data_2OZ6
# 
_entry.id   2OZ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OZ6         
RCSB  RCSB041766   
WWPDB D_1000041766 
# 
_pdbx_database_status.entry_id                        2OZ6 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-24 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cordes, T.J.' 1 
'Bright, A.R.' 2 
'Forest, K.T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of the Pseudomonas aeruginosa Virulence Factor Regulator.' 
_citation.journal_abbrev            J.Bacteriol. 
_citation.journal_volume            193 
_citation.page_first                4069 
_citation.page_last                 4074 
_citation.year                      2011 
_citation.journal_id_ASTM           JOBAAY 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9193 
_citation.journal_id_CSD            0767 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21665969 
_citation.pdbx_database_id_DOI      10.1128/JB.00666-10 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cordes, T.J.'   1 
primary 'Worzalla, G.A.' 2 
primary 'Ginster, A.M.'  3 
primary 'Forest, K.T.'   4 
# 
_cell.length_a           69.950 
_cell.length_b           69.950 
_cell.length_c           147.490 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2OZ6 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'I 41' 
_symmetry.entry_id                         2OZ6 
_symmetry.Int_Tables_number                80 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Virulence Factor Regulator'           23542.246 1  ? ? ? ? 
2 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 329.206   2  ? ? ? ? 
3 water       nat water                                  18.015    13 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEKEGSEQER
SAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDG
MQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGTR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEKEGSEQER
SAWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDG
MQIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGTR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LEU n 
1 4   LYS n 
1 5   HIS n 
1 6   LEU n 
1 7   ASP n 
1 8   LYS n 
1 9   LEU n 
1 10  LEU n 
1 11  ALA n 
1 12  HIS n 
1 13  CYS n 
1 14  HIS n 
1 15  ARG n 
1 16  ARG n 
1 17  ARG n 
1 18  TYR n 
1 19  THR n 
1 20  ALA n 
1 21  LYS n 
1 22  SER n 
1 23  THR n 
1 24  ILE n 
1 25  ILE n 
1 26  TYR n 
1 27  ALA n 
1 28  GLY n 
1 29  ASP n 
1 30  ARG n 
1 31  CYS n 
1 32  GLU n 
1 33  THR n 
1 34  LEU n 
1 35  PHE n 
1 36  PHE n 
1 37  ILE n 
1 38  ILE n 
1 39  LYS n 
1 40  GLY n 
1 41  SER n 
1 42  VAL n 
1 43  THR n 
1 44  ILE n 
1 45  LEU n 
1 46  ILE n 
1 47  GLU n 
1 48  ASP n 
1 49  ASP n 
1 50  ASP n 
1 51  GLY n 
1 52  ARG n 
1 53  GLU n 
1 54  MET n 
1 55  ILE n 
1 56  ILE n 
1 57  GLY n 
1 58  TYR n 
1 59  LEU n 
1 60  ASN n 
1 61  SER n 
1 62  GLY n 
1 63  ASP n 
1 64  PHE n 
1 65  PHE n 
1 66  GLY n 
1 67  GLU n 
1 68  LEU n 
1 69  GLY n 
1 70  LEU n 
1 71  PHE n 
1 72  GLU n 
1 73  LYS n 
1 74  GLU n 
1 75  GLY n 
1 76  SER n 
1 77  GLU n 
1 78  GLN n 
1 79  GLU n 
1 80  ARG n 
1 81  SER n 
1 82  ALA n 
1 83  TRP n 
1 84  VAL n 
1 85  ARG n 
1 86  ALA n 
1 87  LYS n 
1 88  VAL n 
1 89  GLU n 
1 90  CYS n 
1 91  GLU n 
1 92  VAL n 
1 93  ALA n 
1 94  GLU n 
1 95  ILE n 
1 96  SER n 
1 97  TYR n 
1 98  ALA n 
1 99  LYS n 
1 100 PHE n 
1 101 ARG n 
1 102 GLU n 
1 103 LEU n 
1 104 SER n 
1 105 GLN n 
1 106 GLN n 
1 107 ASP n 
1 108 SER n 
1 109 GLU n 
1 110 ILE n 
1 111 LEU n 
1 112 TYR n 
1 113 THR n 
1 114 LEU n 
1 115 GLY n 
1 116 SER n 
1 117 GLN n 
1 118 MET n 
1 119 ALA n 
1 120 ASP n 
1 121 ARG n 
1 122 LEU n 
1 123 ARG n 
1 124 LYS n 
1 125 THR n 
1 126 THR n 
1 127 ARG n 
1 128 LYS n 
1 129 VAL n 
1 130 GLY n 
1 131 ASP n 
1 132 LEU n 
1 133 ALA n 
1 134 PHE n 
1 135 LEU n 
1 136 ASP n 
1 137 VAL n 
1 138 THR n 
1 139 GLY n 
1 140 ARG n 
1 141 VAL n 
1 142 ALA n 
1 143 ARG n 
1 144 THR n 
1 145 LEU n 
1 146 LEU n 
1 147 ASP n 
1 148 LEU n 
1 149 CYS n 
1 150 GLN n 
1 151 GLN n 
1 152 PRO n 
1 153 ASP n 
1 154 ALA n 
1 155 MET n 
1 156 THR n 
1 157 HIS n 
1 158 PRO n 
1 159 ASP n 
1 160 GLY n 
1 161 MET n 
1 162 GLN n 
1 163 ILE n 
1 164 LYS n 
1 165 ILE n 
1 166 THR n 
1 167 ARG n 
1 168 GLN n 
1 169 GLU n 
1 170 ILE n 
1 171 GLY n 
1 172 ARG n 
1 173 ILE n 
1 174 VAL n 
1 175 GLY n 
1 176 CYS n 
1 177 SER n 
1 178 ARG n 
1 179 GLU n 
1 180 MET n 
1 181 VAL n 
1 182 GLY n 
1 183 ARG n 
1 184 VAL n 
1 185 LEU n 
1 186 LYS n 
1 187 SER n 
1 188 LEU n 
1 189 GLU n 
1 190 GLU n 
1 191 GLN n 
1 192 GLY n 
1 193 LEU n 
1 194 VAL n 
1 195 HIS n 
1 196 VAL n 
1 197 LYS n 
1 198 GLY n 
1 199 LYS n 
1 200 THR n 
1 201 MET n 
1 202 VAL n 
1 203 VAL n 
1 204 PHE n 
1 205 GLY n 
1 206 THR n 
1 207 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pseudomonas 
_entity_src_gen.pdbx_gene_src_gene                 vfr 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PAK 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     287 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) DELTA CRP' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VFR_PSEAE 
_struct_ref.pdbx_db_accession          P55222 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KLKHLDKLLAHCHRRRYTAKSTIIYAGDRCETLFFIIKGSVTILIEDDDGREMIIGYLNSGDFFGELGLFEKEGSEQERS
AWVRAKVECEVAEISYAKFRELSQQDSEILYTLGSQMADRLRKTTRKVGDLAFLDVTGRVARTLLDLCQQPDAMTHPDGM
QIKITRQEIGRIVGCSREMVGRVLKSLEEQGLVHVKGKTMVVFGTR
;
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2OZ6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 207 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P55222 
_struct_ref_seq.db_align_beg                  9 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  214 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       9 
_struct_ref_seq.pdbx_auth_seq_align_end       214 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2OZ6 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P55222 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING METHIONINE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            8 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2OZ6 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.83 
_exptl_crystal.density_percent_sol   67.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    'Sodium malonate, Sodium acetate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 98 ? 1 
2 ?  ? 1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'BRUKER PROTEUM' 
_diffrn_detector.pdbx_collection_date   2005-01-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Montel 200 Multilayer Graded mirrors' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2OZ6 
_reflns.d_resolution_high            2.800 
_reflns.d_resolution_low             32.000 
_reflns.number_obs                   8735 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_netI_over_sigmaI        8.500 
_reflns.pdbx_chi_squared             1.026 
_reflns.pdbx_redundancy              5.000 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              0.095 
_reflns.B_iso_Wilson_estimate        54.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    3.79 
_reflns_shell.pdbx_Rsym_value        0.377 
_reflns_shell.pdbx_chi_squared       0.881 
_reflns_shell.pdbx_redundancy        4.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      876 
_reflns_shell.percent_possible_all   99.50 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OZ6 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.700 
_refine.ls_number_reflns_obs                     8706 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  413 
_refine.B_iso_mean                               40.832 
_refine.solvent_model_param_bsol                 35.926 
_refine.overall_FOM_work_R_set                   0.812 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1G6N, chain A' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2OZ6 
_refine_analyze.Luzzati_coordinate_error_obs    0.2958 
_refine_analyze.Luzzati_sigma_a_obs             0.405 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.422 
_refine_analyze.Luzzati_sigma_a_free            0.575 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1596 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               1653 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.009 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_d    ? 1.404 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.433 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 2.258 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.333 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 3.458 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.800 2.930  8 . 1026 . 0.271 0.341 . 47 . . 1073 . 'X-RAY DIFFRACTION' 
2.930 3.080  8 . 1022 . 0.254 0.356 . 65 . . 1087 . 'X-RAY DIFFRACTION' 
3.080 3.270  8 . 1039 . 0.243 0.356 . 51 . . 1090 . 'X-RAY DIFFRACTION' 
3.270 3.530  8 . 1043 . 0.219 0.305 . 45 . . 1088 . 'X-RAY DIFFRACTION' 
3.530 3.880  8 . 1038 . 0.161 0.204 . 51 . . 1089 . 'X-RAY DIFFRACTION' 
3.880 4.440  8 . 1042 . 0.148 0.191 . 55 . . 1097 . 'X-RAY DIFFRACTION' 
4.440 5.590  8 . 1026 . 0.161 0.183 . 51 . . 1077 . 'X-RAY DIFFRACTION' 
5.590 30.000 8 . 1057 . 0.185 0.268 . 48 . . 1105 . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param cmp.top     'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 ion.param         ion.top     'X-RAY DIFFRACTION' 
5 cmp.par           ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OZ6 
_struct.title                     
'Crystal Structure of Virulence Factor Regulator from Pseudomonas aeruginosa in complex with cAMP' 
_struct.pdbx_descriptor           'Cyclic AMP receptor-like protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OZ6 
_struct_keywords.text            
;winged helix, helix-turn-helix, transcription factor, cAMP-binding proteins, cAMP Receptor Protein, nucleotide binding proteins, DNA-binding proteins, DNA BINDING PROTEIN
;
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 2   ? HIS A 12  ? LYS A 9   HIS A 19  1 ? 11 
HELX_P HELX_P2 2 TYR A 97  ? ASP A 107 ? TYR A 104 ASP A 114 1 ? 11 
HELX_P HELX_P3 3 ASP A 107 ? LEU A 135 ? ASP A 114 LEU A 142 1 ? 29 
HELX_P HELX_P4 4 ASP A 136 ? CYS A 149 ? ASP A 143 CYS A 156 1 ? 14 
HELX_P HELX_P5 5 THR A 166 ? GLY A 175 ? THR A 173 GLY A 182 1 ? 10 
HELX_P HELX_P6 6 SER A 177 ? GLN A 191 ? SER A 184 GLN A 198 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 14  ? TYR A 18  ? HIS A 21  TYR A 25  
A 2 CYS A 90  ? SER A 96  ? CYS A 97  SER A 103 
A 3 THR A 33  ? LYS A 39  ? THR A 40  LYS A 46  
A 4 PHE A 64  ? PHE A 65  ? PHE A 71  PHE A 72  
B 1 THR A 23  ? ILE A 25  ? THR A 30  ILE A 32  
B 2 TRP A 83  ? ALA A 86  ? TRP A 90  ALA A 93  
B 3 SER A 41  ? GLU A 47  ? SER A 48  GLU A 54  
B 4 GLU A 53  ? ASN A 60  ? GLU A 60  ASN A 67  
C 1 MET A 155 ? HIS A 157 ? MET A 162 HIS A 164 
C 2 GLY A 160 ? LYS A 164 ? GLY A 167 LYS A 171 
C 3 THR A 200 ? PHE A 204 ? THR A 207 PHE A 211 
C 4 VAL A 194 ? LYS A 197 ? VAL A 201 LYS A 204 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 16  ? N ARG A 23  O VAL A 92  ? O VAL A 99  
A 2 3 O ILE A 95  ? O ILE A 102 N LEU A 34  ? N LEU A 41  
A 3 4 N PHE A 35  ? N PHE A 42  O PHE A 65  ? O PHE A 72  
B 1 2 N ILE A 24  ? N ILE A 31  O VAL A 84  ? O VAL A 91  
B 2 3 O ARG A 85  ? O ARG A 92  N THR A 43  ? N THR A 50  
B 3 4 N ILE A 46  ? N ILE A 53  O MET A 54  ? O MET A 61  
C 1 2 N MET A 155 ? N MET A 162 O GLN A 162 ? O GLN A 169 
C 2 3 N MET A 161 ? N MET A 168 O VAL A 203 ? O VAL A 210 
C 3 4 O THR A 200 ? O THR A 207 N LYS A 197 ? N LYS A 204 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CMP A 302' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CMP A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ARG A 52  ? ARG A 59  . ? 1_555 ? 
2  AC1 10 GLU A 53  ? GLU A 60  . ? 1_555 ? 
3  AC1 10 ALA A 133 ? ALA A 140 . ? 6_465 ? 
4  AC1 10 GLN A 168 ? GLN A 175 . ? 1_555 ? 
5  AC1 10 GLY A 171 ? GLY A 178 . ? 1_555 ? 
6  AC1 10 ARG A 172 ? ARG A 179 . ? 1_555 ? 
7  AC1 10 GLY A 175 ? GLY A 182 . ? 1_555 ? 
8  AC1 10 CYS A 176 ? CYS A 183 . ? 1_555 ? 
9  AC1 10 SER A 177 ? SER A 184 . ? 1_555 ? 
10 AC1 10 ARG A 178 ? ARG A 185 . ? 1_555 ? 
11 AC2 15 CYS A 31  ? CYS A 38  . ? 1_555 ? 
12 AC2 15 ILE A 56  ? ILE A 63  . ? 1_555 ? 
13 AC2 15 PHE A 65  ? PHE A 72  . ? 1_555 ? 
14 AC2 15 GLY A 66  ? GLY A 73  . ? 1_555 ? 
15 AC2 15 GLU A 67  ? GLU A 74  . ? 1_555 ? 
16 AC2 15 LEU A 68  ? LEU A 75  . ? 1_555 ? 
17 AC2 15 GLY A 69  ? GLY A 76  . ? 1_555 ? 
18 AC2 15 ARG A 80  ? ARG A 87  . ? 1_555 ? 
19 AC2 15 SER A 81  ? SER A 88  . ? 1_555 ? 
20 AC2 15 ALA A 82  ? ALA A 89  . ? 1_555 ? 
21 AC2 15 ARG A 121 ? ARG A 128 . ? 1_555 ? 
22 AC2 15 LEU A 122 ? LEU A 129 . ? 6_465 ? 
23 AC2 15 THR A 125 ? THR A 132 . ? 1_555 ? 
24 AC2 15 THR A 126 ? THR A 133 . ? 6_465 ? 
25 AC2 15 HOH D .   ? HOH A 311 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2OZ6 
_atom_sites.fract_transf_matrix[1][1]   0.014296 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014296 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006780 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? -27.155 26.574 -17.876 1.00 44.54 ? 8   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? -26.120 27.323 -18.638 1.00 43.31 ? 8   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? -25.146 26.360 -19.319 1.00 43.05 ? 8   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? -24.789 25.315 -18.771 1.00 41.37 ? 8   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? -25.347 28.253 -17.707 1.00 41.76 ? 8   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? -24.440 29.201 -18.435 1.00 41.76 ? 8   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? -23.354 30.096 -17.344 1.00 41.95 ? 8   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? -24.325 31.579 -17.098 1.00 43.71 ? 8   MET A CE    1 
ATOM   9    N N     . LYS A 1 2   ? -24.721 26.723 -20.523 1.00 43.67 ? 9   LYS A N     1 
ATOM   10   C CA    . LYS A 1 2   ? -23.797 25.894 -21.286 1.00 42.99 ? 9   LYS A CA    1 
ATOM   11   C C     . LYS A 1 2   ? -22.411 26.538 -21.343 1.00 41.15 ? 9   LYS A C     1 
ATOM   12   O O     . LYS A 1 2   ? -22.270 27.754 -21.144 1.00 36.29 ? 9   LYS A O     1 
ATOM   13   C CB    . LYS A 1 2   ? -24.332 25.694 -22.707 1.00 44.01 ? 9   LYS A CB    1 
ATOM   14   C CG    . LYS A 1 2   ? -25.760 25.187 -22.784 1.00 43.48 ? 9   LYS A CG    1 
ATOM   15   C CD    . LYS A 1 2   ? -25.909 23.841 -22.103 1.00 45.71 ? 9   LYS A CD    1 
ATOM   16   C CE    . LYS A 1 2   ? -27.333 23.343 -22.214 1.00 46.98 ? 9   LYS A CE    1 
ATOM   17   N NZ    . LYS A 1 2   ? -27.717 22.590 -20.991 1.00 48.94 ? 9   LYS A NZ    1 
ATOM   18   N N     . LEU A 1 3   ? -21.400 25.713 -21.628 1.00 40.04 ? 10  LEU A N     1 
ATOM   19   C CA    . LEU A 1 3   ? -20.019 26.196 -21.715 1.00 38.57 ? 10  LEU A CA    1 
ATOM   20   C C     . LEU A 1 3   ? -19.887 27.396 -22.635 1.00 38.28 ? 10  LEU A C     1 
ATOM   21   O O     . LEU A 1 3   ? -19.036 28.259 -22.419 1.00 37.01 ? 10  LEU A O     1 
ATOM   22   C CB    . LEU A 1 3   ? -19.094 25.088 -22.212 1.00 38.14 ? 10  LEU A CB    1 
ATOM   23   C CG    . LEU A 1 3   ? -17.595 25.375 -22.079 1.00 38.45 ? 10  LEU A CG    1 
ATOM   24   C CD1   . LEU A 1 3   ? -17.248 25.608 -20.616 1.00 39.01 ? 10  LEU A CD1   1 
ATOM   25   C CD2   . LEU A 1 3   ? -16.785 24.207 -22.613 1.00 38.38 ? 10  LEU A CD2   1 
ATOM   26   N N     . LYS A 1 4   ? -20.731 27.443 -23.666 1.00 39.77 ? 11  LYS A N     1 
ATOM   27   C CA    . LYS A 1 4   ? -20.710 28.534 -24.632 1.00 38.71 ? 11  LYS A CA    1 
ATOM   28   C C     . LYS A 1 4   ? -21.176 29.836 -24.007 1.00 38.15 ? 11  LYS A C     1 
ATOM   29   O O     . LYS A 1 4   ? -20.753 30.919 -24.405 1.00 38.46 ? 11  LYS A O     1 
ATOM   30   C CB    . LYS A 1 4   ? -21.580 28.189 -25.842 1.00 40.08 ? 11  LYS A CB    1 
ATOM   31   C CG    . LYS A 1 4   ? -23.031 27.892 -25.526 1.00 44.12 ? 11  LYS A CG    1 
ATOM   32   C CD    . LYS A 1 4   ? -23.812 27.555 -26.792 1.00 46.66 ? 11  LYS A CD    1 
ATOM   33   C CE    . LYS A 1 4   ? -25.299 27.352 -26.505 1.00 48.11 ? 11  LYS A CE    1 
ATOM   34   N NZ    . LYS A 1 4   ? -26.006 26.753 -27.673 1.00 50.33 ? 11  LYS A NZ    1 
ATOM   35   N N     . HIS A 1 5   ? -22.043 29.733 -23.013 1.00 37.94 ? 12  HIS A N     1 
ATOM   36   C CA    . HIS A 1 5   ? -22.546 30.922 -22.354 1.00 38.18 ? 12  HIS A CA    1 
ATOM   37   C C     . HIS A 1 5   ? -21.508 31.487 -21.402 1.00 37.58 ? 12  HIS A C     1 
ATOM   38   O O     . HIS A 1 5   ? -21.363 32.706 -21.256 1.00 37.75 ? 12  HIS A O     1 
ATOM   39   C CB    . HIS A 1 5   ? -23.831 30.576 -21.613 1.00 40.21 ? 12  HIS A CB    1 
ATOM   40   C CG    . HIS A 1 5   ? -24.885 29.991 -22.495 1.00 39.93 ? 12  HIS A CG    1 
ATOM   41   N ND1   . HIS A 1 5   ? -25.394 28.724 -22.308 1.00 39.45 ? 12  HIS A ND1   1 
ATOM   42   C CD2   . HIS A 1 5   ? -25.510 30.494 -23.586 1.00 39.29 ? 12  HIS A CD2   1 
ATOM   43   C CE1   . HIS A 1 5   ? -26.289 28.471 -23.246 1.00 40.82 ? 12  HIS A CE1   1 
ATOM   44   N NE2   . HIS A 1 5   ? -26.376 29.528 -24.037 1.00 41.44 ? 12  HIS A NE2   1 
ATOM   45   N N     . LEU A 1 6   ? -20.780 30.586 -20.752 1.00 36.49 ? 13  LEU A N     1 
ATOM   46   C CA    . LEU A 1 6   ? -19.741 30.971 -19.817 1.00 35.42 ? 13  LEU A CA    1 
ATOM   47   C C     . LEU A 1 6   ? -18.692 31.727 -20.614 1.00 33.88 ? 13  LEU A C     1 
ATOM   48   O O     . LEU A 1 6   ? -18.232 32.804 -20.227 1.00 32.86 ? 13  LEU A O     1 
ATOM   49   C CB    . LEU A 1 6   ? -19.134 29.709 -19.187 1.00 38.09 ? 13  LEU A CB    1 
ATOM   50   C CG    . LEU A 1 6   ? -17.893 29.823 -18.290 1.00 37.65 ? 13  LEU A CG    1 
ATOM   51   C CD1   . LEU A 1 6   ? -18.223 30.666 -17.067 1.00 38.54 ? 13  LEU A CD1   1 
ATOM   52   C CD2   . LEU A 1 6   ? -17.432 28.438 -17.883 1.00 34.92 ? 13  LEU A CD2   1 
ATOM   53   N N     . ASP A 1 7   ? -18.339 31.139 -21.745 1.00 34.23 ? 14  ASP A N     1 
ATOM   54   C CA    . ASP A 1 7   ? -17.350 31.701 -22.652 1.00 35.22 ? 14  ASP A CA    1 
ATOM   55   C C     . ASP A 1 7   ? -17.637 33.167 -22.967 1.00 34.83 ? 14  ASP A C     1 
ATOM   56   O O     . ASP A 1 7   ? -16.739 34.013 -22.935 1.00 33.01 ? 14  ASP A O     1 
ATOM   57   C CB    . ASP A 1 7   ? -17.332 30.884 -23.943 1.00 36.80 ? 14  ASP A CB    1 
ATOM   58   C CG    . ASP A 1 7   ? -16.349 31.420 -24.949 1.00 39.33 ? 14  ASP A CG    1 
ATOM   59   O OD1   . ASP A 1 7   ? -15.134 31.375 -24.663 1.00 40.28 ? 14  ASP A OD1   1 
ATOM   60   O OD2   . ASP A 1 7   ? -16.796 31.893 -26.020 1.00 42.01 ? 14  ASP A OD2   1 
ATOM   61   N N     . LYS A 1 8   ? -18.898 33.453 -23.279 1.00 35.87 ? 15  LYS A N     1 
ATOM   62   C CA    . LYS A 1 8   ? -19.333 34.803 -23.605 1.00 35.88 ? 15  LYS A CA    1 
ATOM   63   C C     . LYS A 1 8   ? -19.212 35.740 -22.426 1.00 36.85 ? 15  LYS A C     1 
ATOM   64   O O     . LYS A 1 8   ? -18.658 36.837 -22.546 1.00 38.24 ? 15  LYS A O     1 
ATOM   65   C CB    . LYS A 1 8   ? -20.783 34.801 -24.067 1.00 38.44 ? 15  LYS A CB    1 
ATOM   66   C CG    . LYS A 1 8   ? -21.060 33.997 -25.312 1.00 40.61 ? 15  LYS A CG    1 
ATOM   67   C CD    . LYS A 1 8   ? -22.423 34.363 -25.847 1.00 42.70 ? 15  LYS A CD    1 
ATOM   68   C CE    . LYS A 1 8   ? -22.729 33.658 -27.146 1.00 44.45 ? 15  LYS A CE    1 
ATOM   69   N NZ    . LYS A 1 8   ? -23.925 34.304 -27.780 1.00 49.45 ? 15  LYS A NZ    1 
ATOM   70   N N     . LEU A 1 9   ? -19.759 35.318 -21.285 1.00 36.41 ? 16  LEU A N     1 
ATOM   71   C CA    . LEU A 1 9   ? -19.705 36.123 -20.071 1.00 36.81 ? 16  LEU A CA    1 
ATOM   72   C C     . LEU A 1 9   ? -18.256 36.498 -19.751 1.00 35.18 ? 16  LEU A C     1 
ATOM   73   O O     . LEU A 1 9   ? -17.957 37.651 -19.431 1.00 33.66 ? 16  LEU A O     1 
ATOM   74   C CB    . LEU A 1 9   ? -20.308 35.336 -18.902 1.00 39.13 ? 16  LEU A CB    1 
ATOM   75   C CG    . LEU A 1 9   ? -21.797 34.976 -18.950 1.00 38.90 ? 16  LEU A CG    1 
ATOM   76   C CD1   . LEU A 1 9   ? -22.091 33.918 -17.916 1.00 39.18 ? 16  LEU A CD1   1 
ATOM   77   C CD2   . LEU A 1 9   ? -22.641 36.215 -18.707 1.00 38.97 ? 16  LEU A CD2   1 
ATOM   78   N N     . LEU A 1 10  ? -17.360 35.518 -19.851 1.00 33.57 ? 17  LEU A N     1 
ATOM   79   C CA    . LEU A 1 10  ? -15.955 35.754 -19.570 1.00 35.12 ? 17  LEU A CA    1 
ATOM   80   C C     . LEU A 1 10  ? -15.288 36.632 -20.624 1.00 37.08 ? 17  LEU A C     1 
ATOM   81   O O     . LEU A 1 10  ? -14.201 37.163 -20.391 1.00 37.80 ? 17  LEU A O     1 
ATOM   82   C CB    . LEU A 1 10  ? -15.209 34.429 -19.454 1.00 32.23 ? 17  LEU A CB    1 
ATOM   83   C CG    . LEU A 1 10  ? -15.673 33.461 -18.367 1.00 31.21 ? 17  LEU A CG    1 
ATOM   84   C CD1   . LEU A 1 10  ? -14.763 32.238 -18.372 1.00 30.98 ? 17  LEU A CD1   1 
ATOM   85   C CD2   . LEU A 1 10  ? -15.641 34.130 -17.007 1.00 29.30 ? 17  LEU A CD2   1 
ATOM   86   N N     . ALA A 1 11  ? -15.942 36.778 -21.774 1.00 38.73 ? 18  ALA A N     1 
ATOM   87   C CA    . ALA A 1 11  ? -15.430 37.600 -22.864 1.00 38.35 ? 18  ALA A CA    1 
ATOM   88   C C     . ALA A 1 11  ? -15.908 39.047 -22.751 1.00 39.89 ? 18  ALA A C     1 
ATOM   89   O O     . ALA A 1 11  ? -15.425 39.930 -23.471 1.00 40.58 ? 18  ALA A O     1 
ATOM   90   C CB    . ALA A 1 11  ? -15.861 37.024 -24.171 1.00 36.50 ? 18  ALA A CB    1 
ATOM   91   N N     . HIS A 1 12  ? -16.846 39.290 -21.837 1.00 41.21 ? 19  HIS A N     1 
ATOM   92   C CA    . HIS A 1 12  ? -17.392 40.624 -21.644 1.00 41.97 ? 19  HIS A CA    1 
ATOM   93   C C     . HIS A 1 12  ? -17.397 41.068 -20.194 1.00 41.63 ? 19  HIS A C     1 
ATOM   94   O O     . HIS A 1 12  ? -18.411 41.538 -19.684 1.00 39.95 ? 19  HIS A O     1 
ATOM   95   C CB    . HIS A 1 12  ? -18.811 40.682 -22.198 1.00 43.81 ? 19  HIS A CB    1 
ATOM   96   C CG    . HIS A 1 12  ? -18.894 40.366 -23.660 1.00 47.73 ? 19  HIS A CG    1 
