data_2OZS
# 
_entry.id   2OZS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2OZS         pdb_00002ozs 10.2210/pdb2ozs/pdb 
NDB   PD0994       ?            ?                   
RCSB  RCSB041788   ?            ?                   
WWPDB D_1000041788 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1IG9 . unspecified 
PDB 1RV2 . unspecified 
PDB 2OYQ . unspecified 
PDB 2OZM . unspecified 
PDB 2P5G . unspecified 
# 
_pdbx_database_status.entry_id                        2OZS 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zahn, K.E.'    1 
'Belrhali, H.'  2 
'Wallace, S.S.' 3 
'Doublie, S.'   4 
# 
_citation.id                        primary 
_citation.title                     
'Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                10551 
_citation.page_last                 10561 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17718515 
_citation.pdbx_database_id_DOI      10.1021/bi7008807 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zahn, K.E.'    1 ? 
primary 'Belrhali, H.'  2 ? 
primary 'Wallace, S.S.' 3 ? 
primary 'Doublie, S.'   4 ? 
# 
_cell.entry_id           2OZS 
_cell.length_a           81.306 
_cell.length_b           117.754 
_cell.length_c           129.133 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OZS 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Template DNA'                      5492.554   1   ?       ?           ? ? 
2 polymer     syn 'Primer DNA'                        4304.817   1   ?       ?           ? ? 
3 polymer     man 'DNA polymerase'                    104655.141 1   2.7.7.7 D222A,D327A ? ? 
4 non-polymer syn 'MAGNESIUM ION'                     24.305     1   ?       ?           ? ? 
5 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182    1   ?       ?           ? ? 
6 water       nat water                               18.015     283 ?       ?           ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no  '(DC)(DG)(DT)(DC)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DA)(DG)(DC)(DC)(DG)(DC)(DG)' CGTCTTATGACAGCCGCG T ? 
2 polydeoxyribonucleotide no yes '(DG)(DC)(DG)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DT)(DA)(DA)(DDG)' GCGGCTGTCATAAG P ? 
3 'polypeptide(L)'        no no  
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DT  n 
1 4   DC  n 
1 5   DT  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DG  n 
1 10  DA  n 
1 11  DC  n 
1 12  DA  n 
1 13  DG  n 
1 14  DC  n 
1 15  DC  n 
1 16  DG  n 
1 17  DC  n 
1 18  DG  n 
2 1   DG  n 
2 2   DC  n 
2 3   DG  n 
2 4   DG  n 
2 5   DC  n 
2 6   DT  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DA  n 
2 13  DA  n 
2 14  DDG n 
3 1   MET n 
3 2   LYS n 
3 3   GLU n 
3 4   PHE n 
3 5   TYR n 
3 6   LEU n 
3 7   THR n 
3 8   VAL n 
3 9   GLU n 
3 10  GLN n 
3 11  ILE n 
3 12  GLY n 
3 13  ASP n 
3 14  SER n 
3 15  ILE n 
3 16  PHE n 
3 17  GLU n 
3 18  ARG n 
3 19  TYR n 
3 20  ILE n 
3 21  ASP n 
3 22  SER n 
3 23  ASN n 
3 24  GLY n 
3 25  ARG n 
3 26  GLU n 
3 27  ARG n 
3 28  THR n 
3 29  ARG n 
3 30  GLU n 
3 31  VAL n 
3 32  GLU n 
3 33  TYR n 
3 34  LYS n 
3 35  PRO n 
3 36  SER n 
3 37  LEU n 
3 38  PHE n 
3 39  ALA n 
3 40  HIS n 
3 41  CYS n 
3 42  PRO n 
3 43  GLU n 
3 44  SER n 
3 45  GLN n 
3 46  ALA n 
3 47  THR n 
3 48  LYS n 
3 49  TYR n 
3 50  PHE n 
3 51  ASP n 
3 52  ILE n 
3 53  TYR n 
3 54  GLY n 
3 55  LYS n 
3 56  PRO n 
3 57  CYS n 
3 58  THR n 
3 59  ARG n 
3 60  LYS n 
3 61  LEU n 
3 62  PHE n 
3 63  ALA n 
3 64  ASN n 
3 65  MET n 
3 66  ARG n 
3 67  ASP n 
3 68  ALA n 
3 69  SER n 
3 70  GLN n 
3 71  TRP n 
3 72  ILE n 
3 73  LYS n 
3 74  ARG n 
3 75  MET n 
3 76  GLU n 
3 77  ASP n 
3 78  ILE n 
3 79  GLY n 
3 80  LEU n 
3 81  GLU n 
3 82  ALA n 
3 83  LEU n 
3 84  GLY n 
3 85  MET n 
3 86  ASP n 
3 87  ASP n 
3 88  PHE n 
3 89  LYS n 
3 90  LEU n 
3 91  ALA n 
3 92  TYR n 
3 93  LEU n 
3 94  SER n 
3 95  ASP n 
3 96  THR n 
3 97  TYR n 
3 98  ASN n 
3 99  TYR n 
3 100 GLU n 
3 101 ILE n 
3 102 LYS n 
3 103 TYR n 
3 104 ASP n 
3 105 HIS n 
3 106 THR n 
3 107 LYS n 
3 108 ILE n 
3 109 ARG n 
3 110 VAL n 
3 111 ALA n 
3 112 ASN n 
3 113 PHE n 
3 114 ASP n 
3 115 ILE n 
3 116 GLU n 
3 117 VAL n 
3 118 THR n 
3 119 SER n 
3 120 PRO n 
3 121 ASP n 
3 122 GLY n 
3 123 PHE n 
3 124 PRO n 
3 125 GLU n 
3 126 PRO n 
3 127 SER n 
3 128 GLN n 
3 129 ALA n 
3 130 LYS n 
3 131 HIS n 
3 132 PRO n 
3 133 ILE n 
3 134 ASP n 
3 135 ALA n 
3 136 ILE n 
3 137 THR n 
3 138 HIS n 
3 139 TYR n 
3 140 ASP n 
3 141 SER n 
3 142 ILE n 
3 143 ASP n 
3 144 ASP n 
3 145 ARG n 
3 146 PHE n 
3 147 TYR n 
3 148 VAL n 
3 149 PHE n 
3 150 ASP n 
3 151 LEU n 
3 152 LEU n 
3 153 ASN n 
3 154 SER n 
3 155 PRO n 
3 156 TYR n 
3 157 GLY n 
3 158 ASN n 
3 159 VAL n 
3 160 GLU n 
3 161 GLU n 
3 162 TRP n 
3 163 SER n 
3 164 ILE n 
3 165 GLU n 
3 166 ILE n 
3 167 ALA n 
3 168 ALA n 
3 169 LYS n 
3 170 LEU n 
3 171 GLN n 
3 172 GLU n 
3 173 GLN n 
3 174 GLY n 
3 175 GLY n 
3 176 ASP n 
3 177 GLU n 
3 178 VAL n 
3 179 PRO n 
3 180 SER n 
3 181 GLU n 
3 182 ILE n 
3 183 ILE n 
3 184 ASP n 
3 185 LYS n 
3 186 ILE n 
3 187 ILE n 
3 188 TYR n 
3 189 MET n 
3 190 PRO n 
3 191 PHE n 
3 192 ASP n 
3 193 ASN n 
3 194 GLU n 
3 195 LYS n 
3 196 GLU n 
3 197 LEU n 
3 198 LEU n 
3 199 MET n 
3 200 GLU n 
3 201 TYR n 
3 202 LEU n 
3 203 ASN n 
3 204 PHE n 
3 205 TRP n 
3 206 GLN n 
3 207 GLN n 
3 208 LYS n 
3 209 THR n 
3 210 PRO n 
3 211 VAL n 
3 212 ILE n 
3 213 LEU n 
3 214 THR n 
3 215 GLY n 
3 216 TRP n 
3 217 ASN n 
3 218 VAL n 
3 219 GLU n 
3 220 SER n 
3 221 PHE n 
3 222 ALA n 
3 223 ILE n 
3 224 PRO n 
3 225 TYR n 
3 226 VAL n 
3 227 TYR n 
3 228 ASN n 
3 229 ARG n 
3 230 ILE n 
3 231 LYS n 
3 232 ASN n 
3 233 ILE n 
3 234 PHE n 
3 235 GLY n 
3 236 GLU n 
3 237 SER n 
3 238 THR n 
3 239 ALA n 
3 240 LYS n 
3 241 ARG n 
3 242 LEU n 
3 243 SER n 
3 244 PRO n 
3 245 HIS n 
3 246 ARG n 
3 247 LYS n 
3 248 THR n 
3 249 ARG n 
3 250 VAL n 
3 251 LYS n 
3 252 VAL n 
3 253 ILE n 
3 254 GLU n 
3 255 ASN n 
3 256 MET n 
3 257 TYR n 
3 258 GLY n 
3 259 SER n 
3 260 ARG n 
3 261 GLU n 
3 262 ILE n 
3 263 ILE n 
3 264 THR n 
3 265 LEU n 
3 266 PHE n 
3 267 GLY n 
3 268 ILE n 
3 269 SER n 
3 270 VAL n 
3 271 LEU n 
3 272 ASP n 
3 273 TYR n 
3 274 ILE n 
3 275 ASP n 
3 276 LEU n 
3 277 TYR n 
3 278 LYS n 
3 279 LYS n 
3 280 PHE n 
3 281 SER n 
3 282 PHE n 
3 283 THR n 
3 284 ASN n 
3 285 GLN n 
3 286 PRO n 
3 287 SER n 
3 288 TYR n 
3 289 SER n 
3 290 LEU n 
3 291 ASP n 
3 292 TYR n 
3 293 ILE n 
3 294 SER n 
3 295 GLU n 
3 296 PHE n 
3 297 GLU n 
3 298 LEU n 
3 299 ASN n 
3 300 VAL n 
3 301 GLY n 
3 302 LYS n 
3 303 LEU n 
3 304 LYS n 
3 305 TYR n 
3 306 ASP n 
3 307 GLY n 
3 308 PRO n 
3 309 ILE n 
3 310 SER n 
3 311 LYS n 
3 312 LEU n 
3 313 ARG n 
3 314 GLU n 
3 315 SER n 
3 316 ASN n 
3 317 HIS n 
3 318 GLN n 
3 319 ARG n 
3 320 TYR n 
3 321 ILE n 
3 322 SER n 
3 323 TYR n 
3 324 ASN n 
3 325 ILE n 
3 326 ILE n 
3 327 ALA n 
3 328 VAL n 
3 329 TYR n 
3 330 ARG n 
3 331 VAL n 
3 332 LEU n 
3 333 GLN n 
3 334 ILE n 
3 335 ASP n 
3 336 ALA n 
3 337 LYS n 
3 338 ARG n 
3 339 GLN n 
3 340 PHE n 
3 341 ILE n 
3 342 ASN n 
3 343 LEU n 
3 344 SER n 
3 345 LEU n 
3 346 ASP n 
3 347 MET n 
3 348 GLY n 
3 349 TYR n 
3 350 TYR n 
3 351 ALA n 
3 352 LYS n 
3 353 ILE n 
3 354 GLN n 
3 355 ILE n 
3 356 GLN n 
3 357 SER n 
3 358 VAL n 
3 359 PHE n 
3 360 SER n 
3 361 PRO n 
3 362 ILE n 
3 363 LYS n 
3 364 THR n 
3 365 TRP n 
3 366 ASP n 
3 367 ALA n 
3 368 ILE n 
3 369 ILE n 
3 370 PHE n 
3 371 ASN n 
3 372 SER n 
3 373 LEU n 
3 374 LYS n 
3 375 GLU n 
3 376 GLN n 
3 377 ASN n 
3 378 LYS n 
3 379 VAL n 
3 380 ILE n 
3 381 PRO n 
3 382 GLN n 
3 383 GLY n 
3 384 ARG n 
3 385 SER n 
3 386 HIS n 
3 387 PRO n 
3 388 VAL n 
3 389 GLN n 
3 390 PRO n 
3 391 TYR n 
3 392 PRO n 
3 393 GLY n 
3 394 ALA n 
3 395 PHE n 
3 396 VAL n 
3 397 LYS n 
3 398 GLU n 
3 399 PRO n 
3 400 ILE n 
3 401 PRO n 
3 402 ASN n 
3 403 ARG n 
3 404 TYR n 
3 405 LYS n 
3 406 TYR n 
3 407 VAL n 
3 408 MET n 
3 409 SER n 
3 410 PHE n 
3 411 ASP n 
3 412 LEU n 
3 413 THR n 
3 414 SER n 
3 415 LEU n 
3 416 TYR n 
3 417 PRO n 
3 418 SER n 
3 419 ILE n 
3 420 ILE n 
3 421 ARG n 
3 422 GLN n 
3 423 VAL n 
3 424 ASN n 
3 425 ILE n 
3 426 SER n 
3 427 PRO n 
3 428 GLU n 
3 429 THR n 
3 430 ILE n 
3 431 ALA n 
3 432 GLY n 
3 433 THR n 
3 434 PHE n 
3 435 LYS n 
3 436 VAL n 
3 437 ALA n 
3 438 PRO n 
3 439 LEU n 
3 440 HIS n 
3 441 ASP n 
3 442 TYR n 
3 443 ILE n 
3 444 ASN n 
3 445 ALA n 
3 446 VAL n 
3 447 ALA n 
3 448 GLU n 
3 449 ARG n 
3 450 PRO n 
3 451 SER n 
3 452 ASP n 
3 453 VAL n 
3 454 TYR n 
3 455 SER n 
3 456 CYS n 
3 457 SER n 
3 458 PRO n 
3 459 ASN n 
3 460 GLY n 
3 461 MET n 
3 462 MET n 
3 463 TYR n 
3 464 TYR n 
3 465 LYS n 
3 466 ASP n 
3 467 ARG n 
3 468 ASP n 
3 469 GLY n 
3 470 VAL n 
3 471 VAL n 
3 472 PRO n 
3 473 THR n 
3 474 GLU n 
3 475 ILE n 
3 476 THR n 
3 477 LYS n 
3 478 VAL n 
3 479 PHE n 
3 480 ASN n 
3 481 GLN n 
3 482 ARG n 
3 483 LYS n 
3 484 GLU n 
3 485 HIS n 
3 486 LYS n 
3 487 GLY n 
3 488 TYR n 
3 489 MET n 
3 490 LEU n 
3 491 ALA n 
3 492 ALA n 
3 493 GLN n 
3 494 ARG n 
3 495 ASN n 
3 496 GLY n 
3 497 GLU n 
3 498 ILE n 
3 499 ILE n 
3 500 LYS n 
3 501 GLU n 
3 502 ALA n 
3 503 LEU n 
3 504 HIS n 
3 505 ASN n 
3 506 PRO n 
3 507 ASN n 
3 508 LEU n 
3 509 SER n 
3 510 VAL n 
3 511 ASP n 
3 512 GLU n 
3 513 PRO n 
3 514 LEU n 
3 515 ASP n 
3 516 VAL n 
3 517 ASP n 
3 518 TYR n 
3 519 ARG n 
3 520 PHE n 
3 521 ASP n 
3 522 PHE n 
3 523 SER n 
3 524 ASP n 
3 525 GLU n 
3 526 ILE n 
3 527 LYS n 
3 528 GLU n 
3 529 LYS n 
3 530 ILE n 
3 531 LYS n 
3 532 LYS n 
3 533 LEU n 
3 534 SER n 
3 535 ALA n 
3 536 LYS n 
3 537 SER n 
3 538 LEU n 
3 539 ASN n 
3 540 GLU n 
3 541 MET n 
3 542 LEU n 
3 543 PHE n 
3 544 ARG n 
3 545 ALA n 
3 546 GLN n 
3 547 ARG n 
3 548 THR n 
3 549 GLU n 
3 550 VAL n 
3 551 ALA n 
3 552 GLY n 
3 553 MET n 
3 554 THR n 
3 555 ALA n 
3 556 GLN n 
3 557 ILE n 
3 558 ASN n 
3 559 ARG n 
3 560 LYS n 
3 561 LEU n 
3 562 LEU n 
3 563 ILE n 
3 564 ASN n 
3 565 SER n 
3 566 LEU n 
3 567 TYR n 
3 568 GLY n 
3 569 ALA n 
3 570 LEU n 
3 571 GLY n 
3 572 ASN n 
3 573 VAL n 
3 574 TRP n 
3 575 PHE n 
3 576 ARG n 
3 577 TYR n 
3 578 TYR n 
3 579 ASP n 
3 580 LEU n 
3 581 ARG n 
3 582 ASN n 
3 583 ALA n 
3 584 THR n 
3 585 ALA n 
3 586 ILE n 
3 587 THR n 
3 588 THR n 
3 589 PHE n 
3 590 GLY n 
3 591 GLN n 
3 592 MET n 
3 593 ALA n 
3 594 LEU n 
3 595 GLN n 
3 596 TRP n 
3 597 ILE n 
3 598 GLU n 
3 599 ARG n 
3 600 LYS n 
3 601 VAL n 
3 602 ASN n 
3 603 GLU n 
3 604 TYR n 
3 605 LEU n 
3 606 ASN n 
3 607 GLU n 
3 608 VAL n 
3 609 CYS n 
3 610 GLY n 
3 611 THR n 
3 612 GLU n 
3 613 GLY n 
3 614 GLU n 
3 615 ALA n 
3 616 PHE n 
3 617 VAL n 
3 618 LEU n 
3 619 TYR n 
3 620 GLY n 
3 621 ASP n 
3 622 THR n 
3 623 ASP n 
3 624 SER n 
3 625 ILE n 
3 626 TYR n 
3 627 VAL n 
3 628 SER n 
3 629 ALA n 
3 630 ASP n 
3 631 LYS n 
3 632 ILE n 
3 633 ILE n 
3 634 ASP n 
3 635 LYS n 
3 636 VAL n 
3 637 GLY n 
3 638 GLU n 
3 639 SER n 
3 640 LYS n 
3 641 PHE n 
3 642 ARG n 
3 643 ASP n 
3 644 THR n 
3 645 ASN n 
3 646 HIS n 
3 647 TRP n 
3 648 VAL n 
3 649 ASP n 
3 650 PHE n 
3 651 LEU n 
3 652 ASP n 
3 653 LYS n 
3 654 PHE n 
3 655 ALA n 
3 656 ARG n 
3 657 GLU n 
3 658 ARG n 
3 659 MET n 
3 660 GLU n 
3 661 PRO n 
3 662 ALA n 
3 663 ILE n 
3 664 ASP n 
3 665 ARG n 
3 666 GLY n 
3 667 PHE n 
3 668 ARG n 
3 669 GLU n 
3 670 MET n 
3 671 CYS n 
3 672 GLU n 
3 673 TYR n 
3 674 MET n 
3 675 ASN n 
3 676 ASN n 
3 677 LYS n 
3 678 GLN n 
3 679 HIS n 
3 680 LEU n 
3 681 MET n 
3 682 PHE n 
3 683 MET n 
3 684 ASP n 
3 685 ARG n 
3 686 GLU n 
3 687 ALA n 
3 688 ILE n 
3 689 ALA n 
3 690 GLY n 
3 691 PRO n 
3 692 PRO n 
3 693 LEU n 
3 694 GLY n 
3 695 SER n 
3 696 LYS n 
3 697 GLY n 
3 698 ILE n 
3 699 GLY n 
3 700 GLY n 
3 701 PHE n 
3 702 TRP n 
3 703 THR n 
3 704 GLY n 
3 705 LYS n 
3 706 LYS n 
3 707 ARG n 
3 708 TYR n 
3 709 ALA n 
3 710 LEU n 
3 711 ASN n 
3 712 VAL n 
3 713 TRP n 
3 714 ASP n 
3 715 MET n 
3 716 GLU n 
3 717 GLY n 
3 718 THR n 
3 719 ARG n 
3 720 TYR n 
3 721 ALA n 
3 722 GLU n 
3 723 PRO n 
3 724 LYS n 
3 725 LEU n 
3 726 LYS n 
3 727 ILE n 
3 728 MET n 
3 729 GLY n 
3 730 LEU n 
3 731 GLU n 
3 732 THR n 
3 733 GLN n 
3 734 LYS n 
3 735 SER n 
3 736 SER n 
3 737 THR n 
3 738 PRO n 
3 739 LYS n 
3 740 ALA n 
3 741 VAL n 
3 742 GLN n 
3 743 LYS n 
3 744 ALA n 
3 745 LEU n 
3 746 LYS n 
3 747 GLU n 
3 748 CYS n 
3 749 ILE n 
3 750 ARG n 
3 751 ARG n 
3 752 MET n 
3 753 LEU n 
3 754 GLN n 
3 755 GLU n 
3 756 GLY n 
3 757 GLU n 
3 758 GLU n 
3 759 SER n 
3 760 LEU n 
3 761 GLN n 
3 762 GLU n 
3 763 TYR n 
3 764 PHE n 
3 765 LYS n 
3 766 GLU n 
3 767 PHE n 
3 768 GLU n 
3 769 LYS n 
3 770 GLU n 
3 771 PHE n 
3 772 ARG n 
3 773 GLN n 
3 774 LEU n 
3 775 ASN n 
3 776 TYR n 
3 777 ILE n 
3 778 SER n 
3 779 ILE n 
3 780 ALA n 
3 781 SER n 
3 782 VAL n 
3 783 SER n 
3 784 SER n 
3 785 ALA n 
3 786 ASN n 
3 787 ASN n 
3 788 ILE n 
3 789 ALA n 
3 790 LYS n 
3 791 TYR n 
3 792 ASP n 
3 793 VAL n 
3 794 GLY n 
3 795 GLY n 
3 796 PHE n 
3 797 PRO n 
3 798 GLY n 
3 799 PRO n 
3 800 LYS n 
3 801 CYS n 
3 802 PRO n 
3 803 PHE n 
3 804 HIS n 
3 805 ILE n 
3 806 ARG n 
3 807 GLY n 
3 808 ILE n 
3 809 LEU n 
3 810 THR n 
3 811 TYR n 
3 812 ASN n 
3 813 ARG n 
3 814 ALA n 
3 815 ILE n 
3 816 LYS n 
3 817 GLY n 
3 818 ASN n 
3 819 ILE n 
3 820 ASP n 
3 821 ALA n 
3 822 PRO n 
3 823 GLN n 
3 824 VAL n 
3 825 VAL n 
3 826 GLU n 
3 827 GLY n 
3 828 GLU n 
3 829 LYS n 
3 830 VAL n 
3 831 TYR n 
3 832 VAL n 
3 833 LEU n 
3 834 PRO n 
3 835 LEU n 
3 836 ARG n 
3 837 GLU n 
3 838 GLY n 
3 839 ASN n 
3 840 PRO n 
3 841 PHE n 
3 842 GLY n 
3 843 ASP n 
3 844 LYS n 
3 845 CYS n 
3 846 ILE n 
3 847 ALA n 
3 848 TRP n 
3 849 PRO n 
3 850 SER n 
3 851 GLY n 
3 852 THR n 
3 853 GLU n 
3 854 ILE n 
3 855 THR n 
3 856 ASP n 
3 857 LEU n 
3 858 ILE n 
3 859 LYS n 
3 860 ASP n 
3 861 ASP n 
3 862 VAL n 
3 863 LEU n 
3 864 HIS n 
3 865 TRP n 
3 866 MET n 
3 867 ASP n 
3 868 TYR n 
3 869 THR n 
3 870 VAL n 
3 871 LEU n 
3 872 LEU n 
3 873 GLU n 
3 874 LYS n 
3 875 THR n 
3 876 PHE n 
3 877 ILE n 
3 878 LYS n 
3 879 PRO n 
3 880 LEU n 
3 881 GLU n 
3 882 GLY n 
3 883 PHE n 
3 884 THR n 
3 885 SER n 
3 886 ALA n 
3 887 ALA n 
3 888 LYS n 
3 889 LEU n 
3 890 ASP n 
3 891 TYR n 
3 892 GLU n 
3 893 LYS n 
3 894 LYS n 
3 895 ALA n 
3 896 SER n 
3 897 LEU n 
3 898 PHE n 
3 899 ASP n 
3 900 MET n 
3 901 PHE n 
3 902 ASP n 
3 903 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 PDB 2OZS       2OZS   1 CGTCTTATGACAGCCGCG 1 ? 
2 PDB 2OZS       2OZS   2 GCGGCTGTCATAAG 1 ? 
3 UNP DPOL_BPR69 Q38087 3 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OZS T 1 ? 18  ? 2OZS   1   ? 18  ? 1   18  
2 2 2OZS P 1 ? 14  ? 2OZS   101 ? 114 ? 101 114 
3 3 2OZS A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 2OZS ALA A 222 ? UNP Q38087 ASP 222 'engineered mutation' 222 1 
3 2OZS ALA A 327 ? UNP Q38087 ASP 327 'engineered mutation' 327 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DDG 'DNA linking'       n "2',3'-DIDEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
? 'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2OZS 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.69 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;PEG 20000, sodium acetate, magnesium acetate, beta-mercaptoethanol, TRIS 7.0, glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 20000'          ? ? ? 
1 2 1 'sodium acetate'     ? ? ? 
1 3 1 'magnesium acetate'  ? ? ? 
1 4 1 beta-mercaptoethanol ? ? ? 
1 5 2 'PEG 20000'          ? ? ? 
1 6 2 'sodium acetate'     ? ? ? 
1 7 2 'magnesium acetate'  ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    Si111 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.873 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.873 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
# 
_reflns.entry_id                     2OZS 
_reflns.d_resolution_high            2.750 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   31271 
_reflns.pdbx_Rmerge_I_obs            0.148 
_reflns.pdbx_netI_over_sigmaI        10.100 
_reflns.pdbx_chi_squared             1.054 
_reflns.pdbx_redundancy              4.100 
_reflns.percent_possible_obs         94.900 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   31271 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.85 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.341 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.054 
_reflns_shell.pdbx_redundancy        2.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2348 
_reflns_shell.percent_possible_all   73.10 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2OZS 
_refine.ls_d_res_high                            2.750 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    92.530 
_refine.ls_number_reflns_obs                     30422 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'COPIED FROM 1IG9' 
_refine.ls_R_factor_obs                          0.221 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.272 
_refine.ls_percent_reflns_R_free                 8.700 
_refine.ls_number_reflns_R_free                  2641 
_refine.B_iso_mean                               53.334 
_refine.aniso_B[1][1]                            -3.220 
_refine.aniso_B[2][2]                            -3.240 
_refine.aniso_B[3][3]                            6.460 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.883 
_refine.pdbx_overall_ESU_R_Free                  0.433 
_refine.overall_SU_ML                            0.320 
_refine.overall_SU_B                             15.807 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'Isomorphous Replacement' 
_refine.pdbx_starting_model                      1IG9 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7350 
_refine_hist.pdbx_number_atoms_nucleic_acid   650 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             283 
_refine_hist.number_atoms_total               8314 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         8291  0.013  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      11351 1.389  2.065  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   902   5.614  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   373   35.691 24.182 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1330  17.532 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   45    14.779 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1203  0.090  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     6121  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            3934  0.202  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          5653  0.312  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    413   0.127  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      2     0.140  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   36    0.153  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 8     0.134  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              4600  1.032  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             7298  1.652  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4407  2.813  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4053  3.845  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.750 
_refine_ls_shell.d_res_low                        2.821 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               64.330 
_refine_ls_shell.number_reflns_R_work             1502 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.292 
_refine_ls_shell.R_factor_R_free                  0.437 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             18 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1520 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OZS 
_struct.title                     'Crystal structure of RB69 gp43 in complex with DNA with dATP opposite dTMP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OZS 
_struct_keywords.pdbx_keywords   transferase/DNA 
_struct_keywords.text            'DNA polymerase, dATP, transferase-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN C 64  ? GLY C 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP C 87  ? TYR C 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP C 104 ? ILE C 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER C 163 ? LYS C 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  PRO C 179 ? ASP C 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P6  6  ASN C 193 ? LYS C 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P7  7  PHE C 221 ? GLY C 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P8  8  GLY C 235 ? LYS C 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P9  9  ARG C 241 ? SER C 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P10 10 ASP C 272 ? SER C 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P11 11 SER C 289 ? ASN C 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P12 12 PRO C 308 ? SER C 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P13 13 LYS C 311 ? ASN C 316 ? LYS A 311 ASN A 316 1 ? 6  
HELX_P HELX_P14 14 ASN C 316 ? GLN C 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P15 15 GLN C 339 ? LYS C 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN C 354 ? PHE C 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER C 360 ? GLU C 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P18 18 SER C 414 ? ASN C 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 SER C 426 ? GLU C 428 ? SER A 426 GLU A 428 5 ? 3  
HELX_P HELX_P20 20 PRO C 438 ? ASN C 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P21 21 GLY C 469 ? LEU C 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P22 22 SER C 523 ? LYS C 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P23 23 SER C 534 ? GLY C 571 ? SER A 534 GLY A 571 1 ? 38 
HELX_P HELX_P24 24 ASP C 579 ? GLY C 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P25 25 ALA C 629 ? LYS C 635 ? ALA A 629 LYS A 635 1 ? 7  
HELX_P HELX_P26 26 ASP C 643 ? ARG C 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG C 658 ? MET C 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU C 730 ? LYS C 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO C 738 ? GLU C 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY C 756 ? PHE C 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG C 772 ? LEU C 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 TYR C 776 ? ALA C 780 ? TYR A 776 ALA A 780 5 ? 5  
HELX_P HELX_P33 33 ILE C 788 ? LYS C 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P34 34 PRO C 802 ? ILE C 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P35 35 THR C 855 ? MET C 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P36 36 ASP C 867 ? PHE C 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P37 37 PHE C 876 ? LYS C 888 ? PHE A 876 LYS A 888 1 ? 13 
HELX_P HELX_P38 38 PHE C 898 ? ASP C 902 ? PHE A 898 ASP A 902 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? B DA  13  "O3'" ? ? ? 1_555 B DDG 14 P   ? ? P DA  113 P DDG 114 1_555 ? ? ? ? ? ? ?            1.598 ? ? 
metalc1  metalc ?    ? C ASP 411 OD1   ? ? ? 1_555 D MG  .  MG  ? ? A ASP 411 A MG  904 1_555 ? ? ? ? ? ? ?            2.170 ? ? 
metalc2  metalc ?    ? C LEU 412 O     ? ? ? 1_555 D MG  .  MG  ? ? A LEU 412 A MG  904 1_555 ? ? ? ? ? ? ?            2.212 ? ? 
metalc3  metalc ?    ? C ASP 623 OD2   ? ? ? 1_555 D MG  .  MG  ? ? A ASP 623 A MG  904 1_555 ? ? ? ? ? ? ?            1.956 ? ? 
metalc4  metalc ?    ? D MG  .   MG    ? ? ? 1_555 E DTP .  O2A ? ? A MG  904 A DTP 905 1_555 ? ? ? ? ? ? ?            2.225 ? ? 
metalc5  metalc ?    ? D MG  .   MG    ? ? ? 1_555 E DTP .  O1G ? ? A MG  904 A DTP 905 1_555 ? ? ? ? ? ? ?            1.878 ? ? 
metalc6  metalc ?    ? D MG  .   MG    ? ? ? 1_555 E DTP .  O2B ? ? A MG  904 A DTP 905 1_555 ? ? ? ? ? ? ?            1.773 ? ? 
hydrog1  hydrog ?    ? A DC  4   N3    ? ? ? 1_555 B DDG 14 N1  ? ? T DC  4   P DDG 114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? A DC  4   N4    ? ? ? 1_555 B DDG 14 O6  ? ? T DC  4   P DDG 114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? A DC  4   O2    ? ? ? 1_555 B DDG 14 N2  ? ? T DC  4   P DDG 114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? A DT  5   N3    ? ? ? 1_555 B DA  13 N1  ? ? T DT  5   P DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? A DT  5   O4    ? ? ? 1_555 B DA  13 N6  ? ? T DT  5   P DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? A DT  6   N3    ? ? ? 1_555 B DA  12 N1  ? ? T DT  6   P DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? A DT  6   O4    ? ? ? 1_555 B DA  12 N6  ? ? T DT  6   P DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? A DA  7   N1    ? ? ? 1_555 B DT  11 N3  ? ? T DA  7   P DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? A DA  7   N6    ? ? ? 1_555 B DT  11 O4  ? ? T DA  7   P DT  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? A DT  8   N3    ? ? ? 1_555 B DA  10 N1  ? ? T DT  8   P DA  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? A DT  8   O4    ? ? ? 1_555 B DA  10 N6  ? ? T DT  8   P DA  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? A DG  9   N1    ? ? ? 1_555 B DC  9  N3  ? ? T DG  9   P DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? A DG  9   N2    ? ? ? 1_555 B DC  9  O2  ? ? T DG  9   P DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? A DG  9   O6    ? ? ? 1_555 B DC  9  N4  ? ? T DG  9   P DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? A DA  10  N1    ? ? ? 1_555 B DT  8  N3  ? ? T DA  10  P DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? A DA  10  N6    ? ? ? 1_555 B DT  8  O4  ? ? T DA  10  P DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? A DC  11  N3    ? ? ? 1_555 B DG  7  N1  ? ? T DC  11  P DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? A DC  11  N4    ? ? ? 1_555 B DG  7  O6  ? ? T DC  11  P DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? A DC  11  O2    ? ? ? 1_555 B DG  7  N2  ? ? T DC  11  P DG  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? A DA  12  N1    ? ? ? 1_555 B DT  6  N3  ? ? T DA  12  P DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? A DA  12  N6    ? ? ? 1_555 B DT  6  O4  ? ? T DA  12  P DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? A DG  13  N1    ? ? ? 1_555 B DC  5  N3  ? ? T DG  13  P DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? A DG  13  N2    ? ? ? 1_555 B DC  5  O2  ? ? T DG  13  P DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? A DG  13  O6    ? ? ? 1_555 B DC  5  N4  ? ? T DG  13  P DC  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? A DC  14  N3    ? ? ? 1_555 B DG  4  N1  ? ? T DC  14  P DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? A DC  14  N4    ? ? ? 1_555 B DG  4  O6  ? ? T DC  14  P DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? A DC  14  O2    ? ? ? 1_555 B DG  4  N2  ? ? T DC  14  P DG  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? A DC  15  N3    ? ? ? 1_555 B DG  3  N1  ? ? T DC  15  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? A DC  15  N4    ? ? ? 1_555 B DG  3  O6  ? ? T DC  15  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? A DC  15  O2    ? ? ? 1_555 B DG  3  N2  ? ? T DC  15  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ?    ? A DG  16  N1    ? ? ? 1_555 B DC  2  N3  ? ? T DG  16  P DC  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ?    ? A DG  16  N2    ? ? ? 1_555 B DC  2  O2  ? ? T DG  16  P DC  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ?    ? A DG  16  O6    ? ? ? 1_555 B DC  2  N4  ? ? T DG  16  P DC  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ?    ? A DC  17  N3    ? ? ? 1_555 B DG  1  N1  ? ? T DC  17  P DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ?    ? A DC  17  N4    ? ? ? 1_555 B DG  1  O6  ? ? T DC  17  P DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ?    ? A DC  17  O2    ? ? ? 1_555 B DG  1  N2  ? ? T DC  17  P DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE C 4   ? ILE C 11  ? PHE A 4   ILE A 11  
A 2 SER C 14  ? ILE C 20  ? SER A 14  ILE A 20  
A 3 GLU C 26  ? VAL C 31  ? GLU A 26  VAL A 31  
B 1 SER C 36  ? HIS C 40  ? SER A 36  HIS A 40  
B 2 CYS C 57  ? LEU C 61  ? CYS A 57  LEU A 61  
C 1 PHE C 50  ? ASP C 51  ? PHE A 50  ASP A 51  
C 2 LYS C 378 ? VAL C 379 ? LYS A 378 VAL A 379 
D 1 ILE C 186 ? PHE C 191 ? ILE A 186 PHE A 191 
D 2 ARG C 145 ? LEU C 151 ? ARG A 145 LEU A 151 
D 3 ILE C 133 ? ASP C 140 ? ILE A 133 ASP A 140 
D 4 VAL C 110 ? VAL C 117 ? VAL A 110 VAL A 117 
D 5 ILE C 212 ? THR C 214 ? ILE A 212 THR A 214 
D 6 SER C 269 ? VAL C 270 ? SER A 269 VAL A 270 
E 1 ASN C 153 ? SER C 154 ? ASN A 153 SER A 154 
E 2 GLY C 157 ? ASN C 158 ? GLY A 157 ASN A 158 
F 1 THR C 248 ? VAL C 252 ? THR A 248 VAL A 252 
F 2 GLU C 261 ? LEU C 265 ? GLU A 261 LEU A 265 
G 1 ARG C 403 ? TYR C 404 ? ARG A 403 TYR A 404 
G 2 GLY C 700 ? GLY C 704 ? GLY A 700 GLY A 704 
G 3 ARG C 707 ? MET C 715 ? ARG A 707 MET A 715 
G 4 MET C 683 ? ALA C 689 ? MET A 683 ALA A 689 
G 5 VAL C 407 ? LEU C 412 ? VAL A 407 LEU A 412 
G 6 SER C 624 ? SER C 628 ? SER A 624 SER A 628 
G 7 VAL C 617 ? TYR C 619 ? VAL A 617 TYR A 619 
H 1 ARG C 403 ? TYR C 404 ? ARG A 403 TYR A 404 
H 2 GLY C 700 ? GLY C 704 ? GLY A 700 GLY A 704 
H 3 ARG C 707 ? MET C 715 ? ARG A 707 MET A 715 
H 4 THR C 718 ? MET C 728 ? THR A 718 MET A 728 
I 1 ILE C 430 ? THR C 433 ? ILE A 430 THR A 433 
I 2 MET C 461 ? TYR C 463 ? MET A 461 TYR A 463 
I 3 SER C 455 ? CYS C 456 ? SER A 455 CYS A 456 
J 1 SER C 781 ? SER C 784 ? SER A 781 SER A 784 
J 2 LYS C 829 ? PRO C 834 ? LYS A 829 PRO A 834 
J 3 CYS C 845 ? PRO C 849 ? CYS A 845 PRO A 849 
K 1 ASP C 792 ? VAL C 793 ? ASP A 792 VAL A 793 
K 2 PHE C 796 ? PRO C 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU C 6   ? N LEU A 6   O ARG C 18  ? O ARG A 18  
A 2 3 N ILE C 15  ? N ILE A 15  O VAL C 31  ? O VAL A 31  
B 1 2 N LEU C 37  ? N LEU A 37  O LYS C 60  ? O LYS A 60  
C 1 2 N PHE C 50  ? N PHE A 50  O VAL C 379 ? O VAL A 379 
D 1 2 O MET C 189 ? O MET A 189 N VAL C 148 ? N VAL A 148 
D 2 3 O TYR C 147 ? O TYR A 147 N HIS C 138 ? N HIS A 138 
D 3 4 O ALA C 135 ? O ALA A 135 N GLU C 116 ? N GLU A 116 
D 4 5 N ALA C 111 ? N ALA A 111 O THR C 214 ? O THR A 214 
D 5 6 N LEU C 213 ? N LEU A 213 O SER C 269 ? O SER A 269 
E 1 2 N SER C 154 ? N SER A 154 O GLY C 157 ? O GLY A 157 
F 1 2 N LYS C 251 ? N LYS A 251 O ILE C 262 ? O ILE A 262 
G 1 2 N TYR C 404 ? N TYR A 404 O GLY C 700 ? O GLY A 700 
G 2 3 N THR C 703 ? N THR A 703 O ARG C 707 ? O ARG A 707 
G 3 4 O TRP C 713 ? O TRP A 713 N ILE C 688 ? N ILE A 688 
G 4 5 O ALA C 689 ? O ALA A 689 N VAL C 407 ? N VAL A 407 
G 5 6 N MET C 408 ? N MET A 408 O VAL C 627 ? O VAL A 627 
G 6 7 O TYR C 626 ? O TYR A 626 N TYR C 619 ? N TYR A 619 
H 1 2 N TYR C 404 ? N TYR A 404 O GLY C 700 ? O GLY A 700 
H 2 3 N THR C 703 ? N THR A 703 O ARG C 707 ? O ARG A 707 
H 3 4 N TYR C 708 ? N TYR A 708 O MET C 728 ? O MET A 728 
I 1 2 N ALA C 431 ? N ALA A 431 O MET C 462 ? O MET A 462 
I 2 3 O TYR C 463 ? O TYR A 463 N SER C 455 ? N SER A 455 
J 1 2 N SER C 783 ? N SER A 783 O VAL C 830 ? O VAL A 830 
J 2 3 N TYR C 831 ? N TYR A 831 O TRP C 848 ? O TRP A 848 
K 1 2 N VAL C 793 ? N VAL A 793 O PHE C 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  904 ? 4  'BINDING SITE FOR RESIDUE MG A 904'  
AC2 Software A DTP 905 ? 17 'BINDING SITE FOR RESIDUE DTP A 905' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP C 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 4  LEU C 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 4  ASP C 623 ? ASP A 623  . ? 1_555 ? 
4  AC1 4  DTP E .   ? DTP A 905  . ? 1_555 ? 
5  AC2 17 ASP C 411 ? ASP A 411  . ? 1_555 ? 
6  AC2 17 LEU C 412 ? LEU A 412  . ? 1_555 ? 
7  AC2 17 THR C 413 ? THR A 413  . ? 1_555 ? 
8  AC2 17 SER C 414 ? SER A 414  . ? 1_555 ? 
9  AC2 17 LEU C 415 ? LEU A 415  . ? 1_555 ? 
10 AC2 17 TYR C 416 ? TYR A 416  . ? 1_555 ? 
11 AC2 17 ARG C 482 ? ARG A 482  . ? 1_555 ? 
12 AC2 17 LYS C 560 ? LYS A 560  . ? 1_555 ? 
13 AC2 17 ASN C 564 ? ASN A 564  . ? 1_555 ? 
14 AC2 17 THR C 622 ? THR A 622  . ? 1_555 ? 
15 AC2 17 ASP C 623 ? ASP A 623  . ? 1_555 ? 
16 AC2 17 MG  D .   ? MG  A 904  . ? 1_555 ? 
17 AC2 17 HOH H .   ? HOH A 906  . ? 1_555 ? 
18 AC2 17 HOH H .   ? HOH A 1022 . ? 1_555 ? 
19 AC2 17 DDG B 14  ? DDG P 114  . ? 1_555 ? 
20 AC2 17 DT  A 3   ? DT  T 3    . ? 1_555 ? 
21 AC2 17 DC  A 4   ? DC  T 4    . ? 1_555 ? 
# 
_atom_sites.entry_id                    2OZS 
_atom_sites.fract_transf_matrix[1][1]   0.012299 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008492 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1   ? 15.365  60.851 36.724  1.00 99.46  ? 1    DC  T "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1   ? 14.194  61.349 37.347  1.00 100.50 ? 1    DC  T "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1   ? 13.329  60.204 37.861  1.00 101.52 ? 1    DC  T "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1   ? 12.695  60.618 39.104  1.00 102.75 ? 1    DC  T "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1   ? 12.176  59.748 36.950  1.00 101.22 ? 1    DC  T "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1   ? 11.956  58.302 37.017  1.00 98.76  ? 1    DC  T "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1   ? 11.018  60.545 37.541  1.00 102.58 ? 1    DC  T "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1   ? 11.323  60.271 39.008  1.00 103.98 ? 1    DC  T "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1   ? 10.447  60.979 40.012  1.00 104.94 ? 1    DC  T N1    1 
ATOM   10   C  C2    . DC  A 1 1   ? 9.036   60.878 39.931  1.00 105.47 ? 1    DC  T C2    1 
ATOM   11   O  O2    . DC  A 1 1   ? 8.487   60.215 39.028  1.00 105.21 ? 1    DC  T O2    1 
ATOM   12   N  N3    . DC  A 1 1   ? 8.295   61.530 40.872  1.00 105.90 ? 1    DC  T N3    1 
ATOM   13   C  C4    . DC  A 1 1   ? 8.897   62.239 41.845  1.00 105.80 ? 1    DC  T C4    1 
ATOM   14   N  N4    . DC  A 1 1   ? 8.120   62.859 42.742  1.00 105.85 ? 1    DC  T N4    1 
ATOM   15   C  C5    . DC  A 1 1   ? 10.321  62.349 41.946  1.00 105.61 ? 1    DC  T C5    1 
ATOM   16   C  C6    . DC  A 1 1   ? 11.042  61.704 41.019  1.00 105.40 ? 1    DC  T C6    1 
ATOM   17   P  P     . DG  A 1 2   ? 10.548  57.544 36.735  1.00 96.66  ? 2    DG  T P     1 
ATOM   18   O  OP1   . DG  A 1 2   ? 9.640   57.643 37.906  1.00 96.11  ? 2    DG  T OP1   1 
ATOM   19   O  OP2   . DG  A 1 2   ? 10.909  56.213 36.195  1.00 97.03  ? 2    DG  T OP2   1 
ATOM   20   O  "O5'" . DG  A 1 2   ? 9.887   58.397 35.559  1.00 92.82  ? 2    DG  T "O5'" 1 
ATOM   21   C  "C5'" . DG  A 1 2   ? 9.583   57.773 34.335  1.00 85.74  ? 2    DG  T "C5'" 1 
ATOM   22   C  "C4'" . DG  A 1 2   ? 8.096   57.809 34.023  1.00 79.14  ? 2    DG  T "C4'" 1 
ATOM   23   O  "O4'" . DG  A 1 2   ? 7.339   58.756 34.806  1.00 78.81  ? 2    DG  T "O4'" 1 
ATOM   24   C  "C3'" . DG  A 1 2   ? 7.823   58.179 32.582  1.00 74.18  ? 2    DG  T "C3'" 1 
ATOM   25   O  "O3'" . DG  A 1 2   ? 6.869   57.280 32.177  1.00 65.79  ? 2    DG  T "O3'" 1 
ATOM   26   C  "C2'" . DG  A 1 2   ? 7.301   59.609 32.562  1.00 75.75  ? 2    DG  T "C2'" 1 
ATOM   27   C  "C1'" . DG  A 1 2   ? 7.035   59.894 34.031  1.00 78.60  ? 2    DG  T "C1'" 1 
ATOM   28   N  N9    . DG  A 1 2   ? 7.835   60.964 34.596  1.00 79.46  ? 2    DG  T N9    1 
ATOM   29   C  C8    . DG  A 1 2   ? 9.177   61.250 34.452  1.00 79.72  ? 2    DG  T C8    1 
ATOM   30   N  N7    . DG  A 1 2   ? 9.551   62.301 35.136  1.00 79.92  ? 2    DG  T N7    1 
ATOM   31   C  C5    . DG  A 1 2   ? 8.383   62.721 35.767  1.00 79.90  ? 2    DG  T C5    1 
ATOM   32   C  C6    . DG  A 1 2   ? 8.146   63.803 36.642  1.00 79.80  ? 2    DG  T C6    1 
ATOM   33   O  O6    . DG  A 1 2   ? 8.972   64.634 37.032  1.00 79.96  ? 2    DG  T O6    1 
ATOM   34   N  N1    . DG  A 1 2   ? 6.807   63.870 37.056  1.00 79.91  ? 2    DG  T N1    1 
ATOM   35   C  C2    . DG  A 1 2   ? 5.812   62.986 36.661  1.00 80.41  ? 2    DG  T C2    1 
ATOM   36   N  N2    . DG  A 1 2   ? 4.572   63.174 37.140  1.00 80.41  ? 2    DG  T N2    1 
ATOM   37   N  N3    . DG  A 1 2   ? 6.023   61.963 35.844  1.00 80.19  ? 2    DG  T N3    1 
ATOM   38   C  C4    . DG  A 1 2   ? 7.322   61.903 35.445  1.00 80.07  ? 2    DG  T C4    1 
ATOM   39   P  P     . DT  A 1 3   ? 7.375   56.011 31.388  1.00 58.47  ? 3    DT  T P     1 
ATOM   40   O  OP1   . DT  A 1 3   ? 6.617   54.836 31.876  1.00 59.22  ? 3    DT  T OP1   1 
ATOM   41   O  OP2   . DT  A 1 3   ? 8.855   56.025 31.401  1.00 59.83  ? 3    DT  T OP2   1 
ATOM   42   O  "O5'" . DT  A 1 3   ? 6.933   56.367 29.893  1.00 53.58  ? 3    DT  T "O5'" 1 
ATOM   43   C  "C5'" . DT  A 1 3   ? 5.574   56.532 29.582  1.00 45.76  ? 3    DT  T "C5'" 1 
ATOM   44   C  "C4'" . DT  A 1 3   ? 5.404   56.708 28.095  1.00 41.10  ? 3    DT  T "C4'" 1 
ATOM   45   O  "O4'" . DT  A 1 3   ? 5.699   55.464 27.423  1.00 39.02  ? 3    DT  T "O4'" 1 
ATOM   46   C  "C3'" . DT  A 1 3   ? 3.975   56.997 27.675  1.00 38.98  ? 3    DT  T "C3'" 1 
ATOM   47   O  "O3'" . DT  A 1 3   ? 3.563   58.371 27.886  1.00 33.89  ? 3    DT  T "O3'" 1 
ATOM   48   C  "C2'" . DT  A 1 3   ? 3.991   56.565 26.208  1.00 37.93  ? 3    DT  T "C2'" 1 
ATOM   49   C  "C1'" . DT  A 1 3   ? 4.945   55.388 26.222  1.00 37.58  ? 3    DT  T "C1'" 1 
ATOM   50   N  N1    . DT  A 1 3   ? 4.242   54.067 26.140  1.00 38.12  ? 3    DT  T N1    1 
ATOM   51   C  C2    . DT  A 1 3   ? 3.680   53.656 24.944  1.00 38.24  ? 3    DT  T C2    1 
ATOM   52   O  O2    . DT  A 1 3   ? 3.698   54.310 23.913  1.00 38.72  ? 3    DT  T O2    1 
ATOM   53   N  N3    . DT  A 1 3   ? 3.078   52.425 24.981  1.00 35.98  ? 3    DT  T N3    1 
ATOM   54   C  C4    . DT  A 1 3   ? 2.968   51.575 26.045  1.00 35.93  ? 3    DT  T C4    1 
ATOM   55   O  O4    . DT  A 1 3   ? 2.387   50.496 25.937  1.00 37.29  ? 3    DT  T O4    1 
ATOM   56   C  C5    . DT  A 1 3   ? 3.578   52.046 27.258  1.00 36.12  ? 3    DT  T C5    1 
ATOM   57   C  C7    . DT  A 1 3   ? 3.535   51.219 28.511  1.00 36.30  ? 3    DT  T C7    1 
ATOM   58   C  C6    . DT  A 1 3   ? 4.175   53.245 27.247  1.00 36.97  ? 3    DT  T C6    1 
ATOM   59   P  P     . DC  A 1 4   ? 1.979   58.638 28.041  1.00 32.92  ? 4    DC  T P     1 
ATOM   60   O  OP1   . DC  A 1 4   ? 1.785   60.016 28.536  1.00 31.78  ? 4    DC  T OP1   1 
ATOM   61   O  OP2   . DC  A 1 4   ? 1.338   57.474 28.727  1.00 29.87  ? 4    DC  T OP2   1 
ATOM   62   O  "O5'" . DC  A 1 4   ? 1.464   58.548 26.529  1.00 32.18  ? 4    DC  T "O5'" 1 
ATOM   63   C  "C5'" . DC  A 1 4   ? 1.774   59.551 25.619  1.00 32.97  ? 4    DC  T "C5'" 1 
ATOM   64   C  "C4'" . DC  A 1 4   ? 1.248   59.097 24.282  1.00 33.90  ? 4    DC  T "C4'" 1 
ATOM   65   O  "O4'" . DC  A 1 4   ? 1.744   57.775 23.985  1.00 34.33  ? 4    DC  T "O4'" 1 
ATOM   66   C  "C3'" . DC  A 1 4   ? -0.261  58.951 24.245  1.00 34.08  ? 4    DC  T "C3'" 1 
ATOM   67   O  "O3'" . DC  A 1 4   ? -0.739  60.227 23.920  1.00 32.81  ? 4    DC  T "O3'" 1 
ATOM   68   C  "C2'" . DC  A 1 4   ? -0.461  57.960 23.095  1.00 35.16  ? 4    DC  T "C2'" 1 
ATOM   69   C  "C1'" . DC  A 1 4   ? 0.762   57.051 23.249  1.00 34.40  ? 4    DC  T "C1'" 1 
ATOM   70   N  N1    . DC  A 1 4   ? 0.401   55.751 23.928  1.00 33.52  ? 4    DC  T N1    1 
ATOM   71   C  C2    . DC  A 1 4   ? -0.179  54.736 23.168  1.00 33.71  ? 4    DC  T C2    1 
ATOM   72   O  O2    . DC  A 1 4   ? -0.360  54.906 21.953  1.00 34.91  ? 4    DC  T O2    1 
ATOM   73   N  N3    . DC  A 1 4   ? -0.528  53.575 23.772  1.00 33.46  ? 4    DC  T N3    1 
ATOM   74   C  C4    . DC  A 1 4   ? -0.319  53.395 25.069  1.00 32.92  ? 4    DC  T C4    1 
ATOM   75   N  N4    . DC  A 1 4   ? -0.674  52.220 25.579  1.00 33.35  ? 4    DC  T N4    1 
ATOM   76   C  C5    . DC  A 1 4   ? 0.253   54.413 25.879  1.00 34.41  ? 4    DC  T C5    1 
ATOM   77   C  C6    . DC  A 1 4   ? 0.586   55.569 25.269  1.00 34.47  ? 4    DC  T C6    1 
ATOM   78   P  P     . DT  A 1 5   ? -2.280  60.569 24.066  1.00 33.34  ? 5    DT  T P     1 
ATOM   79   O  OP1   . DT  A 1 5   ? -2.408  62.044 23.947  1.00 31.07  ? 5    DT  T OP1   1 
ATOM   80   O  OP2   . DT  A 1 5   ? -2.740  59.873 25.281  1.00 34.79  ? 5    DT  T OP2   1 
ATOM   81   O  "O5'" . DT  A 1 5   ? -2.948  59.831 22.801  1.00 33.63  ? 5    DT  T "O5'" 1 
ATOM   82   C  "C5'" . DT  A 1 5   ? -2.766  60.389 21.506  1.00 33.03  ? 5    DT  T "C5'" 1 
ATOM   83   C  "C4'" . DT  A 1 5   ? -3.677  59.678 20.524  1.00 35.58  ? 5    DT  T "C4'" 1 
ATOM   84   O  "O4'" . DT  A 1 5   ? -3.563  58.232 20.650  1.00 37.33  ? 5    DT  T "O4'" 1 
ATOM   85   C  "C3'" . DT  A 1 5   ? -5.166  59.934 20.657  1.00 36.04  ? 5    DT  T "C3'" 1 
ATOM   86   O  "O3'" . DT  A 1 5   ? -5.747  59.763 19.358  1.00 36.66  ? 5    DT  T "O3'" 1 
ATOM   87   C  "C2'" . DT  A 1 5   ? -5.570  58.806 21.603  1.00 34.83  ? 5    DT  T "C2'" 1 
ATOM   88   C  "C1'" . DT  A 1 5   ? -4.797  57.644 20.997  1.00 33.49  ? 5    DT  T "C1'" 1 
ATOM   89   N  N1    . DT  A 1 5   ? -4.611  56.501 21.940  1.00 33.09  ? 5    DT  T N1    1 
ATOM   90   C  C2    . DT  A 1 5   ? -5.056  55.235 21.594  1.00 33.36  ? 5    DT  T C2    1 
ATOM   91   O  O2    . DT  A 1 5   ? -5.600  54.940 20.544  1.00 34.87  ? 5    DT  T O2    1 
ATOM   92   N  N3    . DT  A 1 5   ? -4.867  54.273 22.532  1.00 31.95  ? 5    DT  T N3    1 
ATOM   93   C  C4    . DT  A 1 5   ? -4.284  54.432 23.768  1.00 33.36  ? 5    DT  T C4    1 
ATOM   94   O  O4    . DT  A 1 5   ? -4.158  53.478 24.547  1.00 33.56  ? 5    DT  T O4    1 
ATOM   95   C  C5    . DT  A 1 5   ? -3.830  55.769 24.078  1.00 33.41  ? 5    DT  T C5    1 
ATOM   96   C  C7    . DT  A 1 5   ? -3.168  56.048 25.395  1.00 32.61  ? 5    DT  T C7    1 
ATOM   97   C  C6    . DT  A 1 5   ? -4.020  56.734 23.168  1.00 33.53  ? 5    DT  T C6    1 
ATOM   98   P  P     . DT  A 1 6   ? -7.309  60.041 19.066  1.00 38.81  ? 6    DT  T P     1 
ATOM   99   O  OP1   . DT  A 1 6   ? -7.351  60.985 17.938  1.00 42.28  ? 6    DT  T OP1   1 
ATOM   100  O  OP2   . DT  A 1 6   ? -8.037  60.387 20.313  1.00 37.56  ? 6    DT  T OP2   1 
ATOM   101  O  "O5'" . DT  A 1 6   ? -7.913  58.678 18.477  1.00 38.55  ? 6    DT  T "O5'" 1 
ATOM   102  C  "C5'" . DT  A 1 6   ? -7.259  57.428 18.414  1.00 39.29  ? 6    DT  T "C5'" 1 
ATOM   103  C  "C4'" . DT  A 1 6   ? -8.271  56.345 18.063  1.00 39.16  ? 6    DT  T "C4'" 1 
ATOM   104  O  "O4'" . DT  A 1 6   ? -8.154  55.194 18.960  1.00 40.17  ? 6    DT  T "O4'" 1 
ATOM   105  C  "C3'" . DT  A 1 6   ? -9.717  56.794 18.179  1.00 38.03  ? 6    DT  T "C3'" 1 
ATOM   106  O  "O3'" . DT  A 1 6   ? -10.496 56.089 17.215  1.00 38.12  ? 6    DT  T "O3'" 1 
ATOM   107  C  "C2'" . DT  A 1 6   ? -10.070 56.420 19.613  1.00 38.48  ? 6    DT  T "C2'" 1 
ATOM   108  C  "C1'" . DT  A 1 6   ? -9.263  55.142 19.846  1.00 38.73  ? 6    DT  T "C1'" 1 
ATOM   109  N  N1    . DT  A 1 6   ? -8.807  54.971 21.284  1.00 37.54  ? 6    DT  T N1    1 
ATOM   110  C  C2    . DT  A 1 6   ? -8.828  53.713 21.828  1.00 37.14  ? 6    DT  T C2    1 
ATOM   111  O  O2    . DT  A 1 6   ? -9.167  52.720 21.201  1.00 37.26  ? 6    DT  T O2    1 
ATOM   112  N  N3    . DT  A 1 6   ? -8.423  53.652 23.132  1.00 36.44  ? 6    DT  T N3    1 
ATOM   113  C  C4    . DT  A 1 6   ? -8.006  54.702 23.926  1.00 37.99  ? 6    DT  T C4    1 
ATOM   114  O  O4    . DT  A 1 6   ? -7.651  54.573 25.103  1.00 38.38  ? 6    DT  T O4    1 
ATOM   115  C  C5    . DT  A 1 6   ? -8.028  55.991 23.300  1.00 37.09  ? 6    DT  T C5    1 
ATOM   116  C  C7    . DT  A 1 6   ? -7.608  57.189 24.105  1.00 36.72  ? 6    DT  T C7    1 
ATOM   117  C  C6    . DT  A 1 6   ? -8.429  56.064 22.029  1.00 36.34  ? 6    DT  T C6    1 
ATOM   118  P  P     . DA  A 1 7   ? -12.087 56.292 16.999  1.00 37.76  ? 7    DA  T P     1 
ATOM   119  O  OP1   . DA  A 1 7   ? -12.326 55.818 15.617  1.00 36.86  ? 7    DA  T OP1   1 
ATOM   120  O  OP2   . DA  A 1 7   ? -12.486 57.647 17.436  1.00 34.79  ? 7    DA  T OP2   1 
ATOM   121  O  "O5'" . DA  A 1 7   ? -12.757 55.233 18.013  1.00 38.63  ? 7    DA  T "O5'" 1 
ATOM   122  C  "C5'" . DA  A 1 7   ? -12.615 53.804 17.761  1.00 39.74  ? 7    DA  T "C5'" 1 
ATOM   123  C  "C4'" . DA  A 1 7   ? -13.172 53.012 18.923  1.00 40.64  ? 7    DA  T "C4'" 1 
ATOM   124  O  "O4'" . DA  A 1 7   ? -12.296 53.209 20.059  1.00 40.88  ? 7    DA  T "O4'" 1 
ATOM   125  C  "C3'" . DA  A 1 7   ? -14.524 53.533 19.410  1.00 41.47  ? 7    DA  T "C3'" 1 
ATOM   126  O  "O3'" . DA  A 1 7   ? -15.577 52.715 18.919  1.00 42.69  ? 7    DA  T "O3'" 1 
ATOM   127  C  "C2'" . DA  A 1 7   ? -14.423 53.507 20.934  1.00 40.54  ? 7    DA  T "C2'" 1 
ATOM   128  C  "C1'" . DA  A 1 7   ? -13.032 52.948 21.230  1.00 38.15  ? 7    DA  T "C1'" 1 
ATOM   129  N  N9    . DA  A 1 7   ? -12.459 53.586 22.419  1.00 36.56  ? 7    DA  T N9    1 
ATOM   130  C  C8    . DA  A 1 7   ? -12.101 54.904 22.593  1.00 36.85  ? 7    DA  T C8    1 
ATOM   131  N  N7    . DA  A 1 7   ? -11.627 55.177 23.786  1.00 36.22  ? 7    DA  T N7    1 
ATOM   132  C  C5    . DA  A 1 7   ? -11.709 53.954 24.446  1.00 36.17  ? 7    DA  T C5    1 
ATOM   133  C  C6    . DA  A 1 7   ? -11.374 53.541 25.754  1.00 36.39  ? 7    DA  T C6    1 
ATOM   134  N  N6    . DA  A 1 7   ? -10.869 54.339 26.703  1.00 35.10  ? 7    DA  T N6    1 
ATOM   135  N  N1    . DA  A 1 7   ? -11.568 52.235 26.056  1.00 37.58  ? 7    DA  T N1    1 
ATOM   136  C  C2    . DA  A 1 7   ? -12.066 51.393 25.141  1.00 36.21  ? 7    DA  T C2    1 
ATOM   137  N  N3    . DA  A 1 7   ? -12.421 51.675 23.896  1.00 36.00  ? 7    DA  T N3    1 
ATOM   138  C  C4    . DA  A 1 7   ? -12.217 52.972 23.615  1.00 35.57  ? 7    DA  T C4    1 
ATOM   139  P  P     . DT  A 1 8   ? -17.062 52.768 19.526  1.00 43.90  ? 8    DT  T P     1 
ATOM   140  O  OP1   . DT  A 1 8   ? -17.958 52.293 18.453  1.00 43.55  ? 8    DT  T OP1   1 
ATOM   141  O  OP2   . DT  A 1 8   ? -17.253 54.058 20.218  1.00 43.57  ? 8    DT  T OP2   1 
ATOM   142  O  "O5'" . DT  A 1 8   ? -17.093 51.602 20.618  1.00 44.28  ? 8    DT  T "O5'" 1 
ATOM   143  C  "C5'" . DT  A 1 8   ? -16.815 50.262 20.175  1.00 43.88  ? 8    DT  T "C5'" 1 
ATOM   144  C  "C4'" . DT  A 1 8   ? -17.004 49.341 21.344  1.00 44.32  ? 8    DT  T "C4'" 1 
ATOM   145  O  "O4'" . DT  A 1 8   ? -16.074 49.721 22.391  1.00 43.58  ? 8    DT  T "O4'" 1 
ATOM   146  C  "C3'" . DT  A 1 8   ? -18.401 49.496 21.917  1.00 46.18  ? 8    DT  T "C3'" 1 
ATOM   147  O  "O3'" . DT  A 1 8   ? -19.058 48.244 21.900  1.00 49.97  ? 8    DT  T "O3'" 1 
ATOM   148  C  "C2'" . DT  A 1 8   ? -18.224 50.015 23.346  1.00 44.63  ? 8    DT  T "C2'" 1 
ATOM   149  C  "C1'" . DT  A 1 8   ? -16.728 49.908 23.636  1.00 42.38  ? 8    DT  T "C1'" 1 
ATOM   150  N  N1    . DT  A 1 8   ? -16.188 51.131 24.346  1.00 40.75  ? 8    DT  T N1    1 
ATOM   151  C  C2    . DT  A 1 8   ? -15.610 50.965 25.585  1.00 41.14  ? 8    DT  T C2    1 
ATOM   152  O  O2    . DT  A 1 8   ? -15.497 49.871 26.117  1.00 42.27  ? 8    DT  T O2    1 
ATOM   153  N  N3    . DT  A 1 8   ? -15.151 52.110 26.190  1.00 40.54  ? 8    DT  T N3    1 
ATOM   154  C  C4    . DT  A 1 8   ? -15.201 53.387 25.676  1.00 41.71  ? 8    DT  T C4    1 
ATOM   155  O  O4    . DT  A 1 8   ? -14.747 54.340 26.296  1.00 41.32  ? 8    DT  T O4    1 
ATOM   156  C  C5    . DT  A 1 8   ? -15.833 53.507 24.372  1.00 41.46  ? 8    DT  T C5    1 
ATOM   157  C  C7    . DT  A 1 8   ? -15.964 54.844 23.716  1.00 39.53  ? 8    DT  T C7    1 
ATOM   158  C  C6    . DT  A 1 8   ? -16.286 52.388 23.777  1.00 40.57  ? 8    DT  T C6    1 
ATOM   159  P  P     . DG  A 1 9   ? -20.590 48.208 22.356  1.00 54.28  ? 9    DG  T P     1 
ATOM   160  O  OP1   . DG  A 1 9   ? -21.140 46.884 21.968  1.00 54.37  ? 9    DG  T OP1   1 
ATOM   161  O  OP2   . DG  A 1 9   ? -21.211 49.468 21.831  1.00 52.95  ? 9    DG  T OP2   1 
ATOM   162  O  "O5'" . DG  A 1 9   ? -20.515 48.211 23.963  1.00 50.01  ? 9    DG  T "O5'" 1 
ATOM   163  C  "C5'" . DG  A 1 9   ? -20.082 47.008 24.602  1.00 46.15  ? 9    DG  T "C5'" 1 
ATOM   164  C  "C4'" . DG  A 1 9   ? -20.245 47.050 26.105  1.00 43.45  ? 9    DG  T "C4'" 1 
ATOM   165  O  "O4'" . DG  A 1 9   ? -19.379 48.041 26.729  1.00 41.04  ? 9    DG  T "O4'" 1 
ATOM   166  C  "C3'" . DG  A 1 9   ? -21.657 47.390 26.549  1.00 44.26  ? 9    DG  T "C3'" 1 
ATOM   167  O  "O3'" . DG  A 1 9   ? -21.836 46.570 27.679  1.00 47.10  ? 9    DG  T "O3'" 1 
ATOM   168  C  "C2'" . DG  A 1 9   ? -21.566 48.881 26.898  1.00 42.76  ? 9    DG  T "C2'" 1 
ATOM   169  C  "C1'" . DG  A 1 9   ? -20.134 49.016 27.424  1.00 40.05  ? 9    DG  T "C1'" 1 
ATOM   170  N  N9    . DG  A 1 9   ? -19.529 50.345 27.283  1.00 38.89  ? 9    DG  T N9    1 
ATOM   171  C  C8    . DG  A 1 9   ? -19.658 51.234 26.237  1.00 40.14  ? 9    DG  T C8    1 
ATOM   172  N  N7    . DG  A 1 9   ? -19.006 52.357 26.373  1.00 39.17  ? 9    DG  T N7    1 
ATOM   173  C  C5    . DG  A 1 9   ? -18.399 52.210 27.621  1.00 40.19  ? 9    DG  T C5    1 
ATOM   174  C  C6    . DG  A 1 9   ? -17.550 53.097 28.362  1.00 40.84  ? 9    DG  T C6    1 
ATOM   175  O  O6    . DG  A 1 9   ? -17.145 54.233 28.045  1.00 40.42  ? 9    DG  T O6    1 
ATOM   176  N  N1    . DG  A 1 9   ? -17.159 52.568 29.595  1.00 39.70  ? 9    DG  T N1    1 
ATOM   177  C  C2    . DG  A 1 9   ? -17.538 51.336 30.055  1.00 39.26  ? 9    DG  T C2    1 
ATOM   178  N  N2    . DG  A 1 9   ? -17.090 50.969 31.256  1.00 38.74  ? 9    DG  T N2    1 
ATOM   179  N  N3    . DG  A 1 9   ? -18.321 50.511 29.379  1.00 39.97  ? 9    DG  T N3    1 
ATOM   180  C  C4    . DG  A 1 9   ? -18.722 50.993 28.181  1.00 38.80  ? 9    DG  T C4    1 
ATOM   181  P  P     . DA  A 1 10  ? -23.208 46.268 28.437  1.00 47.69  ? 10   DA  T P     1 
ATOM   182  O  OP1   . DA  A 1 10  ? -23.464 44.805 28.357  1.00 48.22  ? 10   DA  T OP1   1 
ATOM   183  O  OP2   . DA  A 1 10  ? -24.232 47.238 27.987  1.00 48.24  ? 10   DA  T OP2   1 
ATOM   184  O  "O5'" . DA  A 1 10  ? -22.760 46.664 29.913  1.00 45.38  ? 10   DA  T "O5'" 1 
ATOM   185  C  "C5'" . DA  A 1 10  ? -21.944 45.843 30.676  1.00 44.04  ? 10   DA  T "C5'" 1 
ATOM   186  C  "C4'" . DA  A 1 10  ? -21.839 46.462 32.053  1.00 45.51  ? 10   DA  T "C4'" 1 
ATOM   187  O  "O4'" . DA  A 1 10  ? -21.139 47.733 31.966  1.00 46.32  ? 10   DA  T "O4'" 1 
ATOM   188  C  "C3'" . DA  A 1 10  ? -23.159 46.794 32.725  1.00 46.22  ? 10   DA  T "C3'" 1 
ATOM   189  O  "O3'" . DA  A 1 10  ? -22.989 46.723 34.122  1.00 47.63  ? 10   DA  T "O3'" 1 
ATOM   190  C  "C2'" . DA  A 1 10  ? -23.402 48.243 32.313  1.00 46.07  ? 10   DA  T "C2'" 1 
ATOM   191  C  "C1'" . DA  A 1 10  ? -21.982 48.792 32.361  1.00 45.64  ? 10   DA  T "C1'" 1 
ATOM   192  N  N9    . DA  A 1 10  ? -21.756 49.921 31.468  1.00 45.33  ? 10   DA  T N9    1 
ATOM   193  C  C8    . DA  A 1 10  ? -22.146 50.054 30.164  1.00 44.67  ? 10   DA  T C8    1 
ATOM   194  N  N7    . DA  A 1 10  ? -21.794 51.208 29.644  1.00 44.86  ? 10   DA  T N7    1 
ATOM   195  C  C5    . DA  A 1 10  ? -21.131 51.867 30.670  1.00 44.69  ? 10   DA  T C5    1 
ATOM   196  C  C6    . DA  A 1 10  ? -20.503 53.130 30.774  1.00 45.07  ? 10   DA  T C6    1 
ATOM   197  N  N6    . DA  A 1 10  ? -20.433 54.010 29.770  1.00 45.42  ? 10   DA  T N6    1 
ATOM   198  N  N1    . DA  A 1 10  ? -19.936 53.473 31.959  1.00 45.75  ? 10   DA  T N1    1 
ATOM   199  C  C2    . DA  A 1 10  ? -19.986 52.608 32.985  1.00 45.76  ? 10   DA  T C2    1 
ATOM   200  N  N3    . DA  A 1 10  ? -20.554 51.398 33.001  1.00 46.08  ? 10   DA  T N3    1 
ATOM   201  C  C4    . DA  A 1 10  ? -21.107 51.085 31.807  1.00 45.19  ? 10   DA  T C4    1 
ATOM   202  P  P     . DC  A 1 11  ? -24.273 46.590 35.055  1.00 48.09  ? 11   DC  T P     1 
ATOM   203  O  OP1   . DC  A 1 11  ? -24.036 45.497 36.003  1.00 48.59  ? 11   DC  T OP1   1 
ATOM   204  O  OP2   . DC  A 1 11  ? -25.453 46.583 34.151  1.00 47.01  ? 11   DC  T OP2   1 
ATOM   205  O  "O5'" . DC  A 1 11  ? -24.177 47.893 35.956  1.00 47.70  ? 11   DC  T "O5'" 1 
ATOM   206  C  "C5'" . DC  A 1 11  ? -24.301 49.084 35.274  1.00 48.70  ? 11   DC  T "C5'" 1 
ATOM   207  C  "C4'" . DC  A 1 11  ? -23.790 50.228 36.097  1.00 49.04  ? 11   DC  T "C4'" 1 
ATOM   208  O  "O4'" . DC  A 1 11  ? -23.138 51.071 35.130  1.00 49.66  ? 11   DC  T "O4'" 1 
ATOM   209  C  "C3'" . DC  A 1 11  ? -24.937 51.024 36.701  1.00 49.59  ? 11   DC  T "C3'" 1 
ATOM   210  O  "O3'" . DC  A 1 11  ? -24.625 51.462 38.022  1.00 50.20  ? 11   DC  T "O3'" 1 
ATOM   211  C  "C2'" . DC  A 1 11  ? -25.166 52.162 35.698  1.00 49.27  ? 11   DC  T "C2'" 1 
ATOM   212  C  "C1'" . DC  A 1 11  ? -23.799 52.316 35.039  1.00 49.36  ? 11   DC  T "C1'" 1 
ATOM   213  N  N1    . DC  A 1 11  ? -23.852 52.724 33.602  1.00 49.07  ? 11   DC  T N1    1 
ATOM   214  C  C2    . DC  A 1 11  ? -23.292 53.962 33.214  1.00 49.14  ? 11   DC  T C2    1 
ATOM   215  O  O2    . DC  A 1 11  ? -22.752 54.695 34.057  1.00 49.62  ? 11   DC  T O2    1 
ATOM   216  N  N3    . DC  A 1 11  ? -23.345 54.339 31.914  1.00 47.50  ? 11   DC  T N3    1 
ATOM   217  C  C4    . DC  A 1 11  ? -23.917 53.536 31.033  1.00 47.33  ? 11   DC  T C4    1 
ATOM   218  N  N4    . DC  A 1 11  ? -23.925 53.956 29.778  1.00 48.52  ? 11   DC  T N4    1 
ATOM   219  C  C5    . DC  A 1 11  ? -24.488 52.279 31.391  1.00 48.00  ? 11   DC  T C5    1 
ATOM   220  C  C6    . DC  A 1 11  ? -24.438 51.906 32.678  1.00 48.15  ? 11   DC  T C6    1 
ATOM   221  P  P     . DA  A 1 12  ? -25.741 52.216 38.905  1.00 50.25  ? 12   DA  T P     1 
ATOM   222  O  OP1   . DA  A 1 12  ? -25.508 51.996 40.345  1.00 49.95  ? 12   DA  T OP1   1 
ATOM   223  O  OP2   . DA  A 1 12  ? -27.027 51.859 38.283  1.00 50.26  ? 12   DA  T OP2   1 
ATOM   224  O  "O5'" . DA  A 1 12  ? -25.490 53.759 38.621  1.00 50.35  ? 12   DA  T "O5'" 1 
ATOM   225  C  "C5'" . DA  A 1 12  ? -24.384 54.386 39.221  1.00 51.61  ? 12   DA  T "C5'" 1 
ATOM   226  C  "C4'" . DA  A 1 12  ? -24.538 55.897 39.128  1.00 52.50  ? 12   DA  T "C4'" 1 
ATOM   227  O  "O4'" . DA  A 1 12  ? -24.359 56.365 37.766  1.00 51.31  ? 12   DA  T "O4'" 1 
ATOM   228  C  "C3'" . DA  A 1 12  ? -25.886 56.435 39.594  1.00 52.75  ? 12   DA  T "C3'" 1 
ATOM   229  O  "O3'" . DA  A 1 12  ? -25.600 57.620 40.303  1.00 53.47  ? 12   DA  T "O3'" 1 
ATOM   230  C  "C2'" . DA  A 1 12  ? -26.670 56.658 38.302  1.00 50.88  ? 12   DA  T "C2'" 1 
ATOM   231  C  "C1'" . DA  A 1 12  ? -25.555 56.962 37.309  1.00 50.64  ? 12   DA  T "C1'" 1 
ATOM   232  N  N9    . DA  A 1 12  ? -25.786 56.511 35.938  1.00 50.23  ? 12   DA  T N9    1 
ATOM   233  C  C8    . DA  A 1 12  ? -26.273 55.307 35.513  1.00 49.49  ? 12   DA  T C8    1 
ATOM   234  N  N7    . DA  A 1 12  ? -26.349 55.220 34.200  1.00 48.94  ? 12   DA  T N7    1 
ATOM   235  C  C5    . DA  A 1 12  ? -25.885 56.439 33.739  1.00 47.45  ? 12   DA  T C5    1 
ATOM   236  C  C6    . DA  A 1 12  ? -25.718 56.978 32.446  1.00 48.71  ? 12   DA  T C6    1 
ATOM   237  N  N6    . DA  A 1 12  ? -26.023 56.319 31.321  1.00 48.77  ? 12   DA  T N6    1 
ATOM   238  N  N1    . DA  A 1 12  ? -25.225 58.244 32.345  1.00 49.92  ? 12   DA  T N1    1 
ATOM   239  C  C2    . DA  A 1 12  ? -24.921 58.920 33.473  1.00 49.67  ? 12   DA  T C2    1 
ATOM   240  N  N3    . DA  A 1 12  ? -25.035 58.498 34.739  1.00 48.38  ? 12   DA  T N3    1 
ATOM   241  C  C4    . DA  A 1 12  ? -25.529 57.247 34.799  1.00 48.14  ? 12   DA  T C4    1 
ATOM   242  P  P     . DG  A 1 13  ? -26.714 58.436 41.102  1.00 54.41  ? 13   DG  T P     1 
ATOM   243  O  OP1   . DG  A 1 13  ? -26.049 59.065 42.276  1.00 53.16  ? 13   DG  T OP1   1 
ATOM   244  O  OP2   . DG  A 1 13  ? -27.942 57.615 41.275  1.00 53.08  ? 13   DG  T OP2   1 
ATOM   245  O  "O5'" . DG  A 1 13  ? -27.009 59.544 39.997  1.00 54.81  ? 13   DG  T "O5'" 1 
ATOM   246  C  "C5'" . DG  A 1 13  ? -26.064 60.562 39.687  1.00 56.12  ? 13   DG  T "C5'" 1 
ATOM   247  C  "C4'" . DG  A 1 13  ? -26.691 61.446 38.624  1.00 57.38  ? 13   DG  T "C4'" 1 
ATOM   248  O  "O4'" . DG  A 1 13  ? -26.770 60.721 37.366  1.00 56.37  ? 13   DG  T "O4'" 1 
ATOM   249  C  "C3'" . DG  A 1 13  ? -28.134 61.883 38.888  1.00 59.04  ? 13   DG  T "C3'" 1 
ATOM   250  O  "O3'" . DG  A 1 13  ? -28.362 63.080 38.145  1.00 63.67  ? 13   DG  T "O3'" 1 
ATOM   251  C  "C2'" . DG  A 1 13  ? -28.934 60.749 38.259  1.00 56.61  ? 13   DG  T "C2'" 1 
ATOM   252  C  "C1'" . DG  A 1 13  ? -28.131 60.738 36.965  1.00 53.08  ? 13   DG  T "C1'" 1 
ATOM   253  N  N9    . DG  A 1 13  ? -28.429 59.672 36.033  1.00 51.02  ? 13   DG  T N9    1 
