.42 ? 161  THR D C     1 
ATOM   8101  O  O     . THR F  1 162 ? -26.814 -13.366 60.938  1.00 37.41 ? 161  THR D O     1 
ATOM   8102  C  CB    . THR F  1 162 ? -27.108 -12.464 58.075  1.00 37.01 ? 161  THR D CB    1 
ATOM   8103  O  OG1   . THR F  1 162 ? -26.262 -13.477 57.516  1.00 36.42 ? 161  THR D OG1   1 
ATOM   8104  C  CG2   . THR F  1 162 ? -27.515 -11.459 56.992  1.00 38.05 ? 161  THR D CG2   1 
ATOM   8105  N  N     . GLN F  1 163 ? -24.655 -13.070 60.331  1.00 37.33 ? 162  GLN D N     1 
ATOM   8106  C  CA    . GLN F  1 163 ? -24.061 -14.138 61.169  1.00 38.19 ? 162  GLN D CA    1 
ATOM   8107  C  C     . GLN F  1 163 ? -24.243 -15.556 60.601  1.00 38.68 ? 162  GLN D C     1 
ATOM   8108  O  O     . GLN F  1 163 ? -23.895 -16.548 61.262  1.00 38.50 ? 162  GLN D O     1 
ATOM   8109  C  CB    . GLN F  1 163 ? -24.528 -14.071 62.632  1.00 37.93 ? 162  GLN D CB    1 
ATOM   8110  C  CG    . GLN F  1 163 ? -24.319 -12.701 63.280  1.00 38.83 ? 162  GLN D CG    1 
ATOM   8111  C  CD    . GLN F  1 163 ? -24.381 -12.750 64.798  1.00 38.73 ? 162  GLN D CD    1 
ATOM   8112  O  OE1   . GLN F  1 163 ? -25.366 -13.198 65.365  1.00 41.77 ? 162  GLN D OE1   1 
ATOM   8113  N  NE2   . GLN F  1 163 ? -23.332 -12.273 65.461  1.00 40.29 ? 162  GLN D NE2   1 
ATOM   8114  N  N     . ARG F  1 164 ? -24.762 -15.658 59.378  1.00 39.01 ? 163  ARG D N     1 
ATOM   8115  C  CA    . ARG F  1 164 ? -24.912 -16.961 58.727  1.00 39.85 ? 163  ARG D CA    1 
ATOM   8116  C  C     . ARG F  1 164 ? -23.545 -17.599 58.497  1.00 39.08 ? 163  ARG D C     1 
ATOM   8117  O  O     . ARG F  1 164 ? -22.681 -16.980 57.879  1.00 39.20 ? 163  ARG D O     1 
ATOM   8118  C  CB    . ARG F  1 164 ? -25.651 -16.820 57.393  1.00 40.67 ? 163  ARG D CB    1 
ATOM   8119  C  CG    . ARG F  1 164 ? -26.194 -18.128 56.892  1.00 44.46 ? 163  ARG D CG    1 
ATOM   8120  C  CD    . ARG F  1 164 ? -26.498 -18.124 55.409  1.00 50.01 ? 163  ARG D CD    1 
ATOM   8121  N  NE    . ARG F  1 164 ? -26.844 -19.483 54.970  1.00 53.47 ? 163  ARG D NE    1 
ATOM   8122  C  CZ    . ARG F  1 164 ? -27.122 -19.833 53.715  1.00 55.18 ? 163  ARG D CZ    1 
ATOM   8123  N  NH1   . ARG F  1 164 ? -27.103 -18.919 52.738  1.00 57.00 ? 163  ARG D NH1   1 
ATOM   8124  N  NH2   . ARG F  1 164 ? -27.416 -21.105 53.436  1.00 54.23 ? 163  ARG D NH2   1 
ATOM   8125  N  N     . GLY F  1 165 ? -23.345 -18.814 59.014  1.00 38.60 ? 164  GLY D N     1 
ATOM   8126  C  CA    . GLY F  1 165 ? -22.059 -19.541 58.873  1.00 38.13 ? 164  GLY D CA    1 
ATOM   8127  C  C     . GLY F  1 165 ? -20.903 -18.998 59.702  1.00 37.87 ? 164  GLY D C     1 
ATOM   8128  O  O     . GLY F  1 165 ? -19.784 -19.518 59.643  1.00 38.27 ? 164  GLY D O     1 
ATOM   8129  N  N     . LEU F  1 166 ? -21.175 -17.960 60.488  1.00 37.56 ? 165  LEU D N     1 
ATOM   8130  C  CA    . LEU F  1 166 ? -20.151 -17.202 61.200  1.00 37.17 ? 165  LEU D CA    1 
ATOM   8131  C  C     . LEU F  1 166 ? -19.536 -18.003 62.355  1.00 37.66 ? 165  LEU D C     1 
ATOM   8132  O  O     . LEU F  1 166 ? -18.331 -18.115 62.435  1.00 37.81 ? 165  LEU D O     1 
ATOM   8133  C  CB    . LEU F  1 166 ? -20.752 -15.876 61.713  1.00 36.90 ? 165  LEU D CB    1 
ATOM   8134  C  CG    . LEU F  1 166 ? -19.861 -14.906 62.505  1.00 37.20 ? 165  LEU D CG    1 
ATOM   8135  C  CD1   . LEU F  1 166 ? -18.588 -14.563 61.714  1.00 33.49 ? 165  LEU D CD1   1 
ATOM   8136  C  CD2   . LEU F  1 166 ? -20.644 -13.660 62.916  1.00 34.97 ? 165  LEU D CD2   1 
ATOM   8137  N  N     . LYS F  1 167 ? -20.359 -18.556 63.243  1.00 38.45 ? 166  LYS D N     1 
ATOM   8138  C  CA    . LYS F  1 167 ? -19.856 -19.405 64.338  1.00 38.63 ? 166  LYS D CA    1 
ATOM   8139  C  C     . LYS F  1 167 ? -19.094 -20.632 63.827  1.00 38.87 ? 166  LYS D C     1 
ATOM   8140  O  O     . LYS F  1 167 ? -18.102 -21.054 64.429  1.00 38.80 ? 166  LYS D O     1 
ATOM   8141  C  CB    . LYS F  1 167 ? -21.006 -19.865 65.250  1.00 38.74 ? 166  LYS D CB    1 
ATOM   8142  C  CG    . LYS F  1 167 ? -20.626 -20.943 66.294  1.00 39.13 ? 166  LYS D CG    1 
ATOM   8143  C  CD    . LYS F  1 167 ? -21.702 -21.107 67.381  1.00 39.19 ? 166  LYS D CD    1 
ATOM   8144  C  CE    . LYS F  1 167 ? -21.289 -22.093 68.490  1.00 39.45 ? 166  LYS D CE    1 
ATOM   8145  N  NZ    . LYS F  1 167 ? -21.235 -23.513 67.999  1.00 39.57 ? 166  LYS D NZ    1 
ATOM   8146  N  N     . THR F  1 168 ? -19.580 -21.216 62.735  1.00 38.77 ? 167  THR D N     1 
ATOM   8147  C  CA    . THR F  1 168 ? -18.956 -22.392 62.148  1.00 38.51 ? 167  THR D CA    1 
ATOM   8148  C  C     . THR F  1 168 ? -17.520 -22.111 61.717  1.00 38.08 ? 167  THR D C     1 
ATOM   8149  O  O     . THR F  1 168 ? -16.653 -22.966 61.869  1.00 37.54 ? 167  THR D O     1 
ATOM   8150  C  CB    . THR F  1 168 ? -19.804 -22.926 60.976  1.00 38.74 ? 167  THR D CB    1 
ATOM   8151  O  OG1   . THR F  1 168 ? -21.085 -23.319 61.486  1.00 39.19 ? 167  THR D OG1   1 
ATOM   8152  C  CG2   . THR F  1 168 ? -19.131 -24.132 60.277  1.00 38.89 ? 167  THR D CG2   1 
ATOM   8153  N  N     . VAL F  1 169 ? -17.263 -20.905 61.211  1.00 37.89 ? 168  VAL D N     1 
ATOM   8154  C  CA    . VAL F  1 169 ? -15.903 -20.504 60.861  1.00 37.89 ? 168  VAL D CA    1 
ATOM   8155  C  C     . VAL F  1 169 ? -14.925 -20.738 62.029  1.00 38.10 ? 168  VAL D C     1 
ATOM   8156  O  O     . VAL F  1 169 ? -13.880 -21.360 61.868  1.00 37.71 ? 168  VAL D O     1 
ATOM   8157  C  CB    . VAL F  1 169 ? -15.852 -19.028 60.405  1.00 37.86 ? 168  VAL D CB    1 
ATOM   8158  C  CG1   . VAL F  1 169 ? -14.437 -18.479 60.516  1.00 37.91 ? 168  VAL D CG1   1 
ATOM   8159  C  CG2   . VAL F  1 169 ? -16.380 -18.896 58.962  1.00 38.23 ? 168  VAL D CG2   1 
ATOM   8160  N  N     . PHE F  1 170 ? -15.302 -20.263 63.209  1.00 38.33 ? 169  PHE D N     1 
ATOM   8161  C  CA    . PHE F  1 170 ? -14.429 -20.302 64.368  1.00 38.59 ? 169  PHE D CA    1 
ATOM   8162  C  C     . PHE F  1 170 ? -14.456 -21.661 65.040  1.00 38.65 ? 169  PHE D C     1 
ATOM   8163  O  O     . PHE F  1 170 ? -13.433 -22.137 65.501  1.00 38.56 ? 169  PHE D O     1 
ATOM   8164  C  CB    . PHE F  1 170 ? -14.788 -19.163 65.308  1.00 38.55 ? 169  PHE D CB    1 
ATOM   8165  C  CG    . PHE F  1 170 ? -14.551 -17.810 64.691  1.00 38.91 ? 169  PHE D CG    1 
ATOM   8166  C  CD1   . PHE F  1 170 ? -13.310 -17.198 64.794  1.00 38.75 ? 169  PHE D CD1   1 
ATOM   8167  C  CD2   . PHE F  1 170 ? -15.544 -17.191 63.943  1.00 38.38 ? 169  PHE D CD2   1 
ATOM   8168  C  CE1   . PHE F  1 170 ? -13.084 -15.965 64.192  1.00 39.03 ? 169  PHE D CE1   1 
ATOM   8169  C  CE2   . PHE F  1 170 ? -15.325 -15.956 63.336  1.00 39.10 ? 169  PHE D CE2   1 
ATOM   8170  C  CZ    . PHE F  1 170 ? -14.102 -15.341 63.466  1.00 38.57 ? 169  PHE D CZ    1 
ATOM   8171  N  N     . ASP F  1 171 ? -15.620 -22.300 65.053  1.00 39.38 ? 170  ASP D N     1 
ATOM   8172  C  CA    . ASP F  1 171 ? -15.737 -23.701 65.466  1.00 39.50 ? 170  ASP D CA    1 
ATOM   8173  C  C     . ASP F  1 171 ? -14.744 -24.570 64.667  1.00 39.83 ? 170  ASP D C     1 
ATOM   8174  O  O     . ASP F  1 171 ? -14.008 -25.372 65.237  1.00 39.44 ? 170  ASP D O     1 
ATOM   8175  C  CB    . ASP F  1 171 ? -17.176 -24.207 65.255  1.00 39.75 ? 170  ASP D CB    1 
ATOM   8176  C  CG    . ASP F  1 171 ? -18.165 -23.700 66.316  1.00 40.52 ? 170  ASP D CG    1 
ATOM   8177  O  OD1   . ASP F  1 171 ? -17.800 -22.866 67.170  1.00 40.95 ? 170  ASP D OD1   1 
ATOM   8178  O  OD2   . ASP F  1 171 ? -19.334 -24.152 66.299  1.00 42.34 ? 170  ASP D OD2   1 
ATOM   8179  N  N     . GLU F  1 172 ? -14.713 -24.391 63.348  1.00 40.29 ? 171  GLU D N     1 
ATOM   8180  C  CA    . GLU F  1 172 ? -13.790 -25.157 62.490  1.00 40.76 ? 171  GLU D CA    1 
ATOM   8181  C  C     . GLU F  1 172 ? -12.322 -24.792 62.726  1.00 40.28 ? 171  GLU D C     1 
ATOM   8182  O  O     . GLU F  1 172 ? -11.461 -25.674 62.744  1.00 40.82 ? 171  GLU D O     1 
ATOM   8183  C  CB    . GLU F  1 172 ? -14.142 -24.989 61.003  1.00 41.22 ? 171  GLU D CB    1 
ATOM   8184  C  CG    . GLU F  1 172 ? -15.395 -25.741 60.575  1.00 42.82 ? 171  GLU D CG    1 
ATOM   8185  C  CD    . GLU F  1 172 ? -15.307 -27.241 60.856  1.00 45.17 ? 171  GLU D CD    1 
ATOM   8186  O  OE1   . GLU F  1 172 ? -14.216 -27.819 60.662  1.00 47.47 ? 171  GLU D OE1   1 
ATOM   8187  O  OE2   . GLU F  1 172 ? -16.320 -27.833 61.284  1.00 46.40 ? 171  GLU D OE2   1 
ATOM   8188  N  N     . ALA F  1 173 ? -12.050 -23.503 62.914  1.00 39.67 ? 172  ALA D N     1 
ATOM   8189  C  CA    . ALA F  1 173 ? -10.714 -23.025 63.257  1.00 39.20 ? 172  ALA D CA    1 
ATOM   8190  C  C     . ALA F  1 173 ? -10.196 -23.666 64.554  1.00 39.07 ? 172  ALA D C     1 
ATOM   8191  O  O     . ALA F  1 173 ? -9.051  -24.120 64.616  1.00 39.42 ? 172  ALA D O     1 
ATOM   8192  C  CB    . ALA F  1 173 ? -10.709 -21.479 63.361  1.00 39.17 ? 172  ALA D CB    1 
ATOM   8193  N  N     . ILE F  1 174 ? -11.040 -23.726 65.581  1.00 38.72 ? 173  ILE D N     1 
ATOM   8194  C  CA    . ILE F  1 174 ? -10.668 -24.351 66.855  1.00 38.28 ? 173  ILE D CA    1 
ATOM   8195  C  C     . ILE F  1 174 ? -10.406 -25.841 66.631  1.00 38.53 ? 173  ILE D C     1 
ATOM   8196  O  O     . ILE F  1 174 ? -9.380  -26.366 67.028  1.00 38.00 ? 173  ILE D O     1 
ATOM   8197  C  CB    . ILE F  1 174 ? -11.772 -24.161 67.920  1.00 38.30 ? 173  ILE D CB    1 
ATOM   8198  C  CG1   . ILE F  1 174 ? -11.902 -22.675 68.308  1.00 38.48 ? 173  ILE D CG1   1 
ATOM   8199  C  CG2   . ILE F  1 174 ? -11.485 -25.012 69.179  1.00 37.46 ? 173  ILE D CG2   1 
ATOM   8200  C  CD1   . ILE F  1 174 ? -13.215 -22.336 68.996  1.00 38.05 ? 173  ILE D CD1   1 
ATOM   8201  N  N     . ARG F  1 175 ? -11.348 -26.492 65.955  1.00 38.90 ? 174  ARG D N     1 
ATOM   8202  C  CA    . ARG F  1 175 ? -11.264 -27.903 65.606  1.00 39.30 ? 174  ARG D CA    1 
ATOM   8203  C  C     . ARG F  1 175 ? -9.986  -28.239 64.813  1.00 39.15 ? 174  ARG D C     1 
ATOM   8204  O  O     . ARG F  1 175 ? -9.381  -29.289 65.013  1.00 39.11 ? 174  ARG D O     1 
ATOM   8205  C  CB    . ARG F  1 175 ? -12.497 -28.295 64.782  1.00 39.65 ? 174  ARG D CB    1 
ATOM   8206  C  CG    . ARG F  1 175 ? -13.365 -29.364 65.387  1.00 40.79 ? 174  ARG D CG    1 
ATOM   8207  C  CD    . ARG F  1 175 ? -13.941 -30.282 64.281  1.00 43.63 ? 174  ARG D CD    1 
ATOM   8208  N  N     . ALA F  1 176 ? -9.580  -27.352 63.912  1.00 39.13 ? 175  ALA D N     1 
ATOM   8209  C  CA    . ALA F  1 176 ? -8.330  -27.533 63.160  1.00 39.19 ? 175  ALA D CA    1 
ATOM   8210  C  C     . ALA F  1 176 ? -7.089  -27.572 64.071  1.00 39.38 ? 175  ALA D C     1 
ATOM   8211  O  O     . ALA F  1 176 ? -6.076  -28.175 63.710  1.00 39.29 ? 175  ALA D O     1 
ATOM   8212  C  CB    . ALA F  1 176 ? -8.168  -26.423 62.101  1.00 38.97 ? 175  ALA D CB    1 
ATOM   8213  N  N     . VAL F  1 177 ? -7.176  -26.921 65.235  1.00 39.35 ? 176  VAL D N     1 
ATOM   8214  C  CA    . VAL F  1 177 ? -6.087  -26.889 66.206  1.00 39.45 ? 176  VAL D CA    1 
ATOM   8215  C  C     . VAL F  1 177 ? -6.195  -27.993 67.261  1.00 39.53 ? 176  VAL D C     1 
ATOM   8216  O  O     . VAL F  1 177 ? -5.222  -28.687 67.532  1.00 39.03 ? 176  VAL D O     1 
ATOM   8217  C  CB    . VAL F  1 177 ? -6.042  -25.528 66.934  1.00 39.42 ? 176  VAL D CB    1 
ATOM   8218  C  CG1   . VAL F  1 177 ? -4.983  -25.556 68.053  1.00 40.40 ? 176  VAL D CG1   1 
ATOM   8219  C  CG2   . VAL F  1 177 ? -5.761  -24.424 65.949  1.00 39.12 ? 176  VAL D CG2   1 
ATOM   8220  N  N     . LEU F  1 178 ? -7.380  -28.133 67.853  1.00 40.16 ? 177  LEU D N     1 
ATOM   8221  C  CA    . LEU F  1 178 ? -7.609  -29.055 68.967  1.00 40.92 ? 177  LEU D CA    1 
ATOM   8222  C  C     . LEU F  1 178 ? -8.157  -30.409 68.539  1.00 41.90 ? 177  LEU D C     1 
ATOM   8223  O  O     . LEU F  1 178 ? -8.059  -31.371 69.291  1.00 42.15 ? 177  LEU D O     1 
ATOM   8224  C  CB    . LEU F  1 178 ? -8.591  -28.442 69.962  1.00 40.81 ? 177  LEU D CB    1 
ATOM   8225  C  CG    . LEU F  1 178 ? -8.252  -27.058 70.511  1.00 40.72 ? 177  LEU D CG    1 
ATOM   8226  C  CD1   . LEU F  1 178 ? -9.224  -26.716 71.624  1.00 40.82 ? 177  LEU D CD1   1 
ATOM   8227  C  CD2   . LEU F  1 178 ? -6.812  -26.964 70.999  1.00 40.32 ? 177  LEU D CD2   1 
ATOM   8228  N  N     . GLY F  1 179 ? -8.757  -30.476 67.353  1.00 43.24 ? 178  GLY D N     1 
ATOM   8229  C  CA    . GLY F  1 179 ? -9.282  -31.729 66.818  1.00 44.49 ? 178  GLY D CA    1 
ATOM   8230  C  C     . GLY F  1 179 ? -10.662 -32.074 67.356  1.00 45.35 ? 178  GLY D C     1 
ATOM   8231  O  O     . GLY F  1 179 ? -10.813 -32.547 68.487  1.00 46.07 ? 178  GLY D O     1 
ATOM   8232  O  OXT   . GLY F  1 179 ? -11.669 -31.905 66.658  1.00 46.47 ? 178  GLY D OXT   1 
ATOM   8233  N  N     . GLN G  1 3   ? -20.861 -0.590  4.736   1.00 42.40 ? 2    GLN E N     1 
ATOM   8234  C  CA    . GLN G  1 3   ? -21.036 -2.077  4.878   1.00 43.09 ? 2    GLN E CA    1 
ATOM   8235  C  C     . GLN G  1 3   ? -20.637 -2.729  3.568   1.00 42.74 ? 2    GLN E C     1 
ATOM   8236  O  O     . GLN G  1 3   ? -21.367 -2.643  2.564   1.00 43.15 ? 2    GLN E O     1 
ATOM   8237  C  CB    . GLN G  1 3   ? -22.475 -2.445  5.231   1.00 43.04 ? 2    GLN E CB    1 
ATOM   8238  N  N     . ALA G  1 4   ? -19.460 -3.349  3.569   1.00 42.38 ? 3    ALA E N     1 
ATOM   8239  C  CA    . ALA G  1 4   ? -18.837 -3.816  2.335   1.00 41.96 ? 3    ALA E CA    1 
ATOM   8240  C  C     . ALA G  1 4   ? -18.703 -5.319  2.409   1.00 41.39 ? 3    ALA E C     1 
ATOM   8241  O  O     . ALA G  1 4   ? -18.613 -5.867  3.501   1.00 41.30 ? 3    ALA E O     1 
ATOM   8242  C  CB    . ALA G  1 4   ? -17.480 -3.146  2.147   1.00 41.98 ? 3    ALA E CB    1 
ATOM   8243  N  N     . ILE G  1 5   ? -18.739 -5.983  1.255   1.00 40.53 ? 4    ILE E N     1 
ATOM   8244  C  CA    . ILE G  1 5   ? -18.455 -7.399  1.177   1.00 40.26 ? 4    ILE E CA    1 
ATOM   8245  C  C     . ILE G  1 5   ? -17.394 -7.647  0.127   1.00 39.38 ? 4    ILE E C     1 
ATOM   8246  O  O     . ILE G  1 5   ? -17.567 -7.247  -1.015  1.00 39.46 ? 4    ILE E O     1 
ATOM   8247  C  CB    . ILE G  1 5   ? -19.724 -8.219  0.811   1.00 41.01 ? 4    ILE E CB    1 
ATOM   8248  C  CG1   . ILE G  1 5   ? -20.760 -8.146  1.946   1.00 41.40 ? 4    ILE E CG1   1 
ATOM   8249  C  CG2   . ILE G  1 5   ? -19.345 -9.674  0.457   1.00 39.85 ? 4    ILE E CG2   1 
ATOM   8250  C  CD1   . ILE G  1 5   ? -22.075 -8.884  1.650   1.00 41.71 ? 4    ILE E CD1   1 
ATOM   8251  N  N     . LYS G  1 6   ? -16.299 -8.315  0.504   1.00 38.48 ? 5    LYS E N     1 
ATOM   8252  C  CA    . LYS G  1 6   ? -15.298 -8.760  -0.469  1.00 37.72 ? 5    LYS E CA    1 
ATOM   8253  C  C     . LYS G  1 6   ? -15.533 -10.216 -0.891  1.00 37.16 ? 5    LYS E C     1 
ATOM   8254  O  O     . LYS G  1 6   ? -15.317 -11.146 -0.118  1.00 35.15 ? 5    LYS E O     1 
ATOM   8255  C  CB    . LYS G  1 6   ? -13.875 -8.574  0.068   1.00 38.07 ? 5    LYS E CB    1 
ATOM   8256  C  CG    . LYS G  1 6   ? -12.784 -9.026  -0.928  1.00 38.34 ? 5    LYS E CG    1 
ATOM   8257  C  CD    . LYS G  1 6   ? -11.376 -8.621  -0.520  1.00 38.33 ? 5    LYS E CD    1 
ATOM   8258  C  CE    . LYS G  1 6   ? -10.359 -9.285  -1.448  1.00 38.15 ? 5    LYS E CE    1 
ATOM   8259  N  NZ    . LYS G  1 6   ? -8.953  -8.965  -1.139  1.00 37.22 ? 5    LYS E NZ    1 
ATOM   8260  N  N     . CYS G  1 7   ? -15.977 -10.378 -2.137  1.00 37.29 ? 6    CYS E N     1 
ATOM   8261  C  CA    . CYS G  1 7   ? -16.251 -11.669 -2.731  1.00 37.53 ? 6    CYS E CA    1 
ATOM   8262  C  C     . CYS G  1 7   ? -15.265 -11.931 -3.868  1.00 37.73 ? 6    CYS E C     1 
ATOM   8263  O  O     . CYS G  1 7   ? -15.223 -11.175 -4.826  1.00 38.24 ? 6    CYS E O     1 
ATOM   8264  C  CB    . CYS G  1 7   ? -17.682 -11.739 -3.257  1.00 37.85 ? 6    CYS E CB    1 
ATOM   8265  S  SG    . CYS G  1 7   ? -18.044 -13.248 -4.175  1.00 39.40 ? 6    CYS E SG    1 
ATOM   8266  N  N     . VAL G  1 8   ? -14.492 -13.013 -3.736  1.00 36.90 ? 7    VAL E N     1 
ATOM   8267  C  CA    . VAL G  1 8   ? -13.503 -13.417 -4.709  1.00 37.04 ? 7    VAL E CA    1 
ATOM   8268  C  C     . VAL G  1 8   ? -13.977 -14.680 -5.453  1.00 36.87 ? 7    VAL E C     1 
ATOM   8269  O  O     . VAL G  1 8   ? -14.413 -15.655 -4.848  1.00 36.75 ? 7    VAL E O     1 
ATOM   8270  C  CB    . VAL G  1 8   ? -12.138 -13.623 -4.030  1.00 36.55 ? 7    VAL E CB    1 
ATOM   8271  C  CG1   . VAL G  1 8   ? -11.069 -14.191 -5.023  1.00 37.99 ? 7    VAL E CG1   1 
ATOM   8272  C  CG2   . VAL G  1 8   ? -11.671 -12.299 -3.428  1.00 35.52 ? 7    VAL E CG2   1 
ATOM   8273  N  N     . VAL G  1 9   ? -13.891 -14.627 -6.775  1.00 37.04 ? 8    VAL E N     1 
ATOM   8274  C  CA    . VAL G  1 9   ? -14.329 -15.717 -7.637  1.00 36.39 ? 8    VAL E CA    1 
ATOM   8275  C  C     . VAL G  1 9   ? -13.150 -16.418 -8.321  1.00 36.23 ? 8    VAL E C     1 
ATOM   8276  O  O     . VAL G  1 9   ? -12.350 -15.754 -8.982  1.00 35.81 ? 8    VAL E O     1 
ATOM   8277  C  CB    . VAL G  1 9   ? -15.287 -15.180 -8.688  1.00 36.91 ? 8    VAL E CB    1 
ATOM   8278  C  CG1   . VAL G  1 9   ? -15.886 -16.353 -9.537  1.00 34.90 ? 8    VAL E CG1   1 
ATOM   8279  C  CG2   . VAL G  1 9   ? -16.388 -14.343 -7.982  1.00 36.03 ? 8    VAL E CG2   1 
ATOM   8280  N  N     . VAL G  1 10  ? -13.069 -17.746 -8.166  1.00 35.32 ? 9    VAL E N     1 
ATOM   8281  C  CA    . VAL G  1 10  ? -11.958 -18.559 -8.709  1.00 35.38 ? 9    VAL E CA    1 
ATOM   8282  C  C     . VAL G  1 10  ? -12.470 -19.846 -9.354  1.00 35.88 ? 9    VAL E C     1 
ATOM   8283  O  O     . VAL G  1 10  ? -13.587 -20.273 -9.078  1.00 36.03 ? 9    VAL E O     1 
ATOM   8284  C  CB    . VAL G  1 10  ? -10.917 -18.944 -7.628  1.00 35.30 ? 9    VAL E CB    1 
ATOM   8285  C  CG1   . VAL G  1 10  ? -10.501 -17.706 -6.782  1.00 33.23 ? 9    VAL E CG1   1 
ATOM   8286  C  CG2   . VAL G  1 10  ? -11.445 -20.084 -6.738  1.00 33.50 ? 9    VAL E CG2   1 
ATOM   8287  N  N     . GLY G  1 11  ? -11.649 -20.439 -10.223 1.00 36.12 ? 10   GLY E N     1 
ATOM   8288  C  CA    . GLY G  1 11  ? -12.037 -21.602 -11.048 1.00 36.23 ? 10   GLY E CA    1 
ATOM   8289  C  C     . GLY G  1 11  ? -11.240 -21.714 -12.359 1.00 36.55 ? 10   GLY E C     1 
ATOM   8290  O  O     . GLY G  1 11  ? -10.587 -20.754 -12.798 1.00 36.61 ? 10   GLY E O     1 
ATOM   8291  N  N     . ASP G  1 12  ? -11.288 -22.894 -12.971 1.00 36.54 ? 11   ASP E N     1 
ATOM   8292  C  CA    . ASP G  1 12  ? -10.619 -23.175 -14.235 1.00 36.75 ? 11   ASP E CA    1 
ATOM   8293  C  C     . ASP G  1 12  ? -10.981 -22.173 -15.321 1.00 36.70 ? 11   ASP E C     1 
ATOM   8294  O  O     . ASP G  1 12  ? -12.016 -21.539 -15.263 1.00 37.23 ? 11   ASP E O     1 
ATOM   8295  C  CB    . ASP G  1 12  ? -10.973 -24.587 -14.747 1.00 36.47 ? 11   ASP E CB    1 
ATOM   8296  C  CG    . ASP G  1 12  ? -10.101 -25.695 -14.129 1.00 37.80 ? 11   ASP E CG    1 
ATOM   8297  O  OD1   . ASP G  1 12  ? -9.344  -25.411 -13.172 1.00 36.86 ? 11   ASP E OD1   1 
ATOM   8298  O  OD2   . ASP G  1 12  ? -10.172 -26.866 -14.608 1.00 38.52 ? 11   ASP E OD2   1 
ATOM   8299  N  N     . GLY G  1 13  ? -10.111 -22.052 -16.314 1.00 36.84 ? 12   GLY E N     1 
ATOM   8300  C  CA    . GLY G  1 13  ? -10.410 -21.310 -17.529 1.00 37.40 ? 12   GLY E CA    1 
ATOM   8301  C  C     . GLY G  1 13  ? -11.665 -21.882 -18.167 1.00 37.54 ? 12   GLY E C     1 
ATOM   8302  O  O     . GLY G  1 13  ? -11.974 -23.054 -17.983 1.00 37.28 ? 12   GLY E O     1 
ATOM   8303  N  N     . ALA G  1 14  ? -12.377 -21.043 -18.913 1.00 37.77 ? 13   ALA E N     1 
ATOM   8304  C  CA    . ALA G  1 14  ? -13.580 -21.437 -19.644 1.00 37.84 ? 13   ALA E CA    1 
ATOM   8305  C  C     . ALA G  1 14  ? -14.825 -21.806 -18.808 1.00 37.52 ? 13   ALA E C     1 
ATOM   8306  O  O     . ALA G  1 14  ? -15.840 -22.225 -19.394 1.00 38.35 ? 13   ALA E O     1 
ATOM   8307  C  CB    . ALA G  1 14  ? -13.238 -22.582 -20.611 1.00 38.23 ? 13   ALA E CB    1 
ATOM   8308  N  N     . VAL G  1 15  ? -14.790 -21.655 -17.480 1.00 37.65 ? 14   VAL E N     1 
ATOM   8309  C  CA    . VAL G  1 15  ? -15.922 -22.097 -16.648 1.00 37.08 ? 14   VAL E CA    1 
ATOM   8310  C  C     . VAL G  1 15  ? -17.079 -21.108 -16.583 1.00 37.13 ? 14   VAL E C     1 
ATOM   8311  O  O     . VAL G  1 15  ? -18.222 -21.512 -16.322 1.00 37.36 ? 14   VAL E O     1 
ATOM   8312  C  CB    . VAL G  1 15  ? -15.527 -22.610 -15.195 1.00 37.25 ? 14   VAL E CB    1 
ATOM   8313  C  CG1   . VAL G  1 15  ? -14.579 -23.808 -15.273 1.00 37.43 ? 14   VAL E CG1   1 
ATOM   8314  C  CG2   . VAL G  1 15  ? -14.979 -21.540 -14.303 1.00 37.39 ? 14   VAL E CG2   1 
ATOM   8315  N  N     . GLY G  1 16  ? -16.809 -19.829 -16.830 1.00 36.65 ? 15   GLY E N     1 
ATOM   8316  C  CA    . GLY G  1 16  ? -17.870 -18.821 -16.855 1.00 36.83 ? 15   GLY E CA    1 
ATOM   8317  C  C     . GLY G  1 16  ? -17.921 -17.858 -15.682 1.00 36.38 ? 15   GLY E C     1 
ATOM   8318  O  O     . GLY G  1 16  ? -18.974 -17.334 -15.390 1.00 37.17 ? 15   GLY E O     1 
ATOM   8319  N  N     . LYS G  1 17  ? -16.787 -17.622 -15.027 1.00 36.00 ? 16   LYS E N     1 
ATOM   8320  C  CA    . LYS G  1 17  ? -16.703 -16.740 -13.882 1.00 35.60 ? 16   LYS E CA    1 
ATOM   8321  C  C     . LYS G  1 17  ? -17.127 -15.329 -14.269 1.00 36.08 ? 16   LYS E C     1 
ATOM   8322  O  O     . LYS G  1 17  ? -17.974 -14.727 -13.613 1.00 37.42 ? 16   LYS E O     1 
ATOM   8323  C  CB    . LYS G  1 17  ? -15.267 -16.716 -13.292 1.00 36.00 ? 16   LYS E CB    1 
ATOM   8324  C  CG    . LYS G  1 17  ? -14.743 -18.091 -12.816 1.00 34.52 ? 16   LYS E CG    1 
ATOM   8325  C  CD    . LYS G  1 17  ? -13.383 -18.042 -12.164 1.00 34.37 ? 16   LYS E CD    1 
ATOM   8326  C  CE    . LYS G  1 17  ? -12.267 -17.737 -13.134 1.00 33.52 ? 16   LYS E CE    1 
ATOM   8327  N  NZ    . LYS G  1 17  ? -12.244 -18.646 -14.329 1.00 31.83 ? 16   LYS E NZ    1 
ATOM   8328  N  N     . THR G  1 18  ? -16.546 -14.806 -15.333 1.00 36.37 ? 17   THR E N     1 
ATOM   8329  C  CA    . THR G  1 18  ? -16.797 -13.431 -15.746 1.00 36.50 ? 17   THR E CA    1 
ATOM   8330  C  C     . THR G  1 18  ? -18.224 -13.267 -16.230 1.00 36.50 ? 17   THR E C     1 
ATOM   8331  O  O     . THR G  1 18  ? -18.900 -12.298 -15.869 1.00 36.42 ? 17   THR E O     1 
ATOM   8332  C  CB    . THR G  1 18  ? -15.799 -12.979 -16.805 1.00 36.36 ? 17   THR E CB    1 
ATOM   8333  O  OG1   . THR G  1 18  ? -14.478 -13.055 -16.250 1.00 37.12 ? 17   THR E OG1   1 
ATOM   8334  C  CG2   . THR G  1 18  ? -16.081 -11.557 -17.253 1.00 35.26 ? 17   THR E CG2   1 
ATOM   8335  N  N     . CYS G  1 19  ? -18.708 -14.228 -17.002 1.00 36.44 ? 18   CYS E N     1 
ATOM   8336  C  CA    . CYS G  1 19  ? -20.084 -14.159 -17.507 1.00 36.88 ? 18   CYS E CA    1 
ATOM   8337  C  C     . CYS G  1 19  ? -21.111 -14.154 -16.367 1.00 37.47 ? 18   CYS E C     1 
ATOM   8338  O  O     . CYS G  1 19  ? -22.150 -13.464 -16.416 1.00 37.04 ? 18   CYS E O     1 
ATOM   8339  C  CB    . CYS G  1 19  ? -20.352 -15.331 -18.459 1.00 36.87 ? 18   CYS E CB    1 
ATOM   8340  S  SG    . CYS G  1 19  ? -19.786 -15.037 -20.123 1.00 35.75 ? 18   CYS E SG    1 
ATOM   8341  N  N     . LEU G  1 20  ? -20.812 -14.943 -15.346 1.00 37.94 ? 19   LEU E N     1 
ATOM   8342  C  CA    . LEU G  1 20  ? -21.646 -15.033 -14.141 1.00 38.22 ? 19   LEU E CA    1 
ATOM   8343  C  C     . LEU G  1 20  ? -21.727 -13.674 -13.430 1.00 37.86 ? 19   LEU E C     1 
ATOM   8344  O  O     . LEU G  1 20  ? -22.808 -13.205 -13.044 1.00 37.13 ? 19   LEU E O     1 
ATOM   8345  C  CB    . LEU G  1 20  ? -21.014 -16.107 -13.232 1.00 38.89 ? 19   LEU E CB    1 
ATOM   8346  C  CG    . LEU G  1 20  ? -21.459 -16.484 -11.835 1.00 39.05 ? 19   LEU E CG    1 
ATOM   8347  C  CD1   . LEU G  1 20  ? -21.240 -18.007 -11.644 1.00 41.63 ? 19   LEU E CD1   1 
ATOM   8348  C  CD2   . LEU G  1 20  ? -20.679 -15.693 -10.802 1.00 40.38 ? 19   LEU E CD2   1 
ATOM   8349  N  N     . LEU G  1 21  ? -20.568 -13.049 -13.273 1.00 37.25 ? 20   LEU E N     1 
ATOM   8350  C  CA    . LEU G  1 21  ? -20.448 -11.770 -12.576 1.00 36.86 ? 20   LEU E CA    1 
ATOM   8351  C  C     . LEU G  1 21  ? -21.108 -10.637 -13.365 1.00 36.51 ? 20   LEU E C     1 
ATOM   8352  O  O     . LEU G  1 21  ? -21.775 -9.758  -12.802 1.00 37.01 ? 20   LEU E O     1 