ATOM   97   N ND1   . HIS A 1 12  ? -19.067 39.082 -24.137 1.00 48.76 ? 19  HIS A ND1   1 
ATOM   98   C CD2   . HIS A 1 12  ? -18.773 41.160 -24.749 1.00 45.97 ? 19  HIS A CD2   1 
ATOM   99   C CE1   . HIS A 1 12  ? -19.048 39.097 -25.455 1.00 48.17 ? 19  HIS A CE1   1 
ATOM   100  N NE2   . HIS A 1 12  ? -18.869 40.345 -25.852 1.00 48.99 ? 19  HIS A NE2   1 
ATOM   101  N N     . CYS A 1 13  ? -16.251 40.955 -19.538 1.00 42.69 ? 20  CYS A N     1 
ATOM   102  C CA    . CYS A 1 13  ? -16.166 41.327 -18.135 1.00 42.78 ? 20  CYS A CA    1 
ATOM   103  C C     . CYS A 1 13  ? -14.813 41.892 -17.723 1.00 44.18 ? 20  CYS A C     1 
ATOM   104  O O     . CYS A 1 13  ? -13.875 41.972 -18.522 1.00 43.38 ? 20  CYS A O     1 
ATOM   105  C CB    . CYS A 1 13  ? -16.444 40.099 -17.266 1.00 41.55 ? 20  CYS A CB    1 
ATOM   106  S SG    . CYS A 1 13  ? -15.075 38.910 -17.289 1.00 35.10 ? 20  CYS A SG    1 
ATOM   107  N N     . HIS A 1 14  ? -14.740 42.276 -16.455 1.00 45.37 ? 21  HIS A N     1 
ATOM   108  C CA    . HIS A 1 14  ? -13.523 42.783 -15.857 1.00 45.43 ? 21  HIS A CA    1 
ATOM   109  C C     . HIS A 1 14  ? -13.150 41.767 -14.770 1.00 45.03 ? 21  HIS A C     1 
ATOM   110  O O     . HIS A 1 14  ? -13.851 41.658 -13.764 1.00 45.95 ? 21  HIS A O     1 
ATOM   111  C CB    . HIS A 1 14  ? -13.760 44.158 -15.232 1.00 46.57 ? 21  HIS A CB    1 
ATOM   112  C CG    . HIS A 1 14  ? -12.600 44.648 -14.418 1.00 50.91 ? 21  HIS A CG    1 
ATOM   113  N ND1   . HIS A 1 14  ? -12.753 45.264 -13.192 1.00 51.65 ? 21  HIS A ND1   1 
ATOM   114  C CD2   . HIS A 1 14  ? -11.265 44.571 -14.635 1.00 49.78 ? 21  HIS A CD2   1 
ATOM   115  C CE1   . HIS A 1 14  ? -11.562 45.541 -12.691 1.00 51.11 ? 21  HIS A CE1   1 
ATOM   116  N NE2   . HIS A 1 14  ? -10.644 45.130 -13.547 1.00 50.43 ? 21  HIS A NE2   1 
ATOM   117  N N     . ARG A 1 15  ? -12.075 41.004 -14.982 1.00 45.36 ? 22  ARG A N     1 
ATOM   118  C CA    . ARG A 1 15  ? -11.646 40.018 -13.989 1.00 45.29 ? 22  ARG A CA    1 
ATOM   119  C C     . ARG A 1 15  ? -11.038 40.704 -12.782 1.00 46.16 ? 22  ARG A C     1 
ATOM   120  O O     . ARG A 1 15  ? -10.492 41.804 -12.889 1.00 46.60 ? 22  ARG A O     1 
ATOM   121  C CB    . ARG A 1 15  ? -10.588 39.065 -14.526 1.00 46.76 ? 22  ARG A CB    1 
ATOM   122  C CG    . ARG A 1 15  ? -11.034 38.084 -15.560 1.00 48.75 ? 22  ARG A CG    1 
ATOM   123  C CD    . ARG A 1 15  ? -10.383 36.716 -15.334 1.00 50.96 ? 22  ARG A CD    1 
ATOM   124  N NE    . ARG A 1 15  ? -8.960  36.733 -14.950 1.00 51.32 ? 22  ARG A NE    1 
ATOM   125  C CZ    . ARG A 1 15  ? -7.958  37.229 -15.681 1.00 50.75 ? 22  ARG A CZ    1 
ATOM   126  N NH1   . ARG A 1 15  ? -8.180  37.783 -16.868 1.00 49.28 ? 22  ARG A NH1   1 
ATOM   127  N NH2   . ARG A 1 15  ? -6.712  37.140 -15.232 1.00 49.97 ? 22  ARG A NH2   1 
ATOM   128  N N     . ARG A 1 16  ? -11.129 40.034 -11.640 1.00 47.17 ? 23  ARG A N     1 
ATOM   129  C CA    . ARG A 1 16  ? -10.584 40.531 -10.377 1.00 47.90 ? 23  ARG A CA    1 
ATOM   130  C C     . ARG A 1 16  ? -10.307 39.377 -9.429  1.00 47.17 ? 23  ARG A C     1 
ATOM   131  O O     . ARG A 1 16  ? -11.108 38.448 -9.319  1.00 46.13 ? 23  ARG A O     1 
ATOM   132  C CB    . ARG A 1 16  ? -11.555 41.492 -9.684  1.00 50.57 ? 23  ARG A CB    1 
ATOM   133  C CG    . ARG A 1 16  ? -11.554 42.909 -10.226 1.00 54.01 ? 23  ARG A CG    1 
ATOM   134  C CD    . ARG A 1 16  ? -11.542 43.908 -9.072  1.00 57.21 ? 23  ARG A CD    1 
ATOM   135  N NE    . ARG A 1 16  ? -10.478 43.598 -8.101  1.00 58.44 ? 23  ARG A NE    1 
ATOM   136  C CZ    . ARG A 1 16  ? -10.201 44.327 -7.020  1.00 56.84 ? 23  ARG A CZ    1 
ATOM   137  N NH1   . ARG A 1 16  ? -10.901 45.428 -6.739  1.00 55.23 ? 23  ARG A NH1   1 
ATOM   138  N NH2   . ARG A 1 16  ? -9.227  43.948 -6.207  1.00 54.50 ? 23  ARG A NH2   1 
ATOM   139  N N     . ARG A 1 17  ? -9.155  39.422 -8.769  1.00 46.38 ? 24  ARG A N     1 
ATOM   140  C CA    . ARG A 1 17  ? -8.819  38.401 -7.799  1.00 45.08 ? 24  ARG A CA    1 
ATOM   141  C C     . ARG A 1 17  ? -8.977  39.101 -6.461  1.00 42.95 ? 24  ARG A C     1 
ATOM   142  O O     . ARG A 1 17  ? -8.579  40.254 -6.302  1.00 41.63 ? 24  ARG A O     1 
ATOM   143  C CB    . ARG A 1 17  ? -7.380  37.903 -7.950  1.00 46.91 ? 24  ARG A CB    1 
ATOM   144  C CG    . ARG A 1 17  ? -7.017  36.835 -6.911  1.00 52.04 ? 24  ARG A CG    1 
ATOM   145  C CD    . ARG A 1 17  ? -5.516  36.624 -6.759  1.00 56.25 ? 24  ARG A CD    1 
ATOM   146  N NE    . ARG A 1 17  ? -4.878  36.075 -7.962  1.00 63.72 ? 24  ARG A NE    1 
ATOM   147  C CZ    . ARG A 1 17  ? -5.111  34.861 -8.468  1.00 66.48 ? 24  ARG A CZ    1 
ATOM   148  N NH1   . ARG A 1 17  ? -5.978  34.037 -7.880  1.00 66.80 ? 24  ARG A NH1   1 
ATOM   149  N NH2   . ARG A 1 17  ? -4.469  34.460 -9.565  1.00 66.42 ? 24  ARG A NH2   1 
ATOM   150  N N     . TYR A 1 18  ? -9.604  38.420 -5.509  1.00 41.97 ? 25  TYR A N     1 
ATOM   151  C CA    . TYR A 1 18  ? -9.794  38.971 -4.176  1.00 39.29 ? 25  TYR A CA    1 
ATOM   152  C C     . TYR A 1 18  ? -9.151  38.016 -3.209  1.00 38.93 ? 25  TYR A C     1 
ATOM   153  O O     . TYR A 1 18  ? -9.263  36.803 -3.345  1.00 40.27 ? 25  TYR A O     1 
ATOM   154  C CB    . TYR A 1 18  ? -11.269 39.117 -3.855  1.00 37.19 ? 25  TYR A CB    1 
ATOM   155  C CG    . TYR A 1 18  ? -11.915 40.274 -4.552  1.00 35.68 ? 25  TYR A CG    1 
ATOM   156  C CD1   . TYR A 1 18  ? -11.955 41.530 -3.958  1.00 35.47 ? 25  TYR A CD1   1 
ATOM   157  C CD2   . TYR A 1 18  ? -12.486 40.117 -5.821  1.00 36.22 ? 25  TYR A CD2   1 
ATOM   158  C CE1   . TYR A 1 18  ? -12.555 42.607 -4.603  1.00 35.68 ? 25  TYR A CE1   1 
ATOM   159  C CE2   . TYR A 1 18  ? -13.086 41.182 -6.481  1.00 34.49 ? 25  TYR A CE2   1 
ATOM   160  C CZ    . TYR A 1 18  ? -13.122 42.423 -5.862  1.00 35.68 ? 25  TYR A CZ    1 
ATOM   161  O OH    . TYR A 1 18  ? -13.759 43.481 -6.473  1.00 36.22 ? 25  TYR A OH    1 
ATOM   162  N N     . THR A 1 19  ? -8.441  38.565 -2.236  1.00 39.71 ? 26  THR A N     1 
ATOM   163  C CA    . THR A 1 19  ? -7.779  37.736 -1.256  1.00 39.85 ? 26  THR A CA    1 
ATOM   164  C C     . THR A 1 19  ? -8.800  37.453 -0.167  1.00 40.11 ? 26  THR A C     1 
ATOM   165  O O     . THR A 1 19  ? -9.708  38.257 0.058   1.00 42.02 ? 26  THR A O     1 
ATOM   166  C CB    . THR A 1 19  ? -6.533  38.457 -0.716  1.00 38.98 ? 26  THR A CB    1 
ATOM   167  O OG1   . THR A 1 19  ? -6.875  39.789 -0.320  1.00 39.36 ? 26  THR A OG1   1 
ATOM   168  C CG2   . THR A 1 19  ? -5.473  38.528 -1.804  1.00 37.59 ? 26  THR A CG2   1 
ATOM   169  N N     . ALA A 1 20  ? -8.685  36.300 0.488   1.00 38.23 ? 27  ALA A N     1 
ATOM   170  C CA    . ALA A 1 20  ? -9.641  35.944 1.529   1.00 37.75 ? 27  ALA A CA    1 
ATOM   171  C C     . ALA A 1 20  ? -9.897  37.095 2.484   1.00 36.29 ? 27  ALA A C     1 
ATOM   172  O O     . ALA A 1 20  ? -8.987  37.837 2.840   1.00 34.58 ? 27  ALA A O     1 
ATOM   173  C CB    . ALA A 1 20  ? -9.164  34.718 2.295   1.00 36.66 ? 27  ALA A CB    1 
ATOM   174  N N     . LYS A 1 21  ? -11.161 37.234 2.865   1.00 37.32 ? 28  LYS A N     1 
ATOM   175  C CA    . LYS A 1 21  ? -11.631 38.266 3.790   1.00 40.77 ? 28  LYS A CA    1 
ATOM   176  C C     . LYS A 1 21  ? -11.842 39.654 3.201   1.00 37.98 ? 28  LYS A C     1 
ATOM   177  O O     . LYS A 1 21  ? -12.412 40.529 3.854   1.00 37.79 ? 28  LYS A O     1 
ATOM   178  C CB    . LYS A 1 21  ? -10.709 38.342 5.012   1.00 43.58 ? 28  LYS A CB    1 
ATOM   179  C CG    . LYS A 1 21  ? -10.869 37.150 5.939   1.00 45.86 ? 28  LYS A CG    1 
ATOM   180  C CD    . LYS A 1 21  ? -9.693  37.016 6.887   1.00 49.80 ? 28  LYS A CD    1 
ATOM   181  C CE    . LYS A 1 21  ? -9.818  35.738 7.706   1.00 52.42 ? 28  LYS A CE    1 
ATOM   182  N NZ    . LYS A 1 21  ? -8.634  35.527 8.590   1.00 54.23 ? 28  LYS A NZ    1 
ATOM   183  N N     . SER A 1 22  ? -11.398 39.857 1.972   1.00 37.15 ? 29  SER A N     1 
ATOM   184  C CA    . SER A 1 22  ? -11.582 41.146 1.325   1.00 37.40 ? 29  SER A CA    1 
ATOM   185  C C     . SER A 1 22  ? -13.061 41.347 1.015   1.00 36.65 ? 29  SER A C     1 
ATOM   186  O O     . SER A 1 22  ? -13.768 40.393 0.710   1.00 37.27 ? 29  SER A O     1 
ATOM   187  C CB    . SER A 1 22  ? -10.787 41.200 0.031   1.00 37.53 ? 29  SER A CB    1 
ATOM   188  O OG    . SER A 1 22  ? -9.413  41.002 0.288   1.00 42.83 ? 29  SER A OG    1 
ATOM   189  N N     . THR A 1 23  ? -13.525 42.586 1.103   1.00 34.82 ? 30  THR A N     1 
ATOM   190  C CA    . THR A 1 23  ? -14.911 42.892 0.801   1.00 35.21 ? 30  THR A CA    1 
ATOM   191  C C     . THR A 1 23  ? -15.078 43.107 -0.700  1.00 37.26 ? 30  THR A C     1 
ATOM   192  O O     . THR A 1 23  ? -14.356 43.904 -1.306  1.00 37.29 ? 30  THR A O     1 
ATOM   193  C CB    . THR A 1 23  ? -15.367 44.159 1.502   1.00 33.31 ? 30  THR A CB    1 
ATOM   194  O OG1   . THR A 1 23  ? -15.255 43.974 2.918   1.00 35.61 ? 30  THR A OG1   1 
ATOM   195  C CG2   . THR A 1 23  ? -16.802 44.490 1.125   1.00 31.97 ? 30  THR A CG2   1 
ATOM   196  N N     . ILE A 1 24  ? -16.018 42.393 -1.307  1.00 36.40 ? 31  ILE A N     1 
ATOM   197  C CA    . ILE A 1 24  ? -16.241 42.556 -2.732  1.00 35.93 ? 31  ILE A CA    1 
ATOM   198  C C     . ILE A 1 24  ? -17.391 43.540 -2.935  1.00 35.50 ? 31  ILE A C     1 
ATOM   199  O O     . ILE A 1 24  ? -17.375 44.338 -3.866  1.00 34.79 ? 31  ILE A O     1 
ATOM   200  C CB    . ILE A 1 24  ? -16.572 41.212 -3.403  1.00 34.81 ? 31  ILE A CB    1 
ATOM   201  C CG1   . ILE A 1 24  ? -15.424 40.230 -3.173  1.00 33.35 ? 31  ILE A CG1   1 
ATOM   202  C CG2   . ILE A 1 24  ? -16.826 41.419 -4.896  1.00 32.52 ? 31  ILE A CG2   1 
ATOM   203  C CD1   . ILE A 1 24  ? -15.715 38.817 -3.647  1.00 32.02 ? 31  ILE A CD1   1 
ATOM   204  N N     . ILE A 1 25  ? -18.384 43.479 -2.054  1.00 34.96 ? 32  ILE A N     1 
ATOM   205  C CA    . ILE A 1 25  ? -19.520 44.377 -2.143  1.00 35.22 ? 32  ILE A CA    1 
ATOM   206  C C     . ILE A 1 25  ? -19.833 44.993 -0.793  1.00 36.17 ? 32  ILE A C     1 
ATOM   207  O O     . ILE A 1 25  ? -19.825 44.310 0.243   1.00 36.19 ? 32  ILE A O     1 
ATOM   208  C CB    . ILE A 1 25  ? -20.785 43.656 -2.659  1.00 34.97 ? 32  ILE A CB    1 
ATOM   209  C CG1   . ILE A 1 25  ? -20.676 43.416 -4.165  1.00 36.15 ? 32  ILE A CG1   1 
ATOM   210  C CG2   . ILE A 1 25  ? -22.023 44.493 -2.360  1.00 34.07 ? 32  ILE A CG2   1 
ATOM   211  C CD1   . ILE A 1 25  ? -21.861 42.692 -4.761  1.00 36.13 ? 32  ILE A CD1   1 
ATOM   212  N N     . TYR A 1 26  ? -20.101 46.293 -0.809  1.00 35.37 ? 33  TYR A N     1 
ATOM   213  C CA    . TYR A 1 26  ? -20.445 47.007 0.410   1.00 35.58 ? 33  TYR A CA    1 
ATOM   214  C C     . TYR A 1 26  ? -21.940 47.281 0.436   1.00 34.18 ? 33  TYR A C     1 
ATOM   215  O O     . TYR A 1 26  ? -22.503 47.839 -0.511  1.00 32.89 ? 33  TYR A O     1 
ATOM   216  C CB    . TYR A 1 26  ? -19.673 48.326 0.491   1.00 35.94 ? 33  TYR A CB    1 
ATOM   217  C CG    . TYR A 1 26  ? -18.179 48.142 0.590   1.00 37.31 ? 33  TYR A CG    1 
ATOM   218  C CD1   . TYR A 1 26  ? -17.401 47.968 -0.557  1.00 39.62 ? 33  TYR A CD1   1 
ATOM   219  C CD2   . TYR A 1 26  ? -17.544 48.105 1.831   1.00 36.55 ? 33  TYR A CD2   1 
ATOM   220  C CE1   . TYR A 1 26  ? -16.017 47.759 -0.466  1.00 39.32 ? 33  TYR A CE1   1 
ATOM   221  C CE2   . TYR A 1 26  ? -16.173 47.898 1.934   1.00 37.85 ? 33  TYR A CE2   1 
ATOM   222  C CZ    . TYR A 1 26  ? -15.414 47.728 0.781   1.00 39.43 ? 33  TYR A CZ    1 
ATOM   223  O OH    . TYR A 1 26  ? -14.053 47.541 0.861   1.00 41.52 ? 33  TYR A OH    1 
ATOM   224  N N     . ALA A 1 27  ? -22.596 46.869 1.513   1.00 32.46 ? 34  ALA A N     1 
ATOM   225  C CA    . ALA A 1 27  ? -24.023 47.116 1.616   1.00 34.50 ? 34  ALA A CA    1 
ATOM   226  C C     . ALA A 1 27  ? -24.261 48.630 1.467   1.00 36.30 ? 34  ALA A C     1 
ATOM   227  O O     . ALA A 1 27  ? -23.531 49.453 2.043   1.00 36.83 ? 34  ALA A O     1 
ATOM   228  C CB    . ALA A 1 27  ? -24.536 46.624 2.944   1.00 28.73 ? 34  ALA A CB    1 
ATOM   229  N N     . GLY A 1 28  ? -25.257 49.006 0.680   1.00 36.04 ? 35  GLY A N     1 
ATOM   230  C CA    . GLY A 1 28  ? -25.536 50.417 0.516   1.00 35.98 ? 35  GLY A CA    1 
ATOM   231  C C     . GLY A 1 28  ? -25.024 51.019 -0.773  1.00 36.64 ? 35  GLY A C     1 
ATOM   232  O O     . GLY A 1 28  ? -25.627 51.955 -1.283  1.00 37.22 ? 35  GLY A O     1 
ATOM   233  N N     . ASP A 1 29  ? -23.922 50.496 -1.301  1.00 37.96 ? 36  ASP A N     1 
ATOM   234  C CA    . ASP A 1 29  ? -23.366 51.015 -2.546  1.00 40.81 ? 36  ASP A CA    1 
ATOM   235  C C     . ASP A 1 29  ? -24.363 50.895 -3.689  1.00 44.36 ? 36  ASP A C     1 
ATOM   236  O O     . ASP A 1 29  ? -25.242 50.036 -3.675  1.00 44.59 ? 36  ASP A O     1 
ATOM   237  C CB    . ASP A 1 29  ? -22.077 50.281 -2.915  1.00 39.46 ? 36  ASP A CB    1 
ATOM   238  C CG    . ASP A 1 29  ? -20.879 50.753 -2.106  1.00 38.51 ? 36  ASP A CG    1 
ATOM   239  O OD1   . ASP A 1 29  ? -19.771 50.196 -2.298  1.00 37.67 ? 36  ASP A OD1   1 
ATOM   240  O OD2   . ASP A 1 29  ? -21.042 51.679 -1.281  1.00 35.73 ? 36  ASP A OD2   1 
ATOM   241  N N     . ARG A 1 30  ? -24.231 51.767 -4.687  1.00 48.04 ? 37  ARG A N     1 
ATOM   242  C CA    . ARG A 1 30  ? -25.148 51.729 -5.812  1.00 52.13 ? 37  ARG A CA    1 
ATOM   243  C C     . ARG A 1 30  ? -24.814 50.520 -6.675  1.00 52.45 ? 37  ARG A C     1 
ATOM   244  O O     . ARG A 1 30  ? -23.648 50.230 -6.923  1.00 51.62 ? 37  ARG A O     1 
ATOM   245  C CB    . ARG A 1 30  ? -25.044 53.014 -6.644  1.00 54.68 ? 37  ARG A CB    1 
ATOM   246  C CG    . ARG A 1 30  ? -26.366 53.443 -7.305  1.00 60.71 ? 37  ARG A CG    1 
ATOM   247  C CD    . ARG A 1 30  ? -27.135 54.469 -6.444  1.00 64.98 ? 37  ARG A CD    1 
ATOM   248  N NE    . ARG A 1 30  ? -28.514 54.675 -6.890  1.00 68.65 ? 37  ARG A NE    1 
ATOM   249  C CZ    . ARG A 1 30  ? -28.865 55.025 -8.130  1.00 70.31 ? 37  ARG A CZ    1 
ATOM   250  N NH1   . ARG A 1 30  ? -27.932 55.212 -9.054  1.00 70.82 ? 37  ARG A NH1   1 
ATOM   251  N NH2   . ARG A 1 30  ? -30.149 55.183 -8.439  1.00 70.34 ? 37  ARG A NH2   1 
ATOM   252  N N     . CYS A 1 31  ? -25.847 49.809 -7.119  1.00 53.65 ? 38  CYS A N     1 
ATOM   253  C CA    . CYS A 1 31  ? -25.672 48.627 -7.959  1.00 52.98 ? 38  CYS A CA    1 
ATOM   254  C C     . CYS A 1 31  ? -25.438 49.071 -9.390  1.00 53.30 ? 38  CYS A C     1 
ATOM   255  O O     . CYS A 1 31  ? -26.158 49.926 -9.891  1.00 54.95 ? 38  CYS A O     1 
ATOM   256  C CB    . CYS A 1 31  ? -26.927 47.763 -7.925  1.00 52.71 ? 38  CYS A CB    1 
ATOM   257  S SG    . CYS A 1 31  ? -27.491 47.302 -6.289  1.00 53.60 ? 38  CYS A SG    1 
ATOM   258  N N     . GLU A 1 32  ? -24.452 48.488 -10.058 1.00 52.36 ? 39  GLU A N     1 
ATOM   259  C CA    . GLU A 1 32  ? -24.180 48.862 -11.435 1.00 50.46 ? 39  GLU A CA    1 
ATOM   260  C C     . GLU A 1 32  ? -23.748 47.631 -12.222 1.00 48.58 ? 39  GLU A C     1 
ATOM   261  O O     . GLU A 1 32  ? -23.875 47.585 -13.446 1.00 45.97 ? 39  GLU A O     1 
ATOM   262  C CB    . GLU A 1 32  ? -23.081 49.919 -11.471 1.00 54.53 ? 39  GLU A CB    1 
ATOM   263  C CG    . GLU A 1 32  ? -23.241 50.983 -12.554 1.00 59.12 ? 39  GLU A CG    1 
ATOM   264  C CD    . GLU A 1 32  ? -23.683 52.323 -11.989 1.00 62.38 ? 39  GLU A CD    1 
ATOM   265  O OE1   . GLU A 1 32  ? -23.172 52.692 -10.900 1.00 63.91 ? 39  GLU A OE1   1 
ATOM   266  O OE2   . GLU A 1 32  ? -24.523 53.004 -12.630 1.00 63.12 ? 39  GLU A OE2   1 
ATOM   267  N N     . THR A 1 33  ? -23.251 46.625 -11.509 1.00 46.89 ? 40  THR A N     1 
ATOM   268  C CA    . THR A 1 33  ? -22.777 45.389 -12.134 1.00 43.36 ? 40  THR A CA    1 
ATOM   269  C C     . THR A 1 33  ? -23.110 44.159 -11.299 1.00 41.48 ? 40  THR A C     1 
ATOM   270  O O     . THR A 1 33  ? -23.617 44.271 -10.188 1.00 42.24 ? 40  THR A O     1 
ATOM   271  C CB    . THR A 1 33  ? -21.255 45.412 -12.277 1.00 41.59 ? 40  THR A CB    1 
ATOM   272  O OG1   . THR A 1 33  ? -20.670 45.397 -10.976 1.00 38.28 ? 40  THR A OG1   1 
ATOM   273  C CG2   . THR A 1 33  ? -20.805 46.660 -12.995 1.00 40.64 ? 40  THR A CG2   1 
ATOM   274  N N     . LEU A 1 34  ? -22.836 42.982 -11.850 1.00 39.97 ? 41  LEU A N     1 
ATOM   275  C CA    . LEU A 1 34  ? -23.033 41.735 -11.122 1.00 39.07 ? 41  LEU A CA    1 
ATOM   276  C C     . LEU A 1 34  ? -21.786 40.872 -11.326 1.00 39.15 ? 41  LEU A C     1 
ATOM   277  O O     . LEU A 1 34  ? -21.022 41.073 -12.277 1.00 38.67 ? 41  LEU A O     1 
ATOM   278  C CB    . LEU A 1 34  ? -24.316 40.997 -11.546 1.00 39.39 ? 41  LEU A CB    1 
ATOM   279  C CG    . LEU A 1 34  ? -24.664 40.442 -12.928 1.00 39.43 ? 41  LEU A CG    1 
ATOM   280  C CD1   . LEU A 1 34  ? -23.674 39.376 -13.371 1.00 39.84 ? 41  LEU A CD1   1 
ATOM   281  C CD2   . LEU A 1 34  ? -26.064 39.849 -12.841 1.00 36.61 ? 41  LEU A CD2   1 
ATOM   282  N N     . PHE A 1 35  ? -21.573 39.919 -10.427 1.00 37.17 ? 42  PHE A N     1 
ATOM   283  C CA    . PHE A 1 35  ? -20.386 39.088 -10.485 1.00 32.51 ? 42  PHE A CA    1 
ATOM   284  C C     . PHE A 1 35  ? -20.631 37.616 -10.723 1.00 31.96 ? 42  PHE A C     1 
ATOM   285  O O     . PHE A 1 35  ? -21.718 37.105 -10.471 1.00 31.71 ? 42  PHE A O     1 
ATOM   286  C CB    . PHE A 1 35  ? -19.608 39.248 -9.190  1.00 28.27 ? 42  PHE A CB    1 
ATOM   287  C CG    . PHE A 1 35  ? -19.313 40.676 -8.832  1.00 28.29 ? 42  PHE A CG    1 
ATOM   288  C CD1   . PHE A 1 35  ? -17.998 41.148 -8.837  1.00 26.66 ? 42  PHE A CD1   1 
ATOM   289  C CD2   . PHE A 1 35  ? -20.336 41.545 -8.440  1.00 26.52 ? 42  PHE A CD2   1 
ATOM   290  C CE1   . PHE A 1 35  ? -17.705 42.459 -8.454  1.00 24.52 ? 42  PHE A CE1   1 
ATOM   291  C CE2   . PHE A 1 35  ? -20.053 42.864 -8.056  1.00 25.90 ? 42  PHE A CE2   1 
ATOM   292  C CZ    . PHE A 1 35  ? -18.733 43.321 -8.063  1.00 23.98 ? 42  PHE A CZ    1 
ATOM   293  N N     . PHE A 1 36  ? -19.596 36.941 -11.213 1.00 31.93 ? 43  PHE A N     1 
ATOM   294  C CA    . PHE A 1 36  ? -19.644 35.511 -11.466 1.00 31.07 ? 43  PHE A CA    1 
ATOM   295  C C     . PHE A 1 36  ? -18.375 34.892 -10.880 1.00 32.45 ? 43  PHE A C     1 
ATOM   296  O O     . PHE A 1 36  ? -17.255 35.272 -11.234 1.00 33.50 ? 43  PHE A O     1 
ATOM   297  C CB    . PHE A 1 36  ? -19.739 35.239 -12.966 1.00 31.12 ? 43  PHE A CB    1 
ATOM   298  C CG    . PHE A 1 36  ? -19.722 33.784 -13.317 1.00 30.45 ? 43  PHE A CG    1 
ATOM   299  C CD1   . PHE A 1 36  ? -18.532 33.157 -13.667 1.00 30.13 ? 43  PHE A CD1   1 
ATOM   300  C CD2   . PHE A 1 36  ? -20.889 33.027 -13.254 1.00 28.61 ? 43  PHE A CD2   1 
ATOM   301  C CE1   . PHE A 1 36  ? -18.501 31.784 -13.951 1.00 29.24 ? 43  PHE A CE1   1 
ATOM   302  C CE2   . PHE A 1 36  ? -20.866 31.666 -13.534 1.00 27.56 ? 43  PHE A CE2   1 
ATOM   303  C CZ    . PHE A 1 36  ? -19.665 31.044 -13.885 1.00 27.35 ? 43  PHE A CZ    1 
ATOM   304  N N     . ILE A 1 37  ? -18.552 33.946 -9.966  1.00 32.92 ? 44  ILE A N     1 
ATOM   305  C CA    . ILE A 1 37  ? -17.418 33.310 -9.311  1.00 33.02 ? 44  ILE A CA    1 
ATOM   306  C C     . ILE A 1 37  ? -16.738 32.297 -10.197 1.00 32.61 ? 44  ILE A C     1 
ATOM   307  O O     . ILE A 1 37  ? -17.273 31.221 -10.430 1.00 32.21 ? 44  ILE A O     1 
ATOM   308  C CB    . ILE A 1 37  ? -17.844 32.604 -8.001  1.00 32.14 ? 44  ILE A CB    1 
ATOM   309  C CG1   . ILE A 1 37  ? -18.574 33.606 -7.090  1.00 31.66 ? 44  ILE A CG1   1 
ATOM   310  C CG2   . ILE A 1 37  ? -16.618 31.993 -7.313  1.00 28.00 ? 44  ILE A CG2   1 
ATOM   311  C CD1   . ILE A 1 37  ? -19.022 33.039 -5.755  1.00 29.13 ? 44  ILE A CD1   1 
ATOM   312  N N     . ILE A 1 38  ? -15.548 32.644 -10.682 1.00 34.55 ? 45  ILE A N     1 
ATOM   313  C CA    . ILE A 1 38  ? -14.773 31.738 -11.539 1.00 35.96 ? 45  ILE A CA    1 
ATOM   314  C C     . ILE A 1 38  ? -14.150 30.654 -10.671 1.00 35.72 ? 45  ILE A C     1 
ATOM   315  O O     . ILE A 1 38  ? -14.223 29.455 -10.991 1.00 34.02 ? 45  ILE A O     1 
ATOM   316  C CB    . ILE A 1 38  ? -13.656 32.498 -12.295 1.00 34.73 ? 45  ILE A CB    1 
ATOM   317  C CG1   . ILE A 1 38  ? -14.291 33.507 -13.260 1.00 33.26 ? 45  ILE A CG1   1 
ATOM   318  C CG2   . ILE A 1 38  ? -12.772 31.520 -13.038 1.00 32.76 ? 45  ILE A CG2   1 
ATOM   319  C CD1   . ILE A 1 38  ? -13.338 34.552 -13.755 1.00 34.27 ? 45  ILE A CD1   1 
ATOM   320  N N     . LYS A 1 39  ? -13.548 31.084 -9.564  1.00 35.65 ? 46  LYS A N     1 
ATOM   321  C CA    . LYS A 1 39  ? -12.943 30.157 -8.631  1.00 37.72 ? 46  LYS A CA    1 
ATOM   322  C C     . LYS A 1 39  ? -12.974 30.710 -7.211  1.00 37.12 ? 46  LYS A C     1 
ATOM   323  O O     . LYS A 1 39  ? -12.704 31.889 -6.986  1.00 37.80 ? 46  LYS A O     1 
ATOM   324  C CB    . LYS A 1 39  ? -11.504 29.842 -9.055  1.00 40.25 ? 46  LYS A CB    1 
ATOM   325  C CG    . LYS A 1 39  ? -10.801 28.866 -8.120  1.00 44.13 ? 46  LYS A CG    1 
ATOM   326  C CD    . LYS A 1 39  ? -9.557  28.268 -8.747  1.00 46.40 ? 46  LYS A CD    1 
ATOM   327  C CE    . LYS A 1 39  ? -8.618  27.752 -7.669  1.00 47.56 ? 46  LYS A CE    1 
ATOM   328  N NZ    . LYS A 1 39  ? -8.179  28.885 -6.810  1.00 46.68 ? 46  LYS A NZ    1 
ATOM   329  N N     . GLY A 1 40  ? -13.325 29.856 -6.254  1.00 37.62 ? 47  GLY A N     1 
ATOM   330  C CA    . GLY A 1 40  ? -13.368 30.281 -4.865  1.00 36.96 ? 47  GLY A CA    1 
ATOM   331  C C     . GLY A 1 40  ? -14.741 30.389 -4.223  1.00 36.81 ? 47  GLY A C     1 
ATOM   332  O O     . GLY A 1 40  ? -15.747 29.924 -4.762  1.00 36.57 ? 47  GLY A O     1 
ATOM   333  N N     . SER A 1 41  ? -14.777 31.022 -3.050  1.00 35.79 ? 48  SER A N     1 
ATOM   334  C CA    . SER A 1 41  ? -16.019 31.193 -2.316  1.00 35.82 ? 48  SER A CA    1 
ATOM   335  C C     . SER A 1 41  ? -16.228 32.558 -1.691  1.00 34.25 ? 48  SER A C     1 
ATOM   336  O O     . SER A 1 41  ? -15.267 33.242 -1.333  1.00 33.62 ? 48  SER A O     1 
ATOM   337  C CB    . SER A 1 41  ? -16.116 30.145 -1.223  1.00 36.51 ? 48  SER A CB    1 