ATOM   254  C  C8    . DG  A 1 13  ? -28.880 58.401 36.303  1.00 50.49  ? 13   DG  T C8    1 
ATOM   255  N  N7    . DG  A 1 13  ? -29.058 57.681 35.224  1.00 49.54  ? 13   DG  T N7    1 
ATOM   256  C  C5    . DG  A 1 13  ? -28.713 58.547 34.190  1.00 49.24  ? 13   DG  T C5    1 
ATOM   257  C  C6    . DG  A 1 13  ? -28.713 58.330 32.799  1.00 49.52  ? 13   DG  T C6    1 
ATOM   258  O  O6    . DG  A 1 13  ? -29.020 57.292 32.202  1.00 50.49  ? 13   DG  T O6    1 
ATOM   259  N  N1    . DG  A 1 13  ? -28.291 59.450 32.087  1.00 49.52  ? 13   DG  T N1    1 
ATOM   260  C  C2    . DG  A 1 13  ? -27.921 60.641 32.662  1.00 49.83  ? 13   DG  T C2    1 
ATOM   261  N  N2    . DG  A 1 13  ? -27.558 61.587 31.793  1.00 50.04  ? 13   DG  T N2    1 
ATOM   262  N  N3    . DG  A 1 13  ? -27.912 60.876 33.974  1.00 48.90  ? 13   DG  T N3    1 
ATOM   263  C  C4    . DG  A 1 13  ? -28.320 59.780 34.668  1.00 49.54  ? 13   DG  T C4    1 
ATOM   264  P  P     . DC  A 1 14  ? -28.914 64.397 38.861  1.00 67.24  ? 14   DC  T P     1 
ATOM   265  O  OP1   . DC  A 1 14  ? -27.809 64.936 39.697  1.00 66.37  ? 14   DC  T OP1   1 
ATOM   266  O  OP2   . DC  A 1 14  ? -30.185 63.989 39.525  1.00 66.36  ? 14   DC  T OP2   1 
ATOM   267  O  "O5'" . DC  A 1 14  ? -29.189 65.398 37.620  1.00 65.69  ? 14   DC  T "O5'" 1 
ATOM   268  C  "C5'" . DC  A 1 14  ? -28.408 65.323 36.416  1.00 66.01  ? 14   DC  T "C5'" 1 
ATOM   269  C  "C4'" . DC  A 1 14  ? -29.243 65.438 35.140  1.00 67.21  ? 14   DC  T "C4'" 1 
ATOM   270  O  "O4'" . DC  A 1 14  ? -29.332 64.162 34.434  1.00 65.73  ? 14   DC  T "O4'" 1 
ATOM   271  C  "C3'" . DC  A 1 14  ? -30.682 65.905 35.353  1.00 68.83  ? 14   DC  T "C3'" 1 
ATOM   272  O  "O3'" . DC  A 1 14  ? -30.963 67.058 34.560  1.00 72.18  ? 14   DC  T "O3'" 1 
ATOM   273  C  "C2'" . DC  A 1 14  ? -31.536 64.709 34.932  1.00 66.61  ? 14   DC  T "C2'" 1 
ATOM   274  C  "C1'" . DC  A 1 14  ? -30.643 63.993 33.931  1.00 63.60  ? 14   DC  T "C1'" 1 
ATOM   275  N  N1    . DC  A 1 14  ? -31.002 62.521 33.785  1.00 62.38  ? 14   DC  T N1    1 
ATOM   276  C  C2    . DC  A 1 14  ? -31.094 61.926 32.505  1.00 61.23  ? 14   DC  T C2    1 
ATOM   277  O  O2    . DC  A 1 14  ? -30.877 62.582 31.481  1.00 60.86  ? 14   DC  T O2    1 
ATOM   278  N  N3    . DC  A 1 14  ? -31.424 60.615 32.405  1.00 60.04  ? 14   DC  T N3    1 
ATOM   279  C  C4    . DC  A 1 14  ? -31.663 59.901 33.502  1.00 59.79  ? 14   DC  T C4    1 
ATOM   280  N  N4    . DC  A 1 14  ? -31.974 58.618 33.320  1.00 59.43  ? 14   DC  T N4    1 
ATOM   281  C  C5    . DC  A 1 14  ? -31.589 60.471 34.813  1.00 59.75  ? 14   DC  T C5    1 
ATOM   282  C  C6    . DC  A 1 14  ? -31.259 61.767 34.908  1.00 60.77  ? 14   DC  T C6    1 
ATOM   283  P  P     . DC  A 1 15  ? -32.330 67.906 34.734  1.00 75.05  ? 15   DC  T P     1 
ATOM   284  O  OP1   . DC  A 1 15  ? -31.916 69.284 35.113  1.00 74.45  ? 15   DC  T OP1   1 
ATOM   285  O  OP2   . DC  A 1 15  ? -33.289 67.157 35.596  1.00 74.15  ? 15   DC  T OP2   1 
ATOM   286  O  "O5'" . DC  A 1 15  ? -32.947 67.941 33.257  1.00 72.88  ? 15   DC  T "O5'" 1 
ATOM   287  C  "C5'" . DC  A 1 15  ? -32.215 67.494 32.125  1.00 73.05  ? 15   DC  T "C5'" 1 
ATOM   288  C  "C4'" . DC  A 1 15  ? -33.191 66.985 31.087  1.00 73.18  ? 15   DC  T "C4'" 1 
ATOM   289  O  "O4'" . DC  A 1 15  ? -33.137 65.534 31.001  1.00 73.19  ? 15   DC  T "O4'" 1 
ATOM   290  C  "C3'" . DC  A 1 15  ? -34.640 67.331 31.411  1.00 73.67  ? 15   DC  T "C3'" 1 
ATOM   291  O  "O3'" . DC  A 1 15  ? -35.327 67.686 30.227  1.00 74.66  ? 15   DC  T "O3'" 1 
ATOM   292  C  "C2'" . DC  A 1 15  ? -35.193 66.031 31.971  1.00 73.25  ? 15   DC  T "C2'" 1 
ATOM   293  C  "C1'" . DC  A 1 15  ? -34.461 65.033 31.082  1.00 71.67  ? 15   DC  T "C1'" 1 
ATOM   294  N  N1    . DC  A 1 15  ? -34.540 63.617 31.599  1.00 70.32  ? 15   DC  T N1    1 
ATOM   295  C  C2    . DC  A 1 15  ? -34.752 62.568 30.692  1.00 69.76  ? 15   DC  T C2    1 
ATOM   296  O  O2    . DC  A 1 15  ? -34.858 62.821 29.483  1.00 69.23  ? 15   DC  T O2    1 
ATOM   297  N  N3    . DC  A 1 15  ? -34.839 61.294 31.171  1.00 69.80  ? 15   DC  T N3    1 
ATOM   298  C  C4    . DC  A 1 15  ? -34.733 61.061 32.488  1.00 69.99  ? 15   DC  T C4    1 
ATOM   299  N  N4    . DC  A 1 15  ? -34.830 59.795 32.910  1.00 70.09  ? 15   DC  T N4    1 
ATOM   300  C  C5    . DC  A 1 15  ? -34.520 62.115 33.428  1.00 69.20  ? 15   DC  T C5    1 
ATOM   301  C  C6    . DC  A 1 15  ? -34.436 63.360 32.944  1.00 69.51  ? 15   DC  T C6    1 
ATOM   302  P  P     . DG  A 1 16  ? -36.628 68.624 30.270  1.00 74.64  ? 16   DG  T P     1 
ATOM   303  O  OP1   . DG  A 1 16  ? -36.209 69.967 29.771  1.00 74.06  ? 16   DG  T OP1   1 
ATOM   304  O  OP2   . DG  A 1 16  ? -37.310 68.451 31.584  1.00 73.85  ? 16   DG  T OP2   1 
ATOM   305  O  "O5'" . DG  A 1 16  ? -37.551 67.924 29.165  1.00 72.06  ? 16   DG  T "O5'" 1 
ATOM   306  C  "C5'" . DG  A 1 16  ? -37.098 67.644 27.825  1.00 68.20  ? 16   DG  T "C5'" 1 
ATOM   307  C  "C4'" . DG  A 1 16  ? -37.855 66.430 27.301  1.00 65.59  ? 16   DG  T "C4'" 1 
ATOM   308  O  "O4'" . DG  A 1 16  ? -37.519 65.268 28.118  1.00 62.92  ? 16   DG  T "O4'" 1 
ATOM   309  C  "C3'" . DG  A 1 16  ? -39.380 66.563 27.355  1.00 65.39  ? 16   DG  T "C3'" 1 
ATOM   310  O  "O3'" . DG  A 1 16  ? -39.966 66.121 26.138  1.00 68.10  ? 16   DG  T "O3'" 1 
ATOM   311  C  "C2'" . DG  A 1 16  ? -39.797 65.678 28.528  1.00 62.54  ? 16   DG  T "C2'" 1 
ATOM   312  C  "C1'" . DG  A 1 16  ? -38.694 64.621 28.544  1.00 57.58  ? 16   DG  T "C1'" 1 
ATOM   313  N  N9    . DG  A 1 16  ? -38.538 64.016 29.863  1.00 55.06  ? 16   DG  T N9    1 
ATOM   314  C  C8    . DG  A 1 16  ? -38.415 64.648 31.082  1.00 54.46  ? 16   DG  T C8    1 
ATOM   315  N  N7    . DG  A 1 16  ? -38.316 63.821 32.095  1.00 53.57  ? 16   DG  T N7    1 
ATOM   316  C  C5    . DG  A 1 16  ? -38.389 62.564 31.507  1.00 52.95  ? 16   DG  T C5    1 
ATOM   317  C  C6    . DG  A 1 16  ? -38.344 61.273 32.092  1.00 53.23  ? 16   DG  T C6    1 
ATOM   318  O  O6    . DG  A 1 16  ? -38.224 60.978 33.289  1.00 53.23  ? 16   DG  T O6    1 
ATOM   319  N  N1    . DG  A 1 16  ? -38.446 60.258 31.135  1.00 53.33  ? 16   DG  T N1    1 
ATOM   320  C  C2    . DG  A 1 16  ? -38.584 60.487 29.783  1.00 52.77  ? 16   DG  T C2    1 
ATOM   321  N  N2    . DG  A 1 16  ? -38.672 59.406 29.006  1.00 53.18  ? 16   DG  T N2    1 
ATOM   322  N  N3    . DG  A 1 16  ? -38.631 61.687 29.222  1.00 51.93  ? 16   DG  T N3    1 
ATOM   323  C  C4    . DG  A 1 16  ? -38.528 62.673 30.137  1.00 52.94  ? 16   DG  T C4    1 
ATOM   324  P  P     . DC  A 1 17  ? -41.486 66.466 25.757  1.00 70.55  ? 17   DC  T P     1 
ATOM   325  O  OP1   . DC  A 1 17  ? -41.581 66.444 24.274  1.00 69.82  ? 17   DC  T OP1   1 
ATOM   326  O  OP2   . DC  A 1 17  ? -41.907 67.681 26.509  1.00 69.44  ? 17   DC  T OP2   1 
ATOM   327  O  "O5'" . DC  A 1 17  ? -42.259 65.194 26.348  1.00 69.19  ? 17   DC  T "O5'" 1 
ATOM   328  C  "C5'" . DC  A 1 17  ? -42.332 63.974 25.623  1.00 68.84  ? 17   DC  T "C5'" 1 
ATOM   329  C  "C4'" . DC  A 1 17  ? -42.931 62.939 26.548  1.00 69.19  ? 17   DC  T "C4'" 1 
ATOM   330  O  "O4'" . DC  A 1 17  ? -42.138 62.890 27.759  1.00 68.84  ? 17   DC  T "O4'" 1 
ATOM   331  C  "C3'" . DC  A 1 17  ? -44.351 63.269 27.015  1.00 69.38  ? 17   DC  T "C3'" 1 
ATOM   332  O  "O3'" . DC  A 1 17  ? -45.235 62.206 26.742  1.00 69.57  ? 17   DC  T "O3'" 1 
ATOM   333  C  "C2'" . DC  A 1 17  ? -44.241 63.458 28.522  1.00 69.29  ? 17   DC  T "C2'" 1 
ATOM   334  C  "C1'" . DC  A 1 17  ? -43.040 62.561 28.780  1.00 68.52  ? 17   DC  T "C1'" 1 
ATOM   335  N  N1    . DC  A 1 17  ? -42.449 62.733 30.114  1.00 67.74  ? 17   DC  T N1    1 
ATOM   336  C  C2    . DC  A 1 17  ? -42.075 61.580 30.835  1.00 67.51  ? 17   DC  T C2    1 
ATOM   337  O  O2    . DC  A 1 17  ? -42.208 60.448 30.339  1.00 66.85  ? 17   DC  T O2    1 
ATOM   338  N  N3    . DC  A 1 17  ? -41.554 61.740 32.079  1.00 67.64  ? 17   DC  T N3    1 
ATOM   339  C  C4    . DC  A 1 17  ? -41.418 62.968 32.594  1.00 68.12  ? 17   DC  T C4    1 
ATOM   340  N  N4    . DC  A 1 17  ? -40.892 63.046 33.820  1.00 68.35  ? 17   DC  T N4    1 
ATOM   341  C  C5    . DC  A 1 17  ? -41.797 64.154 31.874  1.00 67.72  ? 17   DC  T C5    1 
ATOM   342  C  C6    . DC  A 1 17  ? -42.309 63.989 30.644  1.00 67.66  ? 17   DC  T C6    1 
ATOM   343  P  P     . DG  A 1 18  ? -46.592 62.574 25.979  1.00 70.95  ? 18   DG  T P     1 
ATOM   344  O  OP1   . DG  A 1 18  ? -47.446 61.350 25.884  1.00 71.53  ? 18   DG  T OP1   1 
ATOM   345  O  OP2   . DG  A 1 18  ? -46.237 63.325 24.740  1.00 69.59  ? 18   DG  T OP2   1 
ATOM   346  O  "O5'" . DG  A 1 18  ? -47.238 63.595 27.031  1.00 68.56  ? 18   DG  T "O5'" 1 
ATOM   347  C  "C5'" . DG  A 1 18  ? -48.625 63.634 27.301  1.00 63.95  ? 18   DG  T "C5'" 1 
ATOM   348  C  "C4'" . DG  A 1 18  ? -48.841 63.517 28.799  1.00 61.09  ? 18   DG  T "C4'" 1 
ATOM   349  O  "O4'" . DG  A 1 18  ? -50.054 64.222 29.156  1.00 60.10  ? 18   DG  T "O4'" 1 
ATOM   350  C  "C3'" . DG  A 1 18  ? -49.073 62.099 29.309  1.00 60.07  ? 18   DG  T "C3'" 1 
ATOM   351  O  "O3'" . DG  A 1 18  ? -48.759 62.032 30.693  1.00 59.34  ? 18   DG  T "O3'" 1 
ATOM   352  C  "C2'" . DG  A 1 18  ? -50.571 61.906 29.066  1.00 58.09  ? 18   DG  T "C2'" 1 
ATOM   353  C  "C1'" . DG  A 1 18  ? -51.093 63.294 29.446  1.00 56.20  ? 18   DG  T "C1'" 1 
ATOM   354  N  N9    . DG  A 1 18  ? -52.334 63.724 28.792  1.00 54.70  ? 18   DG  T N9    1 
ATOM   355  C  C8    . DG  A 1 18  ? -53.444 64.128 29.491  1.00 54.02  ? 18   DG  T C8    1 
ATOM   356  N  N7    . DG  A 1 18  ? -54.439 64.471 28.737  1.00 53.66  ? 18   DG  T N7    1 
ATOM   357  C  C5    . DG  A 1 18  ? -53.975 64.278 27.451  1.00 53.30  ? 18   DG  T C5    1 
ATOM   358  C  C6    . DG  A 1 18  ? -54.653 64.497 26.231  1.00 53.98  ? 18   DG  T C6    1 
ATOM   359  O  O6    . DG  A 1 18  ? -55.803 64.913 26.073  1.00 54.01  ? 18   DG  T O6    1 
ATOM   360  N  N1    . DG  A 1 18  ? -53.864 64.203 25.125  1.00 54.03  ? 18   DG  T N1    1 
ATOM   361  C  C2    . DG  A 1 18  ? -52.569 63.752 25.210  1.00 53.35  ? 18   DG  T C2    1 
ATOM   362  N  N2    . DG  A 1 18  ? -51.982 63.532 24.023  1.00 53.79  ? 18   DG  T N2    1 
ATOM   363  N  N3    . DG  A 1 18  ? -51.921 63.533 26.356  1.00 52.39  ? 18   DG  T N3    1 
ATOM   364  C  C4    . DG  A 1 18  ? -52.677 63.823 27.447  1.00 53.05  ? 18   DG  T C4    1 
ATOM   365  O  "O5'" . DG  B 2 1   ? -42.634 52.891 39.425  1.00 93.87  ? 101  DG  P "O5'" 1 
ATOM   366  C  "C5'" . DG  B 2 1   ? -43.091 53.700 38.351  1.00 95.51  ? 101  DG  P "C5'" 1 
ATOM   367  C  "C4'" . DG  B 2 1   ? -42.654 53.186 36.976  1.00 96.73  ? 101  DG  P "C4'" 1 
ATOM   368  O  "O4'" . DG  B 2 1   ? -42.666 54.278 36.012  1.00 96.60  ? 101  DG  P "O4'" 1 
ATOM   369  C  "C3'" . DG  B 2 1   ? -41.247 52.617 36.812  1.00 97.79  ? 101  DG  P "C3'" 1 
ATOM   370  O  "O3'" . DG  B 2 1   ? -41.207 51.825 35.609  1.00 100.05 ? 101  DG  P "O3'" 1 
ATOM   371  C  "C2'" . DG  B 2 1   ? -40.419 53.889 36.649  1.00 97.06  ? 101  DG  P "C2'" 1 
ATOM   372  C  "C1'" . DG  B 2 1   ? -41.334 54.699 35.726  1.00 95.24  ? 101  DG  P "C1'" 1 
ATOM   373  N  N9    . DG  B 2 1   ? -41.244 56.159 35.864  1.00 94.45  ? 101  DG  P N9    1 
ATOM   374  C  C8    . DG  B 2 1   ? -41.094 56.896 37.023  1.00 93.82  ? 101  DG  P C8    1 
ATOM   375  N  N7    . DG  B 2 1   ? -41.055 58.185 36.822  1.00 93.44  ? 101  DG  P N7    1 
ATOM   376  C  C5    . DG  B 2 1   ? -41.186 58.317 35.440  1.00 93.54  ? 101  DG  P C5    1 
ATOM   377  C  C6    . DG  B 2 1   ? -41.213 59.480 34.621  1.00 93.48  ? 101  DG  P C6    1 
ATOM   378  O  O6    . DG  B 2 1   ? -41.125 60.666 34.975  1.00 93.29  ? 101  DG  P O6    1 
ATOM   379  N  N1    . DG  B 2 1   ? -41.363 59.172 33.265  1.00 93.16  ? 101  DG  P N1    1 
ATOM   380  C  C2    . DG  B 2 1   ? -41.477 57.897 32.759  1.00 93.11  ? 101  DG  P C2    1 
ATOM   381  N  N2    . DG  B 2 1   ? -41.617 57.794 31.431  1.00 92.83  ? 101  DG  P N2    1 
ATOM   382  N  N3    . DG  B 2 1   ? -41.453 56.798 33.510  1.00 93.37  ? 101  DG  P N3    1 
ATOM   383  C  C4    . DG  B 2 1   ? -41.307 57.079 34.836  1.00 93.83  ? 101  DG  P C4    1 
ATOM   384  P  P     . DC  B 2 2   ? -39.962 50.889 35.190  1.00 101.38 ? 102  DC  P P     1 
ATOM   385  O  OP1   . DC  B 2 2   ? -40.513 49.837 34.293  1.00 101.52 ? 102  DC  P OP1   1 
ATOM   386  O  OP2   . DC  B 2 2   ? -39.226 50.506 36.423  1.00 100.82 ? 102  DC  P OP2   1 
ATOM   387  O  "O5'" . DC  B 2 2   ? -39.015 51.853 34.321  1.00 99.81  ? 102  DC  P "O5'" 1 
ATOM   388  C  "C5'" . DC  B 2 2   ? -38.102 51.314 33.354  1.00 97.42  ? 102  DC  P "C5'" 1 
ATOM   389  C  "C4'" . DC  B 2 2   ? -38.579 51.616 31.939  1.00 95.68  ? 102  DC  P "C4'" 1 
ATOM   390  O  "O4'" . DC  B 2 2   ? -39.458 52.778 31.917  1.00 95.05  ? 102  DC  P "O4'" 1 
ATOM   391  C  "C3'" . DC  B 2 2   ? -37.473 51.841 30.912  1.00 94.69  ? 102  DC  P "C3'" 1 
ATOM   392  O  "O3'" . DC  B 2 2   ? -37.619 50.874 29.851  1.00 94.23  ? 102  DC  P "O3'" 1 
ATOM   393  C  "C2'" . DC  B 2 2   ? -37.680 53.275 30.421  1.00 94.21  ? 102  DC  P "C2'" 1 
ATOM   394  C  "C1'" . DC  B 2 2   ? -38.913 53.824 31.130  1.00 93.25  ? 102  DC  P "C1'" 1 
ATOM   395  N  N1    . DC  B 2 2   ? -38.634 55.062 31.972  1.00 92.04  ? 102  DC  P N1    1 
ATOM   396  C  C2    . DC  B 2 2   ? -38.556 56.336 31.361  1.00 91.20  ? 102  DC  P C2    1 
ATOM   397  O  O2    . DC  B 2 2   ? -38.713 56.457 30.136  1.00 90.53  ? 102  DC  P O2    1 
ATOM   398  N  N3    . DC  B 2 2   ? -38.306 57.423 32.140  1.00 90.47  ? 102  DC  P N3    1 
ATOM   399  C  C4    . DC  B 2 2   ? -38.138 57.272 33.460  1.00 91.09  ? 102  DC  P C4    1 
ATOM   400  N  N4    . DC  B 2 2   ? -37.897 58.363 34.185  1.00 91.15  ? 102  DC  P N4    1 
ATOM   401  C  C5    . DC  B 2 2   ? -38.209 55.997 34.102  1.00 90.72  ? 102  DC  P C5    1 
ATOM   402  C  C6    . DC  B 2 2   ? -38.455 54.937 33.327  1.00 91.17  ? 102  DC  P C6    1 
ATOM   403  P  P     . DG  B 2 3   ? -36.718 50.839 28.510  1.00 94.35  ? 103  DG  P P     1 
ATOM   404  O  OP1   . DG  B 2 3   ? -36.848 49.490 27.893  1.00 94.33  ? 103  DG  P OP1   1 
ATOM   405  O  OP2   . DG  B 2 3   ? -35.372 51.363 28.848  1.00 94.35  ? 103  DG  P OP2   1 
ATOM   406  O  "O5'" . DG  B 2 3   ? -37.454 51.900 27.554  1.00 92.01  ? 103  DG  P "O5'" 1 
ATOM   407  C  "C5'" . DG  B 2 3   ? -37.355 51.819 26.134  1.00 88.07  ? 103  DG  P "C5'" 1 
ATOM   408  C  "C4'" . DG  B 2 3   ? -36.925 53.152 25.529  1.00 85.60  ? 103  DG  P "C4'" 1 
ATOM   409  O  "O4'" . DG  B 2 3   ? -36.913 54.272 26.475  1.00 83.66  ? 103  DG  P "O4'" 1 
ATOM   410  C  "C3'" . DG  B 2 3   ? -35.536 53.117 24.920  1.00 84.40  ? 103  DG  P "C3'" 1 
ATOM   411  O  "O3'" . DG  B 2 3   ? -35.669 53.748 23.648  1.00 84.83  ? 103  DG  P "O3'" 1 
ATOM   412  C  "C2'" . DG  B 2 3   ? -34.670 53.879 25.937  1.00 82.50  ? 103  DG  P "C2'" 1 
ATOM   413  C  "C1'" . DG  B 2 3   ? -35.645 54.912 26.498  1.00 79.97  ? 103  DG  P "C1'" 1 
ATOM   414  N  N9    . DG  B 2 3   ? -35.422 55.313 27.890  1.00 78.55  ? 103  DG  P N9    1 
ATOM   415  C  C8    . DG  B 2 3   ? -35.216 54.458 28.946  1.00 77.95  ? 103  DG  P C8    1 
ATOM   416  N  N7    . DG  B 2 3   ? -35.059 55.048 30.100  1.00 77.71  ? 103  DG  P N7    1 
ATOM   417  C  C5    . DG  B 2 3   ? -35.170 56.396 29.799  1.00 77.05  ? 103  DG  P C5    1 
ATOM   418  C  C6    . DG  B 2 3   ? -35.085 57.507 30.667  1.00 76.10  ? 103  DG  P C6    1 
ATOM   419  O  O6    . DG  B 2 3   ? -34.894 57.502 31.882  1.00 75.99  ? 103  DG  P O6    1 
ATOM   420  N  N1    . DG  B 2 3   ? -35.247 58.711 29.995  1.00 76.32  ? 103  DG  P N1    1 
ATOM   421  C  C2    . DG  B 2 3   ? -35.464 58.812 28.635  1.00 77.07  ? 103  DG  P C2    1 
ATOM   422  N  N2    . DG  B 2 3   ? -35.593 60.061 28.173  1.00 77.11  ? 103  DG  P N2    1 
ATOM   423  N  N3    . DG  B 2 3   ? -35.548 57.777 27.791  1.00 76.80  ? 103  DG  P N3    1 
ATOM   424  C  C4    . DG  B 2 3   ? -35.394 56.587 28.441  1.00 77.81  ? 103  DG  P C4    1 
ATOM   425  P  P     . DG  B 2 4   ? -34.400 54.311 22.847  1.00 85.29  ? 104  DG  P P     1 
ATOM   426  O  OP1   . DG  B 2 4   ? -34.726 54.228 21.395  1.00 84.49  ? 104  DG  P OP1   1 
ATOM   427  O  OP2   . DG  B 2 4   ? -33.206 53.606 23.396  1.00 85.71  ? 104  DG  P OP2   1 
ATOM   428  O  "O5'" . DG  B 2 4   ? -34.293 55.856 23.298  1.00 81.28  ? 104  DG  P "O5'" 1 
ATOM   429  C  "C5'" . DG  B 2 4   ? -34.133 56.884 22.321  1.00 75.68  ? 104  DG  P "C5'" 1 
ATOM   430  C  "C4'" . DG  B 2 4   ? -33.298 58.055 22.814  1.00 71.24  ? 104  DG  P "C4'" 1 
ATOM   431  O  "O4'" . DG  B 2 4   ? -33.347 58.243 24.256  1.00 67.54  ? 104  DG  P "O4'" 1 
ATOM   432  C  "C3'" . DG  B 2 4   ? -31.824 57.967 22.469  1.00 70.80  ? 104  DG  P "C3'" 1 
ATOM   433  O  "O3'" . DG  B 2 4   ? -31.528 59.223 21.905  1.00 74.31  ? 104  DG  P "O3'" 1 
ATOM   434  C  "C2'" . DG  B 2 4   ? -31.134 57.736 23.816  1.00 66.85  ? 104  DG  P "C2'" 1 
ATOM   435  C  "C1'" . DG  B 2 4   ? -32.049 58.512 24.755  1.00 61.14  ? 104  DG  P "C1'" 1 
ATOM   436  N  N9    . DG  B 2 4   ? -32.018 58.103 26.159  1.00 58.19  ? 104  DG  P N9    1 
ATOM   437  C  C8    . DG  B 2 4   ? -32.164 56.815 26.617  1.00 56.79  ? 104  DG  P C8    1 
ATOM   438  N  N7    . DG  B 2 4   ? -32.115 56.715 27.915  1.00 55.84  ? 104  DG  P N7    1 
ATOM   439  C  C5    . DG  B 2 4   ? -31.933 58.017 28.348  1.00 55.21  ? 104  DG  P C5    1 
ATOM   440  C  C6    . DG  B 2 4   ? -31.797 58.509 29.665  1.00 55.71  ? 104  DG  P C6    1 
ATOM   441  O  O6    . DG  B 2 4   ? -31.831 57.853 30.716  1.00 56.23  ? 104  DG  P O6    1 
ATOM   442  N  N1    . DG  B 2 4   ? -31.611 59.888 29.715  1.00 55.09  ? 104  DG  P N1    1 
ATOM   443  C  C2    . DG  B 2 4   ? -31.572 60.690 28.606  1.00 55.34  ? 104  DG  P C2    1 
ATOM   444  N  N2    . DG  B 2 4   ? -31.389 61.997 28.859  1.00 54.66  ? 104  DG  P N2    1 
ATOM   445  N  N3    . DG  B 2 4   ? -31.695 60.234 27.351  1.00 55.35  ? 104  DG  P N3    1 
ATOM   446  C  C4    . DG  B 2 4   ? -31.873 58.890 27.289  1.00 55.70  ? 104  DG  P C4    1 
ATOM   447  P  P     . DC  B 2 5   ? -30.046 59.577 21.436  1.00 77.73  ? 105  DC  P P     1 
ATOM   448  O  OP1   . DC  B 2 5   ? -30.075 60.733 20.488  1.00 78.03  ? 105  DC  P OP1   1 
ATOM   449  O  OP2   . DC  B 2 5   ? -29.432 58.287 21.024  1.00 77.58  ? 105  DC  P OP2   1 
ATOM   450  O  "O5'" . DC  B 2 5   ? -29.405 60.135 22.792  1.00 74.97  ? 105  DC  P "O5'" 1 
ATOM   451  C  "C5'" . DC  B 2 5   ? -29.716 61.485 23.089  1.00 72.41  ? 105  DC  P "C5'" 1 
ATOM   452  C  "C4'" . DC  B 2 5   ? -28.854 62.032 24.206  1.00 69.97  ? 105  DC  P "C4'" 1 
ATOM   453  O  "O4'" . DC  B 2 5   ? -29.225 61.391 25.454  1.00 67.15  ? 105  DC  P "O4'" 1 
ATOM   454  C  "C3'" . DC  B 2 5   ? -27.357 61.822 23.983  1.00 69.11  ? 105  DC  P "C3'" 1 
ATOM   455  O  "O3'" . DC  B 2 5   ? -26.694 63.097 24.077  1.00 70.34  ? 105  DC  P "O3'" 1 
ATOM   456  C  "C2'" . DC  B 2 5   ? -26.973 60.831 25.083  1.00 67.11  ? 105  DC  P "C2'" 1 
ATOM   457  C  "C1'" . DC  B 2 5   ? -28.039 61.083 26.152  1.00 63.56  ? 105  DC  P "C1'" 1 
ATOM   458  N  N1    . DC  B 2 5   ? -28.271 59.917 27.071  1.00 60.06  ? 105  DC  P N1    1 
ATOM   459  C  C2    . DC  B 2 5   ? -28.292 60.139 28.464  1.00 58.28  ? 105  DC  P C2    1 
ATOM   460  O  O2    . DC  B 2 5   ? -28.129 61.279 28.915  1.00 57.73  ? 105  DC  P O2    1 
ATOM   461  N  N3    . DC  B 2 5   ? -28.501 59.087 29.290  1.00 57.20  ? 105  DC  P N3    1 
ATOM   462  C  C4    . DC  B 2 5   ? -28.659 57.868 28.768  1.00 58.12  ? 105  DC  P C4    1 
ATOM   463  N  N4    . DC  B 2 5   ? -28.844 56.866 29.629  1.00 58.38  ? 105  DC  P N4    1 
ATOM   464  C  C5    . DC  B 2 5   ? -28.638 57.615 27.359  1.00 57.10  ? 105  DC  P C5    1 
ATOM   465  C  C6    . DC  B 2 5   ? -28.444 58.661 26.552  1.00 57.62  ? 105  DC  P C6    1 
ATOM   466  P  P     . DT  B 2 6   ? -25.096 63.265 23.958  1.00 71.34  ? 106  DT  P P     1 
ATOM   467  O  OP1   . DT  B 2 6   ? -24.781 64.618 23.418  1.00 69.77  ? 106  DT  P OP1   1 
ATOM   468  O  OP2   . DT  B 2 6   ? -24.582 62.022 23.315  1.00 70.27  ? 106  DT  P OP2   1 
ATOM   469  O  "O5'" . DT  B 2 6   ? -24.665 63.281 25.498  1.00 69.53  ? 106  DT  P "O5'" 1 
ATOM   470  C  "C5'" . DT  B 2 6   ? -25.178 64.298 26.354  1.00 67.87  ? 106  DT  P "C5'" 1 
ATOM   471  C  "C4'" . DT  B 2 6   ? -24.315 64.388 27.597  1.00 66.05  ? 106  DT  P "C4'" 1 
ATOM   472  O  "O4'" . DT  B 2 6   ? -24.684 63.328 28.524  1.00 63.93  ? 106  DT  P "O4'" 1 
ATOM   473  C  "C3'" . DT  B 2 6   ? -22.829 64.220 27.306  1.00 65.93  ? 106  DT  P "C3'" 1 
ATOM   474  O  "O3'" . DT  B 2 6   ? -22.062 65.164 28.085  1.00 67.25  ? 106  DT  P "O3'" 1 
ATOM   475  C  "C2'" . DT  B 2 6   ? -22.558 62.747 27.649  1.00 64.13  ? 106  DT  P "C2'" 1 
ATOM   476  C  "C1'" . DT  B 2 6   ? -23.611 62.430 28.715  1.00 60.87  ? 106  DT  P "C1'" 1 
ATOM   477  N  N1    . DT  B 2 6   ? -24.130 61.008 28.736  1.00 58.76  ? 106  DT  P N1    1 
ATOM   478  C  C2    . DT  B 2 6   ? -24.513 60.496 29.955  1.00 58.19  ? 106  DT  P C2    1 
ATOM   479  O  O2    . DT  B 2 6   ? -24.461 61.129 30.997  1.00 59.13  ? 106  DT  P O2    1 
ATOM   480  N  N3    . DT  B 2 6   ? -24.961 59.207 29.929  1.00 56.48  ? 106  DT  P N3    1 
ATOM   481  C  C4    . DT  B 2 6   ? -25.069 58.381 28.833  1.00 56.90  ? 106  DT  P C4    1 
ATOM   482  O  O4    . DT  B 2 6   ? -25.495 57.235 28.954  1.00 56.24  ? 106  DT  P O4    1 
ATOM   483  C  C5    . DT  B 2 6   ? -24.651 58.964 27.574  1.00 57.17  ? 106  DT  P C5    1 
ATOM   484  C  C7    . DT  B 2 6   ? -24.718 58.165 26.293  1.00 56.94  ? 106  DT  P C7    1 
ATOM   485  C  C6    . DT  B 2 6   ? -24.210 60.237 27.590  1.00 57.51  ? 106  DT  P C6    1 
ATOM   486  P  P     . DG  B 2 7   ? -20.449 65.181 28.016  1.00 67.51  ? 107  DG  P P     1 
ATOM   487  O  OP1   . DG  B 2 7   ? -19.963 66.582 28.129  1.00 66.74  ? 107  DG  P OP1   1 
ATOM   488  O  OP2   . DG  B 2 7   ? -20.038 64.351 26.845  1.00 66.38  ? 107  DG  P OP2   1 
ATOM   489  O  "O5'" . DG  B 2 7   ? -20.082 64.447 29.400  1.00 64.29  ? 107  DG  P "O5'" 1 
ATOM   490  C  "C5'" . DG  B 2 7   ? -20.536 64.975 30.651  1.00 59.85  ? 107  DG  P "C5'" 1 
ATOM   491  C  "C4'" . DG  B 2 7   ? -20.263 63.924 31.698  1.00 57.75  ? 107  DG  P "C4'" 1 
ATOM   492  O  "O4'" . DG  B 2 7   ? -20.990 62.742 31.287  1.00 57.31  ? 107  DG  P "O4'" 1 
ATOM   493  C  "C3'" . DG  B 2 7   ? -18.802 63.492 31.789  1.00 57.14  ? 107  DG  P "C3'" 1 
ATOM   494  O  "O3'" . DG  B 2 7   ? -18.290 63.730 33.099  1.00 57.55  ? 107  DG  P "O3'" 1 
ATOM   495  C  "C2'" . DG  B 2 7   ? -18.757 62.005 31.413  1.00 55.17  ? 107  DG  P "C2'" 1 
ATOM   496  C  "C1'" . DG  B 2 7   ? -20.213 61.590 31.538  1.00 52.23  ? 107  DG  P "C1'" 1 
ATOM   497  N  N9    . DG  B 2 7   ? -20.658 60.485 30.677  1.00 50.30  ? 107  DG  P N9    1 
ATOM   498  C  C8    . DG  B 2 7   ? -20.681 60.380 29.300  1.00 48.55  ? 107  DG  P C8    1 
ATOM   499  N  N7    . DG  B 2 7   ? -21.154 59.229 28.874  1.00 48.06  ? 107  DG  P N7    1 
ATOM   500  C  C5    . DG  B 2 7   ? -21.461 58.535 30.049  1.00 48.43  ? 107  DG  P C5    1 
ATOM   501  C  C6    . DG  B 2 7   ? -22.012 57.246 30.262  1.00 48.06  ? 107  DG  P C6    1 
ATOM   502  O  O6    . DG  B 2 7   ? -22.354 56.395 29.426  1.00 47.94  ? 107  DG  P O6    1 
ATOM   503  N  N1    . DG  B 2 7   ? -22.155 56.959 31.617  1.00 47.70  ? 107  DG  P N1    1 
ATOM   504  C  C2    . DG  B 2 7   ? -21.821 57.797 32.652  1.00 47.59  ? 107  DG  P C2    1 
ATOM   505  N  N2    . DG  B 2 7   ? -22.022 57.335 33.901  1.00 47.37  ? 107  DG  P N2    1 
ATOM   506  N  N3    . DG  B 2 7   ? -21.320 59.005 32.472  1.00 46.88  ? 107  DG  P N3    1 
ATOM   507  C  C4    . DG  B 2 7   ? -21.161 59.299 31.160  1.00 48.75  ? 107  DG  P C4    1 
ATOM   508  P  P     . DT  B 2 8   ? -16.707 63.598 33.426  1.00 57.98  ? 108  DT  P P     1 
ATOM   509  O  OP1   . DT  B 2 8   ? -16.424 64.687 34.401  1.00 58.53  ? 108  DT  P OP1   1 
ATOM   510  O  OP2   . DT  B 2 8   ? -15.875 63.440 32.207  1.00 54.14  ? 108  DT  P OP2   1 
ATOM   511  O  "O5'" . DT  B 2 8   ? -16.675 62.196 34.206  1.00 55.21  ? 108  DT  P "O5'" 1 
ATOM   512  C  "C5'" . DT  B 2 8   ? -17.567 61.950 35.305  1.00 50.30  ? 108  DT  P "C5'" 1 
ATOM   513  C  "C4'" . DT  B 2 8   ? -17.378 60.546 35.859  1.00 47.16  ? 108  DT  P "C4'" 1 
ATOM   514  O  "O4'" . DT  B 2 8   ? -18.105 59.580 35.051  1.00 45.76  ? 108  DT  P "O4'" 1 
ATOM   515  C  "C3'" . DT  B 2 8   ? -15.938 60.048 35.937  1.00 45.09  ? 108  DT  P "C3'" 1 
ATOM   516  O  "O3'" . DT  B 2 8   ? -15.815 59.453 37.212  1.00 45.34  ? 108  DT  P "O3'" 1 
ATOM   517  C  "C2'" . DT  B 2 8   ? -15.814 59.072 34.759  1.00 43.50  ? 108  DT  P "C2'" 1 
ATOM   518  C  "C1'" . DT  B 2 8   ? -17.247 58.531 34.653  1.00 42.67  ? 108  DT  P "C1'" 1 
ATOM   519  N  N1    . DT  B 2 8   ? -17.685 57.991 33.300  1.00 40.95  ? 108  DT  P N1    1 
ATOM   520  C  C2    . DT  B 2 8   ? -18.350 56.778 33.269  1.00 40.44  ? 108  DT  P C2    1 
ATOM   521  O  O2    . DT  B 2 8   ? -18.600 56.144 34.272  1.00 40.48  ? 108  DT  P O2    1 
ATOM   522  N  N3    . DT  B 2 8   ? -18.712 56.318 32.023  1.00 39.72  ? 108  DT  P N3    1 
ATOM   523  C  C4    . DT  B 2 8   ? -18.494 56.956 30.810  1.00 40.16  ? 108  DT  P C4    1 
ATOM   524  O  O4    . DT  B 2 8   ? -18.868 56.477 29.739  1.00 39.28  ? 108  DT  P O4    1 
ATOM   525  C  C5    . DT  B 2 8   ? -17.796 58.220 30.905  1.00 40.65  ? 108  DT  P C5    1 
ATOM   526  C  C7    . DT  B 2 8   ? -17.505 59.001 29.657  1.00 40.65  ? 108  DT  P C7    1 
ATOM   527  C  C6    . DT  B 2 8   ? -17.431 58.675 32.121  1.00 40.74  ? 108  DT  P C6    1 
ATOM   528  P  P     . DC  B 2 9   ? -14.443 58.797 37.727  1.00 47.77  ? 109  DC  P P     1 
ATOM   529  O  OP1   . DC  B 2 9   ? -14.496 58.724 39.212  1.00 46.40  ? 109  DC  P OP1   1 
ATOM   530  O  OP2   . DC  B 2 9   ? -13.292 59.422 37.033  1.00 47.46  ? 109  DC  P OP2   1 
ATOM   531  O  "O5'" . DC  B 2 9   ? -14.559 57.311 37.145  1.00 46.56  ? 109  DC  P "O5'" 1 
ATOM   532  C  "C5'" . DC  B 2 9   ? -15.437 56.390 37.785  1.00 43.90  ? 109  DC  P "C5'" 1 
ATOM   533  C  "C4'" . DC  B 2 9   ? -15.339 55.064 37.086  1.00 41.37  ? 109  DC  P "C4'" 1 
ATOM   534  O  "O4'" . DC  B 2 9   ? -15.683 55.262 35.701  1.00 39.20  ? 109  DC  P "O4'" 1 
ATOM   535  C  "C3'" . DC  B 2 9   ? -13.933 54.504 37.073  1.00 41.49  ? 109  DC  P "C3'" 1 
ATOM   536  O  "O3'" . DC  B 2 9   ? -13.928 53.393 37.960  1.00 42.98  ? 109  DC  P "O3'" 1 
ATOM   537  C  "C2'" . DC  B 2 9   ? -13.675 54.142 35.601  1.00 40.87  ? 109  DC  P "C2'" 1 
ATOM   538  C  "C1'" . DC  B 2 9   ? -15.066 54.227 34.987  1.00 39.03  ? 109  DC  P "C1'" 1 
ATOM   539  N  N1    . DC  B 2 9   ? -15.174 54.603 33.554  1.00 38.76  ? 109  DC  P N1    1 
ATOM   540  C  C2    . DC  B 2 9   ? -15.847 53.749 32.659  1.00 39.34  ? 109  DC  P C2    1 
ATOM   541  O  O2    . DC  B 2 9   ? -16.313 52.680 33.076  1.00 39.25  ? 109  DC  P O2    1 
ATOM   542  N  N3    . DC  B 2 9   ? -15.965 54.113 31.348  1.00 38.49  ? 109  DC  P N3    1 
ATOM   543  C  C4    . DC  B 2 9   ? -15.450 55.269 30.928  1.00 38.35  ? 109  DC  P C4    1 
ATOM   544  N  N4    . DC  B 2 9   ? -15.585 55.577 29.637  1.00 38.24  ? 109  DC  P N4    1 
ATOM   545  C  C5    . DC  B 2 9   ? -14.778 56.162 31.822  1.00 38.82  ? 109  DC  P C5    1 
ATOM   546  C  C6    . DC  B 2 9   ? -14.662 55.791 33.106  1.00 38.62  ? 109  DC  P C6    1 
ATOM   547  P  P     . DA  B 2 10  ? -12.616 52.492 38.202  1.00 44.36  ? 110  DA  P P     1 
ATOM   548  O  OP1   . DA  B 2 10  ? -12.840 51.891 39.535  1.00 43.54  ? 110  DA  P OP1   1 
ATOM   549  O  OP2   . DA  B 2 10  ? -11.363 53.245 37.890  1.00 40.88  ? 110  DA  P OP2   1 
ATOM   550  O  "O5'" . DA  B 2 10  ? -12.770 51.410 37.033  1.00 41.72  ? 110  DA  P "O5'" 1 
ATOM   551  C  "C5'" . DA  B 2 10  ? -13.711 50.379 37.120  1.00 40.83  ? 110  DA  P "C5'" 1 
ATOM   552  C  "C4'" . DA  B 2 10  ? -13.565 49.530 35.882  1.00 41.74  ? 110  DA  P "C4'" 1 
ATOM   553  O  "O4'" . DA  B 2 10  ? -13.808 50.334 34.705  1.00 41.95  ? 110  DA  P "O4'" 1 
ATOM   554  C  "C3'" . DA  B 2 10  ? -12.184 48.901 35.688  1.00 42.35  ? 110  DA  P "C3'" 1 
ATOM   555  O  "O3'" . DA  B 2 10  ? -12.420 47.491 35.577  1.00 44.33  ? 110  DA  P "O3'" 1 
ATOM   556  C  "C2'" . DA  B 2 10  ? -11.650 49.563 34.413  1.00 41.24  ? 110  DA  P "C2'" 1 
ATOM   557  C  "C1'" . DA  B 2 10  ? -12.940 49.906 33.679  1.00 40.64  ? 110  DA  P "C1'" 1 
ATOM   558  N  N9    . DA  B 2 10  ? -12.837 51.018 32.741  1.00 40.07  ? 110  DA  P N9    1 
ATOM   559  C  C8    . DA  B 2 10  ? -12.304 52.256 32.997  1.00 40.13  ? 110  DA  P C8    1 
ATOM   560  N  N7    . DA  B 2 10  ? -12.340 53.094 31.984  1.00 39.44  ? 110  DA  P N7    1 
ATOM   561  C  C5    . DA  B 2 10  ? -12.953 52.341 30.984  1.00 40.53  ? 110  DA  P C5    1 
ATOM   562  C  C6    . DA  B 2 10  ? -13.285 52.635 29.639  1.00 39.90  ? 110  DA  P C6    1 
ATOM   563  N  N6    . DA  B 2 10  ? -13.036 53.824 29.074  1.00 38.97  ? 110  DA  P N6    1 
ATOM   564  N  N1    . DA  B 2 10  ? -13.886 51.663 28.912  1.00 39.22  ? 110  DA  P N1    1 
ATOM   565  C  C2    . DA  B 2 10  ? -14.135 50.481 29.481  1.00 38.66  ? 110  DA  P C2    1 
ATOM   566  N  N3    . DA  B 2 10  ? -13.861 50.090 30.724  1.00 38.87  ? 110  DA  P N3    1 
ATOM   567  C  C4    . DA  B 2 10  ? -13.270 51.063 31.434  1.00 39.56  ? 110  DA  P C4    1 
ATOM   568  P  P     . DT  B 2 11  ? -11.264 46.419 35.300  1.00 44.21  ? 111  DT  P P     1 
ATOM   569  O  OP1   . DT  B 2 11  ? -11.809 45.062 35.536  1.00 43.53  ? 111  DT  P OP1   1 
ATOM   570  O  OP2   . DT  B 2 11  ? -10.070 46.894 36.042  1.00 42.69  ? 111  DT  P OP2   1 
ATOM   571  O  "O5'" . DT  B 2 11  ? -11.074 46.559 33.709  1.00 42.89  ? 111  DT  P "O5'" 1 
ATOM   572  C  "C5'" . DT  B 2 11  ? -12.095 46.101 32.843  1.00 42.64  ? 111  DT  P "C5'" 1 
ATOM   573  C  "C4'" . DT  B 2 11  ? -11.666 46.221 31.400  1.00 42.72  ? 111  DT  P "C4'" 1 
ATOM   574  O  "O4'" . DT  B 2 11  ? -11.754 47.620 31.037  1.00 43.41  ? 111  DT  P "O4'" 1 
ATOM   575  C  "C3'" . DT  B 2 11  ? -10.244 45.770 31.055  1.00 42.35  ? 111  DT  P "C3'" 1 
ATOM   576  O  "O3'" . DT  B 2 11  ? -10.335 44.711 30.154  1.00 42.43  ? 111  DT  P "O3'" 1 
ATOM   577  C  "C2'" . DT  B 2 11  ? -9.653  46.963 30.307  1.00 42.59  ? 111  DT  P "C2'" 1 
ATOM   578  C  "C1'" . DT  B 2 11  ? -10.880 47.795 29.951  1.00 42.62  ? 111  DT  P "C1'" 1 
ATOM   579  N  N1    . DT  B 2 11  ? -10.574 49.239 29.773  1.00 42.89  ? 111  DT  P N1    1 
ATOM   580  C  C2    . DT  B 2 11  ? -10.933 49.866 28.591  1.00 42.94  ? 111  DT  P C2    1 
ATOM   581  O  O2    . DT  B 2 11  ? -11.509 49.306 27.671  1.00 43.17  ? 111  DT  P O2    1 
ATOM   582  N  N3    . DT  B 2 11  ? -10.599 51.196 28.524  1.00 41.69  ? 111  DT  P N3    1 
ATOM   583  C  C4    . DT  B 2 11  ? -9.944  51.926 29.494  1.00 42.29  ? 111  DT  P C4    1 
ATOM   584  O  O4    . DT  B 2 11  ? -9.687  53.107 29.324  1.00 44.10  ? 111  DT  P O4    1 
ATOM   585  C  C5    . DT  B 2 11  ? -9.595  51.223 30.704  1.00 41.54  ? 111  DT  P C5    1 
ATOM   586  C  C7    . DT  B 2 11  ? -8.894  51.914 31.831  1.00 40.93  ? 111  DT  P C7    1 
ATOM   587  C  C6    . DT  B 2 11  ? -9.925  49.929 30.781  1.00 42.31  ? 111  DT  P C6    1 
ATOM   588  P  P     . DA  B 2 12  ? -9.172  43.658 29.841  1.00 42.51  ? 112  DA  P P     1 
ATOM   589  O  OP1   . DA  B 2 12  ? -9.424  42.534 30.748  1.00 42.66  ? 112  DA  P OP1   1 
ATOM   590  O  OP2   . DA  B 2 12  ? -7.828  44.278 29.817  1.00 42.71  ? 112  DA  P OP2   1 
ATOM   591  O  "O5'" . DA  B 2 12  ? -9.534  43.211 28.353  1.00 41.10  ? 112  DA  P "O5'" 1 
ATOM   592  C  "C5'" . DA  B 2 12  ? -8.803  43.738 27.295  1.00 40.80  ? 112  DA  P "C5'" 1 
ATOM   593  C  "C4'" . DA  B 2 12  ? -9.753  44.250 26.249  1.00 40.81  ? 112  DA  P "C4'" 1 
ATOM   594  O  "O4'" . DA  B 2 12  ? -10.181 45.566 26.650  1.00 41.83  ? 112  DA  P "O4'" 1 
ATOM   595  C  "C3'" . DA  B 2 12  ? -9.104  44.454 24.897  1.00 39.53  ? 112  DA  P "C3'" 1 
ATOM   596  O  "O3'" . DA  B 2 12  ? -9.414  43.346 24.163  1.00 39.58  ? 112  DA  P "O3'" 1 
ATOM   597  C  "C2'" . DA  B 2 12  ? -9.808  45.657 24.280  1.00 39.19  ? 112  DA  P "C2'" 1 
ATOM   598  C  "C1'" . DA  B 2 12  ? -10.243 46.424 25.503  1.00 39.07  ? 112  DA  P "C1'" 1 
ATOM   599  N  N9    . DA  B 2 12  ? -9.474  47.606 25.840  1.00 38.52  ? 112  DA  P N9    1 
ATOM   600  C  C8    . DA  B 2 12  ? -8.824  47.773 27.028  1.00 38.44  ? 112  DA  P C8    1 
ATOM   601  N  N7    . DA  B 2 12  ? -8.238  48.938 27.153  1.00 38.46  ? 112  DA  P N7    1 
ATOM   602  C  C5    . DA  B 2 12  ? -8.527  49.580 25.961  1.00 37.79  ? 112  DA  P C5    1 
ATOM   603  C  C6    . DA  B 2 12  ? -8.192  50.856 25.482  1.00 37.74  ? 112  DA  P C6    1 
ATOM   604  N  N6    . DA  B 2 12  ? -7.458  51.720 26.195  1.00 36.79  ? 112  DA  P N6    1 
ATOM   605  N  N1    . DA  B 2 12  ? -8.646  51.205 24.253  1.00 38.19  ? 112  DA  P N1    1 
ATOM   606  C  C2    . DA  B 2 12  ? -9.377  50.331 23.555  1.00 37.69  ? 112  DA  P C2    1 
ATOM   607  N  N3    . DA  B 2 12  ? -9.756  49.106 23.913  1.00 38.08  ? 112  DA  P N3    1 
ATOM   608  C  C4    . DA  B 2 12  ? -9.297  48.780 25.135  1.00 38.31  ? 112  DA  P C4    1 
ATOM   609  P  P     . DA  B 2 13  ? -8.505  42.947 22.926  1.00 40.86  ? 113  DA  P P     1 
ATOM   610  O  OP1   . DA  B 2 13  ? -9.187  41.827 22.242  1.00 40.66  ? 113  DA  P OP1   1 
ATOM   611  O  OP2   . DA  B 2 13  ? -7.124  42.754 23.428  1.00 43.04  ? 113  DA  P OP2   1 
ATOM   612  O  "O5'" . DA  B 2 13  ? -8.454  44.239 22.008  1.00 40.30  ? 113  DA  P "O5'" 1 
ATOM   613  C  "C5'" . DA  B 2 13  ? -9.540  44.440 21.153  1.00 42.73  ? 113  DA  P "C5'" 1 
ATOM   614  C  "C4'" . DA  B 2 13  ? -9.158  45.434 20.093  1.00 42.00  ? 113  DA  P "C4'" 1 
ATOM   615  O  "O4'" . DA  B 2 13  ? -8.804  46.661 20.760  1.00 41.14  ? 113  DA  P "O4'" 1 
ATOM   616  C  "C3'" . DA  B 2 13  ? -7.949  44.977 19.303  1.00 42.68  ? 113  DA  P "C3'" 1 
ATOM   617  O  "O3'" . DA  B 2 13  ? -8.253  45.097 17.931  1.00 44.09  ? 113  DA  P "O3'" 1 
ATOM   618  C  "C2'" . DA  B 2 13  ? -6.817  45.893 19.782  1.00 41.23  ? 113  DA  P "C2'" 1 
ATOM   619  C  "C1'" . DA  B 2 13  ? -7.556  47.126 20.278  1.00 39.84  ? 113  DA  P "C1'" 1 
ATOM   620  N  N9    . DA  B 2 13  ? -6.918  47.813 21.403  1.00 38.00  ? 113  DA  P N9    1 
ATOM   621  C  C8    . DA  B 2 13  ? -6.584  47.273 22.613  1.00 35.96  ? 113  DA  P C8    1 
ATOM   622  N  N7    . DA  B 2 13  ? -6.039  48.139 23.431  1.00 36.52  ? 113  DA  P N7    1 
ATOM   623  C  C5    . DA  B 2 13  ? -6.020  49.321 22.709  1.00 36.17  ? 113  DA  P C5    1 
ATOM   624  C  C6    . DA  B 2 13  ? -5.569  50.619 23.014  1.00 35.35  ? 113  DA  P C6    1 
ATOM   625  N  N6    . DA  B 2 13  ? -5.023  50.930 24.180  1.00 33.37  ? 113  DA  P N6    1 
ATOM   626  N  N1    . DA  B 2 13  ? -5.712  51.584 22.074  1.00 36.08  ? 113  DA  P N1    1 
ATOM   627  C  C2    . DA  B 2 13  ? -6.256  51.253 20.893  1.00 35.59  ? 113  DA  P C2    1 
ATOM   628  N  N3    . DA  B 2 13  ? -6.715  50.069 20.500  1.00 35.55  ? 113  DA  P N3    1 
ATOM   629  C  C4    . DA  B 2 13  ? -6.568  49.142 21.457  1.00 36.20  ? 113  DA  P C4    1 
HETATM 630  P  P     . DDG B 2 14  ? -7.226  44.552 16.834  1.00 48.05  ? 114  DDG P P     1 
HETATM 631  O  OP1   . DDG B 2 14  ? -8.045  44.000 15.727  1.00 47.95  ? 114  DDG P OP1   1 
HETATM 632  O  OP2   . DDG B 2 14  ? -6.161  43.734 17.496  1.00 48.27  ? 114  DDG P OP2   1 
HETATM 633  O  "O5'" . DDG B 2 14  ? -6.516  45.877 16.308  1.00 47.36  ? 114  DDG P "O5'" 1 
HETATM 634  C  "C5'" . DDG B 2 14  ? -5.155  46.119 16.601  1.00 47.06  ? 114  DDG P "C5'" 1 
HETATM 635  C  "C4'" . DDG B 2 14  ? -4.963  47.616 16.599  1.00 47.08  ? 114  DDG P "C4'" 1 
HETATM 636  O  "O4'" . DDG B 2 14  ? -5.093  48.125 17.953  1.00 47.18  ? 114  DDG P "O4'" 1 
HETATM 637  C  "C3'" . DDG B 2 14  ? -3.598  48.026 16.080  1.00 47.82  ? 114  DDG P "C3'" 1 
HETATM 638  C  "C2'" . DDG B 2 14  ? -2.889  48.488 17.344  1.00 47.54  ? 114  DDG P "C2'" 1 
HETATM 639  C  "C1'" . DDG B 2 14  ? -4.035  49.019 18.199  1.00 46.46  ? 114  DDG P "C1'" 1 
HETATM 640  N  N9    . DDG B 2 14  ? -3.590  49.007 19.585  1.00 45.46  ? 114  DDG P N9    1 
HETATM 641  C  C8    . DDG B 2 14  ? -3.535  47.934 20.446  1.00 44.91  ? 114  DDG P C8    1 
HETATM 642  N  N7    . DDG B 2 14  ? -3.037  48.246 21.616  1.00 45.00  ? 114  DDG P N7    1 
HETATM 643  C  C5    . DDG B 2 14  ? -2.722  49.599 21.515  1.00 44.20  ? 114  DDG P C5    1 
HETATM 644  C  C6    . DDG B 2 14  ? -2.152  50.493 22.459  1.00 43.68  ? 114  DDG P C6    1 
HETATM 645  O  O6    . DDG B 2 14  ? -1.794  50.251 23.616  1.00 43.70  ? 114  DDG P O6    1 
HETATM 646  N  N1    . DDG B 2 14  ? -1.996  51.786 21.953  1.00 43.19  ? 114  DDG P N1    1 
HETATM 647  C  C2    . DDG B 2 14  ? -2.355  52.159 20.676  1.00 43.52  ? 114  DDG P C2    1 
HETATM 648  N  N2    . DDG B 2 14  ? -2.143  53.437 20.337  1.00 43.71  ? 114  DDG P N2    1 
HETATM 649  N  N3    . DDG B 2 14  ? -2.890  51.330 19.784  1.00 43.66  ? 114  DDG P N3    1 
HETATM 650  C  C4    . DDG B 2 14  ? -3.048  50.074 20.265  1.00 44.21  ? 114  DDG P C4    1 
ATOM   651  N  N     . MET C 3 1   ? 37.634  38.065 30.350  1.00 72.95  ? 1    MET A N     1 
ATOM   652  C  CA    . MET C 3 1   ? 36.351  38.602 29.811  1.00 73.19  ? 1    MET A CA    1 
ATOM   653  C  C     . MET C 3 1   ? 36.220  40.088 30.162  1.00 72.50  ? 1    MET A C     1 
ATOM   654  O  O     . MET C 3 1   ? 36.905  40.583 31.083  1.00 72.66  ? 1    MET A O     1 
ATOM   655  C  CB    . MET C 3 1   ? 35.161  37.816 30.387  1.00 73.22  ? 1    MET A CB    1 
ATOM   656  C  CG    . MET C 3 1   ? 34.884  38.118 31.882  1.00 74.34  ? 1    MET A CG    1 
ATOM   657  S  SD    . MET C 3 1   ? 33.888  36.885 32.750  1.00 75.99  ? 1    MET A SD    1 
ATOM   658  C  CE    . MET C 3 1   ? 35.009  35.469 32.739  1.00 76.30  ? 1    MET A CE    1 
ATOM   659  N  N     . LYS C 3 2   ? 35.326  40.777 29.440  1.00 71.31  ? 2    LYS A N     1 
ATOM   660  C  CA    . LYS C 3 2   ? 35.002  42.182 29.686  1.00 70.01  ? 2    LYS A CA    1 
ATOM   661  C  C     . LYS C 3 2   ? 34.419  42.397 31.083  1.00 69.03  ? 2    LYS A C     1 
ATOM   662  O  O     . LYS C 3 2   ? 33.816  41.492 31.659  1.00 68.86  ? 2    LYS A O     1 
ATOM   663  C  CB    . LYS C 3 2   ? 34.001  42.682 28.647  1.00 70.33  ? 2    LYS A CB    1 
ATOM   664  C  CG    . LYS C 3 2   ? 34.503  42.763 27.216  1.00 70.67  ? 2    LYS A CG    1 
ATOM   665  C  CD    . LYS C 3 2   ? 33.320  42.953 26.281  1.00 72.26  ? 2    LYS A CD    1 
ATOM   666  C  CE    . LYS C 3 2   ? 33.620  42.506 24.858  1.00 74.20  ? 2    LYS A CE    1 
ATOM   667  N  NZ    . LYS C 3 2   ? 34.149  43.633 24.026  1.00 75.87  ? 2    LYS A NZ    1 
ATOM   668  N  N     . GLU C 3 3   ? 34.602  43.597 31.624  1.00 67.93  ? 3    GLU A N     1 
ATOM   669  C  CA    . GLU C 3 3   ? 34.026  43.955 32.925  1.00 66.95  ? 3    GLU A CA    1 
ATOM   670  C  C     . GLU C 3 3   ? 32.617  44.523 32.763  1.00 65.88  ? 3    GLU A C     1 
ATOM   671  O  O     . GLU C 3 3   ? 32.361  45.286 31.824  1.00 65.83  ? 3    GLU A O     1 
ATOM   672  C  CB    . GLU C 3 3   ? 34.906  44.982 33.636  1.00 67.27  ? 3    GLU A CB    1 
ATOM   673  C  CG    . GLU C 3 3   ? 36.225  44.441 34.149  1.00 68.45  ? 3    GLU A CG    1 
ATOM   674  C  CD    . GLU C 3 3   ? 36.911  45.405 35.092  1.00 70.99  ? 3    GLU A CD    1 
ATOM   675  O  OE1   . GLU C 3 3   ? 37.587  46.341 34.610  1.00 72.91  ? 3    GLU A OE1   1 
ATOM   676  O  OE2   . GLU C 3 3   ? 36.781  45.228 36.320  1.00 71.78  ? 3    GLU A OE2   1 
ATOM   677  N  N     . PHE C 3 4   ? 31.706  44.151 33.665  1.00 64.21  ? 4    PHE A N     1 
ATOM   678  C  CA    . PHE C 3 4   ? 30.333  44.676 33.622  1.00 62.62  ? 4    PHE A CA    1 
ATOM   679  C  C     . PHE C 3 4   ? 29.826  45.053 35.008  1.00 61.49  ? 4    PHE A C     1 
ATOM   680  O  O     . PHE C 3 4   ? 30.280  44.503 36.007  1.00 61.22  ? 4    PHE A O     1 
ATOM   681  C  CB    . PHE C 3 4   ? 29.360  43.731 32.881  1.00 62.59  ? 4    PHE A CB    1 
ATOM   682  C  CG    . PHE C 3 4   ? 29.101  42.419 33.585  1.00 62.61  ? 4    PHE A CG    1 
ATOM   683  C  CD1   . PHE C 3 4   ? 28.149  42.327 34.599  1.00 62.06  ? 4    PHE A CD1   1 
ATOM   684  C  CD2   . PHE C 3 4   ? 29.785  41.263 33.206  1.00 62.77  ? 4    PHE A CD2   1 
ATOM   685  C  CE1   . PHE C 3 4   ? 27.905  41.115 35.245  1.00 62.41  ? 4    PHE A CE1   1 
ATOM   686  C  CE2   . PHE C 3 4   ? 29.552  40.045 33.852  1.00 62.86  ? 4    PHE A CE2   1 
ATOM   687  C  CZ    . PHE C 3 4   ? 28.610  39.971 34.869  1.00 62.82  ? 4    PHE A CZ    1 
ATOM   688  N  N     . TYR C 3 5   ? 28.903  46.011 35.057  1.00 60.14  ? 5    TYR A N     1 
ATOM   689  C  CA    . TYR C 3 5   ? 28.372  46.513 36.328  1.00 58.79  ? 5    TYR A CA    1 
ATOM   690  C  C     . TYR C 3 5   ? 27.259  45.627 36.879  1.00 58.42  ? 5    TYR A C     1 
ATOM   691  O  O     . TYR C 3 5   ? 26.598  44.892 36.143  1.00 57.65  ? 5    TYR A O     1 
ATOM   692  C  CB    . TYR C 3 5   ? 27.893  47.972 36.202  1.00 58.07  ? 5    TYR A CB    1 
ATOM   693  C  CG    . TYR C 3 5   ? 26.753  48.172 35.223  1.00 57.37  ? 5    TYR A CG    1 
ATOM   694  C  CD1   . TYR C 3 5   ? 27.003  48.345 33.863  1.00 56.37  ? 5    TYR A CD1   1 
ATOM   695  C  CD2   . TYR C 3 5   ? 25.424  48.175 35.651  1.00 55.84  ? 5    TYR A CD2   1 
ATOM   696  C  CE1   . TYR C 3 5   ? 25.978  48.513 32.972  1.00 55.26  ? 5    TYR A CE1   1 
ATOM   697  C  CE2   . TYR C 3 5   ? 24.393  48.348 34.762  1.00 54.13  ? 5    TYR A CE2   1 
ATOM   698  C  CZ    . TYR C 3 5   ? 24.676  48.514 33.425  1.00 55.88  ? 5    TYR A CZ    1 
ATOM   699  O  OH    . TYR C 3 5   ? 23.658  48.677 32.510  1.00 57.18  ? 5    TYR A OH    1 
ATOM   700  N  N     . LEU C 3 6   ? 27.088  45.696 38.192  1.00 58.38  ? 6    LEU A N     1 
ATOM   701  C  CA    . LEU C 3 6   ? 25.985  45.060 38.882  1.00 58.48  ? 6    LEU A CA    1 
ATOM   702  C  C     . LEU C 3 6   ? 24.987  46.144 39.274  1.00 58.75  ? 6    LEU A C     1 
ATOM   703  O  O     . LEU C 3 6   ? 23.985  46.352 38.592  1.00 58.42  ? 6    LEU A O     1 
ATOM   704  C  CB    . LEU C 3 6   ? 26.499  44.299 40.102  1.00 58.42  ? 6    LEU A CB    1 
ATOM   705  C  CG    . LEU C 3 6   ? 26.944  42.833 39.950  1.00 58.19  ? 6    LEU A CG    1 
ATOM   706  C  CD1   . LEU C 3 6   ? 27.078  42.337 38.506  1.00 57.17  ? 6    LEU A CD1   1 
ATOM   707  C  CD2   . LEU C 3 6   ? 28.217  42.594 40.733  1.00 56.66  ? 6    LEU A CD2   1 
ATOM   708  N  N     . THR C 3 7   ? 25.266  46.862 40.353  1.00 59.19  ? 7    THR A N     1 
ATOM   709  C  CA    . THR C 3 7   ? 24.456  48.030 40.662  1.00 59.77  ? 7    THR A CA    1 
ATOM   710  C  C     . THR C 3 7   ? 25.271  49.321 40.516  1.00 60.11  ? 7    THR A C     1 
ATOM   711  O  O     . THR C 3 7   ? 26.475  49.269 40.276  1.00 60.21  ? 7    THR A O     1 
ATOM   712  C  CB    . THR C 3 7   ? 23.802  47.938 42.056  1.00 59.71  ? 7    THR A CB    1 
ATOM   713  O  OG1   . THR C 3 7   ? 24.769  48.256 43.060  1.00 60.13  ? 7    THR A OG1   1 
ATOM   714  C  CG2   . THR C 3 7   ? 23.199  46.543 42.295  1.00 59.17  ? 7    THR A CG2   1 
ATOM   715  N  N     . VAL C 3 8   ? 24.600  50.469 40.620  1.00 60.50  ? 8    VAL A N     1 
ATOM   716  C  CA    . VAL C 3 8   ? 25.264  51.774 40.698  1.00 60.64  ? 8    VAL A CA    1 
ATOM   717  C  C     . VAL C 3 8   ? 24.373  52.739 41.454  1.00 60.91  ? 8    VAL A C     1 
ATOM   718  O  O     . VAL C 3 8   ? 23.154  52.719 41.289  1.00 60.96  ? 8    VAL A O     1 
ATOM   719  C  CB    . VAL C 3 8   ? 25.645  52.353 39.300  1.00 60.61  ? 8    VAL A CB    1 
ATOM   720  C  CG1   . VAL C 3 8   ? 24.410  52.788 38.515  1.00 60.70  ? 8    VAL A CG1   1 
ATOM   721  C  CG2   . VAL C 3 8   ? 26.625  53.511 39.438  1.00 60.06  ? 8    VAL A CG2   1 
ATOM   722  N  N     . GLU C 3 9   ? 24.981  53.555 42.308  1.00 61.42  ? 9    GLU A N     1 
ATOM   723  C  CA    . GLU C 3 9   ? 24.253  54.602 43.026  1.00 62.01  ? 9    GLU A CA    1 
ATOM   724  C  C     . GLU C 3 9   ? 25.008  55.933 43.054  1.00 62.22  ? 9    GLU A C     1 
ATOM   725  O  O     . GLU C 3 9   ? 26.241  55.967 43.010  1.00 61.68  ? 9    GLU A O     1 
ATOM   726  C  CB    . GLU C 3 9   ? 23.914  54.167 44.456  1.00 61.73  ? 9    GLU A CB    1 
ATOM   727  C  CG    . GLU C 3 9   ? 23.040  52.914 44.557  1.00 63.06  ? 9    GLU A CG    1 
ATOM   728  C  CD    . GLU C 3 9   ? 21.550  53.138 44.284  1.00 63.59  ? 9    GLU A CD    1 
ATOM   729  O  OE1   . GLU C 3 9   ? 21.155  54.252 43.842  1.00 64.10  ? 9    GLU A OE1   1 
ATOM   730  O  OE2   . GLU C 3 9   ? 20.776  52.179 44.530  1.00 62.10  ? 9    GLU A OE2   1 
ATOM   731  N  N     . GLN C 3 10  ? 24.246  57.023 43.099  1.00 62.93  ? 10   GLN A N     1 
ATOM   732  C  CA    . GLN C 3 10  ? 24.792  58.320 43.454  1.00 63.62  ? 10   GLN A CA    1 
ATOM   733  C  C     . GLN C 3 10  ? 24.510  58.613 44.918  1.00 64.21  ? 10   GLN A C     1 
ATOM   734  O  O     . GLN C 3 10  ? 23.360  58.616 45.352  1.00 64.24  ? 10   GLN A O     1 
ATOM   735  C  CB    . GLN C 3 10  ? 24.202  59.422 42.592  1.00 63.38  ? 10   GLN A CB    1 
ATOM   736  C  CG    . GLN C 3 10  ? 24.600  60.799 43.078  1.00 63.63  ? 10   GLN A CG    1 
ATOM   737  C  CD    . GLN C 3 10  ? 24.080  61.927 42.222  1.00 63.94  ? 10   GLN A CD    1 
ATOM   738  O  OE1   . GLN C 3 10  ? 23.538  61.723 41.127  1.00 64.01  ? 10   GLN A OE1   1 
ATOM   739  N  NE2   . GLN C 3 10  ? 24.245  63.142 42.722  1.00 64.60  ? 10   GLN A NE2   1 
ATOM   740  N  N     . ILE C 3 11  ? 25.572  58.839 45.680  1.00 65.33  ? 11   ILE A N     1 
ATOM   741  C  CA    . ILE C 3 11  ? 25.446  59.335 47.057  1.00 66.37  ? 11   ILE A CA    1 
ATOM   742  C  C     . ILE C 3 11  ? 26.333  60.574 47.225  1.00 66.83  ? 11   ILE A C     1 
ATOM   743  O  O     . ILE C 3 11  ? 27.568  60.472 47.171  1.00 67.14  ? 11   ILE A O     1 
ATOM   744  C  CB    . ILE C 3 11  ? 25.826  58.260 48.101  1.00 66.45  ? 11   ILE A CB    1 
ATOM   745  C  CG1   . ILE C 3 11  ? 24.929  57.019 47.938  1.00 66.90  ? 11   ILE A CG1   1 
ATOM   746  C  CG2   . ILE C 3 11  ? 25.740  58.848 49.522  1.00 66.51  ? 11   ILE A CG2   1 
ATOM   747  C  CD1   . ILE C 3 11  ? 25.539  55.728 48.435  1.00 66.88  ? 11   ILE A CD1   1 
ATOM   748  N  N     . GLY C 3 12  ? 25.702  61.734 47.411  1.00 66.98  ? 12   GLY A N     1 
ATOM   749  C  CA    . GLY C 3 12  ? 26.428  62.990 47.542  1.00 67.55  ? 12   GLY A CA    1 
ATOM   750  C  C     . GLY C 3 12  ? 27.361  63.217 46.368  1.00 67.98  ? 12   GLY A C     1 
ATOM   751  O  O     . GLY C 3 12  ? 26.903  63.385 45.235  1.00 68.25  ? 12   GLY A O     1 
ATOM   752  N  N     . ASP C 3 13  ? 28.668  63.203 46.636  1.00 68.13  ? 13   ASP A N     1 
ATOM   753  C  CA    . ASP C 3 13  ? 29.677  63.419 45.598  1.00 68.42  ? 13   ASP A CA    1 
ATOM   754  C  C     . ASP C 3 13  ? 30.383  62.126 45.196  1.00 68.14  ? 13   ASP A C     1 
ATOM   755  O  O     . ASP C 3 13  ? 31.262  62.126 44.322  1.00 68.32  ? 13   ASP A O     1 
ATOM   756  C  CB    . ASP C 3 13  ? 30.689  64.475 46.045  1.00 68.90  ? 13   ASP A CB    1 
ATOM   757  C  CG    . ASP C 3 13  ? 30.074  65.877 46.155  1.00 70.36  ? 13   ASP A CG    1 
ATOM   758  O  OD1   . ASP C 3 13  ? 29.158  66.211 45.355  1.00 70.98  ? 13   ASP A OD1   1 
ATOM   759  O  OD2   . ASP C 3 13  ? 30.520  66.642 47.048  1.00 71.12  ? 13   ASP A OD2   1 
ATOM   760  N  N     . SER C 3 14  ? 29.975  61.028 45.833  1.00 67.70  ? 14   SER A N     1 
ATOM   761  C  CA    . SER C 3 14  ? 30.491  59.692 45.528  1.00 67.08  ? 14   SER A CA    1 
ATOM   762  C  C     . SER C 3 14  ? 29.479  58.789 44.796  1.00 66.46  ? 14   SER A C     1 
ATOM   763  O  O     . SER C 3 14  ? 28.312  58.686 45.187  1.00 66.09  ? 14   SER A O     1 
ATOM   764  C  CB    . SER C 3 14  ? 31.017  59.001 46.799  1.00 67.20  ? 14   SER A CB    1 
ATOM   765  O  OG    . SER C 3 14  ? 32.374  59.342 47.057  1.00 67.17  ? 14   SER A OG    1 
ATOM   766  N  N     . ILE C 3 15  ? 29.961  58.167 43.719  1.00 65.65  ? 15   ILE A N     1 
ATOM   767  C  CA    . ILE C 3 15  ? 29.275  57.100 43.003  1.00 65.04  ? 15   ILE A CA    1 
ATOM   768  C  C     . ILE C 3 15  ? 29.686  55.726 43.544  1.00 64.89  ? 15   ILE A C     1 
ATOM   769  O  O     . ILE C 3 15  ? 30.862  55.349 43.490  1.00 64.93  ? 15   ILE A O     1 
ATOM   770  C  CB    . ILE C 3 15  ? 29.556  57.197 41.482  1.00 65.20  ? 15   ILE A CB    1 
ATOM   771  C  CG1   . ILE C 3 15  ? 28.644  58.270 40.865  1.00 65.21  ? 15   ILE A CG1   1 
ATOM   772  C  CG2   . ILE C 3 15  ? 29.438  55.813 40.766  1.00 64.47  ? 15   ILE A CG2   1 
ATOM   773  C  CD1   . ILE C 3 15  ? 28.833  58.481 39.374  1.00 64.82  ? 15   ILE A CD1   1 
ATOM   774  N  N     . PHE C 3 16  ? 28.709  54.987 44.066  1.00 64.41  ? 16   PHE A N     1 
ATOM   775  C  CA    . PHE C 3 16  ? 28.930  53.629 44.567  1.00 63.98  ? 16   PHE A CA    1 
ATOM   776  C  C     . PHE C 3 16  ? 28.508  52.553 43.548  1.00 63.34  ? 16   PHE A C     1 
ATOM   777  O  O     . PHE C 3 16  ? 27.313  52.315 43.350  1.00 63.65  ? 16   PHE A O     1 
ATOM   778  C  CB    . PHE C 3 16  ? 28.178  53.435 45.878  1.00 64.05  ? 16   PHE A CB    1 
ATOM   779  C  CG    . PHE C 3 16  ? 28.753  54.206 47.037  1.00 65.40  ? 16   PHE A CG    1 
ATOM   780  C  CD1   . PHE C 3 16  ? 28.562  55.584 47.148  1.00 66.10  ? 16   PHE A CD1   1 
ATOM   781  C  CD2   . PHE C 3 16  ? 29.476  53.546 48.039  1.00 65.76  ? 16   PHE A CD2   1 
ATOM   782  C  CE1   . PHE C 3 16  ? 29.090  56.292 48.236  1.00 66.60  ? 16   PHE A CE1   1 
ATOM   783  C  CE2   . PHE C 3 16  ? 30.008  54.242 49.128  1.00 65.28  ? 16   PHE A CE2   1 
ATOM   784  C  CZ    . PHE C 3 16  ? 29.817  55.614 49.229  1.00 65.73  ? 16   PHE A CZ    1 
ATOM   785  N  N     . GLU C 3 17  ? 29.490  51.909 42.914  1.00 62.30  ? 17   GLU A N     1 
ATOM   786  C  CA    . GLU C 3 17  ? 29.248  50.852 41.922  1.00 61.27  ? 17   GLU A CA    1 
ATOM   787  C  C     . GLU C 3 17  ? 29.693  49.452 42.381  1.00 61.26  ? 17   GLU A C     1 
ATOM   788  O  O     . GLU C 3 17  ? 30.819  49.267 42.827  1.00 61.49  ? 17   GLU A O     1 
ATOM   789  C  CB    . GLU C 3 17  ? 29.951  51.196 40.601  1.00 61.00  ? 17   GLU A CB    1 
ATOM   790  C  CG    . GLU C 3 17  ? 29.855  50.104 39.525  1.00 59.88  ? 17   GLU A CG    1 
ATOM   791  C  CD    . GLU C 3 17  ? 30.920  50.229 38.452  1.00 59.73  ? 17   GLU A CD    1 
ATOM   792  O  OE1   . GLU C 3 17  ? 31.982  50.801 38.746  1.00 60.61  ? 17   GLU A OE1   1 
ATOM   793  O  OE2   . GLU C 3 17  ? 30.714  49.751 37.321  1.00 56.42  ? 17   GLU A OE2   1 
ATOM   794  N  N     . ARG C 3 18  ? 28.808  48.467 42.258  1.00 61.02  ? 18   ARG A N     1 
ATOM   795  C  CA    . ARG C 3 18  ? 29.195  47.059 42.392  1.00 60.47  ? 18   ARG A CA    1 
ATOM   796  C  C     . ARG C 3 18  ? 29.439  46.524 40.993  1.00 60.41  ? 18   ARG A C     1 
ATOM   797  O  O     . ARG C 3 18  ? 28.730  46.908 40.066  1.00 60.38  ? 18   ARG A O     1 
ATOM   798  C  CB    . ARG C 3 18  ? 28.080  46.251 43.051  1.00 60.29  ? 18   ARG A CB    1 
ATOM   799  C  CG    . ARG C 3 18  ? 27.807  46.595 44.500  1.00 59.39  ? 18   ARG A CG    1 
ATOM   800  C  CD    . ARG C 3 18  ? 26.455  46.040 44.954  1.00 58.23  ? 18   ARG A CD    1 
ATOM   801  N  NE    . ARG C 3 18  ? 26.481  44.595 45.160  1.00 57.19  ? 18   ARG A NE    1 
ATOM   802  C  CZ    . ARG C 3 18  ? 25.505  43.900 45.740  1.00 57.81  ? 18   ARG A CZ    1 
ATOM   803  N  NH1   . ARG C 3 18  ? 24.416  44.524 46.174  1.00 58.08  ? 18   ARG A NH1   1 
ATOM   804  N  NH2   . ARG C 3 18  ? 25.618  42.578 45.897  1.00 57.93  ? 18   ARG A NH2   1 
ATOM   805  N  N     . TYR C 3 19  ? 30.428  45.650 40.824  1.00 60.44  ? 19   TYR A N     1 
ATOM   806  C  CA    . TYR C 3 19  ? 30.707  45.102 39.493  1.00 60.98  ? 19   TYR A CA    1 
ATOM   807  C  C     . TYR C 3 19  ? 31.443  43.757 39.490  1.00 61.07  ? 19   TYR A C     1 
ATOM   808  O  O     . TYR C 3 19  ? 31.774  43.212 40.544  1.00 60.90  ? 19   TYR A O     1 
ATOM   809  C  CB    . TYR C 3 19  ? 31.442  46.136 38.628  1.00 61.02  ? 19   TYR A CB    1 
ATOM   810  C  CG    . TYR C 3 19  ? 32.874  46.367 39.043  1.00 61.84  ? 19   TYR A CG    1 
ATOM   811  C  CD1   . TYR C 3 19  ? 33.185  46.947 40.282  1.00 62.22  ? 19   TYR A CD1   1 
ATOM   812  C  CD2   . TYR C 3 19  ? 33.928  46.007 38.196  1.00 62.18  ? 19   TYR A CD2   1 
ATOM   813  C  CE1   . TYR C 3 19  ? 34.507  47.156 40.665  1.00 62.66  ? 19   TYR A CE1   1 
ATOM   814  C  CE2   . TYR C 3 19  ? 35.254  46.217 38.565  1.00 61.91  ? 19   TYR A CE2   1 
ATOM   815  C  CZ    . TYR C 3 19  ? 35.537  46.789 39.796  1.00 62.61  ? 19   TYR A CZ    1 
ATOM   816  O  OH    . TYR C 3 19  ? 36.849  46.990 40.158  1.00 63.34  ? 19   TYR A OH    1 
ATOM   817  N  N     . ILE C 3 20  ? 31.659  43.231 38.288  1.00 61.45  ? 20   ILE A N     1 
ATOM   818  C  CA    . ILE C 3 20  ? 32.442  42.025 38.051  1.00 62.43  ? 20   ILE A CA    1 
ATOM   819  C  C     . ILE C 3 20  ? 33.740  42.406 37.297  1.00 63.29  ? 20   ILE A C     1 
ATOM   820  O  O     . ILE C 3 20  ? 33.676  43.051 36.235  1.00 63.30  ? 20   ILE A O     1 
ATOM   821  C  CB    . ILE C 3 20  ? 31.587  40.940 37.275  1.00 62.28  ? 20   ILE A CB    1 
ATOM   822  C  CG1   . ILE C 3 20  ? 31.014  39.877 38.216  1.00 61.71  ? 20   ILE A CG1   1 
ATOM   823  C  CG2   . ILE C 3 20  ? 32.413  40.186 36.245  1.00 62.11  ? 20   ILE A CG2   1 
ATOM   824  C  CD1   . ILE C 3 20  ? 30.118  40.366 39.302  1.00 60.31  ? 20   ILE A CD1   1 
ATOM   825  N  N     . ASP C 3 21  ? 34.902  42.024 37.850  1.00 64.15  ? 21   ASP A N     1 
ATOM   826  C  CA    . ASP C 3 21  ? 36.206  42.289 37.197  1.00 65.11  ? 21   ASP A CA    1 
ATOM   827  C  C     . ASP C 3 21  ? 36.520  41.294 36.082  1.00 65.69  ? 21   ASP A C     1 
ATOM   828  O  O     . ASP C 3 21  ? 35.729  40.387 35.834  1.00 66.02  ? 21   ASP A O     1 
ATOM   829  C  CB    . ASP C 3 21  ? 37.368  42.380 38.208  1.00 65.15  ? 21   ASP A CB    1 
ATOM   830  C  CG    . ASP C 3 21  ? 37.425  41.195 39.168  1.00 66.11  ? 21   ASP A CG    1 
ATOM   831  O  OD1   . ASP C 3 21  ? 37.442  40.035 38.700  1.00 66.81  ? 21   ASP A OD1   1 
ATOM   832  O  OD2   . ASP C 3 21  ? 37.471  41.428 40.401  1.00 66.64  ? 21   ASP A OD2   1 
ATOM   833  N  N     . SER C 3 22  ? 37.672  41.461 35.426  1.00 66.37  ? 22   SER A N     1 
ATOM   834  C  CA    . SER C 3 22  ? 38.080  40.611 34.295  1.00 67.06  ? 22   SER A CA    1 
ATOM   835  C  C     . SER C 3 22  ? 38.040  39.116 34.633  1.00 67.40  ? 22   SER A C     1 
ATOM   836  O  O     . SER C 3 22  ? 37.827  38.274 33.744  1.00 67.42  ? 22   SER A O     1 
ATOM   837  C  CB    . SER C 3 22  ? 39.490  40.979 33.813  1.00 67.22  ? 22   SER A CB    1 
ATOM   838  O  OG    . SER C 3 22  ? 39.572  42.337 33.417  1.00 67.39  ? 22   SER A OG    1 
ATOM   839  N  N     . ASN C 3 23  ? 38.235  38.813 35.919  1.00 67.57  ? 23   ASN A N     1 
ATOM   840  C  CA    . ASN C 3 23  ? 38.277  37.442 36.433  1.00 67.85  ? 23   ASN A CA    1 
ATOM   841  C  C     . ASN C 3 23  ? 36.908  36.824 36.660  1.00 67.84  ? 23   ASN A C     1 
ATOM   842  O  O     . ASN C 3 23  ? 36.776  35.600 36.688  1.00 68.28  ? 23   ASN A O     1 
ATOM   843  C  CB    . ASN C 3 23  ? 39.058  37.392 37.751  1.00 67.93  ? 23   ASN A CB    1 
ATOM   844  C  CG    . ASN C 3 23  ? 40.455  37.963 37.621  1.00 68.34  ? 23   ASN A CG    1 
ATOM   845  O  OD1   . ASN C 3 23  ? 41.208  37.586 36.723  1.00 68.53  ? 23   ASN A OD1   1 
ATOM   846  N  ND2   . ASN C 3 23  ? 40.808  38.879 38.519  1.00 67.93  ? 23   ASN A ND2   1 
ATOM   847  N  N     . GLY C 3 24  ? 35.894  37.665 36.826  1.00 67.63  ? 24   GLY A N     1 
ATOM   848  C  CA    . GLY C 3 24  ? 34.577  37.188 37.227  1.00 67.32  ? 24   GLY A CA    1 
ATOM   849  C  C     . GLY C 3 24  ? 34.362  37.272 38.732  1.00 66.96  ? 24   GLY A C     1 
ATOM   850  O  O     . GLY C 3 24  ? 33.351  36.791 39.248  1.00 67.06  ? 24   GLY A O     1 
ATOM   851  N  N     . ARG C 3 25  ? 35.315  37.874 39.438  1.00 66.50  ? 25   ARG A N     1 
ATOM   852  C  CA    . ARG C 3 25  ? 35.120  38.238 40.836  1.00 66.22  ? 25   ARG A CA    1 
ATOM   853  C  C     . ARG C 3 25  ? 34.291  39.530 40.965  1.00 66.19  ? 25   ARG A C     1 