ATOM   8353  C  CB    . LEU G  1 21  ? -18.950 -11.451 -12.353 1.00 36.77 ? 20   LEU E CB    1 
ATOM   8354  C  CG    . LEU G  1 21  ? -18.210 -12.220 -11.244 1.00 36.90 ? 20   LEU E CG    1 
ATOM   8355  C  CD1   . LEU G  1 21  ? -16.704 -11.923 -11.184 1.00 36.97 ? 20   LEU E CD1   1 
ATOM   8356  C  CD2   . LEU G  1 21  ? -18.834 -11.881 -9.912  1.00 37.57 ? 20   LEU E CD2   1 
ATOM   8357  N  N     . ILE G  1 22  ? -20.913 -10.644 -14.674 1.00 36.47 ? 21   ILE E N     1 
ATOM   8358  C  CA    . ILE G  1 22  ? -21.455 -9.567  -15.526 1.00 36.28 ? 21   ILE E CA    1 
ATOM   8359  C  C     . ILE G  1 22  ? -22.939 -9.758  -15.778 1.00 36.03 ? 21   ILE E C     1 
ATOM   8360  O  O     . ILE G  1 22  ? -23.702 -8.784  -15.744 1.00 36.94 ? 21   ILE E O     1 
ATOM   8361  C  CB    . ILE G  1 22  ? -20.665 -9.430  -16.841 1.00 35.95 ? 21   ILE E CB    1 
ATOM   8362  C  CG1   . ILE G  1 22  ? -19.231 -8.972  -16.529 1.00 35.88 ? 21   ILE E CG1   1 
ATOM   8363  C  CG2   . ILE G  1 22  ? -21.357 -8.460  -17.828 1.00 35.62 ? 21   ILE E CG2   1 
ATOM   8364  C  CD1   . ILE G  1 22  ? -19.122 -7.749  -15.613 1.00 32.85 ? 21   ILE E CD1   1 
ATOM   8365  N  N     . SER G  1 23  ? -23.361 -10.997 -16.011 1.00 36.06 ? 22   SER E N     1 
ATOM   8366  C  CA    . SER G  1 23  ? -24.794 -11.299 -16.099 1.00 36.29 ? 22   SER E CA    1 
ATOM   8367  C  C     . SER G  1 23  ? -25.551 -10.852 -14.829 1.00 36.57 ? 22   SER E C     1 
ATOM   8368  O  O     . SER G  1 23  ? -26.619 -10.264 -14.915 1.00 35.57 ? 22   SER E O     1 
ATOM   8369  C  CB    . SER G  1 23  ? -25.032 -12.782 -16.367 1.00 36.50 ? 22   SER E CB    1 
ATOM   8370  O  OG    . SER G  1 23  ? -26.403 -13.042 -16.554 1.00 35.35 ? 22   SER E OG    1 
ATOM   8371  N  N     . TYR G  1 24  ? -24.981 -11.142 -13.660 1.00 37.02 ? 23   TYR E N     1 
ATOM   8372  C  CA    . TYR G  1 24  ? -25.580 -10.735 -12.397 1.00 37.27 ? 23   TYR E CA    1 
ATOM   8373  C  C     . TYR G  1 24  ? -25.612 -9.196  -12.243 1.00 37.23 ? 23   TYR E C     1 
ATOM   8374  O  O     . TYR G  1 24  ? -26.662 -8.623  -11.991 1.00 36.78 ? 23   TYR E O     1 
ATOM   8375  C  CB    . TYR G  1 24  ? -24.839 -11.393 -11.213 1.00 37.61 ? 23   TYR E CB    1 
ATOM   8376  C  CG    . TYR G  1 24  ? -25.250 -10.847 -9.853  1.00 37.50 ? 23   TYR E CG    1 
ATOM   8377  C  CD1   . TYR G  1 24  ? -26.528 -11.062 -9.362  1.00 36.72 ? 23   TYR E CD1   1 
ATOM   8378  C  CD2   . TYR G  1 24  ? -24.346 -10.130 -9.061  1.00 38.02 ? 23   TYR E CD2   1 
ATOM   8379  C  CE1   . TYR G  1 24  ? -26.911 -10.580 -8.131  1.00 37.81 ? 23   TYR E CE1   1 
ATOM   8380  C  CE2   . TYR G  1 24  ? -24.718 -9.620  -7.831  1.00 38.40 ? 23   TYR E CE2   1 
ATOM   8381  C  CZ    . TYR G  1 24  ? -26.011 -9.851  -7.366  1.00 38.58 ? 23   TYR E CZ    1 
ATOM   8382  O  OH    . TYR G  1 24  ? -26.414 -9.348  -6.146  1.00 38.97 ? 23   TYR E OH    1 
ATOM   8383  N  N     . THR G  1 25  ? -24.469 -8.536  -12.408 1.00 37.73 ? 24   THR E N     1 
ATOM   8384  C  CA    . THR G  1 25  ? -24.389 -7.090  -12.135 1.00 38.03 ? 24   THR E CA    1 
ATOM   8385  C  C     . THR G  1 25  ? -25.002 -6.185  -13.221 1.00 38.24 ? 24   THR E C     1 
ATOM   8386  O  O     . THR G  1 25  ? -25.448 -5.088  -12.920 1.00 37.46 ? 24   THR E O     1 
ATOM   8387  C  CB    . THR G  1 25  ? -22.936 -6.616  -11.887 1.00 37.51 ? 24   THR E CB    1 
ATOM   8388  O  OG1   . THR G  1 25  ? -22.122 -6.950  -13.009 1.00 37.68 ? 24   THR E OG1   1 
ATOM   8389  C  CG2   . THR G  1 25  ? -22.356 -7.249  -10.630 1.00 38.82 ? 24   THR E CG2   1 
ATOM   8390  N  N     . THR G  1 26  ? -24.994 -6.622  -14.479 1.00 38.82 ? 25   THR E N     1 
ATOM   8391  C  CA    . THR G  1 26  ? -25.503 -5.767  -15.568 1.00 38.66 ? 25   THR E CA    1 
ATOM   8392  C  C     . THR G  1 26  ? -26.677 -6.330  -16.353 1.00 38.82 ? 25   THR E C     1 
ATOM   8393  O  O     . THR G  1 26  ? -27.215 -5.637  -17.205 1.00 39.05 ? 25   THR E O     1 
ATOM   8394  C  CB    . THR G  1 26  ? -24.391 -5.441  -16.576 1.00 38.51 ? 25   THR E CB    1 
ATOM   8395  O  OG1   . THR G  1 26  ? -24.037 -6.629  -17.288 1.00 37.95 ? 25   THR E OG1   1 
ATOM   8396  C  CG2   . THR G  1 26  ? -23.164 -4.860  -15.853 1.00 37.50 ? 25   THR E CG2   1 
ATOM   8397  N  N     . ASN G  1 27  ? -27.075 -7.567  -16.084 1.00 39.68 ? 26   ASN E N     1 
ATOM   8398  C  CA    . ASN G  1 27  ? -28.109 -8.269  -16.890 1.00 40.34 ? 26   ASN E CA    1 
ATOM   8399  C  C     . ASN G  1 27  ? -27.806 -8.328  -18.377 1.00 39.73 ? 26   ASN E C     1 
ATOM   8400  O  O     . ASN G  1 27  ? -28.702 -8.190  -19.217 1.00 40.12 ? 26   ASN E O     1 
ATOM   8401  C  CB    . ASN G  1 27  ? -29.503 -7.668  -16.685 1.00 40.92 ? 26   ASN E CB    1 
ATOM   8402  C  CG    . ASN G  1 27  ? -30.100 -8.040  -15.363 1.00 43.81 ? 26   ASN E CG    1 
ATOM   8403  O  OD1   . ASN G  1 27  ? -30.284 -9.228  -15.039 1.00 46.16 ? 26   ASN E OD1   1 
ATOM   8404  N  ND2   . ASN G  1 27  ? -30.422 -7.028  -14.580 1.00 48.54 ? 26   ASN E ND2   1 
ATOM   8405  N  N     . ALA G  1 28  ? -26.536 -8.518  -18.694 1.00 39.00 ? 27   ALA E N     1 
ATOM   8406  C  CA    . ALA G  1 28  ? -26.105 -8.786  -20.054 1.00 38.59 ? 27   ALA E CA    1 
ATOM   8407  C  C     . ALA G  1 28  ? -25.210 -10.025 -20.040 1.00 38.12 ? 27   ALA E C     1 
ATOM   8408  O  O     . ALA G  1 28  ? -24.441 -10.226 -19.100 1.00 37.07 ? 27   ALA E O     1 
ATOM   8409  C  CB    . ALA G  1 28  ? -25.361 -7.575  -20.619 1.00 38.37 ? 27   ALA E CB    1 
ATOM   8410  N  N     . PHE G  1 29  ? -25.356 -10.876 -21.053 1.00 38.12 ? 28   PHE E N     1 
ATOM   8411  C  CA    . PHE G  1 29  ? -24.435 -12.006 -21.253 1.00 37.82 ? 28   PHE E CA    1 
ATOM   8412  C  C     . PHE G  1 29  ? -23.403 -11.513 -22.258 1.00 38.00 ? 28   PHE E C     1 
ATOM   8413  O  O     . PHE G  1 29  ? -23.779 -11.122 -23.340 1.00 37.43 ? 28   PHE E O     1 
ATOM   8414  C  CB    . PHE G  1 29  ? -25.170 -13.251 -21.781 1.00 37.56 ? 28   PHE E CB    1 
ATOM   8415  C  CG    . PHE G  1 29  ? -24.309 -14.489 -21.826 1.00 36.21 ? 28   PHE E CG    1 
ATOM   8416  C  CD1   . PHE G  1 29  ? -24.077 -15.234 -20.677 1.00 36.43 ? 28   PHE E CD1   1 
ATOM   8417  C  CD2   . PHE G  1 29  ? -23.694 -14.879 -23.004 1.00 37.10 ? 28   PHE E CD2   1 
ATOM   8418  C  CE1   . PHE G  1 29  ? -23.254 -16.378 -20.703 1.00 36.10 ? 28   PHE E CE1   1 
ATOM   8419  C  CE2   . PHE G  1 29  ? -22.873 -16.027 -23.044 1.00 37.53 ? 28   PHE E CE2   1 
ATOM   8420  C  CZ    . PHE G  1 29  ? -22.662 -16.767 -21.898 1.00 36.19 ? 28   PHE E CZ    1 
ATOM   8421  N  N     . PRO G  1 30  ? -22.104 -11.467 -21.881 1.00 38.84 ? 29   PRO E N     1 
ATOM   8422  C  CA    . PRO G  1 30  ? -21.094 -10.995 -22.833 1.00 39.38 ? 29   PRO E CA    1 
ATOM   8423  C  C     . PRO G  1 30  ? -21.127 -11.726 -24.179 1.00 39.71 ? 29   PRO E C     1 
ATOM   8424  O  O     . PRO G  1 30  ? -21.276 -12.964 -24.226 1.00 39.28 ? 29   PRO E O     1 
ATOM   8425  C  CB    . PRO G  1 30  ? -19.774 -11.261 -22.107 1.00 39.75 ? 29   PRO E CB    1 
ATOM   8426  C  CG    . PRO G  1 30  ? -20.115 -11.233 -20.686 1.00 39.23 ? 29   PRO E CG    1 
ATOM   8427  C  CD    . PRO G  1 30  ? -21.494 -11.813 -20.588 1.00 39.07 ? 29   PRO E CD    1 
ATOM   8428  N  N     . GLY G  1 31  ? -20.994 -10.941 -25.248 1.00 39.88 ? 30   GLY E N     1 
ATOM   8429  C  CA    . GLY G  1 31  ? -21.014 -11.447 -26.611 1.00 40.74 ? 30   GLY E CA    1 
ATOM   8430  C  C     . GLY G  1 31  ? -19.733 -12.123 -27.073 1.00 41.20 ? 30   GLY E C     1 
ATOM   8431  O  O     . GLY G  1 31  ? -19.762 -12.883 -28.039 1.00 41.64 ? 30   GLY E O     1 
ATOM   8432  N  N     . GLU G  1 32  ? -18.619 -11.854 -26.388 1.00 41.34 ? 31   GLU E N     1 
ATOM   8433  C  CA    . GLU G  1 32  ? -17.302 -12.415 -26.739 1.00 41.70 ? 31   GLU E CA    1 
ATOM   8434  C  C     . GLU G  1 32  ? -16.701 -13.162 -25.542 1.00 40.42 ? 31   GLU E C     1 
ATOM   8435  O  O     . GLU G  1 32  ? -17.050 -12.907 -24.394 1.00 40.92 ? 31   GLU E O     1 
ATOM   8436  C  CB    . GLU G  1 32  ? -16.340 -11.311 -27.242 1.00 41.94 ? 31   GLU E CB    1 
ATOM   8437  C  CG    . GLU G  1 32  ? -16.267 -11.173 -28.791 1.00 43.78 ? 31   GLU E CG    1 
ATOM   8438  C  CD    . GLU G  1 32  ? -15.125 -10.259 -29.297 1.00 44.22 ? 31   GLU E CD    1 
ATOM   8439  O  OE1   . GLU G  1 32  ? -14.781 -9.253  -28.623 1.00 49.36 ? 31   GLU E OE1   1 
ATOM   8440  O  OE2   . GLU G  1 32  ? -14.582 -10.536 -30.393 1.00 49.10 ? 31   GLU E OE2   1 
ATOM   8441  N  N     . TYR G  1 33  ? -15.839 -14.125 -25.826 1.00 39.21 ? 32   TYR E N     1 
ATOM   8442  C  CA    . TYR G  1 33  ? -15.132 -14.866 -24.795 1.00 38.57 ? 32   TYR E CA    1 
ATOM   8443  C  C     . TYR G  1 33  ? -13.729 -14.281 -24.752 1.00 38.13 ? 32   TYR E C     1 
ATOM   8444  O  O     . TYR G  1 33  ? -12.978 -14.364 -25.728 1.00 38.03 ? 32   TYR E O     1 
ATOM   8445  C  CB    . TYR G  1 33  ? -15.147 -16.367 -25.108 1.00 38.46 ? 32   TYR E CB    1 
ATOM   8446  C  CG    . TYR G  1 33  ? -14.170 -17.224 -24.341 1.00 38.46 ? 32   TYR E CG    1 
ATOM   8447  C  CD1   . TYR G  1 33  ? -13.760 -16.907 -23.046 1.00 38.83 ? 32   TYR E CD1   1 
ATOM   8448  C  CD2   . TYR G  1 33  ? -13.678 -18.393 -24.905 1.00 38.46 ? 32   TYR E CD2   1 
ATOM   8449  C  CE1   . TYR G  1 33  ? -12.871 -17.728 -22.359 1.00 36.80 ? 32   TYR E CE1   1 
ATOM   8450  C  CE2   . TYR G  1 33  ? -12.799 -19.206 -24.232 1.00 37.86 ? 32   TYR E CE2   1 
ATOM   8451  C  CZ    . TYR G  1 33  ? -12.391 -18.875 -22.961 1.00 38.64 ? 32   TYR E CZ    1 
ATOM   8452  O  OH    . TYR G  1 33  ? -11.494 -19.719 -22.322 1.00 38.18 ? 32   TYR E OH    1 
ATOM   8453  N  N     . ILE G  1 34  ? -13.426 -13.622 -23.634 1.00 37.59 ? 33   ILE E N     1 
ATOM   8454  C  CA    . ILE G  1 34  ? -12.137 -12.984 -23.393 1.00 37.11 ? 33   ILE E CA    1 
ATOM   8455  C  C     . ILE G  1 34  ? -11.643 -13.363 -22.002 1.00 36.38 ? 33   ILE E C     1 
ATOM   8456  O  O     . ILE G  1 34  ? -12.176 -12.874 -20.998 1.00 36.42 ? 33   ILE E O     1 
ATOM   8457  C  CB    . ILE G  1 34  ? -12.220 -11.443 -23.482 1.00 37.35 ? 33   ILE E CB    1 
ATOM   8458  C  CG1   . ILE G  1 34  ? -12.796 -11.013 -24.825 1.00 37.37 ? 33   ILE E CG1   1 
ATOM   8459  C  CG2   . ILE G  1 34  ? -10.839 -10.822 -23.279 1.00 37.21 ? 33   ILE E CG2   1 
ATOM   8460  C  CD1   . ILE G  1 34  ? -12.994 -9.513  -24.947 1.00 37.07 ? 33   ILE E CD1   1 
ATOM   8461  N  N     . PRO G  1 35  ? -10.644 -14.252 -21.928 1.00 35.77 ? 34   PRO E N     1 
ATOM   8462  C  CA    . PRO G  1 35  ? -10.096 -14.604 -20.616 1.00 35.86 ? 34   PRO E CA    1 
ATOM   8463  C  C     . PRO G  1 35  ? -9.633  -13.391 -19.823 1.00 35.76 ? 34   PRO E C     1 
ATOM   8464  O  O     . PRO G  1 35  ? -9.261  -12.371 -20.405 1.00 36.02 ? 34   PRO E O     1 
ATOM   8465  C  CB    . PRO G  1 35  ? -8.900  -15.512 -20.958 1.00 35.76 ? 34   PRO E CB    1 
ATOM   8466  C  CG    . PRO G  1 35  ? -9.235  -16.086 -22.308 1.00 35.80 ? 34   PRO E CG    1 
ATOM   8467  C  CD    . PRO G  1 35  ? -10.008 -15.012 -23.019 1.00 35.82 ? 34   PRO E CD    1 
ATOM   8468  N  N     . THR G  1 36  ? -9.673  -13.537 -18.501 1.00 36.03 ? 35   THR E N     1 
ATOM   8469  C  CA    . THR G  1 36  ? -9.351  -12.499 -17.537 1.00 35.72 ? 35   THR E CA    1 
ATOM   8470  C  C     . THR G  1 36  ? -7.911  -12.620 -17.067 1.00 35.74 ? 35   THR E C     1 
ATOM   8471  O  O     . THR G  1 36  ? -7.367  -13.727 -16.945 1.00 35.38 ? 35   THR E O     1 
ATOM   8472  C  CB    . THR G  1 36  ? -10.272 -12.654 -16.294 1.00 36.43 ? 35   THR E CB    1 
ATOM   8473  O  OG1   . THR G  1 36  ? -11.644 -12.627 -16.712 1.00 35.72 ? 35   THR E OG1   1 
ATOM   8474  C  CG2   . THR G  1 36  ? -9.999  -11.583 -15.216 1.00 36.23 ? 35   THR E CG2   1 
ATOM   8475  N  N     . VAL G  1 37  ? -7.297  -11.465 -16.825 1.00 35.55 ? 36   VAL E N     1 
ATOM   8476  C  CA    . VAL G  1 37  ? -6.058  -11.374 -16.076 1.00 35.42 ? 36   VAL E CA    1 
ATOM   8477  C  C     . VAL G  1 37  ? -6.482  -11.040 -14.649 1.00 35.45 ? 36   VAL E C     1 
ATOM   8478  O  O     . VAL G  1 37  ? -6.287  -11.832 -13.716 1.00 34.90 ? 36   VAL E O     1 
ATOM   8479  C  CB    . VAL G  1 37  ? -5.138  -10.308 -16.679 1.00 35.57 ? 36   VAL E CB    1 
ATOM   8480  C  CG1   . VAL G  1 37  ? -3.827  -10.168 -15.869 1.00 35.10 ? 36   VAL E CG1   1 
ATOM   8481  C  CG2   . VAL G  1 37  ? -4.865  -10.640 -18.137 1.00 34.76 ? 36   VAL E CG2   1 
ATOM   8482  N  N     . PHE G  1 38  ? -7.124  -9.884  -14.502 1.00 35.80 ? 37   PHE E N     1 
ATOM   8483  C  CA    . PHE G  1 38  ? -7.816  -9.547  -13.272 1.00 36.06 ? 37   PHE E CA    1 
ATOM   8484  C  C     . PHE G  1 38  ? -8.750  -8.380  -13.476 1.00 35.91 ? 37   PHE E C     1 
ATOM   8485  O  O     . PHE G  1 38  ? -8.424  -7.440  -14.176 1.00 35.63 ? 37   PHE E O     1 
ATOM   8486  C  CB    . PHE G  1 38  ? -6.847  -9.238  -12.112 1.00 36.00 ? 37   PHE E CB    1 
ATOM   8487  C  CG    . PHE G  1 38  ? -7.547  -8.699  -10.901 1.00 36.62 ? 37   PHE E CG    1 
ATOM   8488  C  CD1   . PHE G  1 38  ? -8.192  -9.553  -10.032 1.00 37.53 ? 37   PHE E CD1   1 
ATOM   8489  C  CD2   . PHE G  1 38  ? -7.627  -7.320  -10.673 1.00 37.53 ? 37   PHE E CD2   1 
ATOM   8490  C  CE1   . PHE G  1 38  ? -8.868  -9.058  -8.933  1.00 37.99 ? 37   PHE E CE1   1 
ATOM   8491  C  CE2   . PHE G  1 38  ? -8.293  -6.819  -9.582  1.00 37.26 ? 37   PHE E CE2   1 
ATOM   8492  C  CZ    . PHE G  1 38  ? -8.919  -7.684  -8.707  1.00 37.80 ? 37   PHE E CZ    1 
ATOM   8493  N  N     . ASP G  1 39  ? -9.911  -8.441  -12.837 1.00 36.72 ? 38   ASP E N     1 
ATOM   8494  C  CA    . ASP G  1 39  ? -10.876 -7.336  -12.887 1.00 37.05 ? 38   ASP E CA    1 
ATOM   8495  C  C     . ASP G  1 39  ? -11.606 -7.216  -11.577 1.00 37.78 ? 38   ASP E C     1 
ATOM   8496  O  O     . ASP G  1 39  ? -11.846 -8.216  -10.900 1.00 37.77 ? 38   ASP E O     1 
ATOM   8497  C  CB    . ASP G  1 39  ? -11.875 -7.546  -14.028 1.00 37.61 ? 38   ASP E CB    1 
ATOM   8498  C  CG    . ASP G  1 39  ? -11.270 -7.263  -15.370 1.00 36.29 ? 38   ASP E CG    1 
ATOM   8499  O  OD1   . ASP G  1 39  ? -11.133 -6.069  -15.718 1.00 35.31 ? 38   ASP E OD1   1 
ATOM   8500  O  OD2   . ASP G  1 39  ? -10.918 -8.232  -16.078 1.00 37.95 ? 38   ASP E OD2   1 
ATOM   8501  N  N     . ASN G  1 40  ? -11.930 -5.983  -11.201 1.00 38.25 ? 39   ASN E N     1 
ATOM   8502  C  CA    . ASN G  1 40  ? -12.639 -5.723  -9.959  1.00 39.06 ? 39   ASN E CA    1 
ATOM   8503  C  C     . ASN G  1 40  ? -13.873 -4.901  -10.292 1.00 38.91 ? 39   ASN E C     1 
ATOM   8504  O  O     . ASN G  1 40  ? -13.759 -3.849  -10.927 1.00 38.27 ? 39   ASN E O     1 
ATOM   8505  C  CB    . ASN G  1 40  ? -11.722 -4.999  -8.975  1.00 39.41 ? 39   ASN E CB    1 
ATOM   8506  C  CG    . ASN G  1 40  ? -12.341 -4.770  -7.621  1.00 42.47 ? 39   ASN E CG    1 
ATOM   8507  O  OD1   . ASN G  1 40  ? -12.712 -3.641  -7.295  1.00 48.28 ? 39   ASN E OD1   1 
ATOM   8508  N  ND2   . ASN G  1 40  ? -12.427 -5.817  -6.804  1.00 45.26 ? 39   ASN E ND2   1 
ATOM   8509  N  N     . TYR G  1 41  ? -15.041 -5.433  -9.913  1.00 39.09 ? 40   TYR E N     1 
ATOM   8510  C  CA    . TYR G  1 41  ? -16.342 -4.754  -10.074 1.00 39.33 ? 40   TYR E CA    1 
ATOM   8511  C  C     . TYR G  1 41  ? -16.962 -4.452  -8.715  1.00 39.50 ? 40   TYR E C     1 
ATOM   8512  O  O     . TYR G  1 41  ? -16.671 -5.117  -7.713  1.00 39.11 ? 40   TYR E O     1 
ATOM   8513  C  CB    . TYR G  1 41  ? -17.331 -5.605  -10.887 1.00 39.60 ? 40   TYR E CB    1 
ATOM   8514  C  CG    . TYR G  1 41  ? -16.682 -6.404  -11.993 1.00 40.05 ? 40   TYR E CG    1 
ATOM   8515  C  CD1   . TYR G  1 41  ? -16.673 -7.796  -11.956 1.00 40.40 ? 40   TYR E CD1   1 
ATOM   8516  C  CD2   . TYR G  1 41  ? -16.070 -5.774  -13.066 1.00 39.63 ? 40   TYR E CD2   1 
ATOM   8517  C  CE1   . TYR G  1 41  ? -16.086 -8.526  -12.967 1.00 40.49 ? 40   TYR E CE1   1 
ATOM   8518  C  CE2   . TYR G  1 41  ? -15.475 -6.513  -14.090 1.00 39.13 ? 40   TYR E CE2   1 
ATOM   8519  C  CZ    . TYR G  1 41  ? -15.480 -7.883  -14.020 1.00 39.13 ? 40   TYR E CZ    1 
ATOM   8520  O  OH    . TYR G  1 41  ? -14.889 -8.631  -15.006 1.00 41.83 ? 40   TYR E OH    1 
ATOM   8521  N  N     . SER G  1 42  ? -17.812 -3.435  -8.697  1.00 40.09 ? 41   SER E N     1 
ATOM   8522  C  CA    . SER G  1 42  ? -18.593 -3.061  -7.521  1.00 40.89 ? 41   SER E CA    1 
ATOM   8523  C  C     . SER G  1 42  ? -20.056 -2.964  -7.902  1.00 40.41 ? 41   SER E C     1 
ATOM   8524  O  O     . SER G  1 42  ? -20.385 -2.585  -9.032  1.00 40.20 ? 41   SER E O     1 
ATOM   8525  C  CB    . SER G  1 42  ? -18.177 -1.676  -7.011  1.00 41.36 ? 41   SER E CB    1 
ATOM   8526  O  OG    . SER G  1 42  ? -17.055 -1.771  -6.183  1.00 45.15 ? 41   SER E OG    1 
ATOM   8527  N  N     . ALA G  1 43  ? -20.923 -3.259  -6.945  1.00 40.13 ? 42   ALA E N     1 
ATOM   8528  C  CA    . ALA G  1 43  ? -22.355 -3.040  -7.106  1.00 40.59 ? 42   ALA E CA    1 
ATOM   8529  C  C     . ALA G  1 43  ? -23.014 -2.807  -5.737  1.00 40.84 ? 42   ALA E C     1 
ATOM   8530  O  O     . ALA G  1 43  ? -22.588 -3.358  -4.718  1.00 40.80 ? 42   ALA E O     1 
ATOM   8531  C  CB    . ALA G  1 43  ? -22.997 -4.224  -7.826  1.00 39.54 ? 42   ALA E CB    1 
ATOM   8532  N  N     . ASN G  1 44  ? -24.057 -1.989  -5.728  1.00 41.65 ? 43   ASN E N     1 
ATOM   8533  C  CA    . ASN G  1 44  ? -24.868 -1.788  -4.540  1.00 42.15 ? 43   ASN E CA    1 
ATOM   8534  C  C     . ASN G  1 44  ? -26.021 -2.776  -4.507  1.00 41.89 ? 43   ASN E C     1 
ATOM   8535  O  O     . ASN G  1 44  ? -26.663 -3.021  -5.517  1.00 41.02 ? 43   ASN E O     1 
ATOM   8536  C  CB    . ASN G  1 44  ? -25.416 -0.374  -4.506  1.00 42.92 ? 43   ASN E CB    1 
ATOM   8537  C  CG    . ASN G  1 44  ? -24.324 0.664   -4.443  1.00 45.99 ? 43   ASN E CG    1 
ATOM   8538  O  OD1   . ASN G  1 44  ? -24.248 1.560   -5.299  1.00 50.84 ? 43   ASN E OD1   1 
ATOM   8539  N  ND2   . ASN G  1 44  ? -23.458 0.554   -3.427  1.00 49.34 ? 43   ASN E ND2   1 
ATOM   8540  N  N     . VAL G  1 45  ? -26.268 -3.329  -3.326  1.00 42.26 ? 44   VAL E N     1 
ATOM   8541  C  CA    . VAL G  1 45  ? -27.388 -4.220  -3.088  1.00 42.82 ? 44   VAL E CA    1 
ATOM   8542  C  C     . VAL G  1 45  ? -28.030 -3.804  -1.785  1.00 43.03 ? 44   VAL E C     1 
ATOM   8543  O  O     . VAL G  1 45  ? -27.317 -3.474  -0.846  1.00 43.25 ? 44   VAL E O     1 
ATOM   8544  C  CB    . VAL G  1 45  ? -26.912 -5.689  -3.011  1.00 43.17 ? 44   VAL E CB    1 
ATOM   8545  C  CG1   . VAL G  1 45  ? -27.937 -6.552  -2.321  1.00 44.28 ? 44   VAL E CG1   1 
ATOM   8546  C  CG2   . VAL G  1 45  ? -26.589 -6.230  -4.421  1.00 42.43 ? 44   VAL E CG2   1 
ATOM   8547  N  N     . MET G  1 46  ? -29.364 -3.790  -1.738  1.00 43.16 ? 45   MET E N     1 
ATOM   8548  C  CA    . MET G  1 46  ? -30.100 -3.514  -0.513  1.00 43.73 ? 45   MET E CA    1 
ATOM   8549  C  C     . MET G  1 46  ? -30.411 -4.834  0.182   1.00 43.50 ? 45   MET E C     1 
ATOM   8550  O  O     . MET G  1 46  ? -31.049 -5.707  -0.410  1.00 43.27 ? 45   MET E O     1 
ATOM   8551  C  CB    . MET G  1 46  ? -31.414 -2.795  -0.819  1.00 44.09 ? 45   MET E CB    1 
ATOM   8552  C  CG    . MET G  1 46  ? -31.250 -1.396  -1.409  1.00 47.02 ? 45   MET E CG    1 
ATOM   8553  S  SD    . MET G  1 46  ? -30.516 -0.181  -0.272  1.00 51.09 ? 45   MET E SD    1 
ATOM   8554  C  CE    . MET G  1 46  ? -31.524 -0.365  1.202   1.00 48.78 ? 45   MET E CE    1 
ATOM   8555  N  N     . VAL G  1 47  ? -29.976 -4.966  1.434   1.00 43.36 ? 46   VAL E N     1 
ATOM   8556  C  CA    . VAL G  1 47  ? -30.132 -6.204  2.199   1.00 43.20 ? 46   VAL E CA    1 
ATOM   8557  C  C     . VAL G  1 47  ? -30.965 -5.916  3.438   1.00 43.87 ? 46   VAL E C     1 
ATOM   8558  O  O     . VAL G  1 47  ? -30.495 -5.243  4.365   1.00 43.62 ? 46   VAL E O     1 
ATOM   8559  C  CB    . VAL G  1 47  ? -28.769 -6.771  2.628   1.00 43.02 ? 46   VAL E CB    1 
ATOM   8560  C  CG1   . VAL G  1 47  ? -28.955 -8.058  3.440   1.00 41.53 ? 46   VAL E CG1   1 
ATOM   8561  C  CG2   . VAL G  1 47  ? -27.898 -7.007  1.422   1.00 41.88 ? 46   VAL E CG2   1 
ATOM   8562  N  N     . ASP G  1 48  ? -32.202 -6.417  3.444   1.00 44.57 ? 47   ASP E N     1 
ATOM   8563  C  CA    . ASP G  1 48  ? -33.166 -6.113  4.493   1.00 45.09 ? 47   ASP E CA    1 
ATOM   8564  C  C     . ASP G  1 48  ? -33.197 -4.607  4.762   1.00 45.38 ? 47   ASP E C     1 
ATOM   8565  O  O     . ASP G  1 48  ? -33.120 -4.159  5.905   1.00 45.36 ? 47   ASP E O     1 
ATOM   8566  C  CB    . ASP G  1 48  ? -32.845 -6.904  5.772   1.00 45.23 ? 47   ASP E CB    1 
ATOM   8567  C  CG    . ASP G  1 48  ? -32.809 -8.402  5.535   1.00 45.78 ? 47   ASP E CG    1 
ATOM   8568  O  OD1   . ASP G  1 48  ? -33.347 -8.868  4.514   1.00 47.42 ? 47   ASP E OD1   1 
ATOM   8569  O  OD2   . ASP G  1 48  ? -32.231 -9.128  6.361   1.00 47.49 ? 47   ASP E OD2   1 
ATOM   8570  N  N     . GLY G  1 49  ? -33.278 -3.836  3.686   1.00 45.55 ? 48   GLY E N     1 
ATOM   8571  C  CA    . GLY G  1 49  ? -33.435 -2.400  3.777   1.00 46.01 ? 48   GLY E CA    1 
ATOM   8572  C  C     . GLY G  1 49  ? -32.177 -1.620  4.106   1.00 46.22 ? 48   GLY E C     1 
ATOM   8573  O  O     . GLY G  1 49  ? -32.231 -0.407  4.234   1.00 46.85 ? 48   GLY E O     1 
ATOM   8574  N  N     . LYS G  1 50  ? -31.047 -2.302  4.254   1.00 46.17 ? 49   LYS E N     1 
ATOM   8575  C  CA    . LYS G  1 50  ? -29.770 -1.635  4.472   1.00 45.98 ? 49   LYS E CA    1 
ATOM   8576  C  C     . LYS G  1 50  ? -28.895 -1.772  3.211   1.00 45.21 ? 49   LYS E C     1 
ATOM   8577  O  O     . LYS G  1 50  ? -28.787 -2.859  2.644   1.00 44.20 ? 49   LYS E O     1 
ATOM   8578  C  CB    . LYS G  1 50  ? -29.069 -2.212  5.713   1.00 46.19 ? 49   LYS E CB    1 
ATOM   8579  C  CG    . LYS G  1 50  ? -29.691 -1.747  7.059   1.00 47.50 ? 49   LYS E CG    1 
ATOM   8580  C  CD    . LYS G  1 50  ? -30.330 -2.887  7.873   1.00 49.20 ? 49   LYS E CD    1 
ATOM   8581  N  N     . PRO G  1 51  ? -28.273 -0.658  2.767   1.00 44.79 ? 50   PRO E N     1 
ATOM   8582  C  CA    . PRO G  1 51  ? -27.414 -0.717  1.596   1.00 44.37 ? 50   PRO E CA    1 
ATOM   8583  C  C     . PRO G  1 51  ? -26.107 -1.397  1.921   1.00 43.95 ? 50   PRO E C     1 
ATOM   8584  O  O     . PRO G  1 51  ? -25.515 -1.102  2.955   1.00 43.85 ? 50   PRO E O     1 
ATOM   8585  C  CB    . PRO G  1 51  ? -27.177 0.758   1.263   1.00 44.62 ? 50   PRO E CB    1 
ATOM   8586  C  CG    . PRO G  1 51  ? -27.302 1.462   2.563   1.00 44.71 ? 50   PRO E CG    1 
ATOM   8587  C  CD    . PRO G  1 51  ? -28.314 0.700   3.348   1.00 44.61 ? 50   PRO E CD    1 
ATOM   8588  N  N     . VAL G  1 52  ? -25.675 -2.297  1.040   1.00 43.31 ? 51   VAL E N     1 
ATOM   8589  C  CA    . VAL G  1 52  ? -24.397 -2.997  1.154   1.00 43.19 ? 51   VAL E CA    1 
ATOM   8590  C  C     . VAL G  1 52  ? -23.625 -2.808  -0.156  1.00 43.09 ? 51   VAL E C     1 
ATOM   8591  O  O     . VAL G  1 52  ? -24.217 -2.897  -1.236  1.00 43.22 ? 51   VAL E O     1 
ATOM   8592  C  CB    . VAL G  1 52  ? -24.607 -4.513  1.378   1.00 42.94 ? 51   VAL E CB    1 
ATOM   8593  C  CG1   . VAL G  1 52  ? -23.298 -5.254  1.297   1.00 43.70 ? 51   VAL E CG1   1 
ATOM   8594  C  CG2   . VAL G  1 52  ? -25.288 -4.773  2.714   1.00 43.28 ? 51   VAL E CG2   1 
ATOM   8595  N  N     . ASN G  1 53  ? -22.324 -2.549  -0.071  1.00 42.71 ? 52   ASN E N     1 
ATOM   8596  C  CA    . ASN G  1 53  ? -21.495 -2.496  -1.271  1.00 43.59 ? 52   ASN E CA    1 
ATOM   8597  C  C     . ASN G  1 53  ? -20.794 -3.822  -1.520  1.00 42.93 ? 52   ASN E C     1 
ATOM   8598  O  O     . ASN G  1 53  ? -20.028 -4.293  -0.687  1.00 42.35 ? 52   ASN E O     1 
ATOM   8599  C  CB    . ASN G  1 53  ? -20.455 -1.386  -1.196  1.00 44.25 ? 52   ASN E CB    1 
ATOM   8600  C  CG    . ASN G  1 53  ? -19.716 -1.193  -2.533  1.00 48.49 ? 52   ASN E CG    1 
ATOM   8601  O  OD1   . ASN G  1 53  ? -18.491 -1.351  -2.605  1.00 52.63 ? 52   ASN E OD1   1 
ATOM   8602  N  ND2   . ASN G  1 53  ? -20.471 -0.865  -3.607  1.00 52.82 ? 52   ASN E ND2   1 
ATOM   8603  N  N     . LEU G  1 54  ? -21.066 -4.415  -2.678  1.00 42.67 ? 53   LEU E N     1 
ATOM   8604  C  CA    . LEU G  1 54  ? -20.514 -5.721  -3.042  1.00 42.46 ? 53   LEU E CA    1 
ATOM   8605  C  C     . LEU G  1 54  ? -19.282 -5.510  -3.904  1.00 41.83 ? 53   LEU E C     1 