ATOM   338  O OG    . SER A 1 41  ? -16.775 29.006 -1.727  1.00 41.73 ? 48  SER A OG    1 
ATOM   339  N N     . VAL A 1 42  ? -17.492 32.947 -1.547  1.00 31.27 ? 49  VAL A N     1 
ATOM   340  C CA    . VAL A 1 42  ? -17.806 34.227 -0.936  1.00 32.70 ? 49  VAL A CA    1 
ATOM   341  C C     . VAL A 1 42  ? -18.826 34.058 0.185   1.00 32.09 ? 49  VAL A C     1 
ATOM   342  O O     . VAL A 1 42  ? -19.563 33.067 0.240   1.00 30.02 ? 49  VAL A O     1 
ATOM   343  C CB    . VAL A 1 42  ? -18.350 35.277 -1.968  1.00 31.78 ? 49  VAL A CB    1 
ATOM   344  C CG1   . VAL A 1 42  ? -17.391 35.407 -3.127  1.00 31.92 ? 49  VAL A CG1   1 
ATOM   345  C CG2   . VAL A 1 42  ? -19.730 34.895 -2.454  1.00 31.04 ? 49  VAL A CG2   1 
ATOM   346  N N     . THR A 1 43  ? -18.854 35.048 1.070   1.00 30.90 ? 50  THR A N     1 
ATOM   347  C CA    . THR A 1 43  ? -19.749 35.061 2.211   1.00 31.10 ? 50  THR A CA    1 
ATOM   348  C C     . THR A 1 43  ? -20.744 36.211 2.127   1.00 29.52 ? 50  THR A C     1 
ATOM   349  O O     . THR A 1 43  ? -20.374 37.340 1.822   1.00 29.31 ? 50  THR A O     1 
ATOM   350  C CB    . THR A 1 43  ? -18.949 35.227 3.514   1.00 31.37 ? 50  THR A CB    1 
ATOM   351  O OG1   . THR A 1 43  ? -17.953 34.196 3.600   1.00 32.06 ? 50  THR A OG1   1 
ATOM   352  C CG2   . THR A 1 43  ? -19.876 35.150 4.717   1.00 30.35 ? 50  THR A CG2   1 
ATOM   353  N N     . ILE A 1 44  ? -22.011 35.928 2.387   1.00 29.73 ? 51  ILE A N     1 
ATOM   354  C CA    . ILE A 1 44  ? -23.008 36.988 2.374   1.00 32.71 ? 51  ILE A CA    1 
ATOM   355  C C     . ILE A 1 44  ? -23.295 37.358 3.846   1.00 31.99 ? 51  ILE A C     1 
ATOM   356  O O     . ILE A 1 44  ? -23.645 36.506 4.667   1.00 28.26 ? 51  ILE A O     1 
ATOM   357  C CB    . ILE A 1 44  ? -24.321 36.556 1.627   1.00 32.94 ? 51  ILE A CB    1 
ATOM   358  C CG1   . ILE A 1 44  ? -24.091 36.546 0.111   1.00 34.21 ? 51  ILE A CG1   1 
ATOM   359  C CG2   . ILE A 1 44  ? -25.436 37.561 1.893   1.00 33.41 ? 51  ILE A CG2   1 
ATOM   360  C CD1   . ILE A 1 44  ? -23.114 35.517 -0.375  1.00 34.90 ? 51  ILE A CD1   1 
ATOM   361  N N     . LEU A 1 45  ? -23.111 38.634 4.175   1.00 31.51 ? 52  LEU A N     1 
ATOM   362  C CA    . LEU A 1 45  ? -23.320 39.109 5.534   1.00 30.19 ? 52  LEU A CA    1 
ATOM   363  C C     . LEU A 1 45  ? -24.298 40.269 5.612   1.00 29.71 ? 52  LEU A C     1 
ATOM   364  O O     . LEU A 1 45  ? -24.450 41.046 4.677   1.00 29.27 ? 52  LEU A O     1 
ATOM   365  C CB    . LEU A 1 45  ? -22.013 39.638 6.146   1.00 31.13 ? 52  LEU A CB    1 
ATOM   366  C CG    . LEU A 1 45  ? -20.579 39.085 6.091   1.00 31.60 ? 52  LEU A CG    1 
ATOM   367  C CD1   . LEU A 1 45  ? -20.506 37.864 6.938   1.00 34.13 ? 52  LEU A CD1   1 
ATOM   368  C CD2   . LEU A 1 45  ? -20.127 38.822 4.662   1.00 30.68 ? 52  LEU A CD2   1 
ATOM   369  N N     . ILE A 1 46  ? -24.968 40.371 6.745   1.00 32.09 ? 53  ILE A N     1 
ATOM   370  C CA    . ILE A 1 46  ? -25.837 41.508 7.033   1.00 33.51 ? 53  ILE A CA    1 
ATOM   371  C C     . ILE A 1 46  ? -25.416 41.843 8.449   1.00 34.76 ? 53  ILE A C     1 
ATOM   372  O O     . ILE A 1 46  ? -24.763 41.040 9.114   1.00 31.72 ? 53  ILE A O     1 
ATOM   373  C CB    . ILE A 1 46  ? -27.349 41.201 7.006   1.00 30.69 ? 53  ILE A CB    1 
ATOM   374  C CG1   . ILE A 1 46  ? -27.696 40.069 7.980   1.00 30.95 ? 53  ILE A CG1   1 
ATOM   375  C CG2   . ILE A 1 46  ? -27.780 40.945 5.578   1.00 29.84 ? 53  ILE A CG2   1 
ATOM   376  C CD1   . ILE A 1 46  ? -29.179 39.980 8.317   1.00 27.71 ? 53  ILE A CD1   1 
ATOM   377  N N     . GLU A 1 47  ? -25.758 43.027 8.925   1.00 40.65 ? 54  GLU A N     1 
ATOM   378  C CA    . GLU A 1 47  ? -25.355 43.378 10.276  1.00 44.29 ? 54  GLU A CA    1 
ATOM   379  C C     . GLU A 1 47  ? -26.148 44.537 10.808  1.00 43.32 ? 54  GLU A C     1 
ATOM   380  O O     . GLU A 1 47  ? -26.743 45.282 10.039  1.00 43.50 ? 54  GLU A O     1 
ATOM   381  C CB    . GLU A 1 47  ? -23.871 43.721 10.294  1.00 45.24 ? 54  GLU A CB    1 
ATOM   382  C CG    . GLU A 1 47  ? -23.502 44.828 9.344   1.00 45.54 ? 54  GLU A CG    1 
ATOM   383  C CD    . GLU A 1 47  ? -22.032 45.164 9.423   1.00 48.25 ? 54  GLU A CD    1 
ATOM   384  O OE1   . GLU A 1 47  ? -21.588 45.553 10.523  1.00 51.07 ? 54  GLU A OE1   1 
ATOM   385  O OE2   . GLU A 1 47  ? -21.325 45.036 8.397   1.00 49.21 ? 54  GLU A OE2   1 
ATOM   386  N N     . ASP A 1 48  ? -26.169 44.674 12.127  1.00 44.63 ? 55  ASP A N     1 
ATOM   387  C CA    . ASP A 1 48  ? -26.891 45.774 12.729  1.00 48.31 ? 55  ASP A CA    1 
ATOM   388  C C     . ASP A 1 48  ? -25.897 46.898 13.034  1.00 48.82 ? 55  ASP A C     1 
ATOM   389  O O     . ASP A 1 48  ? -24.681 46.696 12.985  1.00 48.34 ? 55  ASP A O     1 
ATOM   390  C CB    . ASP A 1 48  ? -27.677 45.302 13.973  1.00 49.62 ? 55  ASP A CB    1 
ATOM   391  C CG    . ASP A 1 48  ? -26.793 45.024 15.189  1.00 52.27 ? 55  ASP A CG    1 
ATOM   392  O OD1   . ASP A 1 48  ? -25.572 44.795 15.038  1.00 52.09 ? 55  ASP A OD1   1 
ATOM   393  O OD2   . ASP A 1 48  ? -27.343 45.020 16.313  1.00 53.17 ? 55  ASP A OD2   1 
ATOM   394  N N     . ASP A 1 49  ? -26.421 48.093 13.299  1.00 50.77 ? 56  ASP A N     1 
ATOM   395  C CA    . ASP A 1 49  ? -25.589 49.256 13.580  1.00 52.45 ? 56  ASP A CA    1 
ATOM   396  C C     . ASP A 1 49  ? -24.550 48.932 14.657  1.00 52.67 ? 56  ASP A C     1 
ATOM   397  O O     . ASP A 1 49  ? -23.492 49.559 14.748  1.00 52.74 ? 56  ASP A O     1 
ATOM   398  C CB    . ASP A 1 49  ? -26.477 50.416 14.031  1.00 52.47 ? 56  ASP A CB    1 
ATOM   399  C CG    . ASP A 1 49  ? -25.864 51.773 13.736  1.00 55.95 ? 56  ASP A CG    1 
ATOM   400  O OD1   . ASP A 1 49  ? -25.710 52.109 12.538  1.00 56.36 ? 56  ASP A OD1   1 
ATOM   401  O OD2   . ASP A 1 49  ? -25.536 52.507 14.699  1.00 56.85 ? 56  ASP A OD2   1 
ATOM   402  N N     . ASP A 1 50  ? -24.875 47.920 15.444  1.00 52.50 ? 57  ASP A N     1 
ATOM   403  C CA    . ASP A 1 50  ? -24.073 47.442 16.550  1.00 53.40 ? 57  ASP A CA    1 
ATOM   404  C C     . ASP A 1 50  ? -22.749 46.796 16.161  1.00 53.42 ? 57  ASP A C     1 
ATOM   405  O O     . ASP A 1 50  ? -21.851 46.679 16.991  1.00 53.12 ? 57  ASP A O     1 
ATOM   406  C CB    . ASP A 1 50  ? -24.894 46.424 17.328  1.00 57.10 ? 57  ASP A CB    1 
ATOM   407  C CG    . ASP A 1 50  ? -24.758 46.582 18.815  1.00 61.32 ? 57  ASP A CG    1 
ATOM   408  O OD1   . ASP A 1 50  ? -25.346 45.736 19.530  1.00 62.17 ? 57  ASP A OD1   1 
ATOM   409  O OD2   . ASP A 1 50  ? -24.078 47.545 19.263  1.00 63.44 ? 57  ASP A OD2   1 
ATOM   410  N N     . GLY A 1 51  ? -22.624 46.355 14.916  1.00 52.80 ? 58  GLY A N     1 
ATOM   411  C CA    . GLY A 1 51  ? -21.394 45.704 14.503  1.00 49.30 ? 58  GLY A CA    1 
ATOM   412  C C     . GLY A 1 51  ? -21.559 44.192 14.514  1.00 48.62 ? 58  GLY A C     1 
ATOM   413  O O     . GLY A 1 51  ? -20.663 43.461 14.080  1.00 49.94 ? 58  GLY A O     1 
ATOM   414  N N     . ARG A 1 52  ? -22.694 43.714 15.032  1.00 45.20 ? 59  ARG A N     1 
ATOM   415  C CA    . ARG A 1 52  ? -22.974 42.279 15.059  1.00 41.32 ? 59  ARG A CA    1 
ATOM   416  C C     . ARG A 1 52  ? -23.210 41.881 13.605  1.00 40.77 ? 59  ARG A C     1 
ATOM   417  O O     . ARG A 1 52  ? -24.030 42.487 12.918  1.00 40.05 ? 59  ARG A O     1 
ATOM   418  C CB    . ARG A 1 52  ? -24.241 41.979 15.879  1.00 39.73 ? 59  ARG A CB    1 
ATOM   419  C CG    . ARG A 1 52  ? -24.047 41.883 17.378  1.00 35.90 ? 59  ARG A CG    1 
ATOM   420  C CD    . ARG A 1 52  ? -25.254 42.455 18.108  1.00 34.99 ? 59  ARG A CD    1 
ATOM   421  N NE    . ARG A 1 52  ? -26.373 41.533 18.249  1.00 33.64 ? 59  ARG A NE    1 
ATOM   422  C CZ    . ARG A 1 52  ? -27.658 41.904 18.209  1.00 36.66 ? 59  ARG A CZ    1 
ATOM   423  N NH1   . ARG A 1 52  ? -27.986 43.184 18.030  1.00 37.24 ? 59  ARG A NH1   1 
ATOM   424  N NH2   . ARG A 1 52  ? -28.630 41.009 18.383  1.00 35.15 ? 59  ARG A NH2   1 
ATOM   425  N N     . GLU A 1 53  ? -22.493 40.874 13.127  1.00 39.83 ? 60  GLU A N     1 
ATOM   426  C CA    . GLU A 1 53  ? -22.657 40.445 11.752  1.00 38.81 ? 60  GLU A CA    1 
ATOM   427  C C     . GLU A 1 53  ? -23.353 39.092 11.694  1.00 37.19 ? 60  GLU A C     1 
ATOM   428  O O     . GLU A 1 53  ? -23.175 38.261 12.583  1.00 35.95 ? 60  GLU A O     1 
ATOM   429  C CB    . GLU A 1 53  ? -21.301 40.313 11.068  1.00 40.83 ? 60  GLU A CB    1 
ATOM   430  C CG    . GLU A 1 53  ? -20.190 41.155 11.662  1.00 46.72 ? 60  GLU A CG    1 
ATOM   431  C CD    . GLU A 1 53  ? -18.841 40.920 10.975  1.00 49.42 ? 60  GLU A CD    1 
ATOM   432  O OE1   . GLU A 1 53  ? -18.372 39.750 10.943  1.00 51.49 ? 60  GLU A OE1   1 
ATOM   433  O OE2   . GLU A 1 53  ? -18.252 41.906 10.469  1.00 49.62 ? 60  GLU A OE2   1 
ATOM   434  N N     . MET A 1 54  ? -24.157 38.884 10.653  1.00 35.14 ? 61  MET A N     1 
ATOM   435  C CA    . MET A 1 54  ? -24.826 37.603 10.459  1.00 33.32 ? 61  MET A CA    1 
ATOM   436  C C     . MET A 1 54  ? -24.555 37.051 9.066   1.00 32.41 ? 61  MET A C     1 
ATOM   437  O O     . MET A 1 54  ? -24.796 37.716 8.053   1.00 32.90 ? 61  MET A O     1 
ATOM   438  C CB    . MET A 1 54  ? -26.339 37.687 10.657  1.00 31.13 ? 61  MET A CB    1 
ATOM   439  C CG    . MET A 1 54  ? -26.984 36.323 10.399  1.00 30.01 ? 61  MET A CG    1 
ATOM   440  S SD    . MET A 1 54  ? -28.673 36.094 10.956  1.00 29.44 ? 61  MET A SD    1 
ATOM   441  C CE    . MET A 1 54  ? -28.395 35.527 12.615  1.00 30.60 ? 61  MET A CE    1 
ATOM   442  N N     . ILE A 1 55  ? -24.041 35.833 9.016   1.00 30.45 ? 62  ILE A N     1 
ATOM   443  C CA    . ILE A 1 55  ? -23.767 35.210 7.746   1.00 32.14 ? 62  ILE A CA    1 
ATOM   444  C C     . ILE A 1 55  ? -25.067 34.608 7.228   1.00 34.13 ? 62  ILE A C     1 
ATOM   445  O O     . ILE A 1 55  ? -25.637 33.689 7.829   1.00 33.45 ? 62  ILE A O     1 
ATOM   446  C CB    . ILE A 1 55  ? -22.685 34.127 7.869   1.00 32.43 ? 62  ILE A CB    1 
ATOM   447  C CG1   . ILE A 1 55  ? -21.332 34.795 8.163   1.00 30.89 ? 62  ILE A CG1   1 
ATOM   448  C CG2   . ILE A 1 55  ? -22.626 33.294 6.596   1.00 31.98 ? 62  ILE A CG2   1 
ATOM   449  C CD1   . ILE A 1 55  ? -20.225 33.826 8.538   1.00 27.99 ? 62  ILE A CD1   1 
ATOM   450  N N     . ILE A 1 56  ? -25.533 35.178 6.113   1.00 34.18 ? 63  ILE A N     1 
ATOM   451  C CA    . ILE A 1 56  ? -26.749 34.769 5.438   1.00 31.74 ? 63  ILE A CA    1 
ATOM   452  C C     . ILE A 1 56  ? -26.495 33.509 4.613   1.00 32.23 ? 63  ILE A C     1 
ATOM   453  O O     . ILE A 1 56  ? -27.384 32.674 4.458   1.00 34.83 ? 63  ILE A O     1 
ATOM   454  C CB    . ILE A 1 56  ? -27.223 35.871 4.489   1.00 31.93 ? 63  ILE A CB    1 
ATOM   455  C CG1   . ILE A 1 56  ? -27.584 37.122 5.281   1.00 34.31 ? 63  ILE A CG1   1 
ATOM   456  C CG2   . ILE A 1 56  ? -28.395 35.385 3.696   1.00 34.76 ? 63  ILE A CG2   1 
ATOM   457  C CD1   . ILE A 1 56  ? -28.646 36.901 6.347   1.00 32.58 ? 63  ILE A CD1   1 
ATOM   458  N N     . GLY A 1 57  ? -25.287 33.393 4.071   1.00 29.70 ? 64  GLY A N     1 
ATOM   459  C CA    . GLY A 1 57  ? -24.943 32.231 3.280   1.00 27.53 ? 64  GLY A CA    1 
ATOM   460  C C     . GLY A 1 57  ? -23.594 32.312 2.589   1.00 27.07 ? 64  GLY A C     1 
ATOM   461  O O     . GLY A 1 57  ? -22.873 33.293 2.718   1.00 28.11 ? 64  GLY A O     1 
ATOM   462  N N     . TYR A 1 58  ? -23.267 31.265 1.843   1.00 26.56 ? 65  TYR A N     1 
ATOM   463  C CA    . TYR A 1 58  ? -22.017 31.167 1.097   1.00 27.07 ? 65  TYR A CA    1 
ATOM   464  C C     . TYR A 1 58  ? -22.345 30.804 -0.346  1.00 28.12 ? 65  TYR A C     1 
ATOM   465  O O     . TYR A 1 58  ? -23.237 29.992 -0.609  1.00 28.28 ? 65  TYR A O     1 
ATOM   466  C CB    . TYR A 1 58  ? -21.134 30.041 1.633   1.00 26.48 ? 65  TYR A CB    1 
ATOM   467  C CG    . TYR A 1 58  ? -20.744 30.106 3.089   1.00 27.99 ? 65  TYR A CG    1 
ATOM   468  C CD1   . TYR A 1 58  ? -19.846 31.072 3.550   1.00 26.03 ? 65  TYR A CD1   1 
ATOM   469  C CD2   . TYR A 1 58  ? -21.215 29.143 3.998   1.00 27.11 ? 65  TYR A CD2   1 
ATOM   470  C CE1   . TYR A 1 58  ? -19.420 31.076 4.873   1.00 28.45 ? 65  TYR A CE1   1 
ATOM   471  C CE2   . TYR A 1 58  ? -20.800 29.134 5.323   1.00 26.46 ? 65  TYR A CE2   1 
ATOM   472  C CZ    . TYR A 1 58  ? -19.898 30.101 5.760   1.00 29.39 ? 65  TYR A CZ    1 
ATOM   473  O OH    . TYR A 1 58  ? -19.462 30.080 7.069   1.00 25.60 ? 65  TYR A OH    1 
ATOM   474  N N     . LEU A 1 59  ? -21.617 31.395 -1.283  1.00 29.75 ? 66  LEU A N     1 
ATOM   475  C CA    . LEU A 1 59  ? -21.812 31.087 -2.691  1.00 27.81 ? 66  LEU A CA    1 
ATOM   476  C C     . LEU A 1 59  ? -20.460 30.583 -3.159  1.00 29.21 ? 66  LEU A C     1 
ATOM   477  O O     . LEU A 1 59  ? -19.414 30.991 -2.643  1.00 29.65 ? 66  LEU A O     1 
ATOM   478  C CB    . LEU A 1 59  ? -22.254 32.326 -3.468  1.00 24.29 ? 66  LEU A CB    1 
ATOM   479  C CG    . LEU A 1 59  ? -23.622 32.872 -3.051  1.00 21.92 ? 66  LEU A CG    1 
ATOM   480  C CD1   . LEU A 1 59  ? -23.889 34.191 -3.749  1.00 24.05 ? 66  LEU A CD1   1 
ATOM   481  C CD2   . LEU A 1 59  ? -24.688 31.875 -3.367  1.00 16.50 ? 66  LEU A CD2   1 
ATOM   482  N N     . ASN A 1 60  ? -20.479 29.682 -4.128  1.00 31.97 ? 67  ASN A N     1 
ATOM   483  C CA    . ASN A 1 60  ? -19.246 29.088 -4.615  1.00 33.24 ? 67  ASN A CA    1 
ATOM   484  C C     . ASN A 1 60  ? -19.081 29.232 -6.122  1.00 32.83 ? 67  ASN A C     1 
ATOM   485  O O     . ASN A 1 60  ? -19.873 29.906 -6.784  1.00 32.12 ? 67  ASN A O     1 
ATOM   486  C CB    . ASN A 1 60  ? -19.224 27.619 -4.173  1.00 34.90 ? 67  ASN A CB    1 
ATOM   487  C CG    . ASN A 1 60  ? -19.469 27.462 -2.656  1.00 37.02 ? 67  ASN A CG    1 
ATOM   488  O OD1   . ASN A 1 60  ? -18.536 27.506 -1.860  1.00 35.70 ? 67  ASN A OD1   1 
ATOM   489  N ND2   . ASN A 1 60  ? -20.734 27.296 -2.258  1.00 36.55 ? 67  ASN A ND2   1 
ATOM   490  N N     . SER A 1 61  ? -18.037 28.609 -6.660  1.00 34.88 ? 68  SER A N     1 
ATOM   491  C CA    . SER A 1 61  ? -17.729 28.671 -8.092  1.00 34.02 ? 68  SER A CA    1 
ATOM   492  C C     . SER A 1 61  ? -18.961 28.393 -8.956  1.00 34.44 ? 68  SER A C     1 
ATOM   493  O O     . SER A 1 61  ? -19.722 27.450 -8.707  1.00 34.84 ? 68  SER A O     1 
ATOM   494  C CB    . SER A 1 61  ? -16.631 27.664 -8.427  1.00 33.38 ? 68  SER A CB    1 
ATOM   495  O OG    . SER A 1 61  ? -15.731 27.547 -7.339  1.00 37.22 ? 68  SER A OG    1 
ATOM   496  N N     . GLY A 1 62  ? -19.156 29.214 -9.977  1.00 32.37 ? 69  GLY A N     1 
ATOM   497  C CA    . GLY A 1 62  ? -20.297 29.018 -10.839 1.00 31.45 ? 69  GLY A CA    1 
ATOM   498  C C     . GLY A 1 62  ? -21.497 29.826 -10.403 1.00 32.95 ? 69  GLY A C     1 
ATOM   499  O O     . GLY A 1 62  ? -22.528 29.806 -11.069 1.00 33.45 ? 69  GLY A O     1 
ATOM   500  N N     . ASP A 1 63  ? -21.377 30.552 -9.292  1.00 33.97 ? 70  ASP A N     1 
ATOM   501  C CA    . ASP A 1 63  ? -22.496 31.358 -8.822  1.00 34.28 ? 70  ASP A CA    1 
ATOM   502  C C     . ASP A 1 63  ? -22.406 32.809 -9.256  1.00 33.20 ? 70  ASP A C     1 
ATOM   503  O O     . ASP A 1 63  ? -21.328 33.316 -9.559  1.00 34.32 ? 70  ASP A O     1 
ATOM   504  C CB    . ASP A 1 63  ? -22.595 31.330 -7.284  1.00 34.89 ? 70  ASP A CB    1 
ATOM   505  C CG    . ASP A 1 63  ? -23.192 30.044 -6.755  1.00 35.41 ? 70  ASP A CG    1 
ATOM   506  O OD1   . ASP A 1 63  ? -24.128 29.510 -7.389  1.00 34.33 ? 70  ASP A OD1   1 
ATOM   507  O OD2   . ASP A 1 63  ? -22.733 29.577 -5.691  1.00 35.61 ? 70  ASP A OD2   1 
ATOM   508  N N     . PHE A 1 64  ? -23.555 33.469 -9.282  1.00 32.85 ? 71  PHE A N     1 
ATOM   509  C CA    . PHE A 1 64  ? -23.628 34.887 -9.605  1.00 31.82 ? 71  PHE A CA    1 
ATOM   510  C C     . PHE A 1 64  ? -24.003 35.580 -8.304  1.00 30.60 ? 71  PHE A C     1 
ATOM   511  O O     . PHE A 1 64  ? -24.747 35.023 -7.498  1.00 30.32 ? 71  PHE A O     1 
ATOM   512  C CB    . PHE A 1 64  ? -24.751 35.185 -10.601 1.00 33.88 ? 71  PHE A CB    1 
ATOM   513  C CG    . PHE A 1 64  ? -24.456 34.781 -12.016 1.00 34.88 ? 71  PHE A CG    1 
ATOM   514  C CD1   . PHE A 1 64  ? -23.564 35.514 -12.791 1.00 35.07 ? 71  PHE A CD1   1 
ATOM   515  C CD2   . PHE A 1 64  ? -25.083 33.671 -12.574 1.00 34.88 ? 71  PHE A CD2   1 
ATOM   516  C CE1   . PHE A 1 64  ? -23.301 35.149 -14.097 1.00 34.93 ? 71  PHE A CE1   1 
ATOM   517  C CE2   . PHE A 1 64  ? -24.829 33.298 -13.874 1.00 35.95 ? 71  PHE A CE2   1 
ATOM   518  C CZ    . PHE A 1 64  ? -23.935 34.037 -14.643 1.00 36.10 ? 71  PHE A CZ    1 
ATOM   519  N N     . PHE A 1 65  ? -23.489 36.782 -8.090  1.00 29.60 ? 72  PHE A N     1 
ATOM   520  C CA    . PHE A 1 65  ? -23.868 37.542 -6.910  1.00 30.02 ? 72  PHE A CA    1 
ATOM   521  C C     . PHE A 1 65  ? -23.854 39.005 -7.308  1.00 29.96 ? 72  PHE A C     1 
ATOM   522  O O     . PHE A 1 65  ? -23.245 39.369 -8.301  1.00 29.55 ? 72  PHE A O     1 
ATOM   523  C CB    . PHE A 1 65  ? -22.961 37.228 -5.708  1.00 29.07 ? 72  PHE A CB    1 
ATOM   524  C CG    . PHE A 1 65  ? -21.545 37.688 -5.854  1.00 28.48 ? 72  PHE A CG    1 
ATOM   525  C CD1   . PHE A 1 65  ? -21.202 39.017 -5.614  1.00 28.55 ? 72  PHE A CD1   1 
ATOM   526  C CD2   . PHE A 1 65  ? -20.539 36.776 -6.150  1.00 27.27 ? 72  PHE A CD2   1 
ATOM   527  C CE1   . PHE A 1 65  ? -19.884 39.430 -5.650  1.00 27.26 ? 72  PHE A CE1   1 
ATOM   528  C CE2   . PHE A 1 65  ? -19.219 37.176 -6.189  1.00 28.01 ? 72  PHE A CE2   1 
ATOM   529  C CZ    . PHE A 1 65  ? -18.888 38.510 -5.935  1.00 29.12 ? 72  PHE A CZ    1 
ATOM   530  N N     . GLY A 1 66  ? -24.563 39.836 -6.554  1.00 32.98 ? 73  GLY A N     1 
ATOM   531  C CA    . GLY A 1 66  ? -24.651 41.241 -6.899  1.00 33.66 ? 73  GLY A CA    1 
ATOM   532  C C     . GLY A 1 66  ? -25.675 41.345 -8.023  1.00 35.44 ? 73  GLY A C     1 
ATOM   533  O O     . GLY A 1 66  ? -25.590 42.220 -8.878  1.00 37.49 ? 73  GLY A O     1 
ATOM   534  N N     . GLU A 1 67  ? -26.658 40.449 -8.011  1.00 34.40 ? 74  GLU A N     1 
ATOM   535  C CA    . GLU A 1 67  ? -27.669 40.430 -9.055  1.00 35.41 ? 74  GLU A CA    1 
ATOM   536  C C     . GLU A 1 67  ? -29.020 41.004 -8.665  1.00 36.59 ? 74  GLU A C     1 
ATOM   537  O O     . GLU A 1 67  ? -29.919 41.112 -9.497  1.00 35.09 ? 74  GLU A O     1 
ATOM   538  C CB    . GLU A 1 67  ? -27.881 38.993 -9.546  1.00 35.74 ? 74  GLU A CB    1 
ATOM   539  C CG    . GLU A 1 67  ? -28.814 38.130 -8.688  1.00 34.86 ? 74  GLU A CG    1 
ATOM   540  C CD    . GLU A 1 67  ? -28.220 37.715 -7.347  1.00 34.12 ? 74  GLU A CD    1 
ATOM   541  O OE1   . GLU A 1 67  ? -27.007 37.902 -7.121  1.00 30.55 ? 74  GLU A OE1   1 
ATOM   542  O OE2   . GLU A 1 67  ? -28.985 37.182 -6.518  1.00 35.34 ? 74  GLU A OE2   1 
ATOM   543  N N     . LEU A 1 68  ? -29.174 41.375 -7.401  1.00 37.60 ? 75  LEU A N     1 
ATOM   544  C CA    . LEU A 1 68  ? -30.457 41.888 -6.956  1.00 39.64 ? 75  LEU A CA    1 
ATOM   545  C C     . LEU A 1 68  ? -30.814 43.288 -7.457  1.00 42.31 ? 75  LEU A C     1 
ATOM   546  O O     . LEU A 1 68  ? -31.998 43.663 -7.491  1.00 42.45 ? 75  LEU A O     1 
ATOM   547  C CB    . LEU A 1 68  ? -30.537 41.815 -5.429  1.00 37.31 ? 75  LEU A CB    1 
ATOM   548  C CG    . LEU A 1 68  ? -30.369 40.388 -4.906  1.00 34.97 ? 75  LEU A CG    1 
ATOM   549  C CD1   . LEU A 1 68  ? -30.602 40.379 -3.420  1.00 35.83 ? 75  LEU A CD1   1 
ATOM   550  C CD2   . LEU A 1 68  ? -31.349 39.444 -5.603  1.00 35.29 ? 75  LEU A CD2   1 
ATOM   551  N N     . GLY A 1 69  ? -29.804 44.056 -7.865  1.00 43.88 ? 76  GLY A N     1 
ATOM   552  C CA    . GLY A 1 69  ? -30.070 45.396 -8.364  1.00 45.32 ? 76  GLY A CA    1 
ATOM   553  C C     . GLY A 1 69  ? -30.234 45.413 -9.877  1.00 45.00 ? 76  GLY A C     1 
ATOM   554  O O     . GLY A 1 69  ? -30.407 46.466 -10.476 1.00 44.04 ? 76  GLY A O     1 
ATOM   555  N N     . LEU A 1 70  ? -30.194 44.232 -10.480 1.00 45.97 ? 77  LEU A N     1 
ATOM   556  C CA    . LEU A 1 70  ? -30.302 44.091 -11.925 1.00 46.72 ? 77  LEU A CA    1 
ATOM   557  C C     . LEU A 1 70  ? -31.622 44.497 -12.531 1.00 49.51 ? 77  LEU A C     1 
ATOM   558  O O     . LEU A 1 70  ? -31.690 45.425 -13.330 1.00 51.51 ? 77  LEU A O     1 
ATOM   559  C CB    . LEU A 1 70  ? -30.019 42.651 -12.340 1.00 43.75 ? 77  LEU A CB    1 
ATOM   560  C CG    . LEU A 1 70  ? -30.312 42.356 -13.809 1.00 43.32 ? 77  LEU A CG    1 
ATOM   561  C CD1   . LEU A 1 70  ? -29.364 43.150 -14.669 1.00 44.62 ? 77  LEU A CD1   1 
ATOM   562  C CD2   . LEU A 1 70  ? -30.160 40.872 -14.100 1.00 42.48 ? 77  LEU A CD2   1 
ATOM   563  N N     . PHE A 1 71  ? -32.671 43.783 -12.145 1.00 53.04 ? 78  PHE A N     1 
ATOM   564  C CA    . PHE A 1 71  ? -34.018 43.994 -12.671 1.00 54.71 ? 78  PHE A CA    1 
ATOM   565  C C     . PHE A 1 71  ? -34.591 45.400 -12.525 1.00 57.56 ? 78  PHE A C     1 
ATOM   566  O O     . PHE A 1 71  ? -35.419 45.815 -13.339 1.00 58.26 ? 78  PHE A O     1 
ATOM   567  C CB    . PHE A 1 71  ? -34.932 42.958 -12.040 1.00 51.02 ? 78  PHE A CB    1 
ATOM   568  C CG    . PHE A 1 71  ? -34.345 41.584 -12.056 1.00 47.72 ? 78  PHE A CG    1 
ATOM   569  C CD1   . PHE A 1 71  ? -34.470 40.767 -13.175 1.00 45.81 ? 78  PHE A CD1   1 
ATOM   570  C CD2   . PHE A 1 71  ? -33.600 41.130 -10.973 1.00 46.27 ? 78  PHE A CD2   1 
ATOM   571  C CE1   . PHE A 1 71  ? -33.861 39.506 -13.222 1.00 45.20 ? 78  PHE A CE1   1 
ATOM   572  C CE2   . PHE A 1 71  ? -32.989 39.881 -11.008 1.00 46.01 ? 78  PHE A CE2   1 
ATOM   573  C CZ    . PHE A 1 71  ? -33.120 39.062 -12.139 1.00 44.39 ? 78  PHE A CZ    1 
ATOM   574  N N     . GLU A 1 72  ? -34.148 46.131 -11.506 1.00 59.60 ? 79  GLU A N     1 
ATOM   575  C CA    . GLU A 1 72  ? -34.617 47.496 -11.280 1.00 60.31 ? 79  GLU A CA    1 
ATOM   576  C C     . GLU A 1 72  ? -33.947 48.518 -12.196 1.00 59.12 ? 79  GLU A C     1 
ATOM   577  O O     . GLU A 1 72  ? -33.719 48.256 -13.375 1.00 59.46 ? 79  GLU A O     1 
ATOM   578  C CB    . GLU A 1 72  ? -34.390 47.893 -9.820  1.00 62.87 ? 79  GLU A CB    1 