ATOM   854  O  O     . ARG C 3 25  ? 34.296  40.396 40.081  1.00 66.03  ? 25   ARG A O     1 
ATOM   855  C  CB    . ARG C 3 25  ? 36.464  38.368 41.552  1.00 66.17  ? 25   ARG A CB    1 
ATOM   856  N  N     . GLU C 3 26  ? 33.573  39.651 42.070  1.00 66.00  ? 26   GLU A N     1 
ATOM   857  C  CA    . GLU C 3 26  ? 32.703  40.786 42.284  1.00 66.01  ? 26   GLU A CA    1 
ATOM   858  C  C     . GLU C 3 26  ? 33.377  41.794 43.191  1.00 65.90  ? 26   GLU A C     1 
ATOM   859  O  O     . GLU C 3 26  ? 33.720  41.468 44.328  1.00 65.55  ? 26   GLU A O     1 
ATOM   860  C  CB    . GLU C 3 26  ? 31.392  40.321 42.913  1.00 65.99  ? 26   GLU A CB    1 
ATOM   861  C  CG    . GLU C 3 26  ? 30.506  41.456 43.419  1.00 66.67  ? 26   GLU A CG    1 
ATOM   862  C  CD    . GLU C 3 26  ? 29.367  40.981 44.312  1.00 67.03  ? 26   GLU A CD    1 
ATOM   863  O  OE1   . GLU C 3 26  ? 28.967  39.798 44.210  1.00 68.45  ? 26   GLU A OE1   1 
ATOM   864  O  OE2   . GLU C 3 26  ? 28.863  41.796 45.118  1.00 67.36  ? 26   GLU A OE2   1 
ATOM   865  N  N     . ARG C 3 27  ? 33.554  43.019 42.691  1.00 66.15  ? 27   ARG A N     1 
ATOM   866  C  CA    . ARG C 3 27  ? 34.146  44.114 43.486  1.00 66.26  ? 27   ARG A CA    1 
ATOM   867  C  C     . ARG C 3 27  ? 33.191  45.291 43.653  1.00 65.58  ? 27   ARG A C     1 
ATOM   868  O  O     . ARG C 3 27  ? 32.169  45.362 42.991  1.00 65.88  ? 27   ARG A O     1 
ATOM   869  C  CB    . ARG C 3 27  ? 35.477  44.607 42.885  1.00 66.59  ? 27   ARG A CB    1 
ATOM   870  C  CG    . ARG C 3 27  ? 36.519  43.520 42.572  1.00 68.83  ? 27   ARG A CG    1 
ATOM   871  C  CD    . ARG C 3 27  ? 37.084  42.842 43.825  1.00 72.19  ? 27   ARG A CD    1 
ATOM   872  N  NE    . ARG C 3 27  ? 37.211  41.394 43.614  1.00 75.64  ? 27   ARG A NE    1 
ATOM   873  C  CZ    . ARG C 3 27  ? 37.713  40.522 44.493  1.00 77.04  ? 27   ARG A CZ    1 
ATOM   874  N  NH1   . ARG C 3 27  ? 38.169  40.928 45.682  1.00 77.36  ? 27   ARG A NH1   1 
ATOM   875  N  NH2   . ARG C 3 27  ? 37.761  39.231 44.179  1.00 76.87  ? 27   ARG A NH2   1 
ATOM   876  N  N     . THR C 3 28  ? 33.537  46.204 44.553  1.00 65.09  ? 28   THR A N     1 
ATOM   877  C  CA    . THR C 3 28  ? 32.845  47.482 44.691  1.00 64.56  ? 28   THR A CA    1 
ATOM   878  C  C     . THR C 3 28  ? 33.803  48.651 44.459  1.00 64.21  ? 28   THR A C     1 
ATOM   879  O  O     . THR C 3 28  ? 35.015  48.500 44.525  1.00 64.38  ? 28   THR A O     1 
ATOM   880  C  CB    . THR C 3 28  ? 32.193  47.626 46.077  1.00 64.60  ? 28   THR A CB    1 
ATOM   881  O  OG1   . THR C 3 28  ? 31.608  46.373 46.454  1.00 65.15  ? 28   THR A OG1   1 
ATOM   882  C  CG2   . THR C 3 28  ? 31.110  48.714 46.067  1.00 63.44  ? 28   THR A CG2   1 
ATOM   883  N  N     . ARG C 3 29  ? 33.242  49.814 44.171  1.00 63.81  ? 29   ARG A N     1 
ATOM   884  C  CA    . ARG C 3 29  ? 34.005  51.029 44.012  1.00 63.44  ? 29   ARG A CA    1 
ATOM   885  C  C     . ARG C 3 29  ? 33.290  52.146 44.744  1.00 63.79  ? 29   ARG A C     1 
ATOM   886  O  O     . ARG C 3 29  ? 32.061  52.168 44.817  1.00 63.94  ? 29   ARG A O     1 
ATOM   887  C  CB    . ARG C 3 29  ? 34.127  51.395 42.531  1.00 63.20  ? 29   ARG A CB    1 
ATOM   888  C  CG    . ARG C 3 29  ? 35.060  50.502 41.733  1.00 61.27  ? 29   ARG A CG    1 
ATOM   889  C  CD    . ARG C 3 29  ? 35.446  51.169 40.446  1.00 57.94  ? 29   ARG A CD    1 
ATOM   890  N  NE    . ARG C 3 29  ? 34.730  50.645 39.290  1.00 56.89  ? 29   ARG A NE    1 
ATOM   891  C  CZ    . ARG C 3 29  ? 35.307  50.001 38.273  1.00 56.54  ? 29   ARG A CZ    1 
ATOM   892  N  NH1   . ARG C 3 29  ? 36.618  49.789 38.259  1.00 56.18  ? 29   ARG A NH1   1 
ATOM   893  N  NH2   . ARG C 3 29  ? 34.571  49.559 37.258  1.00 55.97  ? 29   ARG A NH2   1 
ATOM   894  N  N     . GLU C 3 30  ? 34.060  53.058 45.314  1.00 63.98  ? 30   GLU A N     1 
ATOM   895  C  CA    . GLU C 3 30  ? 33.536  54.372 45.648  1.00 64.29  ? 30   GLU A CA    1 
ATOM   896  C  C     . GLU C 3 30  ? 34.295  55.352 44.760  1.00 63.84  ? 30   GLU A C     1 
ATOM   897  O  O     . GLU C 3 30  ? 35.514  55.511 44.891  1.00 63.92  ? 30   GLU A O     1 
ATOM   898  C  CB    . GLU C 3 30  ? 33.712  54.692 47.133  1.00 64.29  ? 30   GLU A CB    1 
ATOM   899  C  CG    . GLU C 3 30  ? 33.128  56.044 47.532  1.00 65.39  ? 30   GLU A CG    1 
ATOM   900  C  CD    . GLU C 3 30  ? 33.238  56.330 49.026  1.00 66.26  ? 30   GLU A CD    1 
ATOM   901  O  OE1   . GLU C 3 30  ? 33.157  55.374 49.837  1.00 68.18  ? 30   GLU A OE1   1 
ATOM   902  O  OE2   . GLU C 3 30  ? 33.397  57.517 49.390  1.00 67.31  ? 30   GLU A OE2   1 
ATOM   903  N  N     . VAL C 3 31  ? 33.584  55.971 43.825  1.00 63.37  ? 31   VAL A N     1 
ATOM   904  C  CA    . VAL C 3 31  ? 34.219  56.884 42.885  1.00 62.76  ? 31   VAL A CA    1 
ATOM   905  C  C     . VAL C 3 31  ? 33.740  58.315 43.119  1.00 62.91  ? 31   VAL A C     1 
ATOM   906  O  O     . VAL C 3 31  ? 32.558  58.576 43.325  1.00 63.13  ? 31   VAL A O     1 
ATOM   907  C  CB    . VAL C 3 31  ? 34.039  56.433 41.422  1.00 62.65  ? 31   VAL A CB    1 
ATOM   908  C  CG1   . VAL C 3 31  ? 34.824  57.325 40.474  1.00 62.06  ? 31   VAL A CG1   1 
ATOM   909  C  CG2   . VAL C 3 31  ? 34.491  54.981 41.259  1.00 62.47  ? 31   VAL A CG2   1 
ATOM   910  N  N     . GLU C 3 32  ? 34.699  59.230 43.130  1.00 62.92  ? 32   GLU A N     1 
ATOM   911  C  CA    . GLU C 3 32  ? 34.469  60.641 43.363  1.00 62.29  ? 32   GLU A CA    1 
ATOM   912  C  C     . GLU C 3 32  ? 34.321  61.300 41.987  1.00 61.46  ? 32   GLU A C     1 
ATOM   913  O  O     . GLU C 3 32  ? 35.231  61.994 41.523  1.00 61.54  ? 32   GLU A O     1 
ATOM   914  C  CB    . GLU C 3 32  ? 35.670  61.176 44.147  1.00 62.41  ? 32   GLU A CB    1 
ATOM   915  C  CG    . GLU C 3 32  ? 35.787  62.676 44.242  1.00 64.87  ? 32   GLU A CG    1 
ATOM   916  C  CD    . GLU C 3 32  ? 34.541  63.331 44.782  1.00 67.86  ? 32   GLU A CD    1 
ATOM   917  O  OE1   . GLU C 3 32  ? 33.804  62.666 45.557  1.00 68.70  ? 32   GLU A OE1   1 
ATOM   918  O  OE2   . GLU C 3 32  ? 34.309  64.514 44.427  1.00 68.51  ? 32   GLU A OE2   1 
ATOM   919  N  N     . TYR C 3 33  ? 33.172  61.068 41.342  1.00 60.21  ? 33   TYR A N     1 
ATOM   920  C  CA    . TYR C 3 33  ? 33.020  61.301 39.892  1.00 59.46  ? 33   TYR A CA    1 
ATOM   921  C  C     . TYR C 3 33  ? 33.049  62.768 39.453  1.00 59.07  ? 33   TYR A C     1 
ATOM   922  O  O     . TYR C 3 33  ? 32.425  63.649 40.061  1.00 58.60  ? 33   TYR A O     1 
ATOM   923  C  CB    . TYR C 3 33  ? 31.783  60.561 39.336  1.00 59.16  ? 33   TYR A CB    1 
ATOM   924  C  CG    . TYR C 3 33  ? 31.542  60.642 37.812  1.00 58.69  ? 33   TYR A CG    1 
ATOM   925  C  CD1   . TYR C 3 33  ? 32.465  60.132 36.894  1.00 57.82  ? 33   TYR A CD1   1 
ATOM   926  C  CD2   . TYR C 3 33  ? 30.363  61.186 37.304  1.00 56.10  ? 33   TYR A CD2   1 
ATOM   927  C  CE1   . TYR C 3 33  ? 32.225  60.201 35.512  1.00 56.99  ? 33   TYR A CE1   1 
ATOM   928  C  CE2   . TYR C 3 33  ? 30.122  61.259 35.940  1.00 54.72  ? 33   TYR A CE2   1 
ATOM   929  C  CZ    . TYR C 3 33  ? 31.048  60.767 35.053  1.00 56.62  ? 33   TYR A CZ    1 
ATOM   930  O  OH    . TYR C 3 33  ? 30.792  60.843 33.702  1.00 57.44  ? 33   TYR A OH    1 
ATOM   931  N  N     . LYS C 3 34  ? 33.816  63.003 38.394  1.00 58.83  ? 34   LYS A N     1 
ATOM   932  C  CA    . LYS C 3 34  ? 33.995  64.323 37.823  1.00 58.95  ? 34   LYS A CA    1 
ATOM   933  C  C     . LYS C 3 34  ? 33.227  64.400 36.509  1.00 58.16  ? 34   LYS A C     1 
ATOM   934  O  O     . LYS C 3 34  ? 33.753  64.041 35.455  1.00 57.79  ? 34   LYS A O     1 
ATOM   935  C  CB    . LYS C 3 34  ? 35.481  64.610 37.589  1.00 59.12  ? 34   LYS A CB    1 
ATOM   936  C  CG    . LYS C 3 34  ? 36.323  64.790 38.855  1.00 60.61  ? 34   LYS A CG    1 
ATOM   937  C  CD    . LYS C 3 34  ? 37.818  64.849 38.490  1.00 61.20  ? 34   LYS A CD    1 
ATOM   938  C  CE    . LYS C 3 34  ? 38.649  65.568 39.558  1.00 64.08  ? 34   LYS A CE    1 
ATOM   939  N  NZ    . LYS C 3 34  ? 40.134  65.508 39.292  1.00 64.65  ? 34   LYS A NZ    1 
ATOM   940  N  N     . PRO C 3 35  ? 31.981  64.897 36.567  1.00 57.81  ? 35   PRO A N     1 
ATOM   941  C  CA    . PRO C 3 35  ? 31.120  64.876 35.403  1.00 57.44  ? 35   PRO A CA    1 
ATOM   942  C  C     . PRO C 3 35  ? 31.391  66.080 34.520  1.00 57.47  ? 35   PRO A C     1 
ATOM   943  O  O     . PRO C 3 35  ? 32.004  67.052 34.960  1.00 57.71  ? 35   PRO A O     1 
ATOM   944  C  CB    . PRO C 3 35  ? 29.727  64.956 36.011  1.00 57.34  ? 35   PRO A CB    1 
ATOM   945  C  CG    . PRO C 3 35  ? 29.911  65.661 37.323  1.00 57.43  ? 35   PRO A CG    1 
ATOM   946  C  CD    . PRO C 3 35  ? 31.340  65.555 37.723  1.00 57.81  ? 35   PRO A CD    1 
ATOM   947  N  N     . SER C 3 36  ? 30.962  66.007 33.271  1.00 57.45  ? 36   SER A N     1 
ATOM   948  C  CA    . SER C 3 36  ? 31.091  67.137 32.378  1.00 57.43  ? 36   SER A CA    1 
ATOM   949  C  C     . SER C 3 36  ? 29.713  67.573 31.926  1.00 57.63  ? 36   SER A C     1 
ATOM   950  O  O     . SER C 3 36  ? 28.856  66.737 31.643  1.00 57.73  ? 36   SER A O     1 
ATOM   951  C  CB    . SER C 3 36  ? 31.945  66.776 31.171  1.00 57.38  ? 36   SER A CB    1 
ATOM   952  O  OG    . SER C 3 36  ? 33.262  66.461 31.564  1.00 57.41  ? 36   SER A OG    1 
ATOM   953  N  N     . LEU C 3 37  ? 29.486  68.881 31.887  1.00 57.66  ? 37   LEU A N     1 
ATOM   954  C  CA    . LEU C 3 37  ? 28.308  69.397 31.206  1.00 57.87  ? 37   LEU A CA    1 
ATOM   955  C  C     . LEU C 3 37  ? 28.750  70.335 30.089  1.00 58.09  ? 37   LEU A C     1 
ATOM   956  O  O     . LEU C 3 37  ? 29.950  70.479 29.846  1.00 57.90  ? 37   LEU A O     1 
ATOM   957  C  CB    . LEU C 3 37  ? 27.330  70.051 32.182  1.00 57.72  ? 37   LEU A CB    1 
ATOM   958  C  CG    . LEU C 3 37  ? 26.351  69.083 32.843  1.00 57.42  ? 37   LEU A CG    1 
ATOM   959  C  CD1   . LEU C 3 37  ? 25.922  69.615 34.199  1.00 57.27  ? 37   LEU A CD1   1 
ATOM   960  C  CD2   . LEU C 3 37  ? 25.151  68.828 31.949  1.00 56.84  ? 37   LEU A CD2   1 
ATOM   961  N  N     . PHE C 3 38  ? 27.790  70.941 29.392  1.00 58.30  ? 38   PHE A N     1 
ATOM   962  C  CA    . PHE C 3 38  ? 28.099  71.743 28.214  1.00 58.47  ? 38   PHE A CA    1 
ATOM   963  C  C     . PHE C 3 38  ? 27.267  73.007 28.128  1.00 58.84  ? 38   PHE A C     1 
ATOM   964  O  O     . PHE C 3 38  ? 26.155  73.077 28.656  1.00 58.74  ? 38   PHE A O     1 
ATOM   965  C  CB    . PHE C 3 38  ? 27.920  70.906 26.946  1.00 58.30  ? 38   PHE A CB    1 
ATOM   966  C  CG    . PHE C 3 38  ? 28.617  69.581 27.001  1.00 57.87  ? 38   PHE A CG    1 
ATOM   967  C  CD1   . PHE C 3 38  ? 28.229  68.614 27.920  1.00 57.33  ? 38   PHE A CD1   1 
ATOM   968  C  CD2   . PHE C 3 38  ? 29.654  69.300 26.133  1.00 57.27  ? 38   PHE A CD2   1 
ATOM   969  C  CE1   . PHE C 3 38  ? 28.878  67.409 27.994  1.00 57.16  ? 38   PHE A CE1   1 
ATOM   970  C  CE2   . PHE C 3 38  ? 30.300  68.092 26.186  1.00 56.92  ? 38   PHE A CE2   1 
ATOM   971  C  CZ    . PHE C 3 38  ? 29.915  67.143 27.120  1.00 57.46  ? 38   PHE A CZ    1 
ATOM   972  N  N     . ALA C 3 39  ? 27.834  74.003 27.458  1.00 59.53  ? 39   ALA A N     1 
ATOM   973  C  CA    . ALA C 3 39  ? 27.166  75.267 27.179  1.00 60.15  ? 39   ALA A CA    1 
ATOM   974  C  C     . ALA C 3 39  ? 27.529  75.695 25.763  1.00 60.82  ? 39   ALA A C     1 
ATOM   975  O  O     . ALA C 3 39  ? 28.630  75.410 25.288  1.00 60.70  ? 39   ALA A O     1 
ATOM   976  C  CB    . ALA C 3 39  ? 27.577  76.327 28.194  1.00 59.77  ? 39   ALA A CB    1 
ATOM   977  N  N     . HIS C 3 40  ? 26.602  76.359 25.079  1.00 61.94  ? 40   HIS A N     1 
ATOM   978  C  CA    . HIS C 3 40  ? 26.892  76.876 23.747  1.00 63.34  ? 40   HIS A CA    1 
ATOM   979  C  C     . HIS C 3 40  ? 28.038  77.884 23.829  1.00 63.84  ? 40   HIS A C     1 
ATOM   980  O  O     . HIS C 3 40  ? 28.408  78.349 24.920  1.00 63.78  ? 40   HIS A O     1 
ATOM   981  C  CB    . HIS C 3 40  ? 25.661  77.547 23.126  1.00 63.67  ? 40   HIS A CB    1 
ATOM   982  C  CG    . HIS C 3 40  ? 24.570  76.595 22.732  1.00 65.05  ? 40   HIS A CG    1 
ATOM   983  N  ND1   . HIS C 3 40  ? 23.326  76.601 23.331  1.00 65.29  ? 40   HIS A ND1   1 
ATOM   984  C  CD2   . HIS C 3 40  ? 24.524  75.630 21.781  1.00 66.04  ? 40   HIS A CD2   1 
ATOM   985  C  CE1   . HIS C 3 40  ? 22.565  75.674 22.774  1.00 65.61  ? 40   HIS A CE1   1 
ATOM   986  N  NE2   . HIS C 3 40  ? 23.267  75.070 21.831  1.00 66.44  ? 40   HIS A NE2   1 
ATOM   987  N  N     . CYS C 3 41  ? 28.594  78.215 22.671  1.00 64.57  ? 41   CYS A N     1 
ATOM   988  C  CA    . CYS C 3 41  ? 29.686  79.178 22.589  1.00 65.36  ? 41   CYS A CA    1 
ATOM   989  C  C     . CYS C 3 41  ? 29.741  79.772 21.184  1.00 65.94  ? 41   CYS A C     1 
ATOM   990  O  O     . CYS C 3 41  ? 29.067  79.272 20.282  1.00 65.98  ? 41   CYS A O     1 
ATOM   991  C  CB    . CYS C 3 41  ? 31.001  78.500 22.943  1.00 65.27  ? 41   CYS A CB    1 
ATOM   992  S  SG    . CYS C 3 41  ? 31.317  77.068 21.927  1.00 65.36  ? 41   CYS A SG    1 
ATOM   993  N  N     . PRO C 3 42  ? 30.546  80.833 20.984  1.00 66.68  ? 42   PRO A N     1 
ATOM   994  C  CA    . PRO C 3 42  ? 30.498  81.487 19.668  1.00 67.41  ? 42   PRO A CA    1 
ATOM   995  C  C     . PRO C 3 42  ? 31.134  80.584 18.609  1.00 68.19  ? 42   PRO A C     1 
ATOM   996  O  O     . PRO C 3 42  ? 31.910  79.692 18.972  1.00 68.38  ? 42   PRO A O     1 
ATOM   997  C  CB    . PRO C 3 42  ? 31.310  82.774 19.876  1.00 67.50  ? 42   PRO A CB    1 
ATOM   998  C  CG    . PRO C 3 42  ? 31.599  82.854 21.377  1.00 66.85  ? 42   PRO A CG    1 
ATOM   999  C  CD    . PRO C 3 42  ? 31.534  81.461 21.882  1.00 66.55  ? 42   PRO A CD    1 
ATOM   1000 N  N     . GLU C 3 43  ? 30.799  80.788 17.330  1.00 68.99  ? 43   GLU A N     1 
ATOM   1001 C  CA    . GLU C 3 43  ? 31.251  79.883 16.255  1.00 69.76  ? 43   GLU A CA    1 
ATOM   1002 C  C     . GLU C 3 43  ? 32.756  79.684 16.326  1.00 70.44  ? 43   GLU A C     1 
ATOM   1003 O  O     . GLU C 3 43  ? 33.248  78.555 16.425  1.00 70.86  ? 43   GLU A O     1 
ATOM   1004 C  CB    . GLU C 3 43  ? 30.844  80.399 14.872  1.00 69.72  ? 43   GLU A CB    1 
ATOM   1005 N  N     . SER C 3 44  ? 33.475  80.800 16.316  1.00 71.06  ? 44   SER A N     1 
ATOM   1006 C  CA    . SER C 3 44  ? 34.918  80.824 16.476  1.00 71.53  ? 44   SER A CA    1 
ATOM   1007 C  C     . SER C 3 44  ? 35.300  80.491 17.919  1.00 71.80  ? 44   SER A C     1 
ATOM   1008 O  O     . SER C 3 44  ? 35.729  81.352 18.689  1.00 71.67  ? 44   SER A O     1 
ATOM   1009 C  CB    . SER C 3 44  ? 35.426  82.210 16.090  1.00 71.88  ? 44   SER A CB    1 
ATOM   1010 O  OG    . SER C 3 44  ? 34.476  83.206 16.471  1.00 72.07  ? 44   SER A OG    1 
ATOM   1011 N  N     . GLN C 3 45  ? 35.104  79.229 18.279  1.00 72.40  ? 45   GLN A N     1 
ATOM   1012 C  CA    . GLN C 3 45  ? 35.532  78.690 19.562  1.00 72.93  ? 45   GLN A CA    1 
ATOM   1013 C  C     . GLN C 3 45  ? 35.762  77.208 19.322  1.00 72.99  ? 45   GLN A C     1 
ATOM   1014 O  O     . GLN C 3 45  ? 34.871  76.388 19.572  1.00 73.05  ? 45   GLN A O     1 
ATOM   1015 C  CB    . GLN C 3 45  ? 34.455  78.885 20.627  1.00 72.98  ? 45   GLN A CB    1 
ATOM   1016 C  CG    . GLN C 3 45  ? 34.945  78.680 22.053  1.00 74.29  ? 45   GLN A CG    1 
ATOM   1017 C  CD    . GLN C 3 45  ? 35.473  79.961 22.682  1.00 76.27  ? 45   GLN A CD    1 
ATOM   1018 O  OE1   . GLN C 3 45  ? 35.506  81.016 22.042  1.00 76.64  ? 45   GLN A OE1   1 
ATOM   1019 N  NE2   . GLN C 3 45  ? 35.884  79.875 23.948  1.00 76.73  ? 45   GLN A NE2   1 
ATOM   1020 N  N     . ALA C 3 46  ? 36.952  76.883 18.810  1.00 73.07  ? 46   ALA A N     1 
ATOM   1021 C  CA    . ALA C 3 46  ? 37.321  75.510 18.413  1.00 72.92  ? 46   ALA A CA    1 
ATOM   1022 C  C     . ALA C 3 46  ? 36.855  74.453 19.428  1.00 72.66  ? 46   ALA A C     1 
ATOM   1023 O  O     . ALA C 3 46  ? 37.060  74.614 20.646  1.00 72.63  ? 46   ALA A O     1 
ATOM   1024 C  CB    . ALA C 3 46  ? 38.846  75.404 18.169  1.00 72.61  ? 46   ALA A CB    1 
ATOM   1025 N  N     . THR C 3 47  ? 36.220  73.390 18.928  1.00 72.00  ? 47   THR A N     1 
ATOM   1026 C  CA    . THR C 3 47  ? 35.683  72.355 19.806  1.00 71.70  ? 47   THR A CA    1 
ATOM   1027 C  C     . THR C 3 47  ? 35.433  71.025 19.102  1.00 71.63  ? 47   THR A C     1 
ATOM   1028 O  O     . THR C 3 47  ? 35.263  70.967 17.880  1.00 71.76  ? 47   THR A O     1 
ATOM   1029 C  CB    . THR C 3 47  ? 34.395  72.852 20.542  1.00 71.80  ? 47   THR A CB    1 
ATOM   1030 O  OG1   . THR C 3 47  ? 34.078  71.973 21.627  1.00 71.49  ? 47   THR A OG1   1 
ATOM   1031 C  CG2   . THR C 3 47  ? 33.203  72.979 19.586  1.00 71.59  ? 47   THR A CG2   1 
ATOM   1032 N  N     . LYS C 3 48  ? 35.418  69.957 19.889  1.00 71.41  ? 48   LYS A N     1 
ATOM   1033 C  CA    . LYS C 3 48  ? 35.120  68.629 19.378  1.00 71.51  ? 48   LYS A CA    1 
ATOM   1034 C  C     . LYS C 3 48  ? 33.624  68.291 19.549  1.00 71.11  ? 48   LYS A C     1 
ATOM   1035 O  O     . LYS C 3 48  ? 33.085  67.434 18.839  1.00 71.44  ? 48   LYS A O     1 
ATOM   1036 C  CB    . LYS C 3 48  ? 36.004  67.596 20.084  1.00 71.61  ? 48   LYS A CB    1 
ATOM   1037 C  CG    . LYS C 3 48  ? 36.654  66.564 19.147  1.00 72.46  ? 48   LYS A CG    1 
ATOM   1038 C  CD    . LYS C 3 48  ? 37.827  65.798 19.812  1.00 72.81  ? 48   LYS A CD    1 
ATOM   1039 C  CE    . LYS C 3 48  ? 37.354  64.626 20.709  1.00 72.88  ? 48   LYS A CE    1 
ATOM   1040 N  NZ    . LYS C 3 48  ? 36.884  65.082 22.053  1.00 72.32  ? 48   LYS A NZ    1 
ATOM   1041 N  N     . TYR C 3 49  ? 32.962  69.000 20.465  1.00 70.28  ? 49   TYR A N     1 
ATOM   1042 C  CA    . TYR C 3 49  ? 31.573  68.745 20.849  1.00 69.45  ? 49   TYR A CA    1 
ATOM   1043 C  C     . TYR C 3 49  ? 30.556  69.656 20.158  1.00 68.99  ? 49   TYR A C     1 
ATOM   1044 O  O     . TYR C 3 49  ? 30.680  70.879 20.186  1.00 69.26  ? 49   TYR A O     1 
ATOM   1045 C  CB    . TYR C 3 49  ? 31.430  68.930 22.352  1.00 69.38  ? 49   TYR A CB    1 
ATOM   1046 C  CG    . TYR C 3 49  ? 32.480  68.221 23.175  1.00 69.42  ? 49   TYR A CG    1 
ATOM   1047 C  CD1   . TYR C 3 49  ? 32.288  66.907 23.590  1.00 69.71  ? 49   TYR A CD1   1 
ATOM   1048 C  CD2   . TYR C 3 49  ? 33.661  68.867 23.550  1.00 69.59  ? 49   TYR A CD2   1 
ATOM   1049 C  CE1   . TYR C 3 49  ? 33.243  66.244 24.356  1.00 69.92  ? 49   TYR A CE1   1 
ATOM   1050 C  CE2   . TYR C 3 49  ? 34.629  68.210 24.318  1.00 69.52  ? 49   TYR A CE2   1 
ATOM   1051 C  CZ    . TYR C 3 49  ? 34.407  66.900 24.718  1.00 69.23  ? 49   TYR A CZ    1 
ATOM   1052 O  OH    . TYR C 3 49  ? 35.331  66.231 25.479  1.00 68.76  ? 49   TYR A OH    1 
ATOM   1053 N  N     . PHE C 3 50  ? 29.536  69.062 19.553  1.00 68.27  ? 50   PHE A N     1 
ATOM   1054 C  CA    . PHE C 3 50  ? 28.442  69.837 18.954  1.00 67.47  ? 50   PHE A CA    1 
ATOM   1055 C  C     . PHE C 3 50  ? 27.070  69.321 19.390  1.00 66.83  ? 50   PHE A C     1 
ATOM   1056 O  O     . PHE C 3 50  ? 26.911  68.133 19.654  1.00 66.47  ? 50   PHE A O     1 
ATOM   1057 C  CB    . PHE C 3 50  ? 28.571  69.837 17.435  1.00 67.43  ? 50   PHE A CB    1 
ATOM   1058 C  CG    . PHE C 3 50  ? 29.861  70.416 16.956  1.00 68.14  ? 50   PHE A CG    1 
ATOM   1059 C  CD1   . PHE C 3 50  ? 31.036  69.660 16.990  1.00 68.86  ? 50   PHE A CD1   1 
ATOM   1060 C  CD2   . PHE C 3 50  ? 29.918  71.727 16.493  1.00 69.08  ? 50   PHE A CD2   1 
ATOM   1061 C  CE1   . PHE C 3 50  ? 32.247  70.196 16.558  1.00 68.99  ? 50   PHE A CE1   1 
ATOM   1062 C  CE2   . PHE C 3 50  ? 31.125  72.280 16.054  1.00 69.17  ? 50   PHE A CE2   1 
ATOM   1063 C  CZ    . PHE C 3 50  ? 32.293  71.511 16.085  1.00 68.93  ? 50   PHE A CZ    1 
ATOM   1064 N  N     . ASP C 3 51  ? 26.082  70.212 19.484  1.00 66.30  ? 51   ASP A N     1 
ATOM   1065 C  CA    . ASP C 3 51  ? 24.724  69.778 19.836  1.00 65.84  ? 51   ASP A CA    1 
ATOM   1066 C  C     . ASP C 3 51  ? 24.103  69.026 18.661  1.00 65.25  ? 51   ASP A C     1 
ATOM   1067 O  O     . ASP C 3 51  ? 24.687  68.981 17.578  1.00 65.44  ? 51   ASP A O     1 
ATOM   1068 C  CB    . ASP C 3 51  ? 23.853  70.935 20.383  1.00 65.74  ? 51   ASP A CB    1 
ATOM   1069 C  CG    . ASP C 3 51  ? 23.114  71.743 19.293  1.00 66.69  ? 51   ASP A CG    1 
ATOM   1070 O  OD1   . ASP C 3 51  ? 23.129  71.403 18.087  1.00 66.94  ? 51   ASP A OD1   1 
ATOM   1071 O  OD2   . ASP C 3 51  ? 22.484  72.757 19.676  1.00 67.47  ? 51   ASP A OD2   1 
ATOM   1072 N  N     . ILE C 3 52  ? 22.943  68.419 18.857  1.00 64.63  ? 52   ILE A N     1 
ATOM   1073 C  CA    . ILE C 3 52  ? 22.370  67.632 17.766  1.00 64.18  ? 52   ILE A CA    1 
ATOM   1074 C  C     . ILE C 3 52  ? 21.878  68.469 16.562  1.00 64.12  ? 52   ILE A C     1 
ATOM   1075 O  O     . ILE C 3 52  ? 21.693  67.928 15.471  1.00 64.44  ? 52   ILE A O     1 
ATOM   1076 C  CB    . ILE C 3 52  ? 21.329  66.613 18.258  1.00 63.77  ? 52   ILE A CB    1 
ATOM   1077 C  CG1   . ILE C 3 52  ? 20.137  67.318 18.885  1.00 63.46  ? 52   ILE A CG1   1 
ATOM   1078 C  CG2   . ILE C 3 52  ? 21.971  65.678 19.265  1.00 63.74  ? 52   ILE A CG2   1 
ATOM   1079 C  CD1   . ILE C 3 52  ? 18.926  66.447 19.001  1.00 63.85  ? 52   ILE A CD1   1 
ATOM   1080 N  N     . TYR C 3 53  ? 21.717  69.779 16.745  1.00 63.75  ? 53   TYR A N     1 
ATOM   1081 C  CA    . TYR C 3 53  ? 21.270  70.663 15.661  1.00 63.63  ? 53   TYR A CA    1 
ATOM   1082 C  C     . TYR C 3 53  ? 22.441  71.208 14.860  1.00 63.58  ? 53   TYR A C     1 
ATOM   1083 O  O     . TYR C 3 53  ? 22.243  71.773 13.778  1.00 63.48  ? 53   TYR A O     1 
ATOM   1084 C  CB    . TYR C 3 53  ? 20.375  71.788 16.204  1.00 63.62  ? 53   TYR A CB    1 
ATOM   1085 C  CG    . TYR C 3 53  ? 19.294  71.237 17.112  1.00 63.95  ? 53   TYR A CG    1 
ATOM   1086 C  CD1   . TYR C 3 53  ? 19.532  71.068 18.481  1.00 63.46  ? 53   TYR A CD1   1 
ATOM   1087 C  CD2   . TYR C 3 53  ? 18.055  70.833 16.599  1.00 63.94  ? 53   TYR A CD2   1 
ATOM   1088 C  CE1   . TYR C 3 53  ? 18.565  70.543 19.317  1.00 63.34  ? 53   TYR A CE1   1 
ATOM   1089 C  CE2   . TYR C 3 53  ? 17.074  70.298 17.430  1.00 63.38  ? 53   TYR A CE2   1 
ATOM   1090 C  CZ    . TYR C 3 53  ? 17.341  70.152 18.788  1.00 63.77  ? 53   TYR A CZ    1 
ATOM   1091 O  OH    . TYR C 3 53  ? 16.390  69.619 19.635  1.00 63.48  ? 53   TYR A OH    1 
ATOM   1092 N  N     . GLY C 3 54  ? 23.653  71.024 15.399  1.00 63.56  ? 54   GLY A N     1 
ATOM   1093 C  CA    . GLY C 3 54  ? 24.914  71.362 14.721  1.00 62.96  ? 54   GLY A CA    1 
ATOM   1094 C  C     . GLY C 3 54  ? 25.747  72.428 15.416  1.00 62.90  ? 54   GLY A C     1 
ATOM   1095 O  O     . GLY C 3 54  ? 26.787  72.844 14.893  1.00 63.06  ? 54   GLY A O     1 
ATOM   1096 N  N     . LYS C 3 55  ? 25.313  72.855 16.603  1.00 62.51  ? 55   LYS A N     1 
ATOM   1097 C  CA    . LYS C 3 55  ? 25.846  74.072 17.243  1.00 62.30  ? 55   LYS A CA    1 
ATOM   1098 C  C     . LYS C 3 55  ? 26.973  73.848 18.269  1.00 61.59  ? 55   LYS A C     1 
ATOM   1099 O  O     . LYS C 3 55  ? 26.845  73.010 19.147  1.00 61.71  ? 55   LYS A O     1 
ATOM   1100 C  CB    . LYS C 3 55  ? 24.706  74.912 17.843  1.00 62.39  ? 55   LYS A CB    1 
ATOM   1101 C  CG    . LYS C 3 55  ? 23.851  75.635 16.780  1.00 63.84  ? 55   LYS A CG    1 
ATOM   1102 C  CD    . LYS C 3 55  ? 23.258  76.938 17.308  1.00 66.75  ? 55   LYS A CD    1 
ATOM   1103 C  CE    . LYS C 3 55  ? 24.255  78.092 17.193  1.00 67.59  ? 55   LYS A CE    1 
ATOM   1104 N  NZ    . LYS C 3 55  ? 24.297  78.906 18.442  1.00 67.85  ? 55   LYS A NZ    1 
ATOM   1105 N  N     . PRO C 3 56  ? 28.081  74.609 18.154  1.00 61.14  ? 56   PRO A N     1 
ATOM   1106 C  CA    . PRO C 3 56  ? 29.265  74.395 18.994  1.00 60.75  ? 56   PRO A CA    1 
ATOM   1107 C  C     . PRO C 3 56  ? 28.998  74.504 20.490  1.00 60.26  ? 56   PRO A C     1 
ATOM   1108 O  O     . PRO C 3 56  ? 28.245  75.383 20.922  1.00 60.21  ? 56   PRO A O     1 
ATOM   1109 C  CB    . PRO C 3 56  ? 30.216  75.521 18.561  1.00 60.80  ? 56   PRO A CB    1 
ATOM   1110 C  CG    . PRO C 3 56  ? 29.367  76.512 17.855  1.00 60.91  ? 56   PRO A CG    1 
ATOM   1111 C  CD    . PRO C 3 56  ? 28.285  75.720 17.205  1.00 61.03  ? 56   PRO A CD    1 
ATOM   1112 N  N     . CYS C 3 57  ? 29.618  73.610 21.261  1.00 59.71  ? 57   CYS A N     1 
ATOM   1113 C  CA    . CYS C 3 57  ? 29.536  73.638 22.716  1.00 59.44  ? 57   CYS A CA    1 
ATOM   1114 C  C     . CYS C 3 57  ? 30.893  73.402 23.341  1.00 59.28  ? 57   CYS A C     1 
ATOM   1115 O  O     . CYS C 3 57  ? 31.684  72.615 22.836  1.00 59.29  ? 57   CYS A O     1 
ATOM   1116 C  CB    . CYS C 3 57  ? 28.575  72.570 23.224  1.00 59.65  ? 57   CYS A CB    1 
ATOM   1117 S  SG    . CYS C 3 57  ? 26.880  72.753 22.654  1.00 60.42  ? 57   CYS A SG    1 
ATOM   1118 N  N     . THR C 3 58  ? 31.156  74.090 24.447  1.00 59.19  ? 58   THR A N     1 
ATOM   1119 C  CA    . THR C 3 58  ? 32.358  73.846 25.244  1.00 58.97  ? 58   THR A CA    1 
ATOM   1120 C  C     . THR C 3 58  ? 32.013  72.888 26.377  1.00 58.88  ? 58   THR A C     1 
ATOM   1121 O  O     . THR C 3 58  ? 30.971  73.024 27.020  1.00 58.51  ? 58   THR A O     1 
ATOM   1122 C  CB    . THR C 3 58  ? 32.985  75.169 25.825  1.00 58.89  ? 58   THR A CB    1 
ATOM   1123 O  OG1   . THR C 3 58  ? 32.651  75.330 27.214  1.00 58.69  ? 58   THR A OG1   1 
ATOM   1124 C  CG2   . THR C 3 58  ? 32.526  76.391 25.045  1.00 58.38  ? 58   THR A CG2   1 
ATOM   1125 N  N     . ARG C 3 59  ? 32.888  71.921 26.617  1.00 59.11  ? 59   ARG A N     1 
ATOM   1126 C  CA    . ARG C 3 59  ? 32.720  71.013 27.751  1.00 59.49  ? 59   ARG A CA    1 
ATOM   1127 C  C     . ARG C 3 59  ? 33.156  71.718 29.026  1.00 59.77  ? 59   ARG A C     1 
ATOM   1128 O  O     . ARG C 3 59  ? 34.175  72.400 29.036  1.00 60.29  ? 59   ARG A O     1 
ATOM   1129 C  CB    . ARG C 3 59  ? 33.514  69.722 27.542  1.00 59.04  ? 59   ARG A CB    1 
ATOM   1130 C  CG    . ARG C 3 59  ? 33.608  68.827 28.772  1.00 59.54  ? 59   ARG A CG    1 
ATOM   1131 C  CD    . ARG C 3 59  ? 34.116  67.441 28.396  1.00 60.23  ? 59   ARG A CD    1 
ATOM   1132 N  NE    . ARG C 3 59  ? 35.331  67.063 29.127  1.00 59.79  ? 59   ARG A NE    1 
ATOM   1133 C  CZ    . ARG C 3 59  ? 36.570  67.226 28.664  1.00 60.21  ? 59   ARG A CZ    1 
ATOM   1134 N  NH1   . ARG C 3 59  ? 36.781  67.774 27.471  1.00 60.17  ? 59   ARG A NH1   1 
ATOM   1135 N  NH2   . ARG C 3 59  ? 37.611  66.846 29.395  1.00 61.93  ? 59   ARG A NH2   1 
ATOM   1136 N  N     . LYS C 3 60  ? 32.366  71.569 30.084  1.00 60.14  ? 60   LYS A N     1 
ATOM   1137 C  CA    . LYS C 3 60  ? 32.685  72.122 31.388  1.00 60.34  ? 60   LYS A CA    1 
ATOM   1138 C  C     . LYS C 3 60  ? 32.863  70.963 32.334  1.00 60.71  ? 60   LYS A C     1 
ATOM   1139 O  O     . LYS C 3 60  ? 31.904  70.295 32.695  1.00 60.80  ? 60   LYS A O     1 
ATOM   1140 C  CB    . LYS C 3 60  ? 31.578  73.051 31.891  1.00 60.27  ? 60   LYS A CB    1 
ATOM   1141 C  CG    . LYS C 3 60  ? 31.356  74.274 31.011  1.00 60.76  ? 60   LYS A CG    1 
ATOM   1142 C  CD    . LYS C 3 60  ? 31.157  75.527 31.845  1.00 61.46  ? 60   LYS A CD    1 
ATOM   1143 C  CE    . LYS C 3 60  ? 31.349  76.764 30.986  1.00 62.44  ? 60   LYS A CE    1 
ATOM   1144 N  NZ    . LYS C 3 60  ? 31.669  77.991 31.780  1.00 62.58  ? 60   LYS A NZ    1 
ATOM   1145 N  N     . LEU C 3 61  ? 34.112  70.717 32.702  1.00 61.41  ? 61   LEU A N     1 
ATOM   1146 C  CA    . LEU C 3 61  ? 34.460  69.701 33.668  1.00 61.99  ? 61   LEU A CA    1 
ATOM   1147 C  C     . LEU C 3 61  ? 34.180  70.251 35.051  1.00 62.38  ? 61   LEU A C     1 
ATOM   1148 O  O     . LEU C 3 61  ? 34.336  71.464 35.273  1.00 62.46  ? 61   LEU A O     1 
ATOM   1149 C  CB    . LEU C 3 61  ? 35.938  69.347 33.519  1.00 62.16  ? 61   LEU A CB    1 
ATOM   1150 C  CG    . LEU C 3 61  ? 36.502  68.023 34.065  1.00 62.90  ? 61   LEU A CG    1 
ATOM   1151 C  CD1   . LEU C 3 61  ? 37.061  68.196 35.479  1.00 63.81  ? 61   LEU A CD1   1 
ATOM   1152 C  CD2   . LEU C 3 61  ? 35.490  66.851 33.990  1.00 64.09  ? 61   LEU A CD2   1 
ATOM   1153 N  N     . PHE C 3 62  ? 33.763  69.367 35.964  1.00 62.63  ? 62   PHE A N     1 
ATOM   1154 C  CA    . PHE C 3 62  ? 33.418  69.751 37.340  1.00 63.28  ? 62   PHE A CA    1 
ATOM   1155 C  C     . PHE C 3 62  ? 34.143  68.937 38.401  1.00 63.94  ? 62   PHE A C     1 
ATOM   1156 O  O     . PHE C 3 62  ? 34.344  67.722 38.249  1.00 64.18  ? 62   PHE A O     1 
ATOM   1157 C  CB    . PHE C 3 62  ? 31.917  69.608 37.591  1.00 63.19  ? 62   PHE A CB    1 
ATOM   1158 C  CG    . PHE C 3 62  ? 31.077  70.600 36.845  1.00 63.32  ? 62   PHE A CG    1 
ATOM   1159 C  CD1   . PHE C 3 62  ? 30.829  71.864 37.383  1.00 63.15  ? 62   PHE A CD1   1 
ATOM   1160 C  CD2   . PHE C 3 62  ? 30.520  70.267 35.607  1.00 62.68  ? 62   PHE A CD2   1 
ATOM   1161 C  CE1   . PHE C 3 62  ? 30.046  72.790 36.699  1.00 62.75  ? 62   PHE A CE1   1 
ATOM   1162 C  CE2   . PHE C 3 62  ? 29.737  71.177 34.909  1.00 62.83  ? 62   PHE A CE2   1 
ATOM   1163 C  CZ    . PHE C 3 62  ? 29.500  72.450 35.454  1.00 63.27  ? 62   PHE A CZ    1 
ATOM   1164 N  N     . ALA C 3 63  ? 34.480  69.607 39.501  1.00 64.43  ? 63   ALA A N     1 
ATOM   1165 C  CA    . ALA C 3 63  ? 35.157  68.983 40.648  1.00 64.91  ? 63   ALA A CA    1 
ATOM   1166 C  C     . ALA C 3 63  ? 34.365  67.821 41.254  1.00 65.12  ? 63   ALA A C     1 
ATOM   1167 O  O     . ALA C 3 63  ? 34.944  66.804 41.650  1.00 65.19  ? 63   ALA A O     1 
ATOM   1168 C  CB    . ALA C 3 63  ? 35.457  70.033 41.720  1.00 64.83  ? 63   ALA A CB    1 
ATOM   1169 N  N     . ASN C 3 64  ? 33.046  68.000 41.316  1.00 65.38  ? 64   ASN A N     1 
ATOM   1170 C  CA    . ASN C 3 64  ? 32.106  67.036 41.883  1.00 65.58  ? 64   ASN A CA    1 
ATOM   1171 C  C     . ASN C 3 64  ? 30.676  67.360 41.434  1.00 65.58  ? 64   ASN A C     1 
ATOM   1172 O  O     . ASN C 3 64  ? 30.411  68.445 40.906  1.00 65.65  ? 64   ASN A O     1 
ATOM   1173 C  CB    . ASN C 3 64  ? 32.199  67.012 43.416  1.00 65.77  ? 64   ASN A CB    1 
ATOM   1174 C  CG    . ASN C 3 64  ? 32.084  68.398 44.034  1.00 66.51  ? 64   ASN A CG    1 
ATOM   1175 O  OD1   . ASN C 3 64  ? 31.039  69.052 43.957  1.00 67.29  ? 64   ASN A OD1   1 
ATOM   1176 N  ND2   . ASN C 3 64  ? 33.162  68.850 44.656  1.00 67.32  ? 64   ASN A ND2   1 
ATOM   1177 N  N     . MET C 3 65  ? 29.765  66.420 41.663  1.00 65.48  ? 65   MET A N     1 
ATOM   1178 C  CA    . MET C 3 65  ? 28.412  66.472 41.114  1.00 65.26  ? 65   MET A CA    1 
ATOM   1179 C  C     . MET C 3 65  ? 27.563  67.583 41.709  1.00 65.19  ? 65   MET A C     1 
ATOM   1180 O  O     . MET C 3 65  ? 26.729  68.172 41.014  1.00 65.16  ? 65   MET A O     1 
ATOM   1181 C  CB    . MET C 3 65  ? 27.723  65.122 41.302  1.00 65.13  ? 65   MET A CB    1 
ATOM   1182 C  CG    . MET C 3 65  ? 28.451  63.976 40.615  1.00 65.60  ? 65   MET A CG    1 
ATOM   1183 S  SD    . MET C 3 65  ? 27.749  62.345 40.900  1.00 65.80  ? 65   MET A SD    1 
ATOM   1184 C  CE    . MET C 3 65  ? 28.269  62.004 42.575  1.00 65.77  ? 65   MET A CE    1 
ATOM   1185 N  N     . ARG C 3 66  ? 27.770  67.865 42.992  1.00 65.22  ? 66   ARG A N     1 
ATOM   1186 C  CA    . ARG C 3 66  ? 27.100  68.983 43.635  1.00 65.48  ? 66   ARG A CA    1 
ATOM   1187 C  C     . ARG C 3 66  ? 27.383  70.262 42.841  1.00 65.30  ? 66   ARG A C     1 
ATOM   1188 O  O     . ARG C 3 66  ? 26.463  71.009 42.493  1.00 65.37  ? 66   ARG A O     1 
ATOM   1189 C  CB    . ARG C 3 66  ? 27.549  69.126 45.088  1.00 65.59  ? 66   ARG A CB    1 
ATOM   1190 C  CG    . ARG C 3 66  ? 26.913  70.305 45.823  1.00 67.27  ? 66   ARG A CG    1 
ATOM   1191 C  CD    . ARG C 3 66  ? 27.591  70.518 47.168  1.00 70.18  ? 66   ARG A CD    1 
ATOM   1192 N  NE    . ARG C 3 66  ? 27.654  71.926 47.558  1.00 72.58  ? 66   ARG A NE    1 
ATOM   1193 C  CZ    . ARG C 3 66  ? 28.439  72.405 48.523  1.00 73.39  ? 66   ARG A CZ    1 
ATOM   1194 N  NH1   . ARG C 3 66  ? 29.235  71.590 49.210  1.00 74.15  ? 66   ARG A NH1   1 
ATOM   1195 N  NH2   . ARG C 3 66  ? 28.432  73.703 48.804  1.00 73.28  ? 66   ARG A NH2   1 
ATOM   1196 N  N     . ASP C 3 67  ? 28.656  70.482 42.525  1.00 64.84  ? 67   ASP A N     1 
ATOM   1197 C  CA    . ASP C 3 67  ? 29.059  71.642 41.740  1.00 64.63  ? 67   ASP A CA    1 
ATOM   1198 C  C     . ASP C 3 67  ? 28.446  71.665 40.334  1.00 64.29  ? 67   ASP A C     1 
ATOM   1199 O  O     . ASP C 3 67  ? 28.150  72.739 39.796  1.00 64.52  ? 67   ASP A O     1 
ATOM   1200 C  CB    . ASP C 3 67  ? 30.591  71.767 41.695  1.00 64.52  ? 67   ASP A CB    1 
ATOM   1201 C  CG    . ASP C 3 67  ? 31.186  72.199 43.034  1.00 64.36  ? 67   ASP A CG    1 
ATOM   1202 O  OD1   . ASP C 3 67  ? 30.422  72.481 43.990  1.00 64.39  ? 67   ASP A OD1   1 
ATOM   1203 O  OD2   . ASP C 3 67  ? 32.425  72.260 43.132  1.00 64.71  ? 67   ASP A OD2   1 
ATOM   1204 N  N     . ALA C 3 68  ? 28.244  70.483 39.758  1.00 63.76  ? 68   ALA A N     1 
ATOM   1205 C  CA    . ALA C 3 68  ? 27.589  70.357 38.458  1.00 63.32  ? 68   ALA A CA    1 
ATOM   1206 C  C     . ALA C 3 68  ? 26.077  70.620 38.535  1.00 63.00  ? 68   ALA A C     1 
ATOM   1207 O  O     . ALA C 3 68  ? 25.490  71.095 37.572  1.00 62.60  ? 68   ALA A O     1 
ATOM   1208 C  CB    . ALA C 3 68  ? 27.880  69.001 37.843  1.00 63.18  ? 68   ALA A CB    1 
ATOM   1209 N  N     . SER C 3 69  ? 25.466  70.306 39.680  1.00 62.86  ? 69   SER A N     1 
ATOM   1210 C  CA    . SER C 3 69  ? 24.056  70.644 39.953  1.00 62.68  ? 69   SER A CA    1 
ATOM   1211 C  C     . SER C 3 69  ? 23.899  72.121 40.262  1.00 62.33  ? 69   SER A C     1 
ATOM   1212 O  O     . SER C 3 69  ? 22.936  72.753 39.831  1.00 62.17  ? 69   SER A O     1 
ATOM   1213 C  CB    . SER C 3 69  ? 23.525  69.850 41.143  1.00 62.51  ? 69   SER A CB    1 
ATOM   1214 O  OG    . SER C 3 69  ? 23.407  68.484 40.813  1.00 63.40  ? 69   SER A OG    1 
ATOM   1215 N  N     . GLN C 3 70  ? 24.851  72.647 41.034  1.00 62.15  ? 70   GLN A N     1 
ATOM   1216 C  CA    . GLN C 3 70  ? 24.928  74.059 41.367  1.00 61.88  ? 70   GLN A CA    1 
ATOM   1217 C  C     . GLN C 3 70  ? 24.928  74.880 40.092  1.00 61.65  ? 70   GLN A C     1 
ATOM   1218 O  O     . GLN C 3 70  ? 24.352  75.969 40.038  1.00 62.00  ? 70   GLN A O     1 
ATOM   1219 C  CB    . GLN C 3 70  ? 26.217  74.343 42.135  1.00 62.18  ? 70   GLN A CB    1 
ATOM   1220 C  CG    . GLN C 3 70  ? 26.169  73.976 43.595  1.00 62.83  ? 70   GLN A CG    1 
ATOM   1221 C  CD    . GLN C 3 70  ? 25.187  74.823 44.356  1.00 64.02  ? 70   GLN A CD    1 
ATOM   1222 O  OE1   . GLN C 3 70  ? 24.085  74.372 44.680  1.00 64.69  ? 70   GLN A OE1   1 
ATOM   1223 N  NE2   . GLN C 3 70  ? 25.566  76.076 44.627  1.00 63.98  ? 70   GLN A NE2   1 
ATOM   1224 N  N     . TRP C 3 71  ? 25.571  74.337 39.064  1.00 60.74  ? 71   TRP A N     1 
ATOM   1225 C  CA    . TRP C 3 71  ? 25.683  75.009 37.794  1.00 59.88  ? 71   TRP A CA    1 
ATOM   1226 C  C     . TRP C 3 71  ? 24.397  74.919 36.996  1.00 60.26  ? 71   TRP A C     1 
ATOM   1227 O  O     . TRP C 3 71  ? 24.023  75.883 36.336  1.00 60.66  ? 71   TRP A O     1 
ATOM   1228 C  CB    . TRP C 3 71  ? 26.859  74.446 37.004  1.00 59.12  ? 71   TRP A CB    1 
ATOM   1229 C  CG    . TRP C 3 71  ? 27.124  75.146 35.723  1.00 57.60  ? 71   TRP A CG    1 
ATOM   1230 C  CD1   . TRP C 3 71  ? 27.719  76.364 35.557  1.00 56.79  ? 71   TRP A CD1   1 
ATOM   1231 C  CD2   . TRP C 3 71  ? 26.814  74.669 34.412  1.00 56.50  ? 71   TRP A CD2   1 
ATOM   1232 N  NE1   . TRP C 3 71  ? 27.788  76.681 34.219  1.00 56.00  ? 71   TRP A NE1   1 
ATOM   1233 C  CE2   . TRP C 3 71  ? 27.248  75.654 33.495  1.00 55.97  ? 71   TRP A CE2   1 
ATOM   1234 C  CE3   . TRP C 3 71  ? 26.212  73.503 33.922  1.00 55.88  ? 71   TRP A CE3   1 
ATOM   1235 C  CZ2   . TRP C 3 71  ? 27.096  75.509 32.118  1.00 56.71  ? 71   TRP A CZ2   1 
ATOM   1236 C  CZ3   . TRP C 3 71  ? 26.060  73.359 32.549  1.00 56.61  ? 71   TRP A CZ3   1 
ATOM   1237 C  CH2   . TRP C 3 71  ? 26.496  74.358 31.663  1.00 57.01  ? 71   TRP A CH2   1 
ATOM   1238 N  N     . ILE C 3 72  ? 23.715  73.776 37.054  1.00 60.75  ? 72   ILE A N     1 
ATOM   1239 C  CA    . ILE C 3 72  ? 22.481  73.584 36.262  1.00 61.04  ? 72   ILE A CA    1 
ATOM   1240 C  C     . ILE C 3 72  ? 21.387  74.558 36.702  1.00 61.50  ? 72   ILE A C     1 
ATOM   1241 O  O     . ILE C 3 72  ? 20.676  75.110 35.860  1.00 60.98  ? 72   ILE A O     1 
ATOM   1242 C  CB    . ILE C 3 72  ? 21.939  72.110 36.277  1.00 60.79  ? 72   ILE A CB    1 
ATOM   1243 C  CG1   . ILE C 3 72  ? 22.933  71.152 35.623  1.00 60.80  ? 72   ILE A CG1   1 
ATOM   1244 C  CG2   . ILE C 3 72  ? 20.623  72.013 35.514  1.00 60.43  ? 72   ILE A CG2   1 
ATOM   1245 C  CD1   . ILE C 3 72  ? 22.597  69.673 35.796  1.00 60.80  ? 72   ILE A CD1   1 
ATOM   1246 N  N     . LYS C 3 73  ? 21.260  74.766 38.014  1.00 62.31  ? 73   LYS A N     1 
ATOM   1247 C  CA    . LYS C 3 73  ? 20.257  75.695 38.526  1.00 63.54  ? 73   LYS A CA    1 
ATOM   1248 C  C     . LYS C 3 73  ? 20.620  77.148 38.169  1.00 63.73  ? 73   LYS A C     1 
ATOM   1249 O  O     . LYS C 3 73  ? 19.740  77.941 37.838  1.00 63.73  ? 73   LYS A O     1 
ATOM   1250 C  CB    . LYS C 3 73  ? 20.032  75.523 40.032  1.00 63.22  ? 73   LYS A CB    1 
ATOM   1251 C  CG    . LYS C 3 73  ? 20.648  76.621 40.916  1.00 64.94  ? 73   LYS A CG    1 
ATOM   1252 C  CD    . LYS C 3 73  ? 20.003  76.698 42.317  1.00 66.01  ? 73   LYS A CD    1 
ATOM   1253 C  CE    . LYS C 3 73  ? 20.591  75.664 43.289  1.00 67.52  ? 73   LYS A CE    1 
ATOM   1254 N  NZ    . LYS C 3 73  ? 19.527  75.144 44.195  1.00 69.08  ? 73   LYS A NZ    1 
ATOM   1255 N  N     . ARG C 3 74  ? 21.912  77.482 38.226  1.00 64.08  ? 74   ARG A N     1 
ATOM   1256 C  CA    . ARG C 3 74  ? 22.368  78.830 37.885  1.00 64.23  ? 74   ARG A CA    1 
ATOM   1257 C  C     . ARG C 3 74  ? 22.157  79.128 36.408  1.00 64.25  ? 74   ARG A C     1 
ATOM   1258 O  O     . ARG C 3 74  ? 21.741  80.231 36.056  1.00 64.42  ? 74   ARG A O     1 
ATOM   1259 C  CB    . ARG C 3 74  ? 23.830  79.056 38.273  1.00 64.26  ? 74   ARG A CB    1 
ATOM   1260 C  CG    . ARG C 3 74  ? 24.058  79.167 39.768  1.00 64.84  ? 74   ARG A CG    1 
ATOM   1261 C  CD    . ARG C 3 74  ? 25.376  79.857 40.078  1.00 66.18  ? 74   ARG A CD    1 
ATOM   1262 N  NE    . ARG C 3 74  ? 26.523  79.222 39.430  1.00 66.99  ? 74   ARG A NE    1 
ATOM   1263 C  CZ    . ARG C 3 74  ? 27.213  78.211 39.958  1.00 68.59  ? 74   ARG A CZ    1 
ATOM   1264 N  NH1   . ARG C 3 74  ? 26.870  77.704 41.142  1.00 69.35  ? 74   ARG A NH1   1 
ATOM   1265 N  NH2   . ARG C 3 74  ? 28.244  77.695 39.301  1.00 67.82  ? 74   ARG A NH2   1 
ATOM   1266 N  N     . MET C 3 75  ? 22.422  78.145 35.548  1.00 64.13  ? 75   MET A N     1 
ATOM   1267 C  CA    . MET C 3 75  ? 22.115  78.289 34.124  1.00 64.10  ? 75   MET A CA    1 
ATOM   1268 C  C     . MET C 3 75  ? 20.633  78.571 33.887  1.00 64.19  ? 75   MET A C     1 
ATOM   1269 O  O     . MET C 3 75  ? 20.269  79.198 32.891  1.00 64.23  ? 75   MET A O     1 
ATOM   1270 C  CB    . MET C 3 75  ? 22.572  77.069 33.319  1.00 63.97  ? 75   MET A CB    1 
ATOM   1271 C  CG    . MET C 3 75  ? 24.084  76.975 33.147  1.00 63.98  ? 75   MET A CG    1 
ATOM   1272 S  SD    . MET C 3 75  ? 24.827  78.383 32.268  1.00 63.89  ? 75   MET A SD    1 
ATOM   1273 C  CE    . MET C 3 75  ? 24.668  77.901 30.551  1.00 63.38  ? 75   MET A CE    1 
ATOM   1274 N  N     . GLU C 3 76  ? 19.782  78.121 34.811  1.00 64.36  ? 76   GLU A N     1 
ATOM   1275 C  CA    . GLU C 3 76  ? 18.342  78.384 34.704  1.00 64.44  ? 76   GLU A CA    1 
ATOM   1276 C  C     . GLU C 3 76  ? 17.936  79.695 35.353  1.00 64.09  ? 76   GLU A C     1 
ATOM   1277 O  O     . GLU C 3 76  ? 17.020  80.359 34.873  1.00 64.56  ? 76   GLU A O     1 
ATOM   1278 C  CB    . GLU C 3 76  ? 17.490  77.212 35.218  1.00 64.52  ? 76   GLU A CB    1 
ATOM   1279 C  CG    . GLU C 3 76  ? 17.582  75.907 34.371  1.00 65.85  ? 76   GLU A CG    1 
ATOM   1280 C  CD    . GLU C 3 76  ? 18.125  76.097 32.926  1.00 67.24  ? 76   GLU A CD    1 
ATOM   1281 O  OE1   . GLU C 3 76  ? 17.632  76.964 32.154  1.00 67.36  ? 76   GLU A OE1   1 
ATOM   1282 O  OE2   . GLU C 3 76  ? 19.060  75.350 32.561  1.00 68.10  ? 76   GLU A OE2   1 
ATOM   1283 N  N     . ASP C 3 77  ? 18.630  80.067 36.425  1.00 63.59  ? 77   ASP A N     1 
ATOM   1284 C  CA    . ASP C 3 77  ? 18.439  81.364 37.068  1.00 63.24  ? 77   ASP A CA    1 
ATOM   1285 C  C     . ASP C 3 77  ? 18.772  82.478 36.088  1.00 62.94  ? 77   ASP A C     1 
ATOM   1286 O  O     . ASP C 3 77  ? 18.135  83.530 36.093  1.00 63.29  ? 77   ASP A O     1 
ATOM   1287 C  CB    . ASP C 3 77  ? 19.303  81.478 38.328  1.00 63.36  ? 77   ASP A CB    1 
ATOM   1288 C  CG    . ASP C 3 77  ? 18.779  80.623 39.483  1.00 63.78  ? 77   ASP A CG    1 
ATOM   1289 O  OD1   . ASP C 3 77  ? 17.594  80.233 39.456  1.00 64.80  ? 77   ASP A OD1   1 
ATOM   1290 O  OD2   . ASP C 3 77  ? 19.542  80.342 40.430  1.00 64.57  ? 77   ASP A OD2   1 
ATOM   1291 N  N     . ILE C 3 78  ? 19.776  82.226 35.250  1.00 62.27  ? 78   ILE A N     1 
ATOM   1292 C  CA    . ILE C 3 78  ? 20.126  83.091 34.129  1.00 61.16  ? 78   ILE A CA    1 
ATOM   1293 C  C     . ILE C 3 78  ? 19.171  82.818 32.968  1.00 60.76  ? 78   ILE A C     1 
ATOM   1294 O  O     . ILE C 3 78  ? 18.714  83.748 32.298  1.00 61.37  ? 78   ILE A O     1 
ATOM   1295 C  CB    . ILE C 3 78  ? 21.580  82.834 33.662  1.00 61.10  ? 78   ILE A CB    1 
ATOM   1296 C  CG1   . ILE C 3 78  ? 22.581  83.138 34.789  1.00 60.38  ? 78   ILE A CG1   1 
ATOM   1297 C  CG2   . ILE C 3 78  ? 21.899  83.635 32.388  1.00 60.84  ? 78   ILE A CG2   1 
ATOM   1298 C  CD1   . ILE C 3 78  ? 23.937  82.471 34.608  1.00 58.98  ? 78   ILE A CD1   1 
ATOM   1299 N  N     . GLY C 3 79  ? 18.878  81.544 32.722  1.00 59.86  ? 79   GLY A N     1 
ATOM   1300 C  CA    . GLY C 3 79  ? 17.991  81.170 31.625  1.00 58.43  ? 79   GLY A CA    1 
ATOM   1301 C  C     . GLY C 3 79  ? 18.685  80.811 30.323  1.00 57.37  ? 79   GLY A C     1 
ATOM   1302 O  O     . GLY C 3 79  ? 18.182  81.115 29.243  1.00 57.43  ? 79   GLY A O     1 
ATOM   1303 N  N     . LEU C 3 80  ? 19.833  80.148 30.417  1.00 56.19  ? 80   LEU A N     1 
ATOM   1304 C  CA    . LEU C 3 80  ? 20.480  79.580 29.238  1.00 54.92  ? 80   LEU A CA    1 
ATOM   1305 C  C     . LEU C 3 80  ? 20.526  78.048 29.291  1.00 54.17  ? 80   LEU A C     1 
ATOM   1306 O  O     . LEU C 3 80  ? 20.495  77.463 30.369  1.00 53.92  ? 80   LEU A O     1 
ATOM   1307 C  CB    . LEU C 3 80  ? 21.875  80.169 29.070  1.00 54.97  ? 80   LEU A CB    1 
ATOM   1308 C  CG    . LEU C 3 80  ? 21.927  81.525 28.368  1.00 54.85  ? 80   LEU A CG    1 
ATOM   1309 C  CD1   . LEU C 3 80  ? 23.360  82.011 28.328  1.00 53.77  ? 80   LEU A CD1   1 
ATOM   1310 C  CD2   . LEU C 3 80  ? 21.318  81.458 26.945  1.00 54.47  ? 80   LEU A CD2   1 
ATOM   1311 N  N     . GLU C 3 81  ? 20.589  77.401 28.129  1.00 53.36  ? 81   GLU A N     1 
ATOM   1312 C  CA    . GLU C 3 81  ? 20.514  75.946 28.090  1.00 52.83  ? 81   GLU A CA    1 
ATOM   1313 C  C     . GLU C 3 81  ? 21.733  75.266 28.733  1.00 52.58  ? 81   GLU A C     1 
ATOM   1314 O  O     . GLU C 3 81  ? 22.880  75.566 28.394  1.00 52.50  ? 81   GLU A O     1 
ATOM   1315 C  CB    . GLU C 3 81  ? 20.290  75.429 26.668  1.00 52.44  ? 81   GLU A CB    1 
ATOM   1316 C  CG    . GLU C 3 81  ? 19.948  73.932 26.625  1.00 52.48  ? 81   GLU A CG    1 
ATOM   1317 C  CD    . GLU C 3 81  ? 19.703  73.390 25.219  1.00 52.45  ? 81   GLU A CD    1 
ATOM   1318 O  OE1   . GLU C 3 81  ? 19.661  74.192 24.257  1.00 53.08  ? 81   GLU A OE1   1 
ATOM   1319 O  OE2   . GLU C 3 81  ? 19.549  72.157 25.075  1.00 50.75  ? 81   GLU A OE2   1 
ATOM   1320 N  N     . ALA C 3 82  ? 21.462  74.365 29.674  1.00 51.98  ? 82   ALA A N     1 
ATOM   1321 C  CA    . ALA C 3 82  ? 22.490  73.507 30.245  1.00 51.80  ? 82   ALA A CA    1 
ATOM   1322 C  C     . ALA C 3 82  ? 22.448  72.121 29.581  1.00 51.51  ? 82   ALA A C     1 
ATOM   1323 O  O     . ALA C 3 82  ? 21.780  71.208 30.065  1.00 51.92  ? 82   ALA A O     1 
ATOM   1324 C  CB    . ALA C 3 82  ? 22.332  73.411 31.762  1.00 51.59  ? 82   ALA A CB    1 
ATOM   1325 N  N     . LEU C 3 83  ? 23.159  71.982 28.462  1.00 51.20  ? 83   LEU A N     1 
ATOM   1326 C  CA    . LEU C 3 83  ? 23.166  70.751 27.665  1.00 50.56  ? 83   LEU A CA    1 
ATOM   1327 C  C     . LEU C 3 83  ? 24.000  69.689 28.349  1.00 50.64  ? 83   LEU A C     1 
ATOM   1328 O  O     . LEU C 3 83  ? 24.846  70.014 29.170  1.00 50.68  ? 83   LEU A O     1 
ATOM   1329 C  CB    . LEU C 3 83  ? 23.720  71.006 26.269  1.00 49.98  ? 83   LEU A CB    1 
ATOM   1330 C  CG    . LEU C 3 83  ? 22.987  71.949 25.334  1.00 49.40  ? 83   LEU A CG    1 
ATOM   1331 C  CD1   . LEU C 3 83  ? 23.275  73.388 25.692  1.00 50.17  ? 83   LEU A CD1   1 
ATOM   1332 C  CD2   . LEU C 3 83  ? 23.447  71.689 23.938  1.00 50.01  ? 83   LEU A CD2   1 
ATOM   1333 N  N     . GLY C 3 84  ? 23.752  68.425 28.006  1.00 50.91  ? 84   GLY A N     1 
ATOM   1334 C  CA    . GLY C 3 84  ? 24.460  67.296 28.604  1.00 51.28  ? 84   GLY A CA    1 
ATOM   1335 C  C     . GLY C 3 84  ? 23.559  66.321 29.335  1.00 51.70  ? 84   GLY A C     1 
ATOM   1336 O  O     . GLY C 3 84  ? 22.335  66.428 29.278  1.00 51.80  ? 84   GLY A O     1 
ATOM   1337 N  N     . MET C 3 85  ? 24.176  65.369 30.023  1.00 52.09  ? 85   MET A N     1 
ATOM   1338 C  CA    . MET C 3 85  ? 23.464  64.344 30.763  1.00 52.62  ? 85   MET A CA    1 
ATOM   1339 C  C     . MET C 3 85  ? 23.310  64.712 32.244  1.00 52.60  ? 85   MET A C     1 
ATOM   1340 O  O     . MET C 3 85  ? 24.205  64.463 33.044  1.00 52.38  ? 85   MET A O     1 
ATOM   1341 C  CB    . MET C 3 85  ? 24.207  63.015 30.625  1.00 53.09  ? 85   MET A CB    1 
ATOM   1342 C  CG    . MET C 3 85  ? 23.324  61.797 30.431  1.00 54.27  ? 85   MET A CG    1 
ATOM   1343 S  SD    . MET C 3 85  ? 21.994  61.623 31.637  1.00 57.03  ? 85   MET A SD    1 
ATOM   1344 C  CE    . MET C 3 85  ? 20.887  60.594 30.673  1.00 56.02  ? 85   MET A CE    1 
ATOM   1345 N  N     . ASP C 3 86  ? 22.165  65.292 32.601  1.00 53.16  ? 86   ASP A N     1 
ATOM   1346 C  CA    . ASP C 3 86  ? 21.870  65.697 33.994  1.00 53.69  ? 86   ASP A CA    1 
ATOM   1347 C  C     . ASP C 3 86  ? 21.928  64.561 35.033  1.00 53.70  ? 86   ASP A C     1 
ATOM   1348 O  O     . ASP C 3 86  ? 22.360  64.778 36.166  1.00 53.62  ? 86   ASP A O     1 
ATOM   1349 C  CB    . ASP C 3 86  ? 20.536  66.458 34.084  1.00 53.87  ? 86   ASP A CB    1 
ATOM   1350 C  CG    . ASP C 3 86  ? 19.485  65.966 33.066  1.00 55.24  ? 86   ASP A CG    1 
ATOM   1351 O  OD1   . ASP C 3 86  ? 19.438  64.757 32.738  1.00 55.38  ? 86   ASP A OD1   1 
ATOM   1352 O  OD2   . ASP C 3 86  ? 18.687  66.805 32.593  1.00 56.54  ? 86   ASP A OD2   1 
ATOM   1353 N  N     . ASP C 3 87  ? 21.498  63.360 34.640  1.00 53.81  ? 87   ASP A N     1 
ATOM   1354 C  CA    . ASP C 3 87  ? 21.667  62.165 35.463  1.00 53.82  ? 87   ASP A CA    1 
ATOM   1355 C  C     . ASP C 3 87  ? 23.098  61.635 35.351  1.00 53.96  ? 87   ASP A C     1 
ATOM   1356 O  O     . ASP C 3 87  ? 23.503  61.054 34.326  1.00 53.90  ? 87   ASP A O     1 
ATOM   1357 C  CB    . ASP C 3 87  ? 20.678  61.062 35.078  1.00 53.84  ? 87   ASP A CB    1 
ATOM   1358 C  CG    . ASP C 3 87  ? 20.784  59.835 35.988  1.00 54.49  ? 87   ASP A CG    1 
ATOM   1359 O  OD1   . ASP C 3 87  ? 21.910  59.449 36.369  1.00 55.12  ? 87   ASP A OD1   1 
ATOM   1360 O  OD2   . ASP C 3 87  ? 19.739  59.243 36.323  1.00 56.23  ? 87   ASP A OD2   1 
ATOM   1361 N  N     . PHE C 3 88  ? 23.850  61.805 36.430  1.00 53.71  ? 88   PHE A N     1 
ATOM   1362 C  CA    . PHE C 3 88  ? 25.263  61.493 36.404  1.00 53.53  ? 88   PHE A CA    1 
ATOM   1363 C  C     . PHE C 3 88  ? 25.557  59.989 36.498  1.00 53.64  ? 88   PHE A C     1 
ATOM   1364 O  O     . PHE C 3 88  ? 26.634  59.548 36.073  1.00 53.80  ? 88   PHE A O     1 
ATOM   1365 C  CB    . PHE C 3 88  ? 26.012  62.288 37.481  1.00 53.26  ? 88   PHE A CB    1 
ATOM   1366 C  CG    . PHE C 3 88  ? 25.689  63.763 37.490  1.00 53.23  ? 88   PHE A CG    1 
ATOM   1367 C  CD1   . PHE C 3 88  ? 25.789  64.529 36.327  1.00 53.34  ? 88   PHE A CD1   1 
ATOM   1368 C  CD2   . PHE C 3 88  ? 25.298  64.392 38.666  1.00 52.71  ? 88   PHE A CD2   1 
ATOM   1369 C  CE1   . PHE C 3 88  ? 25.486  65.881 36.343  1.00 51.88  ? 88   PHE A CE1   1 
ATOM   1370 C  CE2   . PHE C 3 88  ? 25.009  65.752 38.689  1.00 52.05  ? 88   PHE A CE2   1 
ATOM   1371 C  CZ    . PHE C 3 88  ? 25.100  66.492 37.528  1.00 51.80  ? 88   PHE A CZ    1 
ATOM   1372 N  N     . LYS C 3 89  ? 24.616  59.200 37.028  1.00 53.29  ? 89   LYS A N     1 
ATOM   1373 C  CA    . LYS C 3 89  ? 24.812  57.737 37.102  1.00 52.91  ? 89   LYS A CA    1 
ATOM   1374 C  C     . LYS C 3 89  ? 24.954  57.158 35.698  1.00 52.73  ? 89   LYS A C     1 
ATOM   1375 O  O     . LYS C 3 89  ? 25.846  56.357 35.441  1.00 52.80  ? 89   LYS A O     1 
ATOM   1376 C  CB    . LYS C 3 89  ? 23.676  57.024 37.849  1.00 52.54  ? 89   LYS A CB    1 
ATOM   1377 C  CG    . LYS C 3 89  ? 23.397  57.557 39.243  1.00 52.63  ? 89   LYS A CG    1 
ATOM   1378 C  CD    . LYS C 3 89  ? 22.566  56.587 40.088  1.00 53.40  ? 89   LYS A CD    1 
ATOM   1379 C  CE    . LYS C 3 89  ? 21.062  56.588 39.728  1.00 53.47  ? 89   LYS A CE    1 
ATOM   1380 N  NZ    . LYS C 3 89  ? 20.412  57.925 39.764  1.00 51.92  ? 89   LYS A NZ    1 
ATOM   1381 N  N     . LEU C 3 90  ? 24.097  57.587 34.777  1.00 52.68  ? 90   LEU A N     1 
ATOM   1382 C  CA    . LEU C 3 90  ? 24.130  57.033 33.424  1.00 52.73  ? 90   LEU A CA    1 
ATOM   1383 C  C     . LEU C 3 90  ? 25.387  57.456 32.700  1.00 52.75  ? 90   LEU A C     1 
ATOM   1384 O  O     . LEU C 3 90  ? 25.880  56.721 31.854  1.00 53.49  ? 90   LEU A O     1 
ATOM   1385 C  CB    . LEU C 3 90  ? 22.893  57.417 32.599  1.00 52.57  ? 90   LEU A CB    1 
ATOM   1386 C  CG    . LEU C 3 90  ? 21.466  57.259 33.150  1.00 53.00  ? 90   LEU A CG    1 
ATOM   1387 C  CD1   . LEU C 3 90  ? 20.485  57.244 31.987  1.00 53.49  ? 90   LEU A CD1   1 
ATOM   1388 C  CD2   . LEU C 3 90  ? 21.272  56.015 34.028  1.00 51.79  ? 90   LEU A CD2   1 
ATOM   1389 N  N     . ALA C 3 91  ? 25.899  58.639 33.043  1.00 52.69  ? 91   ALA A N     1 
ATOM   1390 C  CA    . ALA C 3 91  ? 27.062  59.231 32.385  1.00 52.26  ? 91   ALA A CA    1 
ATOM   1391 C  C     . ALA C 3 91  ? 28.296  58.442 32.766  1.00 52.23  ? 91   ALA A C     1 
ATOM   1392 O  O     . ALA C 3 91  ? 29.110  58.090 31.914  1.00 51.92  ? 91   ALA A O     1 
ATOM   1393 C  CB    . ALA C 3 91  ? 27.206  60.689 32.790  1.00 52.04  ? 91   ALA A CB    1 
ATOM   1394 N  N     . TYR C 3 92  ? 28.386  58.146 34.057  1.00 52.38  ? 92   TYR A N     1 
ATOM   1395 C  CA    . TYR C 3 92  ? 29.441  57.331 34.636  1.00 52.79  ? 92   TYR A CA    1 
ATOM   1396 C  C     . TYR C 3 92  ? 29.521  55.913 34.058  1.00 52.66  ? 92   TYR A C     1 
ATOM   1397 O  O     . TYR C 3 92  ? 30.627  55.397 33.838  1.00 52.81  ? 92   TYR A O     1 
ATOM   1398 C  CB    . TYR C 3 92  ? 29.251  57.269 36.150  1.00 53.25  ? 92   TYR A CB    1 
ATOM   1399 C  CG    . TYR C 3 92  ? 30.043  56.189 36.836  1.00 54.42  ? 92   TYR A CG    1 
ATOM   1400 C  CD1   . TYR C 3 92  ? 29.520  54.907 36.980  1.00 55.76  ? 92   TYR A CD1   1 
ATOM   1401 C  CD2   . TYR C 3 92  ? 31.317  56.447 37.345  1.00 55.93  ? 92   TYR A CD2   1 
ATOM   1402 C  CE1   . TYR C 3 92  ? 30.240  53.901 37.612  1.00 56.58  ? 92   TYR A CE1   1 
ATOM   1403 C  CE2   . TYR C 3 92  ? 32.054  55.450 37.982  1.00 56.57  ? 92   TYR A CE2   1 
ATOM   1404 C  CZ    . TYR C 3 92  ? 31.504  54.176 38.110  1.00 56.92  ? 92   TYR A CZ    1 
ATOM   1405 O  OH    . TYR C 3 92  ? 32.211  53.175 38.737  1.00 56.49  ? 92   TYR A OH    1 
ATOM   1406 N  N     . LEU C 3 93  ? 28.369  55.273 33.844  1.00 52.15  ? 93   LEU A N     1 
ATOM   1407 C  CA    . LEU C 3 93  ? 28.356  53.946 33.219  1.00 51.75  ? 93   LEU A CA    1 
ATOM   1408 C  C     . LEU C 3 93  ? 28.820  54.095 31.793  1.00 51.97  ? 93   LEU A C     1 
ATOM   1409 O  O     . LEU C 3 93  ? 29.575  53.271 31.303  1.00 52.43  ? 93   LEU A O     1 
ATOM   1410 C  CB    . LEU C 3 93  ? 26.968  53.298 33.206  1.00 51.26  ? 93   LEU A CB    1 
ATOM   1411 C  CG    . LEU C 3 93  ? 26.178  52.891 34.441  1.00 49.73  ? 93   LEU A CG    1 
ATOM   1412 C  CD1   . LEU C 3 93  ? 24.915  52.211 33.970  1.00 48.27  ? 93   LEU A CD1   1 
ATOM   1413 C  CD2   . LEU C 3 93  ? 26.962  51.969 35.328  1.00 49.32  ? 93   LEU A CD2   1 
ATOM   1414 N  N     . SER C 3 94  ? 28.364  55.154 31.131  1.00 52.10  ? 94   SER A N     1 
ATOM   1415 C  CA    . SER C 3 94  ? 28.726  55.396 29.739  1.00 52.55  ? 94   SER A CA    1 
ATOM   1416 C  C     . SER C 3 94  ? 30.245  55.614 29.596  1.00 52.61  ? 94   SER A C     1 
ATOM   1417 O  O     . SER C 3 94  ? 30.872  55.179 28.608  1.00 52.20  ? 94   SER A O     1 
ATOM   1418 C  CB    . SER C 3 94  ? 27.929  56.576 29.181  1.00 52.42  ? 94   SER A CB    1 
ATOM   1419 O  OG    . SER C 3 94  ? 28.431  56.975 27.918  1.00 53.01  ? 94   SER A OG    1 
ATOM   1420 N  N     . ASP C 3 95  ? 30.818  56.276 30.603  1.00 52.68  ? 95   ASP A N     1 
ATOM   1421 C  CA    . ASP C 3 95  ? 32.261  56.486 30.686  1.00 52.79  ? 95   ASP A CA    1 
ATOM   1422 C  C     . ASP C 3 95  ? 33.023  55.215 31.036  1.00 52.74  ? 95   ASP A C     1 
ATOM   1423 O  O     . ASP C 3 95  ? 33.983  54.865 30.346  1.00 52.70  ? 95   ASP A O     1 
ATOM   1424 C  CB    . ASP C 3 95  ? 32.598  57.616 31.657  1.00 52.44  ? 95   ASP A CB    1 
ATOM   1425 C  CG    . ASP C 3 95  ? 32.219  58.964 31.101  1.00 53.23  ? 95   ASP A CG    1 
ATOM   1426 O  OD1   . ASP C 3 95  ? 31.948  59.012 29.880  1.00 53.79  ? 95   ASP A OD1   1 
ATOM   1427 O  OD2   . ASP C 3 95  ? 32.175  59.961 31.869  1.00 53.14  ? 95   ASP A OD2   1 
ATOM   1428 N  N     . THR C 3 96  ? 32.589  54.526 32.088  1.00 52.55  ? 96   THR A N     1 
ATOM   1429 C  CA    . THR C 3 96  ? 33.245  53.296 32.518  1.00 52.64  ? 96   THR A CA    1 
ATOM   1430 C  C     . THR C 3 96  ? 33.065  52.132 31.511  1.00 53.25  ? 96   THR A C     1 
ATOM   1431 O  O     . THR C 3 96  ? 33.875  51.196 31.484  1.00 53.25  ? 96   THR A O     1 
ATOM   1432 C  CB    . THR C 3 96  ? 32.767  52.861 33.927  1.00 52.52  ? 96   THR A CB    1 
ATOM   1433 O  OG1   . THR C 3 96  ? 32.632  54.010 34.779  1.00 52.55  ? 96   THR A OG1   1 
ATOM   1434 C  CG2   . THR C 3 96  ? 33.732  51.870 34.547  1.00 51.53  ? 96   THR A CG2   1 
ATOM   1435 N  N     . TYR C 3 97  ? 32.025  52.186 30.675  1.00 53.65  ? 97   TYR A N     1 
ATOM   1436 C  CA    . TYR C 3 97  ? 31.702  51.031 29.841  1.00 54.24  ? 97   TYR A CA    1 
ATOM   1437 C  C     . TYR C 3 97  ? 31.581  51.346 28.355  1.00 55.30  ? 97   TYR A C     1 
ATOM   1438 O  O     . TYR C 3 97  ? 30.572  51.033 27.717  1.00 55.85  ? 97   TYR A O     1 
ATOM   1439 C  CB    . TYR C 3 97  ? 30.487  50.273 30.411  1.00 53.59  ? 97   TYR A CB    1 
ATOM   1440 C  CG    . TYR C 3 97  ? 30.766  49.752 31.798  1.00 52.52  ? 97   TYR A CG    1 
ATOM   1441 C  CD1   . TYR C 3 97  ? 31.555  48.621 31.987  1.00 52.73  ? 97   TYR A CD1   1 
ATOM   1442 C  CD2   . TYR C 3 97  ? 30.296  50.417 32.926  1.00 52.06  ? 97   TYR A CD2   1 
ATOM   1443 C  CE1   . TYR C 3 97  ? 31.856  48.146 33.268  1.00 52.20  ? 97   TYR A CE1   1 
ATOM   1444 C  CE2   . TYR C 3 97  ? 30.587  49.945 34.213  1.00 52.71  ? 97   TYR A CE2   1 
ATOM   1445 C  CZ    . TYR C 3 97  ? 31.368  48.807 34.370  1.00 52.22  ? 97   TYR A CZ    1 
ATOM   1446 O  OH    . TYR C 3 97  ? 31.669  48.331 35.621  1.00 52.23  ? 97   TYR A OH    1 
ATOM   1447 N  N     . ASN C 3 98  ? 32.648  51.925 27.808  1.00 56.36  ? 98   ASN A N     1 
ATOM   1448 C  CA    . ASN C 3 98  ? 32.676  52.441 26.442  1.00 57.48  ? 98   ASN A CA    1 
ATOM   1449 C  C     . ASN C 3 98  ? 32.599  51.383 25.337  1.00 57.88  ? 98   ASN A C     1 
ATOM   1450 O  O     . ASN C 3 98  ? 33.249  51.516 24.301  1.00 58.17  ? 98   ASN A O     1 
ATOM   1451 C  CB    . ASN C 3 98  ? 33.936  53.292 26.260  1.00 57.96  ? 98   ASN A CB    1 
ATOM   1452 C  CG    . ASN C 3 98  ? 33.721  54.493 25.326  1.00 59.97  ? 98   ASN A CG    1 
ATOM   1453 O  OD1   . ASN C 3 98  ? 34.604  55.361 25.202  1.00 61.07  ? 98   ASN A OD1   1 