ATOM   8606  O  O     . LEU G  1 54  ? -19.357 -4.934  -4.969  1.00 41.86 ? 53   LEU E O     1 
ATOM   8607  C  CB    . LEU G  1 54  ? -21.575 -6.529  -3.792  1.00 42.43 ? 53   LEU E CB    1 
ATOM   8608  C  CG    . LEU G  1 54  ? -21.377 -8.013  -4.118  1.00 43.27 ? 53   LEU E CG    1 
ATOM   8609  C  CD1   . LEU G  1 54  ? -20.754 -8.827  -2.968  1.00 44.50 ? 53   LEU E CD1   1 
ATOM   8610  C  CD2   . LEU G  1 54  ? -22.747 -8.611  -4.521  1.00 43.38 ? 53   LEU E CD2   1 
ATOM   8611  N  N     . GLY G  1 55  ? -18.130 -5.936  -3.419  1.00 41.35 ? 54   GLY E N     1 
ATOM   8612  C  CA    . GLY G  1 55  ? -16.903 -5.845  -4.192  1.00 40.50 ? 54   GLY E CA    1 
ATOM   8613  C  C     . GLY G  1 55  ? -16.666 -7.211  -4.770  1.00 39.94 ? 54   GLY E C     1 
ATOM   8614  O  O     . GLY G  1 55  ? -16.639 -8.198  -4.034  1.00 39.81 ? 54   GLY E O     1 
ATOM   8615  N  N     . LEU G  1 56  ? -16.503 -7.285  -6.082  1.00 39.63 ? 55   LEU E N     1 
ATOM   8616  C  CA    . LEU G  1 56  ? -16.314 -8.562  -6.754  1.00 39.22 ? 55   LEU E CA    1 
ATOM   8617  C  C     . LEU G  1 56  ? -14.937 -8.601  -7.416  1.00 39.00 ? 55   LEU E C     1 
ATOM   8618  O  O     . LEU G  1 56  ? -14.607 -7.734  -8.244  1.00 38.82 ? 55   LEU E O     1 
ATOM   8619  C  CB    . LEU G  1 56  ? -17.391 -8.769  -7.812  1.00 39.47 ? 55   LEU E CB    1 
ATOM   8620  C  CG    . LEU G  1 56  ? -18.843 -8.696  -7.327  1.00 40.66 ? 55   LEU E CG    1 
ATOM   8621  C  CD1   . LEU G  1 56  ? -19.744 -8.497  -8.548  1.00 39.72 ? 55   LEU E CD1   1 
ATOM   8622  C  CD2   . LEU G  1 56  ? -19.223 -9.951  -6.520  1.00 39.00 ? 55   LEU E CD2   1 
ATOM   8623  N  N     . TRP G  1 57  ? -14.155 -9.608  -7.035  1.00 38.36 ? 56   TRP E N     1 
ATOM   8624  C  CA    . TRP G  1 57  ? -12.808 -9.821  -7.539  1.00 38.32 ? 56   TRP E CA    1 
ATOM   8625  C  C     . TRP G  1 57  ? -12.874 -11.007 -8.519  1.00 37.79 ? 56   TRP E C     1 
ATOM   8626  O  O     . TRP G  1 57  ? -13.076 -12.168 -8.134  1.00 37.31 ? 56   TRP E O     1 
ATOM   8627  C  CB    . TRP G  1 57  ? -11.817 -10.016 -6.380  1.00 38.90 ? 56   TRP E CB    1 
ATOM   8628  C  CG    . TRP G  1 57  ? -11.842 -8.832  -5.405  1.00 39.82 ? 56   TRP E CG    1 
ATOM   8629  C  CD1   . TRP G  1 57  ? -12.953 -8.314  -4.764  1.00 41.03 ? 56   TRP E CD1   1 
ATOM   8630  C  CD2   . TRP G  1 57  ? -10.733 -8.041  -4.960  1.00 39.20 ? 56   TRP E CD2   1 
ATOM   8631  N  NE1   . TRP G  1 57  ? -12.600 -7.275  -3.966  1.00 41.46 ? 56   TRP E NE1   1 
ATOM   8632  C  CE2   . TRP G  1 57  ? -11.247 -7.070  -4.067  1.00 40.80 ? 56   TRP E CE2   1 
ATOM   8633  C  CE3   . TRP G  1 57  ? -9.365  -8.068  -5.216  1.00 40.45 ? 56   TRP E CE3   1 
ATOM   8634  C  CZ2   . TRP G  1 57  ? -10.442 -6.129  -3.436  1.00 41.37 ? 56   TRP E CZ2   1 
ATOM   8635  C  CZ3   . TRP G  1 57  ? -8.546  -7.126  -4.595  1.00 42.03 ? 56   TRP E CZ3   1 
ATOM   8636  C  CH2   . TRP G  1 57  ? -9.089  -6.162  -3.712  1.00 42.72 ? 56   TRP E CH2   1 
ATOM   8637  N  N     . ASP G  1 58  ? -12.786 -10.663 -9.801  1.00 37.44 ? 57   ASP E N     1 
ATOM   8638  C  CA    . ASP G  1 58  ? -12.889 -11.599 -10.906 1.00 37.13 ? 57   ASP E CA    1 
ATOM   8639  C  C     . ASP G  1 58  ? -11.467 -12.011 -11.318 1.00 37.22 ? 57   ASP E C     1 
ATOM   8640  O  O     . ASP G  1 58  ? -10.740 -11.223 -11.905 1.00 37.58 ? 57   ASP E O     1 
ATOM   8641  C  CB    . ASP G  1 58  ? -13.614 -10.906 -12.061 1.00 36.93 ? 57   ASP E CB    1 
ATOM   8642  C  CG    . ASP G  1 58  ? -13.963 -11.846 -13.209 1.00 36.79 ? 57   ASP E CG    1 
ATOM   8643  O  OD1   . ASP G  1 58  ? -14.033 -13.092 -13.019 1.00 35.63 ? 57   ASP E OD1   1 
ATOM   8644  O  OD2   . ASP G  1 58  ? -14.180 -11.316 -14.318 1.00 38.70 ? 57   ASP E OD2   1 
ATOM   8645  N  N     . THR G  1 59  ? -11.074 -13.243 -10.980 1.00 37.13 ? 58   THR E N     1 
ATOM   8646  C  CA    . THR G  1 59  ? -9.703  -13.719 -11.176 1.00 36.48 ? 58   THR E CA    1 
ATOM   8647  C  C     . THR G  1 59  ? -9.506  -14.547 -12.442 1.00 36.60 ? 58   THR E C     1 
ATOM   8648  O  O     . THR G  1 59  ? -10.463 -14.985 -13.094 1.00 36.81 ? 58   THR E O     1 
ATOM   8649  C  CB    . THR G  1 59  ? -9.251  -14.597 -9.989  1.00 36.91 ? 58   THR E CB    1 
ATOM   8650  O  OG1   . THR G  1 59  ? -10.007 -15.823 -9.970  1.00 34.95 ? 58   THR E OG1   1 
ATOM   8651  C  CG2   . THR G  1 59  ? -9.410  -13.852 -8.684  1.00 35.75 ? 58   THR E CG2   1 
ATOM   8652  N  N     . ALA G  1 60  ? -8.238  -14.806 -12.740 1.00 36.28 ? 59   ALA E N     1 
ATOM   8653  C  CA    . ALA G  1 60  ? -7.841  -15.523 -13.924 1.00 36.38 ? 59   ALA E CA    1 
ATOM   8654  C  C     . ALA G  1 60  ? -7.860  -17.023 -13.703 1.00 36.48 ? 59   ALA E C     1 
ATOM   8655  O  O     . ALA G  1 60  ? -7.224  -17.535 -12.795 1.00 36.63 ? 59   ALA E O     1 
ATOM   8656  C  CB    . ALA G  1 60  ? -6.441  -15.061 -14.376 1.00 35.70 ? 59   ALA E CB    1 
ATOM   8657  N  N     . GLY G  1 61  ? -8.572  -17.740 -14.559 1.00 36.96 ? 60   GLY E N     1 
ATOM   8658  C  CA    . GLY G  1 61  ? -8.516  -19.199 -14.550 1.00 37.17 ? 60   GLY E CA    1 
ATOM   8659  C  C     . GLY G  1 61  ? -7.263  -19.767 -15.183 1.00 37.58 ? 60   GLY E C     1 
ATOM   8660  O  O     . GLY G  1 61  ? -6.885  -20.906 -14.881 1.00 38.30 ? 60   GLY E O     1 
ATOM   8661  N  N     . GLN G  1 62  ? -6.630  -18.999 -16.079 1.00 37.90 ? 61   GLN E N     1 
ATOM   8662  C  CA    . GLN G  1 62  ? -5.384  -19.424 -16.712 1.00 37.81 ? 61   GLN E CA    1 
ATOM   8663  C  C     . GLN G  1 62  ? -4.351  -19.652 -15.634 1.00 38.53 ? 61   GLN E C     1 
ATOM   8664  O  O     . GLN G  1 62  ? -4.083  -18.753 -14.822 1.00 37.43 ? 61   GLN E O     1 
ATOM   8665  C  CB    . GLN G  1 62  ? -4.841  -18.362 -17.667 1.00 38.24 ? 61   GLN E CB    1 
ATOM   8666  C  CG    . GLN G  1 62  ? -5.555  -18.231 -19.039 1.00 37.17 ? 61   GLN E CG    1 
ATOM   8667  C  CD    . GLN G  1 62  ? -5.107  -16.972 -19.768 1.00 37.40 ? 61   GLN E CD    1 
ATOM   8668  O  OE1   . GLN G  1 62  ? -4.133  -16.996 -20.534 1.00 36.00 ? 61   GLN E OE1   1 
ATOM   8669  N  NE2   . GLN G  1 62  ? -5.781  -15.849 -19.492 1.00 35.76 ? 61   GLN E NE2   1 
ATOM   8670  N  N     . GLU G  1 63  ? -3.756  -20.846 -15.631 1.00 39.39 ? 62   GLU E N     1 
ATOM   8671  C  CA    . GLU G  1 63  ? -2.686  -21.138 -14.685 1.00 40.32 ? 62   GLU E CA    1 
ATOM   8672  C  C     . GLU G  1 63  ? -1.444  -20.280 -14.948 1.00 39.79 ? 62   GLU E C     1 
ATOM   8673  O  O     . GLU G  1 63  ? -0.569  -20.190 -14.088 1.00 39.57 ? 62   GLU E O     1 
ATOM   8674  C  CB    . GLU G  1 63  ? -2.328  -22.625 -14.660 1.00 40.03 ? 62   GLU E CB    1 
ATOM   8675  C  CG    . GLU G  1 63  ? -1.804  -23.179 -15.947 1.00 42.63 ? 62   GLU E CG    1 
ATOM   8676  C  CD    . GLU G  1 63  ? -1.292  -24.603 -15.787 1.00 43.67 ? 62   GLU E CD    1 
ATOM   8677  O  OE1   . GLU G  1 63  ? -2.079  -25.468 -15.323 1.00 48.12 ? 62   GLU E OE1   1 
ATOM   8678  O  OE2   . GLU G  1 63  ? -0.102  -24.848 -16.116 1.00 47.92 ? 62   GLU E OE2   1 
ATOM   8679  N  N     . ASP G  1 64  ? -1.366  -19.644 -16.119 1.00 39.45 ? 63   ASP E N     1 
ATOM   8680  C  CA    . ASP G  1 64  ? -0.267  -18.714 -16.394 1.00 39.32 ? 63   ASP E CA    1 
ATOM   8681  C  C     . ASP G  1 64  ? -0.294  -17.507 -15.452 1.00 38.72 ? 63   ASP E C     1 
ATOM   8682  O  O     . ASP G  1 64  ? 0.728   -16.849 -15.277 1.00 38.87 ? 63   ASP E O     1 
ATOM   8683  C  CB    . ASP G  1 64  ? -0.267  -18.246 -17.866 1.00 39.40 ? 63   ASP E CB    1 
ATOM   8684  C  CG    . ASP G  1 64  ? 0.463   -19.234 -18.822 1.00 40.63 ? 63   ASP E CG    1 
ATOM   8685  O  OD1   . ASP G  1 64  ? 0.897   -20.331 -18.394 1.00 39.58 ? 63   ASP E OD1   1 
ATOM   8686  O  OD2   . ASP G  1 64  ? 0.601   -18.893 -20.017 1.00 41.76 ? 63   ASP E OD2   1 
ATOM   8687  N  N     . TYR G  1 65  ? -1.461  -17.200 -14.882 1.00 38.42 ? 64   TYR E N     1 
ATOM   8688  C  CA    . TYR G  1 65  ? -1.592  -16.116 -13.906 1.00 38.30 ? 64   TYR E CA    1 
ATOM   8689  C  C     . TYR G  1 65  ? -1.674  -16.633 -12.452 1.00 38.55 ? 64   TYR E C     1 
ATOM   8690  O  O     . TYR G  1 65  ? -2.243  -15.968 -11.576 1.00 39.18 ? 64   TYR E O     1 
ATOM   8691  C  CB    . TYR G  1 65  ? -2.786  -15.221 -14.289 1.00 38.25 ? 64   TYR E CB    1 
ATOM   8692  C  CG    . TYR G  1 65  ? -2.502  -14.493 -15.597 1.00 38.54 ? 64   TYR E CG    1 
ATOM   8693  C  CD1   . TYR G  1 65  ? -3.245  -14.739 -16.751 1.00 38.09 ? 64   TYR E CD1   1 
ATOM   8694  C  CD2   . TYR G  1 65  ? -1.439  -13.603 -15.688 1.00 37.87 ? 64   TYR E CD2   1 
ATOM   8695  C  CE1   . TYR G  1 65  ? -2.933  -14.096 -17.951 1.00 37.51 ? 64   TYR E CE1   1 
ATOM   8696  C  CE2   . TYR G  1 65  ? -1.139  -12.962 -16.860 1.00 38.30 ? 64   TYR E CE2   1 
ATOM   8697  C  CZ    . TYR G  1 65  ? -1.883  -13.205 -17.992 1.00 37.78 ? 64   TYR E CZ    1 
ATOM   8698  O  OH    . TYR G  1 65  ? -1.527  -12.558 -19.163 1.00 38.67 ? 64   TYR E OH    1 
ATOM   8699  N  N     . ASP G  1 66  ? -1.096  -17.815 -12.206 1.00 38.34 ? 65   ASP E N     1 
ATOM   8700  C  CA    . ASP G  1 66  ? -1.019  -18.398 -10.867 1.00 38.21 ? 65   ASP E CA    1 
ATOM   8701  C  C     . ASP G  1 66  ? -0.333  -17.466 -9.868  1.00 38.23 ? 65   ASP E C     1 
ATOM   8702  O  O     . ASP G  1 66  ? -0.674  -17.477 -8.704  1.00 38.70 ? 65   ASP E O     1 
ATOM   8703  C  CB    . ASP G  1 66  ? -0.259  -19.726 -10.887 1.00 37.94 ? 65   ASP E CB    1 
ATOM   8704  C  CG    . ASP G  1 66  ? -1.157  -20.949 -11.116 1.00 39.60 ? 65   ASP E CG    1 
ATOM   8705  O  OD1   . ASP G  1 66  ? -2.384  -20.825 -11.279 1.00 38.59 ? 65   ASP E OD1   1 
ATOM   8706  O  OD2   . ASP G  1 66  ? -0.609  -22.072 -11.123 1.00 41.99 ? 65   ASP E OD2   1 
ATOM   8707  N  N     . ARG G  1 67  ? 0.635   -16.676 -10.310 1.00 38.39 ? 66   ARG E N     1 
ATOM   8708  C  CA    . ARG G  1 67  ? 1.373   -15.795 -9.403  1.00 39.38 ? 66   ARG E CA    1 
ATOM   8709  C  C     . ARG G  1 67  ? 0.562   -14.540 -9.030  1.00 38.76 ? 66   ARG E C     1 
ATOM   8710  O  O     . ARG G  1 67  ? 0.762   -13.980 -7.967  1.00 39.35 ? 66   ARG E O     1 
ATOM   8711  C  CB    . ARG G  1 67  ? 2.749   -15.411 -9.988  1.00 39.48 ? 66   ARG E CB    1 
ATOM   8712  C  CG    . ARG G  1 67  ? 2.696   -14.516 -11.249 1.00 41.05 ? 66   ARG E CG    1 
ATOM   8713  C  CD    . ARG G  1 67  ? 4.029   -14.555 -12.029 1.00 41.70 ? 66   ARG E CD    1 
ATOM   8714  N  NE    . ARG G  1 67  ? 4.123   -13.552 -13.097 1.00 43.62 ? 66   ARG E NE    1 
ATOM   8715  C  CZ    . ARG G  1 67  ? 3.660   -13.707 -14.339 1.00 44.34 ? 66   ARG E CZ    1 
ATOM   8716  N  NH1   . ARG G  1 67  ? 3.039   -14.827 -14.705 1.00 46.34 ? 66   ARG E NH1   1 
ATOM   8717  N  NH2   . ARG G  1 67  ? 3.806   -12.728 -15.218 1.00 43.80 ? 66   ARG E NH2   1 
ATOM   8718  N  N     . LEU G  1 68  ? -0.368  -14.130 -9.887  1.00 38.31 ? 67   LEU E N     1 
ATOM   8719  C  CA    . LEU G  1 68  ? -1.171  -12.931 -9.667  1.00 37.94 ? 67   LEU E CA    1 
ATOM   8720  C  C     . LEU G  1 68  ? -2.371  -13.200 -8.766  1.00 38.25 ? 67   LEU E C     1 
ATOM   8721  O  O     . LEU G  1 68  ? -2.764  -12.350 -7.961  1.00 37.96 ? 67   LEU E O     1 
ATOM   8722  C  CB    . LEU G  1 68  ? -1.699  -12.410 -11.010 1.00 37.69 ? 67   LEU E CB    1 
ATOM   8723  C  CG    . LEU G  1 68  ? -2.421  -11.059 -11.015 1.00 36.82 ? 67   LEU E CG    1 
ATOM   8724  C  CD1   . LEU G  1 68  ? -1.449  -9.928  -10.685 1.00 36.48 ? 67   LEU E CD1   1 
ATOM   8725  C  CD2   . LEU G  1 68  ? -3.106  -10.812 -12.347 1.00 35.61 ? 67   LEU E CD2   1 
ATOM   8726  N  N     . ARG G  1 69  ? -2.959  -14.380 -8.933  1.00 38.37 ? 68   ARG E N     1 
ATOM   8727  C  CA    . ARG G  1 69  ? -4.241  -14.706 -8.321  1.00 38.57 ? 68   ARG E CA    1 
ATOM   8728  C  C     . ARG G  1 69  ? -4.297  -14.462 -6.805  1.00 38.68 ? 68   ARG E C     1 
ATOM   8729  O  O     . ARG G  1 69  ? -5.211  -13.795 -6.329  1.00 38.59 ? 68   ARG E O     1 
ATOM   8730  C  CB    . ARG G  1 69  ? -4.655  -16.143 -8.660  1.00 38.55 ? 68   ARG E CB    1 
ATOM   8731  C  CG    . ARG G  1 69  ? -6.142  -16.381 -8.439  1.00 38.42 ? 68   ARG E CG    1 
ATOM   8732  C  CD    . ARG G  1 69  ? -6.596  -17.749 -8.864  1.00 38.64 ? 68   ARG E CD    1 
ATOM   8733  N  NE    . ARG G  1 69  ? -6.101  -18.131 -10.181 1.00 37.39 ? 68   ARG E NE    1 
ATOM   8734  C  CZ    . ARG G  1 69  ? -5.064  -18.933 -10.412 1.00 36.97 ? 68   ARG E CZ    1 
ATOM   8735  N  NH1   . ARG G  1 69  ? -4.365  -19.452 -9.423  1.00 36.77 ? 68   ARG E NH1   1 
ATOM   8736  N  NH2   . ARG G  1 69  ? -4.717  -19.203 -11.662 1.00 38.53 ? 68   ARG E NH2   1 
ATOM   8737  N  N     . PRO G  1 70  ? -3.314  -14.981 -6.050  1.00 38.56 ? 69   PRO E N     1 
ATOM   8738  C  CA    . PRO G  1 70  ? -3.366  -14.862 -4.594  1.00 38.53 ? 69   PRO E CA    1 
ATOM   8739  C  C     . PRO G  1 70  ? -3.227  -13.466 -4.008  1.00 38.63 ? 69   PRO E C     1 
ATOM   8740  O  O     . PRO G  1 70  ? -3.482  -13.303 -2.825  1.00 38.51 ? 69   PRO E O     1 
ATOM   8741  C  CB    . PRO G  1 70  ? -2.195  -15.740 -4.127  1.00 38.30 ? 69   PRO E CB    1 
ATOM   8742  C  CG    . PRO G  1 70  ? -1.878  -16.613 -5.310  1.00 38.66 ? 69   PRO E CG    1 
ATOM   8743  C  CD    . PRO G  1 70  ? -2.130  -15.739 -6.473  1.00 38.78 ? 69   PRO E CD    1 
ATOM   8744  N  N     . LEU G  1 71  ? -2.840  -12.471 -4.809  1.00 38.44 ? 70   LEU E N     1 
ATOM   8745  C  CA    . LEU G  1 71  ? -2.864  -11.080 -4.346  1.00 38.26 ? 70   LEU E CA    1 
ATOM   8746  C  C     . LEU G  1 71  ? -4.290  -10.625 -4.059  1.00 38.05 ? 70   LEU E C     1 
ATOM   8747  O  O     . LEU G  1 71  ? -4.481  -9.621  -3.373  1.00 37.56 ? 70   LEU E O     1 
ATOM   8748  C  CB    . LEU G  1 71  ? -2.212  -10.131 -5.373  1.00 38.25 ? 70   LEU E CB    1 
ATOM   8749  C  CG    . LEU G  1 71  ? -0.773  -10.462 -5.780  1.00 39.34 ? 70   LEU E CG    1 
ATOM   8750  C  CD1   . LEU G  1 71  ? -0.117  -9.342  -6.581  1.00 38.51 ? 70   LEU E CD1   1 
ATOM   8751  C  CD2   . LEU G  1 71  ? 0.034   -10.781 -4.538  1.00 37.97 ? 70   LEU E CD2   1 
ATOM   8752  N  N     . SER G  1 72  ? -5.281  -11.353 -4.588  1.00 38.13 ? 71   SER E N     1 
ATOM   8753  C  CA    A SER G  1 72  ? -6.700  -11.048 -4.346  0.50 38.21 ? 71   SER E CA    1 
ATOM   8754  C  CA    B SER G  1 72  ? -6.692  -11.036 -4.343  0.50 38.39 ? 71   SER E CA    1 
ATOM   8755  C  C     . SER G  1 72  ? -7.190  -11.578 -2.995  1.00 38.49 ? 71   SER E C     1 
ATOM   8756  O  O     . SER G  1 72  ? -8.191  -11.105 -2.457  1.00 38.96 ? 71   SER E O     1 
ATOM   8757  C  CB    A SER G  1 72  ? -7.586  -11.629 -5.457  0.50 38.32 ? 71   SER E CB    1 
ATOM   8758  C  CB    B SER G  1 72  ? -7.565  -11.578 -5.479  0.50 38.52 ? 71   SER E CB    1 
ATOM   8759  O  OG    A SER G  1 72  ? -7.564  -10.831 -6.626  0.50 37.73 ? 71   SER E OG    1 
ATOM   8760  O  OG    B SER G  1 72  ? -7.811  -12.968 -5.330  0.50 38.89 ? 71   SER E OG    1 
ATOM   8761  N  N     . TYR G  1 73  ? -6.474  -12.549 -2.432  1.00 38.78 ? 72   TYR E N     1 
ATOM   8762  C  CA    . TYR G  1 73  ? -6.994  -13.312 -1.289  1.00 38.80 ? 72   TYR E CA    1 
ATOM   8763  C  C     . TYR G  1 73  ? -7.054  -12.656 0.109   1.00 38.76 ? 72   TYR E C     1 
ATOM   8764  O  O     . TYR G  1 73  ? -8.018  -12.882 0.854   1.00 38.67 ? 72   TYR E O     1 
ATOM   8765  C  CB    . TYR G  1 73  ? -6.230  -14.641 -1.205  1.00 38.53 ? 72   TYR E CB    1 
ATOM   8766  C  CG    . TYR G  1 73  ? -6.408  -15.554 -2.406  1.00 38.10 ? 72   TYR E CG    1 
ATOM   8767  C  CD1   . TYR G  1 73  ? -7.440  -15.368 -3.337  1.00 38.18 ? 72   TYR E CD1   1 
ATOM   8768  C  CD2   . TYR G  1 73  ? -5.557  -16.629 -2.593  1.00 37.52 ? 72   TYR E CD2   1 
ATOM   8769  C  CE1   . TYR G  1 73  ? -7.589  -16.226 -4.414  1.00 38.34 ? 72   TYR E CE1   1 
ATOM   8770  C  CE2   . TYR G  1 73  ? -5.700  -17.484 -3.653  1.00 38.14 ? 72   TYR E CE2   1 
ATOM   8771  C  CZ    . TYR G  1 73  ? -6.704  -17.289 -4.562  1.00 38.17 ? 72   TYR E CZ    1 
ATOM   8772  O  OH    . TYR G  1 73  ? -6.823  -18.177 -5.610  1.00 38.26 ? 72   TYR E OH    1 
ATOM   8773  N  N     . PRO G  1 74  ? -6.033  -11.870 0.488   1.00 39.06 ? 73   PRO E N     1 
ATOM   8774  C  CA    . PRO G  1 74  ? -6.078  -11.309 1.842   1.00 39.10 ? 73   PRO E CA    1 
ATOM   8775  C  C     . PRO G  1 74  ? -7.385  -10.552 2.136   1.00 39.11 ? 73   PRO E C     1 
ATOM   8776  O  O     . PRO G  1 74  ? -7.862  -9.773  1.291   1.00 39.03 ? 73   PRO E O     1 
ATOM   8777  C  CB    . PRO G  1 74  ? -4.861  -10.368 1.883   1.00 39.35 ? 73   PRO E CB    1 
ATOM   8778  C  CG    . PRO G  1 74  ? -3.913  -10.921 0.860   1.00 39.25 ? 73   PRO E CG    1 
ATOM   8779  C  CD    . PRO G  1 74  ? -4.805  -11.481 -0.232  1.00 39.59 ? 73   PRO E CD    1 
ATOM   8780  N  N     . GLN G  1 75  ? -7.959  -10.842 3.309   1.00 38.71 ? 74   GLN E N     1 
ATOM   8781  C  CA    . GLN G  1 75  ? -9.162  -10.194 3.836   1.00 38.35 ? 74   GLN E CA    1 
ATOM   8782  C  C     . GLN G  1 75  ? -10.444 -10.445 3.007   1.00 38.12 ? 74   GLN E C     1 
ATOM   8783  O  O     . GLN G  1 75  ? -11.375 -9.647  3.019   1.00 38.17 ? 74   GLN E O     1 
ATOM   8784  C  CB    . GLN G  1 75  ? -8.900  -8.696  4.055   1.00 38.61 ? 74   GLN E CB    1 
ATOM   8785  C  CG    . GLN G  1 75  ? -7.737  -8.402  5.026   1.00 38.62 ? 74   GLN E CG    1 
ATOM   8786  N  N     . THR G  1 76  ? -10.499 -11.579 2.315   1.00 37.49 ? 75   THR E N     1 
ATOM   8787  C  CA    . THR G  1 76  ? -11.701 -11.985 1.589   1.00 37.03 ? 75   THR E CA    1 
ATOM   8788  C  C     . THR G  1 76  ? -12.804 -12.354 2.612   1.00 37.26 ? 75   THR E C     1 
ATOM   8789  O  O     . THR G  1 76  ? -12.546 -13.009 3.636   1.00 36.74 ? 75   THR E O     1 
ATOM   8790  C  CB    . THR G  1 76  ? -11.379 -13.175 0.650   1.00 37.27 ? 75   THR E CB    1 
ATOM   8791  O  OG1   . THR G  1 76  ? -10.404 -12.759 -0.320  1.00 36.29 ? 75   THR E OG1   1 
ATOM   8792  C  CG2   . THR G  1 76  ? -12.641 -13.724 -0.071  1.00 35.46 ? 75   THR E CG2   1 
ATOM   8793  N  N     . ASP G  1 77  ? -14.025 -11.918 2.332   1.00 37.20 ? 76   ASP E N     1 
ATOM   8794  C  CA    . ASP G  1 77  ? -15.192 -12.298 3.130   1.00 36.75 ? 76   ASP E CA    1 
ATOM   8795  C  C     . ASP G  1 77  ? -15.812 -13.611 2.657   1.00 36.43 ? 76   ASP E C     1 
ATOM   8796  O  O     . ASP G  1 77  ? -16.211 -14.450 3.473   1.00 36.96 ? 76   ASP E O     1 
ATOM   8797  C  CB    . ASP G  1 77  ? -16.238 -11.202 3.080   1.00 36.86 ? 76   ASP E CB    1 
ATOM   8798  C  CG    . ASP G  1 77  ? -15.778 -9.931  3.752   1.00 36.86 ? 76   ASP E CG    1 
ATOM   8799  O  OD1   . ASP G  1 77  ? -15.471 -9.988  4.962   1.00 37.51 ? 76   ASP E OD1   1 
ATOM   8800  O  OD2   . ASP G  1 77  ? -15.737 -8.878  3.071   1.00 36.97 ? 76   ASP E OD2   1 
ATOM   8801  N  N     . VAL G  1 78  ? -15.911 -13.791 1.346   1.00 36.26 ? 77   VAL E N     1 
ATOM   8802  C  CA    . VAL G  1 78  ? -16.483 -15.013 0.795   1.00 35.99 ? 77   VAL E CA    1 
ATOM   8803  C  C     . VAL G  1 78  ? -15.894 -15.369 -0.579  1.00 35.89 ? 77   VAL E C     1 
ATOM   8804  O  O     . VAL G  1 78  ? -15.674 -14.496 -1.427  1.00 35.38 ? 77   VAL E O     1 
ATOM   8805  C  CB    . VAL G  1 78  ? -18.011 -14.889 0.701   1.00 35.93 ? 77   VAL E CB    1 
ATOM   8806  C  CG1   . VAL G  1 78  ? -18.376 -13.745 -0.210  1.00 34.96 ? 77   VAL E CG1   1 
ATOM   8807  C  CG2   . VAL G  1 78  ? -18.618 -16.208 0.222   1.00 35.76 ? 77   VAL E CG2   1 
ATOM   8808  N  N     . PHE G  1 79  ? -15.647 -16.663 -0.781  1.00 36.25 ? 78   PHE E N     1 
ATOM   8809  C  CA    . PHE G  1 79  ? -15.169 -17.186 -2.060  1.00 36.31 ? 78   PHE E CA    1 
ATOM   8810  C  C     . PHE G  1 79  ? -16.280 -17.930 -2.794  1.00 36.59 ? 78   PHE E C     1 
ATOM   8811  O  O     . PHE G  1 79  ? -17.050 -18.659 -2.173  1.00 36.26 ? 78   PHE E O     1 
ATOM   8812  C  CB    . PHE G  1 79  ? -14.027 -18.185 -1.850  1.00 36.20 ? 78   PHE E CB    1 
ATOM   8813  C  CG    . PHE G  1 79  ? -12.716 -17.560 -1.479  1.00 35.21 ? 78   PHE E CG    1 
ATOM   8814  C  CD1   . PHE G  1 79  ? -12.359 -17.399 -0.151  1.00 35.87 ? 78   PHE E CD1   1 
ATOM   8815  C  CD2   . PHE G  1 79  ? -11.811 -17.206 -2.452  1.00 35.05 ? 78   PHE E CD2   1 
ATOM   8816  C  CE1   . PHE G  1 79  ? -11.140 -16.839 0.186   1.00 37.16 ? 78   PHE E CE1   1 
ATOM   8817  C  CE2   . PHE G  1 79  ? -10.600 -16.651 -2.119  1.00 34.34 ? 78   PHE E CE2   1 
ATOM   8818  C  CZ    . PHE G  1 79  ? -10.254 -16.469 -0.816  1.00 35.06 ? 78   PHE E CZ    1 
ATOM   8819  N  N     . LEU G  1 80  ? -16.351 -17.734 -4.110  1.00 36.70 ? 79   LEU E N     1 
ATOM   8820  C  CA    . LEU G  1 80  ? -17.061 -18.655 -5.015  1.00 36.58 ? 79   LEU E CA    1 
ATOM   8821  C  C     . LEU G  1 80  ? -15.996 -19.453 -5.765  1.00 36.73 ? 79   LEU E C     1 
ATOM   8822  O  O     . LEU G  1 80  ? -15.190 -18.870 -6.518  1.00 35.77 ? 79   LEU E O     1 
ATOM   8823  C  CB    . LEU G  1 80  ? -17.908 -17.881 -6.028  1.00 36.61 ? 79   LEU E CB    1 
ATOM   8824  C  CG    . LEU G  1 80  ? -18.817 -16.837 -5.382  1.00 37.22 ? 79   LEU E CG    1 
ATOM   8825  C  CD1   . LEU G  1 80  ? -19.620 -16.061 -6.428  1.00 37.13 ? 79   LEU E CD1   1 
ATOM   8826  C  CD2   . LEU G  1 80  ? -19.709 -17.508 -4.370  1.00 36.23 ? 79   LEU E CD2   1 
ATOM   8827  N  N     . ILE G  1 81  ? -15.959 -20.766 -5.513  1.00 36.32 ? 80   ILE E N     1 
ATOM   8828  C  CA    . ILE G  1 81  ? -15.189 -21.691 -6.346  1.00 36.26 ? 80   ILE E CA    1 
ATOM   8829  C  C     . ILE G  1 81  ? -16.159 -22.229 -7.401  1.00 36.20 ? 80   ILE E C     1 
ATOM   8830  O  O     . ILE G  1 81  ? -17.153 -22.862 -7.053  1.00 37.50 ? 80   ILE E O     1 
ATOM   8831  C  CB    . ILE G  1 81  ? -14.591 -22.874 -5.506  1.00 35.99 ? 80   ILE E CB    1 
ATOM   8832  C  CG1   . ILE G  1 81  ? -13.560 -22.341 -4.492  1.00 35.27 ? 80   ILE E CG1   1 
ATOM   8833  C  CG2   . ILE G  1 81  ? -13.983 -23.952 -6.424  1.00 35.20 ? 80   ILE E CG2   1 
ATOM   8834  C  CD1   . ILE G  1 81  ? -12.898 -23.457 -3.635  1.00 34.75 ? 80   ILE E CD1   1 
ATOM   8835  N  N     . CYS G  1 82  ? -15.872 -21.963 -8.668  1.00 36.32 ? 81   CYS E N     1 
ATOM   8836  C  CA    . CYS G  1 82  ? -16.699 -22.371 -9.788  1.00 36.52 ? 81   CYS E CA    1 
ATOM   8837  C  C     . CYS G  1 82  ? -16.101 -23.512 -10.632 1.00 36.41 ? 81   CYS E C     1 
ATOM   8838  O  O     . CYS G  1 82  ? -14.881 -23.602 -10.841 1.00 36.39 ? 81   CYS E O     1 
ATOM   8839  C  CB    . CYS G  1 82  ? -16.907 -21.172 -10.708 1.00 37.02 ? 81   CYS E CB    1 
ATOM   8840  S  SG    . CYS G  1 82  ? -17.459 -19.678 -9.852  1.00 40.35 ? 81   CYS E SG    1 
ATOM   8841  N  N     . PHE G  1 83  ? -16.983 -24.365 -11.134 1.00 36.27 ? 82   PHE E N     1 
ATOM   8842  C  CA    . PHE G  1 83  ? -16.657 -25.368 -12.146 1.00 36.16 ? 82   PHE E CA    1 
ATOM   8843  C  C     . PHE G  1 83  ? -17.858 -25.478 -13.072 1.00 36.11 ? 82   PHE E C     1 
ATOM   8844  O  O     . PHE G  1 83  ? -18.979 -25.121 -12.680 1.00 36.74 ? 82   PHE E O     1 
ATOM   8845  C  CB    . PHE G  1 83  ? -16.390 -26.726 -11.497 1.00 36.07 ? 82   PHE E CB    1 
ATOM   8846  C  CG    . PHE G  1 83  ? -17.623 -27.374 -10.967 1.00 35.98 ? 82   PHE E CG    1 
ATOM   8847  C  CD1   . PHE G  1 83  ? -18.068 -27.094 -9.697  1.00 36.13 ? 82   PHE E CD1   1 
ATOM   8848  C  CD2   . PHE G  1 83  ? -18.368 -28.222 -11.763 1.00 35.78 ? 82   PHE E CD2   1 
ATOM   8849  C  CE1   . PHE G  1 83  ? -19.231 -27.639 -9.226  1.00 35.55 ? 82   PHE E CE1   1 
ATOM   8850  C  CE2   . PHE G  1 83  ? -19.519 -28.784 -11.287 1.00 35.78 ? 82   PHE E CE2   1 
ATOM   8851  C  CZ    . PHE G  1 83  ? -19.941 -28.498 -10.013 1.00 35.65 ? 82   PHE E CZ    1 
ATOM   8852  N  N     . SER G  1 84  ? -17.626 -25.946 -14.294 1.00 36.12 ? 83   SER E N     1 
ATOM   8853  C  CA    . SER G  1 84  ? -18.686 -26.058 -15.306 1.00 35.73 ? 83   SER E CA    1 
ATOM   8854  C  C     . SER G  1 84  ? -19.383 -27.392 -15.134 1.00 35.54 ? 83   SER E C     1 
ATOM   8855  O  O     . SER G  1 84  ? -18.747 -28.416 -15.053 1.00 34.97 ? 83   SER E O     1 
ATOM   8856  C  CB    . SER G  1 84  ? -18.118 -25.951 -16.722 1.00 35.93 ? 83   SER E CB    1 
ATOM   8857  O  OG    . SER G  1 84  ? -19.091 -26.242 -17.717 1.00 36.61 ? 83   SER E OG    1 