ATOM   579  C CG    . GLU A 1 72  ? -35.460 47.398 -8.874  1.00 65.29 ? 79  GLU A CG    1 
ATOM   580  C CD    . GLU A 1 72  ? -36.849 47.872 -9.274  1.00 68.96 ? 79  GLU A CD    1 
ATOM   581  O OE1   . GLU A 1 72  ? -37.803 47.637 -8.496  1.00 69.83 ? 79  GLU A OE1   1 
ATOM   582  O OE2   . GLU A 1 72  ? -36.986 48.474 -10.369 1.00 70.00 ? 79  GLU A OE2   1 
ATOM   583  N N     . GLN A 1 78  ? -31.562 50.946 -7.133  1.00 56.55 ? 85  GLN A N     1 
ATOM   584  C CA    . GLN A 1 78  ? -31.282 49.927 -6.124  1.00 56.22 ? 85  GLN A CA    1 
ATOM   585  C C     . GLN A 1 78  ? -29.880 50.053 -5.554  1.00 54.44 ? 85  GLN A C     1 
ATOM   586  O O     . GLN A 1 78  ? -28.967 50.519 -6.235  1.00 56.16 ? 85  GLN A O     1 
ATOM   587  C CB    . GLN A 1 78  ? -31.447 48.517 -6.715  1.00 58.81 ? 85  GLN A CB    1 
ATOM   588  C CG    . GLN A 1 78  ? -32.901 48.078 -6.892  1.00 62.21 ? 85  GLN A CG    1 
ATOM   589  C CD    . GLN A 1 78  ? -33.681 48.105 -5.577  1.00 64.00 ? 85  GLN A CD    1 
ATOM   590  O OE1   . GLN A 1 78  ? -34.869 48.450 -5.549  1.00 64.87 ? 85  GLN A OE1   1 
ATOM   591  N NE2   . GLN A 1 78  ? -33.015 47.737 -4.485  1.00 64.22 ? 85  GLN A NE2   1 
ATOM   592  N N     . GLU A 1 79  ? -29.710 49.646 -4.300  1.00 51.55 ? 86  GLU A N     1 
ATOM   593  C CA    . GLU A 1 79  ? -28.393 49.677 -3.675  1.00 49.08 ? 86  GLU A CA    1 
ATOM   594  C C     . GLU A 1 79  ? -28.094 48.305 -3.073  1.00 45.32 ? 86  GLU A C     1 
ATOM   595  O O     . GLU A 1 79  ? -28.998 47.621 -2.607  1.00 45.74 ? 86  GLU A O     1 
ATOM   596  C CB    . GLU A 1 79  ? -28.306 50.787 -2.620  1.00 49.66 ? 86  GLU A CB    1 
ATOM   597  C CG    . GLU A 1 79  ? -29.341 50.747 -1.517  1.00 54.74 ? 86  GLU A CG    1 
ATOM   598  C CD    . GLU A 1 79  ? -29.278 51.992 -0.637  1.00 58.46 ? 86  GLU A CD    1 
ATOM   599  O OE1   . GLU A 1 79  ? -28.953 51.865 0.568   1.00 58.20 ? 86  GLU A OE1   1 
ATOM   600  O OE2   . GLU A 1 79  ? -29.547 53.103 -1.153  1.00 59.74 ? 86  GLU A OE2   1 
ATOM   601  N N     . ARG A 1 80  ? -26.830 47.894 -3.130  1.00 42.35 ? 87  ARG A N     1 
ATOM   602  C CA    . ARG A 1 80  ? -26.403 46.594 -2.614  1.00 38.88 ? 87  ARG A CA    1 
ATOM   603  C C     . ARG A 1 80  ? -27.122 46.221 -1.319  1.00 37.07 ? 87  ARG A C     1 
ATOM   604  O O     . ARG A 1 80  ? -27.022 46.923 -0.305  1.00 36.68 ? 87  ARG A O     1 
ATOM   605  C CB    . ARG A 1 80  ? -24.888 46.591 -2.410  1.00 38.35 ? 87  ARG A CB    1 
ATOM   606  C CG    . ARG A 1 80  ? -24.081 46.916 -3.671  1.00 38.30 ? 87  ARG A CG    1 
ATOM   607  C CD    . ARG A 1 80  ? -24.399 45.982 -4.830  1.00 37.77 ? 87  ARG A CD    1 
ATOM   608  N NE    . ARG A 1 80  ? -23.394 46.055 -5.888  1.00 39.17 ? 87  ARG A NE    1 
ATOM   609  C CZ    . ARG A 1 80  ? -23.473 45.408 -7.051  1.00 38.98 ? 87  ARG A CZ    1 
ATOM   610  N NH1   . ARG A 1 80  ? -22.505 45.529 -7.946  1.00 38.98 ? 87  ARG A NH1   1 
ATOM   611  N NH2   . ARG A 1 80  ? -24.524 44.646 -7.322  1.00 39.53 ? 87  ARG A NH2   1 
ATOM   612  N N     . SER A 1 81  ? -27.838 45.100 -1.360  1.00 34.62 ? 88  SER A N     1 
ATOM   613  C CA    . SER A 1 81  ? -28.637 44.623 -0.227  1.00 32.73 ? 88  SER A CA    1 
ATOM   614  C C     . SER A 1 81  ? -27.911 43.943 0.915   1.00 31.10 ? 88  SER A C     1 
ATOM   615  O O     . SER A 1 81  ? -28.476 43.768 1.979   1.00 30.56 ? 88  SER A O     1 
ATOM   616  C CB    . SER A 1 81  ? -29.721 43.671 -0.722  1.00 32.11 ? 88  SER A CB    1 
ATOM   617  O OG    . SER A 1 81  ? -29.150 42.489 -1.255  1.00 31.48 ? 88  SER A OG    1 
ATOM   618  N N     . ALA A 1 82  ? -26.674 43.542 0.700   1.00 32.37 ? 89  ALA A N     1 
ATOM   619  C CA    . ALA A 1 82  ? -25.928 42.877 1.747   1.00 33.21 ? 89  ALA A CA    1 
ATOM   620  C C     . ALA A 1 82  ? -24.447 42.962 1.450   1.00 35.58 ? 89  ALA A C     1 
ATOM   621  O O     . ALA A 1 82  ? -24.055 43.423 0.373   1.00 37.35 ? 89  ALA A O     1 
ATOM   622  C CB    . ALA A 1 82  ? -26.363 41.427 1.836   1.00 33.21 ? 89  ALA A CB    1 
ATOM   623  N N     . TRP A 1 83  ? -23.624 42.527 2.398   1.00 35.58 ? 90  TRP A N     1 
ATOM   624  C CA    . TRP A 1 83  ? -22.183 42.533 2.213   1.00 35.29 ? 90  TRP A CA    1 
ATOM   625  C C     . TRP A 1 83  ? -21.742 41.229 1.601   1.00 34.49 ? 90  TRP A C     1 
ATOM   626  O O     . TRP A 1 83  ? -22.237 40.165 1.980   1.00 34.70 ? 90  TRP A O     1 
ATOM   627  C CB    . TRP A 1 83  ? -21.469 42.702 3.542   1.00 39.48 ? 90  TRP A CB    1 
ATOM   628  C CG    . TRP A 1 83  ? -21.221 44.108 3.910   1.00 46.65 ? 90  TRP A CG    1 
ATOM   629  C CD1   . TRP A 1 83  ? -20.184 44.901 3.495   1.00 48.69 ? 90  TRP A CD1   1 
ATOM   630  C CD2   . TRP A 1 83  ? -22.030 44.918 4.768   1.00 48.99 ? 90  TRP A CD2   1 
ATOM   631  N NE1   . TRP A 1 83  ? -20.297 46.161 4.049   1.00 49.91 ? 90  TRP A NE1   1 
ATOM   632  C CE2   . TRP A 1 83  ? -21.419 46.198 4.838   1.00 49.84 ? 90  TRP A CE2   1 
ATOM   633  C CE3   . TRP A 1 83  ? -23.209 44.688 5.488   1.00 48.62 ? 90  TRP A CE3   1 
ATOM   634  C CZ2   . TRP A 1 83  ? -21.950 47.242 5.601   1.00 50.22 ? 90  TRP A CZ2   1 
ATOM   635  C CZ3   . TRP A 1 83  ? -23.739 45.728 6.247   1.00 51.63 ? 90  TRP A CZ3   1 
ATOM   636  C CH2   . TRP A 1 83  ? -23.107 46.993 6.296   1.00 51.08 ? 90  TRP A CH2   1 
ATOM   637  N N     . VAL A 1 84  ? -20.824 41.311 0.648   1.00 33.09 ? 91  VAL A N     1 
ATOM   638  C CA    . VAL A 1 84  ? -20.286 40.114 0.024   1.00 31.73 ? 91  VAL A CA    1 
ATOM   639  C C     . VAL A 1 84  ? -18.794 40.193 0.231   1.00 31.02 ? 91  VAL A C     1 
ATOM   640  O O     . VAL A 1 84  ? -18.128 41.117 -0.236  1.00 30.06 ? 91  VAL A O     1 
ATOM   641  C CB    . VAL A 1 84  ? -20.607 40.031 -1.472  1.00 32.02 ? 91  VAL A CB    1 
ATOM   642  C CG1   . VAL A 1 84  ? -19.943 38.790 -2.071  1.00 30.90 ? 91  VAL A CG1   1 
ATOM   643  C CG2   . VAL A 1 84  ? -22.105 39.958 -1.671  1.00 29.31 ? 91  VAL A CG2   1 
ATOM   644  N N     . ARG A 1 85  ? -18.286 39.208 0.953   1.00 32.71 ? 92  ARG A N     1 
ATOM   645  C CA    . ARG A 1 85  ? -16.883 39.132 1.312   1.00 34.05 ? 92  ARG A CA    1 
ATOM   646  C C     . ARG A 1 85  ? -16.294 37.802 0.838   1.00 34.60 ? 92  ARG A C     1 
ATOM   647  O O     . ARG A 1 85  ? -16.977 36.779 0.833   1.00 34.73 ? 92  ARG A O     1 
ATOM   648  C CB    . ARG A 1 85  ? -16.795 39.251 2.831   1.00 34.82 ? 92  ARG A CB    1 
ATOM   649  C CG    . ARG A 1 85  ? -15.418 39.376 3.397   1.00 41.06 ? 92  ARG A CG    1 
ATOM   650  C CD    . ARG A 1 85  ? -15.381 38.784 4.802   1.00 45.84 ? 92  ARG A CD    1 
ATOM   651  N NE    . ARG A 1 85  ? -16.107 39.584 5.790   1.00 49.61 ? 92  ARG A NE    1 
ATOM   652  C CZ    . ARG A 1 85  ? -16.434 39.150 7.011   1.00 50.64 ? 92  ARG A CZ    1 
ATOM   653  N NH1   . ARG A 1 85  ? -17.088 39.955 7.845   1.00 50.09 ? 92  ARG A NH1   1 
ATOM   654  N NH2   . ARG A 1 85  ? -16.125 37.907 7.387   1.00 49.50 ? 92  ARG A NH2   1 
ATOM   655  N N     . ALA A 1 86  ? -15.025 37.809 0.451   1.00 35.14 ? 93  ALA A N     1 
ATOM   656  C CA    . ALA A 1 86  ? -14.362 36.592 -0.022  1.00 35.75 ? 93  ALA A CA    1 
ATOM   657  C C     . ALA A 1 86  ? -14.006 35.662 1.132   1.00 37.21 ? 93  ALA A C     1 
ATOM   658  O O     . ALA A 1 86  ? -13.240 36.037 2.023   1.00 36.59 ? 93  ALA A O     1 
ATOM   659  C CB    . ALA A 1 86  ? -13.093 36.947 -0.802  1.00 32.92 ? 93  ALA A CB    1 
ATOM   660  N N     . LYS A 1 87  ? -14.561 34.452 1.111   1.00 37.32 ? 94  LYS A N     1 
ATOM   661  C CA    . LYS A 1 87  ? -14.281 33.469 2.148   1.00 37.13 ? 94  LYS A CA    1 
ATOM   662  C C     . LYS A 1 87  ? -12.842 32.960 1.953   1.00 39.92 ? 94  LYS A C     1 
ATOM   663  O O     . LYS A 1 87  ? -12.073 32.828 2.915   1.00 40.10 ? 94  LYS A O     1 
ATOM   664  C CB    . LYS A 1 87  ? -15.269 32.316 2.045   1.00 34.89 ? 94  LYS A CB    1 
ATOM   665  C CG    . LYS A 1 87  ? -15.248 31.372 3.227   1.00 35.34 ? 94  LYS A CG    1 
ATOM   666  C CD    . LYS A 1 87  ? -16.141 30.183 2.962   1.00 36.77 ? 94  LYS A CD    1 
ATOM   667  C CE    . LYS A 1 87  ? -16.249 29.251 4.147   1.00 35.07 ? 94  LYS A CE    1 
ATOM   668  N NZ    . LYS A 1 87  ? -17.058 28.043 3.786   1.00 37.71 ? 94  LYS A NZ    1 
ATOM   669  N N     . VAL A 1 88  ? -12.486 32.686 0.700   1.00 41.40 ? 95  VAL A N     1 
ATOM   670  C CA    . VAL A 1 88  ? -11.147 32.220 0.343   1.00 40.69 ? 95  VAL A CA    1 
ATOM   671  C C     . VAL A 1 88  ? -10.703 33.049 -0.854  1.00 40.64 ? 95  VAL A C     1 
ATOM   672  O O     . VAL A 1 88  ? -11.436 33.929 -1.280  1.00 41.40 ? 95  VAL A O     1 
ATOM   673  C CB    . VAL A 1 88  ? -11.154 30.714 -0.015  1.00 38.00 ? 95  VAL A CB    1 
ATOM   674  C CG1   . VAL A 1 88  ? -11.587 29.912 1.197   1.00 36.08 ? 95  VAL A CG1   1 
ATOM   675  C CG2   . VAL A 1 88  ? -12.075 30.454 -1.183  1.00 35.64 ? 95  VAL A CG2   1 
ATOM   676  N N     . GLU A 1 89  ? -9.516  32.799 -1.386  1.00 42.35 ? 96  GLU A N     1 
ATOM   677  C CA    . GLU A 1 89  ? -9.070  33.574 -2.536  1.00 45.06 ? 96  GLU A CA    1 
ATOM   678  C C     . GLU A 1 89  ? -10.067 33.411 -3.703  1.00 47.09 ? 96  GLU A C     1 
ATOM   679  O O     . GLU A 1 89  ? -10.436 32.290 -4.081  1.00 47.56 ? 96  GLU A O     1 
ATOM   680  C CB    . GLU A 1 89  ? -7.683  33.129 -2.975  1.00 47.43 ? 96  GLU A CB    1 
ATOM   681  C CG    . GLU A 1 89  ? -6.896  34.245 -3.640  1.00 51.64 ? 96  GLU A CG    1 
ATOM   682  C CD    . GLU A 1 89  ? -5.658  33.743 -4.345  1.00 54.15 ? 96  GLU A CD    1 
ATOM   683  O OE1   . GLU A 1 89  ? -5.817  33.044 -5.376  1.00 54.67 ? 96  GLU A OE1   1 
ATOM   684  O OE2   . GLU A 1 89  ? -4.537  34.040 -3.865  1.00 52.85 ? 96  GLU A OE2   1 
ATOM   685  N N     . CYS A 1 90  ? -10.475 34.531 -4.284  1.00 46.27 ? 97  CYS A N     1 
ATOM   686  C CA    . CYS A 1 90  ? -11.461 34.526 -5.360  1.00 45.17 ? 97  CYS A CA    1 
ATOM   687  C C     . CYS A 1 90  ? -11.096 35.069 -6.721  1.00 45.47 ? 97  CYS A C     1 
ATOM   688  O O     . CYS A 1 90  ? -10.617 36.197 -6.837  1.00 44.78 ? 97  CYS A O     1 
ATOM   689  C CB    . CYS A 1 90  ? -12.685 35.319 -4.935  1.00 45.98 ? 97  CYS A CB    1 
ATOM   690  S SG    . CYS A 1 90  ? -13.694 34.555 -3.736  1.00 49.40 ? 97  CYS A SG    1 
ATOM   691  N N     . GLU A 1 91  ? -11.360 34.278 -7.757  1.00 45.39 ? 98  GLU A N     1 
ATOM   692  C CA    . GLU A 1 91  ? -11.155 34.749 -9.115  1.00 46.11 ? 98  GLU A CA    1 
ATOM   693  C C     . GLU A 1 91  ? -12.603 35.094 -9.453  1.00 42.69 ? 98  GLU A C     1 
ATOM   694  O O     . GLU A 1 91  ? -13.471 34.224 -9.459  1.00 41.17 ? 98  GLU A O     1 
ATOM   695  C CB    . GLU A 1 91  ? -10.611 33.656 -10.049 1.00 50.75 ? 98  GLU A CB    1 
ATOM   696  C CG    . GLU A 1 91  ? -10.299 34.187 -11.467 1.00 57.99 ? 98  GLU A CG    1 
ATOM   697  C CD    . GLU A 1 91  ? -9.142  35.205 -11.504 1.00 64.10 ? 98  GLU A CD    1 
ATOM   698  O OE1   . GLU A 1 91  ? -9.118  36.053 -12.449 1.00 62.81 ? 98  GLU A OE1   1 
ATOM   699  O OE2   . GLU A 1 91  ? -8.258  35.139 -10.596 1.00 65.47 ? 98  GLU A OE2   1 
ATOM   700  N N     . VAL A 1 92  ? -12.857 36.372 -9.695  1.00 40.53 ? 99  VAL A N     1 
ATOM   701  C CA    . VAL A 1 92  ? -14.202 36.864 -9.966  1.00 39.52 ? 99  VAL A CA    1 
ATOM   702  C C     . VAL A 1 92  ? -14.324 37.638 -11.285 1.00 39.09 ? 99  VAL A C     1 
ATOM   703  O O     . VAL A 1 92  ? -13.417 38.370 -11.667 1.00 40.13 ? 99  VAL A O     1 
ATOM   704  C CB    . VAL A 1 92  ? -14.655 37.777 -8.776  1.00 38.53 ? 99  VAL A CB    1 
ATOM   705  C CG1   . VAL A 1 92  ? -15.409 38.993 -9.270  1.00 37.49 ? 99  VAL A CG1   1 
ATOM   706  C CG2   . VAL A 1 92  ? -15.500 36.982 -7.811  1.00 38.05 ? 99  VAL A CG2   1 
ATOM   707  N N     . ALA A 1 93  ? -15.450 37.483 -11.970 1.00 38.90 ? 100 ALA A N     1 
ATOM   708  C CA    . ALA A 1 93  ? -15.686 38.199 -13.228 1.00 37.09 ? 100 ALA A CA    1 
ATOM   709  C C     . ALA A 1 93  ? -16.821 39.204 -13.052 1.00 38.52 ? 100 ALA A C     1 
ATOM   710  O O     . ALA A 1 93  ? -17.975 38.817 -12.805 1.00 37.87 ? 100 ALA A O     1 
ATOM   711  C CB    . ALA A 1 93  ? -16.040 37.218 -14.336 1.00 36.92 ? 100 ALA A CB    1 
ATOM   712  N N     . GLU A 1 94  ? -16.498 40.494 -13.165 1.00 38.06 ? 101 GLU A N     1 
ATOM   713  C CA    . GLU A 1 94  ? -17.512 41.532 -13.023 1.00 36.21 ? 101 GLU A CA    1 
ATOM   714  C C     . GLU A 1 94  ? -18.094 41.912 -14.378 1.00 35.35 ? 101 GLU A C     1 
ATOM   715  O O     . GLU A 1 94  ? -17.363 42.205 -15.321 1.00 34.28 ? 101 GLU A O     1 
ATOM   716  C CB    . GLU A 1 94  ? -16.940 42.770 -12.351 1.00 34.33 ? 101 GLU A CB    1 
ATOM   717  C CG    . GLU A 1 94  ? -18.018 43.797 -12.062 1.00 34.56 ? 101 GLU A CG    1 
ATOM   718  C CD    . GLU A 1 94  ? -17.563 44.866 -11.097 1.00 34.09 ? 101 GLU A CD    1 
ATOM   719  O OE1   . GLU A 1 94  ? -18.424 45.615 -10.604 1.00 34.78 ? 101 GLU A OE1   1 
ATOM   720  O OE2   . GLU A 1 94  ? -16.345 44.962 -10.828 1.00 35.56 ? 101 GLU A OE2   1 
ATOM   721  N N     . ILE A 1 95  ? -19.420 41.921 -14.451 1.00 34.88 ? 102 ILE A N     1 
ATOM   722  C CA    . ILE A 1 95  ? -20.141 42.216 -15.679 1.00 35.16 ? 102 ILE A CA    1 
ATOM   723  C C     . ILE A 1 95  ? -21.192 43.282 -15.435 1.00 37.71 ? 102 ILE A C     1 
ATOM   724  O O     . ILE A 1 95  ? -21.947 43.200 -14.467 1.00 39.86 ? 102 ILE A O     1 
ATOM   725  C CB    . ILE A 1 95  ? -20.836 40.963 -16.179 1.00 34.45 ? 102 ILE A CB    1 
ATOM   726  C CG1   . ILE A 1 95  ? -19.790 39.855 -16.384 1.00 34.59 ? 102 ILE A CG1   1 
ATOM   727  C CG2   . ILE A 1 95  ? -21.646 41.287 -17.413 1.00 32.99 ? 102 ILE A CG2   1 
ATOM   728  C CD1   . ILE A 1 95  ? -20.340 38.433 -16.345 1.00 34.60 ? 102 ILE A CD1   1 
ATOM   729  N N     . SER A 1 96  ? -21.256 44.274 -16.320 1.00 39.02 ? 103 SER A N     1 
ATOM   730  C CA    . SER A 1 96  ? -22.212 45.363 -16.160 1.00 38.96 ? 103 SER A CA    1 
ATOM   731  C C     . SER A 1 96  ? -23.642 44.899 -16.399 1.00 41.22 ? 103 SER A C     1 
ATOM   732  O O     . SER A 1 96  ? -23.888 43.983 -17.192 1.00 41.74 ? 103 SER A O     1 
ATOM   733  C CB    . SER A 1 96  ? -21.886 46.514 -17.117 1.00 38.84 ? 103 SER A CB    1 
ATOM   734  O OG    . SER A 1 96  ? -22.446 46.302 -18.404 1.00 36.39 ? 103 SER A OG    1 
ATOM   735  N N     . TYR A 1 97  ? -24.581 45.530 -15.701 1.00 42.32 ? 104 TYR A N     1 
ATOM   736  C CA    . TYR A 1 97  ? -25.992 45.205 -15.850 1.00 43.15 ? 104 TYR A CA    1 
ATOM   737  C C     . TYR A 1 97  ? -26.402 45.369 -17.314 1.00 44.60 ? 104 TYR A C     1 
ATOM   738  O O     . TYR A 1 97  ? -27.137 44.547 -17.869 1.00 44.65 ? 104 TYR A O     1 
ATOM   739  C CB    . TYR A 1 97  ? -26.840 46.127 -14.966 1.00 43.27 ? 104 TYR A CB    1 
ATOM   740  C CG    . TYR A 1 97  ? -26.854 45.758 -13.496 1.00 42.02 ? 104 TYR A CG    1 
ATOM   741  C CD1   . TYR A 1 97  ? -27.193 46.701 -12.525 1.00 43.14 ? 104 TYR A CD1   1 
ATOM   742  C CD2   . TYR A 1 97  ? -26.570 44.457 -13.079 1.00 42.11 ? 104 TYR A CD2   1 
ATOM   743  C CE1   . TYR A 1 97  ? -27.251 46.355 -11.165 1.00 41.93 ? 104 TYR A CE1   1 
ATOM   744  C CE2   . TYR A 1 97  ? -26.628 44.103 -11.728 1.00 40.94 ? 104 TYR A CE2   1 
ATOM   745  C CZ    . TYR A 1 97  ? -26.971 45.054 -10.781 1.00 40.60 ? 104 TYR A CZ    1 
ATOM   746  O OH    . TYR A 1 97  ? -27.053 44.695 -9.459  1.00 39.69 ? 104 TYR A OH    1 
ATOM   747  N N     . ALA A 1 98  ? -25.919 46.436 -17.948 1.00 46.03 ? 105 ALA A N     1 
ATOM   748  C CA    . ALA A 1 98  ? -26.244 46.679 -19.349 1.00 45.94 ? 105 ALA A CA    1 
ATOM   749  C C     . ALA A 1 98  ? -25.787 45.510 -20.225 1.00 45.87 ? 105 ALA A C     1 
ATOM   750  O O     . ALA A 1 98  ? -26.557 44.988 -21.030 1.00 45.86 ? 105 ALA A O     1 
ATOM   751  C CB    . ALA A 1 98  ? -25.598 47.978 -19.818 1.00 44.80 ? 105 ALA A CB    1 
ATOM   752  N N     . LYS A 1 99  ? -24.540 45.090 -20.052 1.00 46.13 ? 106 LYS A N     1 
ATOM   753  C CA    . LYS A 1 99  ? -23.991 43.996 -20.837 1.00 47.60 ? 106 LYS A CA    1 
ATOM   754  C C     . LYS A 1 99  ? -24.649 42.668 -20.505 1.00 48.00 ? 106 LYS A C     1 
ATOM   755  O O     . LYS A 1 99  ? -24.719 41.772 -21.355 1.00 47.40 ? 106 LYS A O     1 
ATOM   756  C CB    . LYS A 1 99  ? -22.474 43.901 -20.631 1.00 49.43 ? 106 LYS A CB    1 
ATOM   757  C CG    . LYS A 1 99  ? -21.684 45.036 -21.309 1.00 53.97 ? 106 LYS A CG    1 
ATOM   758  C CD    . LYS A 1 99  ? -20.279 45.252 -20.706 1.00 54.96 ? 106 LYS A CD    1 
ATOM   759  C CE    . LYS A 1 99  ? -19.532 46.400 -21.403 1.00 54.90 ? 106 LYS A CE    1 
ATOM   760  N NZ    . LYS A 1 99  ? -20.297 47.693 -21.410 1.00 55.98 ? 106 LYS A NZ    1 
ATOM   761  N N     . PHE A 1 100 ? -25.145 42.535 -19.280 1.00 48.11 ? 107 PHE A N     1 
ATOM   762  C CA    . PHE A 1 100 ? -25.784 41.284 -18.879 1.00 47.69 ? 107 PHE A CA    1 
ATOM   763  C C     . PHE A 1 100 ? -27.165 41.126 -19.485 1.00 48.01 ? 107 PHE A C     1 
ATOM   764  O O     . PHE A 1 100 ? -27.526 40.038 -19.942 1.00 46.61 ? 107 PHE A O     1 
ATOM   765  C CB    . PHE A 1 100 ? -25.903 41.179 -17.356 1.00 46.77 ? 107 PHE A CB    1 
ATOM   766  C CG    . PHE A 1 100 ? -26.417 39.844 -16.886 1.00 45.47 ? 107 PHE A CG    1 
ATOM   767  C CD1   . PHE A 1 100 ? -25.595 38.720 -16.905 1.00 43.89 ? 107 PHE A CD1   1 
ATOM   768  C CD2   . PHE A 1 100 ? -27.739 39.702 -16.469 1.00 44.68 ? 107 PHE A CD2   1 
ATOM   769  C CE1   . PHE A 1 100 ? -26.080 37.475 -16.516 1.00 43.65 ? 107 PHE A CE1   1 
ATOM   770  C CE2   . PHE A 1 100 ? -28.234 38.458 -16.081 1.00 44.07 ? 107 PHE A CE2   1 
ATOM   771  C CZ    . PHE A 1 100 ? -27.403 37.344 -16.102 1.00 43.21 ? 107 PHE A CZ    1 
ATOM   772  N N     . ARG A 1 101 ? -27.946 42.205 -19.470 1.00 48.96 ? 108 ARG A N     1 
ATOM   773  C CA    . ARG A 1 101 ? -29.290 42.161 -20.033 1.00 49.94 ? 108 ARG A CA    1 
ATOM   774  C C     . ARG A 1 101 ? -29.203 41.832 -21.522 1.00 50.10 ? 108 ARG A C     1 
ATOM   775  O O     . ARG A 1 101 ? -30.105 41.221 -22.093 1.00 50.67 ? 108 ARG A O     1 
ATOM   776  C CB    . ARG A 1 101 ? -30.014 43.497 -19.781 1.00 48.91 ? 108 ARG A CB    1 
ATOM   777  C CG    . ARG A 1 101 ? -30.632 43.585 -18.378 1.00 50.43 ? 108 ARG A CG    1 
ATOM   778  C CD    . ARG A 1 101 ? -31.321 44.911 -18.061 1.00 49.99 ? 108 ARG A CD    1 
ATOM   779  N NE    . ARG A 1 101 ? -30.361 45.979 -17.765 1.00 51.89 ? 108 ARG A NE    1 
ATOM   780  C CZ    . ARG A 1 101 ? -30.226 46.580 -16.582 1.00 49.35 ? 108 ARG A CZ    1 
ATOM   781  N NH1   . ARG A 1 101 ? -29.325 47.542 -16.416 1.00 48.28 ? 108 ARG A NH1   1 
ATOM   782  N NH2   . ARG A 1 101 ? -30.992 46.228 -15.565 1.00 49.08 ? 108 ARG A NH2   1 
ATOM   783  N N     . GLU A 1 102 ? -28.088 42.211 -22.137 1.00 50.76 ? 109 GLU A N     1 
ATOM   784  C CA    . GLU A 1 102 ? -27.859 41.961 -23.552 1.00 51.42 ? 109 GLU A CA    1 
ATOM   785  C C     . GLU A 1 102 ? -27.592 40.481 -23.798 1.00 51.62 ? 109 GLU A C     1 
ATOM   786  O O     . GLU A 1 102 ? -28.331 39.819 -24.527 1.00 52.44 ? 109 GLU A O     1 
ATOM   787  C CB    . GLU A 1 102 ? -26.671 42.785 -24.026 1.00 52.90 ? 109 GLU A CB    1 
ATOM   788  C CG    . GLU A 1 102 ? -26.596 42.969 -25.520 1.00 56.39 ? 109 GLU A CG    1 
ATOM   789  C CD    . GLU A 1 102 ? -25.492 43.927 -25.911 1.00 60.07 ? 109 GLU A CD    1 
ATOM   790  O OE1   . GLU A 1 102 ? -24.477 43.454 -26.472 1.00 61.43 ? 109 GLU A OE1   1 
ATOM   791  O OE2   . GLU A 1 102 ? -25.636 45.148 -25.644 1.00 60.71 ? 109 GLU A OE2   1 
ATOM   792  N N     . LEU A 1 103 ? -26.530 39.968 -23.185 1.00 52.05 ? 110 LEU A N     1 
ATOM   793  C CA    . LEU A 1 103 ? -26.160 38.565 -23.322 1.00 51.52 ? 110 LEU A CA    1 
ATOM   794  C C     . LEU A 1 103 ? -27.336 37.662 -23.004 1.00 52.94 ? 110 LEU A C     1 
ATOM   795  O O     . LEU A 1 103 ? -27.412 36.545 -23.508 1.00 53.30 ? 110 LEU A O     1 
ATOM   796  C CB    . LEU A 1 103 ? -25.011 38.228 -22.379 1.00 50.00 ? 110 LEU A CB    1 
ATOM   797  C CG    . LEU A 1 103 ? -23.681 38.917 -22.659 1.00 48.68 ? 110 LEU A CG    1 
ATOM   798  C CD1   . LEU A 1 103 ? -22.795 38.809 -21.426 1.00 47.31 ? 110 LEU A CD1   1 
ATOM   799  C CD2   . LEU A 1 103 ? -23.018 38.281 -23.880 1.00 47.27 ? 110 LEU A CD2   1 
ATOM   800  N N     . SER A 1 104 ? -28.249 38.153 -22.166 1.00 54.57 ? 111 SER A N     1 
ATOM   801  C CA    . SER A 1 104 ? -29.430 37.387 -21.770 1.00 56.39 ? 111 SER A CA    1 
ATOM   802  C C     . SER A 1 104 ? -30.512 37.400 -22.845 1.00 57.40 ? 111 SER A C     1 
ATOM   803  O O     . SER A 1 104 ? -31.247 36.420 -23.003 1.00 56.90 ? 111 SER A O     1 
ATOM   804  C CB    . SER A 1 104 ? -30.007 37.937 -20.467 1.00 57.04 ? 111 SER A CB    1 
ATOM   805  O OG    . SER A 1 104 ? -29.081 37.826 -19.405 1.00 55.83 ? 111 SER A OG    1 
ATOM   806  N N     . GLN A 1 105 ? -30.627 38.508 -23.571 1.00 58.78 ? 112 GLN A N     1 
ATOM   807  C CA    . GLN A 1 105 ? -31.624 38.575 -24.631 1.00 62.15 ? 112 GLN A CA    1 
ATOM   808  C C     . GLN A 1 105 ? -31.191 37.654 -25.758 1.00 62.71 ? 112 GLN A C     1 
ATOM   809  O O     . GLN A 1 105 ? -32.010 36.943 -26.347 1.00 65.06 ? 112 GLN A O     1 
ATOM   810  C CB    . GLN A 1 105 ? -31.790 40.000 -25.170 1.00 63.47 ? 112 GLN A CB    1 
ATOM   811  C CG    . GLN A 1 105 ? -33.150 40.616 -24.843 1.00 64.52 ? 112 GLN A CG    1 
ATOM   812  C CD    . GLN A 1 105 ? -33.248 41.047 -23.388 1.00 66.98 ? 112 GLN A CD    1 
ATOM   813  O OE1   . GLN A 1 105 ? -33.220 42.243 -23.088 1.00 66.48 ? 112 GLN A OE1   1 
ATOM   814  N NE2   . GLN A 1 105 ? -33.339 40.072 -22.470 1.00 68.17 ? 112 GLN A NE2   1 
ATOM   815  N N     . GLN A 1 106 ? -29.899 37.661 -26.055 1.00 60.93 ? 113 GLN A N     1 
ATOM   816  C CA    . GLN A 1 106 ? -29.384 36.807 -27.098 1.00 61.55 ? 113 GLN A CA    1 
ATOM   817  C C     . GLN A 1 106 ? -29.482 35.336 -26.673 1.00 60.99 ? 113 GLN A C     1 
ATOM   818  O O     . GLN A 1 106 ? -29.807 34.465 -27.482 1.00 61.16 ? 113 GLN A O     1 