ATOM   1454 N  ND2   . ASN C 3 98  ? 32.548  54.556 24.679  1.00 60.47  ? 98   ASN A ND2   1 
ATOM   1455 N  N     . TYR C 3 99  ? 31.798  50.341 25.552  1.00 58.49  ? 99   TYR A N     1 
ATOM   1456 C  CA    . TYR C 3 99  ? 31.606  49.261 24.567  1.00 58.89  ? 99   TYR A CA    1 
ATOM   1457 C  C     . TYR C 3 99  ? 30.249  48.576 24.745  1.00 59.56  ? 99   TYR A C     1 
ATOM   1458 O  O     . TYR C 3 99  ? 29.530  48.816 25.731  1.00 59.66  ? 99   TYR A O     1 
ATOM   1459 C  CB    . TYR C 3 99  ? 32.730  48.212 24.664  1.00 58.65  ? 99   TYR A CB    1 
ATOM   1460 C  CG    . TYR C 3 99  ? 33.049  47.773 26.083  1.00 58.34  ? 99   TYR A CG    1 
ATOM   1461 C  CD1   . TYR C 3 99  ? 32.356  46.723 26.689  1.00 58.04  ? 99   TYR A CD1   1 
ATOM   1462 C  CD2   . TYR C 3 99  ? 34.033  48.425 26.827  1.00 58.38  ? 99   TYR A CD2   1 
ATOM   1463 C  CE1   . TYR C 3 99  ? 32.639  46.334 28.002  1.00 58.03  ? 99   TYR A CE1   1 
ATOM   1464 C  CE2   . TYR C 3 99  ? 34.320  48.043 28.136  1.00 58.15  ? 99   TYR A CE2   1 
ATOM   1465 C  CZ    . TYR C 3 99  ? 33.625  47.002 28.714  1.00 57.74  ? 99   TYR A CZ    1 
ATOM   1466 O  OH    . TYR C 3 99  ? 33.929  46.628 29.998  1.00 57.53  ? 99   TYR A OH    1 
ATOM   1467 N  N     . GLU C 3 100 ? 29.909  47.715 23.790  1.00 60.02  ? 100  GLU A N     1 
ATOM   1468 C  CA    . GLU C 3 100 ? 28.712  46.893 23.886  1.00 60.73  ? 100  GLU A CA    1 
ATOM   1469 C  C     . GLU C 3 100 ? 28.903  45.809 24.957  1.00 60.33  ? 100  GLU A C     1 
ATOM   1470 O  O     . GLU C 3 100 ? 29.758  44.936 24.809  1.00 60.64  ? 100  GLU A O     1 
ATOM   1471 C  CB    . GLU C 3 100 ? 28.422  46.273 22.520  1.00 60.70  ? 100  GLU A CB    1 
ATOM   1472 C  CG    . GLU C 3 100 ? 27.067  45.592 22.394  1.00 62.29  ? 100  GLU A CG    1 
ATOM   1473 C  CD    . GLU C 3 100 ? 26.956  44.723 21.147  1.00 63.45  ? 100  GLU A CD    1 
ATOM   1474 O  OE1   . GLU C 3 100 ? 27.784  44.895 20.213  1.00 65.49  ? 100  GLU A OE1   1 
ATOM   1475 O  OE2   . GLU C 3 100 ? 26.041  43.861 21.104  1.00 65.58  ? 100  GLU A OE2   1 
ATOM   1476 N  N     . ILE C 3 101 ? 28.116  45.873 26.031  1.00 60.26  ? 101  ILE A N     1 
ATOM   1477 C  CA    . ILE C 3 101 ? 28.225  44.928 27.158  1.00 59.99  ? 101  ILE A CA    1 
ATOM   1478 C  C     . ILE C 3 101 ? 27.791  43.500 26.816  1.00 60.35  ? 101  ILE A C     1 
ATOM   1479 O  O     . ILE C 3 101 ? 26.656  43.269 26.410  1.00 60.55  ? 101  ILE A O     1 
ATOM   1480 C  CB    . ILE C 3 101 ? 27.425  45.412 28.402  1.00 59.72  ? 101  ILE A CB    1 
ATOM   1481 C  CG1   . ILE C 3 101 ? 27.999  46.734 28.915  1.00 59.79  ? 101  ILE A CG1   1 
ATOM   1482 C  CG2   . ILE C 3 101 ? 27.436  44.355 29.515  1.00 58.99  ? 101  ILE A CG2   1 
ATOM   1483 C  CD1   . ILE C 3 101 ? 27.192  47.401 30.004  1.00 59.66  ? 101  ILE A CD1   1 
ATOM   1484 N  N     . LYS C 3 102 ? 28.717  42.552 26.971  1.00 60.68  ? 102  LYS A N     1 
ATOM   1485 C  CA    . LYS C 3 102 ? 28.405  41.116 27.002  1.00 60.52  ? 102  LYS A CA    1 
ATOM   1486 C  C     . LYS C 3 102 ? 28.585  40.663 28.444  1.00 59.76  ? 102  LYS A C     1 
ATOM   1487 O  O     . LYS C 3 102 ? 29.624  40.929 29.051  1.00 59.83  ? 102  LYS A O     1 
ATOM   1488 C  CB    . LYS C 3 102 ? 29.341  40.324 26.076  1.00 61.05  ? 102  LYS A CB    1 
ATOM   1489 C  CG    . LYS C 3 102 ? 28.770  39.994 24.695  1.00 62.37  ? 102  LYS A CG    1 
ATOM   1490 C  CD    . LYS C 3 102 ? 29.090  41.067 23.655  1.00 65.09  ? 102  LYS A CD    1 
ATOM   1491 C  CE    . LYS C 3 102 ? 29.108  40.461 22.232  1.00 67.10  ? 102  LYS A CE    1 
ATOM   1492 N  NZ    . LYS C 3 102 ? 28.996  41.489 21.144  1.00 67.92  ? 102  LYS A NZ    1 
ATOM   1493 N  N     . TYR C 3 103 ? 27.580  39.991 28.995  1.00 59.06  ? 103  TYR A N     1 
ATOM   1494 C  CA    . TYR C 3 103 ? 27.545  39.721 30.439  1.00 58.23  ? 103  TYR A CA    1 
ATOM   1495 C  C     . TYR C 3 103 ? 27.319  38.253 30.770  1.00 58.20  ? 103  TYR A C     1 
ATOM   1496 O  O     . TYR C 3 103 ? 26.531  37.557 30.118  1.00 57.95  ? 103  TYR A O     1 
ATOM   1497 C  CB    . TYR C 3 103 ? 26.494  40.602 31.145  1.00 57.46  ? 103  TYR A CB    1 
ATOM   1498 C  CG    . TYR C 3 103 ? 25.052  40.239 30.810  1.00 57.03  ? 103  TYR A CG    1 
ATOM   1499 C  CD1   . TYR C 3 103 ? 24.499  40.565 29.572  1.00 56.37  ? 103  TYR A CD1   1 
ATOM   1500 C  CD2   . TYR C 3 103 ? 24.244  39.556 31.733  1.00 56.02  ? 103  TYR A CD2   1 
ATOM   1501 C  CE1   . TYR C 3 103 ? 23.181  40.224 29.257  1.00 56.47  ? 103  TYR A CE1   1 
ATOM   1502 C  CE2   . TYR C 3 103 ? 22.931  39.213 31.427  1.00 55.23  ? 103  TYR A CE2   1 
ATOM   1503 C  CZ    . TYR C 3 103 ? 22.401  39.550 30.185  1.00 55.84  ? 103  TYR A CZ    1 
ATOM   1504 O  OH    . TYR C 3 103 ? 21.097  39.218 29.861  1.00 55.21  ? 103  TYR A OH    1 
ATOM   1505 N  N     . ASP C 3 104 ? 28.016  37.810 31.808  1.00 58.41  ? 104  ASP A N     1 
ATOM   1506 C  CA    . ASP C 3 104 ? 27.892  36.470 32.341  1.00 58.79  ? 104  ASP A CA    1 
ATOM   1507 C  C     . ASP C 3 104 ? 26.850  36.430 33.453  1.00 58.23  ? 104  ASP A C     1 
ATOM   1508 O  O     . ASP C 3 104 ? 27.151  36.743 34.611  1.00 58.26  ? 104  ASP A O     1 
ATOM   1509 C  CB    . ASP C 3 104 ? 29.242  36.012 32.893  1.00 59.37  ? 104  ASP A CB    1 
ATOM   1510 C  CG    . ASP C 3 104 ? 29.239  34.547 33.334  1.00 61.53  ? 104  ASP A CG    1 
ATOM   1511 O  OD1   . ASP C 3 104 ? 28.141  33.920 33.407  1.00 62.07  ? 104  ASP A OD1   1 
ATOM   1512 O  OD2   . ASP C 3 104 ? 30.356  34.033 33.610  1.00 63.66  ? 104  ASP A OD2   1 
ATOM   1513 N  N     . HIS C 3 105 ? 25.640  36.005 33.096  1.00 57.56  ? 105  HIS A N     1 
ATOM   1514 C  CA    . HIS C 3 105 ? 24.517  35.951 34.032  1.00 56.76  ? 105  HIS A CA    1 
ATOM   1515 C  C     . HIS C 3 105 ? 24.769  35.069 35.265  1.00 56.40  ? 105  HIS A C     1 
ATOM   1516 O  O     . HIS C 3 105 ? 24.212  35.316 36.340  1.00 56.26  ? 105  HIS A O     1 
ATOM   1517 C  CB    . HIS C 3 105 ? 23.227  35.546 33.300  1.00 56.77  ? 105  HIS A CB    1 
ATOM   1518 C  CG    . HIS C 3 105 ? 23.153  34.093 32.940  1.00 56.67  ? 105  HIS A CG    1 
ATOM   1519 N  ND1   . HIS C 3 105 ? 22.575  33.150 33.767  1.00 55.76  ? 105  HIS A ND1   1 
ATOM   1520 C  CD2   . HIS C 3 105 ? 23.571  33.424 31.839  1.00 56.25  ? 105  HIS A CD2   1 
ATOM   1521 C  CE1   . HIS C 3 105 ? 22.653  31.962 33.196  1.00 56.67  ? 105  HIS A CE1   1 
ATOM   1522 N  NE2   . HIS C 3 105 ? 23.249  32.100 32.023  1.00 57.34  ? 105  HIS A NE2   1 
ATOM   1523 N  N     . THR C 3 106 ? 25.617  34.055 35.105  1.00 55.99  ? 106  THR A N     1 
ATOM   1524 C  CA    . THR C 3 106 ? 25.913  33.105 36.183  1.00 55.61  ? 106  THR A CA    1 
ATOM   1525 C  C     . THR C 3 106 ? 26.733  33.769 37.292  1.00 55.41  ? 106  THR A C     1 
ATOM   1526 O  O     . THR C 3 106 ? 26.820  33.252 38.408  1.00 55.38  ? 106  THR A O     1 
ATOM   1527 C  CB    . THR C 3 106 ? 26.680  31.861 35.663  1.00 55.69  ? 106  THR A CB    1 
ATOM   1528 O  OG1   . THR C 3 106 ? 28.027  32.232 35.326  1.00 55.53  ? 106  THR A OG1   1 
ATOM   1529 C  CG2   . THR C 3 106 ? 25.976  31.226 34.436  1.00 54.82  ? 106  THR A CG2   1 
ATOM   1530 N  N     . LYS C 3 107 ? 27.341  34.909 36.966  1.00 55.02  ? 107  LYS A N     1 
ATOM   1531 C  CA    . LYS C 3 107 ? 28.102  35.689 37.938  1.00 54.51  ? 107  LYS A CA    1 
ATOM   1532 C  C     . LYS C 3 107 ? 27.221  36.683 38.682  1.00 53.57  ? 107  LYS A C     1 
ATOM   1533 O  O     . LYS C 3 107 ? 27.667  37.297 39.644  1.00 53.53  ? 107  LYS A O     1 
ATOM   1534 C  CB    . LYS C 3 107 ? 29.256  36.432 37.255  1.00 55.26  ? 107  LYS A CB    1 
ATOM   1535 C  CG    . LYS C 3 107 ? 30.368  35.547 36.649  1.00 56.85  ? 107  LYS A CG    1 
ATOM   1536 C  CD    . LYS C 3 107 ? 31.151  34.764 37.721  1.00 59.84  ? 107  LYS A CD    1 
ATOM   1537 C  CE    . LYS C 3 107 ? 32.442  34.177 37.161  1.00 60.25  ? 107  LYS A CE    1 
ATOM   1538 N  NZ    . LYS C 3 107 ? 32.244  33.519 35.818  1.00 62.53  ? 107  LYS A NZ    1 
ATOM   1539 N  N     . ILE C 3 108 ? 25.968  36.827 38.243  1.00 52.47  ? 108  ILE A N     1 
ATOM   1540 C  CA    . ILE C 3 108 ? 25.031  37.811 38.812  1.00 51.02  ? 108  ILE A CA    1 
ATOM   1541 C  C     . ILE C 3 108 ? 24.128  37.203 39.898  1.00 50.43  ? 108  ILE A C     1 
ATOM   1542 O  O     . ILE C 3 108 ? 23.313  36.324 39.611  1.00 50.84  ? 108  ILE A O     1 
ATOM   1543 C  CB    . ILE C 3 108 ? 24.172  38.482 37.694  1.00 51.01  ? 108  ILE A CB    1 
ATOM   1544 C  CG1   . ILE C 3 108 ? 25.066  38.898 36.510  1.00 50.77  ? 108  ILE A CG1   1 
ATOM   1545 C  CG2   . ILE C 3 108 ? 23.404  39.673 38.259  1.00 50.25  ? 108  ILE A CG2   1 
ATOM   1546 C  CD1   . ILE C 3 108 ? 24.364  39.670 35.387  1.00 50.25  ? 108  ILE A CD1   1 
ATOM   1547 N  N     . ARG C 3 109 ? 24.268  37.666 41.139  1.00 49.36  ? 109  ARG A N     1 
ATOM   1548 C  CA    . ARG C 3 109 ? 23.512  37.085 42.254  1.00 48.67  ? 109  ARG A CA    1 
ATOM   1549 C  C     . ARG C 3 109 ? 22.070  37.546 42.275  1.00 48.16  ? 109  ARG A C     1 
ATOM   1550 O  O     . ARG C 3 109 ? 21.746  38.582 42.852  1.00 48.10  ? 109  ARG A O     1 
ATOM   1551 C  CB    . ARG C 3 109 ? 24.166  37.380 43.606  1.00 48.56  ? 109  ARG A CB    1 
ATOM   1552 C  CG    . ARG C 3 109 ? 23.517  36.653 44.795  1.00 48.88  ? 109  ARG A CG    1 
ATOM   1553 C  CD    . ARG C 3 109 ? 24.307  36.889 46.071  1.00 49.92  ? 109  ARG A CD    1 
ATOM   1554 N  NE    . ARG C 3 109 ? 25.737  36.629 45.878  1.00 52.31  ? 109  ARG A NE    1 
ATOM   1555 C  CZ    . ARG C 3 109 ? 26.337  35.458 46.108  1.00 53.69  ? 109  ARG A CZ    1 
ATOM   1556 N  NH1   . ARG C 3 109 ? 25.638  34.417 46.556  1.00 54.76  ? 109  ARG A NH1   1 
ATOM   1557 N  NH2   . ARG C 3 109 ? 27.645  35.324 45.885  1.00 52.52  ? 109  ARG A NH2   1 
ATOM   1558 N  N     . VAL C 3 110 ? 21.207  36.760 41.648  1.00 47.71  ? 110  VAL A N     1 
ATOM   1559 C  CA    . VAL C 3 110 ? 19.775  36.996 41.713  1.00 47.25  ? 110  VAL A CA    1 
ATOM   1560 C  C     . VAL C 3 110 ? 19.214  36.235 42.919  1.00 47.22  ? 110  VAL A C     1 
ATOM   1561 O  O     . VAL C 3 110 ? 19.225  34.989 42.952  1.00 47.06  ? 110  VAL A O     1 
ATOM   1562 C  CB    . VAL C 3 110 ? 19.069  36.579 40.401  1.00 47.20  ? 110  VAL A CB    1 
ATOM   1563 C  CG1   . VAL C 3 110 ? 17.597  36.955 40.442  1.00 47.24  ? 110  VAL A CG1   1 
ATOM   1564 C  CG2   . VAL C 3 110 ? 19.762  37.227 39.189  1.00 46.99  ? 110  VAL A CG2   1 
ATOM   1565 N  N     . ALA C 3 111 ? 18.763  36.992 43.920  1.00 46.73  ? 111  ALA A N     1 
ATOM   1566 C  CA    . ALA C 3 111 ? 18.115  36.410 45.087  1.00 46.34  ? 111  ALA A CA    1 
ATOM   1567 C  C     . ALA C 3 111 ? 16.607  36.566 45.004  1.00 46.19  ? 111  ALA A C     1 
ATOM   1568 O  O     . ALA C 3 111 ? 16.095  37.495 44.396  1.00 45.94  ? 111  ALA A O     1 
ATOM   1569 C  CB    . ALA C 3 111 ? 18.643  37.021 46.357  1.00 46.56  ? 111  ALA A CB    1 
ATOM   1570 N  N     . ASN C 3 112 ? 15.905  35.655 45.659  1.00 46.32  ? 112  ASN A N     1 
ATOM   1571 C  CA    . ASN C 3 112 ? 14.482  35.475 45.452  1.00 46.26  ? 112  ASN A CA    1 
ATOM   1572 C  C     . ASN C 3 112 ? 13.821  34.986 46.736  1.00 45.57  ? 112  ASN A C     1 
ATOM   1573 O  O     . ASN C 3 112 ? 13.906  33.823 47.067  1.00 45.48  ? 112  ASN A O     1 
ATOM   1574 C  CB    . ASN C 3 112 ? 14.318  34.446 44.329  1.00 46.51  ? 112  ASN A CB    1 
ATOM   1575 C  CG    . ASN C 3 112 ? 12.925  34.348 43.847  1.00 48.04  ? 112  ASN A CG    1 
ATOM   1576 O  OD1   . ASN C 3 112 ? 12.297  35.350 43.547  1.00 51.01  ? 112  ASN A OD1   1 
ATOM   1577 N  ND2   . ASN C 3 112 ? 12.414  33.137 43.766  1.00 50.59  ? 112  ASN A ND2   1 
ATOM   1578 N  N     . PHE C 3 113 ? 13.173  35.864 47.477  1.00 45.59  ? 113  PHE A N     1 
ATOM   1579 C  CA    . PHE C 3 113 ? 12.693  35.455 48.802  1.00 45.98  ? 113  PHE A CA    1 
ATOM   1580 C  C     . PHE C 3 113 ? 11.215  35.715 49.126  1.00 46.49  ? 113  PHE A C     1 
ATOM   1581 O  O     . PHE C 3 113 ? 10.490  36.353 48.374  1.00 46.42  ? 113  PHE A O     1 
ATOM   1582 C  CB    . PHE C 3 113 ? 13.605  36.042 49.900  1.00 45.90  ? 113  PHE A CB    1 
ATOM   1583 C  CG    . PHE C 3 113 ? 13.322  37.489 50.238  1.00 45.06  ? 113  PHE A CG    1 
ATOM   1584 C  CD1   . PHE C 3 113 ? 13.424  38.485 49.273  1.00 43.81  ? 113  PHE A CD1   1 
ATOM   1585 C  CD2   . PHE C 3 113 ? 12.971  37.854 51.534  1.00 44.40  ? 113  PHE A CD2   1 
ATOM   1586 C  CE1   . PHE C 3 113 ? 13.161  39.816 49.590  1.00 43.96  ? 113  PHE A CE1   1 
ATOM   1587 C  CE2   . PHE C 3 113 ? 12.716  39.195 51.857  1.00 43.95  ? 113  PHE A CE2   1 
ATOM   1588 C  CZ    . PHE C 3 113 ? 12.810  40.169 50.882  1.00 43.47  ? 113  PHE A CZ    1 
ATOM   1589 N  N     . ASP C 3 114 ? 10.784  35.201 50.267  1.00 47.39  ? 114  ASP A N     1 
ATOM   1590 C  CA    . ASP C 3 114 ? 9.448   35.449 50.779  1.00 48.61  ? 114  ASP A CA    1 
ATOM   1591 C  C     . ASP C 3 114 ? 9.489   35.207 52.284  1.00 48.79  ? 114  ASP A C     1 
ATOM   1592 O  O     . ASP C 3 114 ? 10.253  34.372 52.766  1.00 48.63  ? 114  ASP A O     1 
ATOM   1593 C  CB    . ASP C 3 114 ? 8.416   34.531 50.098  1.00 49.06  ? 114  ASP A CB    1 
ATOM   1594 C  CG    . ASP C 3 114 ? 7.011   35.173 50.000  1.00 51.74  ? 114  ASP A CG    1 
ATOM   1595 O  OD1   . ASP C 3 114 ? 6.910   36.351 49.563  1.00 52.57  ? 114  ASP A OD1   1 
ATOM   1596 O  OD2   . ASP C 3 114 ? 6.000   34.500 50.352  1.00 54.29  ? 114  ASP A OD2   1 
ATOM   1597 N  N     . ILE C 3 115 ? 8.689   35.953 53.030  1.00 49.38  ? 115  ILE A N     1 
ATOM   1598 C  CA    . ILE C 3 115 ? 8.658   35.802 54.482  1.00 50.18  ? 115  ILE A CA    1 
ATOM   1599 C  C     . ILE C 3 115 ? 7.257   35.416 54.947  1.00 51.18  ? 115  ILE A C     1 
ATOM   1600 O  O     . ILE C 3 115 ? 6.272   35.685 54.258  1.00 51.58  ? 115  ILE A O     1 
ATOM   1601 C  CB    . ILE C 3 115 ? 9.122   37.093 55.217  1.00 49.83  ? 115  ILE A CB    1 
ATOM   1602 C  CG1   . ILE C 3 115 ? 8.063   38.194 55.105  1.00 49.90  ? 115  ILE A CG1   1 
ATOM   1603 C  CG2   . ILE C 3 115 ? 10.464  37.576 54.675  1.00 49.31  ? 115  ILE A CG2   1 
ATOM   1604 C  CD1   . ILE C 3 115 ? 8.288   39.371 56.018  1.00 50.34  ? 115  ILE A CD1   1 
ATOM   1605 N  N     . GLU C 3 116 ? 7.167   34.780 56.110  1.00 52.12  ? 116  GLU A N     1 
ATOM   1606 C  CA    . GLU C 3 116 ? 5.875   34.477 56.704  1.00 53.22  ? 116  GLU A CA    1 
ATOM   1607 C  C     . GLU C 3 116 ? 5.803   35.063 58.113  1.00 53.52  ? 116  GLU A C     1 
ATOM   1608 O  O     . GLU C 3 116 ? 6.824   35.191 58.797  1.00 53.55  ? 116  GLU A O     1 
ATOM   1609 C  CB    . GLU C 3 116 ? 5.594   32.974 56.677  1.00 53.57  ? 116  GLU A CB    1 
ATOM   1610 C  CG    . GLU C 3 116 ? 5.466   32.370 55.256  1.00 56.03  ? 116  GLU A CG    1 
ATOM   1611 C  CD    . GLU C 3 116 ? 4.205   32.823 54.501  1.00 59.87  ? 116  GLU A CD    1 
ATOM   1612 O  OE1   . GLU C 3 116 ? 3.099   32.734 55.089  1.00 61.91  ? 116  GLU A OE1   1 
ATOM   1613 O  OE2   . GLU C 3 116 ? 4.314   33.258 53.322  1.00 60.16  ? 116  GLU A OE2   1 
ATOM   1614 N  N     . VAL C 3 117 ? 4.595   35.446 58.517  1.00 53.88  ? 117  VAL A N     1 
ATOM   1615 C  CA    . VAL C 3 117 ? 4.377   36.318 59.664  1.00 54.22  ? 117  VAL A CA    1 
ATOM   1616 C  C     . VAL C 3 117 ? 2.955   36.061 60.164  1.00 54.81  ? 117  VAL A C     1 
ATOM   1617 O  O     . VAL C 3 117 ? 1.981   36.457 59.519  1.00 54.78  ? 117  VAL A O     1 
ATOM   1618 C  CB    . VAL C 3 117 ? 4.523   37.829 59.270  1.00 54.17  ? 117  VAL A CB    1 
ATOM   1619 C  CG1   . VAL C 3 117 ? 4.332   38.745 60.472  1.00 53.77  ? 117  VAL A CG1   1 
ATOM   1620 C  CG2   . VAL C 3 117 ? 5.868   38.117 58.613  1.00 54.14  ? 117  VAL A CG2   1 
ATOM   1621 N  N     . THR C 3 118 ? 2.846   35.391 61.305  1.00 55.49  ? 118  THR A N     1 
ATOM   1622 C  CA    . THR C 3 118 ? 1.573   35.043 61.903  1.00 56.49  ? 118  THR A CA    1 
ATOM   1623 C  C     . THR C 3 118 ? 0.938   36.288 62.521  1.00 57.52  ? 118  THR A C     1 
ATOM   1624 O  O     . THR C 3 118 ? 1.626   37.117 63.107  1.00 57.40  ? 118  THR A O     1 
ATOM   1625 C  CB    . THR C 3 118 ? 1.769   33.963 62.983  1.00 56.70  ? 118  THR A CB    1 
ATOM   1626 O  OG1   . THR C 3 118 ? 2.648   32.937 62.490  1.00 57.04  ? 118  THR A OG1   1 
ATOM   1627 C  CG2   . THR C 3 118 ? 0.422   33.333 63.404  1.00 56.80  ? 118  THR A CG2   1 
ATOM   1628 N  N     . SER C 3 119 ? -0.382  36.409 62.383  1.00 58.85  ? 119  SER A N     1 
ATOM   1629 C  CA    . SER C 3 119 ? -1.113  37.595 62.820  1.00 59.89  ? 119  SER A CA    1 
ATOM   1630 C  C     . SER C 3 119 ? -2.579  37.264 63.087  1.00 60.92  ? 119  SER A C     1 
ATOM   1631 O  O     . SER C 3 119 ? -3.336  36.963 62.161  1.00 60.85  ? 119  SER A O     1 
ATOM   1632 C  CB    . SER C 3 119 ? -1.010  38.713 61.777  1.00 59.72  ? 119  SER A CB    1 
ATOM   1633 O  OG    . SER C 3 119 ? -2.026  39.679 61.982  1.00 60.14  ? 119  SER A OG    1 
ATOM   1634 N  N     . PRO C 3 120 ? -2.983  37.321 64.363  1.00 62.02  ? 120  PRO A N     1 
ATOM   1635 C  CA    . PRO C 3 120 ? -4.359  37.027 64.764  1.00 62.61  ? 120  PRO A CA    1 
ATOM   1636 C  C     . PRO C 3 120 ? -5.323  38.200 64.569  1.00 63.11  ? 120  PRO A C     1 
ATOM   1637 O  O     . PRO C 3 120 ? -6.535  38.007 64.624  1.00 63.35  ? 120  PRO A O     1 
ATOM   1638 C  CB    . PRO C 3 120 ? -4.218  36.715 66.251  1.00 62.79  ? 120  PRO A CB    1 
ATOM   1639 C  CG    . PRO C 3 120 ? -3.083  37.589 66.696  1.00 62.69  ? 120  PRO A CG    1 
ATOM   1640 C  CD    . PRO C 3 120 ? -2.128  37.658 65.518  1.00 62.15  ? 120  PRO A CD    1 
ATOM   1641 N  N     . ASP C 3 121 ? -4.797  39.398 64.338  1.00 63.85  ? 121  ASP A N     1 
ATOM   1642 C  CA    . ASP C 3 121 ? -5.647  40.582 64.206  1.00 64.51  ? 121  ASP A CA    1 
ATOM   1643 C  C     . ASP C 3 121 ? -5.728  41.153 62.782  1.00 64.73  ? 121  ASP A C     1 
ATOM   1644 O  O     . ASP C 3 121 ? -5.922  42.359 62.602  1.00 65.02  ? 121  ASP A O     1 
ATOM   1645 C  CB    . ASP C 3 121 ? -5.188  41.666 65.181  1.00 64.55  ? 121  ASP A CB    1 
ATOM   1646 C  CG    . ASP C 3 121 ? -3.806  42.171 64.864  1.00 65.28  ? 121  ASP A CG    1 
ATOM   1647 O  OD1   . ASP C 3 121 ? -2.834  41.423 65.096  1.00 66.23  ? 121  ASP A OD1   1 
ATOM   1648 O  OD2   . ASP C 3 121 ? -3.697  43.316 64.378  1.00 66.60  ? 121  ASP A OD2   1 
ATOM   1649 N  N     . GLY C 3 122 ? -5.587  40.298 61.773  1.00 64.88  ? 122  GLY A N     1 
ATOM   1650 C  CA    . GLY C 3 122 ? -5.671  40.752 60.383  1.00 64.83  ? 122  GLY A CA    1 
ATOM   1651 C  C     . GLY C 3 122 ? -4.334  41.174 59.803  1.00 64.78  ? 122  GLY A C     1 
ATOM   1652 O  O     . GLY C 3 122 ? -3.321  41.195 60.505  1.00 64.43  ? 122  GLY A O     1 
ATOM   1653 N  N     . PHE C 3 123 ? -4.343  41.530 58.522  1.00 64.72  ? 123  PHE A N     1 
ATOM   1654 C  CA    . PHE C 3 123 ? -3.110  41.693 57.767  1.00 64.80  ? 123  PHE A CA    1 
ATOM   1655 C  C     . PHE C 3 123 ? -2.041  42.499 58.505  1.00 64.81  ? 123  PHE A C     1 
ATOM   1656 O  O     . PHE C 3 123 ? -2.289  43.635 58.904  1.00 64.91  ? 123  PHE A O     1 
ATOM   1657 C  CB    . PHE C 3 123 ? -3.375  42.282 56.384  1.00 64.78  ? 123  PHE A CB    1 
ATOM   1658 C  CG    . PHE C 3 123 ? -2.222  42.130 55.441  1.00 64.52  ? 123  PHE A CG    1 
ATOM   1659 C  CD1   . PHE C 3 123 ? -2.004  40.922 54.780  1.00 65.07  ? 123  PHE A CD1   1 
ATOM   1660 C  CD2   . PHE C 3 123 ? -1.348  43.191 55.216  1.00 64.86  ? 123  PHE A CD2   1 
ATOM   1661 C  CE1   . PHE C 3 123 ? -0.923  40.769 53.896  1.00 66.01  ? 123  PHE A CE1   1 
ATOM   1662 C  CE2   . PHE C 3 123 ? -0.269  43.060 54.342  1.00 65.71  ? 123  PHE A CE2   1 
ATOM   1663 C  CZ    . PHE C 3 123 ? -0.054  41.841 53.675  1.00 66.06  ? 123  PHE A CZ    1 
ATOM   1664 N  N     . PRO C 3 124 ? -0.856  41.887 58.710  1.00 64.88  ? 124  PRO A N     1 
ATOM   1665 C  CA    . PRO C 3 124 ? 0.312   42.504 59.352  1.00 64.86  ? 124  PRO A CA    1 
ATOM   1666 C  C     . PRO C 3 124 ? 0.940   43.635 58.535  1.00 65.02  ? 124  PRO A C     1 
ATOM   1667 O  O     . PRO C 3 124 ? 1.660   43.366 57.570  1.00 65.14  ? 124  PRO A O     1 
ATOM   1668 C  CB    . PRO C 3 124 ? 1.296   41.332 59.474  1.00 65.02  ? 124  PRO A CB    1 
ATOM   1669 C  CG    . PRO C 3 124 ? 0.881   40.371 58.394  1.00 64.66  ? 124  PRO A CG    1 
ATOM   1670 C  CD    . PRO C 3 124 ? -0.600  40.476 58.350  1.00 64.76  ? 124  PRO A CD    1 
ATOM   1671 N  N     . GLU C 3 125 ? 0.684   44.883 58.937  1.00 65.10  ? 125  GLU A N     1 
ATOM   1672 C  CA    . GLU C 3 125 ? 1.211   46.063 58.240  1.00 65.11  ? 125  GLU A CA    1 
ATOM   1673 C  C     . GLU C 3 125 ? 2.722   46.243 58.420  1.00 65.10  ? 125  GLU A C     1 
ATOM   1674 O  O     . GLU C 3 125 ? 3.222   46.203 59.546  1.00 65.10  ? 125  GLU A O     1 
ATOM   1675 C  CB    . GLU C 3 125 ? 0.455   47.323 58.663  1.00 64.99  ? 125  GLU A CB    1 
ATOM   1676 C  CG    . GLU C 3 125 ? -0.997  47.347 58.178  1.00 65.83  ? 125  GLU A CG    1 
ATOM   1677 C  CD    . GLU C 3 125 ? -1.126  47.271 56.644  1.00 66.85  ? 125  GLU A CD    1 
ATOM   1678 O  OE1   . GLU C 3 125 ? -0.583  48.159 55.936  1.00 65.34  ? 125  GLU A OE1   1 
ATOM   1679 O  OE2   . GLU C 3 125 ? -1.778  46.318 56.152  1.00 66.56  ? 125  GLU A OE2   1 
ATOM   1680 N  N     . PRO C 3 126 ? 3.458   46.407 57.303  1.00 65.12  ? 126  PRO A N     1 
ATOM   1681 C  CA    . PRO C 3 126 ? 4.914   46.587 57.360  1.00 65.25  ? 126  PRO A CA    1 
ATOM   1682 C  C     . PRO C 3 126 ? 5.318   47.928 57.954  1.00 65.41  ? 126  PRO A C     1 
ATOM   1683 O  O     . PRO C 3 126 ? 6.392   48.034 58.540  1.00 65.32  ? 126  PRO A O     1 
ATOM   1684 C  CB    . PRO C 3 126 ? 5.348   46.496 55.886  1.00 65.23  ? 126  PRO A CB    1 
ATOM   1685 C  CG    . PRO C 3 126 ? 4.176   45.882 55.171  1.00 65.03  ? 126  PRO A CG    1 
ATOM   1686 C  CD    . PRO C 3 126 ? 2.977   46.390 55.912  1.00 64.96  ? 126  PRO A CD    1 
ATOM   1687 N  N     . SER C 3 127 ? 4.466   48.941 57.783  1.00 66.03  ? 127  SER A N     1 
ATOM   1688 C  CA    . SER C 3 127 ? 4.635   50.249 58.423  1.00 66.19  ? 127  SER A CA    1 
ATOM   1689 C  C     . SER C 3 127 ? 4.959   50.048 59.891  1.00 66.16  ? 127  SER A C     1 
ATOM   1690 O  O     . SER C 3 127 ? 6.044   50.405 60.372  1.00 66.33  ? 127  SER A O     1 
ATOM   1691 C  CB    . SER C 3 127 ? 3.351   51.065 58.303  1.00 65.98  ? 127  SER A CB    1 
ATOM   1692 O  OG    . SER C 3 127 ? 3.509   52.097 57.357  1.00 67.34  ? 127  SER A OG    1 
ATOM   1693 N  N     . GLN C 3 128 ? 4.004   49.447 60.587  1.00 65.83  ? 128  GLN A N     1 
ATOM   1694 C  CA    . GLN C 3 128 ? 4.138   49.155 61.993  1.00 65.62  ? 128  GLN A CA    1 
ATOM   1695 C  C     . GLN C 3 128 ? 5.165   48.056 62.212  1.00 64.91  ? 128  GLN A C     1 
ATOM   1696 O  O     . GLN C 3 128 ? 6.130   48.271 62.943  1.00 64.79  ? 128  GLN A O     1 
ATOM   1697 C  CB    . GLN C 3 128 ? 2.760   48.823 62.589  1.00 66.07  ? 128  GLN A CB    1 
ATOM   1698 C  CG    . GLN C 3 128 ? 1.877   50.073 62.854  1.00 67.73  ? 128  GLN A CG    1 
ATOM   1699 C  CD    . GLN C 3 128 ? 1.930   51.116 61.722  1.00 70.91  ? 128  GLN A CD    1 
ATOM   1700 O  OE1   . GLN C 3 128 ? 1.238   50.985 60.701  1.00 72.57  ? 128  GLN A OE1   1 
ATOM   1701 N  NE2   . GLN C 3 128 ? 2.757   52.159 61.906  1.00 69.98  ? 128  GLN A NE2   1 
ATOM   1702 N  N     . ALA C 3 129 ? 4.983   46.916 61.534  1.00 64.32  ? 129  ALA A N     1 
ATOM   1703 C  CA    . ALA C 3 129 ? 5.852   45.726 61.663  1.00 63.64  ? 129  ALA A CA    1 
ATOM   1704 C  C     . ALA C 3 129 ? 5.848   45.202 63.101  1.00 63.39  ? 129  ALA A C     1 
ATOM   1705 O  O     . ALA C 3 129 ? 6.901   44.988 63.718  1.00 63.30  ? 129  ALA A O     1 
ATOM   1706 C  CB    . ALA C 3 129 ? 7.284   46.017 61.177  1.00 63.30  ? 129  ALA A CB    1 
ATOM   1707 N  N     . LYS C 3 130 ? 4.648   44.997 63.627  1.00 62.91  ? 130  LYS A N     1 
ATOM   1708 C  CA    . LYS C 3 130 ? 4.491   44.737 65.046  1.00 62.59  ? 130  LYS A CA    1 
ATOM   1709 C  C     . LYS C 3 130 ? 4.419   43.248 65.413  1.00 62.31  ? 130  LYS A C     1 
ATOM   1710 O  O     . LYS C 3 130 ? 4.176   42.900 66.570  1.00 62.43  ? 130  LYS A O     1 
ATOM   1711 C  CB    . LYS C 3 130 ? 3.300   45.541 65.601  1.00 62.73  ? 130  LYS A CB    1 
ATOM   1712 C  CG    . LYS C 3 130 ? 1.895   45.036 65.244  1.00 62.93  ? 130  LYS A CG    1 
ATOM   1713 C  CD    . LYS C 3 130 ? 0.849   46.096 65.628  1.00 62.88  ? 130  LYS A CD    1 
ATOM   1714 C  CE    . LYS C 3 130 ? -0.233  45.562 66.576  1.00 63.19  ? 130  LYS A CE    1 
ATOM   1715 N  NZ    . LYS C 3 130 ? -1.242  44.636 65.952  1.00 62.97  ? 130  LYS A NZ    1 
ATOM   1716 N  N     . HIS C 3 131 ? 4.664   42.371 64.439  1.00 61.67  ? 131  HIS A N     1 
ATOM   1717 C  CA    . HIS C 3 131 ? 4.587   40.925 64.669  1.00 60.92  ? 131  HIS A CA    1 
ATOM   1718 C  C     . HIS C 3 131 ? 5.874   40.221 64.267  1.00 60.04  ? 131  HIS A C     1 
ATOM   1719 O  O     . HIS C 3 131 ? 6.578   40.686 63.367  1.00 60.10  ? 131  HIS A O     1 
ATOM   1720 C  CB    . HIS C 3 131 ? 3.406   40.309 63.914  1.00 61.11  ? 131  HIS A CB    1 
ATOM   1721 C  CG    . HIS C 3 131 ? 2.067   40.791 64.382  1.00 62.91  ? 131  HIS A CG    1 
ATOM   1722 N  ND1   . HIS C 3 131 ? 1.433   40.272 65.491  1.00 64.11  ? 131  HIS A ND1   1 
ATOM   1723 C  CD2   . HIS C 3 131 ? 1.236   41.738 63.884  1.00 64.33  ? 131  HIS A CD2   1 
ATOM   1724 C  CE1   . HIS C 3 131 ? 0.271   40.878 65.656  1.00 64.31  ? 131  HIS A CE1   1 
ATOM   1725 N  NE2   . HIS C 3 131 ? 0.126   41.771 64.693  1.00 64.93  ? 131  HIS A NE2   1 
ATOM   1726 N  N     . PRO C 3 132 ? 6.199   39.107 64.954  1.00 59.26  ? 132  PRO A N     1 
ATOM   1727 C  CA    . PRO C 3 132 ? 7.320   38.211 64.621  1.00 58.64  ? 132  PRO A CA    1 
ATOM   1728 C  C     . PRO C 3 132 ? 7.313   37.597 63.194  1.00 57.74  ? 132  PRO A C     1 
ATOM   1729 O  O     . PRO C 3 132 ? 6.289   37.073 62.730  1.00 57.33  ? 132  PRO A O     1 
ATOM   1730 C  CB    . PRO C 3 132 ? 7.193   37.093 65.674  1.00 58.69  ? 132  PRO A CB    1 
ATOM   1731 C  CG    . PRO C 3 132 ? 6.468   37.725 66.809  1.00 58.48  ? 132  PRO A CG    1 
ATOM   1732 C  CD    . PRO C 3 132 ? 5.497   38.661 66.175  1.00 59.14  ? 132  PRO A CD    1 
ATOM   1733 N  N     . ILE C 3 133 ? 8.462   37.687 62.525  1.00 56.59  ? 133  ILE A N     1 
ATOM   1734 C  CA    . ILE C 3 133 ? 8.735   36.963 61.292  1.00 55.69  ? 133  ILE A CA    1 
ATOM   1735 C  C     . ILE C 3 133 ? 9.113   35.532 61.677  1.00 55.72  ? 133  ILE A C     1 
ATOM   1736 O  O     . ILE C 3 133 ? 10.193  35.287 62.234  1.00 55.65  ? 133  ILE A O     1 
ATOM   1737 C  CB    . ILE C 3 133 ? 9.920   37.586 60.500  1.00 55.61  ? 133  ILE A CB    1 
ATOM   1738 C  CG1   . ILE C 3 133 ? 9.646   39.061 60.171  1.00 55.13  ? 133  ILE A CG1   1 
ATOM   1739 C  CG2   . ILE C 3 133 ? 10.234  36.744 59.250  1.00 54.79  ? 133  ILE A CG2   1 
ATOM   1740 C  CD1   . ILE C 3 133 ? 10.833  39.817 59.578  1.00 54.67  ? 133  ILE A CD1   1 
ATOM   1741 N  N     . ASP C 3 134 ? 8.234   34.584 61.376  1.00 55.29  ? 134  ASP A N     1 
ATOM   1742 C  CA    . ASP C 3 134 ? 8.424   33.218 61.841  1.00 54.83  ? 134  ASP A CA    1 
ATOM   1743 C  C     . ASP C 3 134 ? 8.993   32.259 60.793  1.00 54.45  ? 134  ASP A C     1 
ATOM   1744 O  O     . ASP C 3 134 ? 9.061   31.038 61.029  1.00 54.69  ? 134  ASP A O     1 
ATOM   1745 C  CB    . ASP C 3 134 ? 7.127   32.678 62.439  1.00 55.14  ? 134  ASP A CB    1 
ATOM   1746 C  CG    . ASP C 3 134 ? 5.914   33.019 61.606  1.00 55.69  ? 134  ASP A CG    1 
ATOM   1747 O  OD1   . ASP C 3 134 ? 5.890   32.659 60.401  1.00 56.87  ? 134  ASP A OD1   1 
ATOM   1748 O  OD2   . ASP C 3 134 ? 4.988   33.641 62.163  1.00 55.17  ? 134  ASP A OD2   1 
ATOM   1749 N  N     . ALA C 3 135 ? 9.419   32.810 59.655  1.00 53.57  ? 135  ALA A N     1 
ATOM   1750 C  CA    . ALA C 3 135 ? 10.000  32.017 58.562  1.00 52.86  ? 135  ALA A CA    1 
ATOM   1751 C  C     . ALA C 3 135 ? 10.453  32.903 57.419  1.00 52.25  ? 135  ALA A C     1 
ATOM   1752 O  O     . ALA C 3 135 ? 9.776   33.875 57.084  1.00 52.20  ? 135  ALA A O     1 
ATOM   1753 C  CB    . ALA C 3 135 ? 8.988   30.973 58.036  1.00 52.67  ? 135  ALA A CB    1 
ATOM   1754 N  N     . ILE C 3 136 ? 11.595  32.575 56.825  1.00 51.64  ? 136  ILE A N     1 
ATOM   1755 C  CA    . ILE C 3 136 ? 11.965  33.168 55.545  1.00 51.86  ? 136  ILE A CA    1 
ATOM   1756 C  C     . ILE C 3 136 ? 12.603  32.119 54.633  1.00 51.50  ? 136  ILE A C     1 
ATOM   1757 O  O     . ILE C 3 136 ? 13.398  31.298 55.083  1.00 52.14  ? 136  ILE A O     1 
ATOM   1758 C  CB    . ILE C 3 136 ? 12.884  34.433 55.685  1.00 51.79  ? 136  ILE A CB    1 
ATOM   1759 C  CG1   . ILE C 3 136 ? 14.218  34.246 54.961  1.00 53.03  ? 136  ILE A CG1   1 
ATOM   1760 C  CG2   . ILE C 3 136 ? 13.088  34.854 57.141  1.00 52.12  ? 136  ILE A CG2   1 
ATOM   1761 C  CD1   . ILE C 3 136 ? 14.233  34.849 53.569  1.00 54.80  ? 136  ILE A CD1   1 
ATOM   1762 N  N     . THR C 3 137 ? 12.247  32.137 53.354  1.00 50.80  ? 137  THR A N     1 
ATOM   1763 C  CA    . THR C 3 137 ? 12.967  31.331 52.382  1.00 50.06  ? 137  THR A CA    1 
ATOM   1764 C  C     . THR C 3 137 ? 13.658  32.248 51.401  1.00 49.60  ? 137  THR A C     1 
ATOM   1765 O  O     . THR C 3 137 ? 13.030  33.092 50.769  1.00 49.58  ? 137  THR A O     1 
ATOM   1766 C  CB    . THR C 3 137 ? 12.065  30.326 51.671  1.00 49.97  ? 137  THR A CB    1 
ATOM   1767 O  OG1   . THR C 3 137 ? 11.472  29.474 52.652  1.00 50.22  ? 137  THR A OG1   1 
ATOM   1768 C  CG2   . THR C 3 137 ? 12.874  29.466 50.726  1.00 49.95  ? 137  THR A CG2   1 
ATOM   1769 N  N     . HIS C 3 138 ? 14.970  32.091 51.319  1.00 48.98  ? 138  HIS A N     1 
ATOM   1770 C  CA    . HIS C 3 138 ? 15.792  32.944 50.517  1.00 48.25  ? 138  HIS A CA    1 
ATOM   1771 C  C     . HIS C 3 138 ? 16.508  32.037 49.577  1.00 48.06  ? 138  HIS A C     1 
ATOM   1772 O  O     . HIS C 3 138 ? 17.330  31.237 49.992  1.00 48.21  ? 138  HIS A O     1 
ATOM   1773 C  CB    . HIS C 3 138 ? 16.796  33.657 51.405  1.00 48.29  ? 138  HIS A CB    1 
ATOM   1774 C  CG    . HIS C 3 138 ? 17.575  34.721 50.705  1.00 47.97  ? 138  HIS A CG    1 
ATOM   1775 N  ND1   . HIS C 3 138 ? 17.453  36.058 51.020  1.00 47.94  ? 138  HIS A ND1   1 
ATOM   1776 C  CD2   . HIS C 3 138 ? 18.495  34.648 49.713  1.00 47.38  ? 138  HIS A CD2   1 
ATOM   1777 C  CE1   . HIS C 3 138 ? 18.258  36.763 50.244  1.00 47.95  ? 138  HIS A CE1   1 
ATOM   1778 N  NE2   . HIS C 3 138 ? 18.899  35.931 49.441  1.00 47.60  ? 138  HIS A NE2   1 
ATOM   1779 N  N     . TYR C 3 139 ? 16.177  32.143 48.302  1.00 47.94  ? 139  TYR A N     1 
ATOM   1780 C  CA    . TYR C 3 139 ? 16.857  31.373 47.278  1.00 47.52  ? 139  TYR A CA    1 
ATOM   1781 C  C     . TYR C 3 139 ? 17.951  32.215 46.610  1.00 48.37  ? 139  TYR A C     1 
ATOM   1782 O  O     . TYR C 3 139 ? 17.718  33.383 46.273  1.00 48.59  ? 139  TYR A O     1 
ATOM   1783 C  CB    . TYR C 3 139 ? 15.854  30.880 46.226  1.00 46.49  ? 139  TYR A CB    1 
ATOM   1784 C  CG    . TYR C 3 139 ? 16.558  30.323 45.042  1.00 44.42  ? 139  TYR A CG    1 
ATOM   1785 C  CD1   . TYR C 3 139 ? 16.946  28.986 45.017  1.00 42.87  ? 139  TYR A CD1   1 
ATOM   1786 C  CD2   . TYR C 3 139 ? 16.914  31.151 43.972  1.00 41.53  ? 139  TYR A CD2   1 
ATOM   1787 C  CE1   . TYR C 3 139 ? 17.646  28.478 43.938  1.00 43.52  ? 139  TYR A CE1   1 
ATOM   1788 C  CE2   . TYR C 3 139 ? 17.609  30.659 42.896  1.00 40.93  ? 139  TYR A CE2   1 
ATOM   1789 C  CZ    . TYR C 3 139 ? 17.976  29.327 42.879  1.00 43.04  ? 139  TYR A CZ    1 
ATOM   1790 O  OH    . TYR C 3 139 ? 18.677  28.824 41.811  1.00 43.57  ? 139  TYR A OH    1 
ATOM   1791 N  N     . ASP C 3 140 ? 19.115  31.604 46.380  1.00 48.99  ? 140  ASP A N     1 
ATOM   1792 C  CA    . ASP C 3 140 ? 20.273  32.280 45.784  1.00 49.66  ? 140  ASP A CA    1 
ATOM   1793 C  C     . ASP C 3 140 ? 20.720  31.617 44.480  1.00 49.97  ? 140  ASP A C     1 
ATOM   1794 O  O     . ASP C 3 140 ? 21.171  30.477 44.485  1.00 49.97  ? 140  ASP A O     1 
ATOM   1795 C  CB    . ASP C 3 140 ? 21.427  32.275 46.797  1.00 50.04  ? 140  ASP A CB    1 
ATOM   1796 C  CG    . ASP C 3 140 ? 22.653  33.040 46.314  1.00 51.42  ? 140  ASP A CG    1 
ATOM   1797 O  OD1   . ASP C 3 140 ? 23.398  32.515 45.438  1.00 52.97  ? 140  ASP A OD1   1 
ATOM   1798 O  OD2   . ASP C 3 140 ? 22.881  34.161 46.838  1.00 51.84  ? 140  ASP A OD2   1 
ATOM   1799 N  N     . SER C 3 141 ? 20.633  32.351 43.375  1.00 50.49  ? 141  SER A N     1 
ATOM   1800 C  CA    . SER C 3 141 ? 20.902  31.806 42.044  1.00 50.91  ? 141  SER A CA    1 
ATOM   1801 C  C     . SER C 3 141 ? 22.336  31.330 41.825  1.00 51.90  ? 141  SER A C     1 
ATOM   1802 O  O     . SER C 3 141 ? 22.586  30.474 40.970  1.00 51.90  ? 141  SER A O     1 
ATOM   1803 C  CB    . SER C 3 141 ? 20.573  32.846 40.990  1.00 50.41  ? 141  SER A CB    1 
ATOM   1804 O  OG    . SER C 3 141 ? 21.310  34.023 41.245  1.00 50.21  ? 141  SER A OG    1 
ATOM   1805 N  N     . ILE C 3 142 ? 23.277  31.913 42.567  1.00 53.13  ? 142  ILE A N     1 
ATOM   1806 C  CA    . ILE C 3 142 ? 24.706  31.583 42.425  1.00 54.13  ? 142  ILE A CA    1 
ATOM   1807 C  C     . ILE C 3 142 ? 25.055  30.257 43.115  1.00 54.39  ? 142  ILE A C     1 
ATOM   1808 O  O     . ILE C 3 142 ? 25.829  29.445 42.575  1.00 54.41  ? 142  ILE A O     1 
ATOM   1809 C  CB    . ILE C 3 142 ? 25.620  32.736 42.945  1.00 54.46  ? 142  ILE A CB    1 
ATOM   1810 C  CG1   . ILE C 3 142 ? 25.814  33.788 41.838  1.00 54.91  ? 142  ILE A CG1   1 
ATOM   1811 C  CG2   . ILE C 3 142 ? 26.974  32.195 43.445  1.00 54.24  ? 142  ILE A CG2   1 
ATOM   1812 C  CD1   . ILE C 3 142 ? 26.594  35.022 42.278  1.00 54.18  ? 142  ILE A CD1   1 
ATOM   1813 N  N     . ASP C 3 143 ? 24.476  30.060 44.303  1.00 54.39  ? 143  ASP A N     1 
ATOM   1814 C  CA    . ASP C 3 143 ? 24.647  28.844 45.078  1.00 54.52  ? 143  ASP A CA    1 
ATOM   1815 C  C     . ASP C 3 143 ? 23.679  27.783 44.591  1.00 54.68  ? 143  ASP A C     1 
ATOM   1816 O  O     . ASP C 3 143 ? 23.976  26.577 44.649  1.00 55.04  ? 143  ASP A O     1 
ATOM   1817 C  CB    . ASP C 3 143 ? 24.380  29.113 46.556  1.00 54.54  ? 143  ASP A CB    1 
ATOM   1818 C  CG    . ASP C 3 143 ? 25.430  30.010 47.193  1.00 55.27  ? 143  ASP A CG    1 
ATOM   1819 O  OD1   . ASP C 3 143 ? 26.542  30.198 46.619  1.00 55.51  ? 143  ASP A OD1   1 
ATOM   1820 O  OD2   . ASP C 3 143 ? 25.129  30.523 48.290  1.00 55.12  ? 143  ASP A OD2   1 
ATOM   1821 N  N     . ASP C 3 144 ? 22.523  28.252 44.115  1.00 54.29  ? 144  ASP A N     1 
ATOM   1822 C  CA    . ASP C 3 144 ? 21.408  27.407 43.699  1.00 53.62  ? 144  ASP A CA    1 
ATOM   1823 C  C     . ASP C 3 144 ? 20.838  26.624 44.894  1.00 53.17  ? 144  ASP A C     1 
ATOM   1824 O  O     . ASP C 3 144 ? 20.584  25.431 44.807  1.00 53.20  ? 144  ASP A O     1 
ATOM   1825 C  CB    . ASP C 3 144 ? 21.824  26.509 42.528  1.00 53.30  ? 144  ASP A CB    1 
ATOM   1826 C  CG    . ASP C 3 144 ? 20.654  25.813 41.883  1.00 54.13  ? 144  ASP A CG    1 
ATOM   1827 O  OD1   . ASP C 3 144 ? 19.552  26.410 41.833  1.00 56.44  ? 144  ASP A OD1   1 
ATOM   1828 O  OD2   . ASP C 3 144 ? 20.831  24.663 41.422  1.00 54.29  ? 144  ASP A OD2   1 
ATOM   1829 N  N     . ARG C 3 145 ? 20.644  27.316 46.011  1.00 52.93  ? 145  ARG A N     1 
ATOM   1830 C  CA    . ARG C 3 145 ? 20.118  26.693 47.233  1.00 53.05  ? 145  ARG A CA    1 
ATOM   1831 C  C     . ARG C 3 145 ? 18.992  27.554 47.830  1.00 52.93  ? 145  ARG A C     1 
ATOM   1832 O  O     . ARG C 3 145 ? 18.969  28.777 47.645  1.00 53.59  ? 145  ARG A O     1 
ATOM   1833 C  CB    . ARG C 3 145 ? 21.232  26.516 48.290  1.00 53.18  ? 145  ARG A CB    1 
ATOM   1834 C  CG    . ARG C 3 145 ? 22.515  25.750 47.866  1.00 53.57  ? 145  ARG A CG    1 
ATOM   1835 C  CD    . ARG C 3 145 ? 22.395  24.197 47.956  1.00 53.90  ? 145  ARG A CD    1 
ATOM   1836 N  NE    . ARG C 3 145 ? 22.299  23.585 46.627  1.00 54.67  ? 145  ARG A NE    1 
ATOM   1837 C  CZ    . ARG C 3 145 ? 23.313  23.035 45.953  1.00 55.74  ? 145  ARG A CZ    1 
ATOM   1838 N  NH1   . ARG C 3 145 ? 24.533  22.973 46.472  1.00 55.85  ? 145  ARG A NH1   1 
ATOM   1839 N  NH2   . ARG C 3 145 ? 23.103  22.522 44.748  1.00 56.73  ? 145  ARG A NH2   1 
ATOM   1840 N  N     . PHE C 3 146 ? 18.060  26.930 48.535  1.00 52.08  ? 146  PHE A N     1 
ATOM   1841 C  CA    . PHE C 3 146 ? 17.026  27.682 49.218  1.00 51.89  ? 146  PHE A CA    1 
ATOM   1842 C  C     . PHE C 3 146 ? 17.389  27.674 50.660  1.00 51.88  ? 146  PHE A C     1 
ATOM   1843 O  O     . PHE C 3 146 ? 17.444  26.611 51.290  1.00 51.93  ? 146  PHE A O     1 
ATOM   1844 C  CB    . PHE C 3 146 ? 15.652  27.019 49.094  1.00 51.99  ? 146  PHE A CB    1 
ATOM   1845 C  CG    . PHE C 3 146 ? 15.207  26.777 47.684  1.00 51.73  ? 146  PHE A CG    1 
ATOM   1846 C  CD1   . PHE C 3 146 ? 15.915  25.917 46.850  1.00 50.61  ? 146  PHE A CD1   1 
ATOM   1847 C  CD2   . PHE C 3 146 ? 14.053  27.389 47.201  1.00 51.56  ? 146  PHE A CD2   1 
ATOM   1848 C  CE1   . PHE C 3 146 ? 15.496  25.685 45.555  1.00 51.59  ? 146  PHE A CE1   1 
ATOM   1849 C  CE2   . PHE C 3 146 ? 13.617  27.162 45.900  1.00 51.42  ? 146  PHE A CE2   1 
ATOM   1850 C  CZ    . PHE C 3 146 ? 14.338  26.310 45.074  1.00 52.01  ? 146  PHE A CZ    1 
ATOM   1851 N  N     . TYR C 3 147 ? 17.623  28.853 51.203  1.00 51.92  ? 147  TYR A N     1 
ATOM   1852 C  CA    . TYR C 3 147 ? 17.973  28.944 52.602  1.00 52.04  ? 147  TYR A CA    1 
ATOM   1853 C  C     . TYR C 3 147 ? 16.726  29.174 53.442  1.00 52.23  ? 147  TYR A C     1 
ATOM   1854 O  O     . TYR C 3 147 ? 16.102  30.228 53.375  1.00 52.54  ? 147  TYR A O     1 
ATOM   1855 C  CB    . TYR C 3 147 ? 19.024  30.021 52.810  1.00 51.80  ? 147  TYR A CB    1 
ATOM   1856 C  CG    . TYR C 3 147 ? 20.316  29.730 52.090  1.00 52.02  ? 147  TYR A CG    1 
ATOM   1857 C  CD1   . TYR C 3 147 ? 20.475  30.073 50.747  1.00 52.93  ? 147  TYR A CD1   1 
ATOM   1858 C  CD2   . TYR C 3 147 ? 21.392  29.113 52.746  1.00 52.25  ? 147  TYR A CD2   1 
ATOM   1859 C  CE1   . TYR C 3 147 ? 21.668  29.806 50.062  1.00 52.85  ? 147  TYR A CE1   1 
ATOM   1860 C  CE2   . TYR C 3 147 ? 22.594  28.838 52.066  1.00 51.21  ? 147  TYR A CE2   1 
ATOM   1861 C  CZ    . TYR C 3 147 ? 22.716  29.189 50.727  1.00 51.92  ? 147  TYR A CZ    1 
ATOM   1862 O  OH    . TYR C 3 147 ? 23.874  28.941 50.026  1.00 52.01  ? 147  TYR A OH    1 
ATOM   1863 N  N     . VAL C 3 148 ? 16.360  28.168 54.225  1.00 52.76  ? 148  VAL A N     1 
ATOM   1864 C  CA    . VAL C 3 148 ? 15.164  28.242 55.066  1.00 53.15  ? 148  VAL A CA    1 
ATOM   1865 C  C     . VAL C 3 148 ? 15.460  28.614 56.525  1.00 53.94  ? 148  VAL A C     1 
ATOM   1866 O  O     . VAL C 3 148 ? 16.127  27.877 57.276  1.00 53.88  ? 148  VAL A O     1 
ATOM   1867 C  CB    . VAL C 3 148 ? 14.344  26.957 54.985  1.00 52.72  ? 148  VAL A CB    1 
ATOM   1868 C  CG1   . VAL C 3 148 ? 13.008  27.138 55.694  1.00 52.17  ? 148  VAL A CG1   1 
ATOM   1869 C  CG2   . VAL C 3 148 ? 14.130  26.586 53.531  1.00 52.46  ? 148  VAL A CG2   1 
ATOM   1870 N  N     . PHE C 3 149 ? 14.953  29.780 56.896  1.00 54.66  ? 149  PHE A N     1 
ATOM   1871 C  CA    . PHE C 3 149 ? 15.110  30.337 58.228  1.00 55.79  ? 149  PHE A CA    1 
ATOM   1872 C  C     . PHE C 3 149 ? 13.807  30.084 58.946  1.00 56.85  ? 149  PHE A C     1 
ATOM   1873 O  O     . PHE C 3 149 ? 12.759  30.549 58.517  1.00 57.32  ? 149  PHE A O     1 
ATOM   1874 C  CB    . PHE C 3 149 ? 15.416  31.843 58.134  1.00 55.59  ? 149  PHE A CB    1 
ATOM   1875 C  CG    . PHE C 3 149 ? 16.750  32.149 57.504  1.00 54.78  ? 149  PHE A CG    1 
ATOM   1876 C  CD1   . PHE C 3 149 ? 16.895  32.166 56.120  1.00 54.10  ? 149  PHE A CD1   1 
ATOM   1877 C  CD2   . PHE C 3 149 ? 17.869  32.381 58.298  1.00 53.90  ? 149  PHE A CD2   1 
ATOM   1878 C  CE1   . PHE C 3 149 ? 18.143  32.420 55.531  1.00 54.88  ? 149  PHE A CE1   1 
ATOM   1879 C  CE2   . PHE C 3 149 ? 19.113  32.636 57.725  1.00 54.47  ? 149  PHE A CE2   1 
ATOM   1880 C  CZ    . PHE C 3 149 ? 19.253  32.655 56.335  1.00 54.41  ? 149  PHE A CZ    1 
ATOM   1881 N  N     . ASP C 3 150 ? 13.864  29.323 60.028  1.00 58.21  ? 150  ASP A N     1 
ATOM   1882 C  CA    . ASP C 3 150 ? 12.654  28.845 60.673  1.00 59.45  ? 150  ASP A CA    1 
ATOM   1883 C  C     . ASP C 3 150 ? 12.693  29.284 62.121  1.00 60.34  ? 150  ASP A C     1 
ATOM   1884 O  O     . ASP C 3 150 ? 13.740  29.169 62.765  1.00 60.99  ? 150  ASP A O     1 
ATOM   1885 C  CB    . ASP C 3 150 ? 12.599  27.315 60.557  1.00 59.40  ? 150  ASP A CB    1 
ATOM   1886 C  CG    . ASP C 3 150 ? 11.264  26.719 60.994  1.00 60.30  ? 150  ASP A CG    1 
ATOM   1887 O  OD1   . ASP C 3 150 ? 10.337  27.475 61.385  1.00 61.90  ? 150  ASP A OD1   1 
ATOM   1888 O  OD2   . ASP C 3 150 ? 11.147  25.472 60.945  1.00 60.22  ? 150  ASP A OD2   1 
ATOM   1889 N  N     . LEU C 3 151 ? 11.565  29.795 62.617  1.00 61.31  ? 151  LEU A N     1 
ATOM   1890 C  CA    . LEU C 3 151 ? 11.432  30.233 64.021  1.00 62.23  ? 151  LEU A CA    1 
ATOM   1891 C  C     . LEU C 3 151 ? 10.609  29.265 64.916  1.00 62.78  ? 151  LEU A C     1 
ATOM   1892 O  O     . LEU C 3 151 ? 9.363   29.256 64.877  1.00 63.11  ? 151  LEU A O     1 
ATOM   1893 C  CB    . LEU C 3 151 ? 10.845  31.651 64.104  1.00 62.04  ? 151  LEU A CB    1 
ATOM   1894 C  CG    . LEU C 3 151 ? 10.522  32.142 65.529  1.00 62.78  ? 151  LEU A CG    1 
ATOM   1895 C  CD1   . LEU C 3 151 ? 11.806  32.453 66.326  1.00 62.79  ? 151  LEU A CD1   1 
ATOM   1896 C  CD2   . LEU C 3 151 ? 9.559   33.328 65.545  1.00 61.96  ? 151  LEU A CD2   1 
ATOM   1897 N  N     . LEU C 3 152 ? 11.306  28.487 65.742  1.00 62.69  ? 152  LEU A N     1 
ATOM   1898 C  CA    . LEU C 3 152 ? 10.655  27.474 66.562  1.00 62.71  ? 152  LEU A CA    1 
ATOM   1899 C  C     . LEU C 3 152 ? 9.863   28.043 67.735  1.00 62.81  ? 152  LEU A C     1 
ATOM   1900 O  O     . LEU C 3 152 ? 8.987   27.370 68.279  1.00 62.72  ? 152  LEU A O     1 
ATOM   1901 C  CB    . LEU C 3 152 ? 11.679  26.446 67.049  1.00 62.68  ? 152  LEU A CB    1 
ATOM   1902 C  CG    . LEU C 3 152 ? 12.522  25.764 65.967  1.00 63.21  ? 152  LEU A CG    1 
ATOM   1903 C  CD1   . LEU C 3 152 ? 13.601  24.868 66.570  1.00 64.29  ? 152  LEU A CD1   1 
ATOM   1904 C  CD2   . LEU C 3 152 ? 11.649  24.999 64.961  1.00 63.85  ? 152  LEU A CD2   1 
ATOM   1905 N  N     . ASN C 3 153 ? 10.157  29.286 68.113  1.00 63.31  ? 153  ASN A N     1 
ATOM   1906 C  CA    . ASN C 3 153 ? 9.570   29.873 69.328  1.00 63.76  ? 153  ASN A CA    1 
ATOM   1907 C  C     . ASN C 3 153 ? 9.092   31.302 69.204  1.00 63.89  ? 153  ASN A C     1 
ATOM   1908 O  O     . ASN C 3 153 ? 9.835   32.182 68.767  1.00 63.90  ? 153  ASN A O     1 
ATOM   1909 C  CB    . ASN C 3 153 ? 10.537  29.757 70.508  1.00 63.67  ? 153  ASN A CB    1 
ATOM   1910 C  CG    . ASN C 3 153 ? 10.678  28.338 70.992  1.00 63.67  ? 153  ASN A CG    1 
ATOM   1911 O  OD1   . ASN C 3 153 ? 9.679   27.638 71.210  1.00 63.14  ? 153  ASN A OD1   1 
ATOM   1912 N  ND2   . ASN C 3 153 ? 11.922  27.892 71.149  1.00 63.61  ? 153  ASN A ND2   1 
ATOM   1913 N  N     . SER C 3 154 ? 7.853   31.526 69.631  1.00 64.22  ? 154  SER A N     1 
ATOM   1914 C  CA    . SER C 3 154 ? 7.190   32.806 69.431  1.00 64.75  ? 154  SER A CA    1 
ATOM   1915 C  C     . SER C 3 154 ? 6.010   32.998 70.372  1.00 64.97  ? 154  SER A C     1 
ATOM   1916 O  O     . SER C 3 154 ? 5.397   32.018 70.798  1.00 65.34  ? 154  SER A O     1 
ATOM   1917 C  CB    . SER C 3 154 ? 6.701   32.904 67.988  1.00 64.62  ? 154  SER A CB    1 
ATOM   1918 O  OG    . SER C 3 154 ? 5.496   33.641 67.912  1.00 65.37  ? 154  SER A OG    1 
ATOM   1919 N  N     . PRO C 3 155 ? 5.671   34.265 70.680  1.00 65.12  ? 155  PRO A N     1 
ATOM   1920 C  CA    . PRO C 3 155 ? 4.443   34.576 71.405  1.00 65.33  ? 155  PRO A CA    1 
ATOM   1921 C  C     . PRO C 3 155 ? 3.235   33.798 70.880  1.00 65.64  ? 155  PRO A C     1 
ATOM   1922 O  O     . PRO C 3 155 ? 2.228   33.691 71.579  1.00 65.83  ? 155  PRO A O     1 
ATOM   1923 C  CB    . PRO C 3 155 ? 4.240   36.074 71.128  1.00 65.37  ? 155  PRO A CB    1 
ATOM   1924 C  CG    . PRO C 3 155 ? 5.359   36.488 70.179  1.00 65.01  ? 155  PRO A CG    1 
ATOM   1925 C  CD    . PRO C 3 155 ? 6.433   35.486 70.369  1.00 65.00  ? 155  PRO A CD    1 
ATOM   1926 N  N     . TYR C 3 156 ? 3.344   33.270 69.662  1.00 65.89  ? 156  TYR A N     1 
ATOM   1927 C  CA    . TYR C 3 156 ? 2.231   32.592 68.984  1.00 66.17  ? 156  TYR A CA    1 
ATOM   1928 C  C     . TYR C 3 156 ? 2.388   31.075 68.874  1.00 66.53  ? 156  TYR A C     1 
ATOM   1929 O  O     . TYR C 3 156 ? 1.653   30.424 68.117  1.00 66.62  ? 156  TYR A O     1 
ATOM   1930 C  CB    . TYR C 3 156 ? 2.004   33.189 67.588  1.00 65.94  ? 156  TYR A CB    1 
ATOM   1931 C  CG    . TYR C 3 156 ? 1.579   34.630 67.629  1.00 65.44  ? 156  TYR A CG    1 
ATOM   1932 C  CD1   . TYR C 3 156 ? 0.319   34.980 68.094  1.00 65.40  ? 156  TYR A CD1   1 
ATOM   1933 C  CD2   . TYR C 3 156 ? 2.436   35.642 67.211  1.00 65.54  ? 156  TYR A CD2   1 
ATOM   1934 C  CE1   . TYR C 3 156 ? -0.081  36.297 68.157  1.00 65.31  ? 156  TYR A CE1   1 
ATOM   1935 C  CE2   . TYR C 3 156 ? 2.044   36.973 67.259  1.00 65.55  ? 156  TYR A CE2   1 
ATOM   1936 C  CZ    . TYR C 3 156 ? 0.778   37.291 67.737  1.00 65.45  ? 156  TYR A CZ    1 
ATOM   1937 O  OH    . TYR C 3 156 ? 0.360   38.600 67.802  1.00 65.14  ? 156  TYR A OH    1 
ATOM   1938 N  N     . GLY C 3 157 ? 3.343   30.520 69.620  1.00 66.69  ? 157  GLY A N     1 
ATOM   1939 C  CA    . GLY C 3 157 ? 3.536   29.080 69.646  1.00 66.65  ? 157  GLY A CA    1 
ATOM   1940 C  C     . GLY C 3 157 ? 4.967   28.575 69.706  1.00 66.88  ? 157  GLY A C     1 
ATOM   1941 O  O     . GLY C 3 157 ? 5.904   29.199 69.189  1.00 66.65  ? 157  GLY A O     1 
ATOM   1942 N  N     . ASN C 3 158 ? 5.113   27.423 70.354  1.00 66.97  ? 158  ASN A N     1 
ATOM   1943 C  CA    . ASN C 3 158 ? 6.341   26.656 70.346  1.00 66.97  ? 158  ASN A CA    1 
ATOM   1944 C  C     . ASN C 3 158 ? 6.121   25.414 69.484  1.00 66.53  ? 158  ASN A C     1 
ATOM   1945 O  O     . ASN C 3 158 ? 5.210   24.629 69.743  1.00 66.37  ? 158  ASN A O     1 
ATOM   1946 C  CB    . ASN C 3 158 ? 6.731   26.282 71.784  1.00 67.36  ? 158  ASN A CB    1 
ATOM   1947 C  CG    . ASN C 3 158 ? 6.887   27.506 72.693  1.00 68.58  ? 158  ASN A CG    1 
ATOM   1948 O  OD1   . ASN C 3 158 ? 7.194   28.609 72.225  1.00 70.64  ? 158  ASN A OD1   1 
ATOM   1949 N  ND2   . ASN C 3 158 ? 6.682   27.311 73.998  1.00 68.88  ? 158  ASN A ND2   1 
ATOM   1950 N  N     . VAL C 3 159 ? 6.946   25.255 68.453  1.00 66.22  ? 159  VAL A N     1 
ATOM   1951 C  CA    . VAL C 3 159 ? 6.784   24.174 67.474  1.00 66.09  ? 159  VAL A CA    1 
ATOM   1952 C  C     . VAL C 3 159 ? 8.063   23.350 67.327  1.00 66.33  ? 159  VAL A C     1 
ATOM   1953 O  O     . VAL C 3 159 ? 9.155   23.858 67.591  1.00 66.20  ? 159  VAL A O     1 
ATOM   1954 C  CB    . VAL C 3 159 ? 6.416   24.731 66.081  1.00 66.12  ? 159  VAL A CB    1 
ATOM   1955 C  CG1   . VAL C 3 159 ? 5.215   25.675 66.167  1.00 65.68  ? 159  VAL A CG1   1 
ATOM   1956 C  CG2   . VAL C 3 159 ? 7.613   25.426 65.438  1.00 65.42  ? 159  VAL A CG2   1 
ATOM   1957 N  N     . GLU C 3 160 ? 7.933   22.090 66.902  1.00 66.50  ? 160  GLU A N     1 
ATOM   1958 C  CA    . GLU C 3 160 ? 9.117   21.254 66.639  1.00 66.65  ? 160  GLU A CA    1 
ATOM   1959 C  C     . GLU C 3 160 ? 9.655   21.489 65.241  1.00 66.18  ? 160  GLU A C     1 
ATOM   1960 O  O     . GLU C 3 160 ? 8.932   21.954 64.360  1.00 66.38  ? 160  GLU A O     1 
ATOM   1961 C  CB    . GLU C 3 160 ? 8.873   19.752 66.873  1.00 66.94  ? 160  GLU A CB    1 
ATOM   1962 C  CG    . GLU C 3 160 ? 7.429   19.283 66.808  1.00 69.21  ? 160  GLU A CG    1 
ATOM   1963 C  CD    . GLU C 3 160 ? 6.842   19.011 68.195  1.00 72.34  ? 160  GLU A CD    1 
ATOM   1964 O  OE1   . GLU C 3 160 ? 7.379   18.133 68.914  1.00 72.69  ? 160  GLU A OE1   1 
ATOM   1965 O  OE2   . GLU C 3 160 ? 5.839   19.669 68.565  1.00 73.91  ? 160  GLU A OE2   1 
ATOM   1966 N  N     . GLU C 3 161 ? 10.927  21.157 65.048  1.00 65.58  ? 161  GLU A N     1 
ATOM   1967 C  CA    . GLU C 3 161 ? 11.601  21.335 63.765  1.00 65.15  ? 161  GLU A CA    1 
ATOM   1968 C  C     . GLU C 3 161 ? 10.847  20.773 62.539  1.00 64.37  ? 161  GLU A C     1 
ATOM   1969 O  O     . GLU C 3 161 ? 10.122  19.775 62.628  1.00 64.33  ? 161  GLU A O     1 
ATOM   1970 C  CB    . GLU C 3 161 ? 13.009  20.742 63.834  1.00 65.22  ? 161  GLU A CB    1 
ATOM   1971 C  CG    . GLU C 3 161 ? 14.036  21.629 64.519  1.00 65.75  ? 161  GLU A CG    1 
ATOM   1972 C  CD    . GLU C 3 161 ? 15.473  21.146 64.291  1.00 66.72  ? 161  GLU A CD    1 
ATOM   1973 O  OE1   . GLU C 3 161 ? 15.870  20.922 63.117  1.00 67.86  ? 161  GLU A OE1   1 
ATOM   1974 O  OE2   . GLU C 3 161 ? 16.217  21.002 65.288  1.00 67.59  ? 161  GLU A OE2   1 
ATOM   1975 N  N     . TRP C 3 162 ? 11.037  21.432 61.401  1.00 63.38  ? 162  TRP A N     1 
ATOM   1976 C  CA    . TRP C 3 162 ? 10.516  20.985 60.106  1.00 62.22  ? 162  TRP A CA    1 
ATOM   1977 C  C     . TRP C 3 162 ? 11.300  19.778 59.578  1.00 61.92  ? 162  TRP A C     1 
ATOM   1978 O  O     . TRP C 3 162 ? 12.538  19.782 59.543  1.00 61.77  ? 162  TRP A O     1 
ATOM   1979 C  CB    . TRP C 3 162 ? 10.562  22.159 59.114  1.00 61.38  ? 162  TRP A CB    1 
ATOM   1980 C  CG    . TRP C 3 162 ? 10.257  21.841 57.672  1.00 59.83  ? 162  TRP A CG    1 
ATOM   1981 C  CD1   . TRP C 3 162 ? 9.023   21.762 57.086  1.00 58.58  ? 162  TRP A CD1   1 
ATOM   1982 C  CD2   . TRP C 3 162 ? 11.209  21.613 56.630  1.00 58.38  ? 162  TRP A CD2   1 
ATOM   1983 N  NE1   . TRP C 3 162 ? 9.152   21.485 55.745  1.00 57.80  ? 162  TRP A NE1   1 
ATOM   1984 C  CE2   . TRP C 3 162 ? 10.482  21.383 55.442  1.00 57.52  ? 162  TRP A CE2   1 
ATOM   1985 C  CE3   . TRP C 3 162 ? 12.606  21.569 56.587  1.00 58.13  ? 162  TRP A CE3   1 
ATOM   1986 C  CZ2   . TRP C 3 162 ? 11.104  21.112 54.230  1.00 58.27  ? 162  TRP A CZ2   1 
ATOM   1987 C  CZ3   . TRP C 3 162 ? 13.225  21.294 55.377  1.00 58.55  ? 162  TRP A CZ3   1 
ATOM   1988 C  CH2   . TRP C 3 162 ? 12.475  21.071 54.216  1.00 58.58  ? 162  TRP A CH2   1 
ATOM   1989 N  N     . SER C 3 163 ? 10.565  18.752 59.164  1.00 61.64  ? 163  SER A N     1 
ATOM   1990 C  CA    . SER C 3 163 ? 11.169  17.537 58.651  1.00 61.63  ? 163  SER A CA    1 
ATOM   1991 C  C     . SER C 3 163 ? 11.214  17.525 57.131  1.00 61.67  ? 163  SER A C     1 
ATOM   1992 O  O     . SER C 3 163 ? 10.184  17.515 56.463  1.00 61.42  ? 163  SER A O     1 
ATOM   1993 C  CB    . SER C 3 163 ? 10.425  16.312 59.170  1.00 61.48  ? 163  SER A CB    1 
ATOM   1994 O  OG    . SER C 3 163 ? 10.779  15.161 58.431  1.00 61.96  ? 163  SER A OG    1 
ATOM   1995 N  N     . ILE C 3 164 ? 12.423  17.528 56.586  1.00 62.03  ? 164  ILE A N     1 
ATOM   1996 C  CA    . ILE C 3 164 ? 12.573  17.431 55.148  1.00 62.54  ? 164  ILE A CA    1 
ATOM   1997 C  C     . ILE C 3 164 ? 12.073  16.087 54.662  1.00 63.08  ? 164  ILE A C     1 
ATOM   1998 O  O     . ILE C 3 164 ? 11.475  16.011 53.594  1.00 63.54  ? 164  ILE A O     1 
ATOM   1999 C  CB    . ILE C 3 164 ? 14.017  17.667 54.661  1.00 62.45  ? 164  ILE A CB    1 
ATOM   2000 C  CG1   . ILE C 3 164 ? 14.008  17.901 53.147  1.00 62.25  ? 164  ILE A CG1   1 
ATOM   2001 C  CG2   . ILE C 3 164 ? 14.934  16.506 55.062  1.00 61.92  ? 164  ILE A CG2   1 
ATOM   2002 C  CD1   . ILE C 3 164 ? 15.312  18.403 52.580  1.00 62.36  ? 164  ILE A CD1   1 
ATOM   2003 N  N     . GLU C 3 165 ? 12.306  15.028 55.438  1.00 63.41  ? 165  GLU A N     1 
ATOM   2004 C  CA    . GLU C 3 165 ? 11.865  13.703 55.008  1.00 63.57  ? 165  GLU A CA    1 
ATOM   2005 C  C     . GLU C 3 165 ? 10.351  13.730 54.814  1.00 63.05  ? 165  GLU A C     1 
ATOM   2006 O  O     . GLU C 3 165 ? 9.856   13.251 53.798  1.00 63.02  ? 165  GLU A O     1 
ATOM   2007 C  CB    . GLU C 3 165 ? 12.353  12.568 55.935  1.00 63.65  ? 165  GLU A CB    1 
ATOM   2008 C  CG    . GLU C 3 165 ? 11.456  12.231 57.122  1.00 65.56  ? 165  GLU A CG    1 
ATOM   2009 C  CD    . GLU C 3 165 ? 11.332  10.715 57.378  1.00 68.47  ? 165  GLU A CD    1 
ATOM   2010 O  OE1   . GLU C 3 165 ? 11.102  9.950  56.402  1.00 68.56  ? 165  GLU A OE1   1 
ATOM   2011 O  OE2   . GLU C 3 165 ? 11.443  10.291 58.560  1.00 68.63  ? 165  GLU A OE2   1 
ATOM   2012 N  N     . ILE C 3 166 ? 9.639   14.348 55.757  1.00 62.80  ? 166  ILE A N     1 
ATOM   2013 C  CA    . ILE C 3 166 ? 8.176   14.493 55.666  1.00 62.46  ? 166  ILE A CA    1 
ATOM   2014 C  C     . ILE C 3 166 ? 7.752   15.409 54.512  1.00 62.41  ? 166  ILE A C     1 
ATOM   2015 O  O     . ILE C 3 166 ? 6.789   15.111 53.808  1.00 62.53  ? 166  ILE A O     1 
ATOM   2016 C  CB    . ILE C 3 166 ? 7.536   14.984 57.000  1.00 62.35  ? 166  ILE A CB    1 
ATOM   2017 C  CG1   . ILE C 3 166 ? 7.723   13.935 58.106  1.00 62.11  ? 166  ILE A CG1   1 
ATOM   2018 C  CG2   . ILE C 3 166 ? 6.045   15.304 56.803  1.00 62.04  ? 166  ILE A CG2   1 
ATOM   2019 C  CD1   . ILE C 3 166 ? 7.455   14.437 59.532  1.00 62.16  ? 166  ILE A CD1   1 
ATOM   2020 N  N     . ALA C 3 167 ? 8.479   16.507 54.318  1.00 62.17  ? 167  ALA A N     1 
ATOM   2021 C  CA    . ALA C 3 167 ? 8.176   17.458 53.254  1.00 61.97  ? 167  ALA A CA    1 
ATOM   2022 C  C     . ALA C 3 167 ? 8.262   16.843 51.855  1.00 62.04  ? 167  ALA A C     1 
ATOM   2023 O  O     . ALA C 3 167 ? 7.547   17.271 50.934  1.00 62.02  ? 167  ALA A O     1 
ATOM   2024 C  CB    . ALA C 3 167 ? 9.088   18.648 53.354  1.00 62.00  ? 167  ALA A CB    1 
ATOM   2025 N  N     . ALA C 3 168 ? 9.126   15.839 51.716  1.00 62.20  ? 168  ALA A N     1 
ATOM   2026 C  CA    . ALA C 3 168 ? 9.366   15.146 50.445  1.00 62.75  ? 168  ALA A CA    1 
ATOM   2027 C  C     . ALA C 3 168 ? 8.204   14.241 50.047  1.00 63.09  ? 168  ALA A C     1 
ATOM   2028 O  O     . ALA C 3 168 ? 7.843   14.173 48.873  1.00 63.22  ? 168  ALA A O     1 
ATOM   2029 C  CB    . ALA C 3 168 ? 10.673  14.340 50.510  1.00 62.69  ? 168  ALA A CB    1 
ATOM   2030 N  N     . LYS C 3 169 ? 7.629   13.560 51.039  1.00 63.74  ? 169  LYS A N     1 
ATOM   2031 C  CA    . LYS C 3 169 ? 6.477   12.661 50.865  1.00 64.27  ? 169  LYS A CA    1 
ATOM   2032 C  C     . LYS C 3 169 ? 5.303   13.350 50.170  1.00 64.37  ? 169  LYS A C     1 
ATOM   2033 O  O     . LYS C 3 169 ? 5.103   14.556 50.322  1.00 64.17  ? 169  LYS A O     1 
ATOM   2034 C  CB    . LYS C 3 169 ? 5.997   12.114 52.224  1.00 64.22  ? 169  LYS A CB    1 
ATOM   2035 C  CG    . LYS C 3 169 ? 6.940   11.155 52.981  1.00 64.13  ? 169  LYS A CG    1 
ATOM   2036 C  CD    . LYS C 3 169 ? 6.122   10.362 54.028  1.00 65.33  ? 169  LYS A CD    1 
ATOM   2037 C  CE    . LYS C 3 169 ? 6.958   9.808  55.196  1.00 66.79  ? 169  LYS A CE    1 
ATOM   2038 N  NZ    . LYS C 3 169 ? 7.752   8.577  54.844  1.00 67.15  ? 169  LYS A NZ    1 
ATOM   2039 N  N     . LEU C 3 170 ? 4.525   12.570 49.422  1.00 64.79  ? 170  LEU A N     1 
ATOM   2040 C  CA    . LEU C 3 170 ? 3.384   13.094 48.676  1.00 65.11  ? 170  LEU A CA    1 
ATOM   2041 C  C     . LEU C 3 170 ? 2.233   13.414 49.635  1.00 65.42  ? 170  LEU A C     1 
ATOM   2042 O  O     . LEU C 3 170 ? 2.167   12.869 50.740  1.00 64.92  ? 170  LEU A O     1 
ATOM   2043 C  CB    . LEU C 3 170 ? 2.949   12.103 47.590  1.00 65.15  ? 170  LEU A CB    1 
ATOM   2044 C  CG    . LEU C 3 170 ? 3.981   11.095 47.036  1.00 65.68  ? 170  LEU A CG    1 
ATOM   2045 C  CD1   . LEU C 3 170 ? 3.316   10.140 46.051  1.00 65.58  ? 170  LEU A CD1   1 
ATOM   2046 C  CD2   . LEU C 3 170 ? 5.231   11.737 46.397  1.00 65.09  ? 170  LEU A CD2   1 
ATOM   2047 N  N     . GLN C 3 171 ? 1.337   14.308 49.218  1.00 65.98  ? 171  GLN A N     1 
ATOM   2048 C  CA    . GLN C 3 171 ? 0.256   14.782 50.095  1.00 66.69  ? 171  GLN A CA    1 
ATOM   2049 C  C     . GLN C 3 171 ? -0.791  13.712 50.389  1.00 67.10  ? 171  GLN A C     1 
ATOM   2050 O  O     . GLN C 3 171 ? -1.730  13.947 51.152  1.00 67.50  ? 171  GLN A O     1 
ATOM   2051 C  CB    . GLN C 3 171 ? -0.417  16.046 49.530  1.00 66.74  ? 171  GLN A CB    1 
ATOM   2052 C  CG    . GLN C 3 171 ? 0.543   17.209 49.302  1.00 66.55  ? 171  GLN A CG    1 
ATOM   2053 C  CD    . GLN C 3 171 ? -0.142  18.556 49.172  1.00 66.82  ? 171  GLN A CD    1 
ATOM   2054 O  OE1   . GLN C 3 171 ? -0.940  18.949 50.019  1.00 67.42  ? 171  GLN A OE1   1 