ATOM   8858  N  N     . LEU G  1 85  ? -20.706 -27.368 -15.089 1.00 35.57 ? 84   LEU E N     1 
ATOM   8859  C  CA    . LEU G  1 85  ? -21.485 -28.598 -14.984 1.00 35.29 ? 84   LEU E CA    1 
ATOM   8860  C  C     . LEU G  1 85  ? -21.251 -29.535 -16.180 1.00 35.73 ? 84   LEU E C     1 
ATOM   8861  O  O     . LEU G  1 85  ? -21.531 -30.745 -16.095 1.00 36.06 ? 84   LEU E O     1 
ATOM   8862  C  CB    . LEU G  1 85  ? -22.970 -28.254 -14.811 1.00 34.81 ? 84   LEU E CB    1 
ATOM   8863  C  CG    . LEU G  1 85  ? -23.350 -27.648 -13.458 1.00 34.08 ? 84   LEU E CG    1 
ATOM   8864  C  CD1   . LEU G  1 85  ? -24.767 -27.006 -13.475 1.00 33.20 ? 84   LEU E CD1   1 
ATOM   8865  C  CD2   . LEU G  1 85  ? -23.235 -28.755 -12.380 1.00 33.01 ? 84   LEU E CD2   1 
ATOM   8866  N  N     . VAL G  1 86  ? -20.736 -28.992 -17.290 1.00 35.74 ? 85   VAL E N     1 
ATOM   8867  C  CA    . VAL G  1 86  ? -20.467 -29.811 -18.486 1.00 35.49 ? 85   VAL E CA    1 
ATOM   8868  C  C     . VAL G  1 86  ? -18.955 -30.015 -18.734 1.00 36.30 ? 85   VAL E C     1 
ATOM   8869  O  O     . VAL G  1 86  ? -18.540 -30.393 -19.829 1.00 36.70 ? 85   VAL E O     1 
ATOM   8870  C  CB    . VAL G  1 86  ? -21.233 -29.278 -19.741 1.00 34.93 ? 85   VAL E CB    1 
ATOM   8871  C  CG1   . VAL G  1 86  ? -22.742 -29.417 -19.525 1.00 33.09 ? 85   VAL E CG1   1 
ATOM   8872  C  CG2   . VAL G  1 86  ? -20.895 -27.845 -20.028 1.00 34.40 ? 85   VAL E CG2   1 
ATOM   8873  N  N     . SER G  1 87  ? -18.144 -29.795 -17.696 1.00 36.88 ? 86   SER E N     1 
ATOM   8874  C  CA    . SER G  1 87  ? -16.716 -30.099 -17.743 1.00 37.14 ? 86   SER E CA    1 
ATOM   8875  C  C     . SER G  1 87  ? -16.274 -30.865 -16.505 1.00 37.20 ? 86   SER E C     1 
ATOM   8876  O  O     . SER G  1 87  ? -15.860 -30.263 -15.505 1.00 38.27 ? 86   SER E O     1 
ATOM   8877  C  CB    . SER G  1 87  ? -15.902 -28.813 -17.889 1.00 37.68 ? 86   SER E CB    1 
ATOM   8878  O  OG    . SER G  1 87  ? -14.517 -29.081 -17.752 1.00 38.39 ? 86   SER E OG    1 
ATOM   8879  N  N     . PRO G  1 88  ? -16.361 -32.206 -16.556 1.00 36.94 ? 87   PRO E N     1 
ATOM   8880  C  CA    . PRO G  1 88  ? -15.825 -33.029 -15.468 1.00 36.66 ? 87   PRO E CA    1 
ATOM   8881  C  C     . PRO G  1 88  ? -14.416 -32.655 -15.001 1.00 36.63 ? 87   PRO E C     1 
ATOM   8882  O  O     . PRO G  1 88  ? -14.142 -32.740 -13.800 1.00 35.96 ? 87   PRO E O     1 
ATOM   8883  C  CB    . PRO G  1 88  ? -15.839 -34.440 -16.070 1.00 37.16 ? 87   PRO E CB    1 
ATOM   8884  C  CG    . PRO G  1 88  ? -17.065 -34.397 -17.024 1.00 36.65 ? 87   PRO E CG    1 
ATOM   8885  C  CD    . PRO G  1 88  ? -17.019 -33.016 -17.604 1.00 36.26 ? 87   PRO E CD    1 
ATOM   8886  N  N     . ALA G  1 89  ? -13.545 -32.253 -15.939 1.00 36.81 ? 88   ALA E N     1 
ATOM   8887  C  CA    . ALA G  1 89  ? -12.155 -31.860 -15.629 1.00 36.57 ? 88   ALA E CA    1 
ATOM   8888  C  C     . ALA G  1 89  ? -12.099 -30.626 -14.750 1.00 36.94 ? 88   ALA E C     1 
ATOM   8889  O  O     . ALA G  1 89  ? -11.256 -30.565 -13.844 1.00 37.38 ? 88   ALA E O     1 
ATOM   8890  C  CB    . ALA G  1 89  ? -11.340 -31.633 -16.904 1.00 36.17 ? 88   ALA E CB    1 
ATOM   8891  N  N     . SER G  1 90  ? -12.994 -29.653 -14.989 1.00 37.13 ? 89   SER E N     1 
ATOM   8892  C  CA    . SER G  1 90  ? -13.081 -28.465 -14.123 1.00 36.83 ? 89   SER E CA    1 
ATOM   8893  C  C     . SER G  1 90  ? -13.593 -28.841 -12.733 1.00 37.09 ? 89   SER E C     1 
ATOM   8894  O  O     . SER G  1 90  ? -13.196 -28.245 -11.718 1.00 37.47 ? 89   SER E O     1 
ATOM   8895  C  CB    . SER G  1 90  ? -13.935 -27.353 -14.749 1.00 36.77 ? 89   SER E CB    1 
ATOM   8896  O  OG    . SER G  1 90  ? -15.324 -27.649 -14.749 1.00 36.31 ? 89   SER E OG    1 
ATOM   8897  N  N     . PHE G  1 91  ? -14.460 -29.849 -12.696 1.00 37.28 ? 90   PHE E N     1 
ATOM   8898  C  CA    . PHE G  1 91  ? -15.019 -30.347 -11.453 1.00 37.36 ? 90   PHE E CA    1 
ATOM   8899  C  C     . PHE G  1 91  ? -13.922 -30.927 -10.594 1.00 37.46 ? 90   PHE E C     1 
ATOM   8900  O  O     . PHE G  1 91  ? -13.789 -30.591 -9.419  1.00 37.62 ? 90   PHE E O     1 
ATOM   8901  C  CB    . PHE G  1 91  ? -16.073 -31.409 -11.750 1.00 36.67 ? 90   PHE E CB    1 
ATOM   8902  C  CG    . PHE G  1 91  ? -16.814 -31.921 -10.536 1.00 35.43 ? 90   PHE E CG    1 
ATOM   8903  C  CD1   . PHE G  1 91  ? -17.544 -31.066 -9.737  1.00 36.11 ? 90   PHE E CD1   1 
ATOM   8904  C  CD2   . PHE G  1 91  ? -16.859 -33.285 -10.261 1.00 35.12 ? 90   PHE E CD2   1 
ATOM   8905  C  CE1   . PHE G  1 91  ? -18.278 -31.559 -8.631  1.00 34.86 ? 90   PHE E CE1   1 
ATOM   8906  C  CE2   . PHE G  1 91  ? -17.582 -33.780 -9.167  1.00 35.51 ? 90   PHE E CE2   1 
ATOM   8907  C  CZ    . PHE G  1 91  ? -18.293 -32.901 -8.358  1.00 35.00 ? 90   PHE E CZ    1 
ATOM   8908  N  N     . GLU G  1 92  ? -13.128 -31.799 -11.195 1.00 38.40 ? 91   GLU E N     1 
ATOM   8909  C  CA    . GLU G  1 92  ? -12.054 -32.456 -10.472 1.00 38.58 ? 91   GLU E CA    1 
ATOM   8910  C  C     . GLU G  1 92  ? -11.030 -31.453 -9.995  1.00 38.34 ? 91   GLU E C     1 
ATOM   8911  O  O     . GLU G  1 92  ? -10.425 -31.665 -8.960  1.00 38.02 ? 91   GLU E O     1 
ATOM   8912  C  CB    . GLU G  1 92  ? -11.394 -33.535 -11.321 1.00 38.91 ? 91   GLU E CB    1 
ATOM   8913  C  CG    . GLU G  1 92  ? -12.158 -34.862 -11.313 1.00 41.74 ? 91   GLU E CG    1 
ATOM   8914  N  N     . ASN G  1 93  ? -10.832 -30.370 -10.745 1.00 38.13 ? 92   ASN E N     1 
ATOM   8915  C  CA    . ASN G  1 93  ? -9.895  -29.310 -10.333 1.00 38.50 ? 92   ASN E CA    1 
ATOM   8916  C  C     . ASN G  1 93  ? -10.316 -28.493 -9.099  1.00 38.00 ? 92   ASN E C     1 
ATOM   8917  O  O     . ASN G  1 93  ? -9.490  -27.808 -8.503  1.00 37.99 ? 92   ASN E O     1 
ATOM   8918  C  CB    . ASN G  1 93  ? -9.587  -28.370 -11.502 1.00 38.85 ? 92   ASN E CB    1 
ATOM   8919  C  CG    . ASN G  1 93  ? -8.509  -28.923 -12.407 1.00 39.61 ? 92   ASN E CG    1 
ATOM   8920  O  OD1   . ASN G  1 93  ? -7.550  -29.533 -11.928 1.00 40.56 ? 92   ASN E OD1   1 
ATOM   8921  N  ND2   . ASN G  1 93  ? -8.664  -28.727 -13.725 1.00 38.60 ? 92   ASN E ND2   1 
ATOM   8922  N  N     . VAL G  1 94  ? -11.586 -28.571 -8.722  1.00 37.89 ? 93   VAL E N     1 
ATOM   8923  C  CA    . VAL G  1 94  ? -12.042 -27.993 -7.471  1.00 38.32 ? 93   VAL E CA    1 
ATOM   8924  C  C     . VAL G  1 94  ? -11.279 -28.641 -6.326  1.00 38.68 ? 93   VAL E C     1 
ATOM   8925  O  O     . VAL G  1 94  ? -10.760 -27.957 -5.442  1.00 38.37 ? 93   VAL E O     1 
ATOM   8926  C  CB    . VAL G  1 94  ? -13.555 -28.230 -7.237  1.00 38.39 ? 93   VAL E CB    1 
ATOM   8927  C  CG1   . VAL G  1 94  ? -13.932 -27.819 -5.821  1.00 38.44 ? 93   VAL E CG1   1 
ATOM   8928  C  CG2   . VAL G  1 94  ? -14.426 -27.465 -8.274  1.00 37.28 ? 93   VAL E CG2   1 
ATOM   8929  N  N     . ARG G  1 95  ? -11.222 -29.968 -6.369  1.00 38.97 ? 94   ARG E N     1 
ATOM   8930  C  CA    . ARG G  1 95  ? -10.508 -30.772 -5.392  1.00 40.18 ? 94   ARG E CA    1 
ATOM   8931  C  C     . ARG G  1 95  ? -8.995  -30.666 -5.547  1.00 39.57 ? 94   ARG E C     1 
ATOM   8932  O  O     . ARG G  1 95  ? -8.278  -30.550 -4.560  1.00 39.86 ? 94   ARG E O     1 
ATOM   8933  C  CB    . ARG G  1 95  ? -10.924 -32.244 -5.547  1.00 40.06 ? 94   ARG E CB    1 
ATOM   8934  C  CG    . ARG G  1 95  ? -10.047 -33.224 -4.850  1.00 41.76 ? 94   ARG E CG    1 
ATOM   8935  C  CD    . ARG G  1 95  ? -10.329 -34.658 -5.312  1.00 42.55 ? 94   ARG E CD    1 
ATOM   8936  N  NE    . ARG G  1 95  ? -11.671 -35.094 -4.908  1.00 43.93 ? 94   ARG E NE    1 
ATOM   8937  C  CZ    . ARG G  1 95  ? -12.608 -35.571 -5.721  1.00 45.52 ? 94   ARG E CZ    1 
ATOM   8938  N  NH1   . ARG G  1 95  ? -12.402 -35.691 -7.028  1.00 46.89 ? 94   ARG E NH1   1 
ATOM   8939  N  NH2   . ARG G  1 95  ? -13.772 -35.949 -5.212  1.00 44.97 ? 94   ARG E NH2   1 
ATOM   8940  N  N     . ALA G  1 96  ? -8.504  -30.751 -6.783  1.00 39.56 ? 95   ALA E N     1 
ATOM   8941  C  CA    . ALA G  1 96  ? -7.056  -30.846 -7.026  1.00 38.99 ? 95   ALA E CA    1 
ATOM   8942  C  C     . ALA G  1 96  ? -6.306  -29.506 -6.903  1.00 38.53 ? 95   ALA E C     1 
ATOM   8943  O  O     . ALA G  1 96  ? -5.125  -29.479 -6.510  1.00 38.82 ? 95   ALA E O     1 
ATOM   8944  C  CB    . ALA G  1 96  ? -6.794  -31.479 -8.385  1.00 38.68 ? 95   ALA E CB    1 
ATOM   8945  N  N     . LYS G  1 97  ? -6.976  -28.413 -7.256  1.00 38.05 ? 96   LYS E N     1 
ATOM   8946  C  CA    . LYS G  1 97  ? -6.337  -27.097 -7.318  1.00 38.01 ? 96   LYS E CA    1 
ATOM   8947  C  C     . LYS G  1 97  ? -7.004  -26.050 -6.427  1.00 37.82 ? 96   LYS E C     1 
ATOM   8948  O  O     . LYS G  1 97  ? -6.354  -25.452 -5.562  1.00 37.75 ? 96   LYS E O     1 
ATOM   8949  C  CB    . LYS G  1 97  ? -6.307  -26.567 -8.754  1.00 37.62 ? 96   LYS E CB    1 
ATOM   8950  C  CG    . LYS G  1 97  ? -5.605  -25.204 -8.873  1.00 38.23 ? 96   LYS E CG    1 
ATOM   8951  C  CD    . LYS G  1 97  ? -5.229  -24.832 -10.298 1.00 38.87 ? 96   LYS E CD    1 
ATOM   8952  C  CE    . LYS G  1 97  ? -4.355  -23.560 -10.334 1.00 39.63 ? 96   LYS E CE    1 
ATOM   8953  N  NZ    . LYS G  1 97  ? -3.841  -23.227 -11.682 1.00 37.42 ? 96   LYS E NZ    1 
ATOM   8954  N  N     . TRP G  1 98  ? -8.297  -25.828 -6.623  1.00 37.87 ? 97   TRP E N     1 
ATOM   8955  C  CA    . TRP G  1 98  ? -8.913  -24.610 -6.102  1.00 37.56 ? 97   TRP E CA    1 
ATOM   8956  C  C     . TRP G  1 98  ? -9.163  -24.620 -4.602  1.00 37.86 ? 97   TRP E C     1 
ATOM   8957  O  O     . TRP G  1 98  ? -8.906  -23.622 -3.938  1.00 37.63 ? 97   TRP E O     1 
ATOM   8958  C  CB    . TRP G  1 98  ? -10.155 -24.268 -6.894  1.00 37.43 ? 97   TRP E CB    1 
ATOM   8959  C  CG    . TRP G  1 98  ? -9.858  -24.080 -8.354  1.00 36.68 ? 97   TRP E CG    1 
ATOM   8960  C  CD1   . TRP G  1 98  ? -10.293 -24.861 -9.376  1.00 37.36 ? 97   TRP E CD1   1 
ATOM   8961  C  CD2   . TRP G  1 98  ? -9.023  -23.076 -8.943  1.00 37.51 ? 97   TRP E CD2   1 
ATOM   8962  N  NE1   . TRP G  1 98  ? -9.816  -24.394 -10.564 1.00 38.04 ? 97   TRP E NE1   1 
ATOM   8963  C  CE2   . TRP G  1 98  ? -9.018  -23.306 -10.328 1.00 37.61 ? 97   TRP E CE2   1 
ATOM   8964  C  CE3   . TRP G  1 98  ? -8.289  -21.992 -8.431  1.00 37.70 ? 97   TRP E CE3   1 
ATOM   8965  C  CZ2   . TRP G  1 98  ? -8.305  -22.507 -11.213 1.00 37.28 ? 97   TRP E CZ2   1 
ATOM   8966  C  CZ3   . TRP G  1 98  ? -7.580  -21.208 -9.302  1.00 37.86 ? 97   TRP E CZ3   1 
ATOM   8967  C  CH2   . TRP G  1 98  ? -7.589  -21.467 -10.683 1.00 37.43 ? 97   TRP E CH2   1 
ATOM   8968  N  N     . TYR G  1 99  ? -9.651  -25.738 -4.064  1.00 38.33 ? 98   TYR E N     1 
ATOM   8969  C  CA    . TYR G  1 99  ? -9.844  -25.873 -2.607  1.00 38.31 ? 98   TYR E CA    1 
ATOM   8970  C  C     . TYR G  1 99  ? -8.463  -25.765 -1.913  1.00 38.31 ? 98   TYR E C     1 
ATOM   8971  O  O     . TYR G  1 99  ? -8.286  -24.950 -1.001  1.00 38.44 ? 98   TYR E O     1 
ATOM   8972  C  CB    . TYR G  1 99  ? -10.647 -27.158 -2.236  1.00 38.08 ? 98   TYR E CB    1 
ATOM   8973  C  CG    . TYR G  1 99  ? -10.455 -27.669 -0.821  1.00 38.28 ? 98   TYR E CG    1 
ATOM   8974  C  CD1   . TYR G  1 99  ? -11.015 -27.014 0.272   1.00 38.21 ? 98   TYR E CD1   1 
ATOM   8975  C  CD2   . TYR G  1 99  ? -9.698  -28.817 -0.575  1.00 38.86 ? 98   TYR E CD2   1 
ATOM   8976  C  CE1   . TYR G  1 99  ? -10.819 -27.487 1.584   1.00 38.00 ? 98   TYR E CE1   1 
ATOM   8977  C  CE2   . TYR G  1 99  ? -9.501  -29.286 0.707   1.00 39.21 ? 98   TYR E CE2   1 
ATOM   8978  C  CZ    . TYR G  1 99  ? -10.048 -28.624 1.786   1.00 39.48 ? 98   TYR E CZ    1 
ATOM   8979  O  OH    . TYR G  1 99  ? -9.810  -29.127 3.056   1.00 39.37 ? 98   TYR E OH    1 
ATOM   8980  N  N     . PRO G  1 100 ? -7.474  -26.550 -2.366  1.00 38.39 ? 99   PRO E N     1 
ATOM   8981  C  CA    . PRO G  1 100 ? -6.134  -26.382 -1.828  1.00 38.29 ? 99   PRO E CA    1 
ATOM   8982  C  C     . PRO G  1 100 ? -5.561  -24.966 -1.929  1.00 38.34 ? 99   PRO E C     1 
ATOM   8983  O  O     . PRO G  1 100 ? -4.912  -24.489 -0.979  1.00 37.91 ? 99   PRO E O     1 
ATOM   8984  C  CB    . PRO G  1 100 ? -5.297  -27.338 -2.677  1.00 38.80 ? 99   PRO E CB    1 
ATOM   8985  C  CG    . PRO G  1 100 ? -6.253  -28.341 -3.170  1.00 38.83 ? 99   PRO E CG    1 
ATOM   8986  C  CD    . PRO G  1 100 ? -7.545  -27.654 -3.336  1.00 38.00 ? 99   PRO E CD    1 
ATOM   8987  N  N     . GLU G  1 101 ? -5.767  -24.297 -3.059  1.00 38.18 ? 100  GLU E N     1 
ATOM   8988  C  CA    . GLU G  1 101 ? -5.143  -22.986 -3.236  1.00 38.52 ? 100  GLU E CA    1 
ATOM   8989  C  C     . GLU G  1 101 ? -5.767  -21.964 -2.284  1.00 38.43 ? 100  GLU E C     1 
ATOM   8990  O  O     . GLU G  1 101 ? -5.055  -21.232 -1.589  1.00 38.35 ? 100  GLU E O     1 
ATOM   8991  C  CB    . GLU G  1 101 ? -5.192  -22.479 -4.682  1.00 38.37 ? 100  GLU E CB    1 
ATOM   8992  C  CG    . GLU G  1 101 ? -4.288  -21.256 -4.857  1.00 39.27 ? 100  GLU E CG    1 
ATOM   8993  C  CD    . GLU G  1 101 ? -4.250  -20.675 -6.267  1.00 39.50 ? 100  GLU E CD    1 
ATOM   8994  O  OE1   . GLU G  1 101 ? -3.631  -21.318 -7.146  1.00 39.41 ? 100  GLU E OE1   1 
ATOM   8995  O  OE2   . GLU G  1 101 ? -4.782  -19.548 -6.464  1.00 38.54 ? 100  GLU E OE2   1 
ATOM   8996  N  N     . VAL G  1 102 ? -7.087  -21.930 -2.249  1.00 38.14 ? 101  VAL E N     1 
ATOM   8997  C  CA    . VAL G  1 102 ? -7.800  -20.994 -1.393  1.00 38.59 ? 101  VAL E CA    1 
ATOM   8998  C  C     . VAL G  1 102 ? -7.459  -21.237 0.085   1.00 38.58 ? 101  VAL E C     1 
ATOM   8999  O  O     . VAL G  1 102 ? -7.157  -20.296 0.831   1.00 38.07 ? 101  VAL E O     1 
ATOM   9000  C  CB    . VAL G  1 102 ? -9.331  -21.080 -1.626  1.00 38.39 ? 101  VAL E CB    1 
ATOM   9001  C  CG1   . VAL G  1 102 ? -10.057 -20.230 -0.634  1.00 38.83 ? 101  VAL E CG1   1 
ATOM   9002  C  CG2   . VAL G  1 102 ? -9.672  -20.665 -3.083  1.00 37.47 ? 101  VAL E CG2   1 
ATOM   9003  N  N     . ARG G  1 103 ? -7.461  -22.507 0.479   1.00 38.64 ? 102  ARG E N     1 
ATOM   9004  C  CA    . ARG G  1 103 ? -7.294  -22.860 1.881   1.00 38.97 ? 102  ARG E CA    1 
ATOM   9005  C  C     . ARG G  1 103 ? -5.883  -22.640 2.395   1.00 38.86 ? 102  ARG E C     1 
ATOM   9006  O  O     . ARG G  1 103 ? -5.692  -22.474 3.594   1.00 39.18 ? 102  ARG E O     1 
ATOM   9007  C  CB    . ARG G  1 103 ? -7.737  -24.299 2.139   1.00 38.62 ? 102  ARG E CB    1 
ATOM   9008  C  CG    . ARG G  1 103 ? -9.228  -24.450 2.191   1.00 38.59 ? 102  ARG E CG    1 
ATOM   9009  C  CD    . ARG G  1 103 ? -9.765  -23.878 3.486   1.00 38.97 ? 102  ARG E CD    1 
ATOM   9010  N  NE    . ARG G  1 103 ? -11.226 -23.856 3.589   1.00 38.13 ? 102  ARG E NE    1 
ATOM   9011  C  CZ    . ARG G  1 103 ? -11.981 -22.762 3.541   1.00 36.74 ? 102  ARG E CZ    1 
ATOM   9012  N  NH1   . ARG G  1 103 ? -11.448 -21.567 3.345   1.00 35.17 ? 102  ARG E NH1   1 
ATOM   9013  N  NH2   . ARG G  1 103 ? -13.296 -22.877 3.674   1.00 38.14 ? 102  ARG E NH2   1 
ATOM   9014  N  N     . HIS G  1 104 ? -4.903  -22.639 1.494   1.00 39.32 ? 103  HIS E N     1 
ATOM   9015  C  CA    . HIS G  1 104 ? -3.522  -22.334 1.865   1.00 39.32 ? 103  HIS E CA    1 
ATOM   9016  C  C     . HIS G  1 104 ? -3.384  -20.890 2.325   1.00 38.89 ? 103  HIS E C     1 
ATOM   9017  O  O     . HIS G  1 104 ? -2.554  -20.589 3.179   1.00 38.52 ? 103  HIS E O     1 
ATOM   9018  C  CB    . HIS G  1 104 ? -2.575  -22.594 0.706   1.00 39.67 ? 103  HIS E CB    1 
ATOM   9019  C  CG    . HIS G  1 104 ? -1.156  -22.198 0.988   1.00 40.76 ? 103  HIS E CG    1 
ATOM   9020  N  ND1   . HIS G  1 104 ? -0.352  -22.886 1.872   1.00 42.16 ? 103  HIS E ND1   1 
ATOM   9021  C  CD2   . HIS G  1 104 ? -0.401  -21.183 0.503   1.00 42.48 ? 103  HIS E CD2   1 
ATOM   9022  C  CE1   . HIS G  1 104 ? 0.840   -22.313 1.917   1.00 43.54 ? 103  HIS E CE1   1 
ATOM   9023  N  NE2   . HIS G  1 104 ? 0.837   -21.277 1.093   1.00 43.83 ? 103  HIS E NE2   1 
ATOM   9024  N  N     . HIS G  1 105 ? -4.201  -20.013 1.754   1.00 38.91 ? 104  HIS E N     1 
ATOM   9025  C  CA    . HIS G  1 105 ? -4.200  -18.591 2.085   1.00 39.11 ? 104  HIS E CA    1 
ATOM   9026  C  C     . HIS G  1 105 ? -5.262  -18.209 3.127   1.00 38.88 ? 104  HIS E C     1 
ATOM   9027  O  O     . HIS G  1 105 ? -5.035  -17.340 3.960   1.00 39.76 ? 104  HIS E O     1 
ATOM   9028  C  CB    . HIS G  1 105 ? -4.376  -17.783 0.793   1.00 39.30 ? 104  HIS E CB    1 
ATOM   9029  C  CG    . HIS G  1 105 ? -3.206  -17.904 -0.141  1.00 40.52 ? 104  HIS E CG    1 
ATOM   9030  N  ND1   . HIS G  1 105 ? -3.156  -18.832 -1.161  1.00 41.06 ? 104  HIS E ND1   1 
ATOM   9031  C  CD2   . HIS G  1 105 ? -2.026  -17.239 -0.181  1.00 41.21 ? 104  HIS E CD2   1 
ATOM   9032  C  CE1   . HIS G  1 105 ? -2.000  -18.725 -1.794  1.00 42.07 ? 104  HIS E CE1   1 
ATOM   9033  N  NE2   . HIS G  1 105 ? -1.296  -17.762 -1.222  1.00 41.92 ? 104  HIS E NE2   1 
ATOM   9034  N  N     . CYS G  1 106 ? -6.408  -18.870 3.080   1.00 38.19 ? 105  CYS E N     1 
ATOM   9035  C  CA    . CYS G  1 106 ? -7.563  -18.513 3.890   1.00 37.98 ? 105  CYS E CA    1 
ATOM   9036  C  C     . CYS G  1 106 ? -8.181  -19.802 4.446   1.00 37.54 ? 105  CYS E C     1 
ATOM   9037  O  O     . CYS G  1 106 ? -9.073  -20.376 3.838   1.00 37.48 ? 105  CYS E O     1 
ATOM   9038  C  CB    . CYS G  1 106 ? -8.576  -17.753 3.019   1.00 38.28 ? 105  CYS E CB    1 
ATOM   9039  S  SG    . CYS G  1 106 ? -7.900  -16.261 2.176   1.00 37.73 ? 105  CYS E SG    1 
ATOM   9040  N  N     . PRO G  1 107 ? -7.674  -20.286 5.580   1.00 37.17 ? 106  PRO E N     1 
ATOM   9041  C  CA    . PRO G  1 107 ? -8.057  -21.611 6.084   1.00 37.25 ? 106  PRO E CA    1 
ATOM   9042  C  C     . PRO G  1 107 ? -9.540  -21.870 6.398   1.00 37.42 ? 106  PRO E C     1 
ATOM   9043  O  O     . PRO G  1 107 ? -9.934  -23.036 6.371   1.00 38.03 ? 106  PRO E O     1 
ATOM   9044  C  CB    . PRO G  1 107 ? -7.201  -21.758 7.350   1.00 37.22 ? 106  PRO E CB    1 
ATOM   9045  C  CG    . PRO G  1 107 ? -6.049  -20.835 7.123   1.00 36.56 ? 106  PRO E CG    1 
ATOM   9046  C  CD    . PRO G  1 107 ? -6.642  -19.669 6.432   1.00 37.13 ? 106  PRO E CD    1 
ATOM   9047  N  N     . HIS G  1 108 ? -10.342 -20.832 6.679   1.00 36.87 ? 107  HIS E N     1 
ATOM   9048  C  CA    . HIS G  1 108 ? -11.768 -21.020 7.041   1.00 36.86 ? 107  HIS E CA    1 
ATOM   9049  C  C     . HIS G  1 108 ? -12.786 -20.028 6.439   1.00 36.76 ? 107  HIS E C     1 
ATOM   9050  O  O     . HIS G  1 108 ? -13.989 -20.141 6.695   1.00 36.91 ? 107  HIS E O     1 
ATOM   9051  C  CB    . HIS G  1 108 ? -11.907 -21.013 8.554   1.00 36.34 ? 107  HIS E CB    1 
ATOM   9052  C  CG    . HIS G  1 108 ? -11.162 -22.122 9.219   1.00 36.03 ? 107  HIS E CG    1 
ATOM   9053  N  ND1   . HIS G  1 108 ? -11.409 -23.447 8.939   1.00 35.76 ? 107  HIS E ND1   1 
ATOM   9054  C  CD2   . HIS G  1 108 ? -10.168 -22.109 10.139  1.00 34.67 ? 107  HIS E CD2   1 
ATOM   9055  C  CE1   . HIS G  1 108 ? -10.618 -24.204 9.676   1.00 36.14 ? 107  HIS E CE1   1 
ATOM   9056  N  NE2   . HIS G  1 108 ? -9.858  -23.416 10.415  1.00 36.25 ? 107  HIS E NE2   1 
ATOM   9057  N  N     . THR G  1 109 ? -12.309 -19.069 5.649   1.00 36.48 ? 108  THR E N     1 
ATOM   9058  C  CA    . THR G  1 109 ? -13.171 -18.127 4.976   1.00 36.39 ? 108  THR E CA    1 
ATOM   9059  C  C     . THR G  1 109 ? -14.246 -18.919 4.227   1.00 36.35 ? 108  THR E C     1 
ATOM   9060  O  O     . THR G  1 109 ? -13.928 -19.880 3.518   1.00 36.30 ? 108  THR E O     1 
ATOM   9061  C  CB    . THR G  1 109 ? -12.381 -17.253 3.961   1.00 36.48 ? 108  THR E CB    1 
ATOM   9062  O  OG1   . THR G  1 109 ? -11.236 -16.677 4.600   1.00 37.68 ? 108  THR E OG1   1 
ATOM   9063  C  CG2   . THR G  1 109 ? -13.254 -16.139 3.376   1.00 36.09 ? 108  THR E CG2   1 
ATOM   9064  N  N     . PRO G  1 110 ? -15.520 -18.517 4.374   1.00 36.11 ? 109  PRO E N     1 
ATOM   9065  C  CA    . PRO G  1 110 ? -16.649 -19.144 3.679   1.00 36.42 ? 109  PRO E CA    1 
ATOM   9066  C  C     . PRO G  1 110 ? -16.389 -19.401 2.203   1.00 36.00 ? 109  PRO E C     1 
ATOM   9067  O  O     . PRO G  1 110 ? -15.966 -18.487 1.496   1.00 35.93 ? 109  PRO E O     1 
ATOM   9068  C  CB    . PRO G  1 110 ? -17.777 -18.109 3.807   1.00 36.31 ? 109  PRO E CB    1 
ATOM   9069  C  CG    . PRO G  1 110 ? -17.418 -17.243 4.883   1.00 37.06 ? 109  PRO E CG    1 
ATOM   9070  C  CD    . PRO G  1 110 ? -15.959 -17.424 5.248   1.00 36.47 ? 109  PRO E CD    1 
ATOM   9071  N  N     . ILE G  1 111 ? -16.635 -20.633 1.756   1.00 36.18 ? 110  ILE E N     1 
ATOM   9072  C  CA    . ILE G  1 111 ? -16.618 -20.981 0.326   1.00 36.40 ? 110  ILE E CA    1 
ATOM   9073  C  C     . ILE G  1 111 ? -18.003 -21.413 -0.134  1.00 36.51 ? 110  ILE E C     1 
ATOM   9074  O  O     . ILE G  1 111 ? -18.653 -22.220 0.517   1.00 35.88 ? 110  ILE E O     1 
ATOM   9075  C  CB    . ILE G  1 111 ? -15.673 -22.168 0.063   1.00 36.44 ? 110  ILE E CB    1 
ATOM   9076  C  CG1   . ILE G  1 111 ? -14.218 -21.739 0.236   1.00 37.12 ? 110  ILE E CG1   1 
ATOM   9077  C  CG2   . ILE G  1 111 ? -15.925 -22.755 -1.325  1.00 37.69 ? 110  ILE E CG2   1 
ATOM   9078  C  CD1   . ILE G  1 111 ? -13.232 -22.924 0.431   1.00 36.23 ? 110  ILE E CD1   1 
ATOM   9079  N  N     . LEU G  1 112 ? -18.475 -20.862 -1.244  1.00 37.09 ? 111  LEU E N     1 
ATOM   9080  C  CA    . LEU G  1 112 ? -19.650 -21.433 -1.915  1.00 37.55 ? 111  LEU E CA    1 
ATOM   9081  C  C     . LEU G  1 112 ? -19.154 -22.165 -3.165  1.00 37.28 ? 111  LEU E C     1 
ATOM   9082  O  O     . LEU G  1 112 ? -18.312 -21.635 -3.895  1.00 37.78 ? 111  LEU E O     1 
ATOM   9083  C  CB    . LEU G  1 112 ? -20.688 -20.355 -2.242  1.00 37.56 ? 111  LEU E CB    1 
ATOM   9084  C  CG    . LEU G  1 112 ? -21.521 -19.764 -1.077  1.00 39.60 ? 111  LEU E CG    1 
ATOM   9085  C  CD1   . LEU G  1 112 ? -20.617 -19.072 -0.060  1.00 41.27 ? 111  LEU E CD1   1 
ATOM   9086  C  CD2   . LEU G  1 112 ? -22.571 -18.761 -1.543  1.00 38.87 ? 111  LEU E CD2   1 
ATOM   9087  N  N     . LEU G  1 113 ? -19.624 -23.399 -3.380  1.00 36.70 ? 112  LEU E N     1 
ATOM   9088  C  CA    . LEU G  1 113 ? -19.286 -24.137 -4.597  1.00 36.12 ? 112  LEU E CA    1 
ATOM   9089  C  C     . LEU G  1 113 ? -20.386 -23.925 -5.624  1.00 35.69 ? 112  LEU E C     1 
ATOM   9090  O  O     . LEU G  1 113 ? -21.545 -24.278 -5.379  1.00 35.65 ? 112  LEU E O     1 
ATOM   9091  C  CB    . LEU G  1 113 ? -19.089 -25.629 -4.323  1.00 35.77 ? 112  LEU E CB    1 
ATOM   9092  C  CG    . LEU G  1 113 ? -18.709 -26.502 -5.518  1.00 35.38 ? 112  LEU E CG    1 
ATOM   9093  C  CD1   . LEU G  1 113 ? -17.322 -26.132 -6.024  1.00 33.32 ? 112  LEU E CD1   1 
ATOM   9094  C  CD2   . LEU G  1 113 ? -18.774 -28.013 -5.138  1.00 36.52 ? 112  LEU E CD2   1 
ATOM   9095  N  N     . VAL G  1 114 ? -20.006 -23.342 -6.759  1.00 35.36 ? 113  VAL E N     1 
ATOM   9096  C  CA    . VAL G  1 114 ? -20.931 -22.945 -7.812  1.00 34.95 ? 113  VAL E CA    1 
ATOM   9097  C  C     . VAL G  1 114 ? -20.719 -23.758 -9.089  1.00 35.50 ? 113  VAL E C     1 
ATOM   9098  O  O     . VAL G  1 114 ? -19.611 -23.808 -9.659  1.00 34.96 ? 113  VAL E O     1 
ATOM   9099  C  CB    . VAL G  1 114 ? -20.805 -21.419 -8.116  1.00 35.12 ? 113  VAL E CB    1 
ATOM   9100  C  CG1   . VAL G  1 114 ? -21.847 -20.957 -9.175  1.00 34.62 ? 113  VAL E CG1   1 
ATOM   9101  C  CG2   . VAL G  1 114 ? -20.969 -20.635 -6.858  1.00 33.51 ? 113  VAL E CG2   1 
ATOM   9102  N  N     . GLY G  1 115 ? -21.787 -24.429 -9.500  1.00 35.89 ? 114  GLY E N     1 
ATOM   9103  C  CA    . GLY G  1 115 ? -21.854 -25.154 -10.754 1.00 36.22 ? 114  GLY E CA    1 
ATOM   9104  C  C     . GLY G  1 115 ? -22.497 -24.255 -11.790 1.00 36.46 ? 114  GLY E C     1 
ATOM   9105  O  O     . GLY G  1 115 ? -23.654 -23.831 -11.633 1.00 36.27 ? 114  GLY E O     1 
ATOM   9106  N  N     . THR G  1 116 ? -21.740 -23.977 -12.850 1.00 36.63 ? 115  THR E N     1 
ATOM   9107  C  CA    . THR G  1 116 ? -22.135 -23.046 -13.891 1.00 36.55 ? 115  THR E CA    1 
ATOM   9108  C  C     . THR G  1 116 ? -22.541 -23.758 -15.179 1.00 36.68 ? 115  THR E C     1 
ATOM   9109  O  O     . THR G  1 116 ? -22.342 -24.964 -15.333 1.00 36.71 ? 115  THR E O     1 