ATOM   819  C CB    . GLN A 1 106 ? -27.939 37.193 -27.418 1.00 64.26 ? 113 GLN A CB    1 
ATOM   820  C CG    . GLN A 1 106 ? -27.215 36.182 -28.293 1.00 69.43 ? 113 GLN A CG    1 
ATOM   821  C CD    . GLN A 1 106 ? -28.082 35.651 -29.443 1.00 73.38 ? 113 GLN A CD    1 
ATOM   822  O OE1   . GLN A 1 106 ? -27.864 34.535 -29.930 1.00 75.38 ? 113 GLN A OE1   1 
ATOM   823  N NE2   . GLN A 1 106 ? -29.057 36.452 -29.880 1.00 74.66 ? 113 GLN A NE2   1 
ATOM   824  N N     . ASP A 1 107 ? -29.220 35.072 -25.396 1.00 60.40 ? 114 ASP A N     1 
ATOM   825  C CA    . ASP A 1 107 ? -29.275 33.712 -24.833 1.00 58.63 ? 114 ASP A CA    1 
ATOM   826  C C     . ASP A 1 107 ? -30.090 33.701 -23.545 1.00 57.01 ? 114 ASP A C     1 
ATOM   827  O O     . ASP A 1 107 ? -29.610 34.151 -22.505 1.00 56.84 ? 114 ASP A O     1 
ATOM   828  C CB    . ASP A 1 107 ? -27.865 33.201 -24.517 1.00 59.82 ? 114 ASP A CB    1 
ATOM   829  C CG    . ASP A 1 107 ? -27.031 32.955 -25.764 1.00 60.07 ? 114 ASP A CG    1 
ATOM   830  O OD1   . ASP A 1 107 ? -27.359 32.025 -26.531 1.00 60.79 ? 114 ASP A OD1   1 
ATOM   831  O OD2   . ASP A 1 107 ? -26.046 33.694 -25.973 1.00 59.87 ? 114 ASP A OD2   1 
ATOM   832  N N     . SER A 1 108 ? -31.307 33.172 -23.597 1.00 56.29 ? 115 SER A N     1 
ATOM   833  C CA    . SER A 1 108 ? -32.173 33.141 -22.418 1.00 54.08 ? 115 SER A CA    1 
ATOM   834  C C     . SER A 1 108 ? -31.728 32.150 -21.328 1.00 53.08 ? 115 SER A C     1 
ATOM   835  O O     . SER A 1 108 ? -32.073 32.328 -20.156 1.00 51.83 ? 115 SER A O     1 
ATOM   836  C CB    . SER A 1 108 ? -33.625 32.842 -22.822 1.00 53.73 ? 115 SER A CB    1 
ATOM   837  O OG    . SER A 1 108 ? -33.789 31.476 -23.168 1.00 56.08 ? 115 SER A OG    1 
ATOM   838  N N     . GLU A 1 109 ? -30.961 31.121 -21.693 1.00 50.61 ? 116 GLU A N     1 
ATOM   839  C CA    . GLU A 1 109 ? -30.525 30.153 -20.697 1.00 47.97 ? 116 GLU A CA    1 
ATOM   840  C C     . GLU A 1 109 ? -29.675 30.793 -19.603 1.00 46.30 ? 116 GLU A C     1 
ATOM   841  O O     . GLU A 1 109 ? -29.650 30.310 -18.465 1.00 46.05 ? 116 GLU A O     1 
ATOM   842  C CB    . GLU A 1 109 ? -29.759 28.991 -21.342 1.00 49.26 ? 116 GLU A CB    1 
ATOM   843  C CG    . GLU A 1 109 ? -29.420 27.862 -20.337 1.00 52.47 ? 116 GLU A CG    1 
ATOM   844  C CD    . GLU A 1 109 ? -28.934 26.554 -20.986 1.00 54.67 ? 116 GLU A CD    1 
ATOM   845  O OE1   . GLU A 1 109 ? -28.522 25.630 -20.240 1.00 52.83 ? 116 GLU A OE1   1 
ATOM   846  O OE2   . GLU A 1 109 ? -28.968 26.441 -22.233 1.00 56.83 ? 116 GLU A OE2   1 
ATOM   847  N N     . ILE A 1 110 ? -28.989 31.881 -19.939 1.00 42.86 ? 117 ILE A N     1 
ATOM   848  C CA    . ILE A 1 110 ? -28.150 32.574 -18.968 1.00 41.44 ? 117 ILE A CA    1 
ATOM   849  C C     . ILE A 1 110 ? -28.993 33.171 -17.831 1.00 40.72 ? 117 ILE A C     1 
ATOM   850  O O     . ILE A 1 110 ? -28.635 33.082 -16.652 1.00 38.43 ? 117 ILE A O     1 
ATOM   851  C CB    . ILE A 1 110 ? -27.325 33.685 -19.658 1.00 40.71 ? 117 ILE A CB    1 
ATOM   852  C CG1   . ILE A 1 110 ? -26.296 33.045 -20.598 1.00 40.35 ? 117 ILE A CG1   1 
ATOM   853  C CG2   . ILE A 1 110 ? -26.632 34.559 -18.617 1.00 41.40 ? 117 ILE A CG2   1 
ATOM   854  C CD1   . ILE A 1 110 ? -25.496 34.034 -21.434 1.00 38.57 ? 117 ILE A CD1   1 
ATOM   855  N N     . LEU A 1 111 ? -30.121 33.770 -18.200 1.00 40.74 ? 118 LEU A N     1 
ATOM   856  C CA    . LEU A 1 111 ? -31.041 34.370 -17.242 1.00 37.37 ? 118 LEU A CA    1 
ATOM   857  C C     . LEU A 1 111 ? -31.731 33.269 -16.441 1.00 36.25 ? 118 LEU A C     1 
ATOM   858  O O     . LEU A 1 111 ? -31.973 33.407 -15.252 1.00 34.96 ? 118 LEU A O     1 
ATOM   859  C CB    . LEU A 1 111 ? -32.085 35.209 -17.988 1.00 36.50 ? 118 LEU A CB    1 
ATOM   860  C CG    . LEU A 1 111 ? -33.202 35.837 -17.156 1.00 36.18 ? 118 LEU A CG    1 
ATOM   861  C CD1   . LEU A 1 111 ? -32.610 36.786 -16.128 1.00 36.02 ? 118 LEU A CD1   1 
ATOM   862  C CD2   . LEU A 1 111 ? -34.162 36.573 -18.074 1.00 33.21 ? 118 LEU A CD2   1 
ATOM   863  N N     . TYR A 1 112 ? -32.038 32.166 -17.116 1.00 37.76 ? 119 TYR A N     1 
ATOM   864  C CA    . TYR A 1 112 ? -32.699 31.036 -16.486 1.00 38.24 ? 119 TYR A CA    1 
ATOM   865  C C     . TYR A 1 112 ? -31.830 30.474 -15.357 1.00 37.62 ? 119 TYR A C     1 
ATOM   866  O O     . TYR A 1 112 ? -32.347 30.048 -14.321 1.00 34.38 ? 119 TYR A O     1 
ATOM   867  C CB    . TYR A 1 112 ? -32.965 29.943 -17.526 1.00 39.72 ? 119 TYR A CB    1 
ATOM   868  C CG    . TYR A 1 112 ? -33.908 28.867 -17.040 1.00 42.71 ? 119 TYR A CG    1 
ATOM   869  C CD1   . TYR A 1 112 ? -35.293 29.035 -17.124 1.00 43.86 ? 119 TYR A CD1   1 
ATOM   870  C CD2   . TYR A 1 112 ? -33.417 27.689 -16.464 1.00 44.78 ? 119 TYR A CD2   1 
ATOM   871  C CE1   . TYR A 1 112 ? -36.176 28.047 -16.656 1.00 48.33 ? 119 TYR A CE1   1 
ATOM   872  C CE2   . TYR A 1 112 ? -34.285 26.691 -15.986 1.00 47.95 ? 119 TYR A CE2   1 
ATOM   873  C CZ    . TYR A 1 112 ? -35.668 26.874 -16.087 1.00 50.56 ? 119 TYR A CZ    1 
ATOM   874  O OH    . TYR A 1 112 ? -36.542 25.888 -15.647 1.00 50.53 ? 119 TYR A OH    1 
ATOM   875  N N     . THR A 1 113 ? -30.512 30.467 -15.575 1.00 37.44 ? 120 THR A N     1 
ATOM   876  C CA    . THR A 1 113 ? -29.560 29.977 -14.581 1.00 35.08 ? 120 THR A CA    1 
ATOM   877  C C     . THR A 1 113 ? -29.484 30.954 -13.413 1.00 34.08 ? 120 THR A C     1 
ATOM   878  O O     . THR A 1 113 ? -29.343 30.556 -12.252 1.00 33.24 ? 120 THR A O     1 
ATOM   879  C CB    . THR A 1 113 ? -28.165 29.797 -15.183 1.00 33.78 ? 120 THR A CB    1 
ATOM   880  O OG1   . THR A 1 113 ? -28.193 28.686 -16.077 1.00 35.60 ? 120 THR A OG1   1 
ATOM   881  C CG2   . THR A 1 113 ? -27.126 29.532 -14.099 1.00 33.18 ? 120 THR A CG2   1 
ATOM   882  N N     . LEU A 1 114 ? -29.571 32.236 -13.716 1.00 32.48 ? 121 LEU A N     1 
ATOM   883  C CA    . LEU A 1 114 ? -29.552 33.221 -12.659 1.00 32.66 ? 121 LEU A CA    1 
ATOM   884  C C     . LEU A 1 114 ? -30.839 33.028 -11.849 1.00 33.99 ? 121 LEU A C     1 
ATOM   885  O O     . LEU A 1 114 ? -30.818 33.032 -10.618 1.00 34.50 ? 121 LEU A O     1 
ATOM   886  C CB    . LEU A 1 114 ? -29.512 34.627 -13.240 1.00 29.97 ? 121 LEU A CB    1 
ATOM   887  C CG    . LEU A 1 114 ? -29.464 35.737 -12.203 1.00 31.39 ? 121 LEU A CG    1 
ATOM   888  C CD1   . LEU A 1 114 ? -28.145 35.714 -11.451 1.00 28.67 ? 121 LEU A CD1   1 
ATOM   889  C CD2   . LEU A 1 114 ? -29.643 37.060 -12.912 1.00 33.75 ? 121 LEU A CD2   1 
ATOM   890  N N     . GLY A 1 115 ? -31.959 32.851 -12.555 1.00 33.19 ? 122 GLY A N     1 
ATOM   891  C CA    . GLY A 1 115 ? -33.235 32.660 -11.891 1.00 30.55 ? 122 GLY A CA    1 
ATOM   892  C C     . GLY A 1 115 ? -33.226 31.419 -11.016 1.00 30.55 ? 122 GLY A C     1 
ATOM   893  O O     . GLY A 1 115 ? -33.875 31.361 -9.974  1.00 30.59 ? 122 GLY A O     1 
ATOM   894  N N     . SER A 1 116 ? -32.481 30.414 -11.453 1.00 30.49 ? 123 SER A N     1 
ATOM   895  C CA    . SER A 1 116 ? -32.372 29.166 -10.720 1.00 29.28 ? 123 SER A CA    1 
ATOM   896  C C     . SER A 1 116 ? -31.621 29.385 -9.414  1.00 28.97 ? 123 SER A C     1 
ATOM   897  O O     . SER A 1 116 ? -31.972 28.824 -8.382  1.00 31.41 ? 123 SER A O     1 
ATOM   898  C CB    . SER A 1 116 ? -31.633 28.140 -11.569 1.00 28.19 ? 123 SER A CB    1 
ATOM   899  O OG    . SER A 1 116 ? -31.431 26.956 -10.831 1.00 32.23 ? 123 SER A OG    1 
ATOM   900  N N     . GLN A 1 117 ? -30.577 30.194 -9.459  1.00 28.28 ? 124 GLN A N     1 
ATOM   901  C CA    . GLN A 1 117 ? -29.789 30.483 -8.281  1.00 27.70 ? 124 GLN A CA    1 
ATOM   902  C C     . GLN A 1 117 ? -30.595 31.317 -7.274  1.00 29.02 ? 124 GLN A C     1 
ATOM   903  O O     . GLN A 1 117 ? -30.600 31.014 -6.071  1.00 27.44 ? 124 GLN A O     1 
ATOM   904  C CB    . GLN A 1 117 ? -28.477 31.163 -8.704  1.00 26.10 ? 124 GLN A CB    1 
ATOM   905  C CG    . GLN A 1 117 ? -27.586 30.181 -9.477  1.00 26.39 ? 124 GLN A CG    1 
ATOM   906  C CD    . GLN A 1 117 ? -26.233 30.734 -9.932  1.00 28.32 ? 124 GLN A CD    1 
ATOM   907  O OE1   . GLN A 1 117 ? -25.765 31.781 -9.467  1.00 27.50 ? 124 GLN A OE1   1 
ATOM   908  N NE2   . GLN A 1 117 ? -25.594 30.013 -10.841 1.00 25.50 ? 124 GLN A NE2   1 
ATOM   909  N N     . MET A 1 118 ? -31.294 32.342 -7.748  1.00 28.73 ? 125 MET A N     1 
ATOM   910  C CA    . MET A 1 118 ? -32.106 33.161 -6.856  1.00 31.09 ? 125 MET A CA    1 
ATOM   911  C C     . MET A 1 118 ? -33.149 32.290 -6.155  1.00 30.81 ? 125 MET A C     1 
ATOM   912  O O     . MET A 1 118 ? -33.402 32.444 -4.958  1.00 28.56 ? 125 MET A O     1 
ATOM   913  C CB    . MET A 1 118 ? -32.813 34.273 -7.629  1.00 31.92 ? 125 MET A CB    1 
ATOM   914  C CG    . MET A 1 118 ? -31.910 35.431 -8.035  1.00 33.44 ? 125 MET A CG    1 
ATOM   915  S SD    . MET A 1 118 ? -32.823 36.751 -8.888  1.00 33.68 ? 125 MET A SD    1 
ATOM   916  C CE    . MET A 1 118 ? -33.250 35.903 -10.386 1.00 34.19 ? 125 MET A CE    1 
ATOM   917  N N     . ALA A 1 119 ? -33.754 31.378 -6.914  1.00 32.18 ? 126 ALA A N     1 
ATOM   918  C CA    . ALA A 1 119 ? -34.765 30.461 -6.378  1.00 32.41 ? 126 ALA A CA    1 
ATOM   919  C C     . ALA A 1 119 ? -34.162 29.621 -5.261  1.00 32.40 ? 126 ALA A C     1 
ATOM   920  O O     . ALA A 1 119 ? -34.752 29.482 -4.192  1.00 32.99 ? 126 ALA A O     1 
ATOM   921  C CB    . ALA A 1 119 ? -35.295 29.552 -7.482  1.00 31.43 ? 126 ALA A CB    1 
ATOM   922  N N     . ASP A 1 120 ? -32.981 29.068 -5.520  1.00 32.83 ? 127 ASP A N     1 
ATOM   923  C CA    . ASP A 1 120 ? -32.286 28.258 -4.535  1.00 33.94 ? 127 ASP A CA    1 
ATOM   924  C C     . ASP A 1 120 ? -32.033 29.069 -3.252  1.00 33.62 ? 127 ASP A C     1 
ATOM   925  O O     . ASP A 1 120 ? -32.203 28.564 -2.133  1.00 31.22 ? 127 ASP A O     1 
ATOM   926  C CB    . ASP A 1 120 ? -30.959 27.774 -5.117  1.00 36.90 ? 127 ASP A CB    1 
ATOM   927  C CG    . ASP A 1 120 ? -30.324 26.658 -4.284  1.00 42.06 ? 127 ASP A CG    1 
ATOM   928  O OD1   . ASP A 1 120 ? -30.799 26.389 -3.156  1.00 44.96 ? 127 ASP A OD1   1 
ATOM   929  O OD2   . ASP A 1 120 ? -29.340 26.049 -4.757  1.00 45.03 ? 127 ASP A OD2   1 
ATOM   930  N N     . ARG A 1 121 ? -31.631 30.327 -3.423  1.00 32.64 ? 128 ARG A N     1 
ATOM   931  C CA    . ARG A 1 121 ? -31.351 31.213 -2.296  1.00 31.34 ? 128 ARG A CA    1 
ATOM   932  C C     . ARG A 1 121 ? -32.601 31.627 -1.528  1.00 31.20 ? 128 ARG A C     1 
ATOM   933  O O     . ARG A 1 121 ? -32.552 31.837 -0.314  1.00 29.69 ? 128 ARG A O     1 
ATOM   934  C CB    . ARG A 1 121 ? -30.605 32.452 -2.787  1.00 30.54 ? 128 ARG A CB    1 
ATOM   935  C CG    . ARG A 1 121 ? -29.281 32.120 -3.426  1.00 28.62 ? 128 ARG A CG    1 
ATOM   936  C CD    . ARG A 1 121 ? -28.735 33.267 -4.262  1.00 29.54 ? 128 ARG A CD    1 
ATOM   937  N NE    . ARG A 1 121 ? -27.679 32.791 -5.158  1.00 29.32 ? 128 ARG A NE    1 
ATOM   938  C CZ    . ARG A 1 121 ? -26.901 33.565 -5.912  1.00 28.29 ? 128 ARG A CZ    1 
ATOM   939  N NH1   . ARG A 1 121 ? -25.978 33.012 -6.683  1.00 27.52 ? 128 ARG A NH1   1 
ATOM   940  N NH2   . ARG A 1 121 ? -27.038 34.884 -5.889  1.00 29.18 ? 128 ARG A NH2   1 
ATOM   941  N N     . LEU A 1 122 ? -33.725 31.752 -2.227  1.00 32.47 ? 129 LEU A N     1 
ATOM   942  C CA    . LEU A 1 122 ? -34.961 32.136 -1.560  1.00 32.36 ? 129 LEU A CA    1 
ATOM   943  C C     . LEU A 1 122 ? -35.369 31.018 -0.618  1.00 31.43 ? 129 LEU A C     1 
ATOM   944  O O     . LEU A 1 122 ? -35.834 31.277 0.489   1.00 31.40 ? 129 LEU A O     1 
ATOM   945  C CB    . LEU A 1 122 ? -36.087 32.400 -2.566  1.00 34.28 ? 129 LEU A CB    1 
ATOM   946  C CG    . LEU A 1 122 ? -36.732 33.803 -2.573  1.00 36.99 ? 129 LEU A CG    1 
ATOM   947  C CD1   . LEU A 1 122 ? -38.072 33.746 -3.300  1.00 37.10 ? 129 LEU A CD1   1 
ATOM   948  C CD2   . LEU A 1 122 ? -36.965 34.304 -1.163  1.00 36.90 ? 129 LEU A CD2   1 
ATOM   949  N N     . ARG A 1 123 ? -35.187 29.776 -1.070  1.00 30.80 ? 130 ARG A N     1 
ATOM   950  C CA    . ARG A 1 123 ? -35.528 28.603 -0.271  1.00 29.42 ? 130 ARG A CA    1 
ATOM   951  C C     . ARG A 1 123 ? -34.647 28.563 0.967   1.00 28.59 ? 130 ARG A C     1 
ATOM   952  O O     . ARG A 1 123 ? -35.139 28.472 2.101   1.00 26.29 ? 130 ARG A O     1 
ATOM   953  C CB    . ARG A 1 123 ? -35.311 27.326 -1.084  1.00 31.93 ? 130 ARG A CB    1 
ATOM   954  C CG    . ARG A 1 123 ? -36.546 26.772 -1.762  1.00 35.28 ? 130 ARG A CG    1 
ATOM   955  C CD    . ARG A 1 123 ? -36.252 25.411 -2.393  1.00 38.39 ? 130 ARG A CD    1 
ATOM   956  N NE    . ARG A 1 123 ? -35.519 25.544 -3.651  1.00 43.87 ? 130 ARG A NE    1 
ATOM   957  C CZ    . ARG A 1 123 ? -36.063 25.382 -4.853  1.00 44.87 ? 130 ARG A CZ    1 
ATOM   958  N NH1   . ARG A 1 123 ? -35.313 25.531 -5.948  1.00 42.71 ? 130 ARG A NH1   1 
ATOM   959  N NH2   . ARG A 1 123 ? -37.354 25.053 -4.957  1.00 44.42 ? 130 ARG A NH2   1 
ATOM   960  N N     . LYS A 1 124 ? -33.338 28.618 0.731   1.00 26.64 ? 131 LYS A N     1 
ATOM   961  C CA    . LYS A 1 124 ? -32.345 28.595 1.783   1.00 26.12 ? 131 LYS A CA    1 
ATOM   962  C C     . LYS A 1 124 ? -32.631 29.653 2.847   1.00 27.79 ? 131 LYS A C     1 
ATOM   963  O O     . LYS A 1 124 ? -32.627 29.373 4.052   1.00 26.09 ? 131 LYS A O     1 
ATOM   964  C CB    . LYS A 1 124 ? -30.961 28.847 1.198   1.00 25.16 ? 131 LYS A CB    1 
ATOM   965  C CG    . LYS A 1 124 ? -30.290 27.642 0.591   1.00 27.67 ? 131 LYS A CG    1 
ATOM   966  C CD    . LYS A 1 124 ? -28.777 27.857 0.588   1.00 31.65 ? 131 LYS A CD    1 
ATOM   967  C CE    . LYS A 1 124 ? -27.974 26.580 0.326   1.00 32.82 ? 131 LYS A CE    1 
ATOM   968  N NZ    . LYS A 1 124 ? -28.148 26.053 -1.054  1.00 33.40 ? 131 LYS A NZ    1 
ATOM   969  N N     . THR A 1 125 ? -32.876 30.875 2.383   1.00 27.59 ? 132 THR A N     1 
ATOM   970  C CA    . THR A 1 125 ? -33.136 31.990 3.266   1.00 28.17 ? 132 THR A CA    1 
ATOM   971  C C     . THR A 1 125 ? -34.474 31.874 3.991   1.00 28.87 ? 132 THR A C     1 
ATOM   972  O O     . THR A 1 125 ? -34.603 32.313 5.142   1.00 29.73 ? 132 THR A O     1 
ATOM   973  C CB    . THR A 1 125 ? -33.050 33.302 2.481   1.00 24.96 ? 132 THR A CB    1 
ATOM   974  O OG1   . THR A 1 125 ? -31.804 33.328 1.795   1.00 25.12 ? 132 THR A OG1   1 
ATOM   975  C CG2   . THR A 1 125 ? -33.084 34.497 3.408   1.00 26.09 ? 132 THR A CG2   1 
ATOM   976  N N     . THR A 1 126 ? -35.463 31.283 3.329   1.00 27.49 ? 133 THR A N     1 
ATOM   977  C CA    . THR A 1 126 ? -36.766 31.106 3.952   1.00 28.37 ? 133 THR A CA    1 
ATOM   978  C C     . THR A 1 126 ? -36.631 30.066 5.068   1.00 29.45 ? 133 THR A C     1 
ATOM   979  O O     . THR A 1 126 ? -37.336 30.124 6.079   1.00 26.29 ? 133 THR A O     1 
ATOM   980  C CB    . THR A 1 126 ? -37.814 30.641 2.923   1.00 29.09 ? 133 THR A CB    1 
ATOM   981  O OG1   . THR A 1 126 ? -38.010 31.669 1.940   1.00 29.09 ? 133 THR A OG1   1 
ATOM   982  C CG2   . THR A 1 126 ? -39.131 30.346 3.599   1.00 28.65 ? 133 THR A CG2   1 
ATOM   983  N N     . ARG A 1 127 ? -35.709 29.121 4.885   1.00 30.78 ? 134 ARG A N     1 
ATOM   984  C CA    . ARG A 1 127 ? -35.477 28.098 5.886   1.00 30.42 ? 134 ARG A CA    1 
ATOM   985  C C     . ARG A 1 127 ? -34.728 28.740 7.040   1.00 30.08 ? 134 ARG A C     1 
ATOM   986  O O     . ARG A 1 127 ? -34.901 28.364 8.205   1.00 29.54 ? 134 ARG A O     1 
ATOM   987  C CB    . ARG A 1 127 ? -34.677 26.929 5.300   1.00 33.12 ? 134 ARG A CB    1 
ATOM   988  C CG    . ARG A 1 127 ? -35.450 26.139 4.222   1.00 42.36 ? 134 ARG A CG    1 
ATOM   989  C CD    . ARG A 1 127 ? -34.870 24.728 3.958   1.00 46.72 ? 134 ARG A CD    1 
ATOM   990  N NE    . ARG A 1 127 ? -33.581 24.755 3.258   1.00 50.97 ? 134 ARG A NE    1 
ATOM   991  C CZ    . ARG A 1 127 ? -33.441 24.731 1.934   1.00 51.46 ? 134 ARG A CZ    1 
ATOM   992  N NH1   . ARG A 1 127 ? -32.224 24.768 1.396   1.00 50.82 ? 134 ARG A NH1   1 
ATOM   993  N NH2   . ARG A 1 127 ? -34.516 24.649 1.149   1.00 50.09 ? 134 ARG A NH2   1 
ATOM   994  N N     . LYS A 1 128 ? -33.905 29.732 6.727   1.00 28.62 ? 135 LYS A N     1 
ATOM   995  C CA    . LYS A 1 128 ? -33.153 30.399 7.773   1.00 27.95 ? 135 LYS A CA    1 
ATOM   996  C C     . LYS A 1 128 ? -34.135 31.173 8.648   1.00 28.93 ? 135 LYS A C     1 
ATOM   997  O O     . LYS A 1 128 ? -33.959 31.272 9.864   1.00 27.36 ? 135 LYS A O     1 
ATOM   998  C CB    . LYS A 1 128 ? -32.117 31.351 7.177   1.00 26.97 ? 135 LYS A CB    1 
ATOM   999  C CG    . LYS A 1 128 ? -31.002 31.714 8.154   1.00 26.20 ? 135 LYS A CG    1 
ATOM   1000 C CD    . LYS A 1 128 ? -30.091 32.783 7.587   1.00 28.51 ? 135 LYS A CD    1 
ATOM   1001 C CE    . LYS A 1 128 ? -28.957 33.176 8.542   1.00 30.90 ? 135 LYS A CE    1 
ATOM   1002 N NZ    . LYS A 1 128 ? -27.816 32.208 8.569   1.00 31.74 ? 135 LYS A NZ    1 
ATOM   1003 N N     . VAL A 1 129 ? -35.169 31.728 8.020   1.00 28.44 ? 136 VAL A N     1 
ATOM   1004 C CA    . VAL A 1 129 ? -36.185 32.476 8.742   1.00 26.77 ? 136 VAL A CA    1 
ATOM   1005 C C     . VAL A 1 129 ? -36.856 31.531 9.736   1.00 26.41 ? 136 VAL A C     1 
ATOM   1006 O O     . VAL A 1 129 ? -37.036 31.865 10.906  1.00 24.19 ? 136 VAL A O     1 
ATOM   1007 C CB    . VAL A 1 129 ? -37.257 33.053 7.773   1.00 25.44 ? 136 VAL A CB    1 
ATOM   1008 C CG1   . VAL A 1 129 ? -38.499 33.488 8.557   1.00 24.32 ? 136 VAL A CG1   1 
ATOM   1009 C CG2   . VAL A 1 129 ? -36.684 34.243 7.015   1.00 21.69 ? 136 VAL A CG2   1 
ATOM   1010 N N     . GLY A 1 130 ? -37.211 30.348 9.253   1.00 26.96 ? 137 GLY A N     1 
ATOM   1011 C CA    . GLY A 1 130 ? -37.855 29.363 10.093  1.00 26.69 ? 137 GLY A CA    1 
ATOM   1012 C C     . GLY A 1 130 ? -36.948 28.962 11.231  1.00 26.60 ? 137 GLY A C     1 
ATOM   1013 O O     . GLY A 1 130 ? -37.407 28.792 12.366  1.00 24.18 ? 137 GLY A O     1 
ATOM   1014 N N     . ASP A 1 131 ? -35.657 28.805 10.927  1.00 27.69 ? 138 ASP A N     1 
ATOM   1015 C CA    . ASP A 1 131 ? -34.682 28.437 11.957  1.00 26.51 ? 138 ASP A CA    1 
ATOM   1016 C C     . ASP A 1 131 ? -34.697 29.489 13.061  1.00 26.49 ? 138 ASP A C     1 
ATOM   1017 O O     . ASP A 1 131 ? -34.908 29.185 14.230  1.00 26.12 ? 138 ASP A O     1 
ATOM   1018 C CB    . ASP A 1 131 ? -33.271 28.343 11.375  1.00 27.53 ? 138 ASP A CB    1 
ATOM   1019 C CG    . ASP A 1 131 ? -33.069 27.115 10.494  1.00 29.49 ? 138 ASP A CG    1 
ATOM   1020 O OD1   . ASP A 1 131 ? -33.823 26.130 10.634  1.00 28.91 ? 138 ASP A OD1   1 
ATOM   1021 O OD2   . ASP A 1 131 ? -32.132 27.130 9.668   1.00 32.43 ? 138 ASP A OD2   1 
ATOM   1022 N N     . LEU A 1 132 ? -34.482 30.738 12.671  1.00 26.74 ? 139 LEU A N     1 
ATOM   1023 C CA    . LEU A 1 132 ? -34.473 31.841 13.618  1.00 27.05 ? 139 LEU A CA    1 
ATOM   1024 C C     . LEU A 1 132 ? -35.816 32.014 14.310  1.00 27.13 ? 139 LEU A C     1 
ATOM   1025 O O     . LEU A 1 132 ? -35.868 32.516 15.425  1.00 30.05 ? 139 LEU A O     1 
ATOM   1026 C CB    . LEU A 1 132 ? -34.096 33.146 12.912  1.00 25.41 ? 139 LEU A CB    1 
ATOM   1027 C CG    . LEU A 1 132 ? -32.647 33.241 12.431  1.00 24.71 ? 139 LEU A CG    1 
ATOM   1028 C CD1   . LEU A 1 132 ? -32.533 34.296 11.336  1.00 24.37 ? 139 LEU A CD1   1 
ATOM   1029 C CD2   . LEU A 1 132 ? -31.741 33.550 13.601  1.00 23.96 ? 139 LEU A CD2   1 
ATOM   1030 N N     . ALA A 1 133 ? -36.895 31.596 13.671  1.00 26.19 ? 140 ALA A N     1 
ATOM   1031 C CA    . ALA A 1 133 ? -38.219 31.751 14.254  1.00 25.82 ? 140 ALA A CA    1 
ATOM   1032 C C     . ALA A 1 133 ? -38.624 30.626 15.190  1.00 27.09 ? 140 ALA A C     1 
ATOM   1033 O O     . ALA A 1 133 ? -39.242 30.869 16.228  1.00 27.76 ? 140 ALA A O     1 
ATOM   1034 C CB    . ALA A 1 133 ? -39.262 31.877 13.159  1.00 24.57 ? 140 ALA A CB    1 
ATOM   1035 N N     . PHE A 1 134 ? -38.267 29.398 14.831  1.00 26.49 ? 141 PHE A N     1 
ATOM   1036 C CA    . PHE A 1 134 ? -38.678 28.247 15.616  1.00 26.81 ? 141 PHE A CA    1 
ATOM   1037 C C     . PHE A 1 134 ? -37.644 27.483 16.447  1.00 28.20 ? 141 PHE A C     1 
ATOM   1038 O O     . PHE A 1 134 ? -38.012 26.822 17.424  1.00 30.48 ? 141 PHE A O     1 
ATOM   1039 C CB    . PHE A 1 134 ? -39.376 27.248 14.698  1.00 28.14 ? 141 PHE A CB    1 
ATOM   1040 C CG    . PHE A 1 134 ? -40.463 27.846 13.854  1.00 27.96 ? 141 PHE A CG    1 
ATOM   1041 C CD1   . PHE A 1 134 ? -41.481 28.597 14.431  1.00 27.62 ? 141 PHE A CD1   1 
ATOM   1042 C CD2   . PHE A 1 134 ? -40.488 27.627 12.476  1.00 26.97 ? 141 PHE A CD2   1 
ATOM   1043 C CE1   . PHE A 1 134 ? -42.515 29.123 13.647  1.00 29.91 ? 141 PHE A CE1   1 
ATOM   1044 C CE2   . PHE A 1 134 ? -41.515 28.145 11.688  1.00 26.59 ? 141 PHE A CE2   1 
ATOM   1045 C CZ    . PHE A 1 134 ? -42.531 28.895 12.270  1.00 27.47 ? 141 PHE A CZ    1 
ATOM   1046 N N     . LEU A 1 135 ? -36.373 27.544 16.069  1.00 26.45 ? 142 LEU A N     1 
ATOM   1047 C CA    . LEU A 1 135 ? -35.352 26.801 16.791  1.00 27.19 ? 142 LEU A CA    1 
ATOM   1048 C C     . LEU A 1 135 ? -34.554 27.586 17.816  1.00 29.79 ? 142 LEU A C     1 
ATOM   1049 O O     . LEU A 1 135 ? -34.300 28.790 17.644  1.00 29.14 ? 142 LEU A O     1 
ATOM   1050 C CB    . LEU A 1 135 ? -34.367 26.171 15.807  1.00 27.30 ? 142 LEU A CB    1 
ATOM   1051 C CG    . LEU A 1 135 ? -34.870 25.048 14.902  1.00 26.50 ? 142 LEU A CG    1 
ATOM   1052 C CD1   . LEU A 1 135 ? -33.800 24.711 13.857  1.00 22.89 ? 142 LEU A CD1   1 
ATOM   1053 C CD2   . LEU A 1 135 ? -35.222 23.846 15.759  1.00 25.48 ? 142 LEU A CD2   1 
ATOM   1054 N N     . ASP A 1 136 ? -34.157 26.887 18.877  1.00 29.86 ? 143 ASP A N     1 
ATOM   1055 C CA    . ASP A 1 136 ? -33.337 27.479 19.928  1.00 31.61 ? 143 ASP A CA    1 
ATOM   1056 C C     . ASP A 1 136 ? -31.890 27.421 19.402  1.00 29.70 ? 143 ASP A C     1 
ATOM   1057 O O     . ASP A 1 136 ? -31.643 26.863 18.329  1.00 30.33 ? 143 ASP A O     1 
ATOM   1058 C CB    . ASP A 1 136 ? -33.487 26.679 21.224  1.00 34.91 ? 143 ASP A CB    1 
ATOM   1059 C CG    . ASP A 1 136 ? -32.879 25.291 21.130  1.00 39.62 ? 143 ASP A CG    1 