ATOM   2055 N  NE2   . GLN C 3 171 ? 0.200   19.290 48.120  1.00 67.84  ? 171  GLN A NE2   1 
ATOM   2056 N  N     . GLU C 3 172 ? -0.607  12.539 49.785  1.00 67.43  ? 172  GLU A N     1 
ATOM   2057 C  CA    . GLU C 3 172 ? -1.496  11.391 49.951  1.00 67.64  ? 172  GLU A CA    1 
ATOM   2058 C  C     . GLU C 3 172 ? -0.872  10.363 50.906  1.00 67.71  ? 172  GLU A C     1 
ATOM   2059 O  O     . GLU C 3 172 ? -1.553  9.492  51.443  1.00 67.84  ? 172  GLU A O     1 
ATOM   2060 C  CB    . GLU C 3 172 ? -1.784  10.759 48.585  1.00 67.87  ? 172  GLU A CB    1 
ATOM   2061 C  CG    . GLU C 3 172 ? -2.682  11.608 47.637  1.00 69.03  ? 172  GLU A CG    1 
ATOM   2062 C  CD    . GLU C 3 172 ? -1.924  12.601 46.724  1.00 70.36  ? 172  GLU A CD    1 
ATOM   2063 O  OE1   . GLU C 3 172 ? -0.674  12.539 46.626  1.00 71.90  ? 172  GLU A OE1   1 
ATOM   2064 O  OE2   . GLU C 3 172 ? -2.596  13.446 46.090  1.00 69.55  ? 172  GLU A OE2   1 
ATOM   2065 N  N     . GLN C 3 173 ? 0.436   10.493 51.103  1.00 67.79  ? 173  GLN A N     1 
ATOM   2066 C  CA    . GLN C 3 173 ? 1.218   9.727  52.069  1.00 67.86  ? 173  GLN A CA    1 
ATOM   2067 C  C     . GLN C 3 173 ? 1.284   10.523 53.381  1.00 67.54  ? 173  GLN A C     1 
ATOM   2068 O  O     . GLN C 3 173 ? 1.890   10.086 54.364  1.00 67.51  ? 173  GLN A O     1 
ATOM   2069 C  CB    . GLN C 3 173 ? 2.627   9.571  51.505  1.00 67.89  ? 173  GLN A CB    1 
ATOM   2070 C  CG    . GLN C 3 173 ? 3.358   8.276  51.795  1.00 68.65  ? 173  GLN A CG    1 
ATOM   2071 C  CD    . GLN C 3 173 ? 4.703   8.214  51.054  1.00 69.48  ? 173  GLN A CD    1 
ATOM   2072 O  OE1   . GLN C 3 173 ? 4.884   8.845  49.992  1.00 69.92  ? 173  GLN A OE1   1 
ATOM   2073 N  NE2   . GLN C 3 173 ? 5.653   7.460  51.613  1.00 69.03  ? 173  GLN A NE2   1 
ATOM   2074 N  N     . GLY C 3 174 ? 0.669   11.705 53.372  1.00 67.34  ? 174  GLY A N     1 
ATOM   2075 C  CA    . GLY C 3 174 ? 0.622   12.590 54.529  1.00 66.93  ? 174  GLY A CA    1 
ATOM   2076 C  C     . GLY C 3 174 ? 1.693   13.667 54.514  1.00 66.78  ? 174  GLY A C     1 
ATOM   2077 O  O     . GLY C 3 174 ? 1.927   14.324 55.531  1.00 66.69  ? 174  GLY A O     1 
ATOM   2078 N  N     . GLY C 3 175 ? 2.335   13.857 53.363  1.00 66.59  ? 175  GLY A N     1 
ATOM   2079 C  CA    . GLY C 3 175 ? 3.458   14.788 53.248  1.00 66.32  ? 175  GLY A CA    1 
ATOM   2080 C  C     . GLY C 3 175 ? 3.106   16.092 52.569  1.00 66.10  ? 175  GLY A C     1 
ATOM   2081 O  O     . GLY C 3 175 ? 1.936   16.470 52.518  1.00 65.75  ? 175  GLY A O     1 
ATOM   2082 N  N     . ASP C 3 176 ? 4.123   16.772 52.038  1.00 66.23  ? 176  ASP A N     1 
ATOM   2083 C  CA    . ASP C 3 176 ? 3.949   18.116 51.473  1.00 66.54  ? 176  ASP A CA    1 
ATOM   2084 C  C     . ASP C 3 176 ? 4.122   18.231 49.964  1.00 66.67  ? 176  ASP A C     1 
ATOM   2085 O  O     . ASP C 3 176 ? 3.761   19.249 49.384  1.00 66.57  ? 176  ASP A O     1 
ATOM   2086 C  CB    . ASP C 3 176 ? 4.900   19.095 52.149  1.00 66.62  ? 176  ASP A CB    1 
ATOM   2087 C  CG    . ASP C 3 176 ? 4.525   19.377 53.593  1.00 67.27  ? 176  ASP A CG    1 
ATOM   2088 O  OD1   . ASP C 3 176 ? 3.332   19.649 53.872  1.00 67.30  ? 176  ASP A OD1   1 
ATOM   2089 O  OD2   . ASP C 3 176 ? 5.442   19.340 54.445  1.00 67.80  ? 176  ASP A OD2   1 
ATOM   2090 N  N     . GLU C 3 177 ? 4.663   17.192 49.331  1.00 67.16  ? 177  GLU A N     1 
ATOM   2091 C  CA    . GLU C 3 177 ? 4.991   17.221 47.899  1.00 67.47  ? 177  GLU A CA    1 
ATOM   2092 C  C     . GLU C 3 177 ? 5.876   18.408 47.522  1.00 67.10  ? 177  GLU A C     1 
ATOM   2093 O  O     . GLU C 3 177 ? 5.567   19.148 46.590  1.00 67.06  ? 177  GLU A O     1 
ATOM   2094 C  CB    . GLU C 3 177 ? 3.734   17.188 47.022  1.00 67.65  ? 177  GLU A CB    1 
ATOM   2095 C  CG    . GLU C 3 177 ? 3.464   15.838 46.361  1.00 69.86  ? 177  GLU A CG    1 
ATOM   2096 C  CD    . GLU C 3 177 ? 1.994   15.656 45.957  1.00 72.22  ? 177  GLU A CD    1 
ATOM   2097 O  OE1   . GLU C 3 177 ? 1.122   15.544 46.856  1.00 71.42  ? 177  GLU A OE1   1 
ATOM   2098 O  OE2   . GLU C 3 177 ? 1.717   15.611 44.733  1.00 73.84  ? 177  GLU A OE2   1 
ATOM   2099 N  N     . VAL C 3 178 ? 6.963   18.590 48.267  1.00 66.59  ? 178  VAL A N     1 
ATOM   2100 C  CA    . VAL C 3 178 ? 8.010   19.527 47.870  1.00 66.34  ? 178  VAL A CA    1 
ATOM   2101 C  C     . VAL C 3 178 ? 8.838   18.852 46.770  1.00 66.05  ? 178  VAL A C     1 
ATOM   2102 O  O     . VAL C 3 178 ? 9.394   17.781 46.992  1.00 66.27  ? 178  VAL A O     1 
ATOM   2103 C  CB    . VAL C 3 178 ? 8.910   19.952 49.069  1.00 66.42  ? 178  VAL A CB    1 
ATOM   2104 C  CG1   . VAL C 3 178 ? 9.908   21.004 48.641  1.00 66.24  ? 178  VAL A CG1   1 
ATOM   2105 C  CG2   . VAL C 3 178 ? 8.068   20.495 50.230  1.00 66.13  ? 178  VAL A CG2   1 
ATOM   2106 N  N     . PRO C 3 179 ? 8.900   19.470 45.574  1.00 65.85  ? 179  PRO A N     1 
ATOM   2107 C  CA    . PRO C 3 179 ? 9.467   18.880 44.349  1.00 65.63  ? 179  PRO A CA    1 
ATOM   2108 C  C     . PRO C 3 179 ? 10.805  18.134 44.490  1.00 65.51  ? 179  PRO A C     1 
ATOM   2109 O  O     . PRO C 3 179 ? 11.668  18.567 45.244  1.00 65.48  ? 179  PRO A O     1 
ATOM   2110 C  CB    . PRO C 3 179 ? 9.623   20.096 43.438  1.00 65.53  ? 179  PRO A CB    1 
ATOM   2111 C  CG    . PRO C 3 179 ? 8.498   20.978 43.837  1.00 65.35  ? 179  PRO A CG    1 
ATOM   2112 C  CD    . PRO C 3 179 ? 8.381   20.831 45.321  1.00 65.67  ? 179  PRO A CD    1 
ATOM   2113 N  N     . SER C 3 180 ? 10.946  17.023 43.762  1.00 65.58  ? 180  SER A N     1 
ATOM   2114 C  CA    . SER C 3 180 ? 12.221  16.308 43.580  1.00 65.95  ? 180  SER A CA    1 
ATOM   2115 C  C     . SER C 3 180 ? 13.389  17.252 43.331  1.00 66.17  ? 180  SER A C     1 
ATOM   2116 O  O     . SER C 3 180 ? 14.438  17.163 43.979  1.00 66.20  ? 180  SER A O     1 
ATOM   2117 C  CB    . SER C 3 180 ? 12.141  15.380 42.361  1.00 65.83  ? 180  SER A CB    1 
ATOM   2118 O  OG    . SER C 3 180 ? 11.729  14.079 42.701  1.00 66.73  ? 180  SER A OG    1 
ATOM   2119 N  N     . GLU C 3 181 ? 13.185  18.150 42.369  1.00 66.27  ? 181  GLU A N     1 
ATOM   2120 C  CA    . GLU C 3 181 ? 14.226  19.015 41.842  1.00 66.53  ? 181  GLU A CA    1 
ATOM   2121 C  C     . GLU C 3 181 ? 14.857  19.881 42.917  1.00 65.97  ? 181  GLU A C     1 
ATOM   2122 O  O     . GLU C 3 181 ? 15.996  20.304 42.770  1.00 66.00  ? 181  GLU A O     1 
ATOM   2123 C  CB    . GLU C 3 181 ? 13.665  19.924 40.734  1.00 67.14  ? 181  GLU A CB    1 
ATOM   2124 C  CG    . GLU C 3 181 ? 12.790  19.245 39.669  1.00 69.19  ? 181  GLU A CG    1 
ATOM   2125 C  CD    . GLU C 3 181 ? 11.281  19.380 39.943  1.00 72.77  ? 181  GLU A CD    1 
ATOM   2126 O  OE1   . GLU C 3 181 ? 10.785  18.774 40.924  1.00 73.48  ? 181  GLU A OE1   1 
ATOM   2127 O  OE2   . GLU C 3 181 ? 10.586  20.077 39.158  1.00 73.97  ? 181  GLU A OE2   1 
ATOM   2128 N  N     . ILE C 3 182 ? 14.123  20.139 43.997  1.00 65.47  ? 182  ILE A N     1 
ATOM   2129 C  CA    . ILE C 3 182 ? 14.557  21.136 44.985  1.00 65.12  ? 182  ILE A CA    1 
ATOM   2130 C  C     . ILE C 3 182 ? 14.830  20.604 46.404  1.00 64.82  ? 182  ILE A C     1 
ATOM   2131 O  O     . ILE C 3 182 ? 15.315  21.345 47.280  1.00 64.61  ? 182  ILE A O     1 
ATOM   2132 C  CB    . ILE C 3 182 ? 13.593  22.365 45.026  1.00 64.97  ? 182  ILE A CB    1 
ATOM   2133 C  CG1   . ILE C 3 182 ? 12.215  21.971 45.539  1.00 64.72  ? 182  ILE A CG1   1 
ATOM   2134 C  CG2   . ILE C 3 182 ? 13.460  22.988 43.637  1.00 65.30  ? 182  ILE A CG2   1 
ATOM   2135 C  CD1   . ILE C 3 182 ? 11.411  23.144 46.036  1.00 65.14  ? 182  ILE A CD1   1 
ATOM   2136 N  N     . ILE C 3 183 ? 14.534  19.320 46.615  1.00 64.34  ? 183  ILE A N     1 
ATOM   2137 C  CA    . ILE C 3 183 ? 14.750  18.667 47.914  1.00 63.98  ? 183  ILE A CA    1 
ATOM   2138 C  C     . ILE C 3 183 ? 16.233  18.669 48.332  1.00 63.48  ? 183  ILE A C     1 
ATOM   2139 O  O     . ILE C 3 183 ? 16.557  18.974 49.486  1.00 63.33  ? 183  ILE A O     1 
ATOM   2140 C  CB    . ILE C 3 183 ? 14.122  17.234 47.948  1.00 64.04  ? 183  ILE A CB    1 
ATOM   2141 C  CG1   . ILE C 3 183 ? 12.626  17.300 48.296  1.00 63.25  ? 183  ILE A CG1   1 
ATOM   2142 C  CG2   . ILE C 3 183 ? 14.848  16.311 48.925  1.00 65.02  ? 183  ILE A CG2   1 
ATOM   2143 C  CD1   . ILE C 3 183 ? 12.299  17.607 49.749  1.00 61.88  ? 183  ILE A CD1   1 
ATOM   2144 N  N     . ASP C 3 184 ? 17.122  18.365 47.389  1.00 62.80  ? 184  ASP A N     1 
ATOM   2145 C  CA    . ASP C 3 184 ? 18.562  18.426 47.643  1.00 62.45  ? 184  ASP A CA    1 
ATOM   2146 C  C     . ASP C 3 184 ? 19.184  19.824 47.529  1.00 61.90  ? 184  ASP A C     1 
ATOM   2147 O  O     . ASP C 3 184 ? 20.408  19.953 47.425  1.00 62.06  ? 184  ASP A O     1 
ATOM   2148 C  CB    . ASP C 3 184 ? 19.304  17.444 46.738  1.00 62.39  ? 184  ASP A CB    1 
ATOM   2149 C  CG    . ASP C 3 184 ? 19.103  16.003 47.161  1.00 63.71  ? 184  ASP A CG    1 
ATOM   2150 O  OD1   . ASP C 3 184 ? 18.262  15.741 48.064  1.00 64.09  ? 184  ASP A OD1   1 
ATOM   2151 O  OD2   . ASP C 3 184 ? 19.787  15.128 46.581  1.00 64.65  ? 184  ASP A OD2   1 
ATOM   2152 N  N     . LYS C 3 185 ? 18.354  20.864 47.563  1.00 61.07  ? 185  LYS A N     1 
ATOM   2153 C  CA    . LYS C 3 185 ? 18.849  22.224 47.423  1.00 60.34  ? 185  LYS A CA    1 
ATOM   2154 C  C     . LYS C 3 185 ? 18.387  23.125 48.552  1.00 60.27  ? 185  LYS A C     1 
ATOM   2155 O  O     . LYS C 3 185 ? 18.671  24.318 48.555  1.00 60.54  ? 185  LYS A O     1 
ATOM   2156 C  CB    . LYS C 3 185 ? 18.436  22.800 46.083  1.00 60.17  ? 185  LYS A CB    1 
ATOM   2157 C  CG    . LYS C 3 185 ? 19.110  22.124 44.918  1.00 59.55  ? 185  LYS A CG    1 
ATOM   2158 C  CD    . LYS C 3 185 ? 18.467  22.566 43.632  1.00 58.07  ? 185  LYS A CD    1 
ATOM   2159 C  CE    . LYS C 3 185 ? 19.172  21.958 42.455  1.00 57.18  ? 185  LYS A CE    1 
ATOM   2160 N  NZ    . LYS C 3 185 ? 18.556  22.459 41.216  1.00 57.30  ? 185  LYS A NZ    1 
ATOM   2161 N  N     . ILE C 3 186 ? 17.679  22.546 49.513  1.00 59.88  ? 186  ILE A N     1 
ATOM   2162 C  CA    . ILE C 3 186 ? 17.243  23.268 50.688  1.00 59.41  ? 186  ILE A CA    1 
ATOM   2163 C  C     . ILE C 3 186 ? 18.314  23.181 51.752  1.00 59.61  ? 186  ILE A C     1 
ATOM   2164 O  O     . ILE C 3 186 ? 18.765  22.097 52.082  1.00 59.53  ? 186  ILE A O     1 
ATOM   2165 C  CB    . ILE C 3 186 ? 15.938  22.667 51.248  1.00 59.30  ? 186  ILE A CB    1 
ATOM   2166 C  CG1   . ILE C 3 186 ? 14.797  22.855 50.246  1.00 59.24  ? 186  ILE A CG1   1 
ATOM   2167 C  CG2   . ILE C 3 186 ? 15.584  23.278 52.608  1.00 58.68  ? 186  ILE A CG2   1 
ATOM   2168 C  CD1   . ILE C 3 186 ? 13.592  21.956 50.479  1.00 59.35  ? 186  ILE A CD1   1 
ATOM   2169 N  N     . ILE C 3 187 ? 18.715  24.332 52.281  1.00 59.95  ? 187  ILE A N     1 
ATOM   2170 C  CA    . ILE C 3 187 ? 19.548  24.389 53.477  1.00 60.12  ? 187  ILE A CA    1 
ATOM   2171 C  C     . ILE C 3 187 ? 18.695  24.969 54.598  1.00 60.55  ? 187  ILE A C     1 
ATOM   2172 O  O     . ILE C 3 187 ? 18.313  26.139 54.553  1.00 60.90  ? 187  ILE A O     1 
ATOM   2173 C  CB    . ILE C 3 187 ? 20.856  25.209 53.254  1.00 60.12  ? 187  ILE A CB    1 
ATOM   2174 C  CG1   . ILE C 3 187 ? 21.772  24.474 52.268  1.00 59.95  ? 187  ILE A CG1   1 
ATOM   2175 C  CG2   . ILE C 3 187 ? 21.585  25.451 54.578  1.00 59.24  ? 187  ILE A CG2   1 
ATOM   2176 C  CD1   . ILE C 3 187 ? 22.867  25.321 51.651  1.00 60.00  ? 187  ILE A CD1   1 
ATOM   2177 N  N     . TYR C 3 188 ? 18.405  24.137 55.597  1.00 60.92  ? 188  TYR A N     1 
ATOM   2178 C  CA    . TYR C 3 188 ? 17.419  24.443 56.636  1.00 61.08  ? 188  TYR A CA    1 
ATOM   2179 C  C     . TYR C 3 188 ? 18.052  24.881 57.961  1.00 61.42  ? 188  TYR A C     1 
ATOM   2180 O  O     . TYR C 3 188 ? 18.967  24.237 58.450  1.00 61.61  ? 188  TYR A O     1 
ATOM   2181 C  CB    . TYR C 3 188 ? 16.509  23.225 56.844  1.00 60.66  ? 188  TYR A CB    1 
ATOM   2182 C  CG    . TYR C 3 188 ? 15.557  23.358 58.009  1.00 60.48  ? 188  TYR A CG    1 
ATOM   2183 C  CD1   . TYR C 3 188 ? 14.490  24.258 57.966  1.00 59.25  ? 188  TYR A CD1   1 
ATOM   2184 C  CD2   . TYR C 3 188 ? 15.721  22.582 59.157  1.00 60.32  ? 188  TYR A CD2   1 
ATOM   2185 C  CE1   . TYR C 3 188 ? 13.617  24.384 59.033  1.00 59.01  ? 188  TYR A CE1   1 
ATOM   2186 C  CE2   . TYR C 3 188 ? 14.847  22.696 60.231  1.00 59.56  ? 188  TYR A CE2   1 
ATOM   2187 C  CZ    . TYR C 3 188 ? 13.798  23.598 60.163  1.00 59.37  ? 188  TYR A CZ    1 
ATOM   2188 O  OH    . TYR C 3 188 ? 12.929  23.708 61.222  1.00 58.85  ? 188  TYR A OH    1 
ATOM   2189 N  N     . MET C 3 189 ? 17.556  25.976 58.539  1.00 62.07  ? 189  MET A N     1 
ATOM   2190 C  CA    . MET C 3 189 ? 18.134  26.542 59.770  1.00 62.56  ? 189  MET A CA    1 
ATOM   2191 C  C     . MET C 3 189 ? 17.069  26.925 60.780  1.00 62.27  ? 189  MET A C     1 
ATOM   2192 O  O     . MET C 3 189 ? 16.436  27.978 60.655  1.00 62.28  ? 189  MET A O     1 
ATOM   2193 C  CB    . MET C 3 189 ? 18.999  27.762 59.456  1.00 62.34  ? 189  MET A CB    1 
ATOM   2194 C  CG    . MET C 3 189 ? 20.164  27.461 58.549  1.00 63.35  ? 189  MET A CG    1 
ATOM   2195 S  SD    . MET C 3 189 ? 20.675  28.893 57.592  1.00 65.97  ? 189  MET A SD    1 
ATOM   2196 C  CE    . MET C 3 189 ? 22.296  29.239 58.295  1.00 65.99  ? 189  MET A CE    1 
ATOM   2197 N  N     . PRO C 3 190 ? 16.843  26.058 61.777  1.00 62.36  ? 190  PRO A N     1 
ATOM   2198 C  CA    . PRO C 3 190 ? 15.942  26.403 62.869  1.00 62.53  ? 190  PRO A CA    1 
ATOM   2199 C  C     . PRO C 3 190 ? 16.587  27.395 63.840  1.00 62.94  ? 190  PRO A C     1 
ATOM   2200 O  O     . PRO C 3 190 ? 17.821  27.447 63.956  1.00 62.42  ? 190  PRO A O     1 
ATOM   2201 C  CB    . PRO C 3 190 ? 15.692  25.058 63.554  1.00 62.34  ? 190  PRO A CB    1 
ATOM   2202 C  CG    . PRO C 3 190 ? 16.880  24.257 63.256  1.00 61.92  ? 190  PRO A CG    1 
ATOM   2203 C  CD    . PRO C 3 190 ? 17.388  24.697 61.918  1.00 62.35  ? 190  PRO A CD    1 
ATOM   2204 N  N     . PHE C 3 191 ? 15.742  28.174 64.517  1.00 63.47  ? 191  PHE A N     1 
ATOM   2205 C  CA    . PHE C 3 191 ? 16.174  29.224 65.448  1.00 63.81  ? 191  PHE A CA    1 
ATOM   2206 C  C     . PHE C 3 191 ? 15.300  29.243 66.668  1.00 64.62  ? 191  PHE A C     1 
ATOM   2207 O  O     . PHE C 3 191 ? 14.080  29.049 66.582  1.00 64.66  ? 191  PHE A O     1 
ATOM   2208 C  CB    . PHE C 3 191 ? 16.149  30.608 64.785  1.00 63.08  ? 191  PHE A CB    1 
ATOM   2209 C  CG    . PHE C 3 191 ? 17.199  30.779 63.746  1.00 62.00  ? 191  PHE A CG    1 
ATOM   2210 C  CD1   . PHE C 3 191 ? 18.493  31.133 64.104  1.00 60.72  ? 191  PHE A CD1   1 
ATOM   2211 C  CD2   . PHE C 3 191 ? 16.911  30.539 62.406  1.00 61.31  ? 191  PHE A CD2   1 
ATOM   2212 C  CE1   . PHE C 3 191 ? 19.487  31.270 63.137  1.00 61.48  ? 191  PHE A CE1   1 
ATOM   2213 C  CE2   . PHE C 3 191 ? 17.897  30.670 61.428  1.00 60.98  ? 191  PHE A CE2   1 
ATOM   2214 C  CZ    . PHE C 3 191 ? 19.188  31.036 61.794  1.00 61.45  ? 191  PHE A CZ    1 
ATOM   2215 N  N     . ASP C 3 192 ? 15.929  29.487 67.811  1.00 65.69  ? 192  ASP A N     1 
ATOM   2216 C  CA    . ASP C 3 192 ? 15.198  29.534 69.066  1.00 66.62  ? 192  ASP A CA    1 
ATOM   2217 C  C     . ASP C 3 192 ? 14.429  30.836 69.172  1.00 66.89  ? 192  ASP A C     1 
ATOM   2218 O  O     . ASP C 3 192 ? 13.239  30.830 69.492  1.00 67.18  ? 192  ASP A O     1 
ATOM   2219 C  CB    . ASP C 3 192 ? 16.146  29.340 70.244  1.00 66.73  ? 192  ASP A CB    1 
ATOM   2220 C  CG    . ASP C 3 192 ? 16.769  27.959 70.255  1.00 67.61  ? 192  ASP A CG    1 
ATOM   2221 O  OD1   . ASP C 3 192 ? 16.093  26.989 69.816  1.00 67.61  ? 192  ASP A OD1   1 
ATOM   2222 O  OD2   . ASP C 3 192 ? 17.936  27.847 70.700  1.00 68.17  ? 192  ASP A OD2   1 
ATOM   2223 N  N     . ASN C 3 193 ? 15.101  31.942 68.860  1.00 67.11  ? 193  ASN A N     1 
ATOM   2224 C  CA    . ASN C 3 193 ? 14.491  33.266 68.959  1.00 67.31  ? 193  ASN A CA    1 
ATOM   2225 C  C     . ASN C 3 193 ? 14.604  34.103 67.681  1.00 67.32  ? 193  ASN A C     1 
ATOM   2226 O  O     . ASN C 3 193 ? 15.487  33.890 66.838  1.00 67.20  ? 193  ASN A O     1 
ATOM   2227 C  CB    . ASN C 3 193 ? 15.080  34.036 70.146  1.00 67.47  ? 193  ASN A CB    1 
ATOM   2228 C  CG    . ASN C 3 193 ? 16.552  34.337 69.964  1.00 67.57  ? 193  ASN A CG    1 
ATOM   2229 O  OD1   . ASN C 3 193 ? 16.920  35.398 69.451  1.00 68.49  ? 193  ASN A OD1   1 
ATOM   2230 N  ND2   . ASN C 3 193 ? 17.403  33.392 70.350  1.00 66.94  ? 193  ASN A ND2   1 
ATOM   2231 N  N     . GLU C 3 194 ? 13.695  35.066 67.571  1.00 67.31  ? 194  GLU A N     1 
ATOM   2232 C  CA    . GLU C 3 194 ? 13.627  35.987 66.448  1.00 67.45  ? 194  GLU A CA    1 
ATOM   2233 C  C     . GLU C 3 194 ? 14.951  36.735 66.226  1.00 67.55  ? 194  GLU A C     1 
ATOM   2234 O  O     . GLU C 3 194 ? 15.571  36.632 65.157  1.00 67.36  ? 194  GLU A O     1 
ATOM   2235 C  CB    . GLU C 3 194 ? 12.489  36.968 66.694  1.00 67.18  ? 194  GLU A CB    1 
ATOM   2236 C  CG    . GLU C 3 194 ? 12.263  37.939 65.574  1.00 68.31  ? 194  GLU A CG    1 
ATOM   2237 C  CD    . GLU C 3 194 ? 10.880  38.538 65.603  1.00 69.43  ? 194  GLU A CD    1 
ATOM   2238 O  OE1   . GLU C 3 194 ? 9.992   37.925 66.225  1.00 70.03  ? 194  GLU A OE1   1 
ATOM   2239 O  OE2   . GLU C 3 194 ? 10.679  39.615 65.004  1.00 69.80  ? 194  GLU A OE2   1 
ATOM   2240 N  N     . LYS C 3 195 ? 15.374  37.465 67.256  1.00 67.64  ? 195  LYS A N     1 
ATOM   2241 C  CA    . LYS C 3 195 ? 16.617  38.234 67.265  1.00 67.55  ? 195  LYS A CA    1 
ATOM   2242 C  C     . LYS C 3 195 ? 17.763  37.453 66.624  1.00 67.42  ? 195  LYS A C     1 
ATOM   2243 O  O     . LYS C 3 195 ? 18.525  37.986 65.803  1.00 67.06  ? 195  LYS A O     1 
ATOM   2244 C  CB    . LYS C 3 195 ? 16.976  38.598 68.714  1.00 67.79  ? 195  LYS A CB    1 
ATOM   2245 C  CG    . LYS C 3 195 ? 15.901  39.386 69.482  1.00 67.93  ? 195  LYS A CG    1 
ATOM   2246 C  CD    . LYS C 3 195 ? 14.535  38.659 69.573  1.00 67.38  ? 195  LYS A CD    1 
ATOM   2247 C  CE    . LYS C 3 195 ? 13.393  39.690 69.442  1.00 67.48  ? 195  LYS A CE    1 
ATOM   2248 N  NZ    . LYS C 3 195 ? 12.010  39.141 69.406  1.00 66.30  ? 195  LYS A NZ    1 
ATOM   2249 N  N     . GLU C 3 196 ? 17.848  36.179 67.003  1.00 67.34  ? 196  GLU A N     1 
ATOM   2250 C  CA    . GLU C 3 196 ? 18.873  35.267 66.530  1.00 67.60  ? 196  GLU A CA    1 
ATOM   2251 C  C     . GLU C 3 196 ? 18.717  35.003 65.038  1.00 67.32  ? 196  GLU A C     1 
ATOM   2252 O  O     . GLU C 3 196 ? 19.681  35.121 64.262  1.00 67.35  ? 196  GLU A O     1 
ATOM   2253 C  CB    . GLU C 3 196 ? 18.766  33.943 67.285  1.00 67.92  ? 196  GLU A CB    1 
ATOM   2254 C  CG    . GLU C 3 196 ? 20.067  33.453 67.920  1.00 70.17  ? 196  GLU A CG    1 
ATOM   2255 C  CD    . GLU C 3 196 ? 21.213  33.366 66.923  1.00 72.82  ? 196  GLU A CD    1 
ATOM   2256 O  OE1   . GLU C 3 196 ? 21.914  34.390 66.730  1.00 73.41  ? 196  GLU A OE1   1 
ATOM   2257 O  OE2   . GLU C 3 196 ? 21.411  32.272 66.339  1.00 74.19  ? 196  GLU A OE2   1 
ATOM   2258 N  N     . LEU C 3 197 ? 17.494  34.638 64.648  1.00 66.79  ? 197  LEU A N     1 
ATOM   2259 C  CA    . LEU C 3 197 ? 17.170  34.388 63.250  1.00 66.15  ? 197  LEU A CA    1 
ATOM   2260 C  C     . LEU C 3 197 ? 17.526  35.610 62.409  1.00 65.74  ? 197  LEU A C     1 
ATOM   2261 O  O     . LEU C 3 197 ? 18.298  35.505 61.453  1.00 65.53  ? 197  LEU A O     1 
ATOM   2262 C  CB    . LEU C 3 197 ? 15.698  33.968 63.118  1.00 66.13  ? 197  LEU A CB    1 
ATOM   2263 C  CG    . LEU C 3 197 ? 14.691  34.498 62.087  1.00 66.44  ? 197  LEU A CG    1 
ATOM   2264 C  CD1   . LEU C 3 197 ? 15.161  34.373 60.652  1.00 67.03  ? 197  LEU A CD1   1 
ATOM   2265 C  CD2   . LEU C 3 197 ? 13.367  33.780 62.276  1.00 66.22  ? 197  LEU A CD2   1 
ATOM   2266 N  N     . LEU C 3 198 ? 16.996  36.765 62.812  1.00 65.31  ? 198  LEU A N     1 
ATOM   2267 C  CA    . LEU C 3 198 ? 17.256  38.038 62.142  1.00 64.82  ? 198  LEU A CA    1 
ATOM   2268 C  C     . LEU C 3 198 ? 18.743  38.316 61.985  1.00 64.82  ? 198  LEU A C     1 
ATOM   2269 O  O     . LEU C 3 198 ? 19.230  38.487 60.866  1.00 64.54  ? 198  LEU A O     1 
ATOM   2270 C  CB    . LEU C 3 198 ? 16.575  39.180 62.891  1.00 64.52  ? 198  LEU A CB    1 
ATOM   2271 C  CG    . LEU C 3 198 ? 15.048  39.121 62.986  1.00 63.57  ? 198  LEU A CG    1 
ATOM   2272 C  CD1   . LEU C 3 198 ? 14.539  40.121 64.004  1.00 62.67  ? 198  LEU A CD1   1 
ATOM   2273 C  CD2   . LEU C 3 198 ? 14.397  39.344 61.633  1.00 62.13  ? 198  LEU A CD2   1 
ATOM   2274 N  N     . MET C 3 199 ? 19.466  38.329 63.101  1.00 65.02  ? 199  MET A N     1 
ATOM   2275 C  CA    . MET C 3 199 ? 20.897  38.608 63.065  1.00 65.46  ? 199  MET A CA    1 
ATOM   2276 C  C     . MET C 3 199 ? 21.627  37.686 62.081  1.00 65.07  ? 199  MET A C     1 
ATOM   2277 O  O     . MET C 3 199 ? 22.441  38.146 61.270  1.00 64.96  ? 199  MET A O     1 
ATOM   2278 C  CB    . MET C 3 199 ? 21.507  38.521 64.465  1.00 65.88  ? 199  MET A CB    1 
ATOM   2279 C  CG    . MET C 3 199 ? 22.968  38.973 64.539  1.00 68.35  ? 199  MET A CG    1 
ATOM   2280 S  SD    . MET C 3 199 ? 23.201  40.761 64.794  1.00 75.01  ? 199  MET A SD    1 
ATOM   2281 C  CE    . MET C 3 199 ? 22.687  41.484 63.228  1.00 73.09  ? 199  MET A CE    1 
ATOM   2282 N  N     . GLU C 3 200 ? 21.311  36.394 62.142  1.00 64.67  ? 200  GLU A N     1 
ATOM   2283 C  CA    . GLU C 3 200 ? 21.870  35.426 61.208  1.00 64.55  ? 200  GLU A CA    1 
ATOM   2284 C  C     . GLU C 3 200 ? 21.460  35.717 59.763  1.00 63.84  ? 200  GLU A C     1 
ATOM   2285 O  O     . GLU C 3 200 ? 22.280  35.610 58.845  1.00 63.33  ? 200  GLU A O     1 
ATOM   2286 C  CB    . GLU C 3 200 ? 21.474  33.997 61.598  1.00 65.11  ? 200  GLU A CB    1 
ATOM   2287 C  CG    . GLU C 3 200 ? 21.946  32.909 60.606  1.00 66.90  ? 200  GLU A CG    1 
ATOM   2288 C  CD    . GLU C 3 200 ? 23.469  32.699 60.563  1.00 69.12  ? 200  GLU A CD    1 
ATOM   2289 O  OE1   . GLU C 3 200 ? 24.254  33.616 60.906  1.00 69.14  ? 200  GLU A OE1   1 
ATOM   2290 O  OE2   . GLU C 3 200 ? 23.880  31.587 60.165  1.00 71.40  ? 200  GLU A OE2   1 
ATOM   2291 N  N     . TYR C 3 201 ? 20.198  36.091 59.568  1.00 63.07  ? 201  TYR A N     1 
ATOM   2292 C  CA    . TYR C 3 201 ? 19.754  36.461 58.253  1.00 62.60  ? 201  TYR A CA    1 
ATOM   2293 C  C     . TYR C 3 201 ? 20.597  37.627 57.740  1.00 62.98  ? 201  TYR A C     1 
ATOM   2294 O  O     . TYR C 3 201 ? 21.178  37.550 56.655  1.00 62.92  ? 201  TYR A O     1 
ATOM   2295 C  CB    . TYR C 3 201 ? 18.259  36.778 58.217  1.00 62.31  ? 201  TYR A CB    1 
ATOM   2296 C  CG    . TYR C 3 201 ? 17.772  37.021 56.806  1.00 61.46  ? 201  TYR A CG    1 
ATOM   2297 C  CD1   . TYR C 3 201 ? 17.735  35.988 55.876  1.00 60.82  ? 201  TYR A CD1   1 
ATOM   2298 C  CD2   . TYR C 3 201 ? 17.390  38.289 56.392  1.00 61.38  ? 201  TYR A CD2   1 
ATOM   2299 C  CE1   . TYR C 3 201 ? 17.313  36.204 54.566  1.00 62.03  ? 201  TYR A CE1   1 
ATOM   2300 C  CE2   . TYR C 3 201 ? 16.961  38.525 55.081  1.00 62.53  ? 201  TYR A CE2   1 
ATOM   2301 C  CZ    . TYR C 3 201 ? 16.920  37.479 54.169  1.00 62.53  ? 201  TYR A CZ    1 
ATOM   2302 O  OH    . TYR C 3 201 ? 16.499  37.710 52.873  1.00 61.00  ? 201  TYR A OH    1 
ATOM   2303 N  N     . LEU C 3 202 ? 20.689  38.688 58.536  1.00 63.28  ? 202  LEU A N     1 
ATOM   2304 C  CA    . LEU C 3 202 ? 21.540  39.829 58.201  1.00 63.61  ? 202  LEU A CA    1 
ATOM   2305 C  C     . LEU C 3 202 ? 22.989  39.458 57.889  1.00 63.93  ? 202  LEU A C     1 
ATOM   2306 O  O     . LEU C 3 202 ? 23.556  39.984 56.925  1.00 64.01  ? 202  LEU A O     1 
ATOM   2307 C  CB    . LEU C 3 202 ? 21.512  40.861 59.317  1.00 63.75  ? 202  LEU A CB    1 
ATOM   2308 C  CG    . LEU C 3 202 ? 20.452  41.951 59.221  1.00 63.73  ? 202  LEU A CG    1 
ATOM   2309 C  CD1   . LEU C 3 202 ? 20.131  42.471 60.602  1.00 63.43  ? 202  LEU A CD1   1 
ATOM   2310 C  CD2   . LEU C 3 202 ? 20.937  43.072 58.322  1.00 64.44  ? 202  LEU A CD2   1 
ATOM   2311 N  N     . ASN C 3 203 ? 23.591  38.570 58.690  1.00 64.12  ? 203  ASN A N     1 
ATOM   2312 C  CA    . ASN C 3 203 ? 24.980  38.156 58.427  1.00 64.57  ? 203  ASN A CA    1 
ATOM   2313 C  C     . ASN C 3 203 ? 25.070  37.369 57.135  1.00 64.56  ? 203  ASN A C     1 
ATOM   2314 O  O     . ASN C 3 203 ? 26.010  37.547 56.349  1.00 64.61  ? 203  ASN A O     1 
ATOM   2315 C  CB    . ASN C 3 203 ? 25.568  37.326 59.567  1.00 64.69  ? 203  ASN A CB    1 
ATOM   2316 C  CG    . ASN C 3 203 ? 25.568  38.056 60.892  1.00 65.47  ? 203  ASN A CG    1 
ATOM   2317 O  OD1   . ASN C 3 203 ? 25.643  39.290 60.956  1.00 64.78  ? 203  ASN A OD1   1 
ATOM   2318 N  ND2   . ASN C 3 203 ? 25.478  37.288 61.972  1.00 66.66  ? 203  ASN A ND2   1 
ATOM   2319 N  N     . PHE C 3 204 ? 24.084  36.495 56.933  1.00 64.50  ? 204  PHE A N     1 
ATOM   2320 C  CA    . PHE C 3 204 ? 23.936  35.741 55.690  1.00 64.62  ? 204  PHE A CA    1 
ATOM   2321 C  C     . PHE C 3 204 ? 23.777  36.682 54.496  1.00 64.53  ? 204  PHE A C     1 
ATOM   2322 O  O     . PHE C 3 204 ? 24.356  36.460 53.431  1.00 64.42  ? 204  PHE A O     1 
ATOM   2323 C  CB    . PHE C 3 204 ? 22.743  34.779 55.798  1.00 64.88  ? 204  PHE A CB    1 
ATOM   2324 C  CG    . PHE C 3 204 ? 22.138  34.402 54.479  1.00 65.08  ? 204  PHE A CG    1 
ATOM   2325 C  CD1   . PHE C 3 204 ? 22.775  33.494 53.639  1.00 64.95  ? 204  PHE A CD1   1 
ATOM   2326 C  CD2   . PHE C 3 204 ? 20.922  34.957 54.075  1.00 65.93  ? 204  PHE A CD2   1 
ATOM   2327 C  CE1   . PHE C 3 204 ? 22.218  33.145 52.413  1.00 65.82  ? 204  PHE A CE1   1 
ATOM   2328 C  CE2   . PHE C 3 204 ? 20.350  34.614 52.847  1.00 66.04  ? 204  PHE A CE2   1 
ATOM   2329 C  CZ    . PHE C 3 204 ? 20.997  33.708 52.017  1.00 66.00  ? 204  PHE A CZ    1 
ATOM   2330 N  N     . TRP C 3 205 ? 22.994  37.738 54.692  1.00 64.55  ? 205  TRP A N     1 
ATOM   2331 C  CA    . TRP C 3 205 ? 22.819  38.766 53.684  1.00 64.58  ? 205  TRP A CA    1 
ATOM   2332 C  C     . TRP C 3 205 ? 24.145  39.428 53.319  1.00 64.59  ? 205  TRP A C     1 
ATOM   2333 O  O     . TRP C 3 205 ? 24.377  39.770 52.151  1.00 64.40  ? 205  TRP A O     1 
ATOM   2334 C  CB    . TRP C 3 205 ? 21.847  39.824 54.178  1.00 64.71  ? 205  TRP A CB    1 
ATOM   2335 C  CG    . TRP C 3 205 ? 21.458  40.776 53.122  1.00 64.93  ? 205  TRP A CG    1 
ATOM   2336 C  CD1   . TRP C 3 205 ? 22.225  41.769 52.594  1.00 65.43  ? 205  TRP A CD1   1 
ATOM   2337 C  CD2   . TRP C 3 205 ? 20.205  40.831 52.443  1.00 65.74  ? 205  TRP A CD2   1 
ATOM   2338 N  NE1   . TRP C 3 205 ? 21.528  42.445 51.629  1.00 66.00  ? 205  TRP A NE1   1 
ATOM   2339 C  CE2   . TRP C 3 205 ? 20.279  41.895 51.519  1.00 65.92  ? 205  TRP A CE2   1 
ATOM   2340 C  CE3   . TRP C 3 205 ? 19.014  40.095 52.537  1.00 66.63  ? 205  TRP A CE3   1 
ATOM   2341 C  CZ2   . TRP C 3 205 ? 19.209  42.242 50.682  1.00 65.42  ? 205  TRP A CZ2   1 
ATOM   2342 C  CZ3   . TRP C 3 205 ? 17.947  40.442 51.706  1.00 66.44  ? 205  TRP A CZ3   1 
ATOM   2343 C  CH2   . TRP C 3 205 ? 18.057  41.510 50.790  1.00 65.59  ? 205  TRP A CH2   1 
ATOM   2344 N  N     . GLN C 3 206 ? 25.007  39.607 54.319  1.00 64.48  ? 206  GLN A N     1 
ATOM   2345 C  CA    . GLN C 3 206 ? 26.283  40.267 54.102  1.00 64.33  ? 206  GLN A CA    1 
ATOM   2346 C  C     . GLN C 3 206 ? 27.207  39.477 53.181  1.00 63.72  ? 206  GLN A C     1 
ATOM   2347 O  O     . GLN C 3 206 ? 27.815  40.050 52.278  1.00 63.62  ? 206  GLN A O     1 
ATOM   2348 C  CB    . GLN C 3 206 ? 26.969  40.581 55.431  1.00 64.69  ? 206  GLN A CB    1 
ATOM   2349 C  CG    . GLN C 3 206 ? 27.427  42.024 55.517  1.00 65.94  ? 206  GLN A CG    1 
ATOM   2350 C  CD    . GLN C 3 206 ? 26.282  42.999 55.235  1.00 67.31  ? 206  GLN A CD    1 
ATOM   2351 O  OE1   . GLN C 3 206 ? 25.303  43.051 55.984  1.00 68.42  ? 206  GLN A OE1   1 
ATOM   2352 N  NE2   . GLN C 3 206 ? 26.397  43.766 54.148  1.00 67.09  ? 206  GLN A NE2   1 
ATOM   2353 N  N     . GLN C 3 207 ? 27.291  38.167 53.392  1.00 63.22  ? 207  GLN A N     1 
ATOM   2354 C  CA    . GLN C 3 207 ? 28.212  37.338 52.602  1.00 63.00  ? 207  GLN A CA    1 
ATOM   2355 C  C     . GLN C 3 207 ? 27.634  36.876 51.264  1.00 62.07  ? 207  GLN A C     1 
ATOM   2356 O  O     . GLN C 3 207 ? 28.392  36.586 50.334  1.00 62.08  ? 207  GLN A O     1 
ATOM   2357 C  CB    . GLN C 3 207 ? 28.808  36.170 53.417  1.00 63.06  ? 207  GLN A CB    1 
ATOM   2358 C  CG    . GLN C 3 207 ? 27.900  35.605 54.514  1.00 63.91  ? 207  GLN A CG    1 
ATOM   2359 C  CD    . GLN C 3 207 ? 28.393  34.258 55.064  1.00 64.63  ? 207  GLN A CD    1 
ATOM   2360 O  OE1   . GLN C 3 207 ? 29.573  33.899 54.918  1.00 65.13  ? 207  GLN A OE1   1 
ATOM   2361 N  NE2   . GLN C 3 207 ? 27.485  33.509 55.700  1.00 64.47  ? 207  GLN A NE2   1 
ATOM   2362 N  N     . LYS C 3 208 ? 26.303  36.810 51.170  1.00 61.00  ? 208  LYS A N     1 
ATOM   2363 C  CA    . LYS C 3 208 ? 25.616  36.595 49.886  1.00 59.64  ? 208  LYS A CA    1 
ATOM   2364 C  C     . LYS C 3 208 ? 24.672  37.766 49.582  1.00 58.55  ? 208  LYS A C     1 
ATOM   2365 O  O     . LYS C 3 208 ? 23.457  37.665 49.760  1.00 58.31  ? 208  LYS A O     1 
ATOM   2366 C  CB    . LYS C 3 208 ? 24.880  35.256 49.884  1.00 59.71  ? 208  LYS A CB    1 
ATOM   2367 C  CG    . LYS C 3 208 ? 25.760  34.095 49.489  1.00 60.69  ? 208  LYS A CG    1 
ATOM   2368 C  CD    . LYS C 3 208 ? 25.537  32.890 50.394  1.00 61.49  ? 208  LYS A CD    1 
ATOM   2369 C  CE    . LYS C 3 208 ? 26.770  31.991 50.370  1.00 60.88  ? 208  LYS A CE    1 
ATOM   2370 N  NZ    . LYS C 3 208 ? 26.725  30.988 51.469  1.00 61.91  ? 208  LYS A NZ    1 
ATOM   2371 N  N     . THR C 3 209 ? 25.245  38.882 49.130  1.00 57.08  ? 209  THR A N     1 
ATOM   2372 C  CA    . THR C 3 209 ? 24.477  40.114 48.960  1.00 55.86  ? 209  THR A CA    1 
ATOM   2373 C  C     . THR C 3 209 ? 23.824  40.161 47.578  1.00 54.53  ? 209  THR A C     1 
ATOM   2374 O  O     . THR C 3 209 ? 24.523  40.122 46.557  1.00 54.52  ? 209  THR A O     1 
ATOM   2375 C  CB    . THR C 3 209 ? 25.342  41.367 49.240  1.00 56.04  ? 209  THR A CB    1 
ATOM   2376 O  OG1   . THR C 3 209 ? 25.912  41.263 50.550  1.00 56.35  ? 209  THR A OG1   1 
ATOM   2377 C  CG2   . THR C 3 209 ? 24.515  42.638 49.179  1.00 55.93  ? 209  THR A CG2   1 
ATOM   2378 N  N     . PRO C 3 210 ? 22.478  40.234 47.551  1.00 53.02  ? 210  PRO A N     1 
ATOM   2379 C  CA    . PRO C 3 210 ? 21.670  40.192 46.335  1.00 51.96  ? 210  PRO A CA    1 
ATOM   2380 C  C     . PRO C 3 210 ? 21.972  41.350 45.387  1.00 51.04  ? 210  PRO A C     1 
ATOM   2381 O  O     . PRO C 3 210 ? 22.050  42.502 45.819  1.00 50.75  ? 210  PRO A O     1 
ATOM   2382 C  CB    . PRO C 3 210 ? 20.230  40.309 46.862  1.00 51.77  ? 210  PRO A CB    1 
ATOM   2383 C  CG    . PRO C 3 210 ? 20.283  39.913 48.270  1.00 51.70  ? 210  PRO A CG    1 
ATOM   2384 C  CD    . PRO C 3 210 ? 21.634  40.358 48.752  1.00 53.13  ? 210  PRO A CD    1 
ATOM   2385 N  N     . VAL C 3 211 ? 22.159  41.030 44.111  1.00 49.98  ? 211  VAL A N     1 
ATOM   2386 C  CA    . VAL C 3 211 ? 22.351  42.036 43.082  1.00 49.25  ? 211  VAL A CA    1 
ATOM   2387 C  C     . VAL C 3 211 ? 20.997  42.405 42.516  1.00 48.83  ? 211  VAL A C     1 
ATOM   2388 O  O     . VAL C 3 211 ? 20.709  43.581 42.317  1.00 48.96  ? 211  VAL A O     1 
ATOM   2389 C  CB    . VAL C 3 211 ? 23.230  41.528 41.931  1.00 49.44  ? 211  VAL A CB    1 
ATOM   2390 C  CG1   . VAL C 3 211 ? 23.230  42.540 40.775  1.00 49.08  ? 211  VAL A CG1   1 
ATOM   2391 C  CG2   . VAL C 3 211 ? 24.660  41.244 42.422  1.00 49.47  ? 211  VAL A CG2   1 
ATOM   2392 N  N     . ILE C 3 212 ? 20.179  41.386 42.252  1.00 48.10  ? 212  ILE A N     1 
ATOM   2393 C  CA    . ILE C 3 212 ? 18.811  41.550 41.785  1.00 47.02  ? 212  ILE A CA    1 
ATOM   2394 C  C     . ILE C 3 212 ? 17.921  40.934 42.836  1.00 46.84  ? 212  ILE A C     1 
ATOM   2395 O  O     . ILE C 3 212 ? 17.929  39.726 43.015  1.00 47.19  ? 212  ILE A O     1 
ATOM   2396 C  CB    . ILE C 3 212 ? 18.564  40.789 40.465  1.00 46.78  ? 212  ILE A CB    1 
ATOM   2397 C  CG1   . ILE C 3 212 ? 19.529  41.224 39.369  1.00 45.47  ? 212  ILE A CG1   1 
ATOM   2398 C  CG2   . ILE C 3 212 ? 17.138  40.985 39.997  1.00 47.12  ? 212  ILE A CG2   1 
ATOM   2399 C  CD1   . ILE C 3 212 ? 19.209  42.541 38.763  1.00 44.62  ? 212  ILE A CD1   1 
ATOM   2400 N  N     . LEU C 3 213 ? 17.156  41.746 43.541  1.00 46.57  ? 213  LEU A N     1 
ATOM   2401 C  CA    . LEU C 3 213 ? 16.234  41.190 44.509  1.00 46.60  ? 213  LEU A CA    1 
ATOM   2402 C  C     . LEU C 3 213 ? 14.853  41.062 43.889  1.00 47.03  ? 213  LEU A C     1 
ATOM   2403 O  O     . LEU C 3 213 ? 14.300  42.026 43.355  1.00 47.14  ? 213  LEU A O     1 
ATOM   2404 C  CB    . LEU C 3 213 ? 16.192  42.037 45.776  1.00 46.46  ? 213  LEU A CB    1 
ATOM   2405 C  CG    . LEU C 3 213 ? 15.563  41.433 47.027  1.00 45.82  ? 213  LEU A CG    1 
ATOM   2406 C  CD1   . LEU C 3 213 ? 16.302  40.228 47.487  1.00 45.47  ? 213  LEU A CD1   1 
ATOM   2407 C  CD2   . LEU C 3 213 ? 15.571  42.458 48.125  1.00 47.53  ? 213  LEU A CD2   1 
ATOM   2408 N  N     . THR C 3 214 ? 14.298  39.860 43.961  1.00 47.43  ? 214  THR A N     1 
ATOM   2409 C  CA    . THR C 3 214 ? 12.996  39.592 43.368  1.00 47.87  ? 214  THR A CA    1 
ATOM   2410 C  C     . THR C 3 214 ? 12.148  38.680 44.264  1.00 47.95  ? 214  THR A C     1 
ATOM   2411 O  O     . THR C 3 214 ? 12.580  38.289 45.362  1.00 48.16  ? 214  THR A O     1 
ATOM   2412 C  CB    . THR C 3 214 ? 13.149  39.027 41.928  1.00 48.03  ? 214  THR A CB    1 
ATOM   2413 O  OG1   . THR C 3 214 ? 11.924  39.202 41.208  1.00 48.82  ? 214  THR A OG1   1 
ATOM   2414 C  CG2   . THR C 3 214 ? 13.531  37.554 41.945  1.00 48.28  ? 214  THR A CG2   1 
ATOM   2415 N  N     . GLY C 3 215 ? 10.946  38.349 43.796  1.00 47.78  ? 215  GLY A N     1 
ATOM   2416 C  CA    . GLY C 3 215 ? 9.993   37.582 44.592  1.00 47.69  ? 215  GLY A CA    1 
ATOM   2417 C  C     . GLY C 3 215 ? 8.592   38.093 44.372  1.00 47.68  ? 215  GLY A C     1 
ATOM   2418 O  O     . GLY C 3 215 ? 8.381   39.055 43.646  1.00 47.53  ? 215  GLY A O     1 
ATOM   2419 N  N     . TRP C 3 216 ? 7.619   37.450 44.996  1.00 48.11  ? 216  TRP A N     1 
ATOM   2420 C  CA    . TRP C 3 216 ? 6.243   37.857 44.790  1.00 48.46  ? 216  TRP A CA    1 
ATOM   2421 C  C     . TRP C 3 216 ? 5.863   38.963 45.756  1.00 49.03  ? 216  TRP A C     1 
ATOM   2422 O  O     . TRP C 3 216 ? 5.758   38.728 46.959  1.00 48.87  ? 216  TRP A O     1 
ATOM   2423 C  CB    . TRP C 3 216 ? 5.291   36.669 44.928  1.00 48.23  ? 216  TRP A CB    1 
ATOM   2424 C  CG    . TRP C 3 216 ? 4.011   36.915 44.220  1.00 47.93  ? 216  TRP A CG    1 
ATOM   2425 C  CD1   . TRP C 3 216 ? 2.800   37.189 44.780  1.00 47.39  ? 216  TRP A CD1   1 
ATOM   2426 C  CD2   . TRP C 3 216 ? 3.819   36.952 42.802  1.00 47.60  ? 216  TRP A CD2   1 
ATOM   2427 N  NE1   . TRP C 3 216 ? 1.861   37.386 43.795  1.00 47.52  ? 216  TRP A NE1   1 
ATOM   2428 C  CE2   . TRP C 3 216 ? 2.462   37.244 42.574  1.00 47.56  ? 216  TRP A CE2   1 
ATOM   2429 C  CE3   . TRP C 3 216 ? 4.668   36.767 41.703  1.00 46.97  ? 216  TRP A CE3   1 
ATOM   2430 C  CZ2   . TRP C 3 216 ? 1.931   37.353 41.296  1.00 48.37  ? 216  TRP A CZ2   1 
ATOM   2431 C  CZ3   . TRP C 3 216 ? 4.148   36.870 40.443  1.00 47.43  ? 216  TRP A CZ3   1 
ATOM   2432 C  CH2   . TRP C 3 216 ? 2.783   37.164 40.243  1.00 48.36  ? 216  TRP A CH2   1 
ATOM   2433 N  N     . ASN C 3 217 ? 5.698   40.178 45.233  1.00 49.98  ? 217  ASN A N     1 
ATOM   2434 C  CA    . ASN C 3 217 ? 5.169   41.282 46.026  1.00 51.08  ? 217  ASN A CA    1 
ATOM   2435 C  C     . ASN C 3 217 ? 6.114   41.799 47.105  1.00 51.26  ? 217  ASN A C     1 
ATOM   2436 O  O     . ASN C 3 217 ? 5.691   42.440 48.067  1.00 51.26  ? 217  ASN A O     1 
ATOM   2437 C  CB    . ASN C 3 217 ? 3.872   40.842 46.697  1.00 51.41  ? 217  ASN A CB    1 
ATOM   2438 C  CG    . ASN C 3 217 ? 2.939   41.987 46.931  1.00 53.86  ? 217  ASN A CG    1 
ATOM   2439 O  OD1   . ASN C 3 217 ? 2.680   42.786 46.016  1.00 56.45  ? 217  ASN A OD1   1 
ATOM   2440 N  ND2   . ASN C 3 217 ? 2.423   42.094 48.162  1.00 55.12  ? 217  ASN A ND2   1 
ATOM   2441 N  N     . VAL C 3 218 ? 7.399   41.520 46.943  1.00 51.69  ? 218  VAL A N     1 
ATOM   2442 C  CA    . VAL C 3 218 ? 8.370   41.766 48.005  1.00 51.86  ? 218  VAL A CA    1 
ATOM   2443 C  C     . VAL C 3 218 ? 8.504   43.254 48.273  1.00 52.35  ? 218  VAL A C     1 
ATOM   2444 O  O     . VAL C 3 218 ? 8.834   43.678 49.385  1.00 52.57  ? 218  VAL A O     1 
ATOM   2445 C  CB    . VAL C 3 218 ? 9.751   41.142 47.685  1.00 51.50  ? 218  VAL A CB    1 
ATOM   2446 C  CG1   . VAL C 3 218 ? 9.685   39.637 47.792  1.00 51.14  ? 218  VAL A CG1   1 
ATOM   2447 C  CG2   . VAL C 3 218 ? 10.228  41.560 46.305  1.00 51.34  ? 218  VAL A CG2   1 
ATOM   2448 N  N     . GLU C 3 219 ? 8.204   44.035 47.246  1.00 52.75  ? 219  GLU A N     1 
ATOM   2449 C  CA    . GLU C 3 219 ? 8.431   45.455 47.257  1.00 53.34  ? 219  GLU A CA    1 
ATOM   2450 C  C     . GLU C 3 219 ? 7.463   46.171 48.187  1.00 53.09  ? 219  GLU A C     1 
ATOM   2451 O  O     . GLU C 3 219 ? 7.808   47.178 48.770  1.00 53.16  ? 219  GLU A O     1 
ATOM   2452 C  CB    . GLU C 3 219 ? 8.271   45.967 45.841  1.00 53.86  ? 219  GLU A CB    1 
ATOM   2453 C  CG    . GLU C 3 219 ? 9.462   46.714 45.333  1.00 56.57  ? 219  GLU A CG    1 
ATOM   2454 C  CD    . GLU C 3 219 ? 9.319   48.200 45.483  1.00 61.20  ? 219  GLU A CD    1 
ATOM   2455 O  OE1   . GLU C 3 219 ? 8.280   48.652 46.029  1.00 63.77  ? 219  GLU A OE1   1 
ATOM   2456 O  OE2   . GLU C 3 219 ? 10.249  48.923 45.045  1.00 62.99  ? 219  GLU A OE2   1 
ATOM   2457 N  N     . SER C 3 220 ? 6.252   45.646 48.323  1.00 53.02  ? 220  SER A N     1 
ATOM   2458 C  CA    . SER C 3 220 ? 5.238   46.256 49.179  1.00 53.03  ? 220  SER A CA    1 
ATOM   2459 C  C     . SER C 3 220 ? 5.031   45.514 50.490  1.00 52.81  ? 220  SER A C     1 
ATOM   2460 O  O     . SER C 3 220 ? 4.452   46.064 51.432  1.00 52.92  ? 220  SER A O     1 
ATOM   2461 C  CB    . SER C 3 220 ? 3.912   46.346 48.445  1.00 52.84  ? 220  SER A CB    1 
ATOM   2462 O  OG    . SER C 3 220 ? 4.056   47.202 47.339  1.00 55.00  ? 220  SER A OG    1 
ATOM   2463 N  N     . PHE C 3 221 ? 5.477   44.263 50.543  1.00 52.31  ? 221  PHE A N     1 
ATOM   2464 C  CA    . PHE C 3 221 ? 5.429   43.512 51.778  1.00 51.95  ? 221  PHE A CA    1 
ATOM   2465 C  C     . PHE C 3 221 ? 6.806   43.083 52.337  1.00 52.06  ? 221  PHE A C     1 
ATOM   2466 O  O     . PHE C 3 221 ? 7.308   43.716 53.265  1.00 52.18  ? 221  PHE A O     1 
ATOM   2467 C  CB    . PHE C 3 221 ? 4.476   42.333 51.663  1.00 51.81  ? 221  PHE A CB    1 
ATOM   2468 C  CG    . PHE C 3 221 ? 4.264   41.621 52.954  1.00 51.54  ? 221  PHE A CG    1 
ATOM   2469 C  CD1   . PHE C 3 221 ? 3.540   42.217 53.975  1.00 51.68  ? 221  PHE A CD1   1 
ATOM   2470 C  CD2   . PHE C 3 221 ? 4.809   40.362 53.161  1.00 52.09  ? 221  PHE A CD2   1 
ATOM   2471 C  CE1   . PHE C 3 221 ? 3.349   41.570 55.185  1.00 52.12  ? 221  PHE A CE1   1 
ATOM   2472 C  CE2   . PHE C 3 221 ? 4.622   39.695 54.367  1.00 52.28  ? 221  PHE A CE2   1 
ATOM   2473 C  CZ    . PHE C 3 221 ? 3.893   40.305 55.387  1.00 52.20  ? 221  PHE A CZ    1 
ATOM   2474 N  N     . ALA C 3 222 ? 7.405   42.029 51.779  1.00 51.89  ? 222  ALA A N     1 
ATOM   2475 C  CA    . ALA C 3 222 ? 8.596   41.412 52.364  1.00 51.71  ? 222  ALA A CA    1 
ATOM   2476 C  C     . ALA C 3 222 ? 9.674   42.419 52.766  1.00 51.85  ? 222  ALA A C     1 
ATOM   2477 O  O     . ALA C 3 222 ? 9.948   42.597 53.960  1.00 52.01  ? 222  ALA A O     1 
ATOM   2478 C  CB    . ALA C 3 222 ? 9.159   40.349 51.442  1.00 51.63  ? 222  ALA A CB    1 
ATOM   2479 N  N     . ILE C 3 223 ? 10.258  43.092 51.776  1.00 51.86  ? 223  ILE A N     1 
ATOM   2480 C  CA    . ILE C 3 223 ? 11.331  44.063 52.016  1.00 51.71  ? 223  ILE A CA    1 
ATOM   2481 C  C     . ILE C 3 223 ? 10.929  45.075 53.104  1.00 52.31  ? 223  ILE A C     1 
ATOM   2482 O  O     . ILE C 3 223 ? 11.601  45.171 54.131  1.00 52.23  ? 223  ILE A O     1 
ATOM   2483 C  CB    . ILE C 3 223 ? 11.756  44.809 50.720  1.00 51.30  ? 223  ILE A CB    1 
ATOM   2484 C  CG1   . ILE C 3 223 ? 12.268  43.830 49.667  1.00 50.58  ? 223  ILE A CG1   1 
ATOM   2485 C  CG2   . ILE C 3 223 ? 12.813  45.858 51.030  1.00 50.74  ? 223  ILE A CG2   1 
ATOM   2486 C  CD1   . ILE C 3 223 ? 12.341  44.423 48.281  1.00 49.74  ? 223  ILE A CD1   1 
ATOM   2487 N  N     . PRO C 3 224 ? 9.829   45.825 52.888  1.00 52.70  ? 224  PRO A N     1 
ATOM   2488 C  CA    . PRO C 3 224 ? 9.419   46.766 53.922  1.00 52.96  ? 224  PRO A CA    1 
ATOM   2489 C  C     . PRO C 3 224 ? 9.321   46.127 55.298  1.00 53.16  ? 224  PRO A C     1 
ATOM   2490 O  O     . PRO C 3 224 ? 9.676   46.762 56.292  1.00 53.08  ? 224  PRO A O     1 
ATOM   2491 C  CB    . PRO C 3 224 ? 8.028   47.200 53.464  1.00 53.14  ? 224  PRO A CB    1 
ATOM   2492 C  CG    . PRO C 3 224 ? 8.060   47.060 52.001  1.00 53.50  ? 224  PRO A CG    1 
ATOM   2493 C  CD    . PRO C 3 224 ? 8.928   45.871 51.721  1.00 52.81  ? 224  PRO A CD    1 
ATOM   2494 N  N     . TYR C 3 225 ? 8.856   44.879 55.352  1.00 53.66  ? 225  TYR A N     1 
ATOM   2495 C  CA    . TYR C 3 225 ? 8.578   44.242 56.632  1.00 53.96  ? 225  TYR A CA    1 
ATOM   2496 C  C     . TYR C 3 225 ? 9.847   43.845 57.368  1.00 54.37  ? 225  TYR A C     1 
ATOM   2497 O  O     . TYR C 3 225 ? 9.996   44.147 58.554  1.00 54.59  ? 225  TYR A O     1 
ATOM   2498 C  CB    . TYR C 3 225 ? 7.630   43.050 56.503  1.00 53.69  ? 225  TYR A CB    1 
ATOM   2499 C  CG    . TYR C 3 225 ? 6.948   42.758 57.823  1.00 53.84  ? 225  TYR A CG    1 
ATOM   2500 C  CD1   . TYR C 3 225 ? 7.653   42.155 58.874  1.00 54.06  ? 225  TYR A CD1   1 
ATOM   2501 C  CD2   . TYR C 3 225 ? 5.610   43.109 58.044  1.00 52.99  ? 225  TYR A CD2   1 
ATOM   2502 C  CE1   . TYR C 3 225 ? 7.042   41.890 60.098  1.00 53.27  ? 225  TYR A CE1   1 
ATOM   2503 C  CE2   . TYR C 3 225 ? 4.996   42.847 59.269  1.00 52.38  ? 225  TYR A CE2   1 
ATOM   2504 C  CZ    . TYR C 3 225 ? 5.729   42.237 60.284  1.00 52.41  ? 225  TYR A CZ    1 
ATOM   2505 O  OH    . TYR C 3 225 ? 5.172   41.977 61.499  1.00 53.36  ? 225  TYR A OH    1 
ATOM   2506 N  N     . VAL C 3 226 ? 10.766  43.186 56.672  1.00 54.70  ? 226  VAL A N     1 
ATOM   2507 C  CA    . VAL C 3 226 ? 12.028  42.836 57.295  1.00 55.44  ? 226  VAL A CA    1 
ATOM   2508 C  C     . VAL C 3 226 ? 12.748  44.089 57.739  1.00 56.12  ? 226  VAL A C     1 
ATOM   2509 O  O     . VAL C 3 226 ? 13.261  44.144 58.853  1.00 56.51  ? 226  VAL A O     1 
ATOM   2510 C  CB    . VAL C 3 226 ? 12.938  41.960 56.401  1.00 55.50  ? 226  VAL A CB    1 
ATOM   2511 C  CG1   . VAL C 3 226 ? 12.251  40.644 56.088  1.00 56.20  ? 226  VAL A CG1   1 
ATOM   2512 C  CG2   . VAL C 3 226 ? 13.330  42.670 55.112  1.00 55.81  ? 226  VAL A CG2   1 
ATOM   2513 N  N     . TYR C 3 227 ? 12.761  45.108 56.881  1.00 56.87  ? 227  TYR A N     1 
ATOM   2514 C  CA    . TYR C 3 227 ? 13.400  46.366 57.217  1.00 57.40  ? 227  TYR A CA    1 
ATOM   2515 C  C     . TYR C 3 227 ? 12.899  46.902 58.553  1.00 58.00  ? 227  TYR A C     1 
ATOM   2516 O  O     . TYR C 3 227 ? 13.686  47.144 59.473  1.00 58.12  ? 227  TYR A O     1 
ATOM   2517 C  CB    . TYR C 3 227 ? 13.160  47.404 56.133  1.00 57.32  ? 227  TYR A CB    1 
ATOM   2518 C  CG    . TYR C 3 227 ? 13.994  48.640 56.345  1.00 57.88  ? 227  TYR A CG    1 
ATOM   2519 C  CD1   . TYR C 3 227 ? 15.316  48.681 55.899  1.00 58.76  ? 227  TYR A CD1   1 
ATOM   2520 C  CD2   . TYR C 3 227 ? 13.480  49.762 57.018  1.00 57.34  ? 227  TYR A CD2   1 
ATOM   2521 C  CE1   . TYR C 3 227 ? 16.108  49.805 56.096  1.00 58.40  ? 227  TYR A CE1   1 
ATOM   2522 C  CE2   . TYR C 3 227 ? 14.262  50.897 57.217  1.00 57.42  ? 227  TYR A CE2   1 
ATOM   2523 C  CZ    . TYR C 3 227 ? 15.582  50.907 56.746  1.00 58.00  ? 227  TYR A CZ    1 
ATOM   2524 O  OH    . TYR C 3 227 ? 16.401  52.002 56.916  1.00 58.17  ? 227  TYR A OH    1 
ATOM   2525 N  N     . ASN C 3 228 ? 11.587  47.067 58.660  1.00 58.67  ? 228  ASN A N     1 
ATOM   2526 C  CA    . ASN C 3 228 ? 11.013  47.749 59.805  1.00 59.71  ? 228  ASN A CA    1 
ATOM   2527 C  C     . ASN C 3 228 ? 11.089  46.946 61.091  1.00 60.43  ? 228  ASN A C     1 
ATOM   2528 O  O     . ASN C 3 228 ? 11.354  47.497 62.166  1.00 60.19  ? 228  ASN A O     1 
ATOM   2529 C  CB    . ASN C 3 228 ? 9.579   48.179 59.506  1.00 59.80  ? 228  ASN A CB    1 
ATOM   2530 C  CG    . ASN C 3 228 ? 9.507   49.547 58.851  1.00 59.86  ? 228  ASN A CG    1 
ATOM   2531 O  OD1   . ASN C 3 228 ? 8.435   50.131 58.750  1.00 61.52  ? 228  ASN A OD1   1 
ATOM   2532 N  ND2   . ASN C 3 228 ? 10.645  50.064 58.412  1.00 59.71  ? 228  ASN A ND2   1 
ATOM   2533 N  N     . ARG C 3 229 ? 10.865  45.639 60.961  1.00 61.33  ? 229  ARG A N     1 
ATOM   2534 C  CA    . ARG C 3 229 ? 10.978  44.712 62.071  1.00 62.13  ? 229  ARG A CA    1 
ATOM   2535 C  C     . ARG C 3 229 ? 12.383  44.728 62.679  1.00 62.86  ? 229  ARG A C     1 
ATOM   2536 O  O     . ARG C 3 229 ? 12.542  44.793 63.903  1.00 62.98  ? 229  ARG A O     1 
ATOM   2537 C  CB    . ARG C 3 229 ? 10.638  43.309 61.597  1.00 62.04  ? 229  ARG A CB    1 
ATOM   2538 C  CG    . ARG C 3 229 ? 10.522  42.310 62.716  1.00 62.61  ? 229  ARG A CG    1 
ATOM   2539 C  CD    . ARG C 3 229 ? 9.328   42.627 63.580  1.00 63.03  ? 229  ARG A CD    1 
ATOM   2540 N  NE    . ARG C 3 229 ? 9.267   41.738 64.729  1.00 63.84  ? 229  ARG A NE    1 
ATOM   2541 C  CZ    . ARG C 3 229 ? 8.399   41.857 65.726  1.00 64.65  ? 229  ARG A CZ    1 
ATOM   2542 N  NH1   . ARG C 3 229 ? 7.499   42.839 65.718  1.00 64.69  ? 229  ARG A NH1   1 
ATOM   2543 N  NH2   . ARG C 3 229 ? 8.426   40.986 66.729  1.00 64.74  ? 229  ARG A NH2   1 
ATOM   2544 N  N     . ILE C 3 230 ? 13.390  44.676 61.809  1.00 63.69  ? 230  ILE A N     1 
ATOM   2545 C  CA    . ILE C 3 230 ? 14.795  44.712 62.209  1.00 64.58  ? 230  ILE A CA    1 
ATOM   2546 C  C     . ILE C 3 230 ? 15.157  46.091 62.746  1.00 65.47  ? 230  ILE A C     1 
ATOM   2547 O  O     . ILE C 3 230 ? 15.896  46.202 63.737  1.00 65.33  ? 230  ILE A O     1 
ATOM   2548 C  CB    . ILE C 3 230 ? 15.728  44.325 61.025  1.00 64.55  ? 230  ILE A CB    1 
ATOM   2549 C  CG1   . ILE C 3 230 ? 15.731  42.808 60.841  1.00 64.24  ? 230  ILE A CG1   1 
ATOM   2550 C  CG2   . ILE C 3 230 ? 17.158  44.845 61.233  1.00 64.59  ? 230  ILE A CG2   1 
ATOM   2551 C  CD1   . ILE C 3 230 ? 16.623  42.315 59.723  1.00 64.37  ? 230  ILE A CD1   1 
ATOM   2552 N  N     . LYS C 3 231 ? 14.636  47.129 62.079  1.00 66.44  ? 231  LYS A N     1 
ATOM   2553 C  CA    . LYS C 3 231 ? 14.807  48.519 62.505  1.00 67.16  ? 231  LYS A CA    1 
ATOM   2554 C  C     . LYS C 3 231 ? 14.261  48.752 63.924  1.00 67.49  ? 231  LYS A C     1 
ATOM   2555 O  O     . LYS C 3 231 ? 14.944  49.339 64.761  1.00 67.90  ? 231  LYS A O     1 
ATOM   2556 C  CB    . LYS C 3 231 ? 14.161  49.469 61.494  1.00 67.15  ? 231  LYS A CB    1 
ATOM   2557 C  CG    . LYS C 3 231 ? 14.053  50.929 61.933  1.00 67.74  ? 231  LYS A CG    1 
ATOM   2558 C  CD    . LYS C 3 231 ? 13.384  51.779 60.851  1.00 67.65  ? 231  LYS A CD    1 
ATOM   2559 C  CE    . LYS C 3 231 ? 12.680  52.997 61.427  1.00 67.50  ? 231  LYS A CE    1 
ATOM   2560 N  NZ    . LYS C 3 231 ? 11.348  52.637 61.983  1.00 67.69  ? 231  LYS A NZ    1 
ATOM   2561 N  N     . ASN C 3 232 ? 13.054  48.267 64.204  1.00 67.70  ? 232  ASN A N     1 
ATOM   2562 C  CA    . ASN C 3 232 ? 12.451  48.449 65.527  1.00 67.98  ? 232  ASN A CA    1 
ATOM   2563 C  C     . ASN C 3 232 ? 13.139  47.714 66.670  1.00 68.30  ? 232  ASN A C     1 
ATOM   2564 O  O     . ASN C 3 232 ? 13.105  48.177 67.804  1.00 68.54  ? 232  ASN A O     1 
ATOM   2565 C  CB    . ASN C 3 232 ? 10.965  48.103 65.492  1.00 67.87  ? 232  ASN A CB    1 
ATOM   2566 C  CG    . ASN C 3 232 ? 10.199  48.989 64.546  1.00 67.65  ? 232  ASN A CG    1 
ATOM   2567 O  OD1   . ASN C 3 232 ? 10.744  49.963 64.022  1.00 68.07  ? 232  ASN A OD1   1 
ATOM   2568 N  ND2   . ASN C 3 232 ? 8.937   48.660 64.309  1.00 66.64  ? 232  ASN A ND2   1 
ATOM   2569 N  N     . ILE C 3 233 ? 13.757  46.575 66.374  1.00 68.59  ? 233  ILE A N     1 
ATOM   2570 C  CA    . ILE C 3 233 ? 14.416  45.773 67.401  1.00 69.11  ? 233  ILE A CA    1 
ATOM   2571 C  C     . ILE C 3 233 ? 15.881  46.168 67.611  1.00 69.56  ? 233  ILE A C     1 
ATOM   2572 O  O     . ILE C 3 233 ? 16.311  46.393 68.738  1.00 69.90  ? 233  ILE A O     1 
ATOM   2573 C  CB    . ILE C 3 233 ? 14.323  44.270 67.082  1.00 69.16  ? 233  ILE A CB    1 
ATOM   2574 C  CG1   . ILE C 3 233 ? 12.863  43.812 67.112  1.00 69.46  ? 233  ILE A CG1   1 
ATOM   2575 C  CG2   . ILE C 3 233 ? 15.150  43.455 68.063  1.00 69.32  ? 233  ILE A CG2   1 
ATOM   2576 C  CD1   . ILE C 3 233 ? 12.636  42.473 66.464  1.00 69.08  ? 233  ILE A CD1   1 
ATOM   2577 N  N     . PHE C 3 234 ? 16.641  46.260 66.525  1.00 70.00  ? 234  PHE A N     1 
ATOM   2578 C  CA    . PHE C 3 234 ? 18.081  46.505 66.605  1.00 70.14  ? 234  PHE A CA    1 
ATOM   2579 C  C     . PHE C 3 234 ? 18.470  47.944 66.277  1.00 70.11  ? 234  PHE A C     1 
ATOM   2580 O  O     . PHE C 3 234 ? 19.658  48.266 66.207  1.00 70.18  ? 234  PHE A O     1 
ATOM   2581 C  CB    . PHE C 3 234 ? 18.830  45.542 65.678  1.00 70.35  ? 234  PHE A CB    1 
ATOM   2582 C  CG    . PHE C 3 234 ? 18.502  44.097 65.914  1.00 71.27  ? 234  PHE A CG    1 
ATOM   2583 C  CD1   . PHE C 3 234 ? 17.451  43.486 65.225  1.00 71.86  ? 234  PHE A CD1   1 
ATOM   2584 C  CD2   . PHE C 3 234 ? 19.237  43.341 66.832  1.00 71.92  ? 234  PHE A CD2   1 
ATOM   2585 C  CE1   . PHE C 3 234 ? 17.130  42.146 65.448  1.00 72.28  ? 234  PHE A CE1   1 
ATOM   2586 C  CE2   . PHE C 3 234 ? 18.928  41.994 67.065  1.00 72.42  ? 234  PHE A CE2   1 
ATOM   2587 C  CZ    . PHE C 3 234 ? 17.870  41.395 66.370  1.00 72.52  ? 234  PHE A CZ    1 
ATOM   2588 N  N     . GLY C 3 235 ? 17.476  48.806 66.078  1.00 69.97  ? 235  GLY A N     1 
ATOM   2589 C  CA    . GLY C 3 235 ? 17.736  50.189 65.688  1.00 69.92  ? 235  GLY A CA    1 
ATOM   2590 C  C     . GLY C 3 235 ? 17.946  50.340 64.192  1.00 69.97  ? 235  GLY A C     1 
ATOM   2591 O  O     . GLY C 3 235 ? 18.182  49.355 63.481  1.00 70.05  ? 235  GLY A O     1 
ATOM   2592 N  N     . GLU C 3 236 ? 17.871  51.583 63.722  1.00 69.91  ? 236  GLU A N     1 
ATOM   2593 C  CA    . GLU C 3 236 ? 17.917  51.904 62.297  1.00 69.79  ? 236  GLU A CA    1 
ATOM   2594 C  C     . GLU C 3 236 ? 19.255  51.570 61.641  1.00 69.26  ? 236  GLU A C     1 
ATOM   2595 O  O     . GLU C 3 236 ? 19.299  51.221 60.465  1.00 69.34  ? 236  GLU A O     1 
ATOM   2596 C  CB    . GLU C 3 236 ? 17.573  53.380 62.084  1.00 69.90  ? 236  GLU A CB    1 
ATOM   2597 C  CG    . GLU C 3 236 ? 17.389  53.785 60.614  1.00 71.03  ? 236  GLU A CG    1 
ATOM   2598 C  CD    . GLU C 3 236 ? 16.881  55.217 60.433  1.00 71.80  ? 236  GLU A CD    1 
ATOM   2599 O  OE1   . GLU C 3 236 ? 16.978  56.019 61.397  1.00 72.84  ? 236  GLU A OE1   1 
ATOM   2600 O  OE2   . GLU C 3 236 ? 16.386  55.537 59.321  1.00 72.49  ? 236  GLU A OE2   1 
ATOM   2601 N  N     . SER C 3 237 ? 20.342  51.679 62.402  1.00 68.91  ? 237  SER A N     1 
ATOM   2602 C  CA    . SER C 3 237 ? 21.692  51.421 61.880  1.00 68.30  ? 237  SER A CA    1 
ATOM   2603 C  C     . SER C 3 237 ? 21.875  49.987 61.364  1.00 67.56  ? 237  SER A C     1 
ATOM   2604 O  O     . SER C 3 237 ? 22.484  49.772 60.305  1.00 67.14  ? 237  SER A O     1 
ATOM   2605 C  CB    . SER C 3 237 ? 22.744  51.737 62.948  1.00 68.47  ? 237  SER A CB    1 
ATOM   2606 O  OG    . SER C 3 237 ? 22.850  53.133 63.170  1.00 69.29  ? 237  SER A OG    1 
ATOM   2607 N  N     . THR C 3 238 ? 21.354  49.028 62.133  1.00 66.76  ? 238  THR A N     1 
ATOM   2608 C  CA    . THR C 3 238 ? 21.363  47.609 61.777  1.00 66.09  ? 238  THR A CA    1 
ATOM   2609 C  C     . THR C 3 238 ? 20.524  47.362 60.522  1.00 65.81  ? 238  THR A C     1 
ATOM   2610 O  O     . THR C 3 238 ? 20.951  46.650 59.611  1.00 65.64  ? 238  THR A O     1 
ATOM   2611 C  CB    . THR C 3 238 ? 20.801  46.762 62.918  1.00 65.98  ? 238  THR A CB    1 
ATOM   2612 O  OG1   . THR C 3 238 ? 21.437  47.135 64.144  1.00 65.83  ? 238  THR A OG1   1 
ATOM   2613 C  CG2   . THR C 3 238 ? 21.039  45.291 62.663  1.00 65.80  ? 238  THR A CG2   1 
ATOM   2614 N  N     . ALA C 3 239 ? 19.335  47.966 60.484  1.00 65.30  ? 239  ALA A N     1 
ATOM   2615 C  CA    . ALA C 3 239 ? 18.475  47.919 59.307  1.00 64.82  ? 239  ALA A CA    1 
ATOM   2616 C  C     . ALA C 3 239 ? 19.239  48.292 58.040  1.00 64.48  ? 239  ALA A C     1 
ATOM   2617 O  O     . ALA C 3 239 ? 19.132  47.601 57.033  1.00 64.68  ? 239  ALA A O     1 
ATOM   2618 C  CB    . ALA C 3 239 ? 17.260  48.809 59.491  1.00 64.77  ? 239  ALA A CB    1 
ATOM   2619 N  N     . LYS C 3 240 ? 20.030  49.361 58.102  1.00 63.94  ? 240  LYS A N     1 
ATOM   2620 C  CA    . LYS C 3 240 ? 20.825  49.799 56.954  1.00 63.58  ? 240  LYS A CA    1 
ATOM   2621 C  C     . LYS C 3 240 ? 21.823  48.754 56.449  1.00 63.27  ? 240  LYS A C     1 
ATOM   2622 O  O     . LYS C 3 240 ? 22.421  48.935 55.379  1.00 63.26  ? 240  LYS A O     1 
ATOM   2623 C  CB    . LYS C 3 240 ? 21.579  51.101 57.264  1.00 63.82  ? 240  LYS A CB    1 
ATOM   2624 C  CG    . LYS C 3 240 ? 20.853  52.383 56.899  1.00 63.64  ? 240  LYS A CG    1 
ATOM   2625 C  CD    . LYS C 3 240 ? 20.104  52.968 58.084  1.00 63.26  ? 240  LYS A CD    1 
ATOM   2626 C  CE    . LYS C 3 240 ? 19.436  54.279 57.716  1.00 63.01  ? 240  LYS A CE    1 
ATOM   2627 N  NZ    . LYS C 3 240 ? 20.407  55.302 57.250  1.00 61.86  ? 240  LYS A NZ    1 
ATOM   2628 N  N     . ARG C 3 241 ? 22.026  47.679 57.210  1.00 62.71  ? 241  ARG A N     1 
ATOM   2629 C  CA    . ARG C 3 241 ? 22.944  46.631 56.764  1.00 62.54  ? 241  ARG A CA    1 
ATOM   2630 C  C     . ARG C 3 241 ? 22.394  45.952 55.498  1.00 62.19  ? 241  ARG A C     1 
ATOM   2631 O  O     . ARG C 3 241 ? 23.165  45.493 54.640  1.00 61.98  ? 241  ARG A O     1 
ATOM   2632 C  CB    . ARG C 3 241 ? 23.268  45.616 57.876  1.00 62.70  ? 241  ARG A CB    1 
ATOM   2633 C  CG    . ARG C 3 241 ? 23.947  46.224 59.119  1.00 62.66  ? 241  ARG A CG    1 
ATOM   2634 C  CD    . ARG C 3 241 ? 25.173  45.421 59.609  1.00 62.02  ? 241  ARG A CD    1 
ATOM   2635 N  NE    . ARG C 3 241 ? 24.848  44.357 60.565  1.00 61.05  ? 241  ARG A NE    1 
ATOM   2636 C  CZ    . ARG C 3 241 ? 25.093  43.063 60.367  1.00 59.89  ? 241  ARG A CZ    1 
ATOM   2637 N  NH1   . ARG C 3 241 ? 25.672  42.652 59.244  1.00 59.78  ? 241  ARG A NH1   1 
ATOM   2638 N  NH2   . ARG C 3 241 ? 24.757  42.175 61.292  1.00 59.36  ? 241  ARG A NH2   1 
ATOM   2639 N  N     . LEU C 3 242 ? 21.063  45.940 55.376  1.00 61.58  ? 242  LEU A N     1 
ATOM   2640 C  CA    . LEU C 3 242 ? 20.367  45.516 54.146  1.00 61.05  ? 242  LEU A CA    1 
ATOM   2641 C  C     . LEU C 3 242 ? 20.840  46.199 52.855  1.00 60.69  ? 242  LEU A C     1 
ATOM   2642 O  O     . LEU C 3 242 ? 20.780  45.598 51.791  1.00 60.34  ? 242  LEU A O     1 
ATOM   2643 C  CB    . LEU C 3 242 ? 18.856  45.677 54.296  1.00 60.97  ? 242  LEU A CB    1 
ATOM   2644 C  CG    . LEU C 3 242 ? 18.101  44.562 55.019  1.00 60.32  ? 242  LEU A CG    1 
ATOM   2645 C  CD1   . LEU C 3 242 ? 16.804  45.088 55.587  1.00 58.99  ? 242  LEU A CD1   1 
ATOM   2646 C  CD2   . LEU C 3 242 ? 17.858  43.383 54.080  1.00 60.47  ? 242  LEU A CD2   1 
ATOM   2647 N  N     . SER C 3 243 ? 21.293  47.450 52.959  1.00 60.40  ? 243  SER A N     1 
ATOM   2648 C  CA    . SER C 3 243 ? 21.982  48.125 51.862  1.00 60.29  ? 243  SER A CA    1 
ATOM   2649 C  C     . SER C 3 243 ? 23.487  47.915 51.985  1.00 60.25  ? 243  SER A C     1 
ATOM   2650 O  O     . SER C 3 243 ? 24.062  48.286 52.998  1.00 60.37  ? 243  SER A O     1 
ATOM   2651 C  CB    . SER C 3 243 ? 21.683  49.623 51.882  1.00 60.25  ? 243  SER A CB    1 
ATOM   2652 O  OG    . SER C 3 243 ? 22.648  50.345 51.126  1.00 60.13  ? 243  SER A OG    1 
ATOM   2653 N  N     . PRO C 3 244 ? 24.129  47.328 50.956  1.00 60.27  ? 244  PRO A N     1 
ATOM   2654 C  CA    . PRO C 3 244 ? 25.574  47.106 50.983  1.00 60.74  ? 244  PRO A CA    1 