ATOM   9110  C  CB    . THR G  1 116 ? -20.956 -22.137 -14.242 1.00 37.45 ? 115  THR E CB    1 
ATOM   9111  O  OG1   . THR G  1 116 ? -19.911 -22.927 -14.823 1.00 36.90 ? 115  THR E OG1   1 
ATOM   9112  C  CG2   . THR G  1 116 ? -20.424 -21.426 -12.992 1.00 37.10 ? 115  THR E CG2   1 
ATOM   9113  N  N     . LYS G  1 117 ? -23.084 -22.986 -16.112 1.00 36.66 ? 116  LYS E N     1 
ATOM   9114  C  CA    . LYS G  1 117 ? -23.602 -23.499 -17.398 1.00 36.48 ? 116  LYS E CA    1 
ATOM   9115  C  C     . LYS G  1 117 ? -24.689 -24.538 -17.209 1.00 36.50 ? 116  LYS E C     1 
ATOM   9116  O  O     . LYS G  1 117 ? -24.741 -25.533 -17.939 1.00 36.82 ? 116  LYS E O     1 
ATOM   9117  C  CB    . LYS G  1 117 ? -22.492 -24.052 -18.303 1.00 36.48 ? 116  LYS E CB    1 
ATOM   9118  C  CG    . LYS G  1 117 ? -21.305 -23.104 -18.453 1.00 36.55 ? 116  LYS E CG    1 
ATOM   9119  C  CD    . LYS G  1 117 ? -20.352 -23.503 -19.561 1.00 35.87 ? 116  LYS E CD    1 
ATOM   9120  C  CE    . LYS G  1 117 ? -19.129 -22.569 -19.590 1.00 35.59 ? 116  LYS E CE    1 
ATOM   9121  N  NZ    . LYS G  1 117 ? -18.137 -22.891 -20.643 1.00 34.34 ? 116  LYS E NZ    1 
ATOM   9122  N  N     . LEU G  1 118 ? -25.581 -24.276 -16.261 1.00 36.40 ? 117  LEU E N     1 
ATOM   9123  C  CA    . LEU G  1 118 ? -26.698 -25.164 -15.988 1.00 36.46 ? 117  LEU E CA    1 
ATOM   9124  C  C     . LEU G  1 118 ? -27.535 -25.426 -17.252 1.00 36.75 ? 117  LEU E C     1 
ATOM   9125  O  O     . LEU G  1 118 ? -28.088 -26.512 -17.432 1.00 36.30 ? 117  LEU E O     1 
ATOM   9126  C  CB    . LEU G  1 118 ? -27.549 -24.583 -14.859 1.00 36.72 ? 117  LEU E CB    1 
ATOM   9127  C  CG    . LEU G  1 118 ? -28.818 -25.346 -14.425 1.00 36.83 ? 117  LEU E CG    1 
ATOM   9128  C  CD1   . LEU G  1 118 ? -28.501 -26.795 -14.059 1.00 35.02 ? 117  LEU E CD1   1 
ATOM   9129  C  CD2   . LEU G  1 118 ? -29.503 -24.615 -13.278 1.00 35.36 ? 117  LEU E CD2   1 
ATOM   9130  N  N     . ASP G  1 119 ? -27.597 -24.434 -18.137 1.00 37.12 ? 118  ASP E N     1 
ATOM   9131  C  CA    . ASP G  1 119 ? -28.366 -24.555 -19.376 1.00 37.51 ? 118  ASP E CA    1 
ATOM   9132  C  C     . ASP G  1 119 ? -27.844 -25.642 -20.342 1.00 37.90 ? 118  ASP E C     1 
ATOM   9133  O  O     . ASP G  1 119 ? -28.597 -26.144 -21.182 1.00 38.01 ? 118  ASP E O     1 
ATOM   9134  C  CB    . ASP G  1 119 ? -28.413 -23.193 -20.075 1.00 37.70 ? 118  ASP E CB    1 
ATOM   9135  C  CG    . ASP G  1 119 ? -27.031 -22.670 -20.399 1.00 37.62 ? 118  ASP E CG    1 
ATOM   9136  O  OD1   . ASP G  1 119 ? -26.323 -22.213 -19.465 1.00 36.58 ? 118  ASP E OD1   1 
ATOM   9137  O  OD2   . ASP G  1 119 ? -26.646 -22.747 -21.580 1.00 38.27 ? 118  ASP E OD2   1 
ATOM   9138  N  N     . LEU G  1 120 ? -26.568 -26.011 -20.224 1.00 38.38 ? 119  LEU E N     1 
ATOM   9139  C  CA    . LEU G  1 120 ? -25.973 -27.035 -21.089 1.00 38.71 ? 119  LEU E CA    1 
ATOM   9140  C  C     . LEU G  1 120 ? -26.065 -28.439 -20.513 1.00 38.99 ? 119  LEU E C     1 
ATOM   9141  O  O     . LEU G  1 120 ? -25.735 -29.387 -21.209 1.00 38.46 ? 119  LEU E O     1 
ATOM   9142  C  CB    . LEU G  1 120 ? -24.487 -26.732 -21.362 1.00 38.86 ? 119  LEU E CB    1 
ATOM   9143  C  CG    . LEU G  1 120 ? -24.169 -25.419 -22.102 1.00 40.02 ? 119  LEU E CG    1 
ATOM   9144  C  CD1   . LEU G  1 120 ? -22.665 -25.239 -22.239 1.00 37.72 ? 119  LEU E CD1   1 
ATOM   9145  C  CD2   . LEU G  1 120 ? -24.856 -25.377 -23.456 1.00 37.11 ? 119  LEU E CD2   1 
ATOM   9146  N  N     . ARG G  1 121 ? -26.504 -28.593 -19.259 1.00 39.90 ? 120  ARG E N     1 
ATOM   9147  C  CA    . ARG G  1 121 ? -26.509 -29.930 -18.655 1.00 40.72 ? 120  ARG E CA    1 
ATOM   9148  C  C     . ARG G  1 121 ? -27.537 -30.848 -19.309 1.00 41.26 ? 120  ARG E C     1 
ATOM   9149  O  O     . ARG G  1 121 ? -27.291 -32.047 -19.470 1.00 41.08 ? 120  ARG E O     1 
ATOM   9150  C  CB    . ARG G  1 121 ? -26.753 -29.886 -17.160 1.00 41.01 ? 120  ARG E CB    1 
ATOM   9151  C  CG    . ARG G  1 121 ? -26.713 -31.306 -16.554 1.00 41.80 ? 120  ARG E CG    1 
ATOM   9152  C  CD    . ARG G  1 121 ? -26.435 -31.279 -15.080 1.00 41.80 ? 120  ARG E CD    1 
ATOM   9153  N  NE    . ARG G  1 121 ? -27.549 -30.703 -14.313 1.00 42.03 ? 120  ARG E NE    1 
ATOM   9154  C  CZ    . ARG G  1 121 ? -27.509 -30.478 -13.004 1.00 41.14 ? 120  ARG E CZ    1 
ATOM   9155  N  NH1   . ARG G  1 121 ? -26.424 -30.781 -12.299 1.00 40.10 ? 120  ARG E NH1   1 
ATOM   9156  N  NH2   . ARG G  1 121 ? -28.563 -29.973 -12.397 1.00 42.19 ? 120  ARG E NH2   1 
ATOM   9157  N  N     . ASP G  1 122 ? -28.673 -30.257 -19.694 1.00 42.06 ? 121  ASP E N     1 
ATOM   9158  C  CA    . ASP G  1 122 ? -29.746 -30.944 -20.400 1.00 42.79 ? 121  ASP E CA    1 
ATOM   9159  C  C     . ASP G  1 122 ? -29.744 -30.616 -21.902 1.00 43.06 ? 121  ASP E C     1 
ATOM   9160  O  O     . ASP G  1 122 ? -30.755 -30.795 -22.574 1.00 43.49 ? 121  ASP E O     1 
ATOM   9161  C  CB    . ASP G  1 122 ? -31.098 -30.553 -19.787 1.00 43.20 ? 121  ASP E CB    1 
ATOM   9162  N  N     . ASP G  1 123 ? -28.612 -30.146 -22.422 1.00 43.03 ? 122  ASP E N     1 
ATOM   9163  C  CA    . ASP G  1 123 ? -28.458 -29.906 -23.856 1.00 43.13 ? 122  ASP E CA    1 
ATOM   9164  C  C     . ASP G  1 123 ? -28.044 -31.210 -24.534 1.00 43.13 ? 122  ASP E C     1 
ATOM   9165  O  O     . ASP G  1 123 ? -26.951 -31.713 -24.288 1.00 42.57 ? 122  ASP E O     1 
ATOM   9166  C  CB    . ASP G  1 123 ? -27.395 -28.844 -24.101 1.00 43.19 ? 122  ASP E CB    1 
ATOM   9167  C  CG    . ASP G  1 123 ? -27.205 -28.532 -25.566 1.00 43.40 ? 122  ASP E CG    1 
ATOM   9168  O  OD1   . ASP G  1 123 ? -28.161 -27.990 -26.171 1.00 43.24 ? 122  ASP E OD1   1 
ATOM   9169  O  OD2   . ASP G  1 123 ? -26.095 -28.794 -26.096 1.00 42.01 ? 122  ASP E OD2   1 
ATOM   9170  N  N     . LYS G  1 124 ? -28.938 -31.736 -25.375 1.00 43.13 ? 123  LYS E N     1 
ATOM   9171  C  CA    . LYS G  1 124 ? -28.781 -33.034 -26.038 1.00 43.06 ? 123  LYS E CA    1 
ATOM   9172  C  C     . LYS G  1 124 ? -27.419 -33.155 -26.715 1.00 42.65 ? 123  LYS E C     1 
ATOM   9173  O  O     . LYS G  1 124 ? -26.721 -34.148 -26.545 1.00 42.88 ? 123  LYS E O     1 
ATOM   9174  C  CB    . LYS G  1 124 ? -29.886 -33.211 -27.092 1.00 42.86 ? 123  LYS E CB    1 
ATOM   9175  C  CG    . LYS G  1 124 ? -30.004 -34.603 -27.676 1.00 44.15 ? 123  LYS E CG    1 
ATOM   9176  C  CD    . LYS G  1 124 ? -30.166 -34.576 -29.206 1.00 46.15 ? 123  LYS E CD    1 
ATOM   9177  N  N     . ASP G  1 125 ? -27.049 -32.151 -27.496 1.00 42.35 ? 124  ASP E N     1 
ATOM   9178  C  CA    . ASP G  1 125 ? -25.764 -32.178 -28.192 1.00 42.47 ? 124  ASP E CA    1 
ATOM   9179  C  C     . ASP G  1 125 ? -24.551 -32.225 -27.240 1.00 42.11 ? 124  ASP E C     1 
ATOM   9180  O  O     . ASP G  1 125 ? -23.591 -32.968 -27.489 1.00 42.04 ? 124  ASP E O     1 
ATOM   9181  C  CB    . ASP G  1 125 ? -25.658 -31.001 -29.150 1.00 42.48 ? 124  ASP E CB    1 
ATOM   9182  C  CG    . ASP G  1 125 ? -26.528 -31.176 -30.415 1.00 44.56 ? 124  ASP E CG    1 
ATOM   9183  O  OD1   . ASP G  1 125 ? -27.353 -32.130 -30.483 1.00 45.72 ? 124  ASP E OD1   1 
ATOM   9184  O  OD2   . ASP G  1 125 ? -26.364 -30.345 -31.349 1.00 46.17 ? 124  ASP E OD2   1 
ATOM   9185  N  N     . THR G  1 126 ? -24.597 -31.450 -26.160 1.00 41.20 ? 125  THR E N     1 
ATOM   9186  C  CA    . THR G  1 126 ? -23.525 -31.467 -25.151 1.00 40.88 ? 125  THR E CA    1 
ATOM   9187  C  C     . THR G  1 126 ? -23.464 -32.818 -24.447 1.00 40.74 ? 125  THR E C     1 
ATOM   9188  O  O     . THR G  1 126 ? -22.391 -33.308 -24.117 1.00 40.75 ? 125  THR E O     1 
ATOM   9189  C  CB    . THR G  1 126 ? -23.715 -30.363 -24.104 1.00 40.80 ? 125  THR E CB    1 
ATOM   9190  O  OG1   . THR G  1 126 ? -23.777 -29.082 -24.757 1.00 40.59 ? 125  THR E OG1   1 
ATOM   9191  C  CG2   . THR G  1 126 ? -22.580 -30.375 -23.087 1.00 39.69 ? 125  THR E CG2   1 
ATOM   9192  N  N     . ILE G  1 127 ? -24.619 -33.426 -24.225 1.00 40.64 ? 126  ILE E N     1 
ATOM   9193  C  CA    . ILE G  1 127 ? -24.668 -34.727 -23.588 1.00 40.76 ? 126  ILE E CA    1 
ATOM   9194  C  C     . ILE G  1 127 ? -23.987 -35.748 -24.497 1.00 40.67 ? 126  ILE E C     1 
ATOM   9195  O  O     . ILE G  1 127 ? -23.176 -36.541 -24.035 1.00 40.62 ? 126  ILE E O     1 
ATOM   9196  C  CB    . ILE G  1 127 ? -26.125 -35.141 -23.267 1.00 40.82 ? 126  ILE E CB    1 
ATOM   9197  C  CG1   . ILE G  1 127 ? -26.671 -34.287 -22.114 1.00 41.07 ? 126  ILE E CG1   1 
ATOM   9198  C  CG2   . ILE G  1 127 ? -26.202 -36.638 -22.918 1.00 40.61 ? 126  ILE E CG2   1 
ATOM   9199  C  CD1   . ILE G  1 127 ? -28.192 -34.486 -21.816 1.00 40.95 ? 126  ILE E CD1   1 
ATOM   9200  N  N     . GLU G  1 128 ? -24.304 -35.697 -25.790 1.00 41.08 ? 127  GLU E N     1 
ATOM   9201  C  CA    . GLU G  1 128 ? -23.752 -36.617 -26.793 1.00 41.15 ? 127  GLU E CA    1 
ATOM   9202  C  C     . GLU G  1 128 ? -22.242 -36.457 -26.986 1.00 41.15 ? 127  GLU E C     1 
ATOM   9203  O  O     . GLU G  1 128 ? -21.511 -37.439 -27.012 1.00 40.76 ? 127  GLU E O     1 
ATOM   9204  C  CB    . GLU G  1 128 ? -24.458 -36.430 -28.138 1.00 41.24 ? 127  GLU E CB    1 
ATOM   9205  N  N     . ARG G  1 129 ? -21.784 -35.224 -27.127 1.00 41.20 ? 128  ARG E N     1 
ATOM   9206  C  CA    . ARG G  1 129 ? -20.357 -34.964 -27.261 1.00 41.90 ? 128  ARG E CA    1 
ATOM   9207  C  C     . ARG G  1 129 ? -19.536 -35.413 -26.055 1.00 42.08 ? 128  ARG E C     1 
ATOM   9208  O  O     . ARG G  1 129 ? -18.388 -35.836 -26.221 1.00 42.64 ? 128  ARG E O     1 
ATOM   9209  C  CB    . ARG G  1 129 ? -20.093 -33.482 -27.482 1.00 42.22 ? 128  ARG E CB    1 
ATOM   9210  C  CG    . ARG G  1 129 ? -20.621 -32.951 -28.784 1.00 43.38 ? 128  ARG E CG    1 
ATOM   9211  C  CD    . ARG G  1 129 ? -20.324 -31.463 -28.902 1.00 45.91 ? 128  ARG E CD    1 
ATOM   9212  N  NE    . ARG G  1 129 ? -21.305 -30.840 -29.772 1.00 47.86 ? 128  ARG E NE    1 
ATOM   9213  C  CZ    . ARG G  1 129 ? -22.128 -29.850 -29.436 1.00 48.22 ? 128  ARG E CZ    1 
ATOM   9214  N  NH1   . ARG G  1 129 ? -22.106 -29.268 -28.231 1.00 46.54 ? 128  ARG E NH1   1 
ATOM   9215  N  NH2   . ARG G  1 129 ? -22.975 -29.421 -30.359 1.00 49.85 ? 128  ARG E NH2   1 
ATOM   9216  N  N     . LEU G  1 130 ? -20.086 -35.279 -24.848 1.00 42.00 ? 129  LEU E N     1 
ATOM   9217  C  CA    . LEU G  1 130 ? -19.423 -35.827 -23.651 1.00 42.13 ? 129  LEU E CA    1 
ATOM   9218  C  C     . LEU G  1 130 ? -19.459 -37.360 -23.668 1.00 42.44 ? 129  LEU E C     1 
ATOM   9219  O  O     . LEU G  1 130 ? -18.492 -38.016 -23.292 1.00 42.35 ? 129  LEU E O     1 
ATOM   9220  C  CB    . LEU G  1 130 ? -20.059 -35.291 -22.356 1.00 42.21 ? 129  LEU E CB    1 
ATOM   9221  C  CG    . LEU G  1 130 ? -19.666 -33.851 -21.977 1.00 41.29 ? 129  LEU E CG    1 
ATOM   9222  C  CD1   . LEU G  1 130 ? -20.634 -33.297 -20.969 1.00 39.06 ? 129  LEU E CD1   1 
ATOM   9223  C  CD2   . LEU G  1 130 ? -18.231 -33.769 -21.453 1.00 40.37 ? 129  LEU E CD2   1 
ATOM   9224  N  N     . ARG G  1 131 ? -20.580 -37.919 -24.119 1.00 42.86 ? 130  ARG E N     1 
ATOM   9225  C  CA    . ARG G  1 131 ? -20.746 -39.361 -24.221 1.00 43.43 ? 130  ARG E CA    1 
ATOM   9226  C  C     . ARG G  1 131 ? -19.715 -39.961 -25.178 1.00 43.92 ? 130  ARG E C     1 
ATOM   9227  O  O     . ARG G  1 131 ? -19.218 -41.062 -24.940 1.00 44.36 ? 130  ARG E O     1 
ATOM   9228  C  CB    . ARG G  1 131 ? -22.177 -39.712 -24.664 1.00 43.45 ? 130  ARG E CB    1 
ATOM   9229  C  CG    . ARG G  1 131 ? -22.531 -41.191 -24.545 1.00 43.93 ? 130  ARG E CG    1 
ATOM   9230  C  CD    . ARG G  1 131 ? -23.857 -41.516 -25.232 1.00 43.83 ? 130  ARG E CD    1 
ATOM   9231  N  N     . ASP G  1 132 ? -19.379 -39.238 -26.245 1.00 44.59 ? 131  ASP E N     1 
ATOM   9232  C  CA    . ASP G  1 132 ? -18.334 -39.687 -27.174 1.00 45.17 ? 131  ASP E CA    1 
ATOM   9233  C  C     . ASP G  1 132 ? -16.979 -39.832 -26.479 1.00 44.81 ? 131  ASP E C     1 
ATOM   9234  O  O     . ASP G  1 132 ? -16.233 -40.780 -26.741 1.00 45.19 ? 131  ASP E O     1 
ATOM   9235  C  CB    . ASP G  1 132 ? -18.179 -38.713 -28.339 1.00 45.76 ? 131  ASP E CB    1 
ATOM   9236  C  CG    . ASP G  1 132 ? -19.396 -38.678 -29.247 1.00 47.85 ? 131  ASP E CG    1 
ATOM   9237  O  OD1   . ASP G  1 132 ? -20.215 -39.626 -29.194 1.00 49.42 ? 131  ASP E OD1   1 
ATOM   9238  O  OD2   . ASP G  1 132 ? -19.513 -37.691 -30.027 1.00 51.07 ? 131  ASP E OD2   1 
ATOM   9239  N  N     . LYS G  1 133 ? -16.673 -38.898 -25.588 1.00 44.24 ? 132  LYS E N     1 
ATOM   9240  C  CA    . LYS G  1 133 ? -15.452 -38.951 -24.786 1.00 43.83 ? 132  LYS E CA    1 
ATOM   9241  C  C     . LYS G  1 133 ? -15.560 -39.777 -23.486 1.00 43.43 ? 132  LYS E C     1 
ATOM   9242  O  O     . LYS G  1 133 ? -14.657 -39.740 -22.656 1.00 43.79 ? 132  LYS E O     1 
ATOM   9243  C  CB    . LYS G  1 133 ? -15.006 -37.523 -24.473 1.00 43.82 ? 132  LYS E CB    1 
ATOM   9244  C  CG    . LYS G  1 133 ? -14.500 -36.773 -25.700 1.00 44.26 ? 132  LYS E CG    1 
ATOM   9245  N  N     . LYS G  1 134 ? -16.650 -40.510 -23.295 1.00 42.77 ? 133  LYS E N     1 
ATOM   9246  C  CA    . LYS G  1 134 ? -16.794 -41.368 -22.119 1.00 42.56 ? 133  LYS E CA    1 
ATOM   9247  C  C     . LYS G  1 134 ? -17.057 -40.585 -20.816 1.00 42.22 ? 133  LYS E C     1 
ATOM   9248  O  O     . LYS G  1 134 ? -16.865 -41.112 -19.712 1.00 41.89 ? 133  LYS E O     1 
ATOM   9249  C  CB    . LYS G  1 134 ? -15.553 -42.279 -21.974 1.00 42.95 ? 133  LYS E CB    1 
ATOM   9250  N  N     . LEU G  1 135 ? -17.539 -39.347 -20.965 1.00 41.69 ? 134  LEU E N     1 
ATOM   9251  C  CA    . LEU G  1 135 ? -17.829 -38.444 -19.854 1.00 40.98 ? 134  LEU E CA    1 
ATOM   9252  C  C     . LEU G  1 135 ? -19.336 -38.144 -19.796 1.00 40.58 ? 134  LEU E C     1 
ATOM   9253  O  O     . LEU G  1 135 ? -20.081 -38.458 -20.729 1.00 41.16 ? 134  LEU E O     1 
ATOM   9254  C  CB    . LEU G  1 135 ? -17.058 -37.136 -20.039 1.00 41.08 ? 134  LEU E CB    1 
ATOM   9255  C  CG    . LEU G  1 135 ? -15.523 -37.250 -20.127 1.00 40.85 ? 134  LEU E CG    1 
ATOM   9256  C  CD1   . LEU G  1 135 ? -14.913 -35.941 -20.535 1.00 41.63 ? 134  LEU E CD1   1 
ATOM   9257  C  CD2   . LEU G  1 135 ? -14.930 -37.700 -18.816 1.00 41.53 ? 134  LEU E CD2   1 
ATOM   9258  N  N     . ALA G  1 136 ? -19.783 -37.537 -18.704 1.00 39.57 ? 135  ALA E N     1 
ATOM   9259  C  CA    . ALA G  1 136 ? -21.169 -37.107 -18.576 1.00 39.01 ? 135  ALA E CA    1 
ATOM   9260  C  C     . ALA G  1 136 ? -21.198 -35.805 -17.795 1.00 38.40 ? 135  ALA E C     1 
ATOM   9261  O  O     . ALA G  1 136 ? -20.263 -35.507 -17.063 1.00 38.37 ? 135  ALA E O     1 
ATOM   9262  C  CB    . ALA G  1 136 ? -21.992 -38.170 -17.872 1.00 39.11 ? 135  ALA E CB    1 
ATOM   9263  N  N     . PRO G  1 137 ? -22.268 -35.020 -17.936 1.00 37.47 ? 136  PRO E N     1 
ATOM   9264  C  CA    . PRO G  1 137 ? -22.327 -33.845 -17.085 1.00 37.37 ? 136  PRO E CA    1 
ATOM   9265  C  C     . PRO G  1 137 ? -22.297 -34.199 -15.596 1.00 37.19 ? 136  PRO E C     1 
ATOM   9266  O  O     . PRO G  1 137 ? -22.644 -35.340 -15.211 1.00 36.78 ? 136  PRO E O     1 
ATOM   9267  C  CB    . PRO G  1 137 ? -23.683 -33.219 -17.452 1.00 37.27 ? 136  PRO E CB    1 
ATOM   9268  C  CG    . PRO G  1 137 ? -23.966 -33.699 -18.808 1.00 36.95 ? 136  PRO E CG    1 
ATOM   9269  C  CD    . PRO G  1 137 ? -23.441 -35.105 -18.821 1.00 37.67 ? 136  PRO E CD    1 
ATOM   9270  N  N     . ILE G  1 138 ? -21.886 -33.223 -14.777 1.00 36.65 ? 137  ILE E N     1 
ATOM   9271  C  CA    . ILE G  1 138 ? -21.953 -33.357 -13.323 1.00 36.31 ? 137  ILE E CA    1 
ATOM   9272  C  C     . ILE G  1 138 ? -23.391 -33.219 -12.847 1.00 35.99 ? 137  ILE E C     1 
ATOM   9273  O  O     . ILE G  1 138 ? -24.077 -32.278 -13.227 1.00 35.45 ? 137  ILE E O     1 
ATOM   9274  C  CB    . ILE G  1 138 ? -21.067 -32.308 -12.605 1.00 36.29 ? 137  ILE E CB    1 
ATOM   9275  C  CG1   . ILE G  1 138 ? -19.596 -32.447 -13.048 1.00 36.95 ? 137  ILE E CG1   1 
ATOM   9276  C  CG2   . ILE G  1 138 ? -21.223 -32.419 -11.090 1.00 36.20 ? 137  ILE E CG2   1 
ATOM   9277  C  CD1   . ILE G  1 138 ? -19.101 -33.893 -13.150 1.00 39.49 ? 137  ILE E CD1   1 
ATOM   9278  N  N     . THR G  1 139 ? -23.820 -34.164 -12.007 1.00 36.00 ? 138  THR E N     1 
ATOM   9279  C  CA    . THR G  1 139 ? -25.185 -34.230 -11.516 1.00 36.52 ? 138  THR E CA    1 
ATOM   9280  C  C     . THR G  1 139 ? -25.259 -33.461 -10.206 1.00 37.07 ? 138  THR E C     1 
ATOM   9281  O  O     . THR G  1 139 ? -24.233 -33.187 -9.583  1.00 37.02 ? 138  THR E O     1 
ATOM   9282  C  CB    . THR G  1 139 ? -25.633 -35.678 -11.256 1.00 36.42 ? 138  THR E CB    1 
ATOM   9283  O  OG1   . THR G  1 139 ? -24.902 -36.196 -10.146 1.00 36.46 ? 138  THR E OG1   1 
ATOM   9284  C  CG2   . THR G  1 139 ? -25.388 -36.565 -12.459 1.00 36.58 ? 138  THR E CG2   1 
ATOM   9285  N  N     . TYR G  1 140 ? -26.474 -33.116 -9.785  1.00 37.91 ? 139  TYR E N     1 
ATOM   9286  C  CA    . TYR G  1 140 ? -26.643 -32.358 -8.564  1.00 38.52 ? 139  TYR E CA    1 
ATOM   9287  C  C     . TYR G  1 140 ? -26.061 -33.105 -7.354  1.00 38.58 ? 139  TYR E C     1 
ATOM   9288  O  O     . TYR G  1 140 ? -25.330 -32.496 -6.563  1.00 38.90 ? 139  TYR E O     1 
ATOM   9289  C  CB    . TYR G  1 140 ? -28.109 -32.003 -8.333  1.00 39.67 ? 139  TYR E CB    1 
ATOM   9290  C  CG    . TYR G  1 140 ? -28.322 -31.258 -7.059  1.00 40.78 ? 139  TYR E CG    1 
ATOM   9291  C  CD1   . TYR G  1 140 ? -28.715 -31.913 -5.899  1.00 42.82 ? 139  TYR E CD1   1 
ATOM   9292  C  CD2   . TYR G  1 140 ? -28.104 -29.899 -7.001  1.00 41.69 ? 139  TYR E CD2   1 
ATOM   9293  C  CE1   . TYR G  1 140 ? -28.905 -31.205 -4.705  1.00 43.04 ? 139  TYR E CE1   1 
ATOM   9294  C  CE2   . TYR G  1 140 ? -28.283 -29.188 -5.836  1.00 42.51 ? 139  TYR E CE2   1 
ATOM   9295  C  CZ    . TYR G  1 140 ? -28.683 -29.837 -4.693  1.00 42.34 ? 139  TYR E CZ    1 
ATOM   9296  O  OH    . TYR G  1 140 ? -28.842 -29.106 -3.543  1.00 44.46 ? 139  TYR E OH    1 
ATOM   9297  N  N     . PRO G  1 141 ? -26.384 -34.411 -7.199  1.00 38.06 ? 140  PRO E N     1 
ATOM   9298  C  CA    . PRO G  1 141 ? -25.798 -35.162 -6.073  1.00 38.17 ? 140  PRO E CA    1 
ATOM   9299  C  C     . PRO G  1 141 ? -24.269 -35.178 -6.024  1.00 37.78 ? 140  PRO E C     1 
ATOM   9300  O  O     . PRO G  1 141 ? -23.703 -35.151 -4.920  1.00 38.00 ? 140  PRO E O     1 
ATOM   9301  C  CB    . PRO G  1 141 ? -26.325 -36.589 -6.272  1.00 37.93 ? 140  PRO E CB    1 
ATOM   9302  C  CG    . PRO G  1 141 ? -27.583 -36.421 -7.069  1.00 38.84 ? 140  PRO E CG    1 
ATOM   9303  C  CD    . PRO G  1 141 ? -27.321 -35.246 -7.977  1.00 38.27 ? 140  PRO E CD    1 
ATOM   9304  N  N     . GLN G  1 142 ? -23.616 -35.228 -7.184  1.00 37.41 ? 141  GLN E N     1 
ATOM   9305  C  CA    . GLN G  1 142 ? -22.135 -35.225 -7.243  1.00 37.50 ? 141  GLN E CA    1 
ATOM   9306  C  C     . GLN G  1 142 ? -21.565 -33.893 -6.817  1.00 37.26 ? 141  GLN E C     1 
ATOM   9307  O  O     . GLN G  1 142 ? -20.554 -33.836 -6.114  1.00 37.21 ? 141  GLN E O     1 
ATOM   9308  C  CB    . GLN G  1 142 ? -21.640 -35.511 -8.648  1.00 37.77 ? 141  GLN E CB    1 
ATOM   9309  C  CG    . GLN G  1 142 ? -21.810 -36.938 -9.106  1.00 39.12 ? 141  GLN E CG    1 
ATOM   9310  C  CD    . GLN G  1 142 ? -21.394 -37.120 -10.546 1.00 40.85 ? 141  GLN E CD    1 
ATOM   9311  O  OE1   . GLN G  1 142 ? -21.743 -36.333 -11.421 1.00 41.32 ? 141  GLN E OE1   1 
ATOM   9312  N  NE2   . GLN G  1 142 ? -20.661 -38.182 -10.802 1.00 46.17 ? 141  GLN E NE2   1 
ATOM   9313  N  N     . GLY G  1 143 ? -22.208 -32.819 -7.272  1.00 37.73 ? 142  GLY E N     1 
ATOM   9314  C  CA    . GLY G  1 143 ? -21.841 -31.475 -6.866  1.00 37.88 ? 142  GLY E CA    1 
ATOM   9315  C  C     . GLY G  1 143 ? -21.949 -31.307 -5.363  1.00 38.05 ? 142  GLY E C     1 
ATOM   9316  O  O     . GLY G  1 143 ? -21.076 -30.726 -4.738  1.00 37.68 ? 142  GLY E O     1 
ATOM   9317  N  N     . LEU G  1 144 ? -23.036 -31.812 -4.789  1.00 38.60 ? 143  LEU E N     1 
ATOM   9318  C  CA    . LEU G  1 144 ? -23.271 -31.706 -3.351  1.00 39.01 ? 143  LEU E CA    1 
ATOM   9319  C  C     . LEU G  1 144 ? -22.223 -32.493 -2.556  1.00 38.38 ? 143  LEU E C     1 
ATOM   9320  O  O     . LEU G  1 144 ? -21.665 -31.997 -1.592  1.00 38.54 ? 143  LEU E O     1 
ATOM   9321  C  CB    . LEU G  1 144 ? -24.693 -32.196 -3.027  1.00 39.63 ? 143  LEU E CB    1 
ATOM   9322  C  CG    . LEU G  1 144 ? -25.278 -31.915 -1.640  1.00 41.23 ? 143  LEU E CG    1 
ATOM   9323  C  CD1   . LEU G  1 144 ? -25.323 -30.391 -1.312  1.00 41.22 ? 143  LEU E CD1   1 
ATOM   9324  C  CD2   . LEU G  1 144 ? -26.664 -32.551 -1.536  1.00 40.21 ? 143  LEU E CD2   1 
ATOM   9325  N  N     . ALA G  1 145 ? -21.945 -33.718 -2.977  1.00 38.27 ? 144  ALA E N     1 
ATOM   9326  C  CA    . ALA G  1 145 ? -20.857 -34.502 -2.391  1.00 37.96 ? 144  ALA E CA    1 
ATOM   9327  C  C     . ALA G  1 145 ? -19.528 -33.729 -2.451  1.00 37.86 ? 144  ALA E C     1 
ATOM   9328  O  O     . ALA G  1 145 ? -18.770 -33.682 -1.471  1.00 37.21 ? 144  ALA E O     1 
ATOM   9329  C  CB    . ALA G  1 145 ? -20.740 -35.858 -3.090  1.00 37.88 ? 144  ALA E CB    1 
ATOM   9330  N  N     . MET G  1 146 ? -19.247 -33.100 -3.586  1.00 37.88 ? 145  MET E N     1 
ATOM   9331  C  CA    . MET G  1 146 ? -18.024 -32.313 -3.688  1.00 38.33 ? 145  MET E CA    1 
ATOM   9332  C  C     . MET G  1 146 ? -18.069 -31.122 -2.704  1.00 37.84 ? 145  MET E C     1 
ATOM   9333  O  O     . MET G  1 146 ? -17.072 -30.827 -2.047  1.00 37.51 ? 145  MET E O     1 
ATOM   9334  C  CB    . MET G  1 146 ? -17.779 -31.846 -5.137  1.00 38.70 ? 145  MET E CB    1 
ATOM   9335  C  CG    . MET G  1 146 ? -16.517 -30.970 -5.339  1.00 38.54 ? 145  MET E CG    1 
ATOM   9336  S  SD    . MET G  1 146 ? -14.959 -31.870 -5.115  1.00 37.07 ? 145  MET E SD    1 
ATOM   9337  C  CE    . MET G  1 146 ? -14.864 -32.804 -6.646  1.00 38.78 ? 145  MET E CE    1 
ATOM   9338  N  N     . ALA G  1 147 ? -19.223 -30.469 -2.598  1.00 37.63 ? 146  ALA E N     1 
ATOM   9339  C  CA    . ALA G  1 147 ? -19.394 -29.324 -1.676  1.00 38.34 ? 146  ALA E CA    1 
ATOM   9340  C  C     . ALA G  1 147 ? -19.011 -29.698 -0.242  1.00 38.53 ? 146  ALA E C     1 
ATOM   9341  O  O     . ALA G  1 147 ? -18.328 -28.950 0.444   1.00 37.63 ? 146  ALA E O     1 
ATOM   9342  C  CB    . ALA G  1 147 ? -20.813 -28.805 -1.716  1.00 37.72 ? 146  ALA E CB    1 
ATOM   9343  N  N     . ARG G  1 148 ? -19.440 -30.885 0.172   1.00 39.33 ? 147  ARG E N     1 
ATOM   9344  C  CA    . ARG G  1 148 ? -19.173 -31.403 1.514   1.00 39.85 ? 147  ARG E CA    1 
ATOM   9345  C  C     . ARG G  1 148 ? -17.717 -31.743 1.746   1.00 39.64 ? 147  ARG E C     1 
ATOM   9346  O  O     . ARG G  1 148 ? -17.153 -31.466 2.815   1.00 39.14 ? 147  ARG E O     1 
ATOM   9347  C  CB    . ARG G  1 148 ? -20.044 -32.631 1.772   1.00 39.98 ? 147  ARG E CB    1 
ATOM   9348  C  CG    . ARG G  1 148 ? -21.468 -32.239 1.974   1.00 41.74 ? 147  ARG E CG    1 
ATOM   9349  C  CD    . ARG G  1 148 ? -22.455 -33.382 1.940   1.00 47.98 ? 147  ARG E CD    1 
ATOM   9350  N  NE    . ARG G  1 148 ? -23.807 -32.822 2.096   1.00 51.39 ? 147  ARG E NE    1 
ATOM   9351  C  CZ    . ARG G  1 148 ? -24.951 -33.493 1.958   1.00 53.36 ? 147  ARG E CZ    1 
ATOM   9352  N  NH1   . ARG G  1 148 ? -24.951 -34.785 1.649   1.00 53.83 ? 147  ARG E NH1   1 
ATOM   9353  N  NH2   . ARG G  1 148 ? -26.110 -32.855 2.129   1.00 53.42 ? 147  ARG E NH2   1 
ATOM   9354  N  N     . GLU G  1 149 ? -17.119 -32.354 0.738   1.00 39.54 ? 148  GLU E N     1 
ATOM   9355  C  CA    . GLU G  1 149 ? -15.719 -32.710 0.771   1.00 39.73 ? 148  GLU E CA    1 
ATOM   9356  C  C     . GLU G  1 149 ? -14.808 -31.507 1.020   1.00 39.17 ? 148  GLU E C     1 
ATOM   9357  O  O     . GLU G  1 149 ? -13.790 -31.621 1.695   1.00 38.22 ? 148  GLU E O     1 
ATOM   9358  C  CB    . GLU G  1 149 ? -15.343 -33.361 -0.553  1.00 39.86 ? 148  GLU E CB    1 
ATOM   9359  C  CG    . GLU G  1 149 ? -14.053 -34.116 -0.504  1.00 42.30 ? 148  GLU E CG    1 
ATOM   9360  C  CD    . GLU G  1 149 ? -13.658 -34.643 -1.862  1.00 43.95 ? 148  GLU E CD    1 
ATOM   9361  O  OE1   . GLU G  1 149 ? -14.491 -35.341 -2.483  1.00 44.42 ? 148  GLU E OE1   1 
ATOM   9362  O  OE2   . GLU G  1 149 ? -12.535 -34.311 -2.304  1.00 45.47 ? 148  GLU E OE2   1 