ATOM   1060 O OD1   . ASP A 1 136 ? -33.301 24.509 20.232  1.00 40.71 ? 143 ASP A OD1   1 
ATOM   1061 O OD2   . ASP A 1 136 ? -31.975 24.994 21.947  1.00 40.13 ? 143 ASP A OD2   1 
ATOM   1062 N N     . VAL A 1 137 ? -30.940 27.984 20.138  1.00 28.02 ? 144 VAL A N     1 
ATOM   1063 C CA    . VAL A 1 137 ? -29.556 27.991 19.682  1.00 28.45 ? 144 VAL A CA    1 
ATOM   1064 C C     . VAL A 1 137 ? -28.959 26.612 19.454  1.00 29.78 ? 144 VAL A C     1 
ATOM   1065 O O     . VAL A 1 137 ? -28.338 26.371 18.419  1.00 31.17 ? 144 VAL A O     1 
ATOM   1066 C CB    . VAL A 1 137 ? -28.636 28.761 20.644  1.00 28.82 ? 144 VAL A CB    1 
ATOM   1067 C CG1   . VAL A 1 137 ? -27.214 28.793 20.086  1.00 28.49 ? 144 VAL A CG1   1 
ATOM   1068 C CG2   . VAL A 1 137 ? -29.142 30.181 20.823  1.00 30.21 ? 144 VAL A CG2   1 
ATOM   1069 N N     . THR A 1 138 ? -29.123 25.710 20.412  1.00 29.82 ? 145 THR A N     1 
ATOM   1070 C CA    . THR A 1 138 ? -28.585 24.355 20.257  1.00 29.58 ? 145 THR A CA    1 
ATOM   1071 C C     . THR A 1 138 ? -29.138 23.778 18.948  1.00 27.88 ? 145 THR A C     1 
ATOM   1072 O O     . THR A 1 138 ? -28.403 23.185 18.158  1.00 25.25 ? 145 THR A O     1 
ATOM   1073 C CB    . THR A 1 138 ? -29.016 23.446 21.440  1.00 29.44 ? 145 THR A CB    1 
ATOM   1074 O OG1   . THR A 1 138 ? -28.666 24.080 22.668  1.00 26.41 ? 145 THR A OG1   1 
ATOM   1075 C CG2   . THR A 1 138 ? -28.322 22.100 21.370  1.00 26.01 ? 145 THR A CG2   1 
ATOM   1076 N N     . GLY A 1 139 ? -30.437 23.971 18.732  1.00 27.66 ? 146 GLY A N     1 
ATOM   1077 C CA    . GLY A 1 139 ? -31.059 23.479 17.525  1.00 29.88 ? 146 GLY A CA    1 
ATOM   1078 C C     . GLY A 1 139 ? -30.415 24.091 16.291  1.00 30.72 ? 146 GLY A C     1 
ATOM   1079 O O     . GLY A 1 139 ? -30.024 23.381 15.358  1.00 30.38 ? 146 GLY A O     1 
ATOM   1080 N N     . ARG A 1 140 ? -30.293 25.414 16.282  1.00 30.56 ? 147 ARG A N     1 
ATOM   1081 C CA    . ARG A 1 140 ? -29.699 26.086 15.135  1.00 32.38 ? 147 ARG A CA    1 
ATOM   1082 C C     . ARG A 1 140 ? -28.238 25.729 14.864  1.00 31.43 ? 147 ARG A C     1 
ATOM   1083 O O     . ARG A 1 140 ? -27.819 25.579 13.723  1.00 32.19 ? 147 ARG A O     1 
ATOM   1084 C CB    . ARG A 1 140 ? -29.886 27.594 15.267  1.00 30.34 ? 147 ARG A CB    1 
ATOM   1085 C CG    . ARG A 1 140 ? -31.272 28.000 14.787  1.00 33.30 ? 147 ARG A CG    1 
ATOM   1086 C CD    . ARG A 1 140 ? -31.458 29.501 14.663  1.00 34.42 ? 147 ARG A CD    1 
ATOM   1087 N NE    . ARG A 1 140 ? -31.859 30.066 15.943  1.00 36.51 ? 147 ARG A NE    1 
ATOM   1088 C CZ    . ARG A 1 140 ? -31.091 30.842 16.692  1.00 33.53 ? 147 ARG A CZ    1 
ATOM   1089 N NH1   . ARG A 1 140 ? -31.541 31.295 17.846  1.00 33.20 ? 147 ARG A NH1   1 
ATOM   1090 N NH2   . ARG A 1 140 ? -29.880 31.173 16.280  1.00 35.02 ? 147 ARG A NH2   1 
ATOM   1091 N N     . VAL A 1 141 ? -27.466 25.570 15.928  1.00 31.54 ? 148 VAL A N     1 
ATOM   1092 C CA    . VAL A 1 141 ? -26.074 25.206 15.791  1.00 28.77 ? 148 VAL A CA    1 
ATOM   1093 C C     . VAL A 1 141 ? -25.974 23.830 15.172  1.00 30.05 ? 148 VAL A C     1 
ATOM   1094 O O     . VAL A 1 141 ? -25.137 23.586 14.307  1.00 32.30 ? 148 VAL A O     1 
ATOM   1095 C CB    . VAL A 1 141 ? -25.385 25.187 17.147  1.00 25.75 ? 148 VAL A CB    1 
ATOM   1096 C CG1   . VAL A 1 141 ? -24.005 24.585 17.025  1.00 23.24 ? 148 VAL A CG1   1 
ATOM   1097 C CG2   . VAL A 1 141 ? -25.301 26.591 17.676  1.00 23.01 ? 148 VAL A CG2   1 
ATOM   1098 N N     . ALA A 1 142 ? -26.829 22.925 15.615  1.00 31.35 ? 149 ALA A N     1 
ATOM   1099 C CA    . ALA A 1 142 ? -26.815 21.572 15.085  1.00 33.43 ? 149 ALA A CA    1 
ATOM   1100 C C     . ALA A 1 142 ? -27.186 21.610 13.605  1.00 34.39 ? 149 ALA A C     1 
ATOM   1101 O O     . ALA A 1 142 ? -26.619 20.895 12.777  1.00 35.12 ? 149 ALA A O     1 
ATOM   1102 C CB    . ALA A 1 142 ? -27.805 20.697 15.864  1.00 33.47 ? 149 ALA A CB    1 
ATOM   1103 N N     . ARG A 1 143 ? -28.141 22.464 13.266  1.00 35.32 ? 150 ARG A N     1 
ATOM   1104 C CA    . ARG A 1 143 ? -28.586 22.578 11.893  1.00 36.39 ? 150 ARG A CA    1 
ATOM   1105 C C     . ARG A 1 143 ? -27.505 23.208 11.004  1.00 35.55 ? 150 ARG A C     1 
ATOM   1106 O O     . ARG A 1 143 ? -27.308 22.803 9.855   1.00 33.40 ? 150 ARG A O     1 
ATOM   1107 C CB    . ARG A 1 143 ? -29.881 23.392 11.846  1.00 37.46 ? 150 ARG A CB    1 
ATOM   1108 C CG    . ARG A 1 143 ? -30.432 23.583 10.457  1.00 42.18 ? 150 ARG A CG    1 
ATOM   1109 C CD    . ARG A 1 143 ? -31.937 23.481 10.452  1.00 45.11 ? 150 ARG A CD    1 
ATOM   1110 N NE    . ARG A 1 143 ? -32.363 22.113 10.708  1.00 49.17 ? 150 ARG A NE    1 
ATOM   1111 C CZ    . ARG A 1 143 ? -33.629 21.706 10.670  1.00 51.64 ? 150 ARG A CZ    1 
ATOM   1112 N NH1   . ARG A 1 143 ? -33.927 20.427 10.919  1.00 51.06 ? 150 ARG A NH1   1 
ATOM   1113 N NH2   . ARG A 1 143 ? -34.594 22.575 10.381  1.00 51.96 ? 150 ARG A NH2   1 
ATOM   1114 N N     . THR A 1 144 ? -26.802 24.190 11.560  1.00 34.22 ? 151 THR A N     1 
ATOM   1115 C CA    . THR A 1 144 ? -25.737 24.890 10.846  1.00 32.69 ? 151 THR A CA    1 
ATOM   1116 C C     . THR A 1 144 ? -24.569 23.978 10.541  1.00 34.07 ? 151 THR A C     1 
ATOM   1117 O O     . THR A 1 144 ? -24.048 23.983 9.432   1.00 34.47 ? 151 THR A O     1 
ATOM   1118 C CB    . THR A 1 144 ? -25.222 26.088 11.662  1.00 31.52 ? 151 THR A CB    1 
ATOM   1119 O OG1   . THR A 1 144 ? -26.138 27.182 11.523  1.00 31.08 ? 151 THR A OG1   1 
ATOM   1120 C CG2   . THR A 1 144 ? -23.840 26.510 11.194  1.00 30.30 ? 151 THR A CG2   1 
ATOM   1121 N N     . LEU A 1 145 ? -24.148 23.204 11.534  1.00 36.29 ? 152 LEU A N     1 
ATOM   1122 C CA    . LEU A 1 145 ? -23.037 22.282 11.367  1.00 34.50 ? 152 LEU A CA    1 
ATOM   1123 C C     . LEU A 1 145 ? -23.372 21.259 10.286  1.00 34.99 ? 152 LEU A C     1 
ATOM   1124 O O     . LEU A 1 145 ? -22.520 20.883 9.489   1.00 35.16 ? 152 LEU A O     1 
ATOM   1125 C CB    . LEU A 1 145 ? -22.747 21.568 12.687  1.00 33.80 ? 152 LEU A CB    1 
ATOM   1126 C CG    . LEU A 1 145 ? -22.228 22.407 13.853  1.00 32.94 ? 152 LEU A CG    1 
ATOM   1127 C CD1   . LEU A 1 145 ? -21.962 21.498 15.039  1.00 34.66 ? 152 LEU A CD1   1 
ATOM   1128 C CD2   . LEU A 1 145 ? -20.952 23.117 13.465  1.00 31.88 ? 152 LEU A CD2   1 
ATOM   1129 N N     . LEU A 1 146 ? -24.615 20.802 10.261  1.00 34.62 ? 153 LEU A N     1 
ATOM   1130 C CA    . LEU A 1 146 ? -25.009 19.835 9.261   1.00 35.96 ? 153 LEU A CA    1 
ATOM   1131 C C     . LEU A 1 146 ? -24.940 20.498 7.877   1.00 38.52 ? 153 LEU A C     1 
ATOM   1132 O O     . LEU A 1 146 ? -24.420 19.911 6.924   1.00 38.83 ? 153 LEU A O     1 
ATOM   1133 C CB    . LEU A 1 146 ? -26.426 19.325 9.552   1.00 35.69 ? 153 LEU A CB    1 
ATOM   1134 C CG    . LEU A 1 146 ? -26.615 18.453 10.799  1.00 33.24 ? 153 LEU A CG    1 
ATOM   1135 C CD1   . LEU A 1 146 ? -28.074 18.075 10.947  1.00 32.30 ? 153 LEU A CD1   1 
ATOM   1136 C CD2   . LEU A 1 146 ? -25.772 17.204 10.683  1.00 33.35 ? 153 LEU A CD2   1 
ATOM   1137 N N     . ASP A 1 147 ? -25.460 21.721 7.777   1.00 39.49 ? 154 ASP A N     1 
ATOM   1138 C CA    . ASP A 1 147 ? -25.437 22.466 6.524   1.00 39.08 ? 154 ASP A CA    1 
ATOM   1139 C C     . ASP A 1 147 ? -23.986 22.656 6.086   1.00 39.36 ? 154 ASP A C     1 
ATOM   1140 O O     . ASP A 1 147 ? -23.654 22.490 4.912   1.00 41.97 ? 154 ASP A O     1 
ATOM   1141 C CB    . ASP A 1 147 ? -26.103 23.835 6.693   1.00 40.62 ? 154 ASP A CB    1 
ATOM   1142 C CG    . ASP A 1 147 ? -27.622 23.747 6.823   1.00 45.15 ? 154 ASP A CG    1 
ATOM   1143 O OD1   . ASP A 1 147 ? -28.247 24.737 7.295   1.00 44.22 ? 154 ASP A OD1   1 
ATOM   1144 O OD2   . ASP A 1 147 ? -28.195 22.696 6.443   1.00 46.26 ? 154 ASP A OD2   1 
ATOM   1145 N N     . LEU A 1 148 ? -23.120 23.000 7.035   1.00 37.02 ? 155 LEU A N     1 
ATOM   1146 C CA    . LEU A 1 148 ? -21.704 23.210 6.743   1.00 37.21 ? 155 LEU A CA    1 
ATOM   1147 C C     . LEU A 1 148 ? -21.031 21.952 6.219   1.00 37.95 ? 155 LEU A C     1 
ATOM   1148 O O     . LEU A 1 148 ? -19.998 22.024 5.556   1.00 36.72 ? 155 LEU A O     1 
ATOM   1149 C CB    . LEU A 1 148 ? -20.959 23.682 7.991   1.00 35.54 ? 155 LEU A CB    1 
ATOM   1150 C CG    . LEU A 1 148 ? -21.298 25.066 8.535   1.00 35.86 ? 155 LEU A CG    1 
ATOM   1151 C CD1   . LEU A 1 148 ? -20.579 25.279 9.841   1.00 36.23 ? 155 LEU A CD1   1 
ATOM   1152 C CD2   . LEU A 1 148 ? -20.904 26.132 7.525   1.00 36.56 ? 155 LEU A CD2   1 
ATOM   1153 N N     . CYS A 1 149 ? -21.603 20.798 6.535   1.00 39.95 ? 156 CYS A N     1 
ATOM   1154 C CA    . CYS A 1 149 ? -21.041 19.533 6.082   1.00 42.39 ? 156 CYS A CA    1 
ATOM   1155 C C     . CYS A 1 149 ? -21.378 19.298 4.626   1.00 43.15 ? 156 CYS A C     1 
ATOM   1156 O O     . CYS A 1 149 ? -20.910 18.331 4.018   1.00 44.09 ? 156 CYS A O     1 
ATOM   1157 C CB    . CYS A 1 149 ? -21.565 18.366 6.930   1.00 42.42 ? 156 CYS A CB    1 
ATOM   1158 S SG    . CYS A 1 149 ? -20.751 18.196 8.539   1.00 39.59 ? 156 CYS A SG    1 
ATOM   1159 N N     . GLN A 1 150 ? -22.194 20.190 4.066   1.00 43.56 ? 157 GLN A N     1 
ATOM   1160 C CA    . GLN A 1 150 ? -22.595 20.088 2.673   1.00 43.23 ? 157 GLN A CA    1 
ATOM   1161 C C     . GLN A 1 150 ? -21.837 21.077 1.804   1.00 43.46 ? 157 GLN A C     1 
ATOM   1162 O O     . GLN A 1 150 ? -21.935 21.044 0.585   1.00 45.20 ? 157 GLN A O     1 
ATOM   1163 C CB    . GLN A 1 150 ? -24.092 20.307 2.544   1.00 42.52 ? 157 GLN A CB    1 
ATOM   1164 C CG    . GLN A 1 150 ? -24.896 19.302 3.330   1.00 45.68 ? 157 GLN A CG    1 
ATOM   1165 C CD    . GLN A 1 150 ? -24.501 17.862 3.027   1.00 46.05 ? 157 GLN A CD    1 
ATOM   1166 O OE1   . GLN A 1 150 ? -25.295 17.085 2.496   1.00 49.15 ? 157 GLN A OE1   1 
ATOM   1167 N NE2   . GLN A 1 150 ? -23.271 17.502 3.365   1.00 45.22 ? 157 GLN A NE2   1 
ATOM   1168 N N     . GLN A 1 151 ? -21.076 21.960 2.432   1.00 42.97 ? 158 GLN A N     1 
ATOM   1169 C CA    . GLN A 1 151 ? -20.292 22.919 1.681   1.00 43.55 ? 158 GLN A CA    1 
ATOM   1170 C C     . GLN A 1 151 ? -19.155 22.223 0.939   1.00 43.30 ? 158 GLN A C     1 
ATOM   1171 O O     . GLN A 1 151 ? -18.685 21.167 1.359   1.00 42.32 ? 158 GLN A O     1 
ATOM   1172 C CB    . GLN A 1 151 ? -19.706 23.963 2.619   1.00 43.30 ? 158 GLN A CB    1 
ATOM   1173 C CG    . GLN A 1 151 ? -20.734 24.891 3.207   1.00 46.06 ? 158 GLN A CG    1 
ATOM   1174 C CD    . GLN A 1 151 ? -21.545 25.619 2.149   1.00 46.25 ? 158 GLN A CD    1 
ATOM   1175 O OE1   . GLN A 1 151 ? -22.745 25.371 2.007   1.00 46.07 ? 158 GLN A OE1   1 
ATOM   1176 N NE2   . GLN A 1 151 ? -20.893 26.519 1.400   1.00 43.97 ? 158 GLN A NE2   1 
ATOM   1177 N N     . PRO A 1 152 ? -18.707 22.804 -0.183  1.00 43.89 ? 159 PRO A N     1 
ATOM   1178 C CA    . PRO A 1 152 ? -17.613 22.232 -0.975  1.00 44.18 ? 159 PRO A CA    1 
ATOM   1179 C C     . PRO A 1 152 ? -16.280 22.151 -0.230  1.00 42.32 ? 159 PRO A C     1 
ATOM   1180 O O     . PRO A 1 152 ? -15.381 21.413 -0.628  1.00 42.96 ? 159 PRO A O     1 
ATOM   1181 C CB    . PRO A 1 152 ? -17.553 23.150 -2.193  1.00 43.85 ? 159 PRO A CB    1 
ATOM   1182 C CG    . PRO A 1 152 ? -18.107 24.447 -1.673  1.00 43.06 ? 159 PRO A CG    1 
ATOM   1183 C CD    . PRO A 1 152 ? -19.281 23.968 -0.872  1.00 42.85 ? 159 PRO A CD    1 
ATOM   1184 N N     . ASP A 1 153 ? -16.136 22.914 0.847   1.00 41.93 ? 160 ASP A N     1 
ATOM   1185 C CA    . ASP A 1 153 ? -14.901 22.835 1.607   1.00 42.58 ? 160 ASP A CA    1 
ATOM   1186 C C     . ASP A 1 153 ? -15.013 21.774 2.706   1.00 44.20 ? 160 ASP A C     1 
ATOM   1187 O O     . ASP A 1 153 ? -14.079 21.551 3.476   1.00 44.94 ? 160 ASP A O     1 
ATOM   1188 C CB    . ASP A 1 153 ? -14.509 24.193 2.199   1.00 39.72 ? 160 ASP A CB    1 
ATOM   1189 C CG    . ASP A 1 153 ? -15.642 24.880 2.933   1.00 39.96 ? 160 ASP A CG    1 
ATOM   1190 O OD1   . ASP A 1 153 ? -15.371 25.928 3.568   1.00 38.02 ? 160 ASP A OD1   1 
ATOM   1191 O OD2   . ASP A 1 153 ? -16.795 24.396 2.874   1.00 40.64 ? 160 ASP A OD2   1 
ATOM   1192 N N     . ALA A 1 154 ? -16.159 21.108 2.775   1.00 44.66 ? 161 ALA A N     1 
ATOM   1193 C CA    . ALA A 1 154 ? -16.324 20.065 3.768   1.00 46.86 ? 161 ALA A CA    1 
ATOM   1194 C C     . ALA A 1 154 ? -15.457 18.906 3.306   1.00 48.93 ? 161 ALA A C     1 
ATOM   1195 O O     . ALA A 1 154 ? -15.507 18.512 2.136   1.00 48.66 ? 161 ALA A O     1 
ATOM   1196 C CB    . ALA A 1 154 ? -17.794 19.624 3.863   1.00 45.83 ? 161 ALA A CB    1 
ATOM   1197 N N     . MET A 1 155 ? -14.645 18.382 4.223   1.00 51.87 ? 162 MET A N     1 
ATOM   1198 C CA    . MET A 1 155 ? -13.777 17.247 3.927   1.00 52.52 ? 162 MET A CA    1 
ATOM   1199 C C     . MET A 1 155 ? -14.464 15.941 4.304   1.00 52.54 ? 162 MET A C     1 
ATOM   1200 O O     . MET A 1 155 ? -15.377 15.904 5.135   1.00 52.72 ? 162 MET A O     1 
ATOM   1201 C CB    . MET A 1 155 ? -12.467 17.362 4.694   1.00 54.34 ? 162 MET A CB    1 
ATOM   1202 C CG    . MET A 1 155 ? -11.598 18.506 4.248   1.00 59.33 ? 162 MET A CG    1 
ATOM   1203 S SD    . MET A 1 155 ? -10.243 18.782 5.399   1.00 68.04 ? 162 MET A SD    1 
ATOM   1204 C CE    . MET A 1 155 ? -9.248  17.216 5.129   1.00 64.85 ? 162 MET A CE    1 
ATOM   1205 N N     . THR A 1 156 ? -14.016 14.863 3.684   1.00 53.19 ? 163 THR A N     1 
ATOM   1206 C CA    . THR A 1 156 ? -14.587 13.561 3.948   1.00 52.69 ? 163 THR A CA    1 
ATOM   1207 C C     . THR A 1 156 ? -13.829 12.973 5.141   1.00 53.42 ? 163 THR A C     1 
ATOM   1208 O O     . THR A 1 156 ? -12.711 13.408 5.446   1.00 54.05 ? 163 THR A O     1 
ATOM   1209 C CB    . THR A 1 156 ? -14.472 12.670 2.708   1.00 51.72 ? 163 THR A CB    1 
ATOM   1210 O OG1   . THR A 1 156 ? -15.479 11.664 2.775   1.00 51.12 ? 163 THR A OG1   1 
ATOM   1211 C CG2   . THR A 1 156 ? -13.082 12.024 2.620   1.00 53.62 ? 163 THR A CG2   1 
ATOM   1212 N N     . HIS A 1 157 ? -14.430 11.999 5.813   1.00 52.73 ? 164 HIS A N     1 
ATOM   1213 C CA    . HIS A 1 157 ? -13.803 11.415 6.997   1.00 51.62 ? 164 HIS A CA    1 
ATOM   1214 C C     . HIS A 1 157 ? -14.314 10.004 7.261   1.00 52.16 ? 164 HIS A C     1 
ATOM   1215 O O     . HIS A 1 157 ? -15.485 9.695  7.015   1.00 51.96 ? 164 HIS A O     1 
ATOM   1216 C CB    . HIS A 1 157 ? -14.100 12.329 8.182   1.00 50.22 ? 164 HIS A CB    1 
ATOM   1217 C CG    . HIS A 1 157 ? -13.384 11.967 9.440   1.00 49.41 ? 164 HIS A CG    1 
ATOM   1218 N ND1   . HIS A 1 157 ? -13.689 10.840 10.177  1.00 50.30 ? 164 HIS A ND1   1 
ATOM   1219 C CD2   . HIS A 1 157 ? -12.438 12.634 10.144  1.00 47.51 ? 164 HIS A CD2   1 
ATOM   1220 C CE1   . HIS A 1 157 ? -12.965 10.834 11.284  1.00 49.56 ? 164 HIS A CE1   1 
ATOM   1221 N NE2   . HIS A 1 157 ? -12.199 11.913 11.286  1.00 48.67 ? 164 HIS A NE2   1 
ATOM   1222 N N     . PRO A 1 158 ? -13.441 9.120  7.760   1.00 52.87 ? 165 PRO A N     1 
ATOM   1223 C CA    . PRO A 1 158 ? -13.887 7.751  8.030   1.00 53.11 ? 165 PRO A CA    1 
ATOM   1224 C C     . PRO A 1 158 ? -15.177 7.685  8.848   1.00 54.36 ? 165 PRO A C     1 
ATOM   1225 O O     . PRO A 1 158 ? -16.137 7.011  8.466   1.00 53.57 ? 165 PRO A O     1 
ATOM   1226 C CB    . PRO A 1 158 ? -12.688 7.129  8.755   1.00 52.40 ? 165 PRO A CB    1 
ATOM   1227 C CG    . PRO A 1 158 ? -11.891 8.315  9.243   1.00 51.52 ? 165 PRO A CG    1 
ATOM   1228 C CD    . PRO A 1 158 ? -12.028 9.299  8.133   1.00 51.17 ? 165 PRO A CD    1 
ATOM   1229 N N     . ASP A 1 159 ? -15.201 8.415  9.959   1.00 55.44 ? 166 ASP A N     1 
ATOM   1230 C CA    . ASP A 1 159 ? -16.363 8.429  10.852  1.00 56.39 ? 166 ASP A CA    1 
ATOM   1231 C C     . ASP A 1 159 ? -17.454 9.433  10.475  1.00 55.23 ? 166 ASP A C     1 
ATOM   1232 O O     . ASP A 1 159 ? -18.380 9.659  11.251  1.00 53.57 ? 166 ASP A O     1 
ATOM   1233 C CB    . ASP A 1 159 ? -15.888 8.706  12.275  1.00 56.61 ? 166 ASP A CB    1 
ATOM   1234 C CG    . ASP A 1 159 ? -14.841 7.723  12.727  1.00 55.29 ? 166 ASP A CG    1 
ATOM   1235 O OD1   . ASP A 1 159 ? -13.927 8.140  13.474  1.00 56.12 ? 166 ASP A OD1   1 
ATOM   1236 O OD2   . ASP A 1 159 ? -14.942 6.539  12.335  1.00 52.54 ? 166 ASP A OD2   1 
ATOM   1237 N N     . GLY A 1 160 ? -17.338 10.029 9.297   1.00 56.01 ? 167 GLY A N     1 
ATOM   1238 C CA    . GLY A 1 160 ? -18.327 10.999 8.857   1.00 55.34 ? 167 GLY A CA    1 
ATOM   1239 C C     . GLY A 1 160 ? -17.750 12.104 7.996   1.00 54.77 ? 167 GLY A C     1 
ATOM   1240 O O     . GLY A 1 160 ? -17.187 11.854 6.931   1.00 55.61 ? 167 GLY A O     1 
ATOM   1241 N N     . MET A 1 161 ? -17.888 13.338 8.461   1.00 54.47 ? 168 MET A N     1 
ATOM   1242 C CA    . MET A 1 161 ? -17.394 14.499 7.741   1.00 53.61 ? 168 MET A CA    1 
ATOM   1243 C C     . MET A 1 161 ? -16.674 15.415 8.696   1.00 52.76 ? 168 MET A C     1 
ATOM   1244 O O     . MET A 1 161 ? -17.023 15.468 9.872   1.00 54.08 ? 168 MET A O     1 
ATOM   1245 C CB    . MET A 1 161 ? -18.563 15.271 7.144   1.00 54.71 ? 168 MET A CB    1 
ATOM   1246 C CG    . MET A 1 161 ? -19.195 14.618 5.951   1.00 57.26 ? 168 MET A CG    1 
ATOM   1247 S SD    . MET A 1 161 ? -18.276 15.001 4.461   1.00 55.77 ? 168 MET A SD    1 
ATOM   1248 C CE    . MET A 1 161 ? -19.655 14.931 3.249   1.00 58.82 ? 168 MET A CE    1 
ATOM   1249 N N     . GLN A 1 162 ? -15.664 16.130 8.216   1.00 50.34 ? 169 GLN A N     1 
ATOM   1250 C CA    . GLN A 1 162 ? -15.001 17.073 9.092   1.00 50.40 ? 169 GLN A CA    1 
ATOM   1251 C C     . GLN A 1 162 ? -14.954 18.386 8.363   1.00 48.41 ? 169 GLN A C     1 
ATOM   1252 O O     . GLN A 1 162 ? -14.924 18.416 7.135   1.00 46.08 ? 169 GLN A O     1 
ATOM   1253 C CB    . GLN A 1 162 ? -13.607 16.606 9.517   1.00 52.29 ? 169 GLN A CB    1 
ATOM   1254 C CG    . GLN A 1 162 ? -12.538 16.614 8.470   1.00 57.04 ? 169 GLN A CG    1 
ATOM   1255 C CD    . GLN A 1 162 ? -11.181 16.351 9.089   1.00 59.16 ? 169 GLN A CD    1 
ATOM   1256 O OE1   . GLN A 1 162 ? -10.836 16.944 10.119  1.00 58.37 ? 169 GLN A OE1   1 
ATOM   1257 N NE2   . GLN A 1 162 ? -10.400 15.464 8.468   1.00 60.07 ? 169 GLN A NE2   1 
ATOM   1258 N N     . ILE A 1 163 ? -14.983 19.472 9.126   1.00 46.51 ? 170 ILE A N     1 
ATOM   1259 C CA    . ILE A 1 163 ? -14.995 20.802 8.545   1.00 46.17 ? 170 ILE A CA    1 
ATOM   1260 C C     . ILE A 1 163 ? -14.078 21.761 9.285   1.00 45.24 ? 170 ILE A C     1 
ATOM   1261 O O     . ILE A 1 163 ? -13.767 21.558 10.451  1.00 44.14 ? 170 ILE A O     1 
ATOM   1262 C CB    . ILE A 1 163 ? -16.430 21.399 8.564   1.00 45.23 ? 170 ILE A CB    1 
ATOM   1263 C CG1   . ILE A 1 163 ? -16.930 21.495 10.013  1.00 44.93 ? 170 ILE A CG1   1 
ATOM   1264 C CG2   . ILE A 1 163 ? -17.379 20.538 7.740   1.00 44.35 ? 170 ILE A CG2   1 
ATOM   1265 C CD1   . ILE A 1 163 ? -18.337 22.039 10.161  1.00 42.60 ? 170 ILE A CD1   1 
ATOM   1266 N N     . LYS A 1 164 ? -13.630 22.800 8.589   1.00 46.33 ? 171 LYS A N     1 
ATOM   1267 C CA    . LYS A 1 164 ? -12.793 23.799 9.229   1.00 47.60 ? 171 LYS A CA    1 
ATOM   1268 C C     . LYS A 1 164 ? -13.798 24.891 9.555   1.00 46.97 ? 171 LYS A C     1 
ATOM   1269 O O     . LYS A 1 164 ? -14.487 25.399 8.661   1.00 47.52 ? 171 LYS A O     1 
ATOM   1270 C CB    . LYS A 1 164 ? -11.709 24.334 8.282   1.00 49.34 ? 171 LYS A CB    1 
ATOM   1271 C CG    . LYS A 1 164 ? -10.564 25.009 9.024   1.00 52.44 ? 171 LYS A CG    1 
ATOM   1272 C CD    . LYS A 1 164 ? -9.634  25.778 8.098   1.00 56.28 ? 171 LYS A CD    1 
ATOM   1273 C CE    . LYS A 1 164 ? -8.432  26.337 8.879   1.00 59.09 ? 171 LYS A CE    1 
ATOM   1274 N NZ    . LYS A 1 164 ? -7.475  27.144 8.040   1.00 60.10 ? 171 LYS A NZ    1 
ATOM   1275 N N     . ILE A 1 165 ? -13.906 25.232 10.829  1.00 46.01 ? 172 ILE A N     1 
ATOM   1276 C CA    . ILE A 1 165 ? -14.862 26.241 11.250  1.00 44.24 ? 172 ILE A CA    1 
ATOM   1277 C C     . ILE A 1 165 ? -14.454 26.813 12.604  1.00 43.35 ? 172 ILE A C     1 
ATOM   1278 O O     . ILE A 1 165 ? -13.752 26.158 13.365  1.00 45.33 ? 172 ILE A O     1 
ATOM   1279 C CB    . ILE A 1 165 ? -16.278 25.604 11.330  1.00 43.18 ? 172 ILE A CB    1 
ATOM   1280 C CG1   . ILE A 1 165 ? -17.338 26.676 11.601  1.00 41.96 ? 172 ILE A CG1   1 
ATOM   1281 C CG2   . ILE A 1 165 ? -16.286 24.494 12.370  1.00 40.83 ? 172 ILE A CG2   1 
ATOM   1282 C CD1   . ILE A 1 165 ? -17.684 27.516 10.391  1.00 38.28 ? 172 ILE A CD1   1 
ATOM   1283 N N     . THR A 1 166 ? -14.862 28.044 12.896  1.00 42.61 ? 173 THR A N     1 
ATOM   1284 C CA    . THR A 1 166 ? -14.546 28.648 14.178  1.00 42.54 ? 173 THR A CA    1 
ATOM   1285 C C     . THR A 1 166 ? -15.842 28.891 14.939  1.00 42.89 ? 173 THR A C     1 
ATOM   1286 O O     . THR A 1 166 ? -16.932 28.824 14.367  1.00 40.84 ? 173 THR A O     1 
ATOM   1287 C CB    . THR A 1 166 ? -13.808 29.989 14.027  1.00 43.02 ? 173 THR A CB    1 
ATOM   1288 O OG1   . THR A 1 166 ? -14.650 30.932 13.353  1.00 45.88 ? 173 THR A OG1   1 
ATOM   1289 C CG2   . THR A 1 166 ? -12.519 29.800 13.265  1.00 40.99 ? 173 THR A CG2   1 
ATOM   1290 N N     . ARG A 1 167 ? -15.727 29.155 16.237  1.00 43.57 ? 174 ARG A N     1 
ATOM   1291 C CA    . ARG A 1 167 ? -16.913 29.408 17.045  1.00 44.52 ? 174 ARG A CA    1 
ATOM   1292 C C     . ARG A 1 167 ? -17.533 30.719 16.585  1.00 42.37 ? 174 ARG A C     1 
ATOM   1293 O O     . ARG A 1 167 ? -18.749 30.851 16.541  1.00 41.25 ? 174 ARG A O     1 
ATOM   1294 C CB    . ARG A 1 167 ? -16.552 29.487 18.538  1.00 46.34 ? 174 ARG A CB    1 
ATOM   1295 C CG    . ARG A 1 167 ? -16.171 28.151 19.192  1.00 48.82 ? 174 ARG A CG    1 
ATOM   1296 C CD    . ARG A 1 167 ? -15.541 28.360 20.575  1.00 52.93 ? 174 ARG A CD    1 
ATOM   1297 N NE    . ARG A 1 167 ? -14.427 29.315 20.517  1.00 58.03 ? 174 ARG A NE    1 
ATOM   1298 C CZ    . ARG A 1 167 ? -14.323 30.410 21.274  1.00 58.84 ? 174 ARG A CZ    1 
ATOM   1299 N NH1   . ARG A 1 167 ? -13.274 31.213 21.133  1.00 57.90 ? 174 ARG A NH1   1 
ATOM   1300 N NH2   . ARG A 1 167 ? -15.257 30.700 22.175  1.00 58.79 ? 174 ARG A NH2   1 