ATOM   2655 C  C     . PRO C 3 244 ? 26.354  48.400 51.144  1.00 61.48  ? 244  PRO A C     1 
ATOM   2656 O  O     . PRO C 3 244 ? 27.492  48.380 51.611  1.00 61.78  ? 244  PRO A O     1 
ATOM   2657 C  CB    . PRO C 3 244 ? 25.873  46.485 49.615  1.00 60.43  ? 244  PRO A CB    1 
ATOM   2658 C  CG    . PRO C 3 244 ? 24.712  46.810 48.778  1.00 60.62  ? 244  PRO A CG    1 
ATOM   2659 C  CD    . PRO C 3 244 ? 23.538  46.843 49.703  1.00 60.26  ? 244  PRO A CD    1 
ATOM   2660 N  N     . HIS C 3 245 ? 25.742  49.517 50.767  1.00 62.30  ? 245  HIS A N     1 
ATOM   2661 C  CA    . HIS C 3 245 ? 26.363  50.819 50.935  1.00 62.93  ? 245  HIS A CA    1 
ATOM   2662 C  C     . HIS C 3 245 ? 25.895  51.488 52.227  1.00 63.88  ? 245  HIS A C     1 
ATOM   2663 O  O     . HIS C 3 245 ? 26.305  52.597 52.533  1.00 63.92  ? 245  HIS A O     1 
ATOM   2664 C  CB    . HIS C 3 245 ? 26.088  51.703 49.713  1.00 62.47  ? 245  HIS A CB    1 
ATOM   2665 C  CG    . HIS C 3 245 ? 26.561  51.110 48.420  1.00 62.19  ? 245  HIS A CG    1 
ATOM   2666 N  ND1   . HIS C 3 245 ? 27.806  50.536 48.273  1.00 62.08  ? 245  HIS A ND1   1 
ATOM   2667 C  CD2   . HIS C 3 245 ? 25.964  51.019 47.208  1.00 62.01  ? 245  HIS A CD2   1 
ATOM   2668 C  CE1   . HIS C 3 245 ? 27.951  50.109 47.030  1.00 61.08  ? 245  HIS A CE1   1 
ATOM   2669 N  NE2   . HIS C 3 245 ? 26.848  50.391 46.362  1.00 60.67  ? 245  HIS A NE2   1 
ATOM   2670 N  N     . ARG C 3 246 ? 25.048  50.795 52.986  1.00 65.25  ? 246  ARG A N     1 
ATOM   2671 C  CA    . ARG C 3 246 ? 24.499  51.282 54.273  1.00 66.61  ? 246  ARG A CA    1 
ATOM   2672 C  C     . ARG C 3 246 ? 23.614  52.525 54.163  1.00 67.07  ? 246  ARG A C     1 
ATOM   2673 O  O     . ARG C 3 246 ? 23.383  53.201 55.164  1.00 67.38  ? 246  ARG A O     1 
ATOM   2674 C  CB    . ARG C 3 246 ? 25.591  51.525 55.337  1.00 66.85  ? 246  ARG A CB    1 
ATOM   2675 C  CG    . ARG C 3 246 ? 26.615  50.420 55.525  1.00 68.44  ? 246  ARG A CG    1 
ATOM   2676 C  CD    . ARG C 3 246 ? 26.057  49.248 56.305  1.00 71.78  ? 246  ARG A CD    1 
ATOM   2677 N  NE    . ARG C 3 246 ? 26.998  48.131 56.303  1.00 74.83  ? 246  ARG A NE    1 
ATOM   2678 C  CZ    . ARG C 3 246 ? 27.110  47.225 55.327  1.00 77.09  ? 246  ARG A CZ    1 
ATOM   2679 N  NH1   . ARG C 3 246 ? 26.328  47.280 54.251  1.00 77.46  ? 246  ARG A NH1   1 
ATOM   2680 N  NH2   . ARG C 3 246 ? 28.009  46.249 55.430  1.00 78.01  ? 246  ARG A NH2   1 
ATOM   2681 N  N     . LYS C 3 247 ? 23.115  52.824 52.965  1.00 67.81  ? 247  LYS A N     1 
ATOM   2682 C  CA    . LYS C 3 247 ? 22.180  53.945 52.784  1.00 68.57  ? 247  LYS A CA    1 
ATOM   2683 C  C     . LYS C 3 247 ? 20.793  53.507 52.301  1.00 69.01  ? 247  LYS A C     1 
ATOM   2684 O  O     . LYS C 3 247 ? 20.675  52.792 51.314  1.00 68.95  ? 247  LYS A O     1 
ATOM   2685 C  CB    . LYS C 3 247 ? 22.777  55.007 51.850  1.00 68.40  ? 247  LYS A CB    1 
ATOM   2686 C  CG    . LYS C 3 247 ? 21.839  56.180 51.574  1.00 68.90  ? 247  LYS A CG    1 
ATOM   2687 C  CD    . LYS C 3 247 ? 22.564  57.521 51.530  1.00 69.12  ? 247  LYS A CD    1 
ATOM   2688 C  CE    . LYS C 3 247 ? 21.578  58.670 51.404  1.00 68.76  ? 247  LYS A CE    1 
ATOM   2689 N  NZ    . LYS C 3 247 ? 20.428  58.542 52.354  1.00 68.41  ? 247  LYS A NZ    1 
ATOM   2690 N  N     . THR C 3 248 ? 19.750  53.940 53.003  1.00 69.96  ? 248  THR A N     1 
ATOM   2691 C  CA    . THR C 3 248 ? 18.374  53.642 52.589  1.00 71.30  ? 248  THR A CA    1 
ATOM   2692 C  C     . THR C 3 248 ? 17.463  54.880 52.548  1.00 72.59  ? 248  THR A C     1 
ATOM   2693 O  O     . THR C 3 248 ? 17.842  55.955 53.021  1.00 72.64  ? 248  THR A O     1 
ATOM   2694 C  CB    . THR C 3 248 ? 17.721  52.538 53.469  1.00 71.15  ? 248  THR A CB    1 
ATOM   2695 O  OG1   . THR C 3 248 ? 17.640  52.977 54.829  1.00 70.27  ? 248  THR A OG1   1 
ATOM   2696 C  CG2   . THR C 3 248 ? 18.514  51.238 53.395  1.00 70.96  ? 248  THR A CG2   1 
ATOM   2697 N  N     . ARG C 3 249 ? 16.269  54.715 51.972  1.00 74.19  ? 249  ARG A N     1 
ATOM   2698 C  CA    . ARG C 3 249 ? 15.250  55.771 51.916  1.00 75.92  ? 249  ARG A CA    1 
ATOM   2699 C  C     . ARG C 3 249 ? 13.860  55.201 52.201  1.00 77.08  ? 249  ARG A C     1 
ATOM   2700 O  O     . ARG C 3 249 ? 13.508  54.136 51.690  1.00 77.29  ? 249  ARG A O     1 
ATOM   2701 C  CB    . ARG C 3 249 ? 15.258  56.448 50.543  1.00 75.85  ? 249  ARG A CB    1 
ATOM   2702 C  CG    . ARG C 3 249 ? 14.112  57.416 50.324  1.00 76.71  ? 249  ARG A CG    1 
ATOM   2703 C  CD    . ARG C 3 249 ? 13.865  57.656 48.850  1.00 78.88  ? 249  ARG A CD    1 
ATOM   2704 N  NE    . ARG C 3 249 ? 13.212  58.946 48.619  1.00 81.28  ? 249  ARG A NE    1 
ATOM   2705 C  CZ    . ARG C 3 249 ? 13.841  60.127 48.613  1.00 82.25  ? 249  ARG A CZ    1 
ATOM   2706 N  NH1   . ARG C 3 249 ? 15.152  60.197 48.831  1.00 82.72  ? 249  ARG A NH1   1 
ATOM   2707 N  NH2   . ARG C 3 249 ? 13.160  61.247 48.392  1.00 81.63  ? 249  ARG A NH2   1 
ATOM   2708 N  N     . VAL C 3 250 ? 13.067  55.908 53.003  1.00 78.61  ? 250  VAL A N     1 
ATOM   2709 C  CA    . VAL C 3 250 ? 11.694  55.481 53.280  1.00 80.34  ? 250  VAL A CA    1 
ATOM   2710 C  C     . VAL C 3 250 ? 10.678  56.414 52.609  1.00 81.71  ? 250  VAL A C     1 
ATOM   2711 O  O     . VAL C 3 250 ? 10.604  57.595 52.938  1.00 81.99  ? 250  VAL A O     1 
ATOM   2712 C  CB    . VAL C 3 250 ? 11.411  55.358 54.805  1.00 80.25  ? 250  VAL A CB    1 
ATOM   2713 C  CG1   . VAL C 3 250 ? 9.949   54.983 55.063  1.00 80.05  ? 250  VAL A CG1   1 
ATOM   2714 C  CG2   . VAL C 3 250 ? 12.353  54.336 55.454  1.00 80.24  ? 250  VAL A CG2   1 
ATOM   2715 N  N     . LYS C 3 251 ? 9.915   55.879 51.658  1.00 83.35  ? 251  LYS A N     1 
ATOM   2716 C  CA    . LYS C 3 251 ? 8.880   56.657 50.972  1.00 85.13  ? 251  LYS A CA    1 
ATOM   2717 C  C     . LYS C 3 251 ? 7.485   56.298 51.499  1.00 86.38  ? 251  LYS A C     1 
ATOM   2718 O  O     . LYS C 3 251 ? 6.801   55.394 50.987  1.00 86.75  ? 251  LYS A O     1 
ATOM   2719 C  CB    . LYS C 3 251 ? 8.963   56.507 49.443  1.00 85.08  ? 251  LYS A CB    1 
ATOM   2720 C  CG    . LYS C 3 251 ? 8.140   57.539 48.679  1.00 85.13  ? 251  LYS A CG    1 
ATOM   2721 C  CD    . LYS C 3 251 ? 7.792   57.067 47.274  1.00 85.09  ? 251  LYS A CD    1 
ATOM   2722 C  CE    . LYS C 3 251 ? 6.745   57.973 46.611  1.00 84.76  ? 251  LYS A CE    1 
ATOM   2723 N  NZ    . LYS C 3 251 ? 7.301   59.257 46.077  1.00 83.50  ? 251  LYS A NZ    1 
ATOM   2724 N  N     . VAL C 3 252 ? 7.086   57.028 52.536  1.00 87.74  ? 252  VAL A N     1 
ATOM   2725 C  CA    . VAL C 3 252 ? 5.803   56.858 53.194  1.00 88.99  ? 252  VAL A CA    1 
ATOM   2726 C  C     . VAL C 3 252 ? 4.723   57.486 52.287  1.00 89.94  ? 252  VAL A C     1 
ATOM   2727 O  O     . VAL C 3 252 ? 4.852   58.642 51.866  1.00 90.10  ? 252  VAL A O     1 
ATOM   2728 C  CB    . VAL C 3 252 ? 5.879   57.456 54.659  1.00 88.97  ? 252  VAL A CB    1 
ATOM   2729 C  CG1   . VAL C 3 252 ? 5.280   58.873 54.765  1.00 88.88  ? 252  VAL A CG1   1 
ATOM   2730 C  CG2   . VAL C 3 252 ? 5.263   56.513 55.682  1.00 89.14  ? 252  VAL A CG2   1 
ATOM   2731 N  N     . ILE C 3 253 ? 3.699   56.708 51.932  1.00 91.03  ? 253  ILE A N     1 
ATOM   2732 C  CA    . ILE C 3 253 ? 2.605   57.225 51.085  1.00 92.14  ? 253  ILE A CA    1 
ATOM   2733 C  C     . ILE C 3 253 ? 1.222   56.880 51.662  1.00 92.80  ? 253  ILE A C     1 
ATOM   2734 O  O     . ILE C 3 253 ? 0.524   55.988 51.167  1.00 92.98  ? 253  ILE A O     1 
ATOM   2735 C  CB    . ILE C 3 253 ? 2.769   56.848 49.554  1.00 92.19  ? 253  ILE A CB    1 
ATOM   2736 C  CG1   . ILE C 3 253 ? 1.811   57.674 48.675  1.00 92.40  ? 253  ILE A CG1   1 
ATOM   2737 C  CG2   . ILE C 3 253 ? 2.642   55.331 49.312  1.00 91.94  ? 253  ILE A CG2   1 
ATOM   2738 C  CD1   . ILE C 3 253 ? 2.166   57.702 47.180  1.00 92.42  ? 253  ILE A CD1   1 
ATOM   2739 N  N     . GLU C 3 254 ? 0.851   57.606 52.720  1.00 93.65  ? 254  GLU A N     1 
ATOM   2740 C  CA    . GLU C 3 254 ? -0.417  57.395 53.441  1.00 94.51  ? 254  GLU A CA    1 
ATOM   2741 C  C     . GLU C 3 254 ? -1.665  57.517 52.550  1.00 94.91  ? 254  GLU A C     1 
ATOM   2742 O  O     . GLU C 3 254 ? -2.197  58.613 52.330  1.00 94.95  ? 254  GLU A O     1 
ATOM   2743 C  CB    . GLU C 3 254 ? -0.541  58.336 54.657  1.00 94.43  ? 254  GLU A CB    1 
ATOM   2744 C  CG    . GLU C 3 254 ? 0.211   57.887 55.911  1.00 94.76  ? 254  GLU A CG    1 
ATOM   2745 C  CD    . GLU C 3 254 ? 1.669   58.344 55.944  1.00 95.17  ? 254  GLU A CD    1 
ATOM   2746 O  OE1   . GLU C 3 254 ? 1.950   59.523 55.634  1.00 95.44  ? 254  GLU A OE1   1 
ATOM   2747 O  OE2   . GLU C 3 254 ? 2.538   57.521 56.302  1.00 95.20  ? 254  GLU A OE2   1 
ATOM   2748 N  N     . ASN C 3 255 ? -2.115  56.377 52.035  1.00 95.46  ? 255  ASN A N     1 
ATOM   2749 C  CA    . ASN C 3 255 ? -3.422  56.278 51.406  1.00 95.75  ? 255  ASN A CA    1 
ATOM   2750 C  C     . ASN C 3 255 ? -4.473  56.887 52.338  1.00 95.89  ? 255  ASN A C     1 
ATOM   2751 O  O     . ASN C 3 255 ? -4.316  56.861 53.568  1.00 95.84  ? 255  ASN A O     1 
ATOM   2752 C  CB    . ASN C 3 255 ? -3.748  54.810 51.112  1.00 95.84  ? 255  ASN A CB    1 
ATOM   2753 C  CG    . ASN C 3 255 ? -5.069  54.636 50.398  1.00 95.93  ? 255  ASN A CG    1 
ATOM   2754 O  OD1   . ASN C 3 255 ? -5.226  55.054 49.250  1.00 95.81  ? 255  ASN A OD1   1 
ATOM   2755 N  ND2   . ASN C 3 255 ? -6.032  54.014 51.075  1.00 95.83  ? 255  ASN A ND2   1 
ATOM   2756 N  N     . MET C 3 256 ? -5.530  57.438 51.744  1.00 96.05  ? 256  MET A N     1 
ATOM   2757 C  CA    . MET C 3 256 ? -6.607  58.124 52.475  1.00 96.08  ? 256  MET A CA    1 
ATOM   2758 C  C     . MET C 3 256 ? -7.146  57.385 53.714  1.00 95.86  ? 256  MET A C     1 
ATOM   2759 O  O     . MET C 3 256 ? -7.729  58.018 54.601  1.00 95.89  ? 256  MET A O     1 
ATOM   2760 C  CB    . MET C 3 256 ? -7.745  58.488 51.511  1.00 96.20  ? 256  MET A CB    1 
ATOM   2761 C  CG    . MET C 3 256 ? -7.361  59.557 50.480  1.00 96.99  ? 256  MET A CG    1 
ATOM   2762 S  SD    . MET C 3 256 ? -7.653  61.260 51.038  1.00 98.95  ? 256  MET A SD    1 
ATOM   2763 C  CE    . MET C 3 256 ? -9.378  61.491 50.577  1.00 98.25  ? 256  MET A CE    1 
ATOM   2764 N  N     . TYR C 3 257 ? -6.944  56.063 53.768  1.00 95.56  ? 257  TYR A N     1 
ATOM   2765 C  CA    . TYR C 3 257 ? -7.310  55.245 54.939  1.00 95.12  ? 257  TYR A CA    1 
ATOM   2766 C  C     . TYR C 3 257 ? -6.119  54.991 55.879  1.00 94.52  ? 257  TYR A C     1 
ATOM   2767 O  O     . TYR C 3 257 ? -5.947  55.717 56.861  1.00 94.67  ? 257  TYR A O     1 
ATOM   2768 C  CB    . TYR C 3 257 ? -7.978  53.917 54.526  1.00 95.31  ? 257  TYR A CB    1 
ATOM   2769 C  CG    . TYR C 3 257 ? -9.369  54.056 53.909  1.00 95.65  ? 257  TYR A CG    1 
ATOM   2770 C  CD1   . TYR C 3 257 ? -10.448 54.568 54.648  1.00 95.71  ? 257  TYR A CD1   1 
ATOM   2771 C  CD2   . TYR C 3 257 ? -9.608  53.654 52.588  1.00 95.90  ? 257  TYR A CD2   1 
ATOM   2772 C  CE1   . TYR C 3 257 ? -11.725 54.692 54.076  1.00 95.93  ? 257  TYR A CE1   1 
ATOM   2773 C  CE2   . TYR C 3 257 ? -10.880 53.771 52.009  1.00 96.16  ? 257  TYR A CE2   1 
ATOM   2774 C  CZ    . TYR C 3 257 ? -11.930 54.290 52.756  1.00 95.86  ? 257  TYR A CZ    1 
ATOM   2775 O  OH    . TYR C 3 257 ? -13.174 54.399 52.176  1.00 95.19  ? 257  TYR A OH    1 
ATOM   2776 N  N     . GLY C 3 258 ? -5.302  53.978 55.575  1.00 93.75  ? 258  GLY A N     1 
ATOM   2777 C  CA    . GLY C 3 258 ? -4.156  53.616 56.425  1.00 92.45  ? 258  GLY A CA    1 
ATOM   2778 C  C     . GLY C 3 258 ? -2.778  53.833 55.808  1.00 91.56  ? 258  GLY A C     1 
ATOM   2779 O  O     . GLY C 3 258 ? -2.659  54.246 54.646  1.00 91.58  ? 258  GLY A O     1 
ATOM   2780 N  N     . SER C 3 259 ? -1.741  53.543 56.600  1.00 90.36  ? 259  SER A N     1 
ATOM   2781 C  CA    . SER C 3 259 ? -0.335  53.662 56.181  1.00 89.12  ? 259  SER A CA    1 
ATOM   2782 C  C     . SER C 3 259 ? 0.107   52.691 55.081  1.00 88.08  ? 259  SER A C     1 
ATOM   2783 O  O     . SER C 3 259 ? -0.557  51.680 54.817  1.00 87.92  ? 259  SER A O     1 
ATOM   2784 C  CB    . SER C 3 259 ? 0.601   53.518 57.385  1.00 89.34  ? 259  SER A CB    1 
ATOM   2785 O  OG    . SER C 3 259 ? 1.037   54.784 57.844  1.00 89.47  ? 259  SER A OG    1 
ATOM   2786 N  N     . ARG C 3 260 ? 1.240   53.023 54.454  1.00 86.66  ? 260  ARG A N     1 
ATOM   2787 C  CA    . ARG C 3 260 ? 1.847   52.250 53.360  1.00 85.30  ? 260  ARG A CA    1 
ATOM   2788 C  C     . ARG C 3 260 ? 3.283   52.746 53.114  1.00 83.71  ? 260  ARG A C     1 
ATOM   2789 O  O     . ARG C 3 260 ? 3.499   53.931 52.849  1.00 83.87  ? 260  ARG A O     1 
ATOM   2790 C  CB    . ARG C 3 260 ? 1.001   52.352 52.075  1.00 85.46  ? 260  ARG A CB    1 
ATOM   2791 C  CG    . ARG C 3 260 ? 1.620   51.685 50.850  1.00 86.20  ? 260  ARG A CG    1 
ATOM   2792 C  CD    . ARG C 3 260 ? 0.854   51.988 49.564  1.00 86.89  ? 260  ARG A CD    1 
ATOM   2793 N  NE    . ARG C 3 260 ? 1.749   52.013 48.403  1.00 89.23  ? 260  ARG A NE    1 
ATOM   2794 C  CZ    . ARG C 3 260 ? 2.140   50.938 47.713  1.00 90.61  ? 260  ARG A CZ    1 
ATOM   2795 N  NH1   . ARG C 3 260 ? 1.720   49.721 48.047  1.00 90.72  ? 260  ARG A NH1   1 
ATOM   2796 N  NH2   . ARG C 3 260 ? 2.959   51.082 46.678  1.00 91.50  ? 260  ARG A NH2   1 
ATOM   2797 N  N     . GLU C 3 261 ? 4.255   51.837 53.191  1.00 81.76  ? 261  GLU A N     1 
ATOM   2798 C  CA    . GLU C 3 261 ? 5.674   52.212 53.118  1.00 79.73  ? 261  GLU A CA    1 
ATOM   2799 C  C     . GLU C 3 261 ? 6.441   51.576 51.960  1.00 77.95  ? 261  GLU A C     1 
ATOM   2800 O  O     . GLU C 3 261 ? 6.207   50.414 51.614  1.00 77.95  ? 261  GLU A O     1 
ATOM   2801 C  CB    . GLU C 3 261 ? 6.376   51.889 54.439  1.00 80.00  ? 261  GLU A CB    1 
ATOM   2802 C  CG    . GLU C 3 261 ? 6.054   52.849 55.574  1.00 80.26  ? 261  GLU A CG    1 
ATOM   2803 C  CD    . GLU C 3 261 ? 7.137   52.871 56.627  1.00 81.06  ? 261  GLU A CD    1 
ATOM   2804 O  OE1   . GLU C 3 261 ? 8.047   52.019 56.550  1.00 81.29  ? 261  GLU A OE1   1 
ATOM   2805 O  OE2   . GLU C 3 261 ? 7.086   53.741 57.525  1.00 81.69  ? 261  GLU A OE2   1 
ATOM   2806 N  N     . ILE C 3 262 ? 7.361   52.348 51.376  1.00 75.54  ? 262  ILE A N     1 
ATOM   2807 C  CA    . ILE C 3 262 ? 8.222   51.881 50.274  1.00 73.30  ? 262  ILE A CA    1 
ATOM   2808 C  C     . ILE C 3 262 ? 9.718   52.131 50.560  1.00 71.36  ? 262  ILE A C     1 
ATOM   2809 O  O     . ILE C 3 262 ? 10.170  53.278 50.597  1.00 71.09  ? 262  ILE A O     1 
ATOM   2810 C  CB    . ILE C 3 262 ? 7.805   52.523 48.909  1.00 73.46  ? 262  ILE A CB    1 
ATOM   2811 C  CG1   . ILE C 3 262 ? 6.328   52.214 48.565  1.00 73.68  ? 262  ILE A CG1   1 
ATOM   2812 C  CG2   . ILE C 3 262 ? 8.788   52.143 47.775  1.00 73.73  ? 262  ILE A CG2   1 
ATOM   2813 C  CD1   . ILE C 3 262 ? 5.920   50.717 48.527  1.00 73.58  ? 262  ILE A CD1   1 
ATOM   2814 N  N     . ILE C 3 263 ? 10.478  51.054 50.754  1.00 68.92  ? 263  ILE A N     1 
ATOM   2815 C  CA    . ILE C 3 263 ? 11.890  51.160 51.136  1.00 66.57  ? 263  ILE A CA    1 
ATOM   2816 C  C     . ILE C 3 263 ? 12.816  51.060 49.916  1.00 65.40  ? 263  ILE A C     1 
ATOM   2817 O  O     . ILE C 3 263 ? 12.683  50.149 49.109  1.00 65.23  ? 263  ILE A O     1 
ATOM   2818 C  CB    . ILE C 3 263 ? 12.280  50.122 52.249  1.00 66.27  ? 263  ILE A CB    1 
ATOM   2819 C  CG1   . ILE C 3 263 ? 11.885  50.613 53.645  1.00 64.96  ? 263  ILE A CG1   1 
ATOM   2820 C  CG2   . ILE C 3 263 ? 13.775  49.901 52.293  1.00 66.34  ? 263  ILE A CG2   1 
ATOM   2821 C  CD1   . ILE C 3 263 ? 10.478  50.333 54.070  1.00 63.16  ? 263  ILE A CD1   1 
ATOM   2822 N  N     . THR C 3 264 ? 13.735  52.015 49.783  1.00 63.93  ? 264  THR A N     1 
ATOM   2823 C  CA    . THR C 3 264 ? 14.759  51.982 48.739  1.00 62.72  ? 264  THR A CA    1 
ATOM   2824 C  C     . THR C 3 264 ? 16.085  51.506 49.321  1.00 62.34  ? 264  THR A C     1 
ATOM   2825 O  O     . THR C 3 264 ? 16.656  52.162 50.203  1.00 62.54  ? 264  THR A O     1 
ATOM   2826 C  CB    . THR C 3 264 ? 14.996  53.377 48.138  1.00 62.60  ? 264  THR A CB    1 
ATOM   2827 O  OG1   . THR C 3 264 ? 13.738  53.998 47.868  1.00 62.61  ? 264  THR A OG1   1 
ATOM   2828 C  CG2   . THR C 3 264 ? 15.822  53.296 46.859  1.00 61.06  ? 264  THR A CG2   1 
ATOM   2829 N  N     . LEU C 3 265 ? 16.578  50.371 48.829  1.00 61.29  ? 265  LEU A N     1 
ATOM   2830 C  CA    . LEU C 3 265 ? 17.878  49.860 49.248  1.00 60.07  ? 265  LEU A CA    1 
ATOM   2831 C  C     . LEU C 3 265 ? 18.941  50.258 48.228  1.00 59.50  ? 265  LEU A C     1 
ATOM   2832 O  O     . LEU C 3 265 ? 19.016  49.701 47.133  1.00 59.73  ? 265  LEU A O     1 
ATOM   2833 C  CB    . LEU C 3 265 ? 17.834  48.344 49.465  1.00 59.74  ? 265  LEU A CB    1 
ATOM   2834 C  CG    . LEU C 3 265 ? 16.840  47.837 50.520  1.00 59.59  ? 265  LEU A CG    1 
ATOM   2835 C  CD1   . LEU C 3 265 ? 16.582  46.338 50.373  1.00 58.66  ? 265  LEU A CD1   1 
ATOM   2836 C  CD2   . LEU C 3 265 ? 17.295  48.161 51.939  1.00 59.41  ? 265  LEU A CD2   1 
ATOM   2837 N  N     . PHE C 3 266 ? 19.747  51.250 48.579  1.00 58.74  ? 266  PHE A N     1 
ATOM   2838 C  CA    . PHE C 3 266 ? 20.817  51.692 47.693  1.00 58.11  ? 266  PHE A CA    1 
ATOM   2839 C  C     . PHE C 3 266 ? 21.808  50.557 47.560  1.00 57.01  ? 266  PHE A C     1 
ATOM   2840 O  O     . PHE C 3 266 ? 22.112  49.880 48.546  1.00 56.61  ? 266  PHE A O     1 
ATOM   2841 C  CB    . PHE C 3 266 ? 21.496  52.975 48.214  1.00 58.65  ? 266  PHE A CB    1 
ATOM   2842 C  CG    . PHE C 3 266 ? 20.677  54.239 48.004  1.00 58.96  ? 266  PHE A CG    1 
ATOM   2843 C  CD1   . PHE C 3 266 ? 19.505  54.456 48.709  1.00 58.57  ? 266  PHE A CD1   1 
ATOM   2844 C  CD2   . PHE C 3 266 ? 21.094  55.210 47.099  1.00 60.71  ? 266  PHE A CD2   1 
ATOM   2845 C  CE1   . PHE C 3 266 ? 18.755  55.609 48.518  1.00 58.93  ? 266  PHE A CE1   1 
ATOM   2846 C  CE2   . PHE C 3 266 ? 20.346  56.376 46.905  1.00 60.77  ? 266  PHE A CE2   1 
ATOM   2847 C  CZ    . PHE C 3 266 ? 19.173  56.568 47.623  1.00 59.46  ? 266  PHE A CZ    1 
ATOM   2848 N  N     . GLY C 3 267 ? 22.268  50.336 46.331  1.00 55.98  ? 267  GLY A N     1 
ATOM   2849 C  CA    . GLY C 3 267 ? 23.181  49.238 46.016  1.00 54.81  ? 267  GLY A CA    1 
ATOM   2850 C  C     . GLY C 3 267 ? 22.515  47.936 45.584  1.00 54.12  ? 267  GLY A C     1 
ATOM   2851 O  O     . GLY C 3 267 ? 23.199  46.940 45.331  1.00 53.94  ? 267  GLY A O     1 
ATOM   2852 N  N     . ILE C 3 268 ? 21.185  47.934 45.500  1.00 53.14  ? 268  ILE A N     1 
ATOM   2853 C  CA    . ILE C 3 268 ? 20.443  46.738 45.100  1.00 52.23  ? 268  ILE A CA    1 
ATOM   2854 C  C     . ILE C 3 268 ? 19.365  47.077 44.070  1.00 51.32  ? 268  ILE A C     1 
ATOM   2855 O  O     . ILE C 3 268 ? 18.601  48.023 44.268  1.00 51.23  ? 268  ILE A O     1 
ATOM   2856 C  CB    . ILE C 3 268 ? 19.794  46.029 46.330  1.00 52.47  ? 268  ILE A CB    1 
ATOM   2857 C  CG1   . ILE C 3 268 ? 20.885  45.549 47.306  1.00 52.32  ? 268  ILE A CG1   1 
ATOM   2858 C  CG2   . ILE C 3 268 ? 18.879  44.869 45.879  1.00 51.62  ? 268  ILE A CG2   1 
ATOM   2859 C  CD1   . ILE C 3 268 ? 20.368  45.060 48.658  1.00 52.13  ? 268  ILE A CD1   1 
ATOM   2860 N  N     . SER C 3 269 ? 19.327  46.314 42.977  1.00 49.92  ? 269  SER A N     1 
ATOM   2861 C  CA    . SER C 3 269 ? 18.243  46.407 41.994  1.00 48.93  ? 269  SER A CA    1 
ATOM   2862 C  C     . SER C 3 269 ? 17.067  45.509 42.344  1.00 47.93  ? 269  SER A C     1 
ATOM   2863 O  O     . SER C 3 269 ? 17.022  44.361 41.918  1.00 47.53  ? 269  SER A O     1 
ATOM   2864 C  CB    . SER C 3 269 ? 18.738  46.053 40.594  1.00 48.97  ? 269  SER A CB    1 
ATOM   2865 O  OG    . SER C 3 269 ? 19.519  47.101 40.048  1.00 50.14  ? 269  SER A OG    1 
ATOM   2866 N  N     . VAL C 3 270 ? 16.130  46.036 43.132  1.00 47.04  ? 270  VAL A N     1 
ATOM   2867 C  CA    . VAL C 3 270 ? 14.854  45.368 43.382  1.00 46.49  ? 270  VAL A CA    1 
ATOM   2868 C  C     . VAL C 3 270 ? 13.978  45.314 42.119  1.00 46.28  ? 270  VAL A C     1 
ATOM   2869 O  O     . VAL C 3 270 ? 13.562  46.343 41.589  1.00 46.69  ? 270  VAL A O     1 
ATOM   2870 C  CB    . VAL C 3 270 ? 14.060  46.039 44.543  1.00 46.49  ? 270  VAL A CB    1 
ATOM   2871 C  CG1   . VAL C 3 270 ? 12.638  45.468 44.653  1.00 45.48  ? 270  VAL A CG1   1 
ATOM   2872 C  CG2   . VAL C 3 270 ? 14.784  45.858 45.852  1.00 46.41  ? 270  VAL A CG2   1 
ATOM   2873 N  N     . LEU C 3 271 ? 13.707  44.107 41.644  1.00 45.94  ? 271  LEU A N     1 
ATOM   2874 C  CA    . LEU C 3 271 ? 12.720  43.893 40.596  1.00 45.87  ? 271  LEU A CA    1 
ATOM   2875 C  C     . LEU C 3 271 ? 11.634  42.948 41.112  1.00 45.88  ? 271  LEU A C     1 
ATOM   2876 O  O     . LEU C 3 271 ? 11.760  41.726 40.948  1.00 45.55  ? 271  LEU A O     1 
ATOM   2877 C  CB    . LEU C 3 271 ? 13.373  43.256 39.377  1.00 45.55  ? 271  LEU A CB    1 
ATOM   2878 C  CG    . LEU C 3 271 ? 14.405  44.024 38.569  1.00 45.88  ? 271  LEU A CG    1 
ATOM   2879 C  CD1   . LEU C 3 271 ? 15.091  43.029 37.646  1.00 46.99  ? 271  LEU A CD1   1 
ATOM   2880 C  CD2   . LEU C 3 271 ? 13.764  45.124 37.765  1.00 44.76  ? 271  LEU A CD2   1 
ATOM   2881 N  N     . ASP C 3 272 ? 10.585  43.507 41.730  1.00 45.85  ? 272  ASP A N     1 
ATOM   2882 C  CA    . ASP C 3 272 ? 9.464   42.718 42.268  1.00 46.19  ? 272  ASP A CA    1 
ATOM   2883 C  C     . ASP C 3 272 ? 8.812   41.918 41.127  1.00 46.18  ? 272  ASP A C     1 
ATOM   2884 O  O     . ASP C 3 272 ? 8.613   42.460 40.030  1.00 46.54  ? 272  ASP A O     1 
ATOM   2885 C  CB    . ASP C 3 272 ? 8.453   43.635 42.958  1.00 46.25  ? 272  ASP A CB    1 
ATOM   2886 C  CG    . ASP C 3 272 ? 7.289   42.872 43.580  1.00 47.93  ? 272  ASP A CG    1 
ATOM   2887 O  OD1   . ASP C 3 272 ? 6.845   41.854 42.994  1.00 49.33  ? 272  ASP A OD1   1 
ATOM   2888 O  OD2   . ASP C 3 272 ? 6.806   43.295 44.657  1.00 48.69  ? 272  ASP A OD2   1 
ATOM   2889 N  N     . TYR C 3 273 ? 8.517   40.636 41.351  1.00 45.67  ? 273  TYR A N     1 
ATOM   2890 C  CA    . TYR C 3 273 ? 8.069   39.801 40.230  1.00 45.62  ? 273  TYR A CA    1 
ATOM   2891 C  C     . TYR C 3 273 ? 6.648   40.113 39.802  1.00 45.78  ? 273  TYR A C     1 
ATOM   2892 O  O     . TYR C 3 273 ? 6.288   39.887 38.644  1.00 45.61  ? 273  TYR A O     1 
ATOM   2893 C  CB    . TYR C 3 273 ? 8.253   38.290 40.446  1.00 45.42  ? 273  TYR A CB    1 
ATOM   2894 C  CG    . TYR C 3 273 ? 8.504   37.612 39.111  1.00 45.70  ? 273  TYR A CG    1 
ATOM   2895 C  CD1   . TYR C 3 273 ? 9.790   37.567 38.571  1.00 45.57  ? 273  TYR A CD1   1 
ATOM   2896 C  CD2   . TYR C 3 273 ? 7.453   37.077 38.348  1.00 45.53  ? 273  TYR A CD2   1 
ATOM   2897 C  CE1   . TYR C 3 273 ? 10.031  36.986 37.334  1.00 45.58  ? 273  TYR A CE1   1 
ATOM   2898 C  CE2   . TYR C 3 273 ? 7.688   36.495 37.098  1.00 44.35  ? 273  TYR A CE2   1 
ATOM   2899 C  CZ    . TYR C 3 273 ? 8.983   36.453 36.608  1.00 45.37  ? 273  TYR A CZ    1 
ATOM   2900 O  OH    . TYR C 3 273 ? 9.260   35.884 35.392  1.00 46.18  ? 273  TYR A OH    1 
ATOM   2901 N  N     . ILE C 3 274 ? 5.855   40.638 40.737  1.00 45.75  ? 274  ILE A N     1 
ATOM   2902 C  CA    . ILE C 3 274 ? 4.510   41.101 40.448  1.00 45.91  ? 274  ILE A CA    1 
ATOM   2903 C  C     . ILE C 3 274 ? 4.533   42.226 39.405  1.00 45.99  ? 274  ILE A C     1 
ATOM   2904 O  O     . ILE C 3 274 ? 3.690   42.269 38.521  1.00 46.40  ? 274  ILE A O     1 
ATOM   2905 C  CB    . ILE C 3 274 ? 3.820   41.592 41.732  1.00 46.01  ? 274  ILE A CB    1 
ATOM   2906 C  CG1   . ILE C 3 274 ? 2.315   41.368 41.675  1.00 45.80  ? 274  ILE A CG1   1 
ATOM   2907 C  CG2   . ILE C 3 274 ? 4.135   43.061 42.006  1.00 46.98  ? 274  ILE A CG2   1 
ATOM   2908 C  CD1   . ILE C 3 274 ? 1.750   40.952 43.039  1.00 46.58  ? 274  ILE A CD1   1 
ATOM   2909 N  N     . ASP C 3 275 ? 5.509   43.122 39.495  1.00 45.67  ? 275  ASP A N     1 
ATOM   2910 C  CA    . ASP C 3 275 ? 5.552   44.264 38.600  1.00 45.74  ? 275  ASP A CA    1 
ATOM   2911 C  C     . ASP C 3 275 ? 6.091   43.881 37.236  1.00 45.49  ? 275  ASP A C     1 
ATOM   2912 O  O     . ASP C 3 275 ? 5.687   44.463 36.203  1.00 45.91  ? 275  ASP A O     1 
ATOM   2913 C  CB    . ASP C 3 275 ? 6.418   45.372 39.190  1.00 46.08  ? 275  ASP A CB    1 
ATOM   2914 C  CG    . ASP C 3 275 ? 5.771   46.056 40.372  1.00 47.61  ? 275  ASP A CG    1 
ATOM   2915 O  OD1   . ASP C 3 275 ? 4.517   45.984 40.528  1.00 50.07  ? 275  ASP A OD1   1 
ATOM   2916 O  OD2   . ASP C 3 275 ? 6.533   46.673 41.142  1.00 47.71  ? 275  ASP A OD2   1 
ATOM   2917 N  N     . LEU C 3 276 ? 7.015   42.919 37.242  1.00 44.43  ? 276  LEU A N     1 
ATOM   2918 C  CA    . LEU C 3 276 ? 7.624   42.425 36.024  1.00 43.60  ? 276  LEU A CA    1 
ATOM   2919 C  C     . LEU C 3 276 ? 6.574   41.679 35.248  1.00 43.30  ? 276  LEU A C     1 
ATOM   2920 O  O     . LEU C 3 276 ? 6.631   41.608 34.025  1.00 43.08  ? 276  LEU A O     1 
ATOM   2921 C  CB    . LEU C 3 276 ? 8.759   41.461 36.336  1.00 43.90  ? 276  LEU A CB    1 
ATOM   2922 C  CG    . LEU C 3 276 ? 10.113  41.903 36.898  1.00 42.47  ? 276  LEU A CG    1 
ATOM   2923 C  CD1   . LEU C 3 276 ? 10.844  40.664 37.363  1.00 41.40  ? 276  LEU A CD1   1 
ATOM   2924 C  CD2   . LEU C 3 276 ? 10.920  42.617 35.854  1.00 39.05  ? 276  LEU A CD2   1 
ATOM   2925 N  N     . TYR C 3 277 ? 5.606   41.129 35.970  1.00 43.06  ? 277  TYR A N     1 
ATOM   2926 C  CA    . TYR C 3 277 ? 4.540   40.348 35.343  1.00 42.93  ? 277  TYR A CA    1 
ATOM   2927 C  C     . TYR C 3 277 ? 3.510   41.261 34.699  1.00 42.10  ? 277  TYR A C     1 
ATOM   2928 O  O     . TYR C 3 277 ? 3.098   41.047 33.557  1.00 41.65  ? 277  TYR A O     1 
ATOM   2929 C  CB    . TYR C 3 277 ? 3.868   39.445 36.369  1.00 43.28  ? 277  TYR A CB    1 
ATOM   2930 C  CG    . TYR C 3 277 ? 2.873   38.473 35.779  1.00 44.47  ? 277  TYR A CG    1 
ATOM   2931 C  CD1   . TYR C 3 277 ? 1.525   38.829 35.635  1.00 44.57  ? 277  TYR A CD1   1 
ATOM   2932 C  CD2   . TYR C 3 277 ? 3.271   37.189 35.374  1.00 44.91  ? 277  TYR A CD2   1 
ATOM   2933 C  CE1   . TYR C 3 277 ? 0.597   37.939 35.105  1.00 44.30  ? 277  TYR A CE1   1 
ATOM   2934 C  CE2   . TYR C 3 277 ? 2.342   36.284 34.838  1.00 44.71  ? 277  TYR A CE2   1 
ATOM   2935 C  CZ    . TYR C 3 277 ? 1.007   36.672 34.714  1.00 44.43  ? 277  TYR A CZ    1 
ATOM   2936 O  OH    . TYR C 3 277 ? 0.080   35.809 34.196  1.00 43.89  ? 277  TYR A OH    1 
ATOM   2937 N  N     . LYS C 3 278 ? 3.103   42.280 35.445  1.00 41.49  ? 278  LYS A N     1 
ATOM   2938 C  CA    . LYS C 3 278 ? 2.140   43.254 34.954  1.00 40.73  ? 278  LYS A CA    1 
ATOM   2939 C  C     . LYS C 3 278 ? 2.670   43.894 33.678  1.00 41.00  ? 278  LYS A C     1 
ATOM   2940 O  O     . LYS C 3 278 ? 1.968   43.959 32.676  1.00 40.54  ? 278  LYS A O     1 
ATOM   2941 C  CB    . LYS C 3 278 ? 1.824   44.287 36.037  1.00 40.00  ? 278  LYS A CB    1 
ATOM   2942 C  CG    . LYS C 3 278 ? 1.012   43.719 37.193  1.00 37.68  ? 278  LYS A CG    1 
ATOM   2943 C  CD    . LYS C 3 278 ? 0.420   44.817 38.019  1.00 36.21  ? 278  LYS A CD    1 
ATOM   2944 C  CE    . LYS C 3 278 ? 0.322   44.443 39.481  1.00 36.41  ? 278  LYS A CE    1 
ATOM   2945 N  NZ    . LYS C 3 278 ? -1.066  44.117 39.882  1.00 37.65  ? 278  LYS A NZ    1 
ATOM   2946 N  N     . LYS C 3 279 ? 3.939   44.302 33.701  1.00 42.05  ? 279  LYS A N     1 
ATOM   2947 C  CA    . LYS C 3 279 ? 4.543   44.953 32.536  1.00 42.29  ? 279  LYS A CA    1 
ATOM   2948 C  C     . LYS C 3 279 ? 4.733   44.011 31.380  1.00 42.13  ? 279  LYS A C     1 
ATOM   2949 O  O     . LYS C 3 279 ? 4.307   44.302 30.288  1.00 41.94  ? 279  LYS A O     1 
ATOM   2950 C  CB    . LYS C 3 279 ? 5.884   45.616 32.862  1.00 42.24  ? 279  LYS A CB    1 
ATOM   2951 C  CG    . LYS C 3 279 ? 6.004   46.978 32.183  1.00 43.17  ? 279  LYS A CG    1 
ATOM   2952 C  CD    . LYS C 3 279 ? 7.352   47.230 31.504  1.00 44.60  ? 279  LYS A CD    1 
ATOM   2953 C  CE    . LYS C 3 279 ? 7.450   48.684 31.048  1.00 44.53  ? 279  LYS A CE    1 
ATOM   2954 N  NZ    . LYS C 3 279 ? 6.100   49.244 30.652  1.00 45.86  ? 279  LYS A NZ    1 
ATOM   2955 N  N     . PHE C 3 280 ? 5.364   42.872 31.622  1.00 42.55  ? 280  PHE A N     1 
ATOM   2956 C  CA    . PHE C 3 280 ? 5.834   42.080 30.507  1.00 43.16  ? 280  PHE A CA    1 
ATOM   2957 C  C     . PHE C 3 280 ? 4.939   40.945 30.049  1.00 43.51  ? 280  PHE A C     1 
ATOM   2958 O  O     . PHE C 3 280 ? 5.160   40.416 28.956  1.00 43.59  ? 280  PHE A O     1 
ATOM   2959 C  CB    . PHE C 3 280 ? 7.253   41.569 30.765  1.00 43.60  ? 280  PHE A CB    1 
ATOM   2960 C  CG    . PHE C 3 280 ? 8.257   42.653 31.052  1.00 43.40  ? 280  PHE A CG    1 
ATOM   2961 C  CD1   . PHE C 3 280 ? 8.413   43.727 30.188  1.00 44.36  ? 280  PHE A CD1   1 
ATOM   2962 C  CD2   . PHE C 3 280 ? 9.067   42.579 32.177  1.00 44.32  ? 280  PHE A CD2   1 
ATOM   2963 C  CE1   . PHE C 3 280 ? 9.346   44.726 30.453  1.00 45.89  ? 280  PHE A CE1   1 
ATOM   2964 C  CE2   . PHE C 3 280 ? 10.010  43.570 32.459  1.00 44.48  ? 280  PHE A CE2   1 
ATOM   2965 C  CZ    . PHE C 3 280 ? 10.149  44.647 31.595  1.00 45.39  ? 280  PHE A CZ    1 
ATOM   2966 N  N     . SER C 3 281 ? 3.934   40.574 30.850  1.00 43.79  ? 281  SER A N     1 
ATOM   2967 C  CA    . SER C 3 281 ? 3.171   39.345 30.580  1.00 44.01  ? 281  SER A CA    1 
ATOM   2968 C  C     . SER C 3 281 ? 2.111   39.477 29.505  1.00 44.39  ? 281  SER A C     1 
ATOM   2969 O  O     . SER C 3 281 ? 1.758   38.487 28.876  1.00 44.43  ? 281  SER A O     1 
ATOM   2970 C  CB    . SER C 3 281 ? 2.551   38.751 31.853  1.00 44.16  ? 281  SER A CB    1 
ATOM   2971 O  OG    . SER C 3 281 ? 1.443   39.510 32.310  1.00 43.41  ? 281  SER A OG    1 
ATOM   2972 N  N     . PHE C 3 282 ? 1.608   40.686 29.289  1.00 45.06  ? 282  PHE A N     1 
ATOM   2973 C  CA    . PHE C 3 282 ? 0.481   40.899 28.357  1.00 45.91  ? 282  PHE A CA    1 
ATOM   2974 C  C     . PHE C 3 282 ? -0.764  40.099 28.742  1.00 45.83  ? 282  PHE A C     1 
ATOM   2975 O  O     . PHE C 3 282 ? -1.317  39.346 27.939  1.00 46.32  ? 282  PHE A O     1 
ATOM   2976 C  CB    . PHE C 3 282 ? 0.901   40.637 26.908  1.00 46.01  ? 282  PHE A CB    1 
ATOM   2977 C  CG    . PHE C 3 282 ? 1.633   41.778 26.303  1.00 47.84  ? 282  PHE A CG    1 
ATOM   2978 C  CD1   . PHE C 3 282 ? 3.013   41.929 26.508  1.00 49.61  ? 282  PHE A CD1   1 
ATOM   2979 C  CD2   . PHE C 3 282 ? 0.942   42.751 25.566  1.00 48.59  ? 282  PHE A CD2   1 
ATOM   2980 C  CE1   . PHE C 3 282 ? 3.698   43.026 25.954  1.00 49.76  ? 282  PHE A CE1   1 
ATOM   2981 C  CE2   . PHE C 3 282 ? 1.604   43.842 25.008  1.00 48.22  ? 282  PHE A CE2   1 
ATOM   2982 C  CZ    . PHE C 3 282 ? 2.982   43.989 25.202  1.00 49.30  ? 282  PHE A CZ    1 
ATOM   2983 N  N     . THR C 3 283 ? -1.159  40.252 29.998  1.00 45.61  ? 283  THR A N     1 
ATOM   2984 C  CA    . THR C 3 283 ? -2.360  39.659 30.544  1.00 45.69  ? 283  THR A CA    1 
ATOM   2985 C  C     . THR C 3 283 ? -2.983  40.733 31.399  1.00 45.50  ? 283  THR A C     1 
ATOM   2986 O  O     . THR C 3 283 ? -2.278  41.626 31.868  1.00 46.16  ? 283  THR A O     1 
ATOM   2987 C  CB    . THR C 3 283 ? -2.042  38.467 31.480  1.00 45.98  ? 283  THR A CB    1 
ATOM   2988 O  OG1   . THR C 3 283 ? -0.977  38.821 32.378  1.00 46.02  ? 283  THR A OG1   1 
ATOM   2989 C  CG2   . THR C 3 283 ? -1.661  37.221 30.688  1.00 46.20  ? 283  THR A CG2   1 
ATOM   2990 N  N     . ASN C 3 284 ? -4.293  40.669 31.601  1.00 45.16  ? 284  ASN A N     1 
ATOM   2991 C  CA    . ASN C 3 284 ? -4.925  41.429 32.685  1.00 44.66  ? 284  ASN A CA    1 
ATOM   2992 C  C     . ASN C 3 284 ? -5.708  40.423 33.510  1.00 44.60  ? 284  ASN A C     1 
ATOM   2993 O  O     . ASN C 3 284 ? -6.749  39.940 33.070  1.00 45.03  ? 284  ASN A O     1 
ATOM   2994 C  CB    . ASN C 3 284 ? -5.820  42.545 32.151  1.00 43.98  ? 284  ASN A CB    1 
ATOM   2995 C  CG    . ASN C 3 284 ? -6.242  43.511 33.230  1.00 44.26  ? 284  ASN A CG    1 
ATOM   2996 O  OD1   . ASN C 3 284 ? -6.066  43.254 34.421  1.00 44.98  ? 284  ASN A OD1   1 
ATOM   2997 N  ND2   . ASN C 3 284 ? -6.803  44.636 32.824  1.00 43.69  ? 284  ASN A ND2   1 
ATOM   2998 N  N     . GLN C 3 285 ? -5.190  40.087 34.688  1.00 44.23  ? 285  GLN A N     1 
ATOM   2999 C  CA    . GLN C 3 285 ? -5.726  38.977 35.463  1.00 44.29  ? 285  GLN A CA    1 
ATOM   3000 C  C     . GLN C 3 285 ? -6.863  39.374 36.410  1.00 44.33  ? 285  GLN A C     1 
ATOM   3001 O  O     . GLN C 3 285 ? -6.920  40.515 36.873  1.00 44.09  ? 285  GLN A O     1 
ATOM   3002 C  CB    . GLN C 3 285 ? -4.614  38.257 36.239  1.00 44.24  ? 285  GLN A CB    1 
ATOM   3003 C  CG    . GLN C 3 285 ? -3.525  37.635 35.359  1.00 44.91  ? 285  GLN A CG    1 
ATOM   3004 C  CD    . GLN C 3 285 ? -3.983  36.413 34.556  1.00 45.28  ? 285  GLN A CD    1 
ATOM   3005 O  OE1   . GLN C 3 285 ? -5.029  35.806 34.839  1.00 45.04  ? 285  GLN A OE1   1 
ATOM   3006 N  NE2   . GLN C 3 285 ? -3.187  36.043 33.552  1.00 44.20  ? 285  GLN A NE2   1 
ATOM   3007 N  N     . PRO C 3 286 ? -7.785  38.428 36.687  1.00 44.22  ? 286  PRO A N     1 
ATOM   3008 C  CA    . PRO C 3 286 ? -8.827  38.586 37.693  1.00 44.27  ? 286  PRO A CA    1 
ATOM   3009 C  C     . PRO C 3 286 ? -8.250  38.840 39.070  1.00 44.12  ? 286  PRO A C     1 
ATOM   3010 O  O     . PRO C 3 286 ? -8.887  39.470 39.903  1.00 43.78  ? 286  PRO A O     1 
ATOM   3011 C  CB    . PRO C 3 286 ? -9.512  37.221 37.695  1.00 44.17  ? 286  PRO A CB    1 
ATOM   3012 C  CG    . PRO C 3 286 ? -9.252  36.675 36.382  1.00 44.19  ? 286  PRO A CG    1 
ATOM   3013 C  CD    . PRO C 3 286 ? -7.901  37.135 35.999  1.00 44.17  ? 286  PRO A CD    1 
ATOM   3014 N  N     . SER C 3 287 ? -7.050  38.334 39.303  1.00 44.56  ? 287  SER A N     1 
ATOM   3015 C  CA    . SER C 3 287 ? -6.387  38.497 40.582  1.00 45.00  ? 287  SER A CA    1 
ATOM   3016 C  C     . SER C 3 287 ? -4.893  38.246 40.477  1.00 44.99  ? 287  SER A C     1 
ATOM   3017 O  O     . SER C 3 287 ? -4.427  37.528 39.597  1.00 44.65  ? 287  SER A O     1 
ATOM   3018 C  CB    . SER C 3 287 ? -6.990  37.538 41.576  1.00 44.83  ? 287  SER A CB    1 
ATOM   3019 O  OG    . SER C 3 287 ? -5.980  37.050 42.418  1.00 47.24  ? 287  SER A OG    1 
ATOM   3020 N  N     . TYR C 3 288 ? -4.142  38.830 41.396  1.00 45.84  ? 288  TYR A N     1 
ATOM   3021 C  CA    . TYR C 3 288 ? -2.684  38.719 41.361  1.00 46.28  ? 288  TYR A CA    1 
ATOM   3022 C  C     . TYR C 3 288 ? -2.129  38.152 42.653  1.00 46.82  ? 288  TYR A C     1 
ATOM   3023 O  O     . TYR C 3 288 ? -1.153  38.663 43.200  1.00 46.91  ? 288  TYR A O     1 
ATOM   3024 C  CB    . TYR C 3 288 ? -2.045  40.072 41.041  1.00 45.88  ? 288  TYR A CB    1 
ATOM   3025 C  CG    . TYR C 3 288 ? -2.288  40.533 39.619  1.00 45.59  ? 288  TYR A CG    1 
ATOM   3026 C  CD1   . TYR C 3 288 ? -3.416  41.294 39.291  1.00 44.79  ? 288  TYR A CD1   1 
ATOM   3027 C  CD2   . TYR C 3 288 ? -1.399  40.196 38.597  1.00 44.83  ? 288  TYR A CD2   1 
ATOM   3028 C  CE1   . TYR C 3 288 ? -3.637  41.724 37.995  1.00 44.39  ? 288  TYR A CE1   1 
ATOM   3029 C  CE2   . TYR C 3 288 ? -1.624  40.613 37.291  1.00 45.62  ? 288  TYR A CE2   1 
ATOM   3030 C  CZ    . TYR C 3 288 ? -2.742  41.387 36.997  1.00 44.78  ? 288  TYR A CZ    1 
ATOM   3031 O  OH    . TYR C 3 288 ? -2.957  41.813 35.698  1.00 44.83  ? 288  TYR A OH    1 
ATOM   3032 N  N     . SER C 3 289 ? -2.782  37.103 43.145  1.00 47.39  ? 289  SER A N     1 
ATOM   3033 C  CA    . SER C 3 289 ? -2.228  36.290 44.213  1.00 47.80  ? 289  SER A CA    1 
ATOM   3034 C  C     . SER C 3 289 ? -1.421  35.166 43.565  1.00 47.49  ? 289  SER A C     1 
ATOM   3035 O  O     . SER C 3 289 ? -1.896  34.505 42.644  1.00 47.29  ? 289  SER A O     1 
ATOM   3036 C  CB    . SER C 3 289 ? -3.340  35.716 45.094  1.00 47.76  ? 289  SER A CB    1 
ATOM   3037 O  OG    . SER C 3 289 ? -3.774  34.470 44.581  1.00 49.21  ? 289  SER A OG    1 
ATOM   3038 N  N     . LEU C 3 290 ? -0.200  34.968 44.051  1.00 47.66  ? 290  LEU A N     1 
ATOM   3039 C  CA    . LEU C 3 290 ? 0.715   33.960 43.513  1.00 47.35  ? 290  LEU A CA    1 
ATOM   3040 C  C     . LEU C 3 290 ? -0.040  32.685 43.226  1.00 47.70  ? 290  LEU A C     1 
ATOM   3041 O  O     . LEU C 3 290 ? 0.122   32.085 42.167  1.00 47.44  ? 290  LEU A O     1 
ATOM   3042 C  CB    . LEU C 3 290 ? 1.865   33.681 44.487  1.00 46.84  ? 290  LEU A CB    1 
ATOM   3043 C  CG    . LEU C 3 290 ? 2.911   32.637 44.074  1.00 46.21  ? 290  LEU A CG    1 
ATOM   3044 C  CD1   . LEU C 3 290 ? 3.322   32.754 42.589  1.00 44.62  ? 290  LEU A CD1   1 
ATOM   3045 C  CD2   . LEU C 3 290 ? 4.140   32.683 44.996  1.00 46.22  ? 290  LEU A CD2   1 
ATOM   3046 N  N     . ASP C 3 291 ? -0.879  32.303 44.181  1.00 48.24  ? 291  ASP A N     1 
ATOM   3047 C  CA    . ASP C 3 291 ? -1.706  31.116 44.079  1.00 48.83  ? 291  ASP A CA    1 
ATOM   3048 C  C     . ASP C 3 291 ? -2.493  31.027 42.772  1.00 48.39  ? 291  ASP A C     1 
ATOM   3049 O  O     . ASP C 3 291 ? -2.491  29.986 42.115  1.00 48.85  ? 291  ASP A O     1 
ATOM   3050 C  CB    . ASP C 3 291 ? -2.665  31.075 45.254  1.00 49.40  ? 291  ASP A CB    1 
ATOM   3051 C  CG    . ASP C 3 291 ? -3.094  29.686 45.576  1.00 51.47  ? 291  ASP A CG    1 
ATOM   3052 O  OD1   . ASP C 3 291 ? -2.265  28.764 45.406  1.00 54.11  ? 291  ASP A OD1   1 
ATOM   3053 O  OD2   . ASP C 3 291 ? -4.255  29.509 45.993  1.00 54.74  ? 291  ASP A OD2   1 
ATOM   3054 N  N     . TYR C 3 292 ? -3.153  32.124 42.408  1.00 47.97  ? 292  TYR A N     1 
ATOM   3055 C  CA    . TYR C 3 292 ? -3.906  32.241 41.155  1.00 47.51  ? 292  TYR A CA    1 
ATOM   3056 C  C     . TYR C 3 292 ? -3.008  32.206 39.913  1.00 46.88  ? 292  TYR A C     1 
ATOM   3057 O  O     . TYR C 3 292 ? -3.336  31.559 38.908  1.00 46.49  ? 292  TYR A O     1 
ATOM   3058 C  CB    . TYR C 3 292 ? -4.721  33.545 41.159  1.00 47.87  ? 292  TYR A CB    1 
ATOM   3059 C  CG    . TYR C 3 292 ? -5.686  33.691 39.993  1.00 48.64  ? 292  TYR A CG    1 
ATOM   3060 C  CD1   . TYR C 3 292 ? -7.001  33.214 40.098  1.00 49.44  ? 292  TYR A CD1   1 
ATOM   3061 C  CD2   . TYR C 3 292 ? -5.294  34.311 38.795  1.00 47.61  ? 292  TYR A CD2   1 
ATOM   3062 C  CE1   . TYR C 3 292 ? -7.908  33.343 39.049  1.00 49.83  ? 292  TYR A CE1   1 
ATOM   3063 C  CE2   . TYR C 3 292 ? -6.186  34.445 37.733  1.00 48.77  ? 292  TYR A CE2   1 
ATOM   3064 C  CZ    . TYR C 3 292 ? -7.503  33.955 37.869  1.00 50.72  ? 292  TYR A CZ    1 
ATOM   3065 O  OH    . TYR C 3 292 ? -8.423  34.061 36.838  1.00 50.17  ? 292  TYR A OH    1 
ATOM   3066 N  N     . ILE C 3 293 ? -1.884  32.921 39.984  1.00 46.29  ? 293  ILE A N     1 
ATOM   3067 C  CA    . ILE C 3 293 ? -1.002  33.069 38.838  1.00 45.56  ? 293  ILE A CA    1 
ATOM   3068 C  C     . ILE C 3 293 ? -0.289  31.768 38.532  1.00 46.07  ? 293  ILE A C     1 
ATOM   3069 O  O     . ILE C 3 293 ? -0.216  31.365 37.382  1.00 46.45  ? 293  ILE A O     1 
ATOM   3070 C  CB    . ILE C 3 293 ? -0.014  34.225 39.026  1.00 45.29  ? 293  ILE A CB    1 
ATOM   3071 C  CG1   . ILE C 3 293 ? -0.761  35.544 39.335  1.00 42.98  ? 293  ILE A CG1   1 
ATOM   3072 C  CG2   . ILE C 3 293 ? 0.904   34.347 37.807  1.00 44.42  ? 293  ILE A CG2   1 
ATOM   3073 C  CD1   . ILE C 3 293 ? -1.710  36.005 38.266  1.00 38.31  ? 293  ILE A CD1   1 
ATOM   3074 N  N     . SER C 3 294 ? 0.204   31.100 39.569  1.00 46.73  ? 294  SER A N     1 
ATOM   3075 C  CA    . SER C 3 294 ? 0.744   29.751 39.444  1.00 47.24  ? 294  SER A CA    1 
ATOM   3076 C  C     . SER C 3 294 ? -0.228  28.863 38.724  1.00 47.89  ? 294  SER A C     1 
ATOM   3077 O  O     . SER C 3 294 ? 0.162   28.165 37.801  1.00 48.37  ? 294  SER A O     1 
ATOM   3078 C  CB    . SER C 3 294 ? 1.017   29.129 40.806  1.00 47.30  ? 294  SER A CB    1 
ATOM   3079 O  OG    . SER C 3 294 ? 2.078   29.777 41.467  1.00 47.12  ? 294  SER A OG    1 
ATOM   3080 N  N     . GLU C 3 295 ? -1.489  28.872 39.154  1.00 48.65  ? 295  GLU A N     1 
ATOM   3081 C  CA    . GLU C 3 295 ? -2.506  28.061 38.485  1.00 49.63  ? 295  GLU A CA    1 
ATOM   3082 C  C     . GLU C 3 295 ? -2.515  28.340 36.992  1.00 49.05  ? 295  GLU A C     1 
ATOM   3083 O  O     . GLU C 3 295 ? -2.304  27.431 36.184  1.00 48.96  ? 295  GLU A O     1 
ATOM   3084 C  CB    . GLU C 3 295 ? -3.889  28.271 39.094  1.00 50.04  ? 295  GLU A CB    1 
ATOM   3085 C  CG    . GLU C 3 295 ? -4.467  27.003 39.721  1.00 54.79  ? 295  GLU A CG    1 
ATOM   3086 C  CD    . GLU C 3 295 ? -5.270  27.255 41.018  1.00 61.20  ? 295  GLU A CD    1 
ATOM   3087 O  OE1   . GLU C 3 295 ? -5.478  28.451 41.399  1.00 62.82  ? 295  GLU A OE1   1 
ATOM   3088 O  OE2   . GLU C 3 295 ? -5.695  26.244 41.652  1.00 62.48  ? 295  GLU A OE2   1 
ATOM   3089 N  N     . PHE C 3 296 ? -2.703  29.614 36.654  1.00 48.58  ? 296  PHE A N     1 
ATOM   3090 C  CA    . PHE C 3 296 ? -2.760  30.069 35.282  1.00 48.30  ? 296  PHE A CA    1 
ATOM   3091 C  C     . PHE C 3 296 ? -1.507  29.723 34.467  1.00 48.60  ? 296  PHE A C     1 
ATOM   3092 O  O     . PHE C 3 296 ? -1.614  29.322 33.310  1.00 48.65  ? 296  PHE A O     1 
ATOM   3093 C  CB    . PHE C 3 296 ? -2.997  31.579 35.257  1.00 47.97  ? 296  PHE A CB    1 
ATOM   3094 C  CG    . PHE C 3 296 ? -3.186  32.145 33.870  1.00 47.76  ? 296  PHE A CG    1 
ATOM   3095 C  CD1   . PHE C 3 296 ? -4.456  32.175 33.280  1.00 46.75  ? 296  PHE A CD1   1 
ATOM   3096 C  CD2   . PHE C 3 296 ? -2.096  32.660 33.150  1.00 47.05  ? 296  PHE A CD2   1 
ATOM   3097 C  CE1   . PHE C 3 296 ? -4.639  32.705 31.990  1.00 46.17  ? 296  PHE A CE1   1 
ATOM   3098 C  CE2   . PHE C 3 296 ? -2.270  33.198 31.863  1.00 46.21  ? 296  PHE A CE2   1 
ATOM   3099 C  CZ    . PHE C 3 296 ? -3.545  33.222 31.284  1.00 46.06  ? 296  PHE A CZ    1 
ATOM   3100 N  N     . GLU C 3 297 ? -0.324  29.887 35.058  1.00 48.76  ? 297  GLU A N     1 
ATOM   3101 C  CA    . GLU C 3 297 ? 0.912   29.833 34.277  1.00 49.00  ? 297  GLU A CA    1 
ATOM   3102 C  C     . GLU C 3 297 ? 1.458   28.419 34.185  1.00 49.81  ? 297  GLU A C     1 
ATOM   3103 O  O     . GLU C 3 297 ? 2.115   28.060 33.209  1.00 49.54  ? 297  GLU A O     1 
ATOM   3104 C  CB    . GLU C 3 297 ? 1.971   30.785 34.853  1.00 48.56  ? 297  GLU A CB    1 
ATOM   3105 C  CG    . GLU C 3 297 ? 1.639   32.280 34.767  1.00 47.45  ? 297  GLU A CG    1 
ATOM   3106 C  CD    . GLU C 3 297 ? 1.859   32.888 33.378  1.00 47.44  ? 297  GLU A CD    1 
ATOM   3107 O  OE1   . GLU C 3 297 ? 2.762   32.437 32.658  1.00 48.55  ? 297  GLU A OE1   1 
ATOM   3108 O  OE2   . GLU C 3 297 ? 1.133   33.827 32.992  1.00 45.81  ? 297  GLU A OE2   1 
ATOM   3109 N  N     . LEU C 3 298 ? 1.165   27.616 35.204  1.00 50.93  ? 298  LEU A N     1 
ATOM   3110 C  CA    . LEU C 3 298 ? 1.785   26.313 35.355  1.00 52.16  ? 298  LEU A CA    1 
ATOM   3111 C  C     . LEU C 3 298 ? 0.800   25.160 35.502  1.00 53.67  ? 298  LEU A C     1 
ATOM   3112 O  O     . LEU C 3 298 ? 1.228   24.011 35.643  1.00 53.87  ? 298  LEU A O     1 
ATOM   3113 C  CB    . LEU C 3 298 ? 2.729   26.313 36.558  1.00 51.66  ? 298  LEU A CB    1 
ATOM   3114 C  CG    . LEU C 3 298 ? 3.743   27.441 36.739  1.00 50.94  ? 298  LEU A CG    1 
ATOM   3115 C  CD1   . LEU C 3 298 ? 4.526   27.181 38.000  1.00 49.01  ? 298  LEU A CD1   1 
ATOM   3116 C  CD2   . LEU C 3 298 ? 4.678   27.595 35.534  1.00 50.30  ? 298  LEU A CD2   1 
ATOM   3117 N  N     . ASN C 3 299 ? -0.504  25.454 35.465  1.00 55.45  ? 299  ASN A N     1 
ATOM   3118 C  CA    . ASN C 3 299 ? -1.549  24.427 35.629  1.00 57.26  ? 299  ASN A CA    1 
ATOM   3119 C  C     . ASN C 3 299 ? -1.240  23.624 36.874  1.00 58.40  ? 299  ASN A C     1 
ATOM   3120 O  O     . ASN C 3 299 ? -0.993  22.425 36.802  1.00 59.00  ? 299  ASN A O     1 
ATOM   3121 C  CB    . ASN C 3 299 ? -1.643  23.483 34.415  1.00 56.92  ? 299  ASN A CB    1 
ATOM   3122 C  CG    . ASN C 3 299 ? -1.469  24.205 33.089  1.00 58.06  ? 299  ASN A CG    1 
ATOM   3123 O  OD1   . ASN C 3 299 ? -2.449  24.498 32.408  1.00 59.63  ? 299  ASN A OD1   1 
ATOM   3124 N  ND2   . ASN C 3 299 ? -0.217  24.506 32.719  1.00 57.28  ? 299  ASN A ND2   1 
ATOM   3125 N  N     . VAL C 3 300 ? -1.230  24.292 38.016  1.00 59.91  ? 300  VAL A N     1 
ATOM   3126 C  CA    . VAL C 3 300 ? -0.697  23.673 39.206  1.00 61.78  ? 300  VAL A CA    1 
ATOM   3127 C  C     . VAL C 3 300 ? -1.517  24.046 40.448  1.00 63.52  ? 300  VAL A C     1 
ATOM   3128 O  O     . VAL C 3 300 ? -1.708  25.233 40.755  1.00 63.82  ? 300  VAL A O     1 
ATOM   3129 C  CB    . VAL C 3 300 ? 0.802   24.003 39.357  1.00 61.49  ? 300  VAL A CB    1 
ATOM   3130 C  CG1   . VAL C 3 300 ? 1.015   25.299 40.163  1.00 61.53  ? 300  VAL A CG1   1 
ATOM   3131 C  CG2   . VAL C 3 300 ? 1.521   22.848 39.965  1.00 61.28  ? 300  VAL A CG2   1 
ATOM   3132 N  N     . GLY C 3 301 ? -1.988  23.011 41.150  1.00 65.11  ? 301  GLY A N     1 
ATOM   3133 C  CA    . GLY C 3 301 ? -2.962  23.139 42.237  1.00 66.56  ? 301  GLY A CA    1 
ATOM   3134 C  C     . GLY C 3 301 ? -2.614  24.104 43.348  1.00 67.80  ? 301  GLY A C     1 
ATOM   3135 O  O     . GLY C 3 301 ? -1.441  24.417 43.582  1.00 67.69  ? 301  GLY A O     1 
ATOM   3136 N  N     . LYS C 3 302 ? -3.655  24.578 44.029  1.00 69.13  ? 302  LYS A N     1 
ATOM   3137 C  CA    . LYS C 3 302 ? -3.504  25.514 45.147  1.00 70.44  ? 302  LYS A CA    1 
ATOM   3138 C  C     . LYS C 3 302 ? -2.944  24.817 46.381  1.00 70.63  ? 302  LYS A C     1 
ATOM   3139 O  O     . LYS C 3 302 ? -3.525  23.842 46.871  1.00 70.93  ? 302  LYS A O     1 
ATOM   3140 C  CB    . LYS C 3 302 ? -4.843  26.208 45.475  1.00 70.57  ? 302  LYS A CB    1 
ATOM   3141 C  CG    . LYS C 3 302 ? -6.068  25.268 45.588  1.00 71.58  ? 302  LYS A CG    1 
ATOM   3142 C  CD    . LYS C 3 302 ? -7.337  26.020 46.031  1.00 71.88  ? 302  LYS A CD    1 
ATOM   3143 C  CE    . LYS C 3 302 ? -7.447  26.146 47.557  1.00 71.77  ? 302  LYS A CE    1 
ATOM   3144 N  NZ    . LYS C 3 302 ? -8.299  27.314 47.920  1.00 71.16  ? 302  LYS A NZ    1 
ATOM   3145 N  N     . LEU C 3 303 ? -1.807  25.310 46.866  1.00 71.12  ? 303  LEU A N     1 
ATOM   3146 C  CA    . LEU C 3 303 ? -1.220  24.831 48.125  1.00 71.38  ? 303  LEU A CA    1 
ATOM   3147 C  C     . LEU C 3 303 ? -2.315  24.781 49.207  1.00 71.49  ? 303  LEU A C     1 
ATOM   3148 O  O     . LEU C 3 303 ? -2.798  25.825 49.684  1.00 71.50  ? 303  LEU A O     1 
ATOM   3149 C  CB    . LEU C 3 303 ? -0.054  25.727 48.564  1.00 71.19  ? 303  LEU A CB    1 
ATOM   3150 C  CG    . LEU C 3 303 ? 0.933   26.292 47.544  1.00 71.40  ? 303  LEU A CG    1 
ATOM   3151 C  CD1   . LEU C 3 303 ? 0.386   27.582 46.938  1.00 71.90  ? 303  LEU A CD1   1 
ATOM   3152 C  CD2   . LEU C 3 303 ? 2.261   26.581 48.218  1.00 71.94  ? 303  LEU A CD2   1 
ATOM   3153 N  N     . LYS C 3 304 ? -2.719  23.563 49.562  1.00 71.39  ? 304  LYS A N     1 
ATOM   3154 C  CA    . LYS C 3 304 ? -3.897  23.361 50.404  1.00 71.60  ? 304  LYS A CA    1 
ATOM   3155 C  C     . LYS C 3 304 ? -3.570  23.265 51.908  1.00 71.32  ? 304  LYS A C     1 
ATOM   3156 O  O     . LYS C 3 304 ? -2.562  22.674 52.309  1.00 71.36  ? 304  LYS A O     1 
ATOM   3157 C  CB    . LYS C 3 304 ? -4.717  22.155 49.901  1.00 71.83  ? 304  LYS A CB    1 
ATOM   3158 C  CG    . LYS C 3 304 ? -5.997  21.819 50.701  1.00 72.55  ? 304  LYS A CG    1 
ATOM   3159 C  CD    . LYS C 3 304 ? -5.766  20.653 51.689  1.00 73.80  ? 304  LYS A CD    1 
ATOM   3160 C  CE    . LYS C 3 304 ? -7.080  20.040 52.194  1.00 73.50  ? 304  LYS A CE    1 
ATOM   3161 N  NZ    . LYS C 3 304 ? -6.845  18.776 52.960  1.00 72.98  ? 304  LYS A NZ    1 
ATOM   3162 N  N     . TYR C 3 305 ? -4.436  23.876 52.717  1.00 70.82  ? 305  TYR A N     1 
ATOM   3163 C  CA    . TYR C 3 305 ? -4.349  23.840 54.172  1.00 70.13  ? 305  TYR A CA    1 
ATOM   3164 C  C     . TYR C 3 305 ? -5.721  24.120 54.766  1.00 69.88  ? 305  TYR A C     1 
ATOM   3165 O  O     . TYR C 3 305 ? -6.498  24.915 54.232  1.00 69.90  ? 305  TYR A O     1 
ATOM   3166 C  CB    . TYR C 3 305 ? -3.306  24.841 54.694  1.00 70.12  ? 305  TYR A CB    1 
ATOM   3167 C  CG    . TYR C 3 305 ? -3.536  26.299 54.314  1.00 70.39  ? 305  TYR A CG    1 
ATOM   3168 C  CD1   . TYR C 3 305 ? -3.130  26.798 53.069  1.00 70.22  ? 305  TYR A CD1   1 
ATOM   3169 C  CD2   . TYR C 3 305 ? -4.143  27.187 55.212  1.00 70.82  ? 305  TYR A CD2   1 
ATOM   3170 C  CE1   . TYR C 3 305 ? -3.339  28.135 52.722  1.00 70.27  ? 305  TYR A CE1   1 
ATOM   3171 C  CE2   . TYR C 3 305 ? -4.355  28.532 54.877  1.00 70.95  ? 305  TYR A CE2   1 
ATOM   3172 C  CZ    . TYR C 3 305 ? -3.952  28.999 53.633  1.00 70.84  ? 305  TYR A CZ    1 
ATOM   3173 O  OH    . TYR C 3 305 ? -4.159  30.325 53.309  1.00 70.51  ? 305  TYR A OH    1 
ATOM   3174 N  N     . ASP C 3 306 ? -6.027  23.447 55.864  1.00 69.69  ? 306  ASP A N     1 
ATOM   3175 C  CA    . ASP C 3 306 ? -7.294  23.656 56.550  1.00 69.48  ? 306  ASP A CA    1 
ATOM   3176 C  C     . ASP C 3 306 ? -7.186  24.827 57.511  1.00 68.94  ? 306  ASP A C     1 
ATOM   3177 O  O     . ASP C 3 306 ? -6.137  25.080 58.091  1.00 68.79  ? 306  ASP A O     1 
ATOM   3178 C  CB    . ASP C 3 306 ? -7.715  22.392 57.292  1.00 69.83  ? 306  ASP A CB    1 
ATOM   3179 C  CG    . ASP C 3 306 ? -7.686  21.144 56.406  1.00 71.43  ? 306  ASP A CG    1 
ATOM   3180 O  OD1   . ASP C 3 306 ? -7.854  21.259 55.161  1.00 72.06  ? 306  ASP A OD1   1 
ATOM   3181 O  OD2   . ASP C 3 306 ? -7.499  20.039 56.970  1.00 73.39  ? 306  ASP A OD2   1 
ATOM   3182 N  N     . GLY C 3 307 ? -8.283  25.548 57.667  1.00 68.83  ? 307  GLY A N     1 
ATOM   3183 C  CA    . GLY C 3 307 ? -8.304  26.745 58.507  1.00 68.58  ? 307  GLY A CA    1 
ATOM   3184 C  C     . GLY C 3 307 ? -7.618  27.939 57.861  1.00 67.99  ? 307  GLY A C     1 
ATOM   3185 O  O     . GLY C 3 307 ? -7.098  27.833 56.747  1.00 68.03  ? 307  GLY A O     1 
ATOM   3186 N  N     . PRO C 3 308 ? -7.615  29.088 58.558  1.00 67.63  ? 308  PRO A N     1 
ATOM   3187 C  CA    . PRO C 3 308 ? -7.024  30.295 57.990  1.00 67.34  ? 308  PRO A CA    1 
ATOM   3188 C  C     . PRO C 3 308 ? -5.521  30.322 58.199  1.00 67.08  ? 308  PRO A C     1 
ATOM   3189 O  O     . PRO C 3 308 ? -5.015  29.709 59.142  1.00 66.93  ? 308  PRO A O     1 
ATOM   3190 C  CB    . PRO C 3 308 ? -7.690  31.420 58.783  1.00 67.27  ? 308  PRO A CB    1 
ATOM   3191 C  CG    . PRO C 3 308 ? -8.035  30.806 60.107  1.00 67.47  ? 308  PRO A CG    1 
ATOM   3192 C  CD    . PRO C 3 308 ? -8.164  29.316 59.910  1.00 67.58  ? 308  PRO A CD    1 
ATOM   3193 N  N     . ILE C 3 309 ? -4.819  31.032 57.323  1.00 66.81  ? 309  ILE A N     1 
ATOM   3194 C  CA    . ILE C 3 309 ? -3.365  31.156 57.414  1.00 66.62  ? 309  ILE A CA    1 
ATOM   3195 C  C     . ILE C 3 309 ? -2.887  31.584 58.819  1.00 66.47  ? 309  ILE A C     1 
ATOM   3196 O  O     . ILE C 3 309 ? -1.861  31.113 59.302  1.00 66.23  ? 309  ILE A O     1 
ATOM   3197 C  CB    . ILE C 3 309 ? -2.818  32.100 56.304  1.00 66.57  ? 309  ILE A CB    1 
ATOM   3198 C  CG1   . ILE C 3 309 ? -1.289  32.207 56.353  1.00 66.35  ? 309  ILE A CG1   1 
ATOM   3199 C  CG2   . ILE C 3 309 ? -3.475  33.478 56.373  1.00 66.54  ? 309  ILE A CG2   1 
ATOM   3200 C  CD1   . ILE C 3 309 ? -0.557  31.009 55.761  1.00 66.76  ? 309  ILE A CD1   1 
ATOM   3201 N  N     . SER C 3 310 ? -3.665  32.445 59.473  1.00 66.62  ? 310  SER A N     1 
ATOM   3202 C  CA    . SER C 3 310 ? -3.305  33.032 60.770  1.00 66.66  ? 310  SER A CA    1 
ATOM   3203 C  C     . SER C 3 310 ? -3.046  32.005 61.867  1.00 66.69  ? 310  SER A C     1 
ATOM   3204 O  O     . SER C 3 310 ? -2.452  32.320 62.898  1.00 66.71  ? 310  SER A O     1 
ATOM   3205 C  CB    . SER C 3 310 ? -4.384  34.016 61.221  1.00 66.51  ? 310  SER A CB    1 
ATOM   3206 O  OG    . SER C 3 310 ? -5.651  33.392 61.237  1.00 66.71  ? 310  SER A OG    1 
ATOM   3207 N  N     . LYS C 3 311 ? -3.498  30.777 61.642  1.00 66.82  ? 311  LYS A N     1 
ATOM   3208 C  CA    . LYS C 3 311 ? -3.243  29.685 62.587  1.00 66.94  ? 311  LYS A CA    1 
ATOM   3209 C  C     . LYS C 3 311 ? -2.760  28.401 61.909  1.00 66.37  ? 311  LYS A C     1 
ATOM   3210 O  O     . LYS C 3 311 ? -3.072  27.302 62.355  1.00 66.35  ? 311  LYS A O     1 
ATOM   3211 C  CB    . LYS C 3 311 ? -4.461  29.429 63.501  1.00 66.92  ? 311  LYS A CB    1 
ATOM   3212 C  CG    . LYS C 3 311 ? -5.826  29.535 62.824  1.00 67.42  ? 311  LYS A CG    1 
ATOM   3213 C  CD    . LYS C 3 311 ? -6.985  29.447 63.837  1.00 68.51  ? 311  LYS A CD    1 
ATOM   3214 C  CE    . LYS C 3 311 ? -7.175  30.763 64.627  1.00 69.91  ? 311  LYS A CE    1 
ATOM   3215 N  NZ    . LYS C 3 311 ? -8.443  30.798 65.414  1.00 69.94  ? 311  LYS A NZ    1 
ATOM   3216 N  N     . LEU C 3 312 ? -1.989  28.544 60.838  1.00 65.92  ? 312  LEU A N     1 
ATOM   3217 C  CA    . LEU C 3 312 ? -1.418  27.384 60.185  1.00 65.45  ? 312  LEU A CA    1 
ATOM   3218 C  C     . LEU C 3 312 ? -0.147  26.996 60.894  1.00 65.27  ? 312  LEU A C     1 
ATOM   3219 O  O     . LEU C 3 312 ? 0.097   25.808 61.113  1.00 65.10  ? 312  LEU A O     1 
ATOM   3220 C  CB    . LEU C 3 312 ? -1.157  27.619 58.696  1.00 65.51  ? 312  LEU A CB    1 
ATOM   3221 C  CG    . LEU C 3 312 ? -0.534  26.433 57.931  1.00 65.61  ? 312  LEU A CG    1 
ATOM   3222 C  CD1   . LEU C 3 312 ? -1.344  25.144 58.099  1.00 65.96  ? 312  LEU A CD1   1 
ATOM   3223 C  CD2   . LEU C 3 312 ? -0.310  26.745 56.446  1.00 65.04  ? 312  LEU A CD2   1 
ATOM   3224 N  N     . ARG C 3 313 ? 0.655   27.992 61.269  1.00 65.13  ? 313  ARG A N     1 
ATOM   3225 C  CA    . ARG C 3 313 ? 1.892   27.715 62.007  1.00 65.07  ? 313  ARG A CA    1 
ATOM   3226 C  C     . ARG C 3 313 ? 1.624   26.919 63.289  1.00 65.00  ? 313  ARG A C     1 
ATOM   3227 O  O     . ARG C 3 313 ? 2.425   26.065 63.659  1.00 65.24  ? 313  ARG A O     1 
ATOM   3228 C  CB    . ARG C 3 313 ? 2.705   28.978 62.305  1.00 64.67  ? 313  ARG A CB    1 
ATOM   3229 C  CG    . ARG C 3 313 ? 4.196   28.675 62.540  1.00 64.87  ? 313  ARG A CG    1 
ATOM   3230 C  CD    . ARG C 3 313 ? 4.990   29.858 63.130  1.00 65.24  ? 313  ARG A CD    1 
ATOM   3231 N  NE    . ARG C 3 313 ? 4.719   30.078 64.554  1.00 65.94  ? 313  ARG A NE    1 
ATOM   3232 C  CZ    . ARG C 3 313 ? 5.542   29.742 65.552  1.00 66.93  ? 313  ARG A CZ    1 
ATOM   3233 N  NH1   . ARG C 3 313 ? 6.718   29.169 65.311  1.00 67.04  ? 313  ARG A NH1   1 
ATOM   3234 N  NH2   . ARG C 3 313 ? 5.188   29.984 66.809  1.00 66.95  ? 313  ARG A NH2   1 
ATOM   3235 N  N     . GLU C 3 314 ? 0.494   27.168 63.943  1.00 64.78  ? 314  GLU A N     1 
ATOM   3236 C  CA    . GLU C 3 314 ? 0.170   26.437 65.160  1.00 65.10  ? 314  GLU A CA    1 
ATOM   3237 C  C     . GLU C 3 314 ? -0.451  25.054 64.884  1.00 64.57  ? 314  GLU A C     1 
ATOM   3238 O  O     . GLU C 3 314 ? -0.145  24.091 65.587  1.00 64.67  ? 314  GLU A O     1 
ATOM   3239 C  CB    . GLU C 3 314 ? -0.735  27.270 66.062  1.00 65.17  ? 314  GLU A CB    1 
ATOM   3240 C  CG    . GLU C 3 314 ? -0.744  26.817 67.514  1.00 66.56  ? 314  GLU A CG    1 
ATOM   3241 C  CD    . GLU C 3 314 ? -1.737  27.601 68.371  1.00 68.02  ? 314  GLU A CD    1 
ATOM   3242 O  OE1   . GLU C 3 314 ? -2.850  27.906 67.872  1.00 69.46  ? 314  GLU A OE1   1 
ATOM   3243 O  OE2   . GLU C 3 314 ? -1.407  27.905 69.550  1.00 70.48  ? 314  GLU A OE2   1 
ATOM   3244 N  N     . SER C 3 315 ? -1.314  24.968 63.868  1.00 63.65  ? 315  SER A N     1 
ATOM   3245 C  CA    . SER C 3 315 ? -1.962  23.718 63.472  1.00 62.45  ? 315  SER A CA    1 
ATOM   3246 C  C     . SER C 3 315 ? -1.007  22.736 62.802  1.00 61.82  ? 315  SER A C     1 
ATOM   3247 O  O     . SER C 3 315 ? -1.098  21.528 62.998  1.00 61.88  ? 315  SER A O     1 
ATOM   3248 C  CB    . SER C 3 315 ? -3.073  24.000 62.461  1.00 62.62  ? 315  SER A CB    1 
ATOM   3249 O  OG    . SER C 3 315 ? -3.885  25.093 62.835  1.00 62.93  ? 315  SER A OG    1 
ATOM   3250 N  N     . ASN C 3 316 ? -0.112  23.263 61.978  1.00 60.90  ? 316  ASN A N     1 
ATOM   3251 C  CA    . ASN C 3 316 ? 0.622   22.452 61.031  1.00 59.88  ? 316  ASN A CA    1 
ATOM   3252 C  C     . ASN C 3 316 ? 1.829   23.236 60.561  1.00 59.63  ? 316  ASN A C     1 
ATOM   3253 O  O     . ASN C 3 316 ? 1.887   23.697 59.417  1.00 59.97  ? 316  ASN A O     1 
ATOM   3254 C  CB    . ASN C 3 316 ? -0.285  22.088 59.847  1.00 59.55  ? 316  ASN A CB    1 