ATOM   9363  N  N     . ILE G  1 150 ? -15.176 -30.353 0.465   1.00 39.16 ? 149  ILE E N     1 
ATOM   9364  C  CA    . ILE G  1 150 ? -14.352 -29.163 0.586   1.00 38.72 ? 149  ILE E CA    1 
ATOM   9365  C  C     . ILE G  1 150 ? -14.822 -28.202 1.682   1.00 38.99 ? 149  ILE E C     1 
ATOM   9366  O  O     . ILE G  1 150 ? -14.227 -27.128 1.843   1.00 38.99 ? 149  ILE E O     1 
ATOM   9367  C  CB    . ILE G  1 150 ? -14.194 -28.421 -0.785  1.00 38.89 ? 149  ILE E CB    1 
ATOM   9368  C  CG1   . ILE G  1 150 ? -15.514 -27.788 -1.257  1.00 38.47 ? 149  ILE E CG1   1 
ATOM   9369  C  CG2   . ILE G  1 150 ? -13.653 -29.371 -1.832  1.00 38.02 ? 149  ILE E CG2   1 
ATOM   9370  C  CD1   . ILE G  1 150 ? -15.346 -26.664 -2.300  1.00 38.57 ? 149  ILE E CD1   1 
ATOM   9371  N  N     . GLY G  1 151 ? -15.864 -28.578 2.435   1.00 38.64 ? 150  GLY E N     1 
ATOM   9372  C  CA    . GLY G  1 151 ? -16.346 -27.762 3.560   1.00 38.36 ? 150  GLY E CA    1 
ATOM   9373  C  C     . GLY G  1 151 ? -17.030 -26.474 3.143   1.00 37.89 ? 150  GLY E C     1 
ATOM   9374  O  O     . GLY G  1 151 ? -16.876 -25.429 3.756   1.00 37.66 ? 150  GLY E O     1 
ATOM   9375  N  N     . SER G  1 152 ? -17.809 -26.574 2.092   1.00 37.94 ? 151  SER E N     1 
ATOM   9376  C  CA    . SER G  1 152 ? -18.514 -25.450 1.506   1.00 38.44 ? 151  SER E CA    1 
ATOM   9377  C  C     . SER G  1 152 ? -19.747 -25.086 2.358   1.00 38.39 ? 151  SER E C     1 
ATOM   9378  O  O     . SER G  1 152 ? -20.349 -25.965 2.990   1.00 37.74 ? 151  SER E O     1 
ATOM   9379  C  CB    . SER G  1 152 ? -18.928 -25.914 0.107   1.00 38.54 ? 151  SER E CB    1 
ATOM   9380  O  OG    . SER G  1 152 ? -19.619 -24.946 -0.613  1.00 41.67 ? 151  SER E OG    1 
ATOM   9381  N  N     . VAL G  1 153 ? -20.120 -23.801 2.377   1.00 38.43 ? 152  VAL E N     1 
ATOM   9382  C  CA    . VAL G  1 153 ? -21.392 -23.363 2.978   1.00 38.39 ? 152  VAL E CA    1 
ATOM   9383  C  C     . VAL G  1 153 ? -22.619 -23.905 2.204   1.00 39.03 ? 152  VAL E C     1 
ATOM   9384  O  O     . VAL G  1 153 ? -23.657 -24.245 2.785   1.00 38.57 ? 152  VAL E O     1 
ATOM   9385  C  CB    . VAL G  1 153 ? -21.526 -21.804 3.018   1.00 38.23 ? 152  VAL E CB    1 
ATOM   9386  C  CG1   . VAL G  1 153 ? -22.850 -21.390 3.638   1.00 38.25 ? 152  VAL E CG1   1 
ATOM   9387  C  CG2   . VAL G  1 153 ? -20.389 -21.146 3.766   1.00 37.41 ? 152  VAL E CG2   1 
ATOM   9388  N  N     . LYS G  1 154 ? -22.499 -23.973 0.890   1.00 39.37 ? 153  LYS E N     1 
ATOM   9389  C  CA    . LYS G  1 154 ? -23.657 -24.214 0.038   1.00 39.73 ? 153  LYS E CA    1 
ATOM   9390  C  C     . LYS G  1 154 ? -23.133 -24.664 -1.298  1.00 39.11 ? 153  LYS E C     1 
ATOM   9391  O  O     . LYS G  1 154 ? -22.067 -24.210 -1.718  1.00 39.29 ? 153  LYS E O     1 
ATOM   9392  C  CB    . LYS G  1 154 ? -24.434 -22.902 -0.172  1.00 40.37 ? 153  LYS E CB    1 
ATOM   9393  C  CG    . LYS G  1 154 ? -25.926 -22.964 0.104   1.00 41.78 ? 153  LYS E CG    1 
ATOM   9394  C  CD    . LYS G  1 154 ? -26.214 -22.689 1.582   1.00 43.52 ? 153  LYS E CD    1 
ATOM   9395  N  N     . TYR G  1 155 ? -23.870 -25.562 -1.942  1.00 38.44 ? 154  TYR E N     1 
ATOM   9396  C  CA    . TYR G  1 155 ? -23.643 -25.927 -3.311  1.00 38.37 ? 154  TYR E CA    1 
ATOM   9397  C  C     . TYR G  1 155 ? -24.773 -25.349 -4.122  1.00 38.39 ? 154  TYR E C     1 
ATOM   9398  O  O     . TYR G  1 155 ? -25.960 -25.578 -3.823  1.00 38.43 ? 154  TYR E O     1 
ATOM   9399  C  CB    . TYR G  1 155 ? -23.623 -27.442 -3.498  1.00 39.22 ? 154  TYR E CB    1 
ATOM   9400  C  CG    . TYR G  1 155 ? -23.659 -27.843 -4.961  1.00 39.35 ? 154  TYR E CG    1 
ATOM   9401  C  CD1   . TYR G  1 155 ? -22.665 -27.424 -5.834  1.00 40.00 ? 154  TYR E CD1   1 
ATOM   9402  C  CD2   . TYR G  1 155 ? -24.702 -28.607 -5.470  1.00 40.53 ? 154  TYR E CD2   1 
ATOM   9403  C  CE1   . TYR G  1 155 ? -22.690 -27.776 -7.171  1.00 40.01 ? 154  TYR E CE1   1 
ATOM   9404  C  CE2   . TYR G  1 155 ? -24.739 -28.957 -6.812  1.00 40.93 ? 154  TYR E CE2   1 
ATOM   9405  C  CZ    . TYR G  1 155 ? -23.730 -28.538 -7.653  1.00 40.07 ? 154  TYR E CZ    1 
ATOM   9406  O  OH    . TYR G  1 155 ? -23.762 -28.887 -8.977  1.00 40.24 ? 154  TYR E OH    1 
ATOM   9407  N  N     . LEU G  1 156 ? -24.411 -24.590 -5.148  1.00 38.13 ? 155  LEU E N     1 
ATOM   9408  C  CA    . LEU G  1 156 ? -25.377 -23.861 -5.962  1.00 37.89 ? 155  LEU E CA    1 
ATOM   9409  C  C     . LEU G  1 156 ? -25.075 -24.058 -7.435  1.00 37.89 ? 155  LEU E C     1 
ATOM   9410  O  O     . LEU G  1 156 ? -23.903 -24.089 -7.838  1.00 38.19 ? 155  LEU E O     1 
ATOM   9411  C  CB    . LEU G  1 156 ? -25.347 -22.383 -5.612  1.00 37.62 ? 155  LEU E CB    1 
ATOM   9412  C  CG    . LEU G  1 156 ? -25.739 -22.044 -4.174  1.00 38.54 ? 155  LEU E CG    1 
ATOM   9413  C  CD1   . LEU G  1 156 ? -25.274 -20.638 -3.811  1.00 40.05 ? 155  LEU E CD1   1 
ATOM   9414  C  CD2   . LEU G  1 156 ? -27.257 -22.187 -3.980  1.00 37.36 ? 155  LEU E CD2   1 
ATOM   9415  N  N     . GLU G  1 157 ? -26.142 -24.218 -8.215  1.00 37.90 ? 156  GLU E N     1 
ATOM   9416  C  CA    . GLU G  1 157 ? -26.066 -24.382 -9.664  1.00 37.97 ? 156  GLU E CA    1 
ATOM   9417  C  C     . GLU G  1 157 ? -26.710 -23.190 -10.342 1.00 37.64 ? 156  GLU E C     1 
ATOM   9418  O  O     . GLU G  1 157 ? -27.717 -22.659 -9.867  1.00 37.63 ? 156  GLU E O     1 
ATOM   9419  C  CB    . GLU G  1 157 ? -26.758 -25.664 -10.097 1.00 38.02 ? 156  GLU E CB    1 
ATOM   9420  C  CG    . GLU G  1 157 ? -26.136 -26.894 -9.452  1.00 39.14 ? 156  GLU E CG    1 
ATOM   9421  C  CD    . GLU G  1 157 ? -26.673 -28.200 -9.968  1.00 39.05 ? 156  GLU E CD    1 
ATOM   9422  O  OE1   . GLU G  1 157 ? -27.849 -28.246 -10.361 1.00 38.56 ? 156  GLU E OE1   1 
ATOM   9423  O  OE2   . GLU G  1 157 ? -25.903 -29.186 -9.977  1.00 39.08 ? 156  GLU E OE2   1 
ATOM   9424  N  N     . CYS G  1 158 ? -26.125 -22.750 -11.444 1.00 37.70 ? 157  CYS E N     1 
ATOM   9425  C  CA    . CYS G  1 158 ? -26.689 -21.616 -12.170 1.00 37.94 ? 157  CYS E CA    1 
ATOM   9426  C  C     . CYS G  1 158 ? -26.273 -21.593 -13.634 1.00 38.06 ? 157  CYS E C     1 
ATOM   9427  O  O     . CYS G  1 158 ? -25.372 -22.335 -14.063 1.00 38.44 ? 157  CYS E O     1 
ATOM   9428  C  CB    . CYS G  1 158 ? -26.267 -20.311 -11.503 1.00 38.02 ? 157  CYS E CB    1 
ATOM   9429  S  SG    . CYS G  1 158 ? -24.571 -19.906 -11.742 1.00 39.02 ? 157  CYS E SG    1 
ATOM   9430  N  N     . SER G  1 159 ? -26.973 -20.756 -14.390 1.00 37.39 ? 158  SER E N     1 
ATOM   9431  C  CA    . SER G  1 159 ? -26.616 -20.403 -15.743 1.00 37.12 ? 158  SER E CA    1 
ATOM   9432  C  C     . SER G  1 159 ? -26.555 -18.871 -15.834 1.00 36.71 ? 158  SER E C     1 
ATOM   9433  O  O     . SER G  1 159 ? -27.507 -18.173 -15.469 1.00 35.89 ? 158  SER E O     1 
ATOM   9434  C  CB    . SER G  1 159 ? -27.653 -20.964 -16.728 1.00 37.57 ? 158  SER E CB    1 
ATOM   9435  O  OG    . SER G  1 159 ? -27.506 -20.397 -18.012 1.00 37.12 ? 158  SER E OG    1 
ATOM   9436  N  N     . ALA G  1 160 ? -25.420 -18.359 -16.297 1.00 36.51 ? 159  ALA E N     1 
ATOM   9437  C  CA    . ALA G  1 160 ? -25.254 -16.925 -16.551 1.00 36.70 ? 159  ALA E CA    1 
ATOM   9438  C  C     . ALA G  1 160 ? -26.138 -16.521 -17.731 1.00 36.08 ? 159  ALA E C     1 
ATOM   9439  O  O     . ALA G  1 160 ? -26.678 -15.421 -17.768 1.00 36.16 ? 159  ALA E O     1 
ATOM   9440  C  CB    . ALA G  1 160 ? -23.760 -16.571 -16.826 1.00 35.81 ? 159  ALA E CB    1 
ATOM   9441  N  N     . LEU G  1 161 ? -26.282 -17.450 -18.671 1.00 36.59 ? 160  LEU E N     1 
ATOM   9442  C  CA    . LEU G  1 161 ? -27.035 -17.259 -19.903 1.00 36.73 ? 160  LEU E CA    1 
ATOM   9443  C  C     . LEU G  1 161 ? -28.538 -17.053 -19.647 1.00 36.74 ? 160  LEU E C     1 
ATOM   9444  O  O     . LEU G  1 161 ? -29.108 -16.053 -20.082 1.00 35.90 ? 160  LEU E O     1 
ATOM   9445  C  CB    . LEU G  1 161 ? -26.794 -18.463 -20.841 1.00 36.81 ? 160  LEU E CB    1 
ATOM   9446  C  CG    . LEU G  1 161 ? -27.323 -18.351 -22.286 1.00 37.61 ? 160  LEU E CG    1 
ATOM   9447  C  CD1   . LEU G  1 161 ? -26.595 -17.238 -23.128 1.00 37.42 ? 160  LEU E CD1   1 
ATOM   9448  C  CD2   . LEU G  1 161 ? -27.263 -19.686 -22.993 1.00 36.49 ? 160  LEU E CD2   1 
ATOM   9449  N  N     . THR G  1 162 ? -29.174 -18.009 -18.962 1.00 36.91 ? 161  THR E N     1 
ATOM   9450  C  CA    . THR G  1 162 ? -30.613 -17.915 -18.668 1.00 36.91 ? 161  THR E CA    1 
ATOM   9451  C  C     . THR G  1 162 ? -30.911 -17.178 -17.361 1.00 37.11 ? 161  THR E C     1 
ATOM   9452  O  O     . THR G  1 162 ? -32.041 -16.726 -17.160 1.00 36.51 ? 161  THR E O     1 
ATOM   9453  C  CB    . THR G  1 162 ? -31.305 -19.292 -18.641 1.00 37.19 ? 161  THR E CB    1 
ATOM   9454  O  OG1   . THR G  1 162 ? -30.959 -19.973 -17.433 1.00 36.58 ? 161  THR E OG1   1 
ATOM   9455  C  CG2   . THR G  1 162 ? -30.910 -20.139 -19.894 1.00 36.20 ? 161  THR E CG2   1 
ATOM   9456  N  N     . GLN G  1 163 ? -29.891 -17.039 -16.504 1.00 36.97 ? 162  GLN E N     1 
ATOM   9457  C  CA    . GLN G  1 163 ? -30.029 -16.455 -15.163 1.00 37.23 ? 162  GLN E CA    1 
ATOM   9458  C  C     . GLN G  1 163 ? -30.756 -17.345 -14.144 1.00 37.41 ? 162  GLN E C     1 
ATOM   9459  O  O     . GLN G  1 163 ? -31.006 -16.944 -12.990 1.00 37.20 ? 162  GLN E O     1 
ATOM   9460  C  CB    . GLN G  1 163 ? -30.647 -15.056 -15.224 1.00 37.12 ? 162  GLN E CB    1 
ATOM   9461  C  CG    . GLN G  1 163 ? -29.878 -14.100 -16.139 1.00 37.59 ? 162  GLN E CG    1 
ATOM   9462  C  CD    . GLN G  1 163 ? -30.128 -12.636 -15.793 1.00 38.66 ? 162  GLN E CD    1 
ATOM   9463  O  OE1   . GLN G  1 163 ? -31.268 -12.227 -15.598 1.00 38.88 ? 162  GLN E OE1   1 
ATOM   9464  N  NE2   . GLN G  1 163 ? -29.054 -11.844 -15.693 1.00 37.22 ? 162  GLN E NE2   1 
ATOM   9465  N  N     . ARG G  1 164 ? -31.058 -18.574 -14.536 1.00 37.46 ? 163  ARG E N     1 
ATOM   9466  C  CA    . ARG G  1 164 ? -31.552 -19.530 -13.573 1.00 38.03 ? 163  ARG E CA    1 
ATOM   9467  C  C     . ARG G  1 164 ? -30.522 -19.744 -12.472 1.00 37.87 ? 163  ARG E C     1 
ATOM   9468  O  O     . ARG G  1 164 ? -29.372 -20.097 -12.740 1.00 37.10 ? 163  ARG E O     1 
ATOM   9469  C  CB    . ARG G  1 164 ? -31.881 -20.856 -14.242 1.00 38.37 ? 163  ARG E CB    1 
ATOM   9470  C  CG    . ARG G  1 164 ? -32.601 -21.820 -13.303 1.00 40.90 ? 163  ARG E CG    1 
ATOM   9471  C  CD    . ARG G  1 164 ? -33.127 -23.036 -14.043 1.00 43.44 ? 163  ARG E CD    1 
ATOM   9472  N  NE    . ARG G  1 164 ? -33.359 -24.160 -13.131 1.00 45.44 ? 163  ARG E NE    1 
ATOM   9473  C  CZ    . ARG G  1 164 ? -33.413 -25.439 -13.500 1.00 45.30 ? 163  ARG E CZ    1 
ATOM   9474  N  NH1   . ARG G  1 164 ? -33.254 -25.799 -14.773 1.00 45.94 ? 163  ARG E NH1   1 
ATOM   9475  N  NH2   . ARG G  1 164 ? -33.616 -26.366 -12.583 1.00 46.42 ? 163  ARG E NH2   1 
ATOM   9476  N  N     . GLY G  1 165 ? -30.943 -19.511 -11.232 1.00 38.15 ? 164  GLY E N     1 
ATOM   9477  C  CA    . GLY G  1 165 ? -30.108 -19.747 -10.052 1.00 37.92 ? 164  GLY E CA    1 
ATOM   9478  C  C     . GLY G  1 165 ? -29.110 -18.646 -9.769  1.00 38.40 ? 164  GLY E C     1 
ATOM   9479  O  O     . GLY G  1 165 ? -28.411 -18.689 -8.742  1.00 38.62 ? 164  GLY E O     1 
ATOM   9480  N  N     . LEU G  1 166 ? -29.051 -17.650 -10.655 1.00 38.11 ? 165  LEU E N     1 
ATOM   9481  C  CA    . LEU G  1 166 ? -27.974 -16.677 -10.653 1.00 37.69 ? 165  LEU E CA    1 
ATOM   9482  C  C     . LEU G  1 166 ? -28.063 -15.740 -9.451  1.00 37.86 ? 165  LEU E C     1 
ATOM   9483  O  O     . LEU G  1 166 ? -27.081 -15.541 -8.725  1.00 37.78 ? 165  LEU E O     1 
ATOM   9484  C  CB    . LEU G  1 166 ? -27.956 -15.872 -11.974 1.00 37.90 ? 165  LEU E CB    1 
ATOM   9485  C  CG    . LEU G  1 166 ? -26.792 -14.859 -12.167 1.00 38.19 ? 165  LEU E CG    1 
ATOM   9486  C  CD1   . LEU G  1 166 ? -25.435 -15.525 -11.963 1.00 36.68 ? 165  LEU E CD1   1 
ATOM   9487  C  CD2   . LEU G  1 166 ? -26.860 -14.146 -13.538 1.00 36.80 ? 165  LEU E CD2   1 
ATOM   9488  N  N     . LYS G  1 167 ? -29.229 -15.147 -9.251  1.00 38.06 ? 166  LYS E N     1 
ATOM   9489  C  CA    . LYS G  1 167 ? -29.422 -14.248 -8.120  1.00 38.44 ? 166  LYS E CA    1 
ATOM   9490  C  C     . LYS G  1 167 ? -29.194 -14.996 -6.802  1.00 38.91 ? 166  LYS E C     1 
ATOM   9491  O  O     . LYS G  1 167 ? -28.648 -14.420 -5.856  1.00 38.46 ? 166  LYS E O     1 
ATOM   9492  C  CB    . LYS G  1 167 ? -30.825 -13.641 -8.136  1.00 38.61 ? 166  LYS E CB    1 
ATOM   9493  C  CG    . LYS G  1 167 ? -30.989 -12.540 -7.134  1.00 38.12 ? 166  LYS E CG    1 
ATOM   9494  C  CD    . LYS G  1 167 ? -32.362 -11.883 -7.241  1.00 39.19 ? 166  LYS E CD    1 
ATOM   9495  C  CE    . LYS G  1 167 ? -32.510 -10.741 -6.229  1.00 38.33 ? 166  LYS E CE    1 
ATOM   9496  N  NZ    . LYS G  1 167 ? -32.353 -11.261 -4.849  1.00 37.34 ? 166  LYS E NZ    1 
ATOM   9497  N  N     . THR G  1 168 ? -29.602 -16.274 -6.755  1.00 38.87 ? 167  THR E N     1 
ATOM   9498  C  CA    . THR G  1 168 ? -29.477 -17.090 -5.550  1.00 39.21 ? 167  THR E CA    1 
ATOM   9499  C  C     . THR G  1 168 ? -28.005 -17.279 -5.156  1.00 39.16 ? 167  THR E C     1 
ATOM   9500  O  O     . THR G  1 168 ? -27.675 -17.352 -3.964  1.00 39.98 ? 167  THR E O     1 
ATOM   9501  C  CB    . THR G  1 168 ? -30.168 -18.477 -5.716  1.00 39.28 ? 167  THR E CB    1 
ATOM   9502  O  OG1   . THR G  1 168 ? -31.574 -18.288 -5.945  1.00 41.38 ? 167  THR E OG1   1 
ATOM   9503  C  CG2   . THR G  1 168 ? -29.961 -19.371 -4.482  1.00 38.74 ? 167  THR E CG2   1 
ATOM   9504  N  N     . VAL G  1 169 ? -27.115 -17.352 -6.137  1.00 39.01 ? 168  VAL E N     1 
ATOM   9505  C  CA    . VAL G  1 169 ? -25.680 -17.449 -5.830  1.00 38.60 ? 168  VAL E CA    1 
ATOM   9506  C  C     . VAL G  1 169 ? -25.196 -16.239 -4.999  1.00 38.73 ? 168  VAL E C     1 
ATOM   9507  O  O     . VAL G  1 169 ? -24.515 -16.392 -3.991  1.00 38.69 ? 168  VAL E O     1 
ATOM   9508  C  CB    . VAL G  1 169 ? -24.829 -17.606 -7.114  1.00 38.83 ? 168  VAL E CB    1 
ATOM   9509  C  CG1   . VAL G  1 169 ? -23.299 -17.537 -6.783  1.00 38.50 ? 168  VAL E CG1   1 
ATOM   9510  C  CG2   . VAL G  1 169 ? -25.171 -18.944 -7.829  1.00 37.43 ? 168  VAL E CG2   1 
ATOM   9511  N  N     . PHE G  1 170 ? -25.552 -15.041 -5.430  1.00 38.40 ? 169  PHE E N     1 
ATOM   9512  C  CA    . PHE G  1 170 ? -25.108 -13.829 -4.764  1.00 38.14 ? 169  PHE E CA    1 
ATOM   9513  C  C     . PHE G  1 170 ? -25.901 -13.502 -3.502  1.00 38.53 ? 169  PHE E C     1 
ATOM   9514  O  O     . PHE G  1 170 ? -25.351 -12.962 -2.550  1.00 38.76 ? 169  PHE E O     1 
ATOM   9515  C  CB    . PHE G  1 170 ? -25.079 -12.688 -5.795  1.00 38.23 ? 169  PHE E CB    1 
ATOM   9516  C  CG    . PHE G  1 170 ? -24.055 -12.922 -6.850  1.00 38.29 ? 169  PHE E CG    1 
ATOM   9517  C  CD1   . PHE G  1 170 ? -22.730 -12.594 -6.611  1.00 37.79 ? 169  PHE E CD1   1 
ATOM   9518  C  CD2   . PHE G  1 170 ? -24.382 -13.581 -8.028  1.00 38.30 ? 169  PHE E CD2   1 
ATOM   9519  C  CE1   . PHE G  1 170 ? -21.749 -12.878 -7.542  1.00 39.26 ? 169  PHE E CE1   1 
ATOM   9520  C  CE2   . PHE G  1 170 ? -23.405 -13.877 -8.973  1.00 39.01 ? 169  PHE E CE2   1 
ATOM   9521  C  CZ    . PHE G  1 170 ? -22.077 -13.514 -8.726  1.00 38.48 ? 169  PHE E CZ    1 
ATOM   9522  N  N     . ASP G  1 171 ? -27.186 -13.846 -3.480  1.00 39.02 ? 170  ASP E N     1 
ATOM   9523  C  CA    . ASP G  1 171 ? -27.971 -13.767 -2.264  1.00 39.30 ? 170  ASP E CA    1 
ATOM   9524  C  C     . ASP G  1 171 ? -27.386 -14.656 -1.158  1.00 39.64 ? 170  ASP E C     1 
ATOM   9525  O  O     . ASP G  1 171 ? -27.288 -14.233 -0.006  1.00 39.55 ? 170  ASP E O     1 
ATOM   9526  C  CB    . ASP G  1 171 ? -29.406 -14.167 -2.546  1.00 39.89 ? 170  ASP E CB    1 
ATOM   9527  C  CG    . ASP G  1 171 ? -30.119 -13.198 -3.489  1.00 41.39 ? 170  ASP E CG    1 
ATOM   9528  O  OD1   . ASP G  1 171 ? -29.521 -12.176 -3.907  1.00 44.75 ? 170  ASP E OD1   1 
ATOM   9529  O  OD2   . ASP G  1 171 ? -31.291 -13.468 -3.821  1.00 44.15 ? 170  ASP E OD2   1 
ATOM   9530  N  N     . GLU G  1 172 ? -26.977 -15.873 -1.506  1.00 39.98 ? 171  GLU E N     1 
ATOM   9531  C  CA    . GLU G  1 172 ? -26.319 -16.776 -0.543  1.00 40.46 ? 171  GLU E CA    1 
ATOM   9532  C  C     . GLU G  1 172 ? -24.908 -16.299 -0.137  1.00 40.12 ? 171  GLU E C     1 
ATOM   9533  O  O     . GLU G  1 172 ? -24.532 -16.398 1.026   1.00 40.23 ? 171  GLU E O     1 
ATOM   9534  C  CB    . GLU G  1 172 ? -26.244 -18.204 -1.099  1.00 40.66 ? 171  GLU E CB    1 
ATOM   9535  C  CG    . GLU G  1 172 ? -27.609 -18.870 -1.281  1.00 43.12 ? 171  GLU E CG    1 
ATOM   9536  C  CD    . GLU G  1 172 ? -28.326 -19.125 0.028   1.00 45.98 ? 171  GLU E CD    1 
ATOM   9537  O  OE1   . GLU G  1 172 ? -27.696 -18.991 1.095   1.00 46.52 ? 171  GLU E OE1   1 
ATOM   9538  O  OE2   . GLU G  1 172 ? -29.534 -19.463 -0.012  1.00 49.20 ? 171  GLU E OE2   1 
ATOM   9539  N  N     . ALA G  1 173 ? -24.141 -15.799 -1.104  1.00 39.76 ? 172  ALA E N     1 
ATOM   9540  C  CA    . ALA G  1 173 ? -22.839 -15.208 -0.842  1.00 39.35 ? 172  ALA E CA    1 
ATOM   9541  C  C     . ALA G  1 173 ? -22.990 -14.119 0.213   1.00 39.33 ? 172  ALA E C     1 
ATOM   9542  O  O     . ALA G  1 173 ? -22.293 -14.112 1.240   1.00 39.08 ? 172  ALA E O     1 
ATOM   9543  C  CB    . ALA G  1 173 ? -22.254 -14.624 -2.123  1.00 39.85 ? 172  ALA E CB    1 
ATOM   9544  N  N     . ILE G  1 174 ? -23.939 -13.223 -0.026  1.00 39.11 ? 173  ILE E N     1 
ATOM   9545  C  CA    . ILE G  1 174 ? -24.214 -12.127 0.903   1.00 38.89 ? 173  ILE E CA    1 
ATOM   9546  C  C     . ILE G  1 174 ? -24.630 -12.630 2.309   1.00 38.91 ? 173  ILE E C     1 
ATOM   9547  O  O     . ILE G  1 174 ? -24.095 -12.167 3.331   1.00 37.55 ? 173  ILE E O     1 
ATOM   9548  C  CB    . ILE G  1 174 ? -25.280 -11.183 0.296   1.00 39.20 ? 173  ILE E CB    1 
ATOM   9549  C  CG1   . ILE G  1 174 ? -24.696 -10.488 -0.948  1.00 39.36 ? 173  ILE E CG1   1 
ATOM   9550  C  CG2   . ILE G  1 174 ? -25.775 -10.166 1.331   1.00 38.06 ? 173  ILE E CG2   1 
ATOM   9551  C  CD1   . ILE G  1 174 ? -25.717 -9.975  -1.921  1.00 38.78 ? 173  ILE E CD1   1 
ATOM   9552  N  N     . ARG G  1 175 ? -25.588 -13.569 2.349   1.00 39.31 ? 174  ARG E N     1 
ATOM   9553  C  CA    . ARG G  1 175 ? -26.079 -14.136 3.616   1.00 39.58 ? 174  ARG E CA    1 
ATOM   9554  C  C     . ARG G  1 175 ? -24.967 -14.918 4.330   1.00 39.12 ? 174  ARG E C     1 
ATOM   9555  O  O     . ARG G  1 175 ? -24.962 -15.018 5.550   1.00 38.42 ? 174  ARG E O     1 
ATOM   9556  C  CB    . ARG G  1 175 ? -27.294 -15.056 3.394   1.00 40.22 ? 174  ARG E CB    1 
ATOM   9557  C  CG    . ARG G  1 175 ? -28.464 -14.410 2.634   1.00 42.97 ? 174  ARG E CG    1 
ATOM   9558  C  CD    . ARG G  1 175 ? -29.723 -14.191 3.448   1.00 46.33 ? 174  ARG E CD    1 
ATOM   9559  N  NE    . ARG G  1 175 ? -29.713 -12.939 4.193   1.00 48.36 ? 174  ARG E NE    1 
ATOM   9560  C  CZ    . ARG G  1 175 ? -30.677 -12.011 4.177   1.00 49.26 ? 174  ARG E CZ    1 
ATOM   9561  N  NH1   . ARG G  1 175 ? -30.542 -10.927 4.927   1.00 49.36 ? 174  ARG E NH1   1 
ATOM   9562  N  NH2   . ARG G  1 175 ? -31.774 -12.138 3.430   1.00 49.44 ? 174  ARG E NH2   1 
ATOM   9563  N  N     . ALA G  1 176 ? -24.029 -15.466 3.556   1.00 38.83 ? 175  ALA E N     1 
ATOM   9564  C  CA    . ALA G  1 176 ? -22.872 -16.180 4.127   1.00 38.52 ? 175  ALA E CA    1 
ATOM   9565  C  C     . ALA G  1 176 ? -21.978 -15.259 4.959   1.00 38.37 ? 175  ALA E C     1 
ATOM   9566  O  O     . ALA G  1 176 ? -21.351 -15.705 5.925   1.00 38.57 ? 175  ALA E O     1 
ATOM   9567  C  CB    . ALA G  1 176 ? -22.064 -16.820 3.044   1.00 38.03 ? 175  ALA E CB    1 
ATOM   9568  N  N     . VAL G  1 177 ? -21.901 -13.989 4.566   1.00 38.36 ? 176  VAL E N     1 
ATOM   9569  C  CA    . VAL G  1 177 ? -21.116 -12.999 5.295   1.00 38.65 ? 176  VAL E CA    1 
ATOM   9570  C  C     . VAL G  1 177 ? -21.983 -12.302 6.359   1.00 39.26 ? 176  VAL E C     1 
ATOM   9571  O  O     . VAL G  1 177 ? -21.559 -12.155 7.489   1.00 38.58 ? 176  VAL E O     1 
ATOM   9572  C  CB    . VAL G  1 177 ? -20.457 -11.966 4.345   1.00 38.94 ? 176  VAL E CB    1 
ATOM   9573  C  CG1   . VAL G  1 177 ? -19.589 -10.980 5.132   1.00 37.89 ? 176  VAL E CG1   1 
ATOM   9574  C  CG2   . VAL G  1 177 ? -19.622 -12.678 3.257   1.00 37.78 ? 176  VAL E CG2   1 
ATOM   9575  N  N     . LEU G  1 178 ? -23.205 -11.914 6.009   1.00 40.17 ? 177  LEU E N     1 
ATOM   9576  C  CA    . LEU G  1 178 ? -24.029 -11.084 6.909   1.00 41.31 ? 177  LEU E CA    1 
ATOM   9577  C  C     . LEU G  1 178 ? -25.040 -11.802 7.788   1.00 42.52 ? 177  LEU E C     1 
ATOM   9578  O  O     . LEU G  1 178 ? -25.628 -11.175 8.674   1.00 42.65 ? 177  LEU E O     1 
ATOM   9579  C  CB    . LEU G  1 178 ? -24.779 -10.037 6.103   1.00 40.99 ? 177  LEU E CB    1 
ATOM   9580  C  CG    . LEU G  1 178 ? -23.829 -9.181  5.280   1.00 40.84 ? 177  LEU E CG    1 
ATOM   9581  C  CD1   . LEU G  1 178 ? -24.662 -8.181  4.498   1.00 40.34 ? 177  LEU E CD1   1 
ATOM   9582  C  CD2   . LEU G  1 178 ? -22.795 -8.505  6.183   1.00 40.19 ? 177  LEU E CD2   1 
ATOM   9583  N  N     . GLY G  1 179 ? -25.251 -13.092 7.548   1.00 44.52 ? 178  GLY E N     1 
ATOM   9584  C  CA    . GLY G  1 179 ? -26.161 -13.897 8.370   1.00 46.14 ? 178  GLY E CA    1 
ATOM   9585  C  C     . GLY G  1 179 ? -27.627 -13.768 7.981   1.00 47.41 ? 178  GLY E C     1 
ATOM   9586  O  O     . GLY G  1 179 ? -28.010 -13.887 6.813   1.00 49.07 ? 178  GLY E O     1 
ATOM   9587  O  OXT   . GLY G  1 179 ? -28.509 -13.558 8.818   1.00 49.40 ? 178  GLY E OXT   1 
ATOM   9588  N  N     . SER H  1 1   ? -4.902  -22.729 -63.674 1.00 47.10 ? 0    SER H N     1 
ATOM   9589  C  CA    . SER H  1 1   ? -5.439  -21.614 -62.853 1.00 47.58 ? 0    SER H CA    1 
ATOM   9590  C  C     . SER H  1 1   ? -4.296  -20.960 -62.108 1.00 47.26 ? 0    SER H C     1 
ATOM   9591  O  O     . SER H  1 1   ? -3.178  -21.485 -62.075 1.00 47.95 ? 0    SER H O     1 
ATOM   9592  C  CB    . SER H  1 1   ? -6.533  -22.088 -61.871 1.00 47.81 ? 0    SER H CB    1 
ATOM   9593  O  OG    . SER H  1 1   ? -6.148  -23.250 -61.152 1.00 48.52 ? 0    SER H OG    1 
ATOM   9594  N  N     . MET H  1 2   ? -4.577  -19.814 -61.504 1.00 46.56 ? 1    MET H N     1 
ATOM   9595  C  CA    . MET H  1 2   ? -3.534  -19.033 -60.860 1.00 46.04 ? 1    MET H CA    1 
ATOM   9596  C  C     . MET H  1 2   ? -3.163  -19.715 -59.545 1.00 45.24 ? 1    MET H C     1 
ATOM   9597  O  O     . MET H  1 2   ? -4.025  -20.287 -58.880 1.00 45.00 ? 1    MET H O     1 
ATOM   9598  C  CB    . MET H  1 2   ? -4.008  -17.600 -60.642 1.00 46.15 ? 1    MET H CB    1 
ATOM   9599  C  CG    . MET H  1 2   ? -4.516  -16.936 -61.920 1.00 47.00 ? 1    MET H CG    1 
ATOM   9600  S  SD    . MET H  1 2   ? -3.205  -16.667 -63.126 1.00 50.38 ? 1    MET H SD    1 
ATOM   9601  C  CE    . MET H  1 2   ? -2.618  -15.073 -62.528 1.00 51.30 ? 1    MET H CE    1 
ATOM   9602  N  N     . GLN H  1 3   ? -1.883  -19.670 -59.184 1.00 44.24 ? 2    GLN H N     1 
ATOM   9603  C  CA    . GLN H  1 3   ? -1.426  -20.347 -57.974 1.00 43.90 ? 2    GLN H CA    1 
ATOM   9604  C  C     . GLN H  1 3   ? -2.056  -19.798 -56.687 1.00 43.18 ? 2    GLN H C     1 
ATOM   9605  O  O     . GLN H  1 3   ? -2.072  -18.579 -56.438 1.00 43.11 ? 2    GLN H O     1 
ATOM   9606  C  CB    . GLN H  1 3   ? 0.096   -20.314 -57.854 1.00 44.04 ? 2    GLN H CB    1 
ATOM   9607  C  CG    . GLN H  1 3   ? 0.619   -21.284 -56.808 1.00 44.36 ? 2    GLN H CG    1 
ATOM   9608  C  CD    . GLN H  1 3   ? 0.334   -22.729 -57.185 1.00 46.62 ? 2    GLN H CD    1 
ATOM   9609  O  OE1   . GLN H  1 3   ? 0.715   -23.172 -58.268 1.00 47.84 ? 2    GLN H OE1   1 
ATOM   9610  N  NE2   . GLN H  1 3   ? -0.340  -23.472 -56.296 1.00 46.44 ? 2    GLN H NE2   1 
ATOM   9611  N  N     . ALA H  1 4   ? -2.575  -20.727 -55.887 1.00 42.12 ? 3    ALA H N     1 
ATOM   9612  C  CA    . ALA H  1 4   ? -3.188  -20.436 -54.607 1.00 41.17 ? 3    ALA H CA    1 
ATOM   9613  C  C     . ALA H  1 4   ? -2.746  -21.514 -53.639 1.00 40.65 ? 3    ALA H C     1 
ATOM   9614  O  O     . ALA H  1 4   ? -2.700  -22.690 -53.999 1.00 41.09 ? 3    ALA H O     1 