ATOM   1301 N N     . GLN A 1 168 ? -16.686 31.682 16.228  1.00 43.06 ? 175 GLN A N     1 
ATOM   1302 C CA    . GLN A 1 168 ? -17.151 33.000 15.779  1.00 41.32 ? 175 GLN A CA    1 
ATOM   1303 C C     . GLN A 1 168 ? -18.003 32.891 14.511  1.00 38.49 ? 175 GLN A C     1 
ATOM   1304 O O     . GLN A 1 168 ? -19.040 33.532 14.401  1.00 36.93 ? 175 GLN A O     1 
ATOM   1305 C CB    . GLN A 1 168 ? -15.959 33.936 15.519  1.00 42.89 ? 175 GLN A CB    1 
ATOM   1306 C CG    . GLN A 1 168 ? -14.945 34.056 16.676  1.00 48.82 ? 175 GLN A CG    1 
ATOM   1307 C CD    . GLN A 1 168 ? -13.861 32.947 16.668  1.00 52.27 ? 175 GLN A CD    1 
ATOM   1308 O OE1   . GLN A 1 168 ? -14.142 31.762 16.924  1.00 50.12 ? 175 GLN A OE1   1 
ATOM   1309 N NE2   . GLN A 1 168 ? -12.613 33.342 16.367  1.00 51.78 ? 175 GLN A NE2   1 
ATOM   1310 N N     . GLU A 1 169 ? -17.553 32.069 13.570  1.00 36.30 ? 176 GLU A N     1 
ATOM   1311 C CA    . GLU A 1 169 ? -18.246 31.858 12.309  1.00 33.15 ? 176 GLU A CA    1 
ATOM   1312 C C     . GLU A 1 169 ? -19.622 31.242 12.538  1.00 33.59 ? 176 GLU A C     1 
ATOM   1313 O O     . GLU A 1 169 ? -20.597 31.615 11.888  1.00 33.42 ? 176 GLU A O     1 
ATOM   1314 C CB    . GLU A 1 169 ? -17.408 30.940 11.419  1.00 34.57 ? 176 GLU A CB    1 
ATOM   1315 C CG    . GLU A 1 169 ? -17.904 30.763 9.982   1.00 33.88 ? 176 GLU A CG    1 
ATOM   1316 C CD    . GLU A 1 169 ? -17.709 32.009 9.118   1.00 33.61 ? 176 GLU A CD    1 
ATOM   1317 O OE1   . GLU A 1 169 ? -17.855 31.904 7.881   1.00 32.66 ? 176 GLU A OE1   1 
ATOM   1318 O OE2   . GLU A 1 169 ? -17.416 33.089 9.669   1.00 30.99 ? 176 GLU A OE2   1 
ATOM   1319 N N     . ILE A 1 170 ? -19.695 30.281 13.454  1.00 33.91 ? 177 ILE A N     1 
ATOM   1320 C CA    . ILE A 1 170 ? -20.955 29.612 13.771  1.00 32.48 ? 177 ILE A CA    1 
ATOM   1321 C C     . ILE A 1 170 ? -21.894 30.619 14.422  1.00 32.13 ? 177 ILE A C     1 
ATOM   1322 O O     . ILE A 1 170 ? -23.102 30.633 14.156  1.00 30.84 ? 177 ILE A O     1 
ATOM   1323 C CB    . ILE A 1 170 ? -20.718 28.411 14.731  1.00 33.31 ? 177 ILE A CB    1 
ATOM   1324 C CG1   . ILE A 1 170 ? -19.885 27.337 14.018  1.00 33.67 ? 177 ILE A CG1   1 
ATOM   1325 C CG2   . ILE A 1 170 ? -22.049 27.838 15.203  1.00 32.83 ? 177 ILE A CG2   1 
ATOM   1326 C CD1   . ILE A 1 170 ? -19.324 26.262 14.913  1.00 30.07 ? 177 ILE A CD1   1 
ATOM   1327 N N     . GLY A 1 171 ? -21.322 31.472 15.275  1.00 32.22 ? 178 GLY A N     1 
ATOM   1328 C CA    . GLY A 1 171 ? -22.103 32.491 15.947  1.00 30.40 ? 178 GLY A CA    1 
ATOM   1329 C C     . GLY A 1 171 ? -22.706 33.434 14.925  1.00 28.79 ? 178 GLY A C     1 
ATOM   1330 O O     . GLY A 1 171 ? -23.876 33.787 15.010  1.00 28.80 ? 178 GLY A O     1 
ATOM   1331 N N     . ARG A 1 172 ? -21.896 33.840 13.955  1.00 29.52 ? 179 ARG A N     1 
ATOM   1332 C CA    . ARG A 1 172 ? -22.359 34.725 12.896  1.00 30.17 ? 179 ARG A CA    1 
ATOM   1333 C C     . ARG A 1 172 ? -23.504 34.061 12.131  1.00 28.95 ? 179 ARG A C     1 
ATOM   1334 O O     . ARG A 1 172 ? -24.492 34.711 11.793  1.00 30.13 ? 179 ARG A O     1 
ATOM   1335 C CB    . ARG A 1 172 ? -21.202 35.073 11.937  1.00 31.07 ? 179 ARG A CB    1 
ATOM   1336 C CG    . ARG A 1 172 ? -20.219 36.108 12.488  1.00 36.27 ? 179 ARG A CG    1 
ATOM   1337 C CD    . ARG A 1 172 ? -19.138 36.522 11.486  1.00 41.04 ? 179 ARG A CD    1 
ATOM   1338 N NE    . ARG A 1 172 ? -18.157 35.461 11.232  1.00 45.79 ? 179 ARG A NE    1 
ATOM   1339 C CZ    . ARG A 1 172 ? -17.043 35.261 11.937  1.00 46.41 ? 179 ARG A CZ    1 
ATOM   1340 N NH1   . ARG A 1 172 ? -16.224 34.262 11.625  1.00 46.80 ? 179 ARG A NH1   1 
ATOM   1341 N NH2   . ARG A 1 172 ? -16.737 36.065 12.948  1.00 47.79 ? 179 ARG A NH2   1 
ATOM   1342 N N     . ILE A 1 173 ? -23.386 32.764 11.876  1.00 27.06 ? 180 ILE A N     1 
ATOM   1343 C CA    . ILE A 1 173 ? -24.434 32.058 11.149  1.00 29.01 ? 180 ILE A CA    1 
ATOM   1344 C C     . ILE A 1 173 ? -25.728 31.870 11.933  1.00 30.22 ? 180 ILE A C     1 
ATOM   1345 O O     . ILE A 1 173 ? -26.814 32.109 11.393  1.00 30.64 ? 180 ILE A O     1 
ATOM   1346 C CB    . ILE A 1 173 ? -23.958 30.670 10.659  1.00 27.74 ? 180 ILE A CB    1 
ATOM   1347 C CG1   . ILE A 1 173 ? -22.814 30.829 9.645   1.00 25.75 ? 180 ILE A CG1   1 
ATOM   1348 C CG2   . ILE A 1 173 ? -25.102 29.931 10.030  1.00 21.79 ? 180 ILE A CG2   1 
ATOM   1349 C CD1   . ILE A 1 173 ? -22.136 29.528 9.283   1.00 21.92 ? 180 ILE A CD1   1 
ATOM   1350 N N     . VAL A 1 174 ? -25.630 31.445 13.192  1.00 32.05 ? 181 VAL A N     1 
ATOM   1351 C CA    . VAL A 1 174 ? -26.840 31.240 14.008  1.00 34.18 ? 181 VAL A CA    1 
ATOM   1352 C C     . VAL A 1 174 ? -27.376 32.507 14.672  1.00 32.44 ? 181 VAL A C     1 
ATOM   1353 O O     . VAL A 1 174 ? -28.577 32.653 14.858  1.00 32.64 ? 181 VAL A O     1 
ATOM   1354 C CB    . VAL A 1 174 ? -26.631 30.166 15.120  1.00 32.24 ? 181 VAL A CB    1 
ATOM   1355 C CG1   . VAL A 1 174 ? -26.317 28.827 14.486  1.00 35.52 ? 181 VAL A CG1   1 
ATOM   1356 C CG2   . VAL A 1 174 ? -25.518 30.571 16.056  1.00 31.18 ? 181 VAL A CG2   1 
ATOM   1357 N N     . GLY A 1 175 ? -26.493 33.427 15.025  1.00 32.42 ? 182 GLY A N     1 
ATOM   1358 C CA    . GLY A 1 175 ? -26.952 34.635 15.670  1.00 33.66 ? 182 GLY A CA    1 
ATOM   1359 C C     . GLY A 1 175 ? -26.823 34.564 17.176  1.00 34.61 ? 182 GLY A C     1 
ATOM   1360 O O     . GLY A 1 175 ? -27.805 34.714 17.903  1.00 35.42 ? 182 GLY A O     1 
ATOM   1361 N N     . CYS A 1 176 ? -25.609 34.310 17.646  1.00 32.83 ? 183 CYS A N     1 
ATOM   1362 C CA    . CYS A 1 176 ? -25.335 34.254 19.069  1.00 34.04 ? 183 CYS A CA    1 
ATOM   1363 C C     . CYS A 1 176 ? -23.842 34.496 19.228  1.00 35.34 ? 183 CYS A C     1 
ATOM   1364 O O     . CYS A 1 176 ? -23.105 34.476 18.246  1.00 35.69 ? 183 CYS A O     1 
ATOM   1365 C CB    . CYS A 1 176 ? -25.751 32.906 19.669  1.00 31.99 ? 183 CYS A CB    1 
ATOM   1366 S SG    . CYS A 1 176 ? -24.727 31.473 19.262  1.00 33.11 ? 183 CYS A SG    1 
ATOM   1367 N N     . SER A 1 177 ? -23.405 34.757 20.453  1.00 37.59 ? 184 SER A N     1 
ATOM   1368 C CA    . SER A 1 177 ? -21.995 35.017 20.740  1.00 38.65 ? 184 SER A CA    1 
ATOM   1369 C C     . SER A 1 177 ? -21.162 33.760 20.567  1.00 39.85 ? 184 SER A C     1 
ATOM   1370 O O     . SER A 1 177 ? -21.697 32.651 20.585  1.00 41.94 ? 184 SER A O     1 
ATOM   1371 C CB    . SER A 1 177 ? -21.845 35.475 22.177  1.00 39.87 ? 184 SER A CB    1 
ATOM   1372 O OG    . SER A 1 177 ? -22.122 34.390 23.056  1.00 40.02 ? 184 SER A OG    1 
ATOM   1373 N N     . ARG A 1 178 ? -19.853 33.916 20.426  1.00 40.24 ? 185 ARG A N     1 
ATOM   1374 C CA    . ARG A 1 178 ? -18.999 32.744 20.292  1.00 42.90 ? 185 ARG A CA    1 
ATOM   1375 C C     . ARG A 1 178 ? -19.002 31.948 21.597  1.00 42.25 ? 185 ARG A C     1 
ATOM   1376 O O     . ARG A 1 178 ? -18.862 30.728 21.582  1.00 40.93 ? 185 ARG A O     1 
ATOM   1377 C CB    . ARG A 1 178 ? -17.575 33.151 19.915  1.00 46.87 ? 185 ARG A CB    1 
ATOM   1378 C CG    . ARG A 1 178 ? -17.043 34.336 20.686  1.00 52.10 ? 185 ARG A CG    1 
ATOM   1379 C CD    . ARG A 1 178 ? -15.531 34.466 20.537  1.00 58.07 ? 185 ARG A CD    1 
ATOM   1380 N NE    . ARG A 1 178 ? -14.979 35.274 21.625  1.00 64.61 ? 185 ARG A NE    1 
ATOM   1381 C CZ    . ARG A 1 178 ? -14.969 36.606 21.658  1.00 66.73 ? 185 ARG A CZ    1 
ATOM   1382 N NH1   . ARG A 1 178 ? -14.453 37.238 22.706  1.00 66.73 ? 185 ARG A NH1   1 
ATOM   1383 N NH2   . ARG A 1 178 ? -15.446 37.307 20.629  1.00 67.66 ? 185 ARG A NH2   1 
ATOM   1384 N N     . GLU A 1 179 ? -19.180 32.649 22.721  1.00 41.80 ? 186 GLU A N     1 
ATOM   1385 C CA    . GLU A 1 179 ? -19.233 32.017 24.038  1.00 42.10 ? 186 GLU A CA    1 
ATOM   1386 C C     . GLU A 1 179 ? -20.357 30.982 24.106  1.00 42.04 ? 186 GLU A C     1 
ATOM   1387 O O     . GLU A 1 179 ? -20.165 29.850 24.581  1.00 40.55 ? 186 GLU A O     1 
ATOM   1388 C CB    . GLU A 1 179 ? -19.468 33.055 25.137  1.00 44.42 ? 186 GLU A CB    1 
ATOM   1389 C CG    . GLU A 1 179 ? -18.240 33.857 25.535  1.00 47.88 ? 186 GLU A CG    1 
ATOM   1390 C CD    . GLU A 1 179 ? -17.887 34.964 24.555  1.00 50.34 ? 186 GLU A CD    1 
ATOM   1391 O OE1   . GLU A 1 179 ? -16.750 35.484 24.648  1.00 52.44 ? 186 GLU A OE1   1 
ATOM   1392 O OE2   . GLU A 1 179 ? -18.737 35.325 23.706  1.00 49.19 ? 186 GLU A OE2   1 
ATOM   1393 N N     . MET A 1 180 ? -21.536 31.376 23.641  1.00 39.83 ? 187 MET A N     1 
ATOM   1394 C CA    . MET A 1 180 ? -22.664 30.471 23.654  1.00 40.11 ? 187 MET A CA    1 
ATOM   1395 C C     . MET A 1 180 ? -22.416 29.301 22.699  1.00 40.16 ? 187 MET A C     1 
ATOM   1396 O O     . MET A 1 180 ? -22.833 28.170 22.957  1.00 39.48 ? 187 MET A O     1 
ATOM   1397 C CB    . MET A 1 180 ? -23.931 31.216 23.268  1.00 41.91 ? 187 MET A CB    1 
ATOM   1398 C CG    . MET A 1 180 ? -25.211 30.551 23.745  1.00 46.06 ? 187 MET A CG    1 
ATOM   1399 S SD    . MET A 1 180 ? -26.641 31.530 23.232  1.00 58.41 ? 187 MET A SD    1 
ATOM   1400 C CE    . MET A 1 180 ? -26.057 33.238 23.553  1.00 56.94 ? 187 MET A CE    1 
ATOM   1401 N N     . VAL A 1 181 ? -21.728 29.568 21.591  1.00 38.13 ? 188 VAL A N     1 
ATOM   1402 C CA    . VAL A 1 181 ? -21.432 28.511 20.644  1.00 37.37 ? 188 VAL A CA    1 
ATOM   1403 C C     . VAL A 1 181 ? -20.539 27.487 21.348  1.00 36.05 ? 188 VAL A C     1 
ATOM   1404 O O     . VAL A 1 181 ? -20.766 26.271 21.257  1.00 34.22 ? 188 VAL A O     1 
ATOM   1405 C CB    . VAL A 1 181 ? -20.729 29.080 19.375  1.00 38.31 ? 188 VAL A CB    1 
ATOM   1406 C CG1   . VAL A 1 181 ? -20.140 27.946 18.530  1.00 36.84 ? 188 VAL A CG1   1 
ATOM   1407 C CG2   . VAL A 1 181 ? -21.739 29.863 18.540  1.00 37.25 ? 188 VAL A CG2   1 
ATOM   1408 N N     . GLY A 1 182 ? -19.538 27.991 22.066  1.00 34.51 ? 189 GLY A N     1 
ATOM   1409 C CA    . GLY A 1 182 ? -18.631 27.123 22.791  1.00 33.14 ? 189 GLY A CA    1 
ATOM   1410 C C     . GLY A 1 182 ? -19.410 26.263 23.768  1.00 34.74 ? 189 GLY A C     1 
ATOM   1411 O O     . GLY A 1 182 ? -19.107 25.085 23.973  1.00 35.26 ? 189 GLY A O     1 
ATOM   1412 N N     . ARG A 1 183 ? -20.429 26.849 24.380  1.00 34.04 ? 190 ARG A N     1 
ATOM   1413 C CA    . ARG A 1 183 ? -21.232 26.100 25.315  1.00 32.57 ? 190 ARG A CA    1 
ATOM   1414 C C     . ARG A 1 183 ? -22.014 25.004 24.624  1.00 33.74 ? 190 ARG A C     1 
ATOM   1415 O O     . ARG A 1 183 ? -22.049 23.864 25.106  1.00 35.32 ? 190 ARG A O     1 
ATOM   1416 C CB    . ARG A 1 183 ? -22.165 27.028 26.076  1.00 32.18 ? 190 ARG A CB    1 
ATOM   1417 C CG    . ARG A 1 183 ? -21.606 27.390 27.431  1.00 36.86 ? 190 ARG A CG    1 
ATOM   1418 C CD    . ARG A 1 183 ? -22.513 28.305 28.211  1.00 40.60 ? 190 ARG A CD    1 
ATOM   1419 N NE    . ARG A 1 183 ? -22.276 29.708 27.897  1.00 42.41 ? 190 ARG A NE    1 
ATOM   1420 C CZ    . ARG A 1 183 ? -23.213 30.526 27.430  1.00 45.14 ? 190 ARG A CZ    1 
ATOM   1421 N NH1   . ARG A 1 183 ? -24.453 30.071 27.218  1.00 46.22 ? 190 ARG A NH1   1 
ATOM   1422 N NH2   . ARG A 1 183 ? -22.915 31.799 27.187  1.00 44.47 ? 190 ARG A NH2   1 
ATOM   1423 N N     . VAL A 1 184 ? -22.627 25.330 23.483  1.00 32.64 ? 191 VAL A N     1 
ATOM   1424 C CA    . VAL A 1 184 ? -23.418 24.344 22.754  1.00 30.55 ? 191 VAL A CA    1 
ATOM   1425 C C     . VAL A 1 184 ? -22.526 23.211 22.307  1.00 30.71 ? 191 VAL A C     1 
ATOM   1426 O O     . VAL A 1 184 ? -22.920 22.044 22.338  1.00 30.10 ? 191 VAL A O     1 
ATOM   1427 C CB    . VAL A 1 184 ? -24.119 24.949 21.502  1.00 28.49 ? 191 VAL A CB    1 
ATOM   1428 C CG1   . VAL A 1 184 ? -24.958 23.882 20.817  1.00 27.24 ? 191 VAL A CG1   1 
ATOM   1429 C CG2   . VAL A 1 184 ? -25.015 26.106 21.894  1.00 25.64 ? 191 VAL A CG2   1 
ATOM   1430 N N     . LEU A 1 185 ? -21.306 23.555 21.903  1.00 29.50 ? 192 LEU A N     1 
ATOM   1431 C CA    . LEU A 1 185 ? -20.396 22.529 21.443  1.00 32.94 ? 192 LEU A CA    1 
ATOM   1432 C C     . LEU A 1 185 ? -19.979 21.591 22.562  1.00 34.32 ? 192 LEU A C     1 
ATOM   1433 O O     . LEU A 1 185 ? -19.949 20.364 22.366  1.00 33.44 ? 192 LEU A O     1 
ATOM   1434 C CB    . LEU A 1 185 ? -19.177 23.187 20.785  1.00 35.32 ? 192 LEU A CB    1 
ATOM   1435 C CG    . LEU A 1 185 ? -19.470 23.972 19.493  1.00 36.79 ? 192 LEU A CG    1 
ATOM   1436 C CD1   . LEU A 1 185 ? -18.175 24.551 18.944  1.00 34.35 ? 192 LEU A CD1   1 
ATOM   1437 C CD2   . LEU A 1 185 ? -20.084 23.045 18.450  1.00 35.08 ? 192 LEU A CD2   1 
ATOM   1438 N N     . LYS A 1 186 ? -19.679 22.139 23.723  1.00 36.80 ? 193 LYS A N     1 
ATOM   1439 C CA    . LYS A 1 186 ? -19.319 21.341 24.900  1.00 36.01 ? 193 LYS A CA    1 
ATOM   1440 C C     . LYS A 1 186 ? -20.417 20.319 25.128  1.00 35.14 ? 193 LYS A C     1 
ATOM   1441 O O     . LYS A 1 186 ? -20.130 19.144 25.370  1.00 33.34 ? 193 LYS A O     1 
ATOM   1442 C CB    . LYS A 1 186 ? -19.137 22.214 26.131  1.00 39.33 ? 193 LYS A CB    1 
ATOM   1443 C CG    . LYS A 1 186 ? -18.701 21.454 27.380  1.00 46.29 ? 193 LYS A CG    1 
ATOM   1444 C CD    . LYS A 1 186 ? -18.611 22.351 28.602  1.00 49.22 ? 193 LYS A CD    1 
ATOM   1445 C CE    . LYS A 1 186 ? -18.240 21.530 29.844  1.00 50.75 ? 193 LYS A CE    1 
ATOM   1446 N NZ    . LYS A 1 186 ? -18.148 22.387 31.062  1.00 52.97 ? 193 LYS A NZ    1 
ATOM   1447 N N     . SER A 1 187 ? -21.677 20.734 25.019  1.00 35.19 ? 194 SER A N     1 
ATOM   1448 C CA    . SER A 1 187 ? -22.767 19.791 25.202  1.00 33.57 ? 194 SER A CA    1 
ATOM   1449 C C     . SER A 1 187 ? -22.830 18.729 24.068  1.00 34.76 ? 194 SER A C     1 
ATOM   1450 O O     . SER A 1 187 ? -23.006 17.535 24.324  1.00 34.71 ? 194 SER A O     1 
ATOM   1451 C CB    . SER A 1 187 ? -24.078 20.558 25.286  1.00 32.88 ? 194 SER A CB    1 
ATOM   1452 O OG    . SER A 1 187 ? -25.217 19.757 25.559  1.00 35.12 ? 194 SER A OG    1 
ATOM   1453 N N     . LEU A 1 188 ? -22.660 19.190 22.825  1.00 35.78 ? 195 LEU A N     1 
ATOM   1454 C CA    . LEU A 1 188 ? -22.740 18.295 21.665  1.00 34.86 ? 195 LEU A CA    1 
ATOM   1455 C C     . LEU A 1 188 ? -21.645 17.263 21.695  1.00 35.88 ? 195 LEU A C     1 
ATOM   1456 O O     . LEU A 1 188 ? -21.835 16.108 21.278  1.00 35.19 ? 195 LEU A O     1 
ATOM   1457 C CB    . LEU A 1 188 ? -22.656 19.093 20.358  1.00 33.13 ? 195 LEU A CB    1 
ATOM   1458 C CG    . LEU A 1 188 ? -23.843 19.989 19.989  1.00 30.18 ? 195 LEU A CG    1 
ATOM   1459 C CD1   . LEU A 1 188 ? -23.603 20.597 18.631  1.00 29.03 ? 195 LEU A CD1   1 
ATOM   1460 C CD2   . LEU A 1 188 ? -25.126 19.184 19.973  1.00 29.89 ? 195 LEU A CD2   1 
ATOM   1461 N N     . GLU A 1 189 ? -20.489 17.692 22.197  1.00 38.19 ? 196 GLU A N     1 
ATOM   1462 C CA    . GLU A 1 189 ? -19.330 16.822 22.310  1.00 39.61 ? 196 GLU A CA    1 
ATOM   1463 C C     . GLU A 1 189 ? -19.508 15.848 23.479  1.00 40.37 ? 196 GLU A C     1 
ATOM   1464 O O     . GLU A 1 189 ? -19.207 14.664 23.345  1.00 39.18 ? 196 GLU A O     1 
ATOM   1465 C CB    . GLU A 1 189 ? -18.070 17.658 22.486  1.00 38.34 ? 196 GLU A CB    1 
ATOM   1466 C CG    . GLU A 1 189 ? -16.820 16.888 22.158  1.00 42.52 ? 196 GLU A CG    1 
ATOM   1467 C CD    . GLU A 1 189 ? -15.664 17.788 21.777  1.00 45.80 ? 196 GLU A CD    1 
ATOM   1468 O OE1   . GLU A 1 189 ? -14.581 17.246 21.451  1.00 45.92 ? 196 GLU A OE1   1 
ATOM   1469 O OE2   . GLU A 1 189 ? -15.841 19.035 21.803  1.00 47.51 ? 196 GLU A OE2   1 
ATOM   1470 N N     . GLU A 1 190 ? -20.004 16.346 24.615  1.00 41.67 ? 197 GLU A N     1 
ATOM   1471 C CA    . GLU A 1 190 ? -20.248 15.483 25.772  1.00 42.89 ? 197 GLU A CA    1 
ATOM   1472 C C     . GLU A 1 190 ? -21.171 14.353 25.337  1.00 41.71 ? 197 GLU A C     1 
ATOM   1473 O O     . GLU A 1 190 ? -21.050 13.215 25.808  1.00 42.66 ? 197 GLU A O     1 
ATOM   1474 C CB    . GLU A 1 190 ? -20.907 16.261 26.910  1.00 45.15 ? 197 GLU A CB    1 
ATOM   1475 C CG    . GLU A 1 190 ? -19.932 16.905 27.889  1.00 51.22 ? 197 GLU A CG    1 
ATOM   1476 C CD    . GLU A 1 190 ? -20.527 18.120 28.606  1.00 56.63 ? 197 GLU A CD    1 
ATOM   1477 O OE1   . GLU A 1 190 ? -21.782 18.264 28.594  1.00 59.59 ? 197 GLU A OE1   1 
ATOM   1478 O OE2   . GLU A 1 190 ? -19.745 18.925 29.184  1.00 55.13 ? 197 GLU A OE2   1 
ATOM   1479 N N     . GLN A 1 191 ? -22.089 14.678 24.433  1.00 38.87 ? 198 GLN A N     1 
ATOM   1480 C CA    . GLN A 1 191 ? -23.040 13.710 23.912  1.00 36.66 ? 198 GLN A CA    1 
ATOM   1481 C C     . GLN A 1 191 ? -22.432 12.877 22.795  1.00 38.15 ? 198 GLN A C     1 
ATOM   1482 O O     . GLN A 1 191 ? -23.093 11.994 22.240  1.00 36.88 ? 198 GLN A O     1 
ATOM   1483 C CB    . GLN A 1 191 ? -24.274 14.435 23.410  1.00 33.78 ? 198 GLN A CB    1 
ATOM   1484 C CG    . GLN A 1 191 ? -25.032 15.108 24.529  1.00 30.10 ? 198 GLN A CG    1 
ATOM   1485 C CD    . GLN A 1 191 ? -26.200 15.923 24.044  1.00 28.10 ? 198 GLN A CD    1 
ATOM   1486 O OE1   . GLN A 1 191 ? -26.188 17.162 24.151  1.00 26.88 ? 198 GLN A OE1   1 
ATOM   1487 N NE2   . GLN A 1 191 ? -27.219 15.244 23.504  1.00 20.56 ? 198 GLN A NE2   1 
ATOM   1488 N N     . GLY A 1 192 ? -21.170 13.172 22.475  1.00 39.42 ? 199 GLY A N     1 
ATOM   1489 C CA    . GLY A 1 192 ? -20.452 12.454 21.431  1.00 39.95 ? 199 GLY A CA    1 
ATOM   1490 C C     . GLY A 1 192 ? -21.066 12.587 20.051  1.00 40.93 ? 199 GLY A C     1 
ATOM   1491 O O     . GLY A 1 192 ? -21.017 11.652 19.244  1.00 38.56 ? 199 GLY A O     1 
ATOM   1492 N N     . LEU A 1 193 ? -21.656 13.752 19.779  1.00 41.18 ? 200 LEU A N     1 
ATOM   1493 C CA    . LEU A 1 193 ? -22.279 13.992 18.486  1.00 41.06 ? 200 LEU A CA    1 
ATOM   1494 C C     . LEU A 1 193 ? -21.271 14.569 17.486  1.00 42.35 ? 200 LEU A C     1 
ATOM   1495 O O     . LEU A 1 193 ? -21.407 14.408 16.263  1.00 41.43 ? 200 LEU A O     1 
ATOM   1496 C CB    . LEU A 1 193 ? -23.485 14.913 18.664  1.00 38.00 ? 200 LEU A CB    1 
ATOM   1497 C CG    . LEU A 1 193 ? -24.626 14.207 19.406  1.00 34.94 ? 200 LEU A CG    1 
ATOM   1498 C CD1   . LEU A 1 193 ? -25.821 15.120 19.522  1.00 33.25 ? 200 LEU A CD1   1 
ATOM   1499 C CD2   . LEU A 1 193 ? -25.007 12.941 18.672  1.00 30.86 ? 200 LEU A CD2   1 
ATOM   1500 N N     . VAL A 1 194 ? -20.256 15.229 18.025  1.00 42.71 ? 201 VAL A N     1 
ATOM   1501 C CA    . VAL A 1 194 ? -19.191 15.811 17.230  1.00 44.94 ? 201 VAL A CA    1 
ATOM   1502 C C     . VAL A 1 194 ? -17.948 15.731 18.095  1.00 47.22 ? 201 VAL A C     1 
ATOM   1503 O O     . VAL A 1 194 ? -18.027 15.385 19.275  1.00 48.67 ? 201 VAL A O     1 
ATOM   1504 C CB    . VAL A 1 194 ? -19.448 17.308 16.883  1.00 44.31 ? 201 VAL A CB    1 
ATOM   1505 C CG1   . VAL A 1 194 ? -20.705 17.436 16.064  1.00 43.80 ? 201 VAL A CG1   1 
ATOM   1506 C CG2   . VAL A 1 194 ? -19.548 18.147 18.145  1.00 41.40 ? 201 VAL A CG2   1 
ATOM   1507 N N     . HIS A 1 195 ? -16.803 16.035 17.497  1.00 47.52 ? 202 HIS A N     1 
ATOM   1508 C CA    . HIS A 1 195 ? -15.547 16.041 18.214  1.00 48.20 ? 202 HIS A CA    1 
ATOM   1509 C C     . HIS A 1 195 ? -14.780 17.250 17.710  1.00 48.99 ? 202 HIS A C     1 
ATOM   1510 O O     . HIS A 1 195 ? -14.460 17.337 16.530  1.00 50.89 ? 202 HIS A O     1 
ATOM   1511 C CB    . HIS A 1 195 ? -14.762 14.754 17.948  1.00 49.45 ? 202 HIS A CB    1 
ATOM   1512 C CG    . HIS A 1 195 ? -13.312 14.852 18.321  1.00 51.73 ? 202 HIS A CG    1 
ATOM   1513 N ND1   . HIS A 1 195 ? -12.879 15.508 19.457  1.00 52.32 ? 202 HIS A ND1   1 
ATOM   1514 C CD2   . HIS A 1 195 ? -12.196 14.405 17.699  1.00 52.01 ? 202 HIS A CD2   1 
ATOM   1515 C CE1   . HIS A 1 195 ? -11.561 15.465 19.511  1.00 51.57 ? 202 HIS A CE1   1 
ATOM   1516 N NE2   . HIS A 1 195 ? -11.123 14.801 18.458  1.00 52.65 ? 202 HIS A NE2   1 
ATOM   1517 N N     . VAL A 1 196 ? -14.499 18.193 18.597  1.00 48.07 ? 203 VAL A N     1 
ATOM   1518 C CA    . VAL A 1 196 ? -13.778 19.386 18.201  1.00 49.11 ? 203 VAL A CA    1 
ATOM   1519 C C     . VAL A 1 196 ? -12.287 19.262 18.486  1.00 50.73 ? 203 VAL A C     1 
ATOM   1520 O O     . VAL A 1 196 ? -11.878 18.665 19.485  1.00 51.17 ? 203 VAL A O     1 
ATOM   1521 C CB    . VAL A 1 196 ? -14.337 20.626 18.922  1.00 49.26 ? 203 VAL A CB    1 
ATOM   1522 C CG1   . VAL A 1 196 ? -13.672 21.890 18.393  1.00 46.94 ? 203 VAL A CG1   1 
ATOM   1523 C CG2   . VAL A 1 196 ? -15.842 20.694 18.732  1.00 48.57 ? 203 VAL A CG2   1 
ATOM   1524 N N     . LYS A 1 197 ? -11.483 19.834 17.590  1.00 52.39 ? 204 LYS A N     1 
ATOM   1525 C CA    . LYS A 1 197 ? -10.028 19.807 17.690  1.00 53.52 ? 204 LYS A CA    1 
ATOM   1526 C C     . LYS A 1 197 ? -9.433  20.965 16.909  1.00 53.05 ? 204 LYS A C     1 
ATOM   1527 O O     . LYS A 1 197 ? -9.218  20.863 15.706  1.00 54.98 ? 204 LYS A O     1 
ATOM   1528 C CB    . LYS A 1 197 ? -9.493  18.492 17.123  1.00 56.30 ? 204 LYS A CB    1 
ATOM   1529 C CG    . LYS A 1 197 ? -10.418 17.845 16.076  1.00 59.34 ? 204 LYS A CG    1 
ATOM   1530 C CD    . LYS A 1 197 ? -9.623  17.167 14.964  1.00 61.89 ? 204 LYS A CD    1 
ATOM   1531 C CE    . LYS A 1 197 ? -8.574  16.202 15.511  1.00 63.44 ? 204 LYS A CE    1 
ATOM   1532 N NZ    . LYS A 1 197 ? -7.553  15.844 14.472  1.00 63.83 ? 204 LYS A NZ    1 
ATOM   1533 N N     . GLY A 1 198 ? -9.156  22.066 17.586  1.00 52.62 ? 205 GLY A N     1 
ATOM   1534 C CA    . GLY A 1 198 ? -8.593  23.208 16.894  1.00 55.24 ? 205 GLY A CA    1 
ATOM   1535 C C     . GLY A 1 198 ? -9.668  23.869 16.058  1.00 57.59 ? 205 GLY A C     1 
ATOM   1536 O O     . GLY A 1 198 ? -10.801 24.022 16.520  1.00 57.69 ? 205 GLY A O     1 
ATOM   1537 N N     . LYS A 1 199 ? -9.327  24.257 14.832  1.00 58.86 ? 206 LYS A N     1 
ATOM   1538 C CA    . LYS A 1 199 ? -10.300 24.893 13.942  1.00 58.37 ? 206 LYS A CA    1 
ATOM   1539 C C     . LYS A 1 199 ? -10.973 23.790 13.130  1.00 56.72 ? 206 LYS A C     1 
ATOM   1540 O O     . LYS A 1 199 ? -11.707 24.062 12.187  1.00 57.23 ? 206 LYS A O     1 