ATOM   3255 C  CG    . ASN C 3 316 ? 0.182   20.863 59.103  1.00 57.72  ? 316  ASN A CG    1 
ATOM   3256 O  OD1   . ASN C 3 316 ? 1.367   20.586 59.015  1.00 56.89  ? 316  ASN A OD1   1 
ATOM   3257 N  ND2   . ASN C 3 316 ? -0.755  20.126 58.555  1.00 56.57  ? 316  ASN A ND2   1 
ATOM   3258 N  N     . HIS C 3 317 ? 2.786   23.395 61.464  1.00 59.08  ? 317  HIS A N     1 
ATOM   3259 C  CA    . HIS C 3 317 ? 4.025   24.086 61.178  1.00 58.71  ? 317  HIS A CA    1 
ATOM   3260 C  C     . HIS C 3 317 ? 4.760   23.449 59.988  1.00 58.65  ? 317  HIS A C     1 
ATOM   3261 O  O     . HIS C 3 317 ? 5.404   24.149 59.205  1.00 58.84  ? 317  HIS A O     1 
ATOM   3262 C  CB    . HIS C 3 317 ? 4.902   24.086 62.425  1.00 58.62  ? 317  HIS A CB    1 
ATOM   3263 C  CG    . HIS C 3 317 ? 6.237   24.728 62.225  1.00 59.11  ? 317  HIS A CG    1 
ATOM   3264 N  ND1   . HIS C 3 317 ? 7.390   23.998 62.038  1.00 60.33  ? 317  HIS A ND1   1 
ATOM   3265 C  CD2   . HIS C 3 317 ? 6.604   26.031 62.165  1.00 59.38  ? 317  HIS A CD2   1 
ATOM   3266 C  CE1   . HIS C 3 317 ? 8.412   24.822 61.876  1.00 60.02  ? 317  HIS A CE1   1 
ATOM   3267 N  NE2   . HIS C 3 317 ? 7.962   26.062 61.948  1.00 59.36  ? 317  HIS A NE2   1 
ATOM   3268 N  N     . GLN C 3 318 ? 4.644   22.126 59.851  1.00 58.46  ? 318  GLN A N     1 
ATOM   3269 C  CA    . GLN C 3 318 ? 5.279   21.373 58.758  1.00 58.30  ? 318  GLN A CA    1 
ATOM   3270 C  C     . GLN C 3 318 ? 4.856   21.951 57.415  1.00 58.31  ? 318  GLN A C     1 
ATOM   3271 O  O     . GLN C 3 318 ? 5.692   22.424 56.645  1.00 58.30  ? 318  GLN A O     1 
ATOM   3272 C  CB    . GLN C 3 318 ? 4.943   19.865 58.857  1.00 58.12  ? 318  GLN A CB    1 
ATOM   3273 C  CG    . GLN C 3 318 ? 5.519   18.960 57.747  1.00 57.56  ? 318  GLN A CG    1 
ATOM   3274 C  CD    . GLN C 3 318 ? 7.053   18.868 57.729  1.00 57.91  ? 318  GLN A CD    1 
ATOM   3275 O  OE1   . GLN C 3 318 ? 7.717   18.949 58.769  1.00 58.20  ? 318  GLN A OE1   1 
ATOM   3276 N  NE2   . GLN C 3 318 ? 7.618   18.685 56.534  1.00 57.57  ? 318  GLN A NE2   1 
ATOM   3277 N  N     . ARG C 3 319 ? 3.550   21.912 57.157  1.00 58.36  ? 319  ARG A N     1 
ATOM   3278 C  CA    . ARG C 3 319 ? 2.941   22.560 56.008  1.00 58.38  ? 319  ARG A CA    1 
ATOM   3279 C  C     . ARG C 3 319 ? 3.418   23.998 55.895  1.00 57.81  ? 319  ARG A C     1 
ATOM   3280 O  O     . ARG C 3 319 ? 3.938   24.427 54.846  1.00 57.45  ? 319  ARG A O     1 
ATOM   3281 C  CB    . ARG C 3 319 ? 1.422   22.573 56.183  1.00 58.82  ? 319  ARG A CB    1 
ATOM   3282 C  CG    . ARG C 3 319 ? 0.714   21.410 55.548  1.00 61.23  ? 319  ARG A CG    1 
ATOM   3283 C  CD    . ARG C 3 319 ? 0.567   21.592 54.039  1.00 64.96  ? 319  ARG A CD    1 
ATOM   3284 N  NE    . ARG C 3 319 ? 0.663   20.301 53.359  1.00 67.37  ? 319  ARG A NE    1 
ATOM   3285 C  CZ    . ARG C 3 319 ? -0.365  19.486 53.138  1.00 68.90  ? 319  ARG A CZ    1 
ATOM   3286 N  NH1   . ARG C 3 319 ? -1.595  19.822 53.523  1.00 69.16  ? 319  ARG A NH1   1 
ATOM   3287 N  NH2   . ARG C 3 319 ? -0.161  18.330 52.520  1.00 70.44  ? 319  ARG A NH2   1 
ATOM   3288 N  N     . TYR C 3 320 ? 3.230   24.724 56.997  1.00 56.98  ? 320  TYR A N     1 
ATOM   3289 C  CA    . TYR C 3 320 ? 3.524   26.143 57.061  1.00 56.54  ? 320  TYR A CA    1 
ATOM   3290 C  C     . TYR C 3 320 ? 4.886   26.455 56.453  1.00 55.73  ? 320  TYR A C     1 
ATOM   3291 O  O     . TYR C 3 320 ? 4.986   27.304 55.564  1.00 55.87  ? 320  TYR A O     1 
ATOM   3292 C  CB    . TYR C 3 320 ? 3.427   26.649 58.500  1.00 56.86  ? 320  TYR A CB    1 
ATOM   3293 C  CG    . TYR C 3 320 ? 3.413   28.155 58.615  1.00 57.45  ? 320  TYR A CG    1 
ATOM   3294 C  CD1   . TYR C 3 320 ? 2.232   28.874 58.440  1.00 57.68  ? 320  TYR A CD1   1 
ATOM   3295 C  CD2   . TYR C 3 320 ? 4.581   28.862 58.899  1.00 57.14  ? 320  TYR A CD2   1 
ATOM   3296 C  CE1   . TYR C 3 320 ? 2.215   30.260 58.551  1.00 58.44  ? 320  TYR A CE1   1 
ATOM   3297 C  CE2   . TYR C 3 320 ? 4.577   30.245 59.008  1.00 56.73  ? 320  TYR A CE2   1 
ATOM   3298 C  CZ    . TYR C 3 320 ? 3.396   30.939 58.843  1.00 58.26  ? 320  TYR A CZ    1 
ATOM   3299 O  OH    . TYR C 3 320 ? 3.386   32.319 58.960  1.00 59.78  ? 320  TYR A OH    1 
ATOM   3300 N  N     . ILE C 3 321 ? 5.920   25.752 56.903  1.00 54.53  ? 321  ILE A N     1 
ATOM   3301 C  CA    . ILE C 3 321 ? 7.246   25.931 56.327  1.00 53.69  ? 321  ILE A CA    1 
ATOM   3302 C  C     . ILE C 3 321 ? 7.330   25.515 54.854  1.00 53.17  ? 321  ILE A C     1 
ATOM   3303 O  O     . ILE C 3 321 ? 7.943   26.222 54.044  1.00 52.80  ? 321  ILE A O     1 
ATOM   3304 C  CB    . ILE C 3 321 ? 8.350   25.272 57.190  1.00 53.63  ? 321  ILE A CB    1 
ATOM   3305 C  CG1   . ILE C 3 321 ? 8.489   26.029 58.506  1.00 53.90  ? 321  ILE A CG1   1 
ATOM   3306 C  CG2   . ILE C 3 321 ? 9.719   25.277 56.480  1.00 53.29  ? 321  ILE A CG2   1 
ATOM   3307 C  CD1   . ILE C 3 321 ? 8.973   27.468 58.341  1.00 54.33  ? 321  ILE A CD1   1 
ATOM   3308 N  N     . SER C 3 322 ? 6.696   24.392 54.506  1.00 52.81  ? 322  SER A N     1 
ATOM   3309 C  CA    . SER C 3 322 ? 6.770   23.863 53.139  1.00 52.31  ? 322  SER A CA    1 
ATOM   3310 C  C     . SER C 3 322 ? 6.140   24.816 52.127  1.00 52.17  ? 322  SER A C     1 
ATOM   3311 O  O     . SER C 3 322 ? 6.648   24.972 51.016  1.00 51.61  ? 322  SER A O     1 
ATOM   3312 C  CB    . SER C 3 322 ? 6.156   22.467 53.041  1.00 52.47  ? 322  SER A CB    1 
ATOM   3313 O  OG    . SER C 3 322 ? 6.967   21.485 53.682  1.00 52.11  ? 322  SER A OG    1 
ATOM   3314 N  N     . TYR C 3 323 ? 5.059   25.480 52.531  1.00 52.31  ? 323  TYR A N     1 
ATOM   3315 C  CA    . TYR C 3 323 ? 4.403   26.434 51.646  1.00 52.77  ? 323  TYR A CA    1 
ATOM   3316 C  C     . TYR C 3 323 ? 5.211   27.681 51.428  1.00 52.07  ? 323  TYR A C     1 
ATOM   3317 O  O     . TYR C 3 323 ? 5.222   28.231 50.330  1.00 51.81  ? 323  TYR A O     1 
ATOM   3318 C  CB    . TYR C 3 323 ? 2.984   26.737 52.105  1.00 53.75  ? 323  TYR A CB    1 
ATOM   3319 C  CG    . TYR C 3 323 ? 2.062   25.589 51.748  1.00 56.16  ? 323  TYR A CG    1 
ATOM   3320 C  CD1   . TYR C 3 323 ? 2.569   24.420 51.128  1.00 57.46  ? 323  TYR A CD1   1 
ATOM   3321 C  CD2   . TYR C 3 323 ? 0.705   25.636 52.043  1.00 56.81  ? 323  TYR A CD2   1 
ATOM   3322 C  CE1   . TYR C 3 323 ? 1.754   23.362 50.806  1.00 56.71  ? 323  TYR A CE1   1 
ATOM   3323 C  CE2   . TYR C 3 323 ? -0.126  24.562 51.720  1.00 57.51  ? 323  TYR A CE2   1 
ATOM   3324 C  CZ    . TYR C 3 323 ? 0.409   23.438 51.102  1.00 57.76  ? 323  TYR A CZ    1 
ATOM   3325 O  OH    . TYR C 3 323 ? -0.415  22.384 50.784  1.00 59.92  ? 323  TYR A OH    1 
ATOM   3326 N  N     . ASN C 3 324 ? 5.917   28.117 52.461  1.00 51.44  ? 324  ASN A N     1 
ATOM   3327 C  CA    . ASN C 3 324 ? 6.811   29.237 52.285  1.00 50.74  ? 324  ASN A CA    1 
ATOM   3328 C  C     . ASN C 3 324 ? 7.927   28.856 51.307  1.00 50.48  ? 324  ASN A C     1 
ATOM   3329 O  O     . ASN C 3 324 ? 8.405   29.697 50.537  1.00 50.58  ? 324  ASN A O     1 
ATOM   3330 C  CB    . ASN C 3 324 ? 7.350   29.739 53.624  1.00 50.47  ? 324  ASN A CB    1 
ATOM   3331 C  CG    . ASN C 3 324 ? 8.269   30.945 53.466  1.00 50.35  ? 324  ASN A CG    1 
ATOM   3332 O  OD1   . ASN C 3 324 ? 9.460   30.853 53.746  1.00 49.07  ? 324  ASN A OD1   1 
ATOM   3333 N  ND2   . ASN C 3 324 ? 7.725   32.073 52.987  1.00 50.93  ? 324  ASN A ND2   1 
ATOM   3334 N  N     . ILE C 3 325 ? 8.310   27.580 51.299  1.00 49.95  ? 325  ILE A N     1 
ATOM   3335 C  CA    . ILE C 3 325 ? 9.338   27.131 50.358  1.00 49.64  ? 325  ILE A CA    1 
ATOM   3336 C  C     . ILE C 3 325 ? 8.811   27.047 48.925  1.00 49.00  ? 325  ILE A C     1 
ATOM   3337 O  O     . ILE C 3 325 ? 9.344   27.688 48.026  1.00 49.15  ? 325  ILE A O     1 
ATOM   3338 C  CB    . ILE C 3 325 ? 10.024  25.808 50.797  1.00 49.90  ? 325  ILE A CB    1 
ATOM   3339 C  CG1   . ILE C 3 325 ? 10.416  25.884 52.284  1.00 50.14  ? 325  ILE A CG1   1 
ATOM   3340 C  CG2   . ILE C 3 325 ? 11.253  25.530 49.921  1.00 48.91  ? 325  ILE A CG2   1 
ATOM   3341 C  CD1   . ILE C 3 325 ? 10.994  24.595 52.864  1.00 50.39  ? 325  ILE A CD1   1 
ATOM   3342 N  N     . ILE C 3 326 ? 7.759   26.267 48.727  1.00 48.40  ? 326  ILE A N     1 
ATOM   3343 C  CA    . ILE C 3 326 ? 7.135   26.112 47.418  1.00 47.53  ? 326  ILE A CA    1 
ATOM   3344 C  C     . ILE C 3 326 ? 6.720   27.470 46.831  1.00 46.82  ? 326  ILE A C     1 
ATOM   3345 O  O     . ILE C 3 326 ? 6.815   27.680 45.624  1.00 46.82  ? 326  ILE A O     1 
ATOM   3346 C  CB    . ILE C 3 326 ? 5.949   25.102 47.504  1.00 47.88  ? 326  ILE A CB    1 
ATOM   3347 C  CG1   . ILE C 3 326 ? 6.470   23.715 47.899  1.00 47.27  ? 326  ILE A CG1   1 
ATOM   3348 C  CG2   . ILE C 3 326 ? 5.158   25.018 46.188  1.00 47.74  ? 326  ILE A CG2   1 
ATOM   3349 C  CD1   . ILE C 3 326 ? 5.403   22.804 48.509  1.00 49.43  ? 326  ILE A CD1   1 
ATOM   3350 N  N     . ALA C 3 327 ? 6.296   28.397 47.685  1.00 46.15  ? 327  ALA A N     1 
ATOM   3351 C  CA    . ALA C 3 327 ? 5.979   29.772 47.248  1.00 45.39  ? 327  ALA A CA    1 
ATOM   3352 C  C     . ALA C 3 327 ? 7.152   30.418 46.554  1.00 44.77  ? 327  ALA A C     1 
ATOM   3353 O  O     . ALA C 3 327 ? 7.009   30.987 45.473  1.00 45.59  ? 327  ALA A O     1 
ATOM   3354 C  CB    . ALA C 3 327 ? 5.532   30.638 48.416  1.00 45.60  ? 327  ALA A CB    1 
ATOM   3355 N  N     . VAL C 3 328 ? 8.316   30.336 47.176  1.00 43.58  ? 328  VAL A N     1 
ATOM   3356 C  CA    . VAL C 3 328 ? 9.526   30.809 46.541  1.00 42.78  ? 328  VAL A CA    1 
ATOM   3357 C  C     . VAL C 3 328 ? 9.719   30.088 45.202  1.00 42.84  ? 328  VAL A C     1 
ATOM   3358 O  O     . VAL C 3 328 ? 9.987   30.731 44.186  1.00 42.51  ? 328  VAL A O     1 
ATOM   3359 C  CB    . VAL C 3 328 ? 10.739  30.648 47.489  1.00 42.54  ? 328  VAL A CB    1 
ATOM   3360 C  CG1   . VAL C 3 328 ? 12.056  30.928 46.780  1.00 42.47  ? 328  VAL A CG1   1 
ATOM   3361 C  CG2   . VAL C 3 328 ? 10.583  31.572 48.697  1.00 42.20  ? 328  VAL A CG2   1 
ATOM   3362 N  N     . TYR C 3 329 ? 9.536   28.764 45.199  1.00 43.13  ? 329  TYR A N     1 
ATOM   3363 C  CA    . TYR C 3 329 ? 9.859   27.938 44.031  1.00 43.48  ? 329  TYR A CA    1 
ATOM   3364 C  C     . TYR C 3 329 ? 8.974   28.263 42.860  1.00 43.94  ? 329  TYR A C     1 
ATOM   3365 O  O     . TYR C 3 329 ? 9.439   28.310 41.718  1.00 44.17  ? 329  TYR A O     1 
ATOM   3366 C  CB    . TYR C 3 329 ? 9.761   26.445 44.336  1.00 43.70  ? 329  TYR A CB    1 
ATOM   3367 C  CG    . TYR C 3 329 ? 10.134  25.553 43.160  1.00 44.28  ? 329  TYR A CG    1 
ATOM   3368 C  CD1   . TYR C 3 329 ? 11.258  25.836 42.368  1.00 45.84  ? 329  TYR A CD1   1 
ATOM   3369 C  CD2   . TYR C 3 329 ? 9.383   24.416 42.846  1.00 44.46  ? 329  TYR A CD2   1 
ATOM   3370 C  CE1   . TYR C 3 329 ? 11.613  25.021 41.274  1.00 45.90  ? 329  TYR A CE1   1 
ATOM   3371 C  CE2   . TYR C 3 329 ? 9.735   23.583 41.757  1.00 44.38  ? 329  TYR A CE2   1 
ATOM   3372 C  CZ    . TYR C 3 329 ? 10.850  23.899 40.976  1.00 45.35  ? 329  TYR A CZ    1 
ATOM   3373 O  OH    . TYR C 3 329 ? 11.224  23.106 39.904  1.00 45.38  ? 329  TYR A OH    1 
ATOM   3374 N  N     . ARG C 3 330 ? 7.698   28.499 43.135  1.00 44.09  ? 330  ARG A N     1 
ATOM   3375 C  CA    . ARG C 3 330 ? 6.779   28.770 42.053  1.00 44.43  ? 330  ARG A CA    1 
ATOM   3376 C  C     . ARG C 3 330 ? 7.222   29.957 41.201  1.00 44.21  ? 330  ARG A C     1 
ATOM   3377 O  O     . ARG C 3 330 ? 7.287   29.843 39.965  1.00 44.09  ? 330  ARG A O     1 
ATOM   3378 C  CB    . ARG C 3 330 ? 5.350   28.913 42.552  1.00 44.78  ? 330  ARG A CB    1 
ATOM   3379 C  CG    . ARG C 3 330 ? 4.555   27.658 42.296  1.00 46.25  ? 330  ARG A CG    1 
ATOM   3380 C  CD    . ARG C 3 330 ? 4.268   26.923 43.576  1.00 49.49  ? 330  ARG A CD    1 
ATOM   3381 N  NE    . ARG C 3 330 ? 2.848   26.957 43.938  1.00 51.53  ? 330  ARG A NE    1 
ATOM   3382 C  CZ    . ARG C 3 330 ? 1.977   25.975 43.705  1.00 51.95  ? 330  ARG A CZ    1 
ATOM   3383 N  NH1   . ARG C 3 330 ? 2.366   24.861 43.095  1.00 50.47  ? 330  ARG A NH1   1 
ATOM   3384 N  NH2   . ARG C 3 330 ? 0.706   26.112 44.089  1.00 54.22  ? 330  ARG A NH2   1 
ATOM   3385 N  N     . VAL C 3 331 ? 7.583   31.063 41.862  1.00 43.49  ? 331  VAL A N     1 
ATOM   3386 C  CA    . VAL C 3 331 ? 8.081   32.242 41.159  1.00 42.89  ? 331  VAL A CA    1 
ATOM   3387 C  C     . VAL C 3 331 ? 9.279   31.862 40.291  1.00 42.51  ? 331  VAL A C     1 
ATOM   3388 O  O     . VAL C 3 331 ? 9.513   32.466 39.241  1.00 42.77  ? 331  VAL A O     1 
ATOM   3389 C  CB    . VAL C 3 331 ? 8.465   33.404 42.126  1.00 43.23  ? 331  VAL A CB    1 
ATOM   3390 C  CG1   . VAL C 3 331 ? 8.849   34.659 41.342  1.00 42.92  ? 331  VAL A CG1   1 
ATOM   3391 C  CG2   . VAL C 3 331 ? 7.330   33.731 43.085  1.00 42.92  ? 331  VAL A CG2   1 
ATOM   3392 N  N     . LEU C 3 332 ? 10.031  30.855 40.712  1.00 41.93  ? 332  LEU A N     1 
ATOM   3393 C  CA    . LEU C 3 332 ? 11.191  30.437 39.932  1.00 41.94  ? 332  LEU A CA    1 
ATOM   3394 C  C     . LEU C 3 332 ? 10.775  29.657 38.703  1.00 41.88  ? 332  LEU A C     1 
ATOM   3395 O  O     . LEU C 3 332 ? 11.459  29.686 37.687  1.00 41.60  ? 332  LEU A O     1 
ATOM   3396 C  CB    . LEU C 3 332 ? 12.177  29.614 40.767  1.00 41.78  ? 332  LEU A CB    1 
ATOM   3397 C  CG    . LEU C 3 332 ? 12.980  30.433 41.777  1.00 41.90  ? 332  LEU A CG    1 
ATOM   3398 C  CD1   . LEU C 3 332 ? 13.762  29.550 42.749  1.00 42.45  ? 332  LEU A CD1   1 
ATOM   3399 C  CD2   . LEU C 3 332 ? 13.900  31.399 41.068  1.00 41.77  ? 332  LEU A CD2   1 
ATOM   3400 N  N     . GLN C 3 333 ? 9.654   28.959 38.795  1.00 42.08  ? 333  GLN A N     1 
ATOM   3401 C  CA    . GLN C 3 333 ? 9.201   28.164 37.664  1.00 42.65  ? 333  GLN A CA    1 
ATOM   3402 C  C     . GLN C 3 333 ? 8.493   29.038 36.661  1.00 42.70  ? 333  GLN A C     1 
ATOM   3403 O  O     . GLN C 3 333 ? 8.554   28.784 35.450  1.00 42.30  ? 333  GLN A O     1 
ATOM   3404 C  CB    . GLN C 3 333 ? 8.264   27.069 38.110  1.00 42.80  ? 333  GLN A CB    1 
ATOM   3405 C  CG    . GLN C 3 333 ? 8.623   26.501 39.436  1.00 43.16  ? 333  GLN A CG    1 
ATOM   3406 C  CD    . GLN C 3 333 ? 7.897   25.246 39.673  1.00 43.91  ? 333  GLN A CD    1 
ATOM   3407 O  OE1   . GLN C 3 333 ? 8.176   24.237 39.028  1.00 47.28  ? 333  GLN A OE1   1 
ATOM   3408 N  NE2   . GLN C 3 333 ? 6.938   25.277 40.586  1.00 43.60  ? 333  GLN A NE2   1 
ATOM   3409 N  N     . ILE C 3 334 ? 7.829   30.069 37.174  1.00 42.92  ? 334  ILE A N     1 
ATOM   3410 C  CA    . ILE C 3 334 ? 7.167   31.032 36.320  1.00 43.65  ? 334  ILE A CA    1 
ATOM   3411 C  C     . ILE C 3 334 ? 8.231   31.744 35.538  1.00 43.88  ? 334  ILE A C     1 
ATOM   3412 O  O     . ILE C 3 334 ? 8.097   31.925 34.323  1.00 44.02  ? 334  ILE A O     1 
ATOM   3413 C  CB    . ILE C 3 334 ? 6.329   32.048 37.116  1.00 43.87  ? 334  ILE A CB    1 
ATOM   3414 C  CG1   . ILE C 3 334 ? 5.031   31.388 37.594  1.00 44.09  ? 334  ILE A CG1   1 
ATOM   3415 C  CG2   . ILE C 3 334 ? 6.005   33.268 36.258  1.00 44.03  ? 334  ILE A CG2   1 
ATOM   3416 C  CD1   . ILE C 3 334 ? 4.337   32.127 38.717  1.00 44.09  ? 334  ILE A CD1   1 
ATOM   3417 N  N     . ASP C 3 335 ? 9.310   32.121 36.214  1.00 44.17  ? 335  ASP A N     1 
ATOM   3418 C  CA    . ASP C 3 335 ? 10.347  32.835 35.490  1.00 44.55  ? 335  ASP A CA    1 
ATOM   3419 C  C     . ASP C 3 335 ? 11.141  31.969 34.551  1.00 43.58  ? 335  ASP A C     1 
ATOM   3420 O  O     . ASP C 3 335 ? 11.675  32.468 33.558  1.00 43.79  ? 335  ASP A O     1 
ATOM   3421 C  CB    . ASP C 3 335 ? 11.285  33.657 36.357  1.00 44.93  ? 335  ASP A CB    1 
ATOM   3422 C  CG    . ASP C 3 335 ? 12.187  34.540 35.501  1.00 47.28  ? 335  ASP A CG    1 
ATOM   3423 O  OD1   . ASP C 3 335 ? 11.657  35.193 34.567  1.00 48.43  ? 335  ASP A OD1   1 
ATOM   3424 O  OD2   . ASP C 3 335 ? 13.421  34.546 35.722  1.00 50.81  ? 335  ASP A OD2   1 
ATOM   3425 N  N     . ALA C 3 336 ? 11.207  30.684 34.859  1.00 43.21  ? 336  ALA A N     1 
ATOM   3426 C  CA    . ALA C 3 336 ? 11.814  29.713 33.956  1.00 43.11  ? 336  ALA A CA    1 
ATOM   3427 C  C     . ALA C 3 336 ? 11.054  29.735 32.637  1.00 43.22  ? 336  ALA A C     1 
ATOM   3428 O  O     . ALA C 3 336 ? 11.658  29.727 31.560  1.00 43.08  ? 336  ALA A O     1 
ATOM   3429 C  CB    . ALA C 3 336 ? 11.781  28.341 34.560  1.00 42.80  ? 336  ALA A CB    1 
ATOM   3430 N  N     . LYS C 3 337 ? 9.725   29.810 32.744  1.00 43.30  ? 337  LYS A N     1 
ATOM   3431 C  CA    . LYS C 3 337 ? 8.840   29.848 31.588  1.00 42.89  ? 337  LYS A CA    1 
ATOM   3432 C  C     . LYS C 3 337 ? 8.853   31.198 30.896  1.00 43.01  ? 337  LYS A C     1 
ATOM   3433 O  O     . LYS C 3 337 ? 9.075   31.263 29.685  1.00 43.57  ? 337  LYS A O     1 
ATOM   3434 C  CB    . LYS C 3 337 ? 7.419   29.520 32.004  1.00 42.92  ? 337  LYS A CB    1 
ATOM   3435 C  CG    . LYS C 3 337 ? 6.474   29.423 30.838  1.00 42.88  ? 337  LYS A CG    1 
ATOM   3436 C  CD    . LYS C 3 337 ? 5.056   29.595 31.299  1.00 40.69  ? 337  LYS A CD    1 
ATOM   3437 C  CE    . LYS C 3 337 ? 4.109   29.515 30.140  1.00 39.96  ? 337  LYS A CE    1 
ATOM   3438 N  NZ    . LYS C 3 337 ? 2.753   29.495 30.725  1.00 42.72  ? 337  LYS A NZ    1 
ATOM   3439 N  N     . ARG C 3 338 ? 8.623   32.271 31.657  1.00 42.59  ? 338  ARG A N     1 
ATOM   3440 C  CA    . ARG C 3 338 ? 8.450   33.617 31.078  1.00 41.90  ? 338  ARG A CA    1 
ATOM   3441 C  C     . ARG C 3 338 ? 9.724   34.411 30.698  1.00 41.95  ? 338  ARG A C     1 
ATOM   3442 O  O     . ARG C 3 338 ? 9.651   35.271 29.808  1.00 41.65  ? 338  ARG A O     1 
ATOM   3443 C  CB    . ARG C 3 338 ? 7.535   34.471 31.968  1.00 41.94  ? 338  ARG A CB    1 
ATOM   3444 C  CG    . ARG C 3 338 ? 6.062   34.009 32.048  1.00 40.62  ? 338  ARG A CG    1 
ATOM   3445 C  CD    . ARG C 3 338 ? 5.289   34.252 30.770  1.00 38.23  ? 338  ARG A CD    1 
ATOM   3446 N  NE    . ARG C 3 338 ? 3.855   34.325 31.015  1.00 37.03  ? 338  ARG A NE    1 
ATOM   3447 C  CZ    . ARG C 3 338 ? 3.011   35.082 30.306  1.00 37.33  ? 338  ARG A CZ    1 
ATOM   3448 N  NH1   . ARG C 3 338 ? 3.457   35.825 29.307  1.00 36.11  ? 338  ARG A NH1   1 
ATOM   3449 N  NH2   . ARG C 3 338 ? 1.714   35.105 30.596  1.00 37.36  ? 338  ARG A NH2   1 
ATOM   3450 N  N     . GLN C 3 339 ? 10.859  34.133 31.356  1.00 41.69  ? 339  GLN A N     1 
ATOM   3451 C  CA    . GLN C 3 339 ? 12.142  34.840 31.137  1.00 42.03  ? 339  GLN A CA    1 
ATOM   3452 C  C     . GLN C 3 339 ? 12.128  36.363 31.370  1.00 42.06  ? 339  GLN A C     1 
ATOM   3453 O  O     . GLN C 3 339 ? 12.729  37.121 30.598  1.00 42.10  ? 339  GLN A O     1 
ATOM   3454 C  CB    . GLN C 3 339 ? 12.737  34.594 29.737  1.00 42.12  ? 339  GLN A CB    1 
ATOM   3455 C  CG    . GLN C 3 339 ? 12.448  33.261 29.069  1.00 43.94  ? 339  GLN A CG    1 
ATOM   3456 C  CD    . GLN C 3 339 ? 13.391  32.165 29.477  1.00 45.47  ? 339  GLN A CD    1 
ATOM   3457 O  OE1   . GLN C 3 339 ? 14.222  32.326 30.375  1.00 46.57  ? 339  GLN A OE1   1 
ATOM   3458 N  NE2   . GLN C 3 339 ? 13.270  31.026 28.811  1.00 47.05  ? 339  GLN A NE2   1 
ATOM   3459 N  N     . PHE C 3 340 ? 11.478  36.828 32.427  1.00 42.06  ? 340  PHE A N     1 
ATOM   3460 C  CA    . PHE C 3 340 ? 11.391  38.270 32.622  1.00 42.23  ? 340  PHE A CA    1 
ATOM   3461 C  C     . PHE C 3 340 ? 12.634  38.882 33.250  1.00 42.44  ? 340  PHE A C     1 
ATOM   3462 O  O     . PHE C 3 340 ? 12.975  40.042 32.995  1.00 42.47  ? 340  PHE A O     1 
ATOM   3463 C  CB    . PHE C 3 340 ? 10.124  38.672 33.387  1.00 42.27  ? 340  PHE A CB    1 
ATOM   3464 C  CG    . PHE C 3 340 ? 8.845   38.378 32.648  1.00 41.68  ? 340  PHE A CG    1 
ATOM   3465 C  CD1   . PHE C 3 340 ? 8.819   38.312 31.256  1.00 40.66  ? 340  PHE A CD1   1 
ATOM   3466 C  CD2   . PHE C 3 340 ? 7.654   38.184 33.352  1.00 41.48  ? 340  PHE A CD2   1 
ATOM   3467 C  CE1   . PHE C 3 340 ? 7.636   38.034 30.587  1.00 41.05  ? 340  PHE A CE1   1 
ATOM   3468 C  CE2   . PHE C 3 340 ? 6.466   37.917 32.688  1.00 39.90  ? 340  PHE A CE2   1 
ATOM   3469 C  CZ    . PHE C 3 340 ? 6.454   37.841 31.310  1.00 40.90  ? 340  PHE A CZ    1 
ATOM   3470 N  N     . ILE C 3 341 ? 13.319  38.111 34.072  1.00 42.78  ? 341  ILE A N     1 
ATOM   3471 C  CA    . ILE C 3 341 ? 14.588  38.570 34.587  1.00 43.03  ? 341  ILE A CA    1 
ATOM   3472 C  C     . ILE C 3 341 ? 15.619  38.604 33.454  1.00 43.16  ? 341  ILE A C     1 
ATOM   3473 O  O     . ILE C 3 341 ? 16.253  39.633 33.228  1.00 43.16  ? 341  ILE A O     1 
ATOM   3474 C  CB    . ILE C 3 341 ? 15.000  37.714 35.764  1.00 43.40  ? 341  ILE A CB    1 
ATOM   3475 C  CG1   . ILE C 3 341 ? 14.135  38.114 36.965  1.00 43.71  ? 341  ILE A CG1   1 
ATOM   3476 C  CG2   . ILE C 3 341 ? 16.498  37.859 36.044  1.00 43.00  ? 341  ILE A CG2   1 
ATOM   3477 C  CD1   . ILE C 3 341 ? 13.792  36.975 37.908  1.00 45.56  ? 341  ILE A CD1   1 
ATOM   3478 N  N     . ASN C 3 342 ? 15.745  37.496 32.718  1.00 43.45  ? 342  ASN A N     1 
ATOM   3479 C  CA    . ASN C 3 342 ? 16.548  37.454 31.485  1.00 43.61  ? 342  ASN A CA    1 
ATOM   3480 C  C     . ASN C 3 342 ? 16.305  38.689 30.620  1.00 43.38  ? 342  ASN A C     1 
ATOM   3481 O  O     . ASN C 3 342 ? 17.229  39.445 30.359  1.00 43.84  ? 342  ASN A O     1 
ATOM   3482 C  CB    . ASN C 3 342 ? 16.266  36.165 30.699  1.00 44.05  ? 342  ASN A CB    1 
ATOM   3483 C  CG    . ASN C 3 342 ? 17.091  36.045 29.420  1.00 44.92  ? 342  ASN A CG    1 
ATOM   3484 O  OD1   . ASN C 3 342 ? 18.270  36.396 29.381  1.00 46.32  ? 342  ASN A OD1   1 
ATOM   3485 N  ND2   . ASN C 3 342 ? 16.470  35.523 28.373  1.00 45.29  ? 342  ASN A ND2   1 
ATOM   3486 N  N     . LEU C 3 343 ? 15.056  38.910 30.207  1.00 43.23  ? 343  LEU A N     1 
ATOM   3487 C  CA    . LEU C 3 343 ? 14.662  40.145 29.504  1.00 42.74  ? 343  LEU A CA    1 
ATOM   3488 C  C     . LEU C 3 343 ? 15.215  41.415 30.181  1.00 42.74  ? 343  LEU A C     1 
ATOM   3489 O  O     . LEU C 3 343 ? 15.901  42.212 29.549  1.00 42.50  ? 343  LEU A O     1 
ATOM   3490 C  CB    . LEU C 3 343 ? 13.138  40.237 29.418  1.00 42.07  ? 343  LEU A CB    1 
ATOM   3491 C  CG    . LEU C 3 343 ? 12.386  41.006 28.317  1.00 41.31  ? 343  LEU A CG    1 
ATOM   3492 C  CD1   . LEU C 3 343 ? 11.184  41.663 28.940  1.00 39.02  ? 343  LEU A CD1   1 
ATOM   3493 C  CD2   . LEU C 3 343 ? 13.184  42.034 27.558  1.00 39.84  ? 343  LEU A CD2   1 
ATOM   3494 N  N     . SER C 3 344 ? 14.903  41.594 31.462  1.00 43.04  ? 344  SER A N     1 
ATOM   3495 C  CA    . SER C 3 344 ? 15.321  42.778 32.202  1.00 43.24  ? 344  SER A CA    1 
ATOM   3496 C  C     . SER C 3 344 ? 16.792  43.039 32.063  1.00 44.02  ? 344  SER A C     1 
ATOM   3497 O  O     . SER C 3 344 ? 17.185  44.178 31.808  1.00 43.73  ? 344  SER A O     1 
ATOM   3498 C  CB    . SER C 3 344 ? 15.004  42.642 33.672  1.00 42.91  ? 344  SER A CB    1 
ATOM   3499 O  OG    . SER C 3 344 ? 13.640  42.850 33.866  1.00 41.96  ? 344  SER A OG    1 
ATOM   3500 N  N     . LEU C 3 345 ? 17.604  41.989 32.234  1.00 44.84  ? 345  LEU A N     1 
ATOM   3501 C  CA    . LEU C 3 345 ? 19.057  42.121 32.079  1.00 45.56  ? 345  LEU A CA    1 
ATOM   3502 C  C     . LEU C 3 345 ? 19.436  42.536 30.671  1.00 46.29  ? 345  LEU A C     1 
ATOM   3503 O  O     . LEU C 3 345 ? 20.265  43.419 30.505  1.00 46.75  ? 345  LEU A O     1 
ATOM   3504 C  CB    . LEU C 3 345 ? 19.790  40.845 32.451  1.00 45.22  ? 345  LEU A CB    1 
ATOM   3505 C  CG    . LEU C 3 345 ? 19.609  40.272 33.856  1.00 46.46  ? 345  LEU A CG    1 
ATOM   3506 C  CD1   . LEU C 3 345 ? 20.268  38.883 33.960  1.00 45.90  ? 345  LEU A CD1   1 
ATOM   3507 C  CD2   . LEU C 3 345 ? 20.110  41.204 34.953  1.00 45.57  ? 345  LEU A CD2   1 
ATOM   3508 N  N     . ASP C 3 346 ? 18.830  41.914 29.663  1.00 47.36  ? 346  ASP A N     1 
ATOM   3509 C  CA    . ASP C 3 346 ? 19.077  42.288 28.269  1.00 48.59  ? 346  ASP A CA    1 
ATOM   3510 C  C     . ASP C 3 346 ? 18.919  43.770 28.026  1.00 48.98  ? 346  ASP A C     1 
ATOM   3511 O  O     . ASP C 3 346 ? 19.875  44.445 27.654  1.00 49.08  ? 346  ASP A O     1 
ATOM   3512 C  CB    . ASP C 3 346 ? 18.157  41.524 27.321  1.00 49.03  ? 346  ASP A CB    1 
ATOM   3513 C  CG    . ASP C 3 346 ? 18.625  40.117 27.084  1.00 51.14  ? 346  ASP A CG    1 
ATOM   3514 O  OD1   . ASP C 3 346 ? 19.161  39.524 28.061  1.00 52.95  ? 346  ASP A OD1   1 
ATOM   3515 O  OD2   . ASP C 3 346 ? 18.472  39.622 25.931  1.00 52.22  ? 346  ASP A OD2   1 
ATOM   3516 N  N     . MET C 3 347 ? 17.711  44.272 28.247  1.00 49.68  ? 347  MET A N     1 
ATOM   3517 C  CA    . MET C 3 347 ? 17.418  45.671 28.011  1.00 50.78  ? 347  MET A CA    1 
ATOM   3518 C  C     . MET C 3 347 ? 18.329  46.545 28.870  1.00 50.11  ? 347  MET A C     1 
ATOM   3519 O  O     . MET C 3 347 ? 18.946  47.505 28.373  1.00 50.29  ? 347  MET A O     1 
ATOM   3520 C  CB    . MET C 3 347 ? 15.964  45.966 28.346  1.00 50.70  ? 347  MET A CB    1 
ATOM   3521 C  CG    . MET C 3 347 ? 14.939  45.258 27.484  1.00 52.46  ? 347  MET A CG    1 
ATOM   3522 S  SD    . MET C 3 347 ? 13.247  45.614 28.075  1.00 55.22  ? 347  MET A SD    1 
ATOM   3523 C  CE    . MET C 3 347 ? 13.292  47.418 28.215  1.00 55.12  ? 347  MET A CE    1 
ATOM   3524 N  N     . GLY C 3 348 ? 18.407  46.182 30.151  1.00 49.50  ? 348  GLY A N     1 
ATOM   3525 C  CA    . GLY C 3 348 ? 19.202  46.884 31.153  1.00 48.93  ? 348  GLY A CA    1 
ATOM   3526 C  C     . GLY C 3 348 ? 20.598  47.184 30.688  1.00 48.56  ? 348  GLY A C     1 
ATOM   3527 O  O     . GLY C 3 348 ? 20.993  48.343 30.619  1.00 49.21  ? 348  GLY A O     1 
ATOM   3528 N  N     . TYR C 3 349 ? 21.327  46.139 30.324  1.00 48.21  ? 349  TYR A N     1 
ATOM   3529 C  CA    . TYR C 3 349 ? 22.700  46.275 29.858  1.00 47.76  ? 349  TYR A CA    1 
ATOM   3530 C  C     . TYR C 3 349 ? 22.773  46.823 28.448  1.00 47.68  ? 349  TYR A C     1 
ATOM   3531 O  O     . TYR C 3 349 ? 23.797  47.383 28.051  1.00 48.24  ? 349  TYR A O     1 
ATOM   3532 C  CB    . TYR C 3 349 ? 23.440  44.936 29.935  1.00 47.47  ? 349  TYR A CB    1 
ATOM   3533 C  CG    . TYR C 3 349 ? 23.762  44.519 31.346  1.00 47.07  ? 349  TYR A CG    1 
ATOM   3534 C  CD1   . TYR C 3 349 ? 24.353  45.413 32.229  1.00 47.48  ? 349  TYR A CD1   1 
ATOM   3535 C  CD2   . TYR C 3 349 ? 23.477  43.239 31.805  1.00 45.75  ? 349  TYR A CD2   1 
ATOM   3536 C  CE1   . TYR C 3 349 ? 24.647  45.056 33.531  1.00 46.76  ? 349  TYR A CE1   1 
ATOM   3537 C  CE2   . TYR C 3 349 ? 23.784  42.864 33.113  1.00 45.63  ? 349  TYR A CE2   1 
ATOM   3538 C  CZ    . TYR C 3 349 ? 24.366  43.784 33.969  1.00 46.74  ? 349  TYR A CZ    1 
ATOM   3539 O  OH    . TYR C 3 349 ? 24.668  43.457 35.277  1.00 47.69  ? 349  TYR A OH    1 
ATOM   3540 N  N     . TYR C 3 350 ? 21.707  46.657 27.678  1.00 47.23  ? 350  TYR A N     1 
ATOM   3541 C  CA    . TYR C 3 350 ? 21.706  47.194 26.321  1.00 46.89  ? 350  TYR A CA    1 
ATOM   3542 C  C     . TYR C 3 350 ? 21.641  48.715 26.370  1.00 47.11  ? 350  TYR A C     1 
ATOM   3543 O  O     . TYR C 3 350 ? 22.340  49.397 25.631  1.00 46.90  ? 350  TYR A O     1 
ATOM   3544 C  CB    . TYR C 3 350 ? 20.540  46.635 25.515  1.00 46.38  ? 350  TYR A CB    1 
ATOM   3545 C  CG    . TYR C 3 350 ? 20.490  47.126 24.100  1.00 45.21  ? 350  TYR A CG    1 
ATOM   3546 C  CD1   . TYR C 3 350 ? 19.828  48.314 23.775  1.00 44.36  ? 350  TYR A CD1   1 
ATOM   3547 C  CD2   . TYR C 3 350 ? 21.082  46.401 23.080  1.00 45.10  ? 350  TYR A CD2   1 
ATOM   3548 C  CE1   . TYR C 3 350 ? 19.776  48.771 22.470  1.00 43.70  ? 350  TYR A CE1   1 
ATOM   3549 C  CE2   . TYR C 3 350 ? 21.032  46.845 21.761  1.00 44.86  ? 350  TYR A CE2   1 
ATOM   3550 C  CZ    . TYR C 3 350 ? 20.379  48.025 21.467  1.00 44.72  ? 350  TYR A CZ    1 
ATOM   3551 O  OH    . TYR C 3 350 ? 20.334  48.457 20.167  1.00 45.98  ? 350  TYR A OH    1 
ATOM   3552 N  N     . ALA C 3 351 ? 20.796  49.233 27.258  1.00 47.45  ? 351  ALA A N     1 
ATOM   3553 C  CA    . ALA C 3 351 ? 20.585  50.673 27.380  1.00 47.43  ? 351  ALA A CA    1 
ATOM   3554 C  C     . ALA C 3 351 ? 21.631  51.284 28.290  1.00 47.11  ? 351  ALA A C     1 
ATOM   3555 O  O     . ALA C 3 351 ? 21.825  52.509 28.286  1.00 46.87  ? 351  ALA A O     1 
ATOM   3556 C  CB    . ALA C 3 351 ? 19.184  50.960 27.930  1.00 47.73  ? 351  ALA A CB    1 
ATOM   3557 N  N     . LYS C 3 352 ? 22.284  50.420 29.074  1.00 46.51  ? 352  LYS A N     1 
ATOM   3558 C  CA    . LYS C 3 352 ? 23.264  50.824 30.096  1.00 46.21  ? 352  LYS A CA    1 
ATOM   3559 C  C     . LYS C 3 352 ? 22.594  51.699 31.162  1.00 45.41  ? 352  LYS A C     1 
ATOM   3560 O  O     . LYS C 3 352 ? 22.958  52.862 31.347  1.00 45.88  ? 352  LYS A O     1 
ATOM   3561 C  CB    . LYS C 3 352 ? 24.505  51.538 29.488  1.00 46.26  ? 352  LYS A CB    1 
ATOM   3562 C  CG    . LYS C 3 352 ? 25.374  50.683 28.554  1.00 46.65  ? 352  LYS A CG    1 
ATOM   3563 C  CD    . LYS C 3 352 ? 26.636  51.411 28.095  1.00 46.86  ? 352  LYS A CD    1 
ATOM   3564 C  CE    . LYS C 3 352 ? 27.050  50.928 26.703  1.00 48.70  ? 352  LYS A CE    1 
ATOM   3565 N  NZ    . LYS C 3 352 ? 28.443  51.298 26.302  1.00 48.59  ? 352  LYS A NZ    1 
ATOM   3566 N  N     . ILE C 3 353 ? 21.607  51.133 31.840  1.00 44.41  ? 353  ILE A N     1 
ATOM   3567 C  CA    . ILE C 3 353 ? 20.880  51.817 32.912  1.00 43.59  ? 353  ILE A CA    1 
ATOM   3568 C  C     . ILE C 3 353 ? 20.882  50.905 34.135  1.00 43.42  ? 353  ILE A C     1 
ATOM   3569 O  O     . ILE C 3 353 ? 21.329  49.770 34.031  1.00 43.02  ? 353  ILE A O     1 
ATOM   3570 C  CB    . ILE C 3 353 ? 19.417  52.130 32.490  1.00 43.65  ? 353  ILE A CB    1 
ATOM   3571 C  CG1   . ILE C 3 353 ? 18.800  50.953 31.714  1.00 42.47  ? 353  ILE A CG1   1 
ATOM   3572 C  CG2   . ILE C 3 353 ? 19.363  53.387 31.633  1.00 42.63  ? 353  ILE A CG2   1 
ATOM   3573 C  CD1   . ILE C 3 353 ? 17.322  50.836 31.865  1.00 40.31  ? 353  ILE A CD1   1 
ATOM   3574 N  N     . GLN C 3 354 ? 20.418  51.391 35.286  1.00 43.40  ? 354  GLN A N     1 
ATOM   3575 C  CA    . GLN C 3 354 ? 20.167  50.508 36.423  1.00 43.98  ? 354  GLN A CA    1 
ATOM   3576 C  C     . GLN C 3 354 ? 19.061  49.548 35.996  1.00 43.93  ? 354  GLN A C     1 
ATOM   3577 O  O     . GLN C 3 354 ? 18.043  49.974 35.450  1.00 44.32  ? 354  GLN A O     1 
ATOM   3578 C  CB    . GLN C 3 354 ? 19.685  51.278 37.653  1.00 44.10  ? 354  GLN A CB    1 
ATOM   3579 C  CG    . GLN C 3 354 ? 20.643  52.312 38.205  1.00 45.07  ? 354  GLN A CG    1 
ATOM   3580 C  CD    . GLN C 3 354 ? 19.960  53.248 39.195  1.00 45.90  ? 354  GLN A CD    1 
ATOM   3581 O  OE1   . GLN C 3 354 ? 20.255  53.239 40.402  1.00 46.03  ? 354  GLN A OE1   1 
ATOM   3582 N  NE2   . GLN C 3 354 ? 19.032  54.064 38.686  1.00 47.45  ? 354  GLN A NE2   1 
ATOM   3583 N  N     . ILE C 3 355 ? 19.252  48.261 36.248  1.00 43.79  ? 355  ILE A N     1 
ATOM   3584 C  CA    . ILE C 3 355 ? 18.292  47.237 35.830  1.00 43.39  ? 355  ILE A CA    1 
ATOM   3585 C  C     . ILE C 3 355 ? 16.818  47.582 36.129  1.00 43.11  ? 355  ILE A C     1 
ATOM   3586 O  O     . ILE C 3 355 ? 15.949  47.343 35.280  1.00 42.85  ? 355  ILE A O     1 
ATOM   3587 C  CB    . ILE C 3 355 ? 18.662  45.871 36.448  1.00 43.46  ? 355  ILE A CB    1 
ATOM   3588 C  CG1   . ILE C 3 355 ? 20.111  45.500 36.101  1.00 43.01  ? 355  ILE A CG1   1 
ATOM   3589 C  CG2   . ILE C 3 355 ? 17.687  44.789 36.020  1.00 43.49  ? 355  ILE A CG2   1 
ATOM   3590 C  CD1   . ILE C 3 355 ? 20.504  45.699 34.653  1.00 42.76  ? 355  ILE A CD1   1 
ATOM   3591 N  N     . GLN C 3 356 ? 16.545  48.161 37.306  1.00 42.52  ? 356  GLN A N     1 
ATOM   3592 C  CA    . GLN C 3 356 ? 15.161  48.454 37.704  1.00 42.27  ? 356  GLN A CA    1 
ATOM   3593 C  C     . GLN C 3 356 ? 14.559  49.579 36.876  1.00 42.30  ? 356  GLN A C     1 
ATOM   3594 O  O     . GLN C 3 356 ? 13.372  49.879 36.993  1.00 42.50  ? 356  GLN A O     1 
ATOM   3595 C  CB    . GLN C 3 356 ? 15.012  48.725 39.218  1.00 42.32  ? 356  GLN A CB    1 
ATOM   3596 C  CG    . GLN C 3 356 ? 15.543  50.083 39.720  1.00 42.39  ? 356  GLN A CG    1 
ATOM   3597 C  CD    . GLN C 3 356 ? 17.025  50.059 40.122  1.00 43.49  ? 356  GLN A CD    1 
ATOM   3598 O  OE1   . GLN C 3 356 ? 17.792  49.156 39.757  1.00 43.37  ? 356  GLN A OE1   1 
ATOM   3599 N  NE2   . GLN C 3 356 ? 17.428  51.065 40.872  1.00 43.46  ? 356  GLN A NE2   1 
ATOM   3600 N  N     . SER C 3 357 ? 15.377  50.194 36.034  1.00 42.14  ? 357  SER A N     1 
ATOM   3601 C  CA    . SER C 3 357 ? 14.884  51.231 35.152  1.00 42.11  ? 357  SER A CA    1 
ATOM   3602 C  C     . SER C 3 357 ? 14.334  50.680 33.847  1.00 42.12  ? 357  SER A C     1 
ATOM   3603 O  O     . SER C 3 357 ? 13.941  51.457 32.956  1.00 42.02  ? 357  SER A O     1 
ATOM   3604 C  CB    . SER C 3 357 ? 15.937  52.306 34.915  1.00 42.03  ? 357  SER A CB    1 
ATOM   3605 O  OG    . SER C 3 357 ? 15.707  53.386 35.805  1.00 43.32  ? 357  SER A OG    1 
ATOM   3606 N  N     . VAL C 3 358 ? 14.276  49.349 33.743  1.00 41.83  ? 358  VAL A N     1 
ATOM   3607 C  CA    . VAL C 3 358 ? 13.548  48.737 32.623  1.00 42.21  ? 358  VAL A CA    1 
ATOM   3608 C  C     . VAL C 3 358 ? 12.028  49.004 32.681  1.00 42.04  ? 358  VAL A C     1 
ATOM   3609 O  O     . VAL C 3 358 ? 11.334  48.905 31.660  1.00 41.65  ? 358  VAL A O     1 
ATOM   3610 C  CB    . VAL C 3 358 ? 13.875  47.213 32.380  1.00 42.31  ? 358  VAL A CB    1 
ATOM   3611 C  CG1   . VAL C 3 358 ? 15.340  47.051 31.961  1.00 42.46  ? 358  VAL A CG1   1 
ATOM   3612 C  CG2   . VAL C 3 358 ? 13.497  46.321 33.586  1.00 41.21  ? 358  VAL A CG2   1 
ATOM   3613 N  N     . PHE C 3 359 ? 11.529  49.344 33.870  1.00 42.06  ? 359  PHE A N     1 
ATOM   3614 C  CA    . PHE C 3 359 ? 10.117  49.721 34.030  1.00 42.45  ? 359  PHE A CA    1 
ATOM   3615 C  C     . PHE C 3 359 ? 9.750   51.012 33.323  1.00 42.20  ? 359  PHE A C     1 
ATOM   3616 O  O     . PHE C 3 359 ? 8.632   51.124 32.838  1.00 42.19  ? 359  PHE A O     1 
ATOM   3617 C  CB    . PHE C 3 359 ? 9.696   49.768 35.505  1.00 42.45  ? 359  PHE A CB    1 
ATOM   3618 C  CG    . PHE C 3 359 ? 9.682   48.412 36.158  1.00 43.77  ? 359  PHE A CG    1 
ATOM   3619 C  CD1   . PHE C 3 359 ? 8.771   47.422 35.730  1.00 43.86  ? 359  PHE A CD1   1 
ATOM   3620 C  CD2   . PHE C 3 359 ? 10.597  48.097 37.160  1.00 43.08  ? 359  PHE A CD2   1 
ATOM   3621 C  CE1   . PHE C 3 359 ? 8.764   46.148 36.304  1.00 42.35  ? 359  PHE A CE1   1 
ATOM   3622 C  CE2   . PHE C 3 359 ? 10.587  46.826 37.741  1.00 42.62  ? 359  PHE A CE2   1 
ATOM   3623 C  CZ    . PHE C 3 359 ? 9.672   45.852 37.305  1.00 42.20  ? 359  PHE A CZ    1 
ATOM   3624 N  N     . SER C 3 360 ? 10.688  51.964 33.258  1.00 41.78  ? 360  SER A N     1 
ATOM   3625 C  CA    . SER C 3 360 ? 10.455  53.235 32.570  1.00 41.27  ? 360  SER A CA    1 
ATOM   3626 C  C     . SER C 3 360 ? 11.110  53.271 31.184  1.00 41.39  ? 360  SER A C     1 
ATOM   3627 O  O     . SER C 3 360 ? 12.345  53.399 31.071  1.00 41.66  ? 360  SER A O     1 
ATOM   3628 C  CB    . SER C 3 360 ? 10.943  54.410 33.416  1.00 41.25  ? 360  SER A CB    1 
ATOM   3629 O  OG    . SER C 3 360 ? 11.108  55.593 32.631  1.00 41.11  ? 360  SER A OG    1 
ATOM   3630 N  N     . PRO C 3 361 ? 10.290  53.166 30.118  1.00 41.15  ? 361  PRO A N     1 
ATOM   3631 C  CA    . PRO C 3 361 ? 10.824  53.241 28.758  1.00 40.75  ? 361  PRO A CA    1 
ATOM   3632 C  C     . PRO C 3 361 ? 11.331  54.638 28.407  1.00 40.46  ? 361  PRO A C     1 
ATOM   3633 O  O     . PRO C 3 361 ? 12.054  54.787 27.412  1.00 40.46  ? 361  PRO A O     1 
ATOM   3634 C  CB    . PRO C 3 361 ? 9.619   52.893 27.881  1.00 40.71  ? 361  PRO A CB    1 
ATOM   3635 C  CG    . PRO C 3 361 ? 8.421   53.306 28.708  1.00 40.79  ? 361  PRO A CG    1 
ATOM   3636 C  CD    . PRO C 3 361 ? 8.824   52.973 30.123  1.00 41.22  ? 361  PRO A CD    1 
ATOM   3637 N  N     . ILE C 3 362 ? 10.969  55.652 29.192  1.00 39.72  ? 362  ILE A N     1 
ATOM   3638 C  CA    . ILE C 3 362 ? 11.515  56.975 28.910  1.00 39.91  ? 362  ILE A CA    1 
ATOM   3639 C  C     . ILE C 3 362 ? 12.999  56.975 29.267  1.00 40.08  ? 362  ILE A C     1 
ATOM   3640 O  O     . ILE C 3 362 ? 13.823  57.433 28.484  1.00 40.16  ? 362  ILE A O     1 
ATOM   3641 C  CB    . ILE C 3 362 ? 10.688  58.150 29.524  1.00 39.65  ? 362  ILE A CB    1 
ATOM   3642 C  CG1   . ILE C 3 362 ? 9.444   58.374 28.660  1.00 39.95  ? 362  ILE A CG1   1 
ATOM   3643 C  CG2   . ILE C 3 362 ? 11.485  59.442 29.527  1.00 38.68  ? 362  ILE A CG2   1 
ATOM   3644 C  CD1   . ILE C 3 362 ? 8.451   59.370 29.201  1.00 41.39  ? 362  ILE A CD1   1 
ATOM   3645 N  N     . LYS C 3 363 ? 13.323  56.415 30.427  1.00 40.39  ? 363  LYS A N     1 
ATOM   3646 C  CA    . LYS C 3 363 ? 14.695  56.250 30.865  1.00 40.91  ? 363  LYS A CA    1 
ATOM   3647 C  C     . LYS C 3 363 ? 15.493  55.412 29.872  1.00 40.70  ? 363  LYS A C     1 
ATOM   3648 O  O     . LYS C 3 363 ? 16.543  55.847 29.377  1.00 40.58  ? 363  LYS A O     1 
ATOM   3649 C  CB    . LYS C 3 363 ? 14.711  55.567 32.230  1.00 41.55  ? 363  LYS A CB    1 
ATOM   3650 C  CG    . LYS C 3 363 ? 14.980  56.489 33.379  1.00 43.04  ? 363  LYS A CG    1 
ATOM   3651 C  CD    . LYS C 3 363 ? 16.456  56.617 33.604  1.00 45.79  ? 363  LYS A CD    1 
ATOM   3652 C  CE    . LYS C 3 363 ? 16.724  57.085 35.027  1.00 49.26  ? 363  LYS A CE    1 
ATOM   3653 N  NZ    . LYS C 3 363 ? 16.697  58.577 35.154  1.00 50.91  ? 363  LYS A NZ    1 
ATOM   3654 N  N     . THR C 3 364 ? 14.975  54.218 29.585  1.00 40.41  ? 364  THR A N     1 
ATOM   3655 C  CA    . THR C 3 364 ? 15.591  53.290 28.649  1.00 40.05  ? 364  THR A CA    1 
ATOM   3656 C  C     . THR C 3 364 ? 16.026  54.033 27.385  1.00 40.38  ? 364  THR A C     1 
ATOM   3657 O  O     . THR C 3 364 ? 17.192  53.950 26.971  1.00 40.23  ? 364  THR A O     1 
ATOM   3658 C  CB    . THR C 3 364 ? 14.628  52.131 28.300  1.00 39.99  ? 364  THR A CB    1 
ATOM   3659 O  OG1   . THR C 3 364 ? 14.030  51.634 29.504  1.00 39.81  ? 364  THR A OG1   1 
ATOM   3660 C  CG2   . THR C 3 364 ? 15.355  50.992 27.570  1.00 38.64  ? 364  THR A CG2   1 
ATOM   3661 N  N     . TRP C 3 365 ? 15.104  54.780 26.788  1.00 40.49  ? 365  TRP A N     1 
ATOM   3662 C  CA    . TRP C 3 365 ? 15.419  55.456 25.537  1.00 40.97  ? 365  TRP A CA    1 
ATOM   3663 C  C     . TRP C 3 365 ? 16.359  56.638 25.702  1.00 40.93  ? 365  TRP A C     1 
ATOM   3664 O  O     . TRP C 3 365 ? 17.242  56.842 24.865  1.00 41.23  ? 365  TRP A O     1 
ATOM   3665 C  CB    . TRP C 3 365 ? 14.159  55.837 24.772  1.00 41.33  ? 365  TRP A CB    1 
ATOM   3666 C  CG    . TRP C 3 365 ? 13.565  54.661 24.084  1.00 41.87  ? 365  TRP A CG    1 
ATOM   3667 C  CD1   . TRP C 3 365 ? 12.383  54.064 24.371  1.00 41.83  ? 365  TRP A CD1   1 
ATOM   3668 C  CD2   . TRP C 3 365 ? 14.147  53.912 23.007  1.00 42.77  ? 365  TRP A CD2   1 
ATOM   3669 N  NE1   . TRP C 3 365 ? 12.176  52.995 23.532  1.00 42.52  ? 365  TRP A NE1   1 
ATOM   3670 C  CE2   . TRP C 3 365 ? 13.243  52.881 22.682  1.00 42.20  ? 365  TRP A CE2   1 
ATOM   3671 C  CE3   . TRP C 3 365 ? 15.348  54.014 22.282  1.00 43.26  ? 365  TRP A CE3   1 
ATOM   3672 C  CZ2   . TRP C 3 365 ? 13.491  51.959 21.664  1.00 42.54  ? 365  TRP A CZ2   1 
ATOM   3673 C  CZ3   . TRP C 3 365 ? 15.598  53.092 21.265  1.00 42.34  ? 365  TRP A CZ3   1 
ATOM   3674 C  CH2   . TRP C 3 365 ? 14.674  52.080 20.966  1.00 42.40  ? 365  TRP A CH2   1 
ATOM   3675 N  N     . ASP C 3 366 ? 16.193  57.400 26.778  1.00 40.32  ? 366  ASP A N     1 
ATOM   3676 C  CA    . ASP C 3 366 ? 17.105  58.492 27.059  1.00 40.27  ? 366  ASP A CA    1 
ATOM   3677 C  C     . ASP C 3 366 ? 18.544  57.981 27.086  1.00 40.43  ? 366  ASP A C     1 
ATOM   3678 O  O     . ASP C 3 366 ? 19.440  58.579 26.487  1.00 40.49  ? 366  ASP A O     1 
ATOM   3679 C  CB    . ASP C 3 366 ? 16.762  59.157 28.389  1.00 40.31  ? 366  ASP A CB    1 
ATOM   3680 C  CG    . ASP C 3 366 ? 17.317  60.566 28.498  1.00 40.61  ? 366  ASP A CG    1 
ATOM   3681 O  OD1   . ASP C 3 366 ? 17.408  61.274 27.466  1.00 40.49  ? 366  ASP A OD1   1 
ATOM   3682 O  OD2   . ASP C 3 366 ? 17.648  60.974 29.629  1.00 40.78  ? 366  ASP A OD2   1 
ATOM   3683 N  N     . ALA C 3 367 ? 18.767  56.860 27.766  1.00 40.68  ? 367  ALA A N     1 
ATOM   3684 C  CA    . ALA C 3 367 ? 20.112  56.285 27.837  1.00 40.56  ? 367  ALA A CA    1 
ATOM   3685 C  C     . ALA C 3 367 ? 20.595  55.698 26.503  1.00 40.37  ? 367  ALA A C     1 
ATOM   3686 O  O     . ALA C 3 367 ? 21.746  55.877 26.137  1.00 40.56  ? 367  ALA A O     1 
ATOM   3687 C  CB    . ALA C 3 367 ? 20.196  55.264 28.934  1.00 40.38  ? 367  ALA A CB    1 
ATOM   3688 N  N     . ILE C 3 368 ? 19.727  55.007 25.778  1.00 40.27  ? 368  ILE A N     1 
ATOM   3689 C  CA    . ILE C 3 368 ? 20.117  54.474 24.487  1.00 40.38  ? 368  ILE A CA    1 
ATOM   3690 C  C     . ILE C 3 368 ? 20.513  55.648 23.601  1.00 41.20  ? 368  ILE A C     1 
ATOM   3691 O  O     . ILE C 3 368 ? 21.559  55.619 22.954  1.00 41.37  ? 368  ILE A O     1 
ATOM   3692 C  CB    . ILE C 3 368 ? 18.993  53.601 23.845  1.00 40.26  ? 368  ILE A CB    1 
ATOM   3693 C  CG1   . ILE C 3 368 ? 18.842  52.278 24.596  1.00 39.20  ? 368  ILE A CG1   1 
ATOM   3694 C  CG2   . ILE C 3 368 ? 19.275  53.311 22.388  1.00 39.93  ? 368  ILE A CG2   1 
ATOM   3695 C  CD1   . ILE C 3 368 ? 17.604  51.529 24.262  1.00 36.46  ? 368  ILE A CD1   1 
ATOM   3696 N  N     . ILE C 3 369 ? 19.703  56.699 23.603  1.00 41.84  ? 369  ILE A N     1 
ATOM   3697 C  CA    . ILE C 3 369 ? 19.922  57.801 22.684  1.00 42.81  ? 369  ILE A CA    1 
ATOM   3698 C  C     . ILE C 3 369 ? 21.166  58.588 23.053  1.00 44.10  ? 369  ILE A C     1 
ATOM   3699 O  O     . ILE C 3 369 ? 21.942  58.998 22.183  1.00 44.36  ? 369  ILE A O     1 
ATOM   3700 C  CB    . ILE C 3 369 ? 18.695  58.683 22.605  1.00 42.57  ? 369  ILE A CB    1 
ATOM   3701 C  CG1   . ILE C 3 369 ? 17.647  57.975 21.744  1.00 42.91  ? 369  ILE A CG1   1 
ATOM   3702 C  CG2   . ILE C 3 369 ? 19.024  60.040 22.016  1.00 41.86  ? 369  ILE A CG2   1 
ATOM   3703 C  CD1   . ILE C 3 369 ? 16.209  58.339 22.090  1.00 42.70  ? 369  ILE A CD1   1 
ATOM   3704 N  N     . PHE C 3 370 ? 21.359  58.796 24.347  1.00 45.37  ? 370  PHE A N     1 
ATOM   3705 C  CA    . PHE C 3 370 ? 22.539  59.485 24.826  1.00 46.59  ? 370  PHE A CA    1 
ATOM   3706 C  C     . PHE C 3 370 ? 23.789  58.689 24.452  1.00 47.33  ? 370  PHE A C     1 
ATOM   3707 O  O     . PHE C 3 370 ? 24.677  59.216 23.779  1.00 47.28  ? 370  PHE A O     1 
ATOM   3708 C  CB    . PHE C 3 370 ? 22.412  59.772 26.332  1.00 46.72  ? 370  PHE A CB    1 
ATOM   3709 C  CG    . PHE C 3 370 ? 23.711  59.807 27.071  1.00 46.93  ? 370  PHE A CG    1 
ATOM   3710 C  CD1   . PHE C 3 370 ? 24.689  60.745 26.762  1.00 46.89  ? 370  PHE A CD1   1 
ATOM   3711 C  CD2   . PHE C 3 370 ? 23.943  58.913 28.114  1.00 47.74  ? 370  PHE A CD2   1 
ATOM   3712 C  CE1   . PHE C 3 370 ? 25.902  60.771 27.472  1.00 47.82  ? 370  PHE A CE1   1 
ATOM   3713 C  CE2   . PHE C 3 370 ? 25.142  58.930 28.835  1.00 47.28  ? 370  PHE A CE2   1 
ATOM   3714 C  CZ    . PHE C 3 370 ? 26.128  59.857 28.510  1.00 47.54  ? 370  PHE A CZ    1 
ATOM   3715 N  N     . ASN C 3 371 ? 23.851  57.422 24.853  1.00 48.48  ? 371  ASN A N     1 
ATOM   3716 C  CA    . ASN C 3 371 ? 24.994  56.573 24.489  1.00 49.62  ? 371  ASN A CA    1 
ATOM   3717 C  C     . ASN C 3 371 ? 25.293  56.613 23.000  1.00 50.30  ? 371  ASN A C     1 
ATOM   3718 O  O     . ASN C 3 371 ? 26.428  56.826 22.606  1.00 51.04  ? 371  ASN A O     1 
ATOM   3719 C  CB    . ASN C 3 371 ? 24.785  55.139 24.930  1.00 49.56  ? 371  ASN A CB    1 
ATOM   3720 C  CG    . ASN C 3 371 ? 24.941  54.965 26.419  1.00 50.74  ? 371  ASN A CG    1 
ATOM   3721 O  OD1   . ASN C 3 371 ? 26.025  55.166 26.962  1.00 51.72  ? 371  ASN A OD1   1 
ATOM   3722 N  ND2   . ASN C 3 371 ? 23.858  54.572 27.093  1.00 51.03  ? 371  ASN A ND2   1 
ATOM   3723 N  N     . SER C 3 372 ? 24.273  56.440 22.172  1.00 51.02  ? 372  SER A N     1 
ATOM   3724 C  CA    . SER C 3 372 ? 24.464  56.474 20.735  1.00 51.67  ? 372  SER A CA    1 
ATOM   3725 C  C     . SER C 3 372 ? 25.000  57.833 20.317  1.00 52.37  ? 372  SER A C     1 
ATOM   3726 O  O     . SER C 3 372 ? 25.889  57.931 19.476  1.00 52.69  ? 372  SER A O     1 
ATOM   3727 C  CB    . SER C 3 372 ? 23.151  56.157 20.030  1.00 51.59  ? 372  SER A CB    1 
ATOM   3728 O  OG    . SER C 3 372 ? 23.096  56.719 18.731  1.00 51.92  ? 372  SER A OG    1 
ATOM   3729 N  N     . LEU C 3 373 ? 24.472  58.881 20.935  1.00 53.41  ? 373  LEU A N     1 
ATOM   3730 C  CA    . LEU C 3 373 ? 24.868  60.251 20.631  1.00 54.13  ? 373  LEU A CA    1 
ATOM   3731 C  C     . LEU C 3 373 ? 26.313  60.538 21.056  1.00 55.02  ? 373  LEU A C     1 
ATOM   3732 O  O     . LEU C 3 373 ? 27.047  61.237 20.353  1.00 55.15  ? 373  LEU A O     1 
ATOM   3733 C  CB    . LEU C 3 373 ? 23.931  61.192 21.360  1.00 53.58  ? 373  LEU A CB    1 
ATOM   3734 C  CG    . LEU C 3 373 ? 23.162  62.222 20.564  1.00 53.61  ? 373  LEU A CG    1 
ATOM   3735 C  CD1   . LEU C 3 373 ? 22.941  61.802 19.120  1.00 52.54  ? 373  LEU A CD1   1 
ATOM   3736 C  CD2   . LEU C 3 373 ? 21.850  62.426 21.292  1.00 53.71  ? 373  LEU A CD2   1 
ATOM   3737 N  N     . LYS C 3 374 ? 26.714  59.981 22.199  1.00 55.89  ? 374  LYS A N     1 
ATOM   3738 C  CA    . LYS C 3 374 ? 28.024  60.253 22.781  1.00 56.67  ? 374  LYS A CA    1 
ATOM   3739 C  C     . LYS C 3 374 ? 29.165  59.783 21.895  1.00 57.30  ? 374  LYS A C     1 
ATOM   3740 O  O     . LYS C 3 374 ? 30.168  60.480 21.773  1.00 57.57  ? 374  LYS A O     1 
ATOM   3741 C  CB    . LYS C 3 374 ? 28.144  59.630 24.171  1.00 56.64  ? 374  LYS A CB    1 
ATOM   3742 C  CG    . LYS C 3 374 ? 29.306  60.161 24.977  1.00 56.65  ? 374  LYS A CG    1 
ATOM   3743 C  CD    . LYS C 3 374 ? 29.660  59.227 26.126  1.00 57.84  ? 374  LYS A CD    1 
ATOM   3744 C  CE    . LYS C 3 374 ? 30.747  58.235 25.730  1.00 57.63  ? 374  LYS A CE    1 
ATOM   3745 N  NZ    . LYS C 3 374 ? 31.055  57.254 26.806  1.00 58.13  ? 374  LYS A NZ    1 
ATOM   3746 N  N     . GLU C 3 375 ? 29.012  58.623 21.257  1.00 58.19  ? 375  GLU A N     1 
ATOM   3747 C  CA    . GLU C 3 375 ? 30.107  58.073 20.432  1.00 58.95  ? 375  GLU A CA    1 
ATOM   3748 C  C     . GLU C 3 375 ? 30.367  58.875 19.152  1.00 58.83  ? 375  GLU A C     1 
ATOM   3749 O  O     . GLU C 3 375 ? 31.413  58.730 18.531  1.00 59.11  ? 375  GLU A O     1 
ATOM   3750 C  CB    . GLU C 3 375 ? 29.964  56.558 20.173  1.00 58.90  ? 375  GLU A CB    1 
ATOM   3751 C  CG    . GLU C 3 375 ? 28.602  56.081 19.688  1.00 61.42  ? 375  GLU A CG    1 
ATOM   3752 C  CD    . GLU C 3 375 ? 28.534  55.831 18.169  1.00 65.75  ? 375  GLU A CD    1 
ATOM   3753 O  OE1   . GLU C 3 375 ? 29.612  55.747 17.505  1.00 66.67  ? 375  GLU A OE1   1 
ATOM   3754 O  OE2   . GLU C 3 375 ? 27.390  55.705 17.646  1.00 65.62  ? 375  GLU A OE2   1 
ATOM   3755 N  N     . GLN C 3 376 ? 29.427  59.734 18.780  1.00 58.89  ? 376  GLN A N     1 
ATOM   3756 C  CA    . GLN C 3 376 ? 29.641  60.636 17.658  1.00 59.09  ? 376  GLN A CA    1 
ATOM   3757 C  C     . GLN C 3 376 ? 29.978  62.034 18.170  1.00 58.79  ? 376  GLN A C     1 
ATOM   3758 O  O     . GLN C 3 376 ? 29.915  63.021 17.413  1.00 58.70  ? 376  GLN A O     1 
ATOM   3759 C  CB    . GLN C 3 376 ? 28.416  60.694 16.751  1.00 59.36  ? 376  GLN A CB    1 
ATOM   3760 C  CG    . GLN C 3 376 ? 27.691  59.372 16.567  1.00 61.17  ? 376  GLN A CG    1 
ATOM   3761 C  CD    . GLN C 3 376 ? 26.362  59.558 15.847  1.00 63.28  ? 376  GLN A CD    1 
ATOM   3762 O  OE1   . GLN C 3 376 ? 26.331  59.876 14.654  1.00 63.29  ? 376  GLN A OE1   1 
ATOM   3763 N  NE2   . GLN C 3 376 ? 25.255  59.361 16.572  1.00 64.06  ? 376  GLN A NE2   1 
ATOM   3764 N  N     . ASN C 3 377 ? 30.338  62.107 19.455  1.00 58.24  ? 377  ASN A N     1 
ATOM   3765 C  CA    . ASN C 3 377 ? 30.760  63.362 20.091  1.00 57.98  ? 377  ASN A CA    1 
ATOM   3766 C  C     . ASN C 3 377 ? 29.721  64.472 19.951  1.00 57.47  ? 377  ASN A C     1 
ATOM   3767 O  O     . ASN C 3 377 ? 30.045  65.602 19.580  1.00 57.46  ? 377  ASN A O     1 
ATOM   3768 C  CB    . ASN C 3 377 ? 32.123  63.833 19.549  1.00 58.18  ? 377  ASN A CB    1 
ATOM   3769 C  CG    . ASN C 3 377 ? 33.285  63.038 20.112  1.00 58.55  ? 377  ASN A CG    1 
ATOM   3770 O  OD1   . ASN C 3 377 ? 34.145  63.590 20.781  1.00 60.82  ? 377  ASN A OD1   1 
ATOM   3771 N  ND2   . ASN C 3 377 ? 33.316  61.740 19.842  1.00 58.67  ? 377  ASN A ND2   1 
ATOM   3772 N  N     . LYS C 3 378 ? 28.473  64.128 20.247  1.00 56.72  ? 378  LYS A N     1 
ATOM   3773 C  CA    . LYS C 3 378 ? 27.374  65.065 20.161  1.00 55.80  ? 378  LYS A CA    1 
ATOM   3774 C  C     . LYS C 3 378 ? 26.791  65.305 21.536  1.00 55.52  ? 378  LYS A C     1 
ATOM   3775 O  O     . LYS C 3 378 ? 26.810  64.426 22.407  1.00 55.43  ? 378  LYS A O     1 
ATOM   3776 C  CB    . LYS C 3 378 ? 26.299  64.567 19.202  1.00 55.85  ? 378  LYS A CB    1 
ATOM   3777 C  CG    . LYS C 3 378 ? 26.777  64.372 17.760  1.00 56.09  ? 378  LYS A CG    1 
ATOM   3778 C  CD    . LYS C 3 378 ? 25.734  64.888 16.763  1.00 56.09  ? 378  LYS A CD    1 
ATOM   3779 C  CE    . LYS C 3 378 ? 26.091  64.573 15.319  1.00 55.03  ? 378  LYS A CE    1 
ATOM   3780 N  NZ    . LYS C 3 378 ? 25.730  63.190 14.969  1.00 55.38  ? 378  LYS A NZ    1 
ATOM   3781 N  N     . VAL C 3 379 ? 26.285  66.514 21.726  1.00 55.22  ? 379  VAL A N     1 
ATOM   3782 C  CA    . VAL C 3 379 ? 25.776  66.931 23.013  1.00 55.33  ? 379  VAL A CA    1 
ATOM   3783 C  C     . VAL C 3 379 ? 24.249  66.896 22.985  1.00 54.96  ? 379  VAL A C     1 
ATOM   3784 O  O     . VAL C 3 379 ? 23.628  67.381 22.029  1.00 55.15  ? 379  VAL A O     1 
ATOM   3785 C  CB    . VAL C 3 379 ? 26.303  68.337 23.394  1.00 55.78  ? 379  VAL A CB    1 
ATOM   3786 C  CG1   . VAL C 3 379 ? 26.057  68.616 24.874  1.00 55.73  ? 379  VAL A CG1   1 
ATOM   3787 C  CG2   . VAL C 3 379 ? 27.811  68.450 23.084  1.00 56.21  ? 379  VAL A CG2   1 
ATOM   3788 N  N     . ILE C 3 380 ? 23.662  66.300 24.028  1.00 54.32  ? 380  ILE A N     1 
ATOM   3789 C  CA    . ILE C 3 380 ? 22.206  66.084 24.130  1.00 53.41  ? 380  ILE A CA    1 
ATOM   3790 C  C     . ILE C 3 380 ? 21.515  67.338 24.681  1.00 53.12  ? 380  ILE A C     1 
ATOM   3791 O  O     . ILE C 3 380 ? 22.118  68.072 25.470  1.00 53.10  ? 380  ILE A O     1 
ATOM   3792 C  CB    . ILE C 3 380 ? 21.851  64.832 25.003  1.00 53.13  ? 380  ILE A CB    1 
ATOM   3793 C  CG1   . ILE C 3 380 ? 22.230  65.052 26.467  1.00 52.42  ? 380  ILE A CG1   1 
ATOM   3794 C  CG2   . ILE C 3 380 ? 22.501  63.560 24.443  1.00 52.51  ? 380  ILE A CG2   1 
ATOM   3795 C  CD1   . ILE C 3 380 ? 21.941  63.879 27.361  1.00 53.23  ? 380  ILE A CD1   1 
ATOM   3796 N  N     . PRO C 3 381 ? 20.250  67.582 24.281  1.00 52.55  ? 381  PRO A N     1 
ATOM   3797 C  CA    . PRO C 3 381 ? 19.565  68.791 24.706  1.00 52.26  ? 381  PRO A CA    1 
ATOM   3798 C  C     . PRO C 3 381 ? 19.280  68.735 26.179  1.00 52.27  ? 381  PRO A C     1 
ATOM   3799 O  O     . PRO C 3 381 ? 19.408  67.683 26.788  1.00 52.23  ? 381  PRO A O     1 
ATOM   3800 C  CB    . PRO C 3 381 ? 18.237  68.740 23.943  1.00 52.05  ? 381  PRO A CB    1 
ATOM   3801 C  CG    . PRO C 3 381 ? 18.377  67.702 22.934  1.00 52.05  ? 381  PRO A CG    1 
ATOM   3802 C  CD    . PRO C 3 381 ? 19.388  66.741 23.439  1.00 52.63  ? 381  PRO A CD    1 
ATOM   3803 N  N     . GLN C 3 382 ? 18.905  69.862 26.760  1.00 52.88  ? 382  GLN A N     1 
ATOM   3804 C  CA    . GLN C 3 382 ? 18.371  69.828 28.102  1.00 53.82  ? 382  GLN A CA    1 
ATOM   3805 C  C     . GLN C 3 382 ? 16.886  69.457 28.070  1.00 54.74  ? 382  GLN A C     1 
ATOM   3806 O  O     . GLN C 3 382 ? 16.146  69.885 27.170  1.00 54.82  ? 382  GLN A O     1 
ATOM   3807 C  CB    . GLN C 3 382 ? 18.552  71.158 28.798  1.00 53.30  ? 382  GLN A CB    1 
ATOM   3808 C  CG    . GLN C 3 382 ? 18.062  71.110 30.220  1.00 53.61  ? 382  GLN A CG    1 
ATOM   3809 C  CD    . GLN C 3 382 ? 18.325  72.383 30.967  1.00 54.92  ? 382  GLN A CD    1 
ATOM   3810 O  OE1   . GLN C 3 382 ? 18.481  73.457 30.361  1.00 55.95  ? 382  GLN A OE1   1 
ATOM   3811 N  NE2   . GLN C 3 382 ? 18.376  72.288 32.300  1.00 54.71  ? 382  GLN A NE2   1 
ATOM   3812 N  N     . GLY C 3 383 ? 16.467  68.647 29.046  1.00 55.73  ? 383  GLY A N     1 
ATOM   3813 C  CA    . GLY C 3 383 ? 15.049  68.366 29.289  1.00 57.01  ? 383  GLY A CA    1 
ATOM   3814 C  C     . GLY C 3 383 ? 14.327  69.649 29.662  1.00 58.01  ? 383  GLY A C     1 
ATOM   3815 O  O     . GLY C 3 383 ? 14.735  70.351 30.591  1.00 58.07  ? 383  GLY A O     1 
ATOM   3816 N  N     . ARG C 3 384 ? 13.278  69.971 28.910  1.00 58.78  ? 384  ARG A N     1 
ATOM   3817 C  CA    . ARG C 3 384 ? 12.508  71.189 29.130  1.00 59.81  ? 384  ARG A CA    1 
ATOM   3818 C  C     . ARG C 3 384 ? 11.081  70.823 29.514  1.00 59.67  ? 384  ARG A C     1 
ATOM   3819 O  O     . ARG C 3 384 ? 10.605  69.752 29.144  1.00 60.18  ? 384  ARG A O     1 
ATOM   3820 C  CB    . ARG C 3 384 ? 12.530  72.065 27.872  1.00 60.30  ? 384  ARG A CB    1 
ATOM   3821 C  CG    . ARG C 3 384 ? 13.922  72.550 27.466  1.00 63.07  ? 384  ARG A CG    1 
ATOM   3822 C  CD    . ARG C 3 384 ? 14.604  73.280 28.633  1.00 67.75  ? 384  ARG A CD    1 
ATOM   3823 N  NE    . ARG C 3 384 ? 15.630  74.233 28.198  1.00 70.97  ? 384  ARG A NE    1 
ATOM   3824 C  CZ    . ARG C 3 384 ? 16.086  75.241 28.943  1.00 72.94  ? 384  ARG A CZ    1 
ATOM   3825 N  NH1   . ARG C 3 384 ? 15.605  75.446 30.168  1.00 73.06  ? 384  ARG A NH1   1 
ATOM   3826 N  NH2   . ARG C 3 384 ? 17.019  76.057 28.459  1.00 74.27  ? 384  ARG A NH2   1 
ATOM   3827 N  N     . SER C 3 385 ? 10.407  71.696 30.260  1.00 59.48  ? 385  SER A N     1 
ATOM   3828 C  CA    . SER C 3 385 ? 9.045   71.413 30.730  1.00 59.18  ? 385  SER A CA    1 
ATOM   3829 C  C     . SER C 3 385 ? 7.989   71.773 29.683  1.00 58.67  ? 385  SER A C     1 
ATOM   3830 O  O     . SER C 3 385 ? 8.204   72.671 28.862  1.00 58.88  ? 385  SER A O     1 
ATOM   3831 C  CB    . SER C 3 385 ? 8.754   72.146 32.044  1.00 59.45  ? 385  SER A CB    1 
ATOM   3832 O  OG    . SER C 3 385 ? 7.969   73.305 31.816  1.00 59.91  ? 385  SER A OG    1 
ATOM   3833 N  N     . HIS C 3 386 ? 6.852   71.077 29.727  1.00 57.77  ? 386  HIS A N     1 
ATOM   3834 C  CA    . HIS C 3 386 ? 5.776   71.262 28.748  1.00 56.87  ? 386  HIS A CA    1 
ATOM   3835 C  C     . HIS C 3 386 ? 4.384   70.993 29.305  1.00 56.04  ? 386  HIS A C     1 
ATOM   3836 O  O     . HIS C 3 386 ? 4.205   70.109 30.148  1.00 55.55  ? 386  HIS A O     1 
ATOM   3837 C  CB    . HIS C 3 386 ? 5.970   70.329 27.559  1.00 57.06  ? 386  HIS A CB    1 
ATOM   3838 C  CG    . HIS C 3 386 ? 7.298   70.459 26.903  1.00 57.12  ? 386  HIS A CG    1 
ATOM   3839 N  ND1   . HIS C 3 386 ? 8.322   69.566 27.123  1.00 57.64  ? 386  HIS A ND1   1 
ATOM   3840 C  CD2   . HIS C 3 386 ? 7.779   71.384 26.044  1.00 57.53  ? 386  HIS A CD2   1 
ATOM   3841 C  CE1   . HIS C 3 386 ? 9.377   69.930 26.418  1.00 57.61  ? 386  HIS A CE1   1 
ATOM   3842 N  NE2   . HIS C 3 386 ? 9.072   71.030 25.753  1.00 58.08  ? 386  HIS A NE2   1 
ATOM   3843 N  N     . PRO C 3 387 ? 3.381   71.734 28.803  1.00 55.36  ? 387  PRO A N     1 
ATOM   3844 C  CA    . PRO C 3 387 ? 2.016   71.392 29.161  1.00 54.91  ? 387  PRO A CA    1 
ATOM   3845 C  C     . PRO C 3 387 ? 1.599   70.115 28.434  1.00 54.53  ? 387  PRO A C     1 
ATOM   3846 O  O     . PRO C 3 387 ? 2.103   69.834 27.343  1.00 54.77  ? 387  PRO A O     1 
ATOM   3847 C  CB    . PRO C 3 387 ? 1.216   72.585 28.643  1.00 54.92  ? 387  PRO A CB    1 
ATOM   3848 C  CG    . PRO C 3 387 ? 2.026   73.103 27.491  1.00 54.82  ? 387  PRO A CG    1 
ATOM   3849 C  CD    . PRO C 3 387 ? 3.449   72.899 27.900  1.00 55.23  ? 387  PRO A CD    1 
ATOM   3850 N  N     . VAL C 3 388 ? 0.703   69.345 29.045  1.00 53.71  ? 388  VAL A N     1 
ATOM   3851 C  CA    . VAL C 3 388 ? 0.086   68.193 28.388  1.00 52.81  ? 388  VAL A CA    1 
ATOM   3852 C  C     . VAL C 3 388 ? -0.890  68.670 27.292  1.00 52.41  ? 388  VAL A C     1 
ATOM   3853 O  O     . VAL C 3 388 ? -1.475  69.741 27.408  1.00 52.23  ? 388  VAL A O     1 
ATOM   3854 C  CB    . VAL C 3 388 ? -0.634  67.278 29.423  1.00 52.79  ? 388  VAL A CB    1 
ATOM   3855 C  CG1   . VAL C 3 388 ? -1.107  65.975 28.777  1.00 51.71  ? 388  VAL A CG1   1 