ATOM   9615  C  CB    . ALA H  1 4   ? -4.679  -20.452 -54.731 1.00 41.11 ? 3    ALA H CB    1 
ATOM   9616  N  N     . ILE H  1 5   ? -2.394  -21.108 -52.428 1.00 39.71 ? 4    ILE H N     1 
ATOM   9617  C  CA    . ILE H  1 5   ? -2.011  -22.036 -51.360 1.00 39.11 ? 4    ILE H CA    1 
ATOM   9618  C  C     . ILE H  1 5   ? -3.018  -21.939 -50.239 1.00 38.33 ? 4    ILE H C     1 
ATOM   9619  O  O     . ILE H  1 5   ? -3.296  -20.836 -49.757 1.00 38.46 ? 4    ILE H O     1 
ATOM   9620  C  CB    . ILE H  1 5   ? -0.614  -21.721 -50.792 1.00 38.80 ? 4    ILE H CB    1 
ATOM   9621  C  CG1   . ILE H  1 5   ? 0.433   -21.867 -51.896 1.00 38.70 ? 4    ILE H CG1   1 
ATOM   9622  C  CG2   . ILE H  1 5   ? -0.297  -22.642 -49.634 1.00 38.07 ? 4    ILE H CG2   1 
ATOM   9623  C  CD1   . ILE H  1 5   ? 1.864   -21.718 -51.434 1.00 39.42 ? 4    ILE H CD1   1 
ATOM   9624  N  N     . LYS H  1 6   ? -3.583  -23.085 -49.862 1.00 37.87 ? 5    LYS H N     1 
ATOM   9625  C  CA    . LYS H  1 6   ? -4.404  -23.211 -48.665 1.00 37.77 ? 5    LYS H CA    1 
ATOM   9626  C  C     . LYS H  1 6   ? -3.586  -23.772 -47.496 1.00 37.63 ? 5    LYS H C     1 
ATOM   9627  O  O     . LYS H  1 6   ? -3.226  -24.946 -47.476 1.00 36.74 ? 5    LYS H O     1 
ATOM   9628  C  CB    . LYS H  1 6   ? -5.615  -24.109 -48.913 1.00 38.08 ? 5    LYS H CB    1 
ATOM   9629  C  CG    . LYS H  1 6   ? -6.432  -24.395 -47.635 1.00 37.70 ? 5    LYS H CG    1 
ATOM   9630  C  CD    . LYS H  1 6   ? -7.786  -24.995 -47.950 1.00 37.83 ? 5    LYS H CD    1 
ATOM   9631  C  CE    . LYS H  1 6   ? -8.502  -25.442 -46.706 1.00 37.04 ? 5    LYS H CE    1 
ATOM   9632  N  NZ    . LYS H  1 6   ? -9.904  -25.865 -47.044 1.00 36.61 ? 5    LYS H NZ    1 
ATOM   9633  N  N     . CYS H  1 7   ? -3.314  -22.908 -46.522 1.00 37.75 ? 6    CYS H N     1 
ATOM   9634  C  CA    . CYS H  1 7   ? -2.579  -23.281 -45.331 1.00 37.78 ? 6    CYS H CA    1 
ATOM   9635  C  C     . CYS H  1 7   ? -3.521  -23.299 -44.104 1.00 37.60 ? 6    CYS H C     1 
ATOM   9636  O  O     . CYS H  1 7   ? -4.182  -22.305 -43.809 1.00 37.72 ? 6    CYS H O     1 
ATOM   9637  C  CB    . CYS H  1 7   ? -1.408  -22.312 -45.148 1.00 37.64 ? 6    CYS H CB    1 
ATOM   9638  S  SG    . CYS H  1 7   ? -0.544  -22.482 -43.594 1.00 39.30 ? 6    CYS H SG    1 
ATOM   9639  N  N     . VAL H  1 8   ? -3.597  -24.440 -43.413 1.00 37.51 ? 7    VAL H N     1 
ATOM   9640  C  CA    . VAL H  1 8   ? -4.482  -24.592 -42.250 1.00 37.35 ? 7    VAL H CA    1 
ATOM   9641  C  C     . VAL H  1 8   ? -3.643  -24.698 -40.970 1.00 37.43 ? 7    VAL H C     1 
ATOM   9642  O  O     . VAL H  1 8   ? -2.676  -25.449 -40.922 1.00 37.65 ? 7    VAL H O     1 
ATOM   9643  C  CB    . VAL H  1 8   ? -5.436  -25.810 -42.393 1.00 37.45 ? 7    VAL H CB    1 
ATOM   9644  C  CG1   . VAL H  1 8   ? -6.334  -25.964 -41.118 1.00 36.98 ? 7    VAL H CG1   1 
ATOM   9645  C  CG2   . VAL H  1 8   ? -6.291  -25.642 -43.616 1.00 37.47 ? 7    VAL H CG2   1 
ATOM   9646  N  N     . VAL H  1 9   ? -4.003  -23.911 -39.954 1.00 37.53 ? 8    VAL H N     1 
ATOM   9647  C  CA    . VAL H  1 9   ? -3.231  -23.838 -38.709 1.00 37.25 ? 8    VAL H CA    1 
ATOM   9648  C  C     . VAL H  1 9   ? -3.992  -24.495 -37.556 1.00 37.34 ? 8    VAL H C     1 
ATOM   9649  O  O     . VAL H  1 9   ? -5.121  -24.082 -37.223 1.00 37.68 ? 8    VAL H O     1 
ATOM   9650  C  CB    . VAL H  1 9   ? -2.871  -22.370 -38.360 1.00 37.63 ? 8    VAL H CB    1 
ATOM   9651  C  CG1   . VAL H  1 9   ? -2.046  -22.291 -37.100 1.00 36.81 ? 8    VAL H CG1   1 
ATOM   9652  C  CG2   . VAL H  1 9   ? -2.098  -21.736 -39.517 1.00 37.12 ? 8    VAL H CG2   1 
ATOM   9653  N  N     . VAL H  1 10  ? -3.368  -25.511 -36.947 1.00 36.88 ? 9    VAL H N     1 
ATOM   9654  C  CA    . VAL H  1 10  ? -3.962  -26.221 -35.815 1.00 36.47 ? 9    VAL H CA    1 
ATOM   9655  C  C     . VAL H  1 10  ? -3.007  -26.290 -34.622 1.00 36.96 ? 9    VAL H C     1 
ATOM   9656  O  O     . VAL H  1 10  ? -1.804  -26.069 -34.761 1.00 36.73 ? 9    VAL H O     1 
ATOM   9657  C  CB    . VAL H  1 10  ? -4.438  -27.666 -36.207 1.00 36.45 ? 9    VAL H CB    1 
ATOM   9658  C  CG1   . VAL H  1 10  ? -5.347  -27.629 -37.440 1.00 35.85 ? 9    VAL H CG1   1 
ATOM   9659  C  CG2   . VAL H  1 10  ? -3.255  -28.628 -36.417 1.00 34.54 ? 9    VAL H CG2   1 
ATOM   9660  N  N     . GLY H  1 11  ? -3.566  -26.602 -33.447 1.00 37.40 ? 10   GLY H N     1 
ATOM   9661  C  CA    . GLY H  1 11  ? -2.792  -26.811 -32.217 1.00 37.06 ? 10   GLY H CA    1 
ATOM   9662  C  C     . GLY H  1 11  ? -3.577  -26.377 -30.990 1.00 36.90 ? 10   GLY H C     1 
ATOM   9663  O  O     . GLY H  1 11  ? -4.632  -25.761 -31.121 1.00 36.43 ? 10   GLY H O     1 
ATOM   9664  N  N     . ASP H  1 12  ? -3.050  -26.687 -29.800 1.00 36.89 ? 11   ASP H N     1 
ATOM   9665  C  CA    . ASP H  1 12  ? -3.757  -26.428 -28.534 1.00 36.86 ? 11   ASP H CA    1 
ATOM   9666  C  C     . ASP H  1 12  ? -4.199  -24.962 -28.359 1.00 36.64 ? 11   ASP H C     1 
ATOM   9667  O  O     . ASP H  1 12  ? -3.647  -24.032 -28.942 1.00 36.14 ? 11   ASP H O     1 
ATOM   9668  C  CB    . ASP H  1 12  ? -2.880  -26.818 -27.323 1.00 36.80 ? 11   ASP H CB    1 
ATOM   9669  C  CG    . ASP H  1 12  ? -2.999  -28.284 -26.927 1.00 38.04 ? 11   ASP H CG    1 
ATOM   9670  O  OD1   . ASP H  1 12  ? -3.499  -29.113 -27.716 1.00 38.05 ? 11   ASP H OD1   1 
ATOM   9671  O  OD2   . ASP H  1 12  ? -2.566  -28.617 -25.792 1.00 39.04 ? 11   ASP H OD2   1 
ATOM   9672  N  N     . GLY H  1 13  ? -5.207  -24.768 -27.529 1.00 37.33 ? 12   GLY H N     1 
ATOM   9673  C  CA    . GLY H  1 13  ? -5.563  -23.421 -27.102 1.00 37.55 ? 12   GLY H CA    1 
ATOM   9674  C  C     . GLY H  1 13  ? -4.393  -22.718 -26.420 1.00 37.50 ? 12   GLY H C     1 
ATOM   9675  O  O     . GLY H  1 13  ? -3.543  -23.352 -25.792 1.00 37.65 ? 12   GLY H O     1 
ATOM   9676  N  N     . ALA H  1 14  ? -4.381  -21.399 -26.543 1.00 37.61 ? 13   ALA H N     1 
ATOM   9677  C  CA    . ALA H  1 14  ? -3.361  -20.523 -25.976 1.00 37.75 ? 13   ALA H CA    1 
ATOM   9678  C  C     . ALA H  1 14  ? -1.939  -20.676 -26.562 1.00 37.72 ? 13   ALA H C     1 
ATOM   9679  O  O     . ALA H  1 14  ? -0.994  -20.067 -26.028 1.00 38.41 ? 13   ALA H O     1 
ATOM   9680  C  CB    . ALA H  1 14  ? -3.336  -20.651 -24.433 1.00 37.34 ? 13   ALA H CB    1 
ATOM   9681  N  N     . VAL H  1 15  ? -1.759  -21.426 -27.654 1.00 37.61 ? 14   VAL H N     1 
ATOM   9682  C  CA    . VAL H  1 15  ? -0.383  -21.651 -28.165 1.00 37.31 ? 14   VAL H CA    1 
ATOM   9683  C  C     . VAL H  1 15  ? 0.172   -20.475 -29.004 1.00 37.42 ? 14   VAL H C     1 
ATOM   9684  O  O     . VAL H  1 15  ? 1.388   -20.329 -29.103 1.00 37.78 ? 14   VAL H O     1 
ATOM   9685  C  CB    . VAL H  1 15  ? -0.186  -23.001 -28.936 1.00 37.52 ? 14   VAL H CB    1 
ATOM   9686  C  CG1   . VAL H  1 15  ? -0.812  -24.170 -28.193 1.00 36.39 ? 14   VAL H CG1   1 
ATOM   9687  C  CG2   . VAL H  1 15  ? -0.663  -22.905 -30.386 1.00 37.69 ? 14   VAL H CG2   1 
ATOM   9688  N  N     . GLY H  1 16  ? -0.702  -19.651 -29.587 1.00 36.67 ? 15   GLY H N     1 
ATOM   9689  C  CA    . GLY H  1 16  ? -0.293  -18.470 -30.351 1.00 36.44 ? 15   GLY H CA    1 
ATOM   9690  C  C     . GLY H  1 16  ? -0.531  -18.558 -31.855 1.00 36.60 ? 15   GLY H C     1 
ATOM   9691  O  O     . GLY H  1 16  ? 0.155   -17.909 -32.623 1.00 36.76 ? 15   GLY H O     1 
ATOM   9692  N  N     . LYS H  1 17  ? -1.502  -19.359 -32.286 1.00 36.80 ? 16   LYS H N     1 
ATOM   9693  C  CA    . LYS H  1 17  ? -1.787  -19.530 -33.701 1.00 36.49 ? 16   LYS H CA    1 
ATOM   9694  C  C     . LYS H  1 17  ? -2.233  -18.229 -34.347 1.00 36.36 ? 16   LYS H C     1 
ATOM   9695  O  O     . LYS H  1 17  ? -1.783  -17.874 -35.432 1.00 36.62 ? 16   LYS H O     1 
ATOM   9696  C  CB    . LYS H  1 17  ? -2.867  -20.596 -33.901 1.00 36.68 ? 16   LYS H CB    1 
ATOM   9697  C  CG    . LYS H  1 17  ? -2.486  -21.984 -33.394 1.00 37.23 ? 16   LYS H CG    1 
ATOM   9698  C  CD    . LYS H  1 17  ? -3.575  -23.038 -33.714 1.00 36.05 ? 16   LYS H CD    1 
ATOM   9699  C  CE    . LYS H  1 17  ? -4.867  -22.798 -32.930 1.00 35.23 ? 16   LYS H CE    1 
ATOM   9700  N  NZ    . LYS H  1 17  ? -4.650  -22.767 -31.447 1.00 31.85 ? 16   LYS H NZ    1 
ATOM   9701  N  N     . THR H  1 18  ? -3.138  -17.517 -33.695 1.00 36.59 ? 17   THR H N     1 
ATOM   9702  C  CA    . THR H  1 18  ? -3.679  -16.309 -34.294 1.00 36.82 ? 17   THR H CA    1 
ATOM   9703  C  C     . THR H  1 18  ? -2.624  -15.204 -34.328 1.00 36.82 ? 17   THR H C     1 
ATOM   9704  O  O     . THR H  1 18  ? -2.436  -14.550 -35.363 1.00 36.54 ? 17   THR H O     1 
ATOM   9705  C  CB    . THR H  1 18  ? -4.941  -15.865 -33.575 1.00 37.26 ? 17   THR H CB    1 
ATOM   9706  O  OG1   . THR H  1 18  ? -5.940  -16.873 -33.760 1.00 37.74 ? 17   THR H OG1   1 
ATOM   9707  C  CG2   . THR H  1 18  ? -5.450  -14.525 -34.103 1.00 36.56 ? 17   THR H CG2   1 
ATOM   9708  N  N     . CYS H  1 19  ? -1.926  -15.013 -33.215 1.00 36.74 ? 18   CYS H N     1 
ATOM   9709  C  CA    . CYS H  1 19  ? -0.873  -14.001 -33.162 1.00 37.31 ? 18   CYS H CA    1 
ATOM   9710  C  C     . CYS H  1 19  ? 0.177   -14.196 -34.247 1.00 37.29 ? 18   CYS H C     1 
ATOM   9711  O  O     . CYS H  1 19  ? 0.587   -13.243 -34.881 1.00 37.44 ? 18   CYS H O     1 
ATOM   9712  C  CB    . CYS H  1 19  ? -0.205  -13.979 -31.789 1.00 37.25 ? 18   CYS H CB    1 
ATOM   9713  S  SG    . CYS H  1 19  ? -1.235  -13.203 -30.543 1.00 38.89 ? 18   CYS H SG    1 
ATOM   9714  N  N     . LEU H  1 20  ? 0.609   -15.440 -34.431 1.00 37.88 ? 19   LEU H N     1 
ATOM   9715  C  CA    . LEU H  1 20  ? 1.520   -15.839 -35.516 1.00 38.21 ? 19   LEU H CA    1 
ATOM   9716  C  C     . LEU H  1 20  ? 1.030   -15.403 -36.914 1.00 38.10 ? 19   LEU H C     1 
ATOM   9717  O  O     . LEU H  1 20  ? 1.800   -14.841 -37.714 1.00 37.33 ? 19   LEU H O     1 
ATOM   9718  C  CB    . LEU H  1 20  ? 1.684   -17.367 -35.446 1.00 39.23 ? 19   LEU H CB    1 
ATOM   9719  C  CG    . LEU H  1 20  ? 2.267   -18.203 -36.576 1.00 40.91 ? 19   LEU H CG    1 
ATOM   9720  C  CD1   . LEU H  1 20  ? 3.141   -19.289 -35.956 1.00 44.62 ? 19   LEU H CD1   1 
ATOM   9721  C  CD2   . LEU H  1 20  ? 1.182   -18.828 -37.448 1.00 42.81 ? 19   LEU H CD2   1 
ATOM   9722  N  N     . LEU H  1 21  ? -0.250  -15.649 -37.199 1.00 37.53 ? 20   LEU H N     1 
ATOM   9723  C  CA    . LEU H  1 21  ? -0.835  -15.286 -38.494 1.00 37.78 ? 20   LEU H CA    1 
ATOM   9724  C  C     . LEU H  1 21  ? -0.962  -13.762 -38.694 1.00 37.51 ? 20   LEU H C     1 
ATOM   9725  O  O     . LEU H  1 21  ? -0.676  -13.251 -39.766 1.00 37.65 ? 20   LEU H O     1 
ATOM   9726  C  CB    . LEU H  1 21  ? -2.205  -15.977 -38.664 1.00 38.11 ? 20   LEU H CB    1 
ATOM   9727  C  CG    . LEU H  1 21  ? -2.136  -17.505 -38.833 1.00 37.76 ? 20   LEU H CG    1 
ATOM   9728  C  CD1   . LEU H  1 21  ? -3.496  -18.192 -38.652 1.00 37.77 ? 20   LEU H CD1   1 
ATOM   9729  C  CD2   . LEU H  1 21  ? -1.529  -17.862 -40.180 1.00 37.11 ? 20   LEU H CD2   1 
ATOM   9730  N  N     . ILE H  1 22  ? -1.391  -13.055 -37.647 1.00 37.66 ? 21   ILE H N     1 
ATOM   9731  C  CA    . ILE H  1 22  ? -1.556  -11.608 -37.673 1.00 37.15 ? 21   ILE H CA    1 
ATOM   9732  C  C     . ILE H  1 22  ? -0.231  -10.833 -37.637 1.00 36.82 ? 21   ILE H C     1 
ATOM   9733  O  O     . ILE H  1 22  ? -0.110  -9.798  -38.280 1.00 36.91 ? 21   ILE H O     1 
ATOM   9734  C  CB    . ILE H  1 22  ? -2.495  -11.124 -36.519 1.00 37.39 ? 21   ILE H CB    1 
ATOM   9735  C  CG1   . ILE H  1 22  ? -3.877  -11.755 -36.674 1.00 37.56 ? 21   ILE H CG1   1 
ATOM   9736  C  CG2   . ILE H  1 22  ? -2.660  -9.594  -36.547 1.00 36.15 ? 21   ILE H CG2   1 
ATOM   9737  C  CD1   . ILE H  1 22  ? -4.545  -11.446 -38.059 1.00 39.09 ? 21   ILE H CD1   1 
ATOM   9738  N  N     . SER H  1 23  ? 0.752   -11.322 -36.890 1.00 36.42 ? 22   SER H N     1 
ATOM   9739  C  CA    . SER H  1 23  ? 2.091   -10.734 -36.913 1.00 35.99 ? 22   SER H CA    1 
ATOM   9740  C  C     . SER H  1 23  ? 2.694   -10.839 -38.313 1.00 36.44 ? 22   SER H C     1 
ATOM   9741  O  O     . SER H  1 23  ? 3.319   -9.885  -38.824 1.00 36.41 ? 22   SER H O     1 
ATOM   9742  C  CB    . SER H  1 23  ? 2.997   -11.438 -35.915 1.00 35.72 ? 22   SER H CB    1 
ATOM   9743  O  OG    . SER H  1 23  ? 4.205   -10.735 -35.775 1.00 34.15 ? 22   SER H OG    1 
ATOM   9744  N  N     . TYR H  1 24  ? 2.480   -11.994 -38.936 1.00 36.61 ? 23   TYR H N     1 
ATOM   9745  C  CA    . TYR H  1 24  ? 2.969   -12.258 -40.271 1.00 37.30 ? 23   TYR H CA    1 
ATOM   9746  C  C     . TYR H  1 24  ? 2.322   -11.391 -41.345 1.00 37.81 ? 23   TYR H C     1 
ATOM   9747  O  O     . TYR H  1 24  ? 3.008   -10.811 -42.170 1.00 38.37 ? 23   TYR H O     1 
ATOM   9748  C  CB    . TYR H  1 24  ? 2.725   -13.717 -40.635 1.00 37.95 ? 23   TYR H CB    1 
ATOM   9749  C  CG    . TYR H  1 24  ? 3.170   -14.040 -42.030 1.00 38.30 ? 23   TYR H CG    1 
ATOM   9750  C  CD1   . TYR H  1 24  ? 4.482   -13.808 -42.430 1.00 38.34 ? 23   TYR H CD1   1 
ATOM   9751  C  CD2   . TYR H  1 24  ? 2.279   -14.543 -42.957 1.00 38.47 ? 23   TYR H CD2   1 
ATOM   9752  C  CE1   . TYR H  1 24  ? 4.897   -14.092 -43.705 1.00 38.59 ? 23   TYR H CE1   1 
ATOM   9753  C  CE2   . TYR H  1 24  ? 2.684   -14.833 -44.237 1.00 39.28 ? 23   TYR H CE2   1 
ATOM   9754  C  CZ    . TYR H  1 24  ? 3.996   -14.603 -44.609 1.00 39.56 ? 23   TYR H CZ    1 
ATOM   9755  O  OH    . TYR H  1 24  ? 4.392   -14.901 -45.894 1.00 39.62 ? 23   TYR H OH    1 
ATOM   9756  N  N     . THR H  1 25  ? 0.999   -11.326 -41.360 1.00 38.34 ? 24   THR H N     1 
ATOM   9757  C  CA    . THR H  1 25  ? 0.302   -10.645 -42.441 1.00 38.59 ? 24   THR H CA    1 
ATOM   9758  C  C     . THR H  1 25  ? 0.144   -9.132  -42.233 1.00 38.82 ? 24   THR H C     1 
ATOM   9759  O  O     . THR H  1 25  ? -0.125  -8.411  -43.190 1.00 38.93 ? 24   THR H O     1 
ATOM   9760  C  CB    . THR H  1 25  ? -1.082  -11.264 -42.664 1.00 39.09 ? 24   THR H CB    1 
ATOM   9761  O  OG1   . THR H  1 25  ? -1.842  -11.197 -41.443 1.00 39.76 ? 24   THR H OG1   1 
ATOM   9762  C  CG2   . THR H  1 25  ? -0.959  -12.710 -43.120 1.00 37.76 ? 24   THR H CG2   1 
ATOM   9763  N  N     . THR H  1 26  ? 0.292   -8.642  -41.001 1.00 39.19 ? 25   THR H N     1 
ATOM   9764  C  CA    . THR H  1 26  ? 0.070   -7.212  -40.724 1.00 39.32 ? 25   THR H CA    1 
ATOM   9765  C  C     . THR H  1 26  ? 1.197   -6.507  -39.969 1.00 39.58 ? 25   THR H C     1 
ATOM   9766  O  O     . THR H  1 26  ? 1.155   -5.288  -39.820 1.00 39.28 ? 25   THR H O     1 
ATOM   9767  C  CB    . THR H  1 26  ? -1.227  -6.982  -39.922 1.00 39.47 ? 25   THR H CB    1 
ATOM   9768  O  OG1   . THR H  1 26  ? -1.054  -7.432  -38.570 1.00 39.88 ? 25   THR H OG1   1 
ATOM   9769  C  CG2   . THR H  1 26  ? -2.400  -7.694  -40.564 1.00 38.91 ? 25   THR H CG2   1 
ATOM   9770  N  N     . ASN H  1 27  ? 2.193   -7.262  -39.505 1.00 39.86 ? 26   ASN H N     1 
ATOM   9771  C  CA    . ASN H  1 27  ? 3.273   -6.730  -38.659 1.00 40.16 ? 26   ASN H CA    1 
ATOM   9772  C  C     . ASN H  1 27  ? 2.811   -6.171  -37.312 1.00 40.20 ? 26   ASN H C     1 
ATOM   9773  O  O     . ASN H  1 27  ? 3.588   -5.513  -36.619 1.00 40.68 ? 26   ASN H O     1 
ATOM   9774  C  CB    . ASN H  1 27  ? 4.111   -5.674  -39.401 1.00 40.20 ? 26   ASN H CB    1 
ATOM   9775  C  CG    . ASN H  1 27  ? 5.019   -6.280  -40.445 1.00 41.13 ? 26   ASN H CG    1 
ATOM   9776  O  OD1   . ASN H  1 27  ? 5.435   -7.439  -40.335 1.00 41.76 ? 26   ASN H OD1   1 
ATOM   9777  N  ND2   . ASN H  1 27  ? 5.342   -5.498  -41.466 1.00 40.61 ? 26   ASN H ND2   1 
ATOM   9778  N  N     . ALA H  1 28  ? 1.567   -6.445  -36.932 1.00 40.09 ? 27   ALA H N     1 
ATOM   9779  C  CA    . ALA H  1 28  ? 1.046   -6.016  -35.638 1.00 39.88 ? 27   ALA H CA    1 
ATOM   9780  C  C     . ALA H  1 28  ? 0.821   -7.257  -34.773 1.00 39.46 ? 27   ALA H C     1 
ATOM   9781  O  O     . ALA H  1 28  ? 0.495   -8.329  -35.277 1.00 39.56 ? 27   ALA H O     1 
ATOM   9782  C  CB    . ALA H  1 28  ? -0.252  -5.229  -35.812 1.00 40.03 ? 27   ALA H CB    1 
ATOM   9783  N  N     . PHE H  1 29  ? 1.052   -7.102  -33.476 1.00 39.33 ? 28   PHE H N     1 
ATOM   9784  C  CA    . PHE H  1 29  ? 0.749   -8.124  -32.489 1.00 39.24 ? 28   PHE H CA    1 
ATOM   9785  C  C     . PHE H  1 29  ? -0.596  -7.749  -31.865 1.00 39.32 ? 28   PHE H C     1 
ATOM   9786  O  O     . PHE H  1 29  ? -0.755  -6.638  -31.357 1.00 39.19 ? 28   PHE H O     1 
ATOM   9787  C  CB    . PHE H  1 29  ? 1.842   -8.147  -31.411 1.00 39.47 ? 28   PHE H CB    1 
ATOM   9788  C  CG    . PHE H  1 29  ? 1.795   -9.353  -30.514 1.00 38.46 ? 28   PHE H CG    1 
ATOM   9789  C  CD1   . PHE H  1 29  ? 2.322   -10.566 -30.933 1.00 38.73 ? 28   PHE H CD1   1 
ATOM   9790  C  CD2   . PHE H  1 29  ? 1.242   -9.272  -29.263 1.00 39.39 ? 28   PHE H CD2   1 
ATOM   9791  C  CE1   . PHE H  1 29  ? 2.300   -11.673 -30.123 1.00 38.38 ? 28   PHE H CE1   1 
ATOM   9792  C  CE2   . PHE H  1 29  ? 1.205   -10.388 -28.436 1.00 39.49 ? 28   PHE H CE2   1 
ATOM   9793  C  CZ    . PHE H  1 29  ? 1.742   -11.593 -28.878 1.00 39.78 ? 28   PHE H CZ    1 
ATOM   9794  N  N     . PRO H  1 30  ? -1.580  -8.662  -31.923 1.00 39.43 ? 29   PRO H N     1 
ATOM   9795  C  CA    . PRO H  1 30  ? -2.860  -8.441  -31.258 1.00 39.50 ? 29   PRO H CA    1 
ATOM   9796  C  C     . PRO H  1 30  ? -2.732  -7.977  -29.812 1.00 39.84 ? 29   PRO H C     1 
ATOM   9797  O  O     . PRO H  1 30  ? -1.949  -8.541  -29.036 1.00 39.99 ? 29   PRO H O     1 
ATOM   9798  C  CB    . PRO H  1 30  ? -3.518  -9.824  -31.319 1.00 39.21 ? 29   PRO H CB    1 
ATOM   9799  C  CG    . PRO H  1 30  ? -2.980  -10.412 -32.541 1.00 39.21 ? 29   PRO H CG    1 
ATOM   9800  C  CD    . PRO H  1 30  ? -1.570  -9.942  -32.655 1.00 39.41 ? 29   PRO H CD    1 
ATOM   9801  N  N     . GLY H  1 31  ? -3.526  -6.972  -29.458 1.00 40.12 ? 30   GLY H N     1 
ATOM   9802  C  CA    . GLY H  1 31  ? -3.447  -6.334  -28.153 1.00 40.41 ? 30   GLY H CA    1 
ATOM   9803  C  C     . GLY H  1 31  ? -4.161  -7.104  -27.064 1.00 40.49 ? 30   GLY H C     1 
ATOM   9804  O  O     . GLY H  1 31  ? -3.894  -6.898  -25.876 1.00 41.02 ? 30   GLY H O     1 
ATOM   9805  N  N     . GLU H  1 32  ? -5.077  -7.978  -27.471 1.00 40.46 ? 31   GLU H N     1 
ATOM   9806  C  CA    . GLU H  1 32  ? -5.859  -8.792  -26.548 1.00 40.32 ? 31   GLU H CA    1 
ATOM   9807  C  C     . GLU H  1 32  ? -5.703  -10.281 -26.869 1.00 39.73 ? 31   GLU H C     1 
ATOM   9808  O  O     . GLU H  1 32  ? -5.254  -10.659 -27.953 1.00 39.56 ? 31   GLU H O     1 
ATOM   9809  C  CB    . GLU H  1 32  ? -7.343  -8.396  -26.611 1.00 40.58 ? 31   GLU H CB    1 
ATOM   9810  N  N     . TYR H  1 33  ? -6.055  -11.106 -25.891 1.00 38.55 ? 32   TYR H N     1 
ATOM   9811  C  CA    . TYR H  1 33  ? -6.094  -12.538 -26.059 1.00 37.61 ? 32   TYR H CA    1 
ATOM   9812  C  C     . TYR H  1 33  ? -7.560  -12.939 -26.164 1.00 37.08 ? 32   TYR H C     1 
ATOM   9813  O  O     . TYR H  1 33  ? -8.295  -12.876 -25.173 1.00 36.79 ? 32   TYR H O     1 
ATOM   9814  C  CB    . TYR H  1 33  ? -5.411  -13.215 -24.870 1.00 37.33 ? 32   TYR H CB    1 
ATOM   9815  C  CG    . TYR H  1 33  ? -5.637  -14.709 -24.779 1.00 36.61 ? 32   TYR H CG    1 
ATOM   9816  C  CD1   . TYR H  1 33  ? -5.890  -15.480 -25.919 1.00 36.94 ? 32   TYR H CD1   1 
ATOM   9817  C  CD2   . TYR H  1 33  ? -5.560  -15.353 -23.568 1.00 34.57 ? 32   TYR H CD2   1 
ATOM   9818  C  CE1   . TYR H  1 33  ? -6.078  -16.835 -25.837 1.00 35.76 ? 32   TYR H CE1   1 
ATOM   9819  C  CE2   . TYR H  1 33  ? -5.740  -16.711 -23.484 1.00 36.33 ? 32   TYR H CE2   1 
ATOM   9820  C  CZ    . TYR H  1 33  ? -5.999  -17.446 -24.630 1.00 35.87 ? 32   TYR H CZ    1 
ATOM   9821  O  OH    . TYR H  1 33  ? -6.204  -18.788 -24.544 1.00 36.19 ? 32   TYR H OH    1 
ATOM   9822  N  N     . ILE H  1 34  ? -7.970  -13.303 -27.382 1.00 36.57 ? 33   ILE H N     1 
ATOM   9823  C  CA    . ILE H  1 34  ? -9.346  -13.658 -27.704 1.00 36.23 ? 33   ILE H CA    1 
ATOM   9824  C  C     . ILE H  1 34  ? -9.301  -14.954 -28.490 1.00 35.99 ? 33   ILE H C     1 
ATOM   9825  O  O     . ILE H  1 34  ? -8.892  -14.948 -29.641 1.00 36.18 ? 33   ILE H O     1 
ATOM   9826  C  CB    . ILE H  1 34  ? -10.047 -12.573 -28.566 1.00 36.38 ? 33   ILE H CB    1 
ATOM   9827  C  CG1   . ILE H  1 34  ? -10.039 -11.205 -27.844 1.00 37.12 ? 33   ILE H CG1   1 
ATOM   9828  C  CG2   . ILE H  1 34  ? -11.475 -12.993 -28.878 1.00 34.63 ? 33   ILE H CG2   1 
ATOM   9829  C  CD1   . ILE H  1 34  ? -10.628 -10.054 -28.675 1.00 36.83 ? 33   ILE H CD1   1 
ATOM   9830  N  N     . PRO H  1 35  ? -9.678  -16.087 -27.858 1.00 35.64 ? 34   PRO H N     1 
ATOM   9831  C  CA    . PRO H  1 35  ? -9.736  -17.368 -28.549 1.00 35.41 ? 34   PRO H CA    1 
ATOM   9832  C  C     . PRO H  1 35  ? -10.564 -17.339 -29.834 1.00 35.75 ? 34   PRO H C     1 
ATOM   9833  O  O     . PRO H  1 35  ? -11.557 -16.615 -29.926 1.00 35.92 ? 34   PRO H O     1 
ATOM   9834  C  CB    . PRO H  1 35  ? -10.370 -18.294 -27.519 1.00 35.11 ? 34   PRO H CB    1 
ATOM   9835  C  CG    . PRO H  1 35  ? -10.004 -17.727 -26.223 1.00 35.33 ? 34   PRO H CG    1 
ATOM   9836  C  CD    . PRO H  1 35  ? -10.016 -16.232 -26.435 1.00 35.93 ? 34   PRO H CD    1 
ATOM   9837  N  N     . THR H  1 36  ? -10.135 -18.143 -30.802 1.00 35.68 ? 35   THR H N     1 
ATOM   9838  C  CA    . THR H  1 36  ? -10.720 -18.200 -32.139 1.00 35.83 ? 35   THR H CA    1 
ATOM   9839  C  C     . THR H  1 36  ? -11.802 -19.279 -32.167 1.00 35.80 ? 35   THR H C     1 
ATOM   9840  O  O     . THR H  1 36  ? -11.671 -20.300 -31.490 1.00 36.12 ? 35   THR H O     1 
ATOM   9841  C  CB    . THR H  1 36  ? -9.621  -18.596 -33.168 1.00 35.87 ? 35   THR H CB    1 
ATOM   9842  O  OG1   . THR H  1 36  ? -8.486  -17.718 -33.031 1.00 35.73 ? 35   THR H OG1   1 
ATOM   9843  C  CG2   . THR H  1 36  ? -10.155 -18.581 -34.596 1.00 35.31 ? 35   THR H CG2   1 
ATOM   9844  N  N     . VAL H  1 37  ? -12.871 -19.042 -32.929 1.00 35.68 ? 36   VAL H N     1 
ATOM   9845  C  CA    . VAL H  1 37  ? -13.822 -20.095 -33.266 1.00 35.33 ? 36   VAL H CA    1 
ATOM   9846  C  C     . VAL H  1 37  ? -13.392 -20.569 -34.641 1.00 35.86 ? 36   VAL H C     1 
ATOM   9847  O  O     . VAL H  1 37  ? -13.011 -21.726 -34.821 1.00 35.62 ? 36   VAL H O     1 
ATOM   9848  C  CB    . VAL H  1 37  ? -15.301 -19.600 -33.235 1.00 35.73 ? 36   VAL H CB    1 
ATOM   9849  C  CG1   . VAL H  1 37  ? -16.287 -20.732 -33.611 1.00 35.17 ? 36   VAL H CG1   1 
ATOM   9850  C  CG2   . VAL H  1 37  ? -15.663 -19.054 -31.828 1.00 34.38 ? 36   VAL H CG2   1 
ATOM   9851  N  N     . PHE H  1 38  ? -13.431 -19.661 -35.611 1.00 36.05 ? 37   PHE H N     1 
ATOM   9852  C  CA    . PHE H  1 38  ? -12.745 -19.867 -36.885 1.00 36.16 ? 37   PHE H CA    1 
ATOM   9853  C  C     . PHE H  1 38  ? -12.570 -18.530 -37.572 1.00 36.16 ? 37   PHE H C     1 
ATOM   9854  O  O     . PHE H  1 38  ? -13.460 -17.698 -37.526 1.00 36.44 ? 37   PHE H O     1 
ATOM   9855  C  CB    . PHE H  1 38  ? -13.524 -20.801 -37.836 1.00 36.27 ? 37   PHE H CB    1 
ATOM   9856  C  CG    . PHE H  1 38  ? -12.947 -20.830 -39.217 1.00 36.60 ? 37   PHE H CG    1 
ATOM   9857  C  CD1   . PHE H  1 38  ? -11.764 -21.515 -39.465 1.00 37.66 ? 37   PHE H CD1   1 
ATOM   9858  C  CD2   . PHE H  1 38  ? -13.535 -20.118 -40.251 1.00 36.44 ? 37   PHE H CD2   1 
ATOM   9859  C  CE1   . PHE H  1 38  ? -11.197 -21.504 -40.726 1.00 36.22 ? 37   PHE H CE1   1 
ATOM   9860  C  CE2   . PHE H  1 38  ? -12.982 -20.111 -41.493 1.00 36.42 ? 37   PHE H CE2   1 
ATOM   9861  C  CZ    . PHE H  1 38  ? -11.803 -20.799 -41.735 1.00 36.64 ? 37   PHE H CZ    1 
ATOM   9862  N  N     . ASP H  1 39  ? -11.431 -18.328 -38.213 1.00 36.49 ? 38   ASP H N     1 
ATOM   9863  C  CA    . ASP H  1 39  ? -11.216 -17.135 -39.037 1.00 36.99 ? 38   ASP H CA    1 
ATOM   9864  C  C     . ASP H  1 39  ? -10.440 -17.505 -40.286 1.00 37.41 ? 38   ASP H C     1 
ATOM   9865  O  O     . ASP H  1 39  ? -9.592  -18.385 -40.247 1.00 36.58 ? 38   ASP H O     1 
ATOM   9866  C  CB    . ASP H  1 39  ? -10.437 -16.073 -38.247 1.00 37.28 ? 38   ASP H CB    1 
ATOM   9867  C  CG    . ASP H  1 39  ? -11.271 -15.427 -37.144 1.00 37.89 ? 38   ASP H CG    1 