ATOM   1541 C CB    . LYS A 1 199 ? -9.615  25.870 12.979  1.00 61.44 ? 206 LYS A CB    1 
ATOM   1542 C CG    . LYS A 1 199 ? -8.616  26.866 13.602  1.00 65.67 ? 206 LYS A CG    1 
ATOM   1543 C CD    . LYS A 1 199 ? -9.289  27.970 14.405  1.00 67.61 ? 206 LYS A CD    1 
ATOM   1544 C CE    . LYS A 1 199 ? -9.356  27.625 15.894  1.00 70.52 ? 206 LYS A CE    1 
ATOM   1545 N NZ    . LYS A 1 199 ? -10.170 28.618 16.667  1.00 70.70 ? 206 LYS A NZ    1 
ATOM   1546 N N     . THR A 1 200 ? -10.700 22.543 13.500  1.00 54.52 ? 207 THR A N     1 
ATOM   1547 C CA    . THR A 1 200 ? -11.262 21.385 12.815  1.00 52.83 ? 207 THR A CA    1 
ATOM   1548 C C     . THR A 1 200 ? -12.345 20.763 13.680  1.00 52.49 ? 207 THR A C     1 
ATOM   1549 O O     . THR A 1 200 ? -12.266 20.793 14.906  1.00 53.71 ? 207 THR A O     1 
ATOM   1550 C CB    . THR A 1 200 ? -10.188 20.305 12.571  1.00 52.03 ? 207 THR A CB    1 
ATOM   1551 O OG1   . THR A 1 200 ? -9.058  20.895 11.932  1.00 53.05 ? 207 THR A OG1   1 
ATOM   1552 C CG2   . THR A 1 200 ? -10.728 19.198 11.688  1.00 50.59 ? 207 THR A CG2   1 
ATOM   1553 N N     . MET A 1 201 ? -13.354 20.187 13.042  1.00 50.91 ? 208 MET A N     1 
ATOM   1554 C CA    . MET A 1 201 ? -14.426 19.548 13.783  1.00 49.86 ? 208 MET A CA    1 
ATOM   1555 C C     . MET A 1 201 ? -15.077 18.424 12.993  1.00 48.19 ? 208 MET A C     1 
ATOM   1556 O O     . MET A 1 201 ? -15.531 18.622 11.871  1.00 48.73 ? 208 MET A O     1 
ATOM   1557 C CB    . MET A 1 201 ? -15.497 20.564 14.159  1.00 52.41 ? 208 MET A CB    1 
ATOM   1558 C CG    . MET A 1 201 ? -16.688 19.937 14.879  1.00 54.45 ? 208 MET A CG    1 
ATOM   1559 S SD    . MET A 1 201 ? -18.144 21.002 14.911  1.00 57.29 ? 208 MET A SD    1 
ATOM   1560 C CE    . MET A 1 201 ? -17.368 22.608 15.414  1.00 51.54 ? 208 MET A CE    1 
ATOM   1561 N N     . VAL A 1 202 ? -15.135 17.245 13.596  1.00 46.28 ? 209 VAL A N     1 
ATOM   1562 C CA    . VAL A 1 202 ? -15.743 16.100 12.947  1.00 45.74 ? 209 VAL A CA    1 
ATOM   1563 C C     . VAL A 1 202 ? -17.178 15.905 13.425  1.00 46.43 ? 209 VAL A C     1 
ATOM   1564 O O     . VAL A 1 202 ? -17.474 15.992 14.620  1.00 45.79 ? 209 VAL A O     1 
ATOM   1565 C CB    . VAL A 1 202 ? -14.947 14.803 13.222  1.00 44.47 ? 209 VAL A CB    1 
ATOM   1566 C CG1   . VAL A 1 202 ? -15.586 13.623 12.485  1.00 42.05 ? 209 VAL A CG1   1 
ATOM   1567 C CG2   . VAL A 1 202 ? -13.507 14.982 12.790  1.00 42.71 ? 209 VAL A CG2   1 
ATOM   1568 N N     . VAL A 1 203 ? -18.064 15.649 12.470  1.00 46.08 ? 210 VAL A N     1 
ATOM   1569 C CA    . VAL A 1 203 ? -19.469 15.418 12.753  1.00 46.81 ? 210 VAL A CA    1 
ATOM   1570 C C     . VAL A 1 203 ? -19.763 13.979 12.336  1.00 48.54 ? 210 VAL A C     1 
ATOM   1571 O O     . VAL A 1 203 ? -19.828 13.662 11.148  1.00 50.11 ? 210 VAL A O     1 
ATOM   1572 C CB    . VAL A 1 203 ? -20.341 16.391 11.949  1.00 45.10 ? 210 VAL A CB    1 
ATOM   1573 C CG1   . VAL A 1 203 ? -21.802 16.176 12.285  1.00 43.25 ? 210 VAL A CG1   1 
ATOM   1574 C CG2   . VAL A 1 203 ? -19.906 17.823 12.240  1.00 41.69 ? 210 VAL A CG2   1 
ATOM   1575 N N     . PHE A 1 204 ? -19.941 13.117 13.332  1.00 49.28 ? 211 PHE A N     1 
ATOM   1576 C CA    . PHE A 1 204 ? -20.180 11.694 13.105  1.00 51.42 ? 211 PHE A CA    1 
ATOM   1577 C C     . PHE A 1 204 ? -21.466 11.279 12.387  1.00 53.53 ? 211 PHE A C     1 
ATOM   1578 O O     . PHE A 1 204 ? -22.525 11.885 12.561  1.00 55.17 ? 211 PHE A O     1 
ATOM   1579 C CB    . PHE A 1 204 ? -20.103 10.943 14.440  1.00 50.00 ? 211 PHE A CB    1 
ATOM   1580 C CG    . PHE A 1 204 ? -18.866 11.245 15.237  1.00 50.32 ? 211 PHE A CG    1 
ATOM   1581 C CD1   . PHE A 1 204 ? -18.936 11.999 16.410  1.00 50.32 ? 211 PHE A CD1   1 
ATOM   1582 C CD2   . PHE A 1 204 ? -17.621 10.809 14.798  1.00 52.12 ? 211 PHE A CD2   1 
ATOM   1583 C CE1   . PHE A 1 204 ? -17.778 12.319 17.144  1.00 49.57 ? 211 PHE A CE1   1 
ATOM   1584 C CE2   . PHE A 1 204 ? -16.456 11.124 15.523  1.00 53.34 ? 211 PHE A CE2   1 
ATOM   1585 C CZ    . PHE A 1 204 ? -16.541 11.884 16.701  1.00 50.33 ? 211 PHE A CZ    1 
ATOM   1586 N N     . GLY A 1 205 ? -21.343 10.223 11.579  1.00 56.08 ? 212 GLY A N     1 
ATOM   1587 C CA    . GLY A 1 205 ? -22.458 9.648  10.843  1.00 57.34 ? 212 GLY A CA    1 
ATOM   1588 C C     . GLY A 1 205 ? -23.069 10.421 9.686   1.00 60.53 ? 212 GLY A C     1 
ATOM   1589 O O     . GLY A 1 205 ? -24.093 10.000 9.124   1.00 61.25 ? 212 GLY A O     1 
ATOM   1590 N N     . THR A 1 206 ? -22.454 11.536 9.307   1.00 61.52 ? 213 THR A N     1 
ATOM   1591 C CA    . THR A 1 206 ? -23.000 12.348 8.223   1.00 62.87 ? 213 THR A CA    1 
ATOM   1592 C C     . THR A 1 206 ? -22.099 12.302 6.970   1.00 64.12 ? 213 THR A C     1 
ATOM   1593 O O     . THR A 1 206 ? -22.641 12.326 5.829   1.00 63.65 ? 213 THR A O     1 
ATOM   1594 C CB    . THR A 1 206 ? -23.221 13.814 8.716   1.00 62.15 ? 213 THR A CB    1 
ATOM   1595 O OG1   . THR A 1 206 ? -24.379 14.375 8.082   1.00 60.58 ? 213 THR A OG1   1 
ATOM   1596 C CG2   . THR A 1 206 ? -21.995 14.678 8.427   1.00 61.72 ? 213 THR A CG2   1 
HETATM 1597 P P     . CMP B 2 .   ? -18.587 37.041 18.414  1.00 45.27 ? 302 CMP A P     1 
HETATM 1598 O O1P   . CMP B 2 .   ? -19.279 36.525 19.664  1.00 46.96 ? 302 CMP A O1P   1 
HETATM 1599 O O2P   . CMP B 2 .   ? -17.172 37.438 18.767  1.00 44.10 ? 302 CMP A O2P   1 
HETATM 1600 O "O5'" . CMP B 2 .   ? -18.602 35.931 17.376  1.00 44.09 ? 302 CMP A "O5'" 1 
HETATM 1601 C "C5'" . CMP B 2 .   ? -19.869 35.445 16.865  1.00 41.94 ? 302 CMP A "C5'" 1 
HETATM 1602 C "C4'" . CMP B 2 .   ? -20.332 36.678 16.075  1.00 43.70 ? 302 CMP A "C4'" 1 
HETATM 1603 O "O4'" . CMP B 2 .   ? -21.599 36.545 15.432  1.00 43.00 ? 302 CMP A "O4'" 1 
HETATM 1604 C "C3'" . CMP B 2 .   ? -20.485 37.842 17.055  1.00 42.85 ? 302 CMP A "C3'" 1 
HETATM 1605 O "O3'" . CMP B 2 .   ? -19.252 38.187 17.680  1.00 44.48 ? 302 CMP A "O3'" 1 
HETATM 1606 C "C2'" . CMP B 2 .   ? -21.346 38.774 16.233  1.00 42.09 ? 302 CMP A "C2'" 1 
HETATM 1607 O "O2'" . CMP B 2 .   ? -20.690 39.442 15.190  1.00 40.76 ? 302 CMP A "O2'" 1 
HETATM 1608 C "C1'" . CMP B 2 .   ? -22.382 37.606 15.978  1.00 42.21 ? 302 CMP A "C1'" 1 
HETATM 1609 N N9    . CMP B 2 .   ? -23.825 37.763 16.475  1.00 43.92 ? 302 CMP A N9    1 
HETATM 1610 C C8    . CMP B 2 .   ? -24.813 37.891 15.470  1.00 44.25 ? 302 CMP A C8    1 
HETATM 1611 N N7    . CMP B 2 .   ? -26.046 38.010 15.891  1.00 46.87 ? 302 CMP A N7    1 
HETATM 1612 C C5    . CMP B 2 .   ? -25.843 37.959 17.264  1.00 47.92 ? 302 CMP A C5    1 
HETATM 1613 C C6    . CMP B 2 .   ? -26.674 38.019 18.416  1.00 47.63 ? 302 CMP A C6    1 
HETATM 1614 N N6    . CMP B 2 .   ? -27.987 38.150 18.343  1.00 48.90 ? 302 CMP A N6    1 
HETATM 1615 N N1    . CMP B 2 .   ? -26.018 37.923 19.651  1.00 46.36 ? 302 CMP A N1    1 
HETATM 1616 C C2    . CMP B 2 .   ? -24.685 37.781 19.867  1.00 46.32 ? 302 CMP A C2    1 
HETATM 1617 N N3    . CMP B 2 .   ? -23.859 37.719 18.811  1.00 46.28 ? 302 CMP A N3    1 
HETATM 1618 C C4    . CMP B 2 .   ? -24.536 37.816 17.637  1.00 46.87 ? 302 CMP A C4    1 
HETATM 1619 P P     . CMP C 2 .   ? -26.966 42.915 -4.483  1.00 31.84 ? 301 CMP A P     1 
HETATM 1620 O O1P   . CMP C 2 .   ? -28.027 43.481 -3.580  1.00 32.49 ? 301 CMP A O1P   1 
HETATM 1621 O O2P   . CMP C 2 .   ? -26.936 43.741 -5.738  1.00 28.67 ? 301 CMP A O2P   1 
HETATM 1622 O "O5'" . CMP C 2 .   ? -25.641 42.958 -3.722  1.00 31.37 ? 301 CMP A "O5'" 1 
HETATM 1623 C "C5'" . CMP C 2 .   ? -25.491 42.182 -2.502  1.00 28.49 ? 301 CMP A "C5'" 1 
HETATM 1624 C "C4'" . CMP C 2 .   ? -25.539 40.762 -3.077  1.00 32.12 ? 301 CMP A "C4'" 1 
HETATM 1625 O "O4'" . CMP C 2 .   ? -25.435 39.713 -2.100  1.00 32.57 ? 301 CMP A "O4'" 1 
HETATM 1626 C "C3'" . CMP C 2 .   ? -26.893 40.550 -3.776  1.00 31.10 ? 301 CMP A "C3'" 1 
HETATM 1627 O "O3'" . CMP C 2 .   ? -27.093 41.441 -4.868  1.00 31.58 ? 301 CMP A "O3'" 1 
HETATM 1628 C "C2'" . CMP C 2 .   ? -26.934 39.042 -3.840  1.00 29.35 ? 301 CMP A "C2'" 1 
HETATM 1629 O "O2'" . CMP C 2 .   ? -26.112 38.475 -4.809  1.00 29.62 ? 301 CMP A "O2'" 1 
HETATM 1630 C "C1'" . CMP C 2 .   ? -26.609 38.911 -2.289  1.00 30.23 ? 301 CMP A "C1'" 1 
HETATM 1631 N N9    . CMP C 2 .   ? -27.578 38.128 -1.383  1.00 29.38 ? 301 CMP A N9    1 
HETATM 1632 C C8    . CMP C 2 .   ? -28.439 38.973 -0.636  1.00 29.33 ? 301 CMP A C8    1 
HETATM 1633 N N7    . CMP C 2 .   ? -29.292 38.384 0.141   1.00 31.18 ? 301 CMP A N7    1 
HETATM 1634 C C5    . CMP C 2 .   ? -28.981 37.054 -0.086  1.00 29.90 ? 301 CMP A C5    1 
HETATM 1635 C C6    . CMP C 2 .   ? -29.486 35.822 0.403   1.00 27.78 ? 301 CMP A C6    1 
HETATM 1636 N N6    . CMP C 2 .   ? -30.472 35.747 1.287   1.00 26.62 ? 301 CMP A N6    1 
HETATM 1637 N N1    . CMP C 2 .   ? -28.881 34.675 -0.101  1.00 26.38 ? 301 CMP A N1    1 
HETATM 1638 C C2    . CMP C 2 .   ? -27.867 34.605 -1.004  1.00 24.44 ? 301 CMP A C2    1 
HETATM 1639 N N3    . CMP C 2 .   ? -27.338 35.750 -1.509  1.00 27.87 ? 301 CMP A N3    1 
HETATM 1640 C C4    . CMP C 2 .   ? -27.960 36.850 -0.988  1.00 30.59 ? 301 CMP A C4    1 
HETATM 1641 O O     . HOH D 3 .   ? -21.813 53.564 -4.490  1.00 23.50 ? 303 HOH A O     1 
HETATM 1642 O O     . HOH D 3 .   ? -20.050 47.671 -3.324  1.00 29.54 ? 304 HOH A O     1 
HETATM 1643 O O     . HOH D 3 .   ? -13.797 26.891 -5.584  1.00 32.28 ? 305 HOH A O     1 
HETATM 1644 O O     . HOH D 3 .   ? -29.881 26.087 -15.017 1.00 32.48 ? 306 HOH A O     1 
HETATM 1645 O O     . HOH D 3 .   ? -27.013 30.078 -5.762  1.00 22.73 ? 307 HOH A O     1 
HETATM 1646 O O     . HOH D 3 .   ? -30.596 33.055 21.141  1.00 31.18 ? 308 HOH A O     1 
HETATM 1647 O O     . HOH D 3 .   ? -11.841 34.402 22.603  1.00 34.36 ? 309 HOH A O     1 
HETATM 1648 O O     . HOH D 3 .   ? -12.759 29.032 17.648  1.00 29.58 ? 310 HOH A O     1 
HETATM 1649 O O     . HOH D 3 .   ? -29.256 31.762 0.507   1.00 27.65 ? 311 HOH A O     1 
HETATM 1650 O O     . HOH D 3 .   ? -30.797 27.770 5.788   1.00 43.46 ? 312 HOH A O     1 
HETATM 1651 O O     . HOH D 3 .   ? -17.394 28.190 6.793   1.00 27.36 ? 313 HOH A O     1 
HETATM 1652 O O     . HOH D 3 .   ? -26.080 23.393 -0.964  1.00 38.45 ? 314 HOH A O     1 
HETATM 1653 O O     . HOH D 3 .   ? -26.303 27.212 -10.997 1.00 26.03 ? 315 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   8   8   MET MET A . n 
A 1 2   LYS 2   9   9   LYS LYS A . n 
A 1 3   LEU 3   10  10  LEU LEU A . n 
A 1 4   LYS 4   11  11  LYS LYS A . n 
A 1 5   HIS 5   12  12  HIS HIS A . n 
A 1 6   LEU 6   13  13  LEU LEU A . n 
A 1 7   ASP 7   14  14  ASP ASP A . n 
A 1 8   LYS 8   15  15  LYS LYS A . n 
A 1 9   LEU 9   16  16  LEU LEU A . n 
A 1 10  LEU 10  17  17  LEU LEU A . n 
A 1 11  ALA 11  18  18  ALA ALA A . n 
A 1 12  HIS 12  19  19  HIS HIS A . n 
A 1 13  CYS 13  20  20  CYS CYS A . n 
A 1 14  HIS 14  21  21  HIS HIS A . n 
A 1 15  ARG 15  22  22  ARG ARG A . n 
A 1 16  ARG 16  23  23  ARG ARG A . n 
A 1 17  ARG 17  24  24  ARG ARG A . n 
A 1 18  TYR 18  25  25  TYR TYR A . n 
A 1 19  THR 19  26  26  THR THR A . n 
A 1 20  ALA 20  27  27  ALA ALA A . n 
A 1 21  LYS 21  28  28  LYS LYS A . n 
A 1 22  SER 22  29  29  SER SER A . n 
A 1 23  THR 23  30  30  THR THR A . n 
A 1 24  ILE 24  31  31  ILE ILE A . n 
A 1 25  ILE 25  32  32  ILE ILE A . n 
A 1 26  TYR 26  33  33  TYR TYR A . n 
A 1 27  ALA 27  34  34  ALA ALA A . n 
A 1 28  GLY 28  35  35  GLY GLY A . n 
A 1 29  ASP 29  36  36  ASP ASP A . n 
A 1 30  ARG 30  37  37  ARG ARG A . n 
A 1 31  CYS 31  38  38  CYS CYS A . n 
A 1 32  GLU 32  39  39  GLU GLU A . n 
A 1 33  THR 33  40  40  THR THR A . n 
A 1 34  LEU 34  41  41  LEU LEU A . n 
A 1 35  PHE 35  42  42  PHE PHE A . n 
A 1 36  PHE 36  43  43  PHE PHE A . n 
A 1 37  ILE 37  44  44  ILE ILE A . n 
A 1 38  ILE 38  45  45  ILE ILE A . n 
A 1 39  LYS 39  46  46  LYS LYS A . n 
A 1 40  GLY 40  47  47  GLY GLY A . n 
A 1 41  SER 41  48  48  SER SER A . n 
A 1 42  VAL 42  49  49  VAL VAL A . n 
A 1 43  THR 43  50  50  THR THR A . n 
A 1 44  ILE 44  51  51  ILE ILE A . n 
A 1 45  LEU 45  52  52  LEU LEU A . n 
A 1 46  ILE 46  53  53  ILE ILE A . n 
A 1 47  GLU 47  54  54  GLU GLU A . n 
A 1 48  ASP 48  55  55  ASP ASP A . n 
A 1 49  ASP 49  56  56  ASP ASP A . n 
A 1 50  ASP 50  57  57  ASP ASP A . n 
A 1 51  GLY 51  58  58  GLY GLY A . n 
A 1 52  ARG 52  59  59  ARG ARG A . n 
A 1 53  GLU 53  60  60  GLU GLU A . n 
A 1 54  MET 54  61  61  MET MET A . n 
A 1 55  ILE 55  62  62  ILE ILE A . n 
A 1 56  ILE 56  63  63  ILE ILE A . n 
A 1 57  GLY 57  64  64  GLY GLY A . n 
A 1 58  TYR 58  65  65  TYR TYR A . n 
A 1 59  LEU 59  66  66  LEU LEU A . n 
A 1 60  ASN 60  67  67  ASN ASN A . n 
A 1 61  SER 61  68  68  SER SER A . n 
A 1 62  GLY 62  69  69  GLY GLY A . n 
A 1 63  ASP 63  70  70  ASP ASP A . n 
A 1 64  PHE 64  71  71  PHE PHE A . n 
A 1 65  PHE 65  72  72  PHE PHE A . n 
A 1 66  GLY 66  73  73  GLY GLY A . n 
A 1 67  GLU 67  74  74  GLU GLU A . n 
A 1 68  LEU 68  75  75  LEU LEU A . n 
A 1 69  GLY 69  76  76  GLY GLY A . n 
A 1 70  LEU 70  77  77  LEU LEU A . n 
A 1 71  PHE 71  78  78  PHE PHE A . n 
A 1 72  GLU 72  79  79  GLU GLU A . n 
A 1 73  LYS 73  80  ?   ?   ?   A . n 
A 1 74  GLU 74  81  ?   ?   ?   A . n 
A 1 75  GLY 75  82  ?   ?   ?   A . n 
A 1 76  SER 76  83  ?   ?   ?   A . n 
A 1 77  GLU 77  84  ?   ?   ?   A . n 
A 1 78  GLN 78  85  85  GLN GLN A . n 
A 1 79  GLU 79  86  86  GLU GLU A . n 
A 1 80  ARG 80  87  87  ARG ARG A . n 
A 1 81  SER 81  88  88  SER SER A . n 
A 1 82  ALA 82  89  89  ALA ALA A . n 
A 1 83  TRP 83  90  90  TRP TRP A . n 
A 1 84  VAL 84  91  91  VAL VAL A . n 
A 1 85  ARG 85  92  92  ARG ARG A . n 
A 1 86  ALA 86  93  93  ALA ALA A . n 
A 1 87  LYS 87  94  94  LYS LYS A . n 
A 1 88  VAL 88  95  95  VAL VAL A . n 
A 1 89  GLU 89  96  96  GLU GLU A . n 
A 1 90  CYS 90  97  97  CYS CYS A . n 
A 1 91  GLU 91  98  98  GLU GLU A . n 
A 1 92  VAL 92  99  99  VAL VAL A . n 
A 1 93  ALA 93  100 100 ALA ALA A . n 
A 1 94  GLU 94  101 101 GLU GLU A . n 
A 1 95  ILE 95  102 102 ILE ILE A . n 
A 1 96  SER 96  103 103 SER SER A . n 
A 1 97  TYR 97  104 104 TYR TYR A . n 
A 1 98  ALA 98  105 105 ALA ALA A . n 
A 1 99  LYS 99  106 106 LYS LYS A . n 
A 1 100 PHE 100 107 107 PHE PHE A . n 
A 1 101 ARG 101 108 108 ARG ARG A . n 
A 1 102 GLU 102 109 109 GLU GLU A . n 
A 1 103 LEU 103 110 110 LEU LEU A . n 
A 1 104 SER 104 111 111 SER SER A . n 
A 1 105 GLN 105 112 112 GLN GLN A . n 
A 1 106 GLN 106 113 113 GLN GLN A . n 
A 1 107 ASP 107 114 114 ASP ASP A . n 
A 1 108 SER 108 115 115 SER SER A . n 
A 1 109 GLU 109 116 116 GLU GLU A . n 
A 1 110 ILE 110 117 117 ILE ILE A . n 
A 1 111 LEU 111 118 118 LEU LEU A . n 
A 1 112 TYR 112 119 119 TYR TYR A . n 
A 1 113 THR 113 120 120 THR THR A . n 
A 1 114 LEU 114 121 121 LEU LEU A . n 
A 1 115 GLY 115 122 122 GLY GLY A . n 
A 1 116 SER 116 123 123 SER SER A . n 
A 1 117 GLN 117 124 124 GLN GLN A . n 
A 1 118 MET 118 125 125 MET MET A . n 
A 1 119 ALA 119 126 126 ALA ALA A . n 
A 1 120 ASP 120 127 127 ASP ASP A . n 
A 1 121 ARG 121 128 128 ARG ARG A . n 
A 1 122 LEU 122 129 129 LEU LEU A . n 
A 1 123 ARG 123 130 130 ARG ARG A . n 
A 1 124 LYS 124 131 131 LYS LYS A . n 
A 1 125 THR 125 132 132 THR THR A . n 
A 1 126 THR 126 133 133 THR THR A . n 
A 1 127 ARG 127 134 134 ARG ARG A . n 
A 1 128 LYS 128 135 135 LYS LYS A . n 
A 1 129 VAL 129 136 136 VAL VAL A . n 
A 1 130 GLY 130 137 137 GLY GLY A . n 
A 1 131 ASP 131 138 138 ASP ASP A . n 
A 1 132 LEU 132 139 139 LEU LEU A . n 
A 1 133 ALA 133 140 140 ALA ALA A . n 
A 1 134 PHE 134 141 141 PHE PHE A . n 
A 1 135 LEU 135 142 142 LEU LEU A . n 
A 1 136 ASP 136 143 143 ASP ASP A . n 
A 1 137 VAL 137 144 144 VAL VAL A . n 
A 1 138 THR 138 145 145 THR THR A . n 
A 1 139 GLY 139 146 146 GLY GLY A . n 
A 1 140 ARG 140 147 147 ARG ARG A . n 
A 1 141 VAL 141 148 148 VAL VAL A . n 
A 1 142 ALA 142 149 149 ALA ALA A . n 
A 1 143 ARG 143 150 150 ARG ARG A . n 
A 1 144 THR 144 151 151 THR THR A . n 
A 1 145 LEU 145 152 152 LEU LEU A . n 
A 1 146 LEU 146 153 153 LEU LEU A . n 
A 1 147 ASP 147 154 154 ASP ASP A . n 
A 1 148 LEU 148 155 155 LEU LEU A . n 
A 1 149 CYS 149 156 156 CYS CYS A . n 
A 1 150 GLN 150 157 157 GLN GLN A . n 
A 1 151 GLN 151 158 158 GLN GLN A . n 
A 1 152 PRO 152 159 159 PRO PRO A . n 
A 1 153 ASP 153 160 160 ASP ASP A . n 
A 1 154 ALA 154 161 161 ALA ALA A . n 
A 1 155 MET 155 162 162 MET MET A . n 
A 1 156 THR 156 163 163 THR THR A . n 
A 1 157 HIS 157 164 164 HIS HIS A . n 
A 1 158 PRO 158 165 165 PRO PRO A . n 
A 1 159 ASP 159 166 166 ASP ASP A . n 
A 1 160 GLY 160 167 167 GLY GLY A . n 
A 1 161 MET 161 168 168 MET MET A . n 
A 1 162 GLN 162 169 169 GLN GLN A . n 
A 1 163 ILE 163 170 170 ILE ILE A . n 
A 1 164 LYS 164 171 171 LYS LYS A . n 
A 1 165 ILE 165 172 172 ILE ILE A . n 
A 1 166 THR 166 173 173 THR THR A . n 
A 1 167 ARG 167 174 174 ARG ARG A . n 
A 1 168 GLN 168 175 175 GLN GLN A . n 
A 1 169 GLU 169 176 176 GLU GLU A . n 
A 1 170 ILE 170 177 177 ILE ILE A . n 
A 1 171 GLY 171 178 178 GLY GLY A . n 
A 1 172 ARG 172 179 179 ARG ARG A . n 
A 1 173 ILE 173 180 180 ILE ILE A . n 
A 1 174 VAL 174 181 181 VAL VAL A . n 
A 1 175 GLY 175 182 182 GLY GLY A . n 
A 1 176 CYS 176 183 183 CYS CYS A . n 
A 1 177 SER 177 184 184 SER SER A . n 
A 1 178 ARG 178 185 185 ARG ARG A . n 
A 1 179 GLU 179 186 186 GLU GLU A . n 
A 1 180 MET 180 187 187 MET MET A . n 
A 1 181 VAL 181 188 188 VAL VAL A . n 
A 1 182 GLY 182 189 189 GLY GLY A . n 
A 1 183 ARG 183 190 190 ARG ARG A . n 
A 1 184 VAL 184 191 191 VAL VAL A . n 
A 1 185 LEU 185 192 192 LEU LEU A . n 
A 1 186 LYS 186 193 193 LYS LYS A . n 
A 1 187 SER 187 194 194 SER SER A . n 
A 1 188 LEU 188 195 195 LEU LEU A . n 
A 1 189 GLU 189 196 196 GLU GLU A . n 
A 1 190 GLU 190 197 197 GLU GLU A . n 
A 1 191 GLN 191 198 198 GLN GLN A . n 
A 1 192 GLY 192 199 199 GLY GLY A . n 
A 1 193 LEU 193 200 200 LEU LEU A . n 
A 1 194 VAL 194 201 201 VAL VAL A . n 
A 1 195 HIS 195 202 202 HIS HIS A . n 
A 1 196 VAL 196 203 203 VAL VAL A . n 
A 1 197 LYS 197 204 204 LYS LYS A . n 
A 1 198 GLY 198 205 205 GLY GLY A . n 
A 1 199 LYS 199 206 206 LYS LYS A . n 
A 1 200 THR 200 207 207 THR THR A . n 
A 1 201 MET 201 208 208 MET MET A . n 
A 1 202 VAL 202 209 209 VAL VAL A . n 
A 1 203 VAL 203 210 210 VAL VAL A . n 
A 1 204 PHE 204 211 211 PHE PHE A . n 
A 1 205 GLY 205 212 212 GLY GLY A . n 
A 1 206 THR 206 213 213 THR THR A . n 
A 1 207 ARG 207 214 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CMP 1  302 302 CMP CMP A . 
C 2 CMP 1  301 301 CMP CMP A . 
D 3 HOH 1  303 304 HOH HOH A . 
D 3 HOH 2  304 305 HOH HOH A . 
D 3 HOH 3  305 306 HOH HOH A . 
D 3 HOH 4  306 307 HOH HOH A . 
D 3 HOH 5  307 308 HOH HOH A . 
D 3 HOH 6  308 309 HOH HOH A . 
D 3 HOH 7  309 310 HOH HOH A . 
D 3 HOH 8  310 312 HOH HOH A . 
D 3 HOH 9  311 314 HOH HOH A . 
D 3 HOH 10 312 315 HOH HOH A . 
D 3 HOH 11 313 316 HOH HOH A . 
D 3 HOH 12 314 317 HOH HOH A . 
D 3 HOH 13 315 318 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5950  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  19060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 6_465 -x-1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 -69.9500000000 0.0000000000 -1.0000000000 
0.0000000000 69.9500000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-03-04 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-08-10 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations'      
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'       
2 4 'Structure model' '_software.contact_author'       
3 4 'Structure model' '_software.contact_author_email' 
4 4 'Structure model' '_software.date'                 
5 4 'Structure model' '_software.language'             
6 4 'Structure model' '_software.location'             
7 4 'Structure model' '_software.name'                 
8 4 'Structure model' '_software.type'                 
9 4 'Structure model' '_software.version'              
# 
_pdbx_phasing_MR.entry_id                     2OZ6 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     0.449 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   0.492 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           36.800 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        36.800 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO          .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK      .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
MOLREP         .     ?                other   'A. Vagin'           alexei@ysbl.york.ac.uk   phasing           
http://www.ccp4.ac.uk/dist/html/molrep.html      Fortran_77 ? 3 
CNS            .     ?                package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 4 
PDB_EXTRACT    2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
'PROTEUM PLUS' PLUS  ?                ?       ?                    ?                        'data collection' ? ?          ? 6 
HKL-2000       .     ?                ?       ?                    ?                        'data reduction'  ? ?          ? 7 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              52 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              52 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              52 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                130.91 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            15.61 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 28 ? ? 79.75   -9.82  
2 1 GLU A 39 ? ? -143.89 -22.67 
3 1 ARG A 87 ? ? -38.44  119.98 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 "C1'" ? A CMP 302 ? PLANAR . 
2 1 "C1'" ? A CMP 301 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 80  ? A LYS 73  
2 1 Y 1 A GLU 81  ? A GLU 74  
3 1 Y 1 A GLY 82  ? A GLY 75  
4 1 Y 1 A SER 83  ? A SER 76  
5 1 Y 1 A GLU 84  ? A GLU 77  
6 1 Y 1 A ARG 214 ? A ARG 207 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
3 water                                  HOH 
#