ATOM   9868  O  OD1   . ASP H  1 39  ? -12.013 -14.467 -37.429 1.00 38.80 ? 38   ASP H OD1   1 
ATOM   9869  O  OD2   . ASP H  1 39  ? -11.190 -15.883 -35.998 1.00 38.66 ? 38   ASP H OD2   1 
ATOM   9870  N  N     . ASN H  1 40  ? -10.730 -16.816 -41.389 1.00 38.16 ? 39   ASN H N     1 
ATOM   9871  C  CA    . ASN H  1 40  ? -10.011 -17.005 -42.644 1.00 38.89 ? 39   ASN H CA    1 
ATOM   9872  C  C     . ASN H  1 40  ? -9.414  -15.686 -43.088 1.00 38.85 ? 39   ASN H C     1 
ATOM   9873  O  O     . ASN H  1 40  ? -10.104 -14.676 -43.134 1.00 39.19 ? 39   ASN H O     1 
ATOM   9874  C  CB    . ASN H  1 40  ? -10.956 -17.559 -43.724 1.00 39.50 ? 39   ASN H CB    1 
ATOM   9875  C  CG    . ASN H  1 40  ? -10.291 -17.698 -45.083 1.00 41.22 ? 39   ASN H CG    1 
ATOM   9876  O  OD1   . ASN H  1 40  ? -9.999  -16.707 -45.754 1.00 45.09 ? 39   ASN H OD1   1 
ATOM   9877  N  ND2   . ASN H  1 40  ? -10.065 -18.926 -45.501 1.00 44.45 ? 39   ASN H ND2   1 
ATOM   9878  N  N     . TYR H  1 41  ? -8.123  -15.702 -43.397 1.00 39.58 ? 40   TYR H N     1 
ATOM   9879  C  CA    . TYR H  1 41  ? -7.443  -14.540 -43.960 1.00 39.92 ? 40   TYR H CA    1 
ATOM   9880  C  C     . TYR H  1 41  ? -6.817  -14.884 -45.296 1.00 39.77 ? 40   TYR H C     1 
ATOM   9881  O  O     . TYR H  1 41  ? -6.462  -16.031 -45.564 1.00 39.51 ? 40   TYR H O     1 
ATOM   9882  C  CB    . TYR H  1 41  ? -6.328  -14.035 -43.050 1.00 40.61 ? 40   TYR H CB    1 
ATOM   9883  C  CG    . TYR H  1 41  ? -6.597  -14.143 -41.587 1.00 41.69 ? 40   TYR H CG    1 
ATOM   9884  C  CD1   . TYR H  1 41  ? -6.024  -15.160 -40.850 1.00 42.85 ? 40   TYR H CD1   1 
ATOM   9885  C  CD2   . TYR H  1 41  ? -7.398  -13.223 -40.927 1.00 42.85 ? 40   TYR H CD2   1 
ATOM   9886  C  CE1   . TYR H  1 41  ? -6.234  -15.274 -39.520 1.00 42.65 ? 40   TYR H CE1   1 
ATOM   9887  C  CE2   . TYR H  1 41  ? -7.625  -13.343 -39.564 1.00 43.73 ? 40   TYR H CE2   1 
ATOM   9888  C  CZ    . TYR H  1 41  ? -7.032  -14.384 -38.873 1.00 42.71 ? 40   TYR H CZ    1 
ATOM   9889  O  OH    . TYR H  1 41  ? -7.204  -14.565 -37.518 1.00 44.27 ? 40   TYR H OH    1 
ATOM   9890  N  N     . SER H  1 42  ? -6.678  -13.870 -46.131 1.00 39.81 ? 41   SER H N     1 
ATOM   9891  C  CA    . SER H  1 42  ? -5.965  -14.013 -47.367 1.00 40.14 ? 41   SER H CA    1 
ATOM   9892  C  C     . SER H  1 42  ? -4.886  -12.939 -47.479 1.00 40.26 ? 41   SER H C     1 
ATOM   9893  O  O     . SER H  1 42  ? -5.026  -11.832 -46.943 1.00 39.89 ? 41   SER H O     1 
ATOM   9894  C  CB    . SER H  1 42  ? -6.927  -13.969 -48.555 1.00 40.29 ? 41   SER H CB    1 
ATOM   9895  O  OG    . SER H  1 42  ? -7.699  -12.782 -48.569 1.00 42.50 ? 41   SER H OG    1 
ATOM   9896  N  N     . ALA H  1 43  ? -3.800  -13.299 -48.159 1.00 40.23 ? 42   ALA H N     1 
ATOM   9897  C  CA    . ALA H  1 43  ? -2.726  -12.376 -48.466 1.00 40.48 ? 42   ALA H CA    1 
ATOM   9898  C  C     . ALA H  1 43  ? -2.139  -12.755 -49.808 1.00 40.67 ? 42   ALA H C     1 
ATOM   9899  O  O     . ALA H  1 43  ? -2.302  -13.882 -50.258 1.00 40.33 ? 42   ALA H O     1 
ATOM   9900  C  CB    . ALA H  1 43  ? -1.657  -12.422 -47.391 1.00 40.42 ? 42   ALA H CB    1 
ATOM   9901  N  N     . ASN H  1 44  ? -1.487  -11.793 -50.450 1.00 41.53 ? 43   ASN H N     1 
ATOM   9902  C  CA    . ASN H  1 44  ? -0.700  -12.044 -51.649 1.00 42.21 ? 43   ASN H CA    1 
ATOM   9903  C  C     . ASN H  1 44  ? 0.787   -12.036 -51.318 1.00 42.45 ? 43   ASN H C     1 
ATOM   9904  O  O     . ASN H  1 44  ? 1.253   -11.273 -50.471 1.00 42.22 ? 43   ASN H O     1 
ATOM   9905  C  CB    . ASN H  1 44  ? -1.007  -11.019 -52.746 1.00 42.54 ? 43   ASN H CB    1 
ATOM   9906  C  CG    . ASN H  1 44  ? -2.199  -11.426 -53.614 1.00 44.63 ? 43   ASN H CG    1 
ATOM   9907  O  OD1   . ASN H  1 44  ? -2.293  -12.577 -54.078 1.00 48.61 ? 43   ASN H OD1   1 
ATOM   9908  N  ND2   . ASN H  1 44  ? -3.110  -10.481 -53.847 1.00 46.15 ? 43   ASN H ND2   1 
ATOM   9909  N  N     . VAL H  1 45  ? 1.517   -12.922 -51.982 1.00 42.81 ? 44   VAL H N     1 
ATOM   9910  C  CA    . VAL H  1 45  ? 2.964   -12.968 -51.892 1.00 43.20 ? 44   VAL H CA    1 
ATOM   9911  C  C     . VAL H  1 45  ? 3.475   -13.121 -53.311 1.00 43.54 ? 44   VAL H C     1 
ATOM   9912  O  O     . VAL H  1 45  ? 2.787   -13.695 -54.158 1.00 43.73 ? 44   VAL H O     1 
ATOM   9913  C  CB    . VAL H  1 45  ? 3.429   -14.154 -51.034 1.00 43.29 ? 44   VAL H CB    1 
ATOM   9914  C  CG1   . VAL H  1 45  ? 4.937   -14.267 -51.056 1.00 43.91 ? 44   VAL H CG1   1 
ATOM   9915  C  CG2   . VAL H  1 45  ? 2.951   -13.988 -49.611 1.00 43.31 ? 44   VAL H CG2   1 
ATOM   9916  N  N     . MET H  1 46  ? 4.662   -12.586 -53.578 1.00 44.01 ? 45   MET H N     1 
ATOM   9917  C  CA    . MET H  1 46  ? 5.332   -12.782 -54.858 1.00 44.68 ? 45   MET H CA    1 
ATOM   9918  C  C     . MET H  1 46  ? 6.402   -13.864 -54.645 1.00 44.47 ? 45   MET H C     1 
ATOM   9919  O  O     . MET H  1 46  ? 7.187   -13.766 -53.702 1.00 44.73 ? 45   MET H O     1 
ATOM   9920  C  CB    . MET H  1 46  ? 5.948   -11.455 -55.323 1.00 45.03 ? 45   MET H CB    1 
ATOM   9921  C  CG    . MET H  1 46  ? 5.827   -11.184 -56.828 1.00 47.64 ? 45   MET H CG    1 
ATOM   9922  S  SD    . MET H  1 46  ? 4.128   -10.997 -57.454 1.00 52.68 ? 45   MET H SD    1 
ATOM   9923  C  CE    . MET H  1 46  ? 3.449   -9.828  -56.268 1.00 50.30 ? 45   MET H CE    1 
ATOM   9924  N  N     . VAL H  1 47  ? 6.408   -14.908 -55.475 1.00 44.47 ? 46   VAL H N     1 
ATOM   9925  C  CA    . VAL H  1 47  ? 7.374   -16.016 -55.335 1.00 44.70 ? 46   VAL H CA    1 
ATOM   9926  C  C     . VAL H  1 47  ? 8.196   -16.200 -56.622 1.00 45.44 ? 46   VAL H C     1 
ATOM   9927  O  O     . VAL H  1 47  ? 7.635   -16.470 -57.689 1.00 45.65 ? 46   VAL H O     1 
ATOM   9928  C  CB    . VAL H  1 47  ? 6.675   -17.355 -54.960 1.00 44.81 ? 46   VAL H CB    1 
ATOM   9929  C  CG1   . VAL H  1 47  ? 7.707   -18.456 -54.738 1.00 44.55 ? 46   VAL H CG1   1 
ATOM   9930  C  CG2   . VAL H  1 47  ? 5.822   -17.201 -53.709 1.00 43.23 ? 46   VAL H CG2   1 
ATOM   9931  N  N     . ASP H  1 48  ? 9.523   -16.054 -56.506 1.00 46.14 ? 47   ASP H N     1 
ATOM   9932  C  CA    . ASP H  1 48  ? 10.463  -16.043 -57.653 1.00 46.68 ? 47   ASP H CA    1 
ATOM   9933  C  C     . ASP H  1 48  ? 9.914   -15.274 -58.848 1.00 46.76 ? 47   ASP H C     1 
ATOM   9934  O  O     . ASP H  1 48  ? 10.048  -15.709 -59.999 1.00 46.59 ? 47   ASP H O     1 
ATOM   9935  C  CB    . ASP H  1 48  ? 10.869  -17.463 -58.081 1.00 46.84 ? 47   ASP H CB    1 
ATOM   9936  C  CG    . ASP H  1 48  ? 11.472  -18.275 -56.938 1.00 49.05 ? 47   ASP H CG    1 
ATOM   9937  O  OD1   . ASP H  1 48  ? 11.434  -19.522 -57.014 1.00 51.05 ? 47   ASP H OD1   1 
ATOM   9938  O  OD2   . ASP H  1 48  ? 11.971  -17.678 -55.956 1.00 52.07 ? 47   ASP H OD2   1 
ATOM   9939  N  N     . GLY H  1 49  ? 9.297   -14.128 -58.567 1.00 46.92 ? 48   GLY H N     1 
ATOM   9940  C  CA    . GLY H  1 49  ? 8.715   -13.294 -59.611 1.00 47.19 ? 48   GLY H CA    1 
ATOM   9941  C  C     . GLY H  1 49  ? 7.201   -13.369 -59.717 1.00 47.33 ? 48   GLY H C     1 
ATOM   9942  O  O     . GLY H  1 49  ? 6.560   -12.347 -59.957 1.00 48.06 ? 48   GLY H O     1 
ATOM   9943  N  N     . LYS H  1 50  ? 6.633   -14.562 -59.526 1.00 46.98 ? 49   LYS H N     1 
ATOM   9944  C  CA    . LYS H  1 50  ? 5.215   -14.816 -59.799 1.00 46.58 ? 49   LYS H CA    1 
ATOM   9945  C  C     . LYS H  1 50  ? 4.321   -14.646 -58.555 1.00 46.02 ? 49   LYS H C     1 
ATOM   9946  O  O     . LYS H  1 50  ? 4.753   -14.906 -57.431 1.00 45.58 ? 49   LYS H O     1 
ATOM   9947  C  CB    . LYS H  1 50  ? 5.043   -16.225 -60.384 1.00 46.72 ? 49   LYS H CB    1 
ATOM   9948  C  CG    . LYS H  1 50  ? 5.538   -16.354 -61.833 1.00 47.20 ? 49   LYS H CG    1 
ATOM   9949  C  CD    . LYS H  1 50  ? 5.825   -17.806 -62.224 1.00 47.25 ? 49   LYS H CD    1 
ATOM   9950  N  N     . PRO H  1 51  ? 3.064   -14.204 -58.759 1.00 45.46 ? 50   PRO H N     1 
ATOM   9951  C  CA    . PRO H  1 51  ? 2.118   -14.012 -57.665 1.00 44.91 ? 50   PRO H CA    1 
ATOM   9952  C  C     . PRO H  1 51  ? 1.465   -15.302 -57.178 1.00 44.54 ? 50   PRO H C     1 
ATOM   9953  O  O     . PRO H  1 51  ? 1.071   -16.161 -57.984 1.00 44.28 ? 50   PRO H O     1 
ATOM   9954  C  CB    . PRO H  1 51  ? 1.057   -13.109 -58.287 1.00 45.15 ? 50   PRO H CB    1 
ATOM   9955  C  CG    . PRO H  1 51  ? 1.045   -13.480 -59.705 1.00 45.23 ? 50   PRO H CG    1 
ATOM   9956  C  CD    . PRO H  1 51  ? 2.465   -13.847 -60.059 1.00 45.60 ? 50   PRO H CD    1 
ATOM   9957  N  N     . VAL H  1 52  ? 1.345   -15.414 -55.861 1.00 44.15 ? 51   VAL H N     1 
ATOM   9958  C  CA    . VAL H  1 52  ? 0.686   -16.538 -55.207 1.00 43.82 ? 51   VAL H CA    1 
ATOM   9959  C  C     . VAL H  1 52  ? -0.351  -15.978 -54.237 1.00 43.72 ? 51   VAL H C     1 
ATOM   9960  O  O     . VAL H  1 52  ? -0.062  -15.038 -53.498 1.00 43.90 ? 51   VAL H O     1 
ATOM   9961  C  CB    . VAL H  1 52  ? 1.707   -17.399 -54.442 1.00 43.52 ? 51   VAL H CB    1 
ATOM   9962  C  CG1   . VAL H  1 52  ? 1.015   -18.528 -53.708 1.00 43.60 ? 51   VAL H CG1   1 
ATOM   9963  C  CG2   . VAL H  1 52  ? 2.750   -17.926 -55.394 1.00 42.97 ? 51   VAL H CG2   1 
ATOM   9964  N  N     . ASN H  1 53  ? -1.562  -16.526 -54.260 1.00 43.82 ? 52   ASN H N     1 
ATOM   9965  C  CA    . ASN H  1 53  ? -2.574  -16.137 -53.286 1.00 44.22 ? 52   ASN H CA    1 
ATOM   9966  C  C     . ASN H  1 53  ? -2.464  -17.103 -52.126 1.00 43.78 ? 52   ASN H C     1 
ATOM   9967  O  O     . ASN H  1 53  ? -2.523  -18.320 -52.293 1.00 43.49 ? 52   ASN H O     1 
ATOM   9968  C  CB    . ASN H  1 53  ? -3.987  -16.134 -53.886 1.00 44.94 ? 52   ASN H CB    1 
ATOM   9969  C  CG    . ASN H  1 53  ? -5.085  -15.772 -52.850 1.00 47.98 ? 52   ASN H CG    1 
ATOM   9970  O  OD1   . ASN H  1 53  ? -6.064  -16.510 -52.696 1.00 53.08 ? 52   ASN H OD1   1 
ATOM   9971  N  ND2   . ASN H  1 53  ? -4.917  -14.643 -52.139 1.00 51.56 ? 52   ASN H ND2   1 
ATOM   9972  N  N     . LEU H  1 54  ? -2.269  -16.549 -50.942 1.00 43.34 ? 53   LEU H N     1 
ATOM   9973  C  CA    . LEU H  1 54  ? -2.085  -17.339 -49.756 1.00 43.03 ? 53   LEU H CA    1 
ATOM   9974  C  C     . LEU H  1 54  ? -3.364  -17.235 -48.946 1.00 42.17 ? 53   LEU H C     1 
ATOM   9975  O  O     . LEU H  1 54  ? -3.795  -16.132 -48.613 1.00 42.34 ? 53   LEU H O     1 
ATOM   9976  C  CB    . LEU H  1 54  ? -0.885  -16.795 -48.995 1.00 43.37 ? 53   LEU H CB    1 
ATOM   9977  C  CG    . LEU H  1 54  ? -0.509  -17.493 -47.691 1.00 44.39 ? 53   LEU H CG    1 
ATOM   9978  C  CD1   . LEU H  1 54  ? -0.353  -19.006 -47.873 1.00 45.35 ? 53   LEU H CD1   1 
ATOM   9979  C  CD2   . LEU H  1 54  ? 0.779   -16.837 -47.165 1.00 43.90 ? 53   LEU H CD2   1 
ATOM   9980  N  N     . GLY H  1 55  ? -3.995  -18.376 -48.686 1.00 41.15 ? 54   GLY H N     1 
ATOM   9981  C  CA    . GLY H  1 55  ? -5.185  -18.457 -47.839 1.00 40.57 ? 54   GLY H CA    1 
ATOM   9982  C  C     . GLY H  1 55  ? -4.836  -19.091 -46.503 1.00 40.27 ? 54   GLY H C     1 
ATOM   9983  O  O     . GLY H  1 55  ? -4.246  -20.159 -46.459 1.00 39.82 ? 54   GLY H O     1 
ATOM   9984  N  N     . LEU H  1 56  ? -5.218  -18.430 -45.410 1.00 40.33 ? 55   LEU H N     1 
ATOM   9985  C  CA    . LEU H  1 56  ? -4.832  -18.848 -44.063 1.00 40.27 ? 55   LEU H CA    1 
ATOM   9986  C  C     . LEU H  1 56  ? -6.080  -19.141 -43.226 1.00 40.23 ? 55   LEU H C     1 
ATOM   9987  O  O     . LEU H  1 56  ? -6.901  -18.261 -42.960 1.00 39.75 ? 55   LEU H O     1 
ATOM   9988  C  CB    . LEU H  1 56  ? -3.946  -17.783 -43.404 1.00 40.55 ? 55   LEU H CB    1 
ATOM   9989  C  CG    . LEU H  1 56  ? -2.716  -17.403 -44.237 1.00 41.47 ? 55   LEU H CG    1 
ATOM   9990  C  CD1   . LEU H  1 56  ? -2.093  -16.135 -43.745 1.00 42.16 ? 55   LEU H CD1   1 
ATOM   9991  C  CD2   . LEU H  1 56  ? -1.684  -18.550 -44.237 1.00 43.14 ? 55   LEU H CD2   1 
ATOM   9992  N  N     . TRP H  1 57  ? -6.204  -20.407 -42.832 1.00 40.25 ? 56   TRP H N     1 
ATOM   9993  C  CA    . TRP H  1 57  ? -7.382  -20.912 -42.133 1.00 39.88 ? 56   TRP H CA    1 
ATOM   9994  C  C     . TRP H  1 57  ? -7.026  -21.086 -40.668 1.00 39.34 ? 56   TRP H C     1 
ATOM   9995  O  O     . TRP H  1 57  ? -6.276  -21.980 -40.301 1.00 38.84 ? 56   TRP H O     1 
ATOM   9996  C  CB    . TRP H  1 57  ? -7.820  -22.222 -42.782 1.00 40.15 ? 56   TRP H CB    1 
ATOM   9997  C  CG    . TRP H  1 57  ? -8.207  -22.032 -44.228 1.00 41.19 ? 56   TRP H CG    1 
ATOM   9998  C  CD1   . TRP H  1 57  ? -7.423  -21.526 -45.245 1.00 41.13 ? 56   TRP H CD1   1 
ATOM   9999  C  CD2   . TRP H  1 57  ? -9.465  -22.337 -44.818 1.00 40.20 ? 56   TRP H CD2   1 
ATOM   10000 N  NE1   . TRP H  1 57  ? -8.125  -21.503 -46.412 1.00 40.67 ? 56   TRP H NE1   1 
ATOM   10001 C  CE2   . TRP H  1 57  ? -9.380  -21.996 -46.180 1.00 40.54 ? 56   TRP H CE2   1 
ATOM   10002 C  CE3   . TRP H  1 57  ? -10.657 -22.870 -44.323 1.00 40.50 ? 56   TRP H CE3   1 
ATOM   10003 C  CZ2   . TRP H  1 57  ? -10.442 -22.177 -47.061 1.00 41.18 ? 56   TRP H CZ2   1 
ATOM   10004 C  CZ3   . TRP H  1 57  ? -11.707 -23.046 -45.185 1.00 41.38 ? 56   TRP H CZ3   1 
ATOM   10005 C  CH2   . TRP H  1 57  ? -11.597 -22.701 -46.546 1.00 41.71 ? 56   TRP H CH2   1 
ATOM   10006 N  N     . ASP H  1 58  ? -7.563  -20.195 -39.837 1.00 39.04 ? 57   ASP H N     1 
ATOM   10007 C  CA    . ASP H  1 58  ? -7.202  -20.091 -38.428 1.00 38.73 ? 57   ASP H CA    1 
ATOM   10008 C  C     . ASP H  1 58  ? -8.252  -20.804 -37.551 1.00 38.71 ? 57   ASP H C     1 
ATOM   10009 O  O     . ASP H  1 58  ? -9.381  -20.332 -37.415 1.00 38.57 ? 57   ASP H O     1 
ATOM   10010 C  CB    . ASP H  1 58  ? -7.072  -18.604 -38.055 1.00 38.75 ? 57   ASP H CB    1 
ATOM   10011 C  CG    . ASP H  1 58  ? -6.461  -18.384 -36.685 1.00 38.94 ? 57   ASP H CG    1 
ATOM   10012 O  OD1   . ASP H  1 58  ? -5.928  -19.348 -36.104 1.00 37.47 ? 57   ASP H OD1   1 
ATOM   10013 O  OD2   . ASP H  1 58  ? -6.530  -17.233 -36.192 1.00 40.47 ? 57   ASP H OD2   1 
ATOM   10014 N  N     . THR H  1 59  ? -7.859  -21.932 -36.952 1.00 38.19 ? 58   THR H N     1 
ATOM   10015 C  CA    . THR H  1 59  ? -8.791  -22.798 -36.277 1.00 38.35 ? 58   THR H CA    1 
ATOM   10016 C  C     . THR H  1 59  ? -8.720  -22.708 -34.753 1.00 38.63 ? 58   THR H C     1 
ATOM   10017 O  O     . THR H  1 59  ? -7.763  -22.173 -34.167 1.00 38.74 ? 58   THR H O     1 
ATOM   10018 C  CB    . THR H  1 59  ? -8.583  -24.289 -36.687 1.00 38.57 ? 58   THR H CB    1 
ATOM   10019 O  OG1   . THR H  1 59  ? -7.293  -24.740 -36.245 1.00 38.61 ? 58   THR H OG1   1 
ATOM   10020 C  CG2   . THR H  1 59  ? -8.698  -24.451 -38.186 1.00 38.06 ? 58   THR H CG2   1 
ATOM   10021 N  N     . ALA H  1 60  ? -9.764  -23.256 -34.137 1.00 38.70 ? 59   ALA H N     1 
ATOM   10022 C  CA    . ALA H  1 60  ? -9.932  -23.250 -32.694 1.00 38.65 ? 59   ALA H CA    1 
ATOM   10023 C  C     . ALA H  1 60  ? -9.078  -24.311 -32.003 1.00 38.39 ? 59   ALA H C     1 
ATOM   10024 O  O     . ALA H  1 60  ? -9.147  -25.490 -32.315 1.00 38.60 ? 59   ALA H O     1 
ATOM   10025 C  CB    . ALA H  1 60  ? -11.416 -23.440 -32.349 1.00 38.80 ? 59   ALA H CB    1 
ATOM   10026 N  N     . GLY H  1 61  ? -8.254  -23.877 -31.059 1.00 38.39 ? 60   GLY H N     1 
ATOM   10027 C  CA    . GLY H  1 61  ? -7.573  -24.800 -30.160 1.00 38.30 ? 60   GLY H CA    1 
ATOM   10028 C  C     . GLY H  1 61  ? -8.505  -25.368 -29.103 1.00 38.46 ? 60   GLY H C     1 
ATOM   10029 O  O     . GLY H  1 61  ? -8.205  -26.397 -28.502 1.00 39.09 ? 60   GLY H O     1 
ATOM   10030 N  N     . GLN H  1 62  ? -9.623  -24.684 -28.851 1.00 38.63 ? 61   GLN H N     1 
ATOM   10031 C  CA    . GLN H  1 62  ? -10.624 -25.183 -27.923 1.00 38.60 ? 61   GLN H CA    1 
ATOM   10032 C  C     . GLN H  1 62  ? -11.223 -26.517 -28.377 1.00 39.14 ? 61   GLN H C     1 
ATOM   10033 O  O     . GLN H  1 62  ? -11.848 -26.629 -29.420 1.00 38.10 ? 61   GLN H O     1 
ATOM   10034 C  CB    . GLN H  1 62  ? -11.748 -24.177 -27.723 1.00 38.48 ? 61   GLN H CB    1 
ATOM   10035 C  CG    . GLN H  1 62  ? -11.394 -23.011 -26.851 1.00 38.51 ? 61   GLN H CG    1 
ATOM   10036 C  CD    . GLN H  1 62  ? -12.504 -21.991 -26.824 1.00 39.11 ? 61   GLN H CD    1 
ATOM   10037 O  OE1   . GLN H  1 62  ? -12.529 -21.075 -27.646 1.00 42.33 ? 61   GLN H OE1   1 
ATOM   10038 N  NE2   . GLN H  1 62  ? -13.446 -22.157 -25.906 1.00 37.20 ? 61   GLN H NE2   1 
ATOM   10039 N  N     . GLU H  1 63  ? -11.027 -27.508 -27.524 1.00 40.03 ? 62   GLU H N     1 
ATOM   10040 C  CA    . GLU H  1 63  ? -11.619 -28.820 -27.632 1.00 40.75 ? 62   GLU H CA    1 
ATOM   10041 C  C     . GLU H  1 63  ? -13.133 -28.796 -27.848 1.00 40.24 ? 62   GLU H C     1 
ATOM   10042 O  O     . GLU H  1 63  ? -13.673 -29.635 -28.564 1.00 39.87 ? 62   GLU H O     1 
ATOM   10043 C  CB    . GLU H  1 63  ? -11.301 -29.543 -26.325 1.00 41.26 ? 62   GLU H CB    1 
ATOM   10044 C  CG    . GLU H  1 63  ? -11.778 -30.932 -26.233 1.00 44.74 ? 62   GLU H CG    1 
ATOM   10045 C  CD    . GLU H  1 63  ? -11.144 -31.632 -25.033 1.00 49.74 ? 62   GLU H CD    1 
ATOM   10046 O  OE1   . GLU H  1 63  ? -10.882 -30.941 -24.012 1.00 51.13 ? 62   GLU H OE1   1 
ATOM   10047 O  OE2   . GLU H  1 63  ? -10.903 -32.855 -25.134 1.00 51.72 ? 62   GLU H OE2   1 
ATOM   10048 N  N     . ASP H  1 64  ? -13.813 -27.839 -27.220 1.00 40.08 ? 63   ASP H N     1 
ATOM   10049 C  CA    . ASP H  1 64  ? -15.252 -27.658 -27.411 1.00 39.83 ? 63   ASP H CA    1 
ATOM   10050 C  C     . ASP H  1 64  ? -15.658 -27.414 -28.878 1.00 39.69 ? 63   ASP H C     1 
ATOM   10051 O  O     . ASP H  1 64  ? -16.833 -27.600 -29.241 1.00 40.20 ? 63   ASP H O     1 
ATOM   10052 C  CB    . ASP H  1 64  ? -15.753 -26.480 -26.553 1.00 40.27 ? 63   ASP H CB    1 
ATOM   10053 C  CG    . ASP H  1 64  ? -16.040 -26.870 -25.087 1.00 40.74 ? 63   ASP H CG    1 
ATOM   10054 O  OD1   . ASP H  1 64  ? -15.768 -28.014 -24.652 1.00 37.46 ? 63   ASP H OD1   1 
ATOM   10055 O  OD2   . ASP H  1 64  ? -16.560 -25.990 -24.366 1.00 41.06 ? 63   ASP H OD2   1 
ATOM   10056 N  N     . TYR H  1 65  ? -14.732 -26.937 -29.706 1.00 39.21 ? 64   TYR H N     1 
ATOM   10057 C  CA    . TYR H  1 65  ? -15.015 -26.725 -31.132 1.00 39.03 ? 64   TYR H CA    1 
ATOM   10058 C  C     . TYR H  1 65  ? -14.453 -27.843 -32.019 1.00 38.91 ? 64   TYR H C     1 
ATOM   10059 O  O     . TYR H  1 65  ? -14.334 -27.671 -33.226 1.00 39.54 ? 64   TYR H O     1 
ATOM   10060 C  CB    . TYR H  1 65  ? -14.540 -25.339 -31.586 1.00 38.83 ? 64   TYR H CB    1 
ATOM   10061 C  CG    . TYR H  1 65  ? -15.392 -24.260 -30.976 1.00 39.70 ? 64   TYR H CG    1 
ATOM   10062 C  CD1   . TYR H  1 65  ? -14.851 -23.295 -30.134 1.00 40.17 ? 64   TYR H CD1   1 
ATOM   10063 C  CD2   . TYR H  1 65  ? -16.775 -24.244 -31.196 1.00 39.38 ? 64   TYR H CD2   1 
ATOM   10064 C  CE1   . TYR H  1 65  ? -15.661 -22.307 -29.555 1.00 40.32 ? 64   TYR H CE1   1 
ATOM   10065 C  CE2   . TYR H  1 65  ? -17.583 -23.277 -30.621 1.00 40.28 ? 64   TYR H CE2   1 
ATOM   10066 C  CZ    . TYR H  1 65  ? -17.027 -22.315 -29.799 1.00 39.39 ? 64   TYR H CZ    1 
ATOM   10067 O  OH    . TYR H  1 65  ? -17.853 -21.373 -29.233 1.00 38.63 ? 64   TYR H OH    1 
ATOM   10068 N  N     . ASP H  1 66  ? -14.183 -29.001 -31.424 1.00 38.91 ? 65   ASP H N     1 
ATOM   10069 C  CA    . ASP H  1 66  ? -13.726 -30.182 -32.164 1.00 38.66 ? 65   ASP H CA    1 
ATOM   10070 C  C     . ASP H  1 66  ? -14.551 -30.476 -33.430 1.00 38.60 ? 65   ASP H C     1 
ATOM   10071 O  O     . ASP H  1 66  ? -13.981 -30.841 -34.449 1.00 38.17 ? 65   ASP H O     1 
ATOM   10072 C  CB    . ASP H  1 66  ? -13.715 -31.418 -31.248 1.00 38.58 ? 65   ASP H CB    1 
ATOM   10073 C  CG    . ASP H  1 66  ? -12.408 -31.556 -30.439 1.00 40.28 ? 65   ASP H CG    1 
ATOM   10074 O  OD1   . ASP H  1 66  ? -11.452 -30.771 -30.674 1.00 40.01 ? 65   ASP H OD1   1 
ATOM   10075 O  OD2   . ASP H  1 66  ? -12.341 -32.470 -29.567 1.00 41.23 ? 65   ASP H OD2   1 
ATOM   10076 N  N     . ARG H  1 67  ? -15.869 -30.308 -33.356 1.00 38.14 ? 66   ARG H N     1 
ATOM   10077 C  CA    . ARG H  1 67  ? -16.774 -30.650 -34.460 1.00 38.98 ? 66   ARG H CA    1 
ATOM   10078 C  C     . ARG H  1 67  ? -16.702 -29.707 -35.657 1.00 38.31 ? 66   ARG H C     1 
ATOM   10079 O  O     . ARG H  1 67  ? -17.063 -30.089 -36.752 1.00 38.27 ? 66   ARG H O     1 
ATOM   10080 C  CB    . ARG H  1 67  ? -18.230 -30.716 -33.974 1.00 38.70 ? 66   ARG H CB    1 
ATOM   10081 C  CG    . ARG H  1 67  ? -18.849 -29.350 -33.608 1.00 40.12 ? 66   ARG H CG    1 
ATOM   10082 C  CD    . ARG H  1 67  ? -20.218 -29.523 -32.945 1.00 40.95 ? 66   ARG H CD    1 
ATOM   10083 N  NE    . ARG H  1 67  ? -20.853 -28.259 -32.557 1.00 42.05 ? 66   ARG H NE    1 
ATOM   10084 C  CZ    . ARG H  1 67  ? -20.554 -27.552 -31.466 1.00 43.74 ? 66   ARG H CZ    1 
ATOM   10085 N  NH1   . ARG H  1 67  ? -19.586 -27.942 -30.640 1.00 44.80 ? 66   ARG H NH1   1 
ATOM   10086 N  NH2   . ARG H  1 67  ? -21.232 -26.432 -31.203 1.00 43.82 ? 66   ARG H NH2   1 
ATOM   10087 N  N     . LEU H  1 68  ? -16.257 -28.476 -35.441 1.00 38.40 ? 67   LEU H N     1 
ATOM   10088 C  CA    . LEU H  1 68  ? -16.121 -27.493 -36.526 1.00 38.25 ? 67   LEU H CA    1 
ATOM   10089 C  C     . LEU H  1 68  ? -14.760 -27.614 -37.235 1.00 38.47 ? 67   LEU H C     1 
ATOM   10090 O  O     . LEU H  1 68  ? -14.634 -27.281 -38.409 1.00 38.80 ? 67   LEU H O     1 
ATOM   10091 C  CB    . LEU H  1 68  ? -16.290 -26.070 -35.959 1.00 38.34 ? 67   LEU H CB    1 
ATOM   10092 C  CG    . LEU H  1 68  ? -16.272 -24.850 -36.905 1.00 38.28 ? 67   LEU H CG    1 
ATOM   10093 C  CD1   . LEU H  1 68  ? -17.523 -24.817 -37.764 1.00 37.59 ? 67   LEU H CD1   1 
ATOM   10094 C  CD2   . LEU H  1 68  ? -16.125 -23.533 -36.126 1.00 37.91 ? 67   LEU H CD2   1 
ATOM   10095 N  N     . ARG H  1 69  ? -13.734 -28.067 -36.527 1.00 38.62 ? 68   ARG H N     1 
ATOM   10096 C  CA    . ARG H  1 69  ? -12.373 -27.951 -37.040 1.00 38.95 ? 68   ARG H CA    1 
ATOM   10097 C  C     . ARG H  1 69  ? -12.162 -28.654 -38.382 1.00 38.82 ? 68   ARG H C     1 
ATOM   10098 O  O     . ARG H  1 69  ? -11.631 -28.047 -39.326 1.00 39.38 ? 68   ARG H O     1 
ATOM   10099 C  CB    . ARG H  1 69  ? -11.349 -28.441 -36.011 1.00 38.96 ? 68   ARG H CB    1 
ATOM   10100 C  CG    . ARG H  1 69  ? -9.998  -27.785 -36.180 1.00 39.57 ? 68   ARG H CG    1 
ATOM   10101 C  CD    . ARG H  1 69  ? -9.019  -28.127 -35.073 1.00 40.11 ? 68   ARG H CD    1 
ATOM   10102 N  NE    . ARG H  1 69  ? -9.555  -27.814 -33.748 1.00 41.52 ? 68   ARG H NE    1 
ATOM   10103 C  CZ    . ARG H  1 69  ? -10.086 -28.707 -32.913 1.00 41.76 ? 68   ARG H CZ    1 
ATOM   10104 N  NH1   . ARG H  1 69  ? -10.186 -29.991 -33.260 1.00 41.14 ? 68   ARG H NH1   1 
ATOM   10105 N  NH2   . ARG H  1 69  ? -10.543 -28.304 -31.727 1.00 41.79 ? 68   ARG H NH2   1 
ATOM   10106 N  N     . PRO H  1 70  ? -12.561 -29.932 -38.486 1.00 38.86 ? 69   PRO H N     1 
ATOM   10107 C  CA    . PRO H  1 70  ? -12.275 -30.648 -39.716 1.00 39.03 ? 69   PRO H CA    1 
ATOM   10108 C  C     . PRO H  1 70  ? -12.949 -30.127 -40.985 1.00 38.82 ? 69   PRO H C     1 
ATOM   10109 O  O     . PRO H  1 70  ? -12.591 -30.578 -42.060 1.00 38.90 ? 69   PRO H O     1 
ATOM   10110 C  CB    . PRO H  1 70  ? -12.736 -32.073 -39.402 1.00 38.64 ? 69   PRO H CB    1 
ATOM   10111 C  CG    . PRO H  1 70  ? -12.733 -32.152 -37.935 1.00 38.84 ? 69   PRO H CG    1 
ATOM   10112 C  CD    . PRO H  1 70  ? -13.204 -30.830 -37.511 1.00 39.26 ? 69   PRO H CD    1 
ATOM   10113 N  N     . LEU H  1 71  ? -13.884 -29.188 -40.877 1.00 38.92 ? 70   LEU H N     1 
ATOM   10114 C  CA    . LEU H  1 71  ? -14.486 -28.587 -42.070 1.00 38.89 ? 70   LEU H CA    1 
ATOM   10115 C  C     . LEU H  1 71  ? -13.468 -27.759 -42.838 1.00 38.62 ? 70   LEU H C     1 
ATOM   10116 O  O     . LEU H  1 71  ? -13.682 -27.490 -44.021 1.00 38.68 ? 70   LEU H O     1 
ATOM   10117 C  CB    . LEU H  1 71  ? -15.692 -27.695 -41.732 1.00 38.82 ? 70   LEU H CB    1 
ATOM   10118 C  CG    . LEU H  1 71  ? -16.927 -28.331 -41.100 1.00 39.22 ? 70   LEU H CG    1 
ATOM   10119 C  CD1   . LEU H  1 71  ? -18.021 -27.298 -40.926 1.00 39.27 ? 70   LEU H CD1   1 
ATOM   10120