ATOM   3856 C  CG2   . VAL C 3 388 ? 0.299   66.976 30.597  1.00 51.82  ? 388  VAL A CG2   1 
ATOM   3857 N  N     . GLN C 3 389 ? -1.039  67.888 26.225  1.00 51.73  ? 389  GLN A N     1 
ATOM   3858 C  CA    . GLN C 3 389 ? -1.953  68.232 25.131  1.00 51.34  ? 389  GLN A CA    1 
ATOM   3859 C  C     . GLN C 3 389 ? -2.421  67.010 24.364  1.00 50.12  ? 389  GLN A C     1 
ATOM   3860 O  O     . GLN C 3 389 ? -1.624  66.123 24.061  1.00 50.20  ? 389  GLN A O     1 
ATOM   3861 C  CB    . GLN C 3 389 ? -1.306  69.203 24.135  1.00 51.63  ? 389  GLN A CB    1 
ATOM   3862 C  CG    . GLN C 3 389 ? -1.303  70.643 24.599  1.00 54.03  ? 389  GLN A CG    1 
ATOM   3863 C  CD    . GLN C 3 389 ? -0.690  71.562 23.579  1.00 57.13  ? 389  GLN A CD    1 
ATOM   3864 O  OE1   . GLN C 3 389 ? -1.322  71.892 22.582  1.00 59.74  ? 389  GLN A OE1   1 
ATOM   3865 N  NE2   . GLN C 3 389 ? 0.551   71.985 23.819  1.00 57.48  ? 389  GLN A NE2   1 
ATOM   3866 N  N     . PRO C 3 390 ? -3.720  66.964 24.030  1.00 48.92  ? 390  PRO A N     1 
ATOM   3867 C  CA    . PRO C 3 390 ? -4.207  65.884 23.186  1.00 47.78  ? 390  PRO A CA    1 
ATOM   3868 C  C     . PRO C 3 390 ? -3.594  66.011 21.802  1.00 46.66  ? 390  PRO A C     1 
ATOM   3869 O  O     . PRO C 3 390 ? -3.218  67.103 21.407  1.00 46.47  ? 390  PRO A O     1 
ATOM   3870 C  CB    . PRO C 3 390 ? -5.708  66.158 23.128  1.00 47.68  ? 390  PRO A CB    1 
ATOM   3871 C  CG    . PRO C 3 390 ? -5.990  66.975 24.372  1.00 47.78  ? 390  PRO A CG    1 
ATOM   3872 C  CD    . PRO C 3 390 ? -4.808  67.872 24.423  1.00 48.65  ? 390  PRO A CD    1 
ATOM   3873 N  N     . TYR C 3 391 ? -3.444  64.900 21.097  1.00 45.53  ? 391  TYR A N     1 
ATOM   3874 C  CA    . TYR C 3 391 ? -3.052  64.938 19.701  1.00 44.52  ? 391  TYR A CA    1 
ATOM   3875 C  C     . TYR C 3 391 ? -3.679  63.729 19.049  1.00 44.04  ? 391  TYR A C     1 
ATOM   3876 O  O     . TYR C 3 391 ? -3.924  62.760 19.732  1.00 44.29  ? 391  TYR A O     1 
ATOM   3877 C  CB    . TYR C 3 391 ? -1.525  64.981 19.550  1.00 44.48  ? 391  TYR A CB    1 
ATOM   3878 C  CG    . TYR C 3 391 ? -0.785  63.713 19.903  1.00 44.60  ? 391  TYR A CG    1 
ATOM   3879 C  CD1   . TYR C 3 391 ? -0.549  62.723 18.936  1.00 44.59  ? 391  TYR A CD1   1 
ATOM   3880 C  CD2   . TYR C 3 391 ? -0.281  63.512 21.183  1.00 43.77  ? 391  TYR A CD2   1 
ATOM   3881 C  CE1   . TYR C 3 391 ? 0.141   61.559 19.244  1.00 42.95  ? 391  TYR A CE1   1 
ATOM   3882 C  CE2   . TYR C 3 391 ? 0.404   62.350 21.499  1.00 44.00  ? 391  TYR A CE2   1 
ATOM   3883 C  CZ    . TYR C 3 391 ? 0.612   61.381 20.524  1.00 44.35  ? 391  TYR A CZ    1 
ATOM   3884 O  OH    . TYR C 3 391 ? 1.290   60.218 20.838  1.00 45.70  ? 391  TYR A OH    1 
ATOM   3885 N  N     . PRO C 3 392 ? -3.956  63.772 17.732  1.00 43.94  ? 392  PRO A N     1 
ATOM   3886 C  CA    . PRO C 3 392 ? -4.746  62.686 17.157  1.00 43.79  ? 392  PRO A CA    1 
ATOM   3887 C  C     . PRO C 3 392 ? -3.952  61.382 16.992  1.00 44.07  ? 392  PRO A C     1 
ATOM   3888 O  O     . PRO C 3 392 ? -2.723  61.404 16.854  1.00 44.07  ? 392  PRO A O     1 
ATOM   3889 C  CB    . PRO C 3 392 ? -5.141  63.247 15.800  1.00 43.66  ? 392  PRO A CB    1 
ATOM   3890 C  CG    . PRO C 3 392 ? -3.980  64.104 15.432  1.00 43.19  ? 392  PRO A CG    1 
ATOM   3891 C  CD    . PRO C 3 392 ? -3.567  64.758 16.705  1.00 43.72  ? 392  PRO A CD    1 
ATOM   3892 N  N     . GLY C 3 393 ? -4.657  60.257 17.008  1.00 44.32  ? 393  GLY A N     1 
ATOM   3893 C  CA    . GLY C 3 393 ? -4.024  58.944 16.928  1.00 44.50  ? 393  GLY A CA    1 
ATOM   3894 C  C     . GLY C 3 393 ? -4.399  58.196 15.666  1.00 44.55  ? 393  GLY A C     1 
ATOM   3895 O  O     . GLY C 3 393 ? -4.463  58.784 14.588  1.00 44.24  ? 393  GLY A O     1 
ATOM   3896 N  N     . ALA C 3 394 ? -4.665  56.901 15.804  1.00 44.68  ? 394  ALA A N     1 
ATOM   3897 C  CA    . ALA C 3 394 ? -4.804  56.039 14.645  1.00 45.52  ? 394  ALA A CA    1 
ATOM   3898 C  C     . ALA C 3 394 ? -6.170  56.194 14.003  1.00 46.71  ? 394  ALA A C     1 
ATOM   3899 O  O     . ALA C 3 394 ? -7.063  56.846 14.557  1.00 47.33  ? 394  ALA A O     1 
ATOM   3900 C  CB    . ALA C 3 394 ? -4.577  54.620 15.038  1.00 44.98  ? 394  ALA A CB    1 
ATOM   3901 N  N     . PHE C 3 395 ? -6.336  55.584 12.835  1.00 47.49  ? 395  PHE A N     1 
ATOM   3902 C  CA    . PHE C 3 395 ? -7.620  55.569 12.172  1.00 48.25  ? 395  PHE A CA    1 
ATOM   3903 C  C     . PHE C 3 395 ? -8.271  54.192 12.272  1.00 48.84  ? 395  PHE A C     1 
ATOM   3904 O  O     . PHE C 3 395 ? -7.661  53.160 11.949  1.00 48.90  ? 395  PHE A O     1 
ATOM   3905 C  CB    . PHE C 3 395 ? -7.484  56.002 10.708  1.00 48.44  ? 395  PHE A CB    1 
ATOM   3906 C  CG    . PHE C 3 395 ? -8.689  55.687 9.873   1.00 49.05  ? 395  PHE A CG    1 
ATOM   3907 C  CD1   . PHE C 3 395 ? -9.852  56.462 9.980   1.00 49.03  ? 395  PHE A CD1   1 
ATOM   3908 C  CD2   . PHE C 3 395 ? -8.677  54.598 9.004   1.00 49.25  ? 395  PHE A CD2   1 
ATOM   3909 C  CE1   . PHE C 3 395 ? -10.987 56.163 9.230   1.00 48.15  ? 395  PHE A CE1   1 
ATOM   3910 C  CE2   . PHE C 3 395 ? -9.812  54.288 8.241   1.00 49.96  ? 395  PHE A CE2   1 
ATOM   3911 C  CZ    . PHE C 3 395 ? -10.968 55.077 8.351   1.00 48.85  ? 395  PHE A CZ    1 
ATOM   3912 N  N     . VAL C 3 396 ? -9.523  54.186 12.715  1.00 49.38  ? 396  VAL A N     1 
ATOM   3913 C  CA    . VAL C 3 396 ? -10.296 52.952 12.798  1.00 49.80  ? 396  VAL A CA    1 
ATOM   3914 C  C     . VAL C 3 396 ? -11.510 53.081 11.902  1.00 50.22  ? 396  VAL A C     1 
ATOM   3915 O  O     . VAL C 3 396 ? -12.209 54.094 11.965  1.00 50.74  ? 396  VAL A O     1 
ATOM   3916 C  CB    . VAL C 3 396 ? -10.758 52.646 14.235  1.00 49.29  ? 396  VAL A CB    1 
ATOM   3917 C  CG1   . VAL C 3 396 ? -11.289 51.246 14.316  1.00 49.74  ? 396  VAL A CG1   1 
ATOM   3918 C  CG2   . VAL C 3 396 ? -9.621  52.776 15.192  1.00 49.36  ? 396  VAL A CG2   1 
ATOM   3919 N  N     . LYS C 3 397 ? -11.754 52.060 11.077  1.00 50.49  ? 397  LYS A N     1 
ATOM   3920 C  CA    . LYS C 3 397 ? -12.900 52.021 10.153  1.00 50.96  ? 397  LYS A CA    1 
ATOM   3921 C  C     . LYS C 3 397 ? -14.194 51.610 10.869  1.00 50.97  ? 397  LYS A C     1 
ATOM   3922 O  O     . LYS C 3 397 ? -14.173 50.772 11.765  1.00 51.26  ? 397  LYS A O     1 
ATOM   3923 C  CB    . LYS C 3 397 ? -12.602 51.054 8.996   1.00 50.81  ? 397  LYS A CB    1 
ATOM   3924 C  CG    . LYS C 3 397 ? -13.670 50.983 7.910   1.00 51.60  ? 397  LYS A CG    1 
ATOM   3925 C  CD    . LYS C 3 397 ? -13.297 49.961 6.823   1.00 52.15  ? 397  LYS A CD    1 
ATOM   3926 C  CE    . LYS C 3 397 ? -14.317 49.909 5.685   1.00 51.78  ? 397  LYS A CE    1 
ATOM   3927 N  NZ    . LYS C 3 397 ? -14.463 51.232 5.001   1.00 51.13  ? 397  LYS A NZ    1 
ATOM   3928 N  N     . GLU C 3 398 ? -15.315 52.209 10.480  1.00 51.13  ? 398  GLU A N     1 
ATOM   3929 C  CA    . GLU C 3 398 ? -16.627 51.759 10.947  1.00 50.96  ? 398  GLU A CA    1 
ATOM   3930 C  C     . GLU C 3 398 ? -17.119 50.616 10.065  1.00 50.77  ? 398  GLU A C     1 
ATOM   3931 O  O     . GLU C 3 398 ? -17.464 50.838 8.906   1.00 50.53  ? 398  GLU A O     1 
ATOM   3932 C  CB    . GLU C 3 398 ? -17.645 52.899 10.932  1.00 50.92  ? 398  GLU A CB    1 
ATOM   3933 C  CG    . GLU C 3 398 ? -18.952 52.550 11.606  1.00 51.17  ? 398  GLU A CG    1 
ATOM   3934 C  CD    . GLU C 3 398 ? -18.892 52.695 13.125  1.00 52.94  ? 398  GLU A CD    1 
ATOM   3935 O  OE1   . GLU C 3 398 ? -18.894 53.856 13.601  1.00 52.40  ? 398  GLU A OE1   1 
ATOM   3936 O  OE2   . GLU C 3 398 ? -18.860 51.652 13.842  1.00 53.03  ? 398  GLU A OE2   1 
ATOM   3937 N  N     . PRO C 3 399 ? -17.163 49.390 10.616  1.00 50.64  ? 399  PRO A N     1 
ATOM   3938 C  CA    . PRO C 3 399 ? -17.562 48.253 9.810   1.00 50.65  ? 399  PRO A CA    1 
ATOM   3939 C  C     . PRO C 3 399 ? -19.074 48.111 9.823   1.00 50.88  ? 399  PRO A C     1 
ATOM   3940 O  O     . PRO C 3 399 ? -19.719 48.459 10.825  1.00 50.85  ? 399  PRO A O     1 
ATOM   3941 C  CB    . PRO C 3 399 ? -16.925 47.076 10.547  1.00 50.57  ? 399  PRO A CB    1 
ATOM   3942 C  CG    . PRO C 3 399 ? -16.960 47.481 11.980  1.00 50.35  ? 399  PRO A CG    1 
ATOM   3943 C  CD    . PRO C 3 399 ? -16.885 48.999 12.011  1.00 50.64  ? 399  PRO A CD    1 
ATOM   3944 N  N     . ILE C 3 400 ? -19.630 47.614 8.721   1.00 50.94  ? 400  ILE A N     1 
ATOM   3945 C  CA    . ILE C 3 400 ? -21.045 47.260 8.676   1.00 50.86  ? 400  ILE A CA    1 
ATOM   3946 C  C     . ILE C 3 400 ? -21.240 45.995 9.497   1.00 50.66  ? 400  ILE A C     1 
ATOM   3947 O  O     . ILE C 3 400 ? -20.705 44.937 9.142   1.00 50.78  ? 400  ILE A O     1 
ATOM   3948 C  CB    . ILE C 3 400 ? -21.561 47.055 7.227   1.00 51.05  ? 400  ILE A CB    1 
ATOM   3949 C  CG1   . ILE C 3 400 ? -21.395 48.346 6.420   1.00 50.98  ? 400  ILE A CG1   1 
ATOM   3950 C  CG2   . ILE C 3 400 ? -23.035 46.610 7.239   1.00 50.90  ? 400  ILE A CG2   1 
ATOM   3951 C  CD1   . ILE C 3 400 ? -20.727 48.156 5.090   1.00 50.97  ? 400  ILE A CD1   1 
ATOM   3952 N  N     . PRO C 3 401 ? -21.997 46.103 10.603  1.00 50.38  ? 401  PRO A N     1 
ATOM   3953 C  CA    . PRO C 3 401 ? -22.271 44.969 11.476  1.00 50.52  ? 401  PRO A CA    1 
ATOM   3954 C  C     . PRO C 3 401 ? -22.996 43.826 10.747  1.00 51.13  ? 401  PRO A C     1 
ATOM   3955 O  O     . PRO C 3 401 ? -24.183 43.932 10.429  1.00 51.30  ? 401  PRO A O     1 
ATOM   3956 C  CB    . PRO C 3 401 ? -23.146 45.578 12.577  1.00 50.30  ? 401  PRO A CB    1 
ATOM   3957 C  CG    . PRO C 3 401 ? -22.851 47.044 12.533  1.00 49.83  ? 401  PRO A CG    1 
ATOM   3958 C  CD    . PRO C 3 401 ? -22.645 47.332 11.092  1.00 50.31  ? 401  PRO A CD    1 
ATOM   3959 N  N     . ASN C 3 402 ? -22.270 42.740 10.491  1.00 51.72  ? 402  ASN A N     1 
ATOM   3960 C  CA    . ASN C 3 402 ? -22.811 41.619 9.755   1.00 52.18  ? 402  ASN A CA    1 
ATOM   3961 C  C     . ASN C 3 402 ? -22.111 40.308 10.107  1.00 52.91  ? 402  ASN A C     1 
ATOM   3962 O  O     . ASN C 3 402 ? -21.152 40.301 10.879  1.00 53.02  ? 402  ASN A O     1 
ATOM   3963 C  CB    . ASN C 3 402 ? -22.630 41.899 8.272   1.00 52.12  ? 402  ASN A CB    1 
ATOM   3964 C  CG    . ASN C 3 402 ? -23.780 41.402 7.438   1.00 51.78  ? 402  ASN A CG    1 
ATOM   3965 O  OD1   . ASN C 3 402 ? -23.895 41.766 6.273   1.00 51.93  ? 402  ASN A OD1   1 
ATOM   3966 N  ND2   . ASN C 3 402 ? -24.646 40.583 8.023   1.00 51.37  ? 402  ASN A ND2   1 
ATOM   3967 N  N     . ARG C 3 403 ? -22.593 39.200 9.540   1.00 53.64  ? 403  ARG A N     1 
ATOM   3968 C  CA    . ARG C 3 403 ? -21.794 37.973 9.451   1.00 53.93  ? 403  ARG A CA    1 
ATOM   3969 C  C     . ARG C 3 403 ? -20.829 38.101 8.288   1.00 54.09  ? 403  ARG A C     1 
ATOM   3970 O  O     . ARG C 3 403 ? -21.121 38.803 7.310   1.00 54.02  ? 403  ARG A O     1 
ATOM   3971 C  CB    . ARG C 3 403 ? -22.678 36.747 9.231   1.00 54.03  ? 403  ARG A CB    1 
ATOM   3972 C  CG    . ARG C 3 403 ? -23.445 36.746 7.913   1.00 54.90  ? 403  ARG A CG    1 
ATOM   3973 C  CD    . ARG C 3 403 ? -24.214 35.458 7.726   1.00 55.18  ? 403  ARG A CD    1 
ATOM   3974 N  NE    . ARG C 3 403 ? -25.333 35.347 8.660   1.00 55.38  ? 403  ARG A NE    1 
ATOM   3975 C  CZ    . ARG C 3 403 ? -25.987 34.216 8.915   1.00 56.04  ? 403  ARG A CZ    1 
ATOM   3976 N  NH1   . ARG C 3 403 ? -25.632 33.088 8.307   1.00 54.92  ? 403  ARG A NH1   1 
ATOM   3977 N  NH2   . ARG C 3 403 ? -27.000 34.207 9.780   1.00 55.88  ? 403  ARG A NH2   1 
ATOM   3978 N  N     . TYR C 3 404 ? -19.679 37.436 8.394   1.00 54.54  ? 404  TYR A N     1 
ATOM   3979 C  CA    . TYR C 3 404 ? -18.732 37.371 7.278   1.00 55.03  ? 404  TYR A CA    1 
ATOM   3980 C  C     . TYR C 3 404 ? -18.171 35.955 7.110   1.00 55.80  ? 404  TYR A C     1 
ATOM   3981 O  O     . TYR C 3 404 ? -17.654 35.365 8.057   1.00 55.97  ? 404  TYR A O     1 
ATOM   3982 C  CB    . TYR C 3 404 ? -17.641 38.448 7.405   1.00 54.66  ? 404  TYR A CB    1 
ATOM   3983 C  CG    . TYR C 3 404 ? -18.201 39.861 7.356   1.00 53.96  ? 404  TYR A CG    1 
ATOM   3984 C  CD1   . TYR C 3 404 ? -18.637 40.496 8.511   1.00 53.90  ? 404  TYR A CD1   1 
ATOM   3985 C  CD2   . TYR C 3 404 ? -18.316 40.547 6.153   1.00 53.70  ? 404  TYR A CD2   1 
ATOM   3986 C  CE1   . TYR C 3 404 ? -19.176 41.778 8.471   1.00 54.98  ? 404  TYR A CE1   1 
ATOM   3987 C  CE2   . TYR C 3 404 ? -18.840 41.839 6.097   1.00 53.62  ? 404  TYR A CE2   1 
ATOM   3988 C  CZ    . TYR C 3 404 ? -19.273 42.450 7.260   1.00 54.62  ? 404  TYR A CZ    1 
ATOM   3989 O  OH    . TYR C 3 404 ? -19.804 43.726 7.230   1.00 53.81  ? 404  TYR A OH    1 
ATOM   3990 N  N     . LYS C 3 405 ? -18.300 35.407 5.902   1.00 56.75  ? 405  LYS A N     1 
ATOM   3991 C  CA    . LYS C 3 405 ? -18.007 33.989 5.659   1.00 57.66  ? 405  LYS A CA    1 
ATOM   3992 C  C     . LYS C 3 405 ? -16.540 33.724 5.395   1.00 57.49  ? 405  LYS A C     1 
ATOM   3993 O  O     . LYS C 3 405 ? -15.935 32.901 6.069   1.00 57.90  ? 405  LYS A O     1 
ATOM   3994 C  CB    . LYS C 3 405 ? -18.866 33.431 4.516   1.00 57.98  ? 405  LYS A CB    1 
ATOM   3995 C  CG    . LYS C 3 405 ? -18.800 31.918 4.363   1.00 58.28  ? 405  LYS A CG    1 
ATOM   3996 C  CD    . LYS C 3 405 ? -19.901 31.364 3.430   1.00 59.44  ? 405  LYS A CD    1 
ATOM   3997 C  CE    . LYS C 3 405 ? -21.266 31.250 4.146   1.00 60.82  ? 405  LYS A CE    1 
ATOM   3998 N  NZ    . LYS C 3 405 ? -22.206 30.283 3.497   1.00 59.89  ? 405  LYS A NZ    1 
ATOM   3999 N  N     . TYR C 3 406 ? -15.964 34.407 4.418   1.00 57.58  ? 406  TYR A N     1 
ATOM   4000 C  CA    . TYR C 3 406 ? -14.539 34.227 4.151   1.00 57.74  ? 406  TYR A CA    1 
ATOM   4001 C  C     . TYR C 3 406 ? -13.787 35.511 4.395   1.00 57.31  ? 406  TYR A C     1 
ATOM   4002 O  O     . TYR C 3 406 ? -14.047 36.531 3.757   1.00 57.36  ? 406  TYR A O     1 
ATOM   4003 C  CB    . TYR C 3 406 ? -14.290 33.691 2.744   1.00 58.04  ? 406  TYR A CB    1 
ATOM   4004 C  CG    . TYR C 3 406 ? -14.911 32.335 2.529   1.00 59.82  ? 406  TYR A CG    1 
ATOM   4005 C  CD1   . TYR C 3 406 ? -14.266 31.174 2.953   1.00 60.99  ? 406  TYR A CD1   1 
ATOM   4006 C  CD2   . TYR C 3 406 ? -16.163 32.208 1.909   1.00 61.61  ? 406  TYR A CD2   1 
ATOM   4007 C  CE1   . TYR C 3 406 ? -14.849 29.916 2.763   1.00 61.47  ? 406  TYR A CE1   1 
ATOM   4008 C  CE2   . TYR C 3 406 ? -16.748 30.959 1.717   1.00 61.23  ? 406  TYR A CE2   1 
ATOM   4009 C  CZ    . TYR C 3 406 ? -16.088 29.824 2.150   1.00 60.48  ? 406  TYR A CZ    1 
ATOM   4010 O  OH    . TYR C 3 406 ? -16.669 28.595 1.962   1.00 60.94  ? 406  TYR A OH    1 
ATOM   4011 N  N     . VAL C 3 407 ? -12.865 35.460 5.347   1.00 56.94  ? 407  VAL A N     1 
ATOM   4012 C  CA    . VAL C 3 407 ? -12.107 36.640 5.724   1.00 56.77  ? 407  VAL A CA    1 
ATOM   4013 C  C     . VAL C 3 407 ? -10.621 36.365 5.652   1.00 56.75  ? 407  VAL A C     1 
ATOM   4014 O  O     . VAL C 3 407 ? -10.137 35.349 6.161   1.00 56.52  ? 407  VAL A O     1 
ATOM   4015 C  CB    . VAL C 3 407 ? -12.454 37.123 7.153   1.00 56.78  ? 407  VAL A CB    1 
ATOM   4016 C  CG1   . VAL C 3 407 ? -11.568 38.309 7.563   1.00 56.70  ? 407  VAL A CG1   1 
ATOM   4017 C  CG2   . VAL C 3 407 ? -13.935 37.485 7.263   1.00 56.61  ? 407  VAL A CG2   1 
ATOM   4018 N  N     . MET C 3 408 ? -9.910  37.295 5.025   1.00 56.60  ? 408  MET A N     1 
ATOM   4019 C  CA    . MET C 3 408 ? -8.462  37.275 4.983   1.00 56.82  ? 408  MET A CA    1 
ATOM   4020 C  C     . MET C 3 408 ? -7.949  38.609 5.498   1.00 55.89  ? 408  MET A C     1 
ATOM   4021 O  O     . MET C 3 408 ? -8.411  39.672 5.067   1.00 56.41  ? 408  MET A O     1 
ATOM   4022 C  CB    . MET C 3 408 ? -8.018  37.025 3.552   1.00 56.85  ? 408  MET A CB    1 
ATOM   4023 C  CG    . MET C 3 408 ? -6.556  37.131 3.320   1.00 58.38  ? 408  MET A CG    1 
ATOM   4024 S  SD    . MET C 3 408 ? -6.054  35.994 2.014   1.00 60.59  ? 408  MET A SD    1 
ATOM   4025 C  CE    . MET C 3 408 ? -5.642  34.578 3.034   1.00 59.47  ? 408  MET A CE    1 
ATOM   4026 N  N     . SER C 3 409 ? -7.005  38.562 6.429   1.00 54.73  ? 409  SER A N     1 
ATOM   4027 C  CA    . SER C 3 409 ? -6.481  39.787 7.014   1.00 53.56  ? 409  SER A CA    1 
ATOM   4028 C  C     . SER C 3 409 ? -4.997  39.976 6.753   1.00 53.02  ? 409  SER A C     1 
ATOM   4029 O  O     . SER C 3 409 ? -4.278  39.025 6.427   1.00 52.72  ? 409  SER A O     1 
ATOM   4030 C  CB    . SER C 3 409 ? -6.747  39.808 8.506   1.00 53.51  ? 409  SER A CB    1 
ATOM   4031 O  OG    . SER C 3 409 ? -5.852  38.955 9.184   1.00 53.52  ? 409  SER A OG    1 
ATOM   4032 N  N     . PHE C 3 410 ? -4.551  41.219 6.915   1.00 52.31  ? 410  PHE A N     1 
ATOM   4033 C  CA    . PHE C 3 410 ? -3.206  41.649 6.549   1.00 51.44  ? 410  PHE A CA    1 
ATOM   4034 C  C     . PHE C 3 410 ? -2.796  42.724 7.532   1.00 51.19  ? 410  PHE A C     1 
ATOM   4035 O  O     . PHE C 3 410 ? -3.617  43.559 7.899   1.00 51.32  ? 410  PHE A O     1 
ATOM   4036 C  CB    . PHE C 3 410 ? -3.217  42.270 5.151   1.00 51.12  ? 410  PHE A CB    1 
ATOM   4037 C  CG    . PHE C 3 410 ? -3.418  41.284 4.032   1.00 50.46  ? 410  PHE A CG    1 
ATOM   4038 C  CD1   . PHE C 3 410 ? -4.692  40.840 3.691   1.00 49.90  ? 410  PHE A CD1   1 
ATOM   4039 C  CD2   . PHE C 3 410 ? -2.330  40.828 3.287   1.00 50.57  ? 410  PHE A CD2   1 
ATOM   4040 C  CE1   . PHE C 3 410 ? -4.878  39.937 2.641   1.00 49.50  ? 410  PHE A CE1   1 
ATOM   4041 C  CE2   . PHE C 3 410 ? -2.505  39.930 2.232   1.00 49.77  ? 410  PHE A CE2   1 
ATOM   4042 C  CZ    . PHE C 3 410 ? -3.784  39.484 1.908   1.00 49.23  ? 410  PHE A CZ    1 
ATOM   4043 N  N     . ASP C 3 411 ? -1.533  42.730 7.947   1.00 50.68  ? 411  ASP A N     1 
ATOM   4044 C  CA    . ASP C 3 411 ? -1.085  43.687 8.961   1.00 50.03  ? 411  ASP A CA    1 
ATOM   4045 C  C     . ASP C 3 411 ? 0.323   44.180 8.691   1.00 49.69  ? 411  ASP A C     1 
ATOM   4046 O  O     . ASP C 3 411 ? 1.160   43.421 8.214   1.00 50.23  ? 411  ASP A O     1 
ATOM   4047 C  CB    . ASP C 3 411 ? -1.183  43.082 10.378  1.00 49.67  ? 411  ASP A CB    1 
ATOM   4048 C  CG    . ASP C 3 411 ? -1.004  44.130 11.481  1.00 49.33  ? 411  ASP A CG    1 
ATOM   4049 O  OD1   . ASP C 3 411 ? 0.148   44.538 11.732  1.00 48.49  ? 411  ASP A OD1   1 
ATOM   4050 O  OD2   . ASP C 3 411 ? -2.010  44.549 12.097  1.00 48.50  ? 411  ASP A OD2   1 
ATOM   4051 N  N     . LEU C 3 412 ? 0.585   45.440 9.022   1.00 49.17  ? 412  LEU A N     1 
ATOM   4052 C  CA    . LEU C 3 412 ? 1.911   46.012 8.841   1.00 48.96  ? 412  LEU A CA    1 
ATOM   4053 C  C     . LEU C 3 412 ? 2.903   45.615 9.933   1.00 49.18  ? 412  LEU A C     1 
ATOM   4054 O  O     . LEU C 3 412 ? 2.619   45.668 11.134  1.00 49.22  ? 412  LEU A O     1 
ATOM   4055 C  CB    . LEU C 3 412 ? 1.845   47.529 8.676   1.00 48.84  ? 412  LEU A CB    1 
ATOM   4056 C  CG    . LEU C 3 412 ? 1.186   47.987 7.364   1.00 48.94  ? 412  LEU A CG    1 
ATOM   4057 C  CD1   . LEU C 3 412 ? 0.350   49.265 7.500   1.00 47.30  ? 412  LEU A CD1   1 
ATOM   4058 C  CD2   . LEU C 3 412 ? 2.209   48.107 6.240   1.00 49.01  ? 412  LEU A CD2   1 
ATOM   4059 N  N     . THR C 3 413 ? 4.071   45.189 9.478   1.00 49.26  ? 413  THR A N     1 
ATOM   4060 C  CA    . THR C 3 413 ? 5.199   44.908 10.336  1.00 49.49  ? 413  THR A CA    1 
ATOM   4061 C  C     . THR C 3 413 ? 5.570   46.189 11.057  1.00 49.04  ? 413  THR A C     1 
ATOM   4062 O  O     . THR C 3 413 ? 5.927   47.172 10.411  1.00 48.89  ? 413  THR A O     1 
ATOM   4063 C  CB    . THR C 3 413 ? 6.405   44.470 9.482   1.00 49.93  ? 413  THR A CB    1 
ATOM   4064 O  OG1   . THR C 3 413 ? 5.983   43.501 8.498   1.00 51.94  ? 413  THR A OG1   1 
ATOM   4065 C  CG2   . THR C 3 413 ? 7.519   43.896 10.356  1.00 49.66  ? 413  THR A CG2   1 
ATOM   4066 N  N     . SER C 3 414 ? 5.471   46.181 12.386  1.00 48.73  ? 414  SER A N     1 
ATOM   4067 C  CA    . SER C 3 414 ? 5.872   47.333 13.214  1.00 48.47  ? 414  SER A CA    1 
ATOM   4068 C  C     . SER C 3 414 ? 5.596   48.676 12.544  1.00 48.18  ? 414  SER A C     1 
ATOM   4069 O  O     . SER C 3 414 ? 6.513   49.337 12.052  1.00 48.22  ? 414  SER A O     1 
ATOM   4070 C  CB    . SER C 3 414 ? 7.342   47.230 13.617  1.00 48.24  ? 414  SER A CB    1 
ATOM   4071 O  OG    . SER C 3 414 ? 7.504   46.190 14.561  1.00 48.78  ? 414  SER A OG    1 
ATOM   4072 N  N     . LEU C 3 415 ? 4.330   49.078 12.526  1.00 47.47  ? 415  LEU A N     1 
ATOM   4073 C  CA    . LEU C 3 415 ? 3.959   50.246 11.750  1.00 46.83  ? 415  LEU A CA    1 
ATOM   4074 C  C     . LEU C 3 415 ? 4.696   51.525 12.176  1.00 46.55  ? 415  LEU A C     1 
ATOM   4075 O  O     . LEU C 3 415 ? 5.498   52.063 11.408  1.00 46.77  ? 415  LEU A O     1 
ATOM   4076 C  CB    . LEU C 3 415 ? 2.448   50.451 11.749  1.00 46.58  ? 415  LEU A CB    1 
ATOM   4077 C  CG    . LEU C 3 415 ? 2.064   51.652 10.896  1.00 45.96  ? 415  LEU A CG    1 
ATOM   4078 C  CD1   . LEU C 3 415 ? 2.549   51.471 9.462   1.00 46.30  ? 415  LEU A CD1   1 
ATOM   4079 C  CD2   . LEU C 3 415 ? 0.580   51.900 10.951  1.00 45.43  ? 415  LEU A CD2   1 
ATOM   4080 N  N     . TYR C 3 416 ? 4.437   51.999 13.391  1.00 45.69  ? 416  TYR A N     1 
ATOM   4081 C  CA    . TYR C 3 416 ? 4.980   53.287 13.820  1.00 45.16  ? 416  TYR A CA    1 
ATOM   4082 C  C     . TYR C 3 416 ? 6.513   53.363 13.801  1.00 45.21  ? 416  TYR A C     1 
ATOM   4083 O  O     . TYR C 3 416 ? 7.052   54.397 13.439  1.00 45.68  ? 416  TYR A O     1 
ATOM   4084 C  CB    . TYR C 3 416 ? 4.401   53.755 15.172  1.00 44.34  ? 416  TYR A CB    1 
ATOM   4085 C  CG    . TYR C 3 416 ? 2.942   54.195 15.131  1.00 43.25  ? 416  TYR A CG    1 
ATOM   4086 C  CD1   . TYR C 3 416 ? 2.157   54.014 13.990  1.00 41.63  ? 416  TYR A CD1   1 
ATOM   4087 C  CD2   . TYR C 3 416 ? 2.339   54.764 16.251  1.00 42.23  ? 416  TYR A CD2   1 
ATOM   4088 C  CE1   . TYR C 3 416 ? 0.828   54.399 13.960  1.00 40.88  ? 416  TYR A CE1   1 
ATOM   4089 C  CE2   . TYR C 3 416 ? 1.011   55.143 16.234  1.00 41.51  ? 416  TYR A CE2   1 
ATOM   4090 C  CZ    . TYR C 3 416 ? 0.257   54.953 15.084  1.00 41.87  ? 416  TYR A CZ    1 
ATOM   4091 O  OH    . TYR C 3 416 ? -1.071  55.319 15.063  1.00 41.32  ? 416  TYR A OH    1 
ATOM   4092 N  N     . PRO C 3 417 ? 7.220   52.287 14.194  1.00 45.18  ? 417  PRO A N     1 
ATOM   4093 C  CA    . PRO C 3 417 ? 8.677   52.302 13.986  1.00 44.91  ? 417  PRO A CA    1 
ATOM   4094 C  C     . PRO C 3 417 ? 9.114   52.303 12.511  1.00 44.60  ? 417  PRO A C     1 
ATOM   4095 O  O     . PRO C 3 417 ? 10.071  53.001 12.164  1.00 45.05  ? 417  PRO A O     1 
ATOM   4096 C  CB    . PRO C 3 417 ? 9.148   51.022 14.683  1.00 44.83  ? 417  PRO A CB    1 
ATOM   4097 C  CG    . PRO C 3 417 ? 8.031   50.702 15.664  1.00 45.60  ? 417  PRO A CG    1 
ATOM   4098 C  CD    . PRO C 3 417 ? 6.799   51.060 14.892  1.00 45.36  ? 417  PRO A CD    1 
ATOM   4099 N  N     . SER C 3 418 ? 8.435   51.546 11.656  1.00 43.65  ? 418  SER A N     1 
ATOM   4100 C  CA    . SER C 3 418 ? 8.763   51.543 10.241  1.00 43.19  ? 418  SER A CA    1 
ATOM   4101 C  C     . SER C 3 418 ? 8.576   52.923 9.638   1.00 42.98  ? 418  SER A C     1 
ATOM   4102 O  O     . SER C 3 418 ? 9.380   53.360 8.820   1.00 42.81  ? 418  SER A O     1 
ATOM   4103 C  CB    . SER C 3 418 ? 7.881   50.555 9.508   1.00 43.19  ? 418  SER A CB    1 
ATOM   4104 O  OG    . SER C 3 418 ? 8.154   49.259 9.980   1.00 44.90  ? 418  SER A OG    1 
ATOM   4105 N  N     . ILE C 3 419 ? 7.502   53.599 10.045  1.00 42.74  ? 419  ILE A N     1 
ATOM   4106 C  CA    . ILE C 3 419 ? 7.229   54.951 9.611   1.00 42.11  ? 419  ILE A CA    1 
ATOM   4107 C  C     . ILE C 3 419 ? 8.393   55.824 10.037  1.00 42.38  ? 419  ILE A C     1 
ATOM   4108 O  O     . ILE C 3 419 ? 8.987   56.494 9.201   1.00 42.79  ? 419  ILE A O     1 
ATOM   4109 C  CB    . ILE C 3 419 ? 5.936   55.490 10.234  1.00 42.28  ? 419  ILE A CB    1 
ATOM   4110 C  CG1   . ILE C 3 419 ? 4.731   54.653 9.788   1.00 40.77  ? 419  ILE A CG1   1 
ATOM   4111 C  CG2   . ILE C 3 419 ? 5.759   57.010 9.921   1.00 41.30  ? 419  ILE A CG2   1 
ATOM   4112 C  CD1   . ILE C 3 419 ? 3.441   55.055 10.441  1.00 38.69  ? 419  ILE A CD1   1 
ATOM   4113 N  N     . ILE C 3 420 ? 8.727   55.787 11.331  1.00 42.16  ? 420  ILE A N     1 
ATOM   4114 C  CA    . ILE C 3 420 ? 9.869   56.518 11.895  1.00 42.08  ? 420  ILE A CA    1 
ATOM   4115 C  C     . ILE C 3 420 ? 11.112  56.345 11.032  1.00 42.45  ? 420  ILE A C     1 
ATOM   4116 O  O     . ILE C 3 420 ? 11.867  57.289 10.820  1.00 42.14  ? 420  ILE A O     1 
ATOM   4117 C  CB    . ILE C 3 420 ? 10.152  56.118 13.378  1.00 41.72  ? 420  ILE A CB    1 
ATOM   4118 C  CG1   . ILE C 3 420 ? 9.129   56.776 14.305  1.00 42.00  ? 420  ILE A CG1   1 
ATOM   4119 C  CG2   . ILE C 3 420 ? 11.538  56.560 13.824  1.00 41.44  ? 420  ILE A CG2   1 
ATOM   4120 C  CD1   . ILE C 3 420 ? 8.936   56.092 15.658  1.00 42.00  ? 420  ILE A CD1   1 
ATOM   4121 N  N     . ARG C 3 421 ? 11.305  55.143 10.511  1.00 43.32  ? 421  ARG A N     1 
ATOM   4122 C  CA    . ARG C 3 421 ? 12.443  54.893 9.649   1.00 44.27  ? 421  ARG A CA    1 
ATOM   4123 C  C     . ARG C 3 421 ? 12.151  55.416 8.238   1.00 44.81  ? 421  ARG A C     1 
ATOM   4124 O  O     . ARG C 3 421 ? 12.804  56.345 7.788   1.00 45.32  ? 421  ARG A O     1 
ATOM   4125 C  CB    . ARG C 3 421 ? 12.795  53.417 9.655   1.00 44.11  ? 421  ARG A CB    1 
ATOM   4126 C  CG    . ARG C 3 421 ? 13.076  52.880 11.041  1.00 44.90  ? 421  ARG A CG    1 
ATOM   4127 C  CD    . ARG C 3 421 ? 13.064  51.364 11.057  1.00 46.73  ? 421  ARG A CD    1 
ATOM   4128 N  NE    . ARG C 3 421 ? 14.150  50.790 10.265  1.00 48.54  ? 421  ARG A NE    1 
ATOM   4129 C  CZ    . ARG C 3 421 ? 14.093  49.603 9.664   1.00 50.00  ? 421  ARG A CZ    1 
ATOM   4130 N  NH1   . ARG C 3 421 ? 12.998  48.861 9.762   1.00 49.80  ? 421  ARG A NH1   1 
ATOM   4131 N  NH2   . ARG C 3 421 ? 15.133  49.149 8.967   1.00 50.21  ? 421  ARG A NH2   1 
ATOM   4132 N  N     . GLN C 3 422 ? 11.149  54.850 7.572   1.00 45.17  ? 422  GLN A N     1 
ATOM   4133 C  CA    . GLN C 3 422 ? 10.761  55.237 6.218   1.00 45.46  ? 422  GLN A CA    1 
ATOM   4134 C  C     . GLN C 3 422 ? 10.835  56.731 5.984   1.00 46.44  ? 422  GLN A C     1 
ATOM   4135 O  O     . GLN C 3 422 ? 11.287  57.178 4.927   1.00 47.19  ? 422  GLN A O     1 
ATOM   4136 C  CB    . GLN C 3 422 ? 9.340   54.758 5.930   1.00 45.12  ? 422  GLN A CB    1 
ATOM   4137 C  CG    . GLN C 3 422 ? 8.668   55.392 4.745   1.00 44.05  ? 422  GLN A CG    1 
ATOM   4138 C  CD    . GLN C 3 422 ? 7.988   54.364 3.881   1.00 45.18  ? 422  GLN A CD    1 
ATOM   4139 O  OE1   . GLN C 3 422 ? 8.425   53.218 3.816   1.00 46.65  ? 422  GLN A OE1   1 
ATOM   4140 N  NE2   . GLN C 3 422 ? 6.917   54.755 3.207   1.00 45.50  ? 422  GLN A NE2   1 
ATOM   4141 N  N     . VAL C 3 423 ? 10.388  57.508 6.964   1.00 46.80  ? 423  VAL A N     1 
ATOM   4142 C  CA    . VAL C 3 423 ? 10.291  58.949 6.767   1.00 47.02  ? 423  VAL A CA    1 
ATOM   4143 C  C     . VAL C 3 423 ? 11.523  59.663 7.274   1.00 46.99  ? 423  VAL A C     1 
ATOM   4144 O  O     . VAL C 3 423 ? 11.806  60.761 6.835   1.00 47.48  ? 423  VAL A O     1 
ATOM   4145 C  CB    . VAL C 3 423 ? 9.008   59.556 7.401   1.00 47.03  ? 423  VAL A CB    1 
ATOM   4146 C  CG1   . VAL C 3 423 ? 8.930   61.041 7.106   1.00 46.85  ? 423  VAL A CG1   1 
ATOM   4147 C  CG2   . VAL C 3 423 ? 7.775   58.870 6.854   1.00 46.68  ? 423  VAL A CG2   1 
ATOM   4148 N  N     . ASN C 3 424 ? 12.250  59.018 8.181   1.00 47.11  ? 424  ASN A N     1 
ATOM   4149 C  CA    . ASN C 3 424 ? 13.444  59.579 8.827   1.00 47.25  ? 424  ASN A CA    1 
ATOM   4150 C  C     . ASN C 3 424 ? 13.069  60.651 9.837   1.00 47.11  ? 424  ASN A C     1 
ATOM   4151 O  O     . ASN C 3 424 ? 13.734  61.679 9.963   1.00 47.17  ? 424  ASN A O     1 
ATOM   4152 C  CB    . ASN C 3 424 ? 14.506  60.066 7.821   1.00 47.15  ? 424  ASN A CB    1 
ATOM   4153 C  CG    . ASN C 3 424 ? 15.893  60.201 8.454   1.00 48.78  ? 424  ASN A CG    1 
ATOM   4154 O  OD1   . ASN C 3 424 ? 16.435  59.236 9.018   1.00 50.87  ? 424  ASN A OD1   1 
ATOM   4155 N  ND2   . ASN C 3 424 ? 16.473  61.404 8.373   1.00 49.11  ? 424  ASN A ND2   1 
ATOM   4156 N  N     . ILE C 3 425 ? 11.998  60.364 10.573  1.00 47.44  ? 425  ILE A N     1 
ATOM   4157 C  CA    . ILE C 3 425 ? 11.458  61.230 11.627  1.00 47.47  ? 425  ILE A CA    1 
ATOM   4158 C  C     . ILE C 3 425 ? 12.321  61.166 12.873  1.00 47.71  ? 425  ILE A C     1 
ATOM   4159 O  O     . ILE C 3 425 ? 12.438  60.118 13.473  1.00 48.19  ? 425  ILE A O     1 
ATOM   4160 C  CB    . ILE C 3 425 ? 10.022  60.803 11.976  1.00 47.20  ? 425  ILE A CB    1 
ATOM   4161 C  CG1   . ILE C 3 425 ? 9.138   60.935 10.743  1.00 46.63  ? 425  ILE A CG1   1 
ATOM   4162 C  CG2   . ILE C 3 425 ? 9.467   61.636 13.098  1.00 46.88  ? 425  ILE A CG2   1 
ATOM   4163 C  CD1   . ILE C 3 425 ? 7.730   60.567 10.977  1.00 46.51  ? 425  ILE A CD1   1 
ATOM   4164 N  N     . SER C 3 426 ? 12.917  62.290 13.252  1.00 48.20  ? 426  SER A N     1 
ATOM   4165 C  CA    . SER C 3 426 ? 13.830  62.372 14.391  1.00 48.95  ? 426  SER A CA    1 
ATOM   4166 C  C     . SER C 3 426 ? 13.957  63.847 14.783  1.00 49.77  ? 426  SER A C     1 
ATOM   4167 O  O     . SER C 3 426 ? 13.732  64.720 13.948  1.00 50.23  ? 426  SER A O     1 
ATOM   4168 C  CB    . SER C 3 426 ? 15.193  61.822 13.979  1.00 49.10  ? 426  SER A CB    1 
ATOM   4169 O  OG    . SER C 3 426 ? 16.142  61.909 15.019  1.00 49.58  ? 426  SER A OG    1 
ATOM   4170 N  N     . PRO C 3 427 ? 14.320  64.145 16.039  1.00 50.40  ? 427  PRO A N     1 
ATOM   4171 C  CA    . PRO C 3 427 ? 14.438  65.561 16.413  1.00 51.44  ? 427  PRO A CA    1 
ATOM   4172 C  C     . PRO C 3 427 ? 15.357  66.408 15.499  1.00 52.52  ? 427  PRO A C     1 
ATOM   4173 O  O     . PRO C 3 427 ? 15.029  67.561 15.192  1.00 52.50  ? 427  PRO A O     1 
ATOM   4174 C  CB    . PRO C 3 427 ? 15.026  65.504 17.831  1.00 51.15  ? 427  PRO A CB    1 
ATOM   4175 C  CG    . PRO C 3 427 ? 15.561  64.114 17.975  1.00 50.81  ? 427  PRO A CG    1 
ATOM   4176 C  CD    . PRO C 3 427 ? 14.645  63.266 17.171  1.00 50.35  ? 427  PRO A CD    1 
ATOM   4177 N  N     . GLU C 3 428 ? 16.477  65.838 15.058  1.00 53.51  ? 428  GLU A N     1 
ATOM   4178 C  CA    . GLU C 3 428 ? 17.505  66.624 14.377  1.00 54.79  ? 428  GLU A CA    1 
ATOM   4179 C  C     . GLU C 3 428 ? 17.530  66.426 12.852  1.00 54.95  ? 428  GLU A C     1 
ATOM   4180 O  O     . GLU C 3 428 ? 18.519  66.718 12.193  1.00 55.27  ? 428  GLU A O     1 
ATOM   4181 C  CB    . GLU C 3 428 ? 18.878  66.371 15.025  1.00 54.97  ? 428  GLU A CB    1 
ATOM   4182 C  CG    . GLU C 3 428 ? 19.612  65.102 14.592  1.00 57.23  ? 428  GLU A CG    1 
ATOM   4183 C  CD    . GLU C 3 428 ? 18.821  63.827 14.810  1.00 61.28  ? 428  GLU A CD    1 
ATOM   4184 O  OE1   . GLU C 3 428 ? 17.991  63.777 15.742  1.00 63.93  ? 428  GLU A OE1   1 
ATOM   4185 O  OE2   . GLU C 3 428 ? 19.035  62.858 14.048  1.00 63.49  ? 428  GLU A OE2   1 
ATOM   4186 N  N     . THR C 3 429 ? 16.421  65.947 12.303  1.00 55.24  ? 429  THR A N     1 
ATOM   4187 C  CA    . THR C 3 429 ? 16.311  65.672 10.884  1.00 55.14  ? 429  THR A CA    1 
ATOM   4188 C  C     . THR C 3 429 ? 15.133  66.441 10.290  1.00 55.46  ? 429  THR A C     1 
ATOM   4189 O  O     . THR C 3 429 ? 14.641  66.126 9.200   1.00 55.46  ? 429  THR A O     1 
ATOM   4190 C  CB    . THR C 3 429 ? 16.115  64.165 10.646  1.00 55.31  ? 429  THR A CB    1 
ATOM   4191 O  OG1   . THR C 3 429 ? 14.905  63.729 11.287  1.00 55.41  ? 429  THR A OG1   1 
ATOM   4192 C  CG2   . THR C 3 429 ? 17.308  63.372 11.191  1.00 55.08  ? 429  THR A CG2   1 
ATOM   4193 N  N     . ILE C 3 430 ? 14.684  67.453 11.020  1.00 55.89  ? 430  ILE A N     1 
ATOM   4194 C  CA    . ILE C 3 430 ? 13.540  68.253 10.613  1.00 56.57  ? 430  ILE A CA    1 
ATOM   4195 C  C     . ILE C 3 430 ? 13.978  69.327 9.619   1.00 57.04  ? 430  ILE A C     1 
ATOM   4196 O  O     . ILE C 3 430 ? 14.897  70.104 9.902   1.00 57.10  ? 430  ILE A O     1 
ATOM   4197 C  CB    . ILE C 3 430 ? 12.853  68.875 11.837  1.00 56.67  ? 430  ILE A CB    1 
ATOM   4198 C  CG1   . ILE C 3 430 ? 12.110  67.786 12.615  1.00 56.62  ? 430  ILE A CG1   1 
ATOM   4199 C  CG2   . ILE C 3 430 ? 11.918  70.015 11.428  1.00 56.31  ? 430  ILE A CG2   1 
ATOM   4200 C  CD1   . ILE C 3 430 ? 11.880  68.127 14.091  1.00 56.89  ? 430  ILE A CD1   1 
ATOM   4201 N  N     . ALA C 3 431 ? 13.317  69.356 8.459   1.00 57.48  ? 431  ALA A N     1 
ATOM   4202 C  CA    . ALA C 3 431 ? 13.696  70.243 7.357   1.00 57.84  ? 431  ALA A CA    1 
ATOM   4203 C  C     . ALA C 3 431 ? 12.787  71.457 7.205   1.00 58.52  ? 431  ALA A C     1 
ATOM   4204 O  O     . ALA C 3 431 ? 13.107  72.367 6.446   1.00 59.02  ? 431  ALA A O     1 
ATOM   4205 C  CB    . ALA C 3 431 ? 13.734  69.480 6.066   1.00 57.51  ? 431  ALA A CB    1 
ATOM   4206 N  N     . GLY C 3 432 ? 11.659  71.474 7.909   1.00 58.79  ? 432  GLY A N     1 
ATOM   4207 C  CA    . GLY C 3 432 ? 10.691  72.550 7.763   1.00 59.24  ? 432  GLY A CA    1 
ATOM   4208 C  C     . GLY C 3 432 ? 9.312   72.011 7.467   1.00 59.77  ? 432  GLY A C     1 
ATOM   4209 O  O     . GLY C 3 432 ? 9.048   70.830 7.692   1.00 59.68  ? 432  GLY A O     1 
ATOM   4210 N  N     . THR C 3 433 ? 8.435   72.873 6.952   1.00 60.22  ? 433  THR A N     1 
ATOM   4211 C  CA    . THR C 3 433 ? 7.030   72.511 6.746   1.00 60.84  ? 433  THR A CA    1 
ATOM   4212 C  C     . THR C 3 433 ? 6.535   72.628 5.294   1.00 61.41  ? 433  THR A C     1 
ATOM   4213 O  O     . THR C 3 433 ? 7.322   72.793 4.370   1.00 61.57  ? 433  THR A O     1 
ATOM   4214 C  CB    . THR C 3 433 ? 6.111   73.326 7.665   1.00 60.78  ? 433  THR A CB    1 
ATOM   4215 O  OG1   . THR C 3 433 ? 6.398   74.720 7.510   1.00 60.75  ? 433  THR A OG1   1 
ATOM   4216 C  CG2   . THR C 3 433 ? 6.325   72.924 9.116   1.00 60.96  ? 433  THR A CG2   1 
ATOM   4217 N  N     . PHE C 3 434 ? 5.223   72.520 5.112   1.00 61.95  ? 434  PHE A N     1 
ATOM   4218 C  CA    . PHE C 3 434 ? 4.577   72.702 3.820   1.00 62.69  ? 434  PHE A CA    1 
ATOM   4219 C  C     . PHE C 3 434 ? 3.066   72.775 4.021   1.00 63.77  ? 434  PHE A C     1 
ATOM   4220 O  O     . PHE C 3 434 ? 2.535   72.187 4.972   1.00 64.08  ? 434  PHE A O     1 
ATOM   4221 C  CB    . PHE C 3 434 ? 4.942   71.579 2.840   1.00 62.10  ? 434  PHE A CB    1 
ATOM   4222 C  CG    . PHE C 3 434 ? 4.338   70.224 3.170   1.00 62.15  ? 434  PHE A CG    1 
ATOM   4223 C  CD1   . PHE C 3 434 ? 3.055   69.886 2.741   1.00 60.79  ? 434  PHE A CD1   1 
ATOM   4224 C  CD2   . PHE C 3 434 ? 5.074   69.264 3.866   1.00 61.61  ? 434  PHE A CD2   1 
ATOM   4225 C  CE1   . PHE C 3 434 ? 2.511   68.631 3.032   1.00 60.08  ? 434  PHE A CE1   1 
ATOM   4226 C  CE2   . PHE C 3 434 ? 4.529   68.011 4.153   1.00 60.23  ? 434  PHE A CE2   1 
ATOM   4227 C  CZ    . PHE C 3 434 ? 3.249   67.701 3.736   1.00 59.87  ? 434  PHE A CZ    1 
ATOM   4228 N  N     . LYS C 3 435 ? 2.376   73.487 3.131   1.00 64.65  ? 435  LYS A N     1 
ATOM   4229 C  CA    . LYS C 3 435 ? 0.925   73.618 3.229   1.00 65.66  ? 435  LYS A CA    1 
ATOM   4230 C  C     . LYS C 3 435 ? 0.202   72.330 2.837   1.00 65.86  ? 435  LYS A C     1 
ATOM   4231 O  O     . LYS C 3 435 ? 0.326   71.834 1.704   1.00 66.21  ? 435  LYS A O     1 
ATOM   4232 C  CB    . LYS C 3 435 ? 0.422   74.804 2.411   1.00 65.96  ? 435  LYS A CB    1 
ATOM   4233 C  CG    . LYS C 3 435 ? 0.755   76.160 3.022   1.00 67.62  ? 435  LYS A CG    1 
ATOM   4234 C  CD    . LYS C 3 435 ? -0.155  77.235 2.455   1.00 70.49  ? 435  LYS A CD    1 
ATOM   4235 C  CE    . LYS C 3 435 ? 0.115   77.446 0.965   1.00 72.65  ? 435  LYS A CE    1 
ATOM   4236 N  NZ    . LYS C 3 435 ? -0.940  78.267 0.294   1.00 73.57  ? 435  LYS A NZ    1 
ATOM   4237 N  N     . VAL C 3 436 ? -0.559  71.806 3.792   1.00 66.00  ? 436  VAL A N     1 
ATOM   4238 C  CA    . VAL C 3 436 ? -1.189  70.489 3.679   1.00 66.12  ? 436  VAL A CA    1 
ATOM   4239 C  C     . VAL C 3 436 ? -2.627  70.580 3.155   1.00 66.46  ? 436  VAL A C     1 
ATOM   4240 O  O     . VAL C 3 436 ? -3.417  71.388 3.641   1.00 66.64  ? 436  VAL A O     1 
ATOM   4241 C  CB    . VAL C 3 436 ? -1.106  69.692 5.042   1.00 65.89  ? 436  VAL A CB    1 
ATOM   4242 C  CG1   . VAL C 3 436 ? -0.950  70.616 6.234   1.00 65.15  ? 436  VAL A CG1   1 
ATOM   4243 C  CG2   . VAL C 3 436 ? -2.301  68.773 5.241   1.00 66.09  ? 436  VAL A CG2   1 
ATOM   4244 N  N     . ALA C 3 437 ? -2.954  69.761 2.158   1.00 66.77  ? 437  ALA A N     1 
ATOM   4245 C  CA    . ALA C 3 437 ? -4.335  69.641 1.684   1.00 67.25  ? 437  ALA A CA    1 
ATOM   4246 C  C     . ALA C 3 437 ? -5.145  68.688 2.573   1.00 67.69  ? 437  ALA A C     1 
ATOM   4247 O  O     . ALA C 3 437 ? -4.571  67.770 3.165   1.00 67.75  ? 437  ALA A O     1 
ATOM   4248 C  CB    . ALA C 3 437 ? -4.356  69.151 0.251   1.00 67.32  ? 437  ALA A CB    1 
ATOM   4249 N  N     . PRO C 3 438 ? -6.481  68.892 2.668   1.00 67.82  ? 438  PRO A N     1 
ATOM   4250 C  CA    . PRO C 3 438 ? -7.322  67.881 3.305   1.00 67.75  ? 438  PRO A CA    1 
ATOM   4251 C  C     . PRO C 3 438 ? -6.748  66.484 3.092   1.00 67.76  ? 438  PRO A C     1 
ATOM   4252 O  O     . PRO C 3 438 ? -6.455  66.110 1.953   1.00 67.81  ? 438  PRO A O     1 
ATOM   4253 C  CB    . PRO C 3 438 ? -8.646  68.040 2.562   1.00 67.69  ? 438  PRO A CB    1 
ATOM   4254 C  CG    . PRO C 3 438 ? -8.715  69.519 2.277   1.00 67.91  ? 438  PRO A CG    1 
ATOM   4255 C  CD    . PRO C 3 438 ? -7.285  70.048 2.224   1.00 67.84  ? 438  PRO A CD    1 
ATOM   4256 N  N     . LEU C 3 439 ? -6.567  65.739 4.186   1.00 67.81  ? 439  LEU A N     1 
ATOM   4257 C  CA    . LEU C 3 439 ? -5.888  64.430 4.161   1.00 67.69  ? 439  LEU A CA    1 
ATOM   4258 C  C     . LEU C 3 439 ? -6.491  63.494 3.117   1.00 67.63  ? 439  LEU A C     1 
ATOM   4259 O  O     . LEU C 3 439 ? -5.774  62.701 2.506   1.00 67.62  ? 439  LEU A O     1 
ATOM   4260 C  CB    . LEU C 3 439 ? -5.907  63.765 5.550   1.00 67.55  ? 439  LEU A CB    1 
ATOM   4261 C  CG    . LEU C 3 439 ? -5.185  62.423 5.771   1.00 67.24  ? 439  LEU A CG    1 
ATOM   4262 C  CD1   . LEU C 3 439 ? -3.808  62.652 6.357   1.00 67.14  ? 439  LEU A CD1   1 
ATOM   4263 C  CD2   . LEU C 3 439 ? -5.978  61.501 6.680   1.00 66.00  ? 439  LEU A CD2   1 
ATOM   4264 N  N     . HIS C 3 440 ? -7.801  63.607 2.902   1.00 67.51  ? 440  HIS A N     1 
ATOM   4265 C  CA    . HIS C 3 440 ? -8.503  62.731 1.958   1.00 67.77  ? 440  HIS A CA    1 
ATOM   4266 C  C     . HIS C 3 440 ? -8.025  62.855 0.495   1.00 67.03  ? 440  HIS A C     1 
ATOM   4267 O  O     . HIS C 3 440 ? -8.361  62.025 -0.338  1.00 66.97  ? 440  HIS A O     1 
ATOM   4268 C  CB    . HIS C 3 440 ? -10.033 62.879 2.111   1.00 68.20  ? 440  HIS A CB    1 
ATOM   4269 C  CG    . HIS C 3 440 ? -10.576 62.246 3.364   1.00 70.16  ? 440  HIS A CG    1 
ATOM   4270 N  ND1   . HIS C 3 440 ? -10.948 62.980 4.475   1.00 71.51  ? 440  HIS A ND1   1 
ATOM   4271 C  CD2   . HIS C 3 440 ? -10.787 60.944 3.689   1.00 70.93  ? 440  HIS A CD2   1 
ATOM   4272 C  CE1   . HIS C 3 440 ? -11.367 62.159 5.425   1.00 71.45  ? 440  HIS A CE1   1 
ATOM   4273 N  NE2   . HIS C 3 440 ? -11.280 60.919 4.973   1.00 71.30  ? 440  HIS A NE2   1 
ATOM   4274 N  N     . ASP C 3 441 ? -7.217  63.878 0.216   1.00 66.45  ? 441  ASP A N     1 
ATOM   4275 C  CA    . ASP C 3 441 ? -6.644  64.126 -1.112  1.00 66.08  ? 441  ASP A CA    1 
ATOM   4276 C  C     . ASP C 3 441 ? -5.275  63.486 -1.288  1.00 65.69  ? 441  ASP A C     1 
ATOM   4277 O  O     . ASP C 3 441 ? -4.896  63.118 -2.403  1.00 65.63  ? 441  ASP A O     1 
ATOM   4278 C  CB    . ASP C 3 441 ? -6.502  65.627 -1.360  1.00 66.41  ? 441  ASP A CB    1 
ATOM   4279 C  CG    . ASP C 3 441 ? -7.819  66.300 -1.669  1.00 66.78  ? 441  ASP A CG    1 
ATOM   4280 O  OD1   . ASP C 3 441 ? -8.581  65.746 -2.498  1.00 67.79  ? 441  ASP A OD1   1 
ATOM   4281 O  OD2   . ASP C 3 441 ? -8.079  67.386 -1.091  1.00 66.10  ? 441  ASP A OD2   1 
ATOM   4282 N  N     . TYR C 3 442 ? -4.522  63.394 -0.195  1.00 65.21  ? 442  TYR A N     1 
ATOM   4283 C  CA    . TYR C 3 442 ? -3.319  62.569 -0.150  1.00 64.81  ? 442  TYR A CA    1 
ATOM   4284 C  C     . TYR C 3 442 ? -3.701  61.091 -0.230  1.00 64.90  ? 442  TYR A C     1 
ATOM   4285 O  O     . TYR C 3 442 ? -3.046  60.311 -0.929  1.00 64.73  ? 442  TYR A O     1 
ATOM   4286 C  CB    . TYR C 3 442 ? -2.508  62.847 1.119   1.00 64.69  ? 442  TYR A CB    1 
ATOM   4287 C  CG    . TYR C 3 442 ? -1.928  64.248 1.188   1.00 64.41  ? 442  TYR A CG    1 
ATOM   4288 C  CD1   . TYR C 3 442 ? -1.039  64.703 0.214   1.00 64.47  ? 442  TYR A CD1   1 
ATOM   4289 C  CD2   . TYR C 3 442 ? -2.254  65.111 2.230   1.00 63.71  ? 442  TYR A CD2   1 
ATOM   4290 C  CE1   . TYR C 3 442 ? -0.510  65.983 0.261   1.00 64.60  ? 442  TYR A CE1   1 
ATOM   4291 C  CE2   . TYR C 3 442 ? -1.728  66.393 2.289   1.00 64.25  ? 442  TYR A CE2   1 
ATOM   4292 C  CZ    . TYR C 3 442 ? -0.857  66.826 1.296   1.00 64.98  ? 442  TYR A CZ    1 
ATOM   4293 O  OH    . TYR C 3 442 ? -0.319  68.099 1.332   1.00 65.59  ? 442  TYR A OH    1 
ATOM   4294 N  N     . ILE C 3 443 ? -4.777  60.721 0.472   1.00 65.10  ? 443  ILE A N     1 
ATOM   4295 C  CA    . ILE C 3 443 ? -5.316  59.355 0.433   1.00 65.17  ? 443  ILE A CA    1 
ATOM   4296 C  C     . ILE C 3 443 ? -5.691  59.001 -1.010  1.00 65.70  ? 443  ILE A C     1 
ATOM   4297 O  O     . ILE C 3 443 ? -5.294  57.942 -1.522  1.00 65.62  ? 443  ILE A O     1 
ATOM   4298 C  CB    . ILE C 3 443 ? -6.509  59.168 1.424   1.00 64.87  ? 443  ILE A CB    1 
ATOM   4299 C  CG1   . ILE C 3 443 ? -6.001  59.189 2.864   1.00 64.44  ? 443  ILE A CG1   1 
ATOM   4300 C  CG2   . ILE C 3 443 ? -7.240  57.855 1.182   1.00 64.53  ? 443  ILE A CG2   1 
ATOM   4301 C  CD1   . ILE C 3 443 ? -7.085  59.303 3.913   1.00 64.58  ? 443  ILE A CD1   1 
ATOM   4302 N  N     . ASN C 3 444 ? -6.415  59.911 -1.666  1.00 66.25  ? 444  ASN A N     1 
ATOM   4303 C  CA    . ASN C 3 444 ? -6.827  59.734 -3.067  1.00 66.84  ? 444  ASN A CA    1 
ATOM   4304 C  C     . ASN C 3 444 ? -5.746  59.979 -4.120  1.00 66.89  ? 444  ASN A C     1 
ATOM   4305 O  O     . ASN C 3 444 ? -5.924  59.597 -5.273  1.00 66.89  ? 444  ASN A O     1 
ATOM   4306 C  CB    . ASN C 3 444 ? -8.070  60.569 -3.380  1.00 66.96  ? 444  ASN A CB    1 
ATOM   4307 C  CG    . ASN C 3 444 ? -9.349  59.918 -2.881  1.00 67.43  ? 444  ASN A CG    1 
ATOM   4308 O  OD1   . ASN C 3 444 ? -9.314  58.900 -2.191  1.00 67.42  ? 444  ASN A OD1   1 
ATOM   4309 N  ND2   . ASN C 3 444 ? -10.488 60.502 -3.236  1.00 68.16  ? 444  ASN A ND2   1 
ATOM   4310 N  N     . ALA C 3 445 ? -4.644  60.612 -3.712  1.00 67.12  ? 445  ALA A N     1 
ATOM   4311 C  CA    . ALA C 3 445 ? -3.489  60.932 -4.578  1.00 67.67  ? 445  ALA A CA    1 
ATOM   4312 C  C     . ALA C 3 445 ? -3.680  62.211 -5.414  1.00 68.00  ? 445  ALA A C     1 
ATOM   4313 O  O     . ALA C 3 445 ? -2.844  62.548 -6.265  1.00 68.10  ? 445  ALA A O     1 
ATOM   4314 C  CB    . ALA C 3 445 ? -3.079  59.729 -5.467  1.00 67.38  ? 445  ALA A CB    1 
ATOM   4315 N  N     . VAL C 3 446 ? -4.770  62.925 -5.149  1.00 68.15  ? 446  VAL A N     1 
ATOM   4316 C  CA    . VAL C 3 446 ? -5.089  64.166 -5.862  1.00 68.20  ? 446  VAL A CA    1 
ATOM   4317 C  C     . VAL C 3 446 ? -4.150  65.319 -5.478  1.00 68.06  ? 446  VAL A C     1 
ATOM   4318 O  O     . VAL C 3 446 ? -3.688  66.059 -6.342  1.00 68.03  ? 446  VAL A O     1 
ATOM   4319 C  CB    . VAL C 3 446 ? -6.576  64.575 -5.657  1.00 68.24  ? 446  VAL A CB    1 
ATOM   4320 C  CG1   . VAL C 3 446 ? -6.890  65.883 -6.375  1.00 68.61  ? 446  VAL A CG1   1 
ATOM   4321 C  CG2   . VAL C 3 446 ? -7.515  63.458 -6.137  1.00 68.10  ? 446  VAL A CG2   1 
ATOM   4322 N  N     . ALA C 3 447 ? -3.859  65.450 -4.188  1.00 68.08  ? 447  ALA A N     1 
ATOM   4323 C  CA    . ALA C 3 447 ? -3.070  66.572 -3.673  1.00 68.14  ? 447  ALA A CA    1 
ATOM   4324 C  C     . ALA C 3 447 ? -1.673  66.708 -4.295  1.00 68.32  ? 447  ALA A C     1 
ATOM   4325 O  O     . ALA C 3 447 ? -1.030  65.719 -4.651  1.00 68.45  ? 447  ALA A O     1 
ATOM   4326 C  CB    . ALA C 3 447 ? -2.971  66.493 -2.168  1.00 67.96  ? 447  ALA A CB    1 
ATOM   4327 N  N     . GLU C 3 448 ? -1.224  67.953 -4.424  1.00 68.40  ? 448  GLU A N     1 
ATOM   4328 C  CA    . GLU C 3 448 ? 0.085   68.282 -4.986  1.00 68.61  ? 448  GLU A CA    1 
ATOM   4329 C  C     . GLU C 3 448 ? 1.163   67.494 -4.263  1.00 68.03  ? 448  GLU A C     1 
ATOM   4330 O  O     . GLU C 3 448 ? 1.119   67.381 -3.042  1.00 68.13  ? 448  GLU A O     1 
ATOM   4331 C  CB    . GLU C 3 448 ? 0.319   69.794 -4.826  1.00 68.77  ? 448  GLU A CB    1 
ATOM   4332 C  CG    . GLU C 3 448 ? 1.713   70.327 -5.167  1.00 69.52  ? 448  GLU A CG    1 
ATOM   4333 C  CD    . GLU C 3 448 ? 1.781   71.852 -5.097  1.00 70.30  ? 448  GLU A CD    1 
ATOM   4334 O  OE1   . GLU C 3 448 ? 0.713   72.497 -5.250  1.00 72.05  ? 448  GLU A OE1   1 
ATOM   4335 O  OE2   . GLU C 3 448 ? 2.894   72.406 -4.898  1.00 70.73  ? 448  GLU A OE2   1 
ATOM   4336 N  N     . ARG C 3 449 ? 2.115   66.931 -5.000  1.00 67.60  ? 449  ARG A N     1 
ATOM   4337 C  CA    . ARG C 3 449 ? 3.238   66.264 -4.350  1.00 67.35  ? 449  ARG A CA    1 
ATOM   4338 C  C     . ARG C 3 449 ? 3.937   67.262 -3.422  1.00 66.95  ? 449  ARG A C     1 
ATOM   4339 O  O     . ARG C 3 449 ? 4.424   68.292 -3.884  1.00 67.22  ? 449  ARG A O     1 
ATOM   4340 C  CB    . ARG C 3 449 ? 4.208   65.674 -5.367  1.00 67.36  ? 449  ARG A CB    1 
ATOM   4341 C  CG    . ARG C 3 449 ? 5.512   65.220 -4.749  1.00 67.89  ? 449  ARG A CG    1 
ATOM   4342 C  CD    . ARG C 3 449 ? 6.132   64.084 -5.522  1.00 68.66  ? 449  ARG A CD    1 
ATOM   4343 N  NE    . ARG C 3 449 ? 7.574   64.059 -5.308  1.00 69.81  ? 449  ARG A NE    1 
ATOM   4344 C  CZ    . ARG C 3 449 ? 8.337   62.993 -5.507  1.00 70.39  ? 449  ARG A CZ    1 
ATOM   4345 N  NH1   . ARG C 3 449 ? 7.792   61.854 -5.918  1.00 71.65  ? 449  ARG A NH1   1 
ATOM   4346 N  NH2   . ARG C 3 449 ? 9.639   63.061 -5.286  1.00 70.16  ? 449  ARG A NH2   1 
ATOM   4347 N  N     . PRO C 3 450 ? 3.981   66.960 -2.110  1.00 66.47  ? 450  PRO A N     1 
ATOM   4348 C  CA    . PRO C 3 450 ? 4.301   67.997 -1.131  1.00 66.18  ? 450  PRO A CA    1 
ATOM   4349 C  C     . PRO C 3 450 ? 5.721   68.538 -1.245  1.00 66.14  ? 450  PRO A C     1 
ATOM   4350 O  O     . PRO C 3 450 ? 5.930   69.727 -0.994  1.00 66.26  ? 450  PRO A O     1 
ATOM   4351 C  CB    . PRO C 3 450 ? 4.088   67.298 0.214   1.00 66.31  ? 450  PRO A CB    1 
ATOM   4352 C  CG    . PRO C 3 450 ? 4.208   65.863 -0.065  1.00 66.17  ? 450  PRO A CG    1 
ATOM   4353 C  CD    . PRO C 3 450 ? 3.756   65.650 -1.476  1.00 66.25  ? 450  PRO A CD    1 
ATOM   4354 N  N     . SER C 3 451 ? 6.675   67.677 -1.616  1.00 65.89  ? 451  SER A N     1 
ATOM   4355 C  CA    . SER C 3 451 ? 8.081   68.058 -1.792  1.00 65.67  ? 451  SER A CA    1 
ATOM   4356 C  C     . SER C 3 451 ? 8.846   66.988 -2.573  1.00 65.89  ? 451  SER A C     1 
ATOM   4357 O  O     . SER C 3 451 ? 8.521   65.797 -2.493  1.00 65.88  ? 451  SER A O     1 
ATOM   4358 C  CB    . SER C 3 451 ? 8.749   68.302 -0.440  1.00 65.44  ? 451  SER A CB    1 
ATOM   4359 O  OG    . SER C 3 451 ? 10.109  68.647 -0.588  1.00 65.48  ? 451  SER A OG    1 
ATOM   4360 N  N     . ASP C 3 452 ? 9.850   67.413 -3.340  1.00 65.95  ? 452  ASP A N     1 
ATOM   4361 C  CA    . ASP C 3 452 ? 10.643  66.475 -4.146  1.00 66.20  ? 452  ASP A CA    1 
ATOM   4362 C  C     . ASP C 3 452 ? 12.113  66.558 -3.773  1.00 65.87  ? 452  ASP A C     1 
ATOM   4363 O  O     . ASP C 3 452 ? 12.976  66.000 -4.456  1.00 65.67  ? 452  ASP A O     1 
ATOM   4364 C  CB    . ASP C 3 452 ? 10.431  66.682 -5.657  1.00 66.47  ? 452  ASP A CB    1 
ATOM   4365 C  CG    . ASP C 3 452 ? 10.906  68.048 -6.148  1.00 67.72  ? 452  ASP A CG    1 
ATOM   4366 O  OD1   . ASP C 3 452 ? 11.852  68.620 -5.559  1.00 68.80  ? 452  ASP A OD1   1 
ATOM   4367 O  OD2   . ASP C 3 452 ? 10.336  68.552 -7.144  1.00 69.30  ? 452  ASP A OD2   1 
ATOM   4368 N  N     . VAL C 3 453 ? 12.365  67.279 -2.683  1.00 65.51  ? 453  VAL A N     1 
ATOM   4369 C  CA    . VAL C 3 453 ? 13.680  67.382 -2.059  1.00 65.14  ? 453  VAL A CA    1 
ATOM   4370 C  C     . VAL C 3 453 ? 13.699  66.679 -0.693  1.00 64.93  ? 453  VAL A C     1 
ATOM   4371 O  O     . VAL C 3 453 ? 14.692  66.041 -0.332  1.00 65.26  ? 453  VAL A O     1 
ATOM   4372 C  CB    . VAL C 3 453 ? 14.128  68.874 -1.925  1.00 65.04  ? 453  VAL A CB    1 
ATOM   4373 C  CG1   . VAL C 3 453 ? 12.926  69.796 -1.729  1.00 65.39  ? 453  VAL A CG1   1 
ATOM   4374 C  CG2   . VAL C 3 453 ? 15.146  69.058 -0.799  1.00 64.85  ? 453  VAL A CG2   1 
ATOM   4375 N  N     . TYR C 3 454 ? 12.595  66.787 0.047   1.00 64.43  ? 454  TYR A N     1 
ATOM   4376 C  CA    . TYR C 3 454 ? 12.532  66.323 1.425   1.00 63.89  ? 454  TYR A CA    1 
ATOM   4377 C  C     . TYR C 3 454 ? 11.564  65.172 1.618   1.00 63.57  ? 454  TYR A C     1 
ATOM   4378 O  O     . TYR C 3 454 ? 10.579  65.065 0.883   1.00 63.77  ? 454  TYR A O     1 
ATOM   4379 C  CB    . TYR C 3 454 ? 12.126  67.476 2.336   1.00 64.11  ? 454  TYR A CB    1 
ATOM   4380 C  CG    . TYR C 3 454 ? 13.146  68.583 2.403   1.00 64.07  ? 454  TYR A CG    1 
ATOM   4381 C  CD1   . TYR C 3 454 ? 14.434  68.340 2.890   1.00 63.67  ? 454  TYR A CD1   1 
ATOM   4382 C  CD2   . TYR C 3 454 ? 12.819  69.882 1.993   1.00 64.51  ? 454  TYR A CD2   1 
ATOM   4383 C  CE1   . TYR C 3 454 ? 15.377  69.355 2.955   1.00 64.09  ? 454  TYR A CE1   1 
ATOM   4384 C  CE2   . TYR C 3 454 ? 13.755  70.910 2.055   1.00 64.30  ? 454  TYR A CE2   1 
ATOM   4385 C  CZ    . TYR C 3 454 ? 15.032  70.635 2.533   1.00 64.43  ? 454  TYR A CZ    1 
ATOM   4386 O  OH    . TYR C 3 454 ? 15.966  71.638 2.600   1.00 65.13  ? 454  TYR A OH    1 
ATOM   4387 N  N     . SER C 3 455 ? 11.852  64.323 2.612   1.00 62.76  ? 455  SER A N     1 
ATOM   4388 C  CA    . SER C 3 455 ? 10.965  63.220 3.021   1.00 61.96  ? 455  SER A CA    1 
ATOM   4389 C  C     . SER C 3 455 ? 9.830   63.729 3.912   1.00 61.43  ? 455  SER A C     1 
ATOM   4390 O  O     . SER C 3 455 ? 10.071  64.421 4.907   1.00 61.44  ? 455  SER A O     1 
ATOM   4391 C  CB    . SER C 3 455 ? 11.765  62.124 3.729   1.00 62.02  ? 455  SER A CB    1 
ATOM   4392 O  OG    . SER C 3 455 ? 10.925  61.124 4.269   1.00 61.68  ? 455  SER A OG    1 
ATOM   4393 N  N     . CYS C 3 456 ? 8.598   63.372 3.561   1.00 60.65  ? 456  CYS A N     1 
ATOM   4394 C  CA    . CYS C 3 456 ? 7.435   64.080 4.100   1.00 60.41  ? 456  CYS A CA    1 
ATOM   4395 C  C     . CYS C 3 456 ? 6.347   63.239 4.753   1.00 59.65  ? 456  CYS A C     1 
ATOM   4396 O  O     . CYS C 3 456 ? 6.159   62.075 4.425   1.00 59.95  ? 456  CYS A O     1 
ATOM   4397 C  CB    . CYS C 3 456 ? 6.787   64.923 2.993   1.00 60.71  ? 456  CYS A CB    1 
ATOM   4398 S  SG    . CYS C 3 456 ? 7.864   66.184 2.271   1.00 61.94  ? 456  CYS A SG    1 
ATOM   4399 N  N     . SER C 3 457 ? 5.617   63.871 5.663   1.00 58.88  ? 457  SER A N     1 
ATOM   4400 C  CA    . SER C 3 457 ? 4.400   63.320 6.256   1.00 58.18  ? 457  SER A CA    1 
ATOM   4401 C  C     . SER C 3 457 ? 3.207   64.247 5.960   1.00 57.56  ? 457  SER A C     1 
ATOM   4402 O  O     . SER C 3 457 ? 3.374   65.475 5.968   1.00 57.46  ? 457  SER A O     1 
ATOM   4403 C  CB    . SER C 3 457 ? 4.582   63.184 7.768   1.00 58.13  ? 457  SER A CB    1 
ATOM   4404 O  OG    . SER C 3 457 ? 3.338   63.079 8.440   1.00 58.35  ? 457  SER A OG    1 
ATOM   4405 N  N     . PRO C 3 458 ? 2.003   63.670 5.721   1.00 56.64  ? 458  PRO A N     1 
ATOM   4406 C  CA    . PRO C 3 458 ? 0.802   64.464 5.445   1.00 56.12  ? 458  PRO A CA    1 
ATOM   4407 C  C     . PRO C 3 458 ? 0.328   65.392 6.575   1.00 55.88  ? 458  PRO A C     1 
ATOM   4408 O  O     . PRO C 3 458 ? -0.714  66.014 6.431   1.00 55.81  ? 458  PRO A O     1 
ATOM   4409 C  CB    . PRO C 3 458 ? -0.258  63.407 5.135   1.00 55.96  ? 458  PRO A CB    1 
ATOM   4410 C  CG    . PRO C 3 458 ? 0.227   62.174 5.772   1.00 56.48  ? 458  PRO A CG    1 
ATOM   4411 C  CD    . PRO C 3 458 ? 1.715   62.227 5.675   1.00 56.63  ? 458  PRO A CD    1 
ATOM   4412 N  N     . ASN C 3 459 ? 1.080   65.494 7.673   1.00 55.87  ? 459  ASN A N     1 
ATOM   4413 C  CA    . ASN C 3 459 ? 0.811   66.493 8.720   1.00 55.81  ? 459  ASN A CA    1 
ATOM   4414 C  C     . ASN C 3 459 ? 1.496   67.844 8.433   1.00 55.86  ? 459  ASN A C     1 
ATOM   4415 O  O     . ASN C 3 459 ? 1.301   68.825 9.159   1.00 55.95  ? 459  ASN A O     1 
ATOM   4416 C  CB    . ASN C 3 459 ? 1.194   65.965 10.123  1.00 55.73  ? 459  ASN A CB    1 
ATOM   4417 C  CG    . ASN C 3 459 ? 2.704   66.037 10.403  1.00 55.47  ? 459  ASN A CG    1 
ATOM   4418 O  OD1   . ASN C 3 459 ? 3.519   65.806 9.515   1.00 56.40  ? 459  ASN A OD1   1 
ATOM   4419 N  ND2   . ASN C 3 459 ? 3.071   66.349 11.640  1.00 53.58  ? 459  ASN A ND2   1 
ATOM   4420 N  N     . GLY C 3 460 ? 2.306   67.882 7.378   1.00 55.75  ? 460  GLY A N     1 
ATOM   4421 C  CA    . GLY C 3 460 ? 3.000   69.106 6.988   1.00 55.76  ? 460  GLY A CA    1 
ATOM   4422 C  C     . GLY C 3 460 ? 4.490   69.143 7.289   1.00 55.62  ? 460  GLY A C     1 
ATOM   4423 O  O     . GLY C 3 460 ? 5.164   70.108 6.956   1.00 55.56  ? 460  GLY A O     1 
ATOM   4424 N  N     . MET C 3 461 ? 5.015   68.101 7.920   1.00 55.69  ? 461  MET A N     1 
ATOM   4425 C  CA    . MET C 3 461 ? 6.437   68.063 8.234   1.00 55.72  ? 461  MET A CA    1 
ATOM   4426 C  C     . MET C 3 461 ? 7.301   67.581 7.065   1.00 56.00  ? 461  MET A C     1 
ATOM   4427 O  O     . MET C 3 461 ? 6.856   66.786 6.228   1.00 55.64  ? 461  MET A O     1 
ATOM   4428 C  CB    . MET C 3 461 ? 6.697   67.206 9.468   1.00 55.53  ? 461  MET A CB    1 
ATOM   4429 C  CG    . MET C 3 461 ? 6.094   67.755 10.767  1.00 55.16  ? 461  MET A CG    1 
ATOM   4430 S  SD    . MET C 3 461 ? 6.803   69.298 11.407  1.00 52.53  ? 461  MET A SD    1 
ATOM   4431 C  CE    . MET C 3 461 ? 8.546   68.907 11.543  1.00 53.70  ? 461  MET A CE    1 
ATOM   4432 N  N     . MET C 3 462 ? 8.535   68.085 7.014   1.00 56.23  ? 462  MET A N     1 
ATOM   4433 C  CA    . MET C 3 462 ? 9.517   67.629 6.038   1.00 56.76  ? 462  MET A CA    1 
ATOM   4434 C  C     . MET C 3 462 ? 10.806  67.217 6.727   1.00 56.66  ? 462  MET A C     1 
ATOM   4435 O  O     . MET C 3 462 ? 11.226  67.815 7.722   1.00 56.41  ? 462  MET A O     1 
ATOM   4436 C  CB    . MET C 3 462 ? 9.796   68.700 5.001   1.00 56.73  ? 462  MET A CB    1 
ATOM   4437 C  CG    . MET C 3 462 ? 8.588   69.051 4.152   1.00 57.79  ? 462  MET A CG    1 
ATOM   4438 S  SD    . MET C 3 462 ? 8.985   70.191 2.815   1.00 58.26  ? 462  MET A SD    1 
ATOM   4439 C  CE    . MET C 3 462 ? 9.723   71.557 3.725   1.00 58.65  ? 462  MET A CE    1 
ATOM   4440 N  N     . TYR C 3 463 ? 11.428  66.180 6.191   1.00 56.83  ? 463  TYR A N     1 
ATOM   4441 C  CA    . TYR C 3 463 ? 12.600  65.607 6.818   1.00 57.05  ? 463  TYR A CA    1 
ATOM   4442 C  C     . TYR C 3 463 ? 13.701  65.395 5.807   1.00 57.74  ? 463  TYR A C     1 
ATOM   4443 O  O     . TYR C 3 463 ? 13.436  65.251 4.610   1.00 57.32  ? 463  TYR A O     1 
ATOM   4444 C  CB    . TYR C 3 463 ? 12.237  64.283 7.499   1.00 56.39  ? 463  TYR A CB    1 
ATOM   4445 C  CG    . TYR C 3 463 ? 11.265  64.464 8.622   1.00 54.59  ? 463  TYR A CG    1 
ATOM   4446 C  CD1   . TYR C 3 463 ? 11.712  64.703 9.919   1.00 52.73  ? 463  TYR A CD1   1 
ATOM   4447 C  CD2   . TYR C 3 463 ? 9.892   64.418 8.382   1.00 53.42  ? 463  TYR A CD2   1 
ATOM   4448 C  CE1   . TYR C 3 463 ? 10.805  64.883 10.950  1.00 53.45  ? 463  TYR A CE1   1 
ATOM   4449 C  CE2   . TYR C 3 463 ? 8.975   64.605 9.402   1.00 52.62  ? 463  TYR A CE2   1 
ATOM   4450 C  CZ    . TYR C 3 463 ? 9.432   64.835 10.681  1.00 53.25  ? 463  TYR A CZ    1 
ATOM   4451 O  OH    . TYR C 3 463 ? 8.520   65.013 11.690  1.00 52.79  ? 463  TYR A OH    1 
ATOM   4452 N  N     . TYR C 3 464 ? 14.932  65.375 6.310   1.00 58.83  ? 464  TYR A N     1 
ATOM   4453 C  CA    . TYR C 3 464 ? 16.107  65.142 5.486   1.00 60.27  ? 464  TYR A CA    1 
ATOM   4454 C  C     . TYR C 3 464 ? 16.221  63.684 5.057   1.00 61.12  ? 464  TYR A C     1 
ATOM   4455 O  O     . TYR C 3 464 ? 15.870  62.781 5.809   1.00 61.72  ? 464  TYR A O     1 
ATOM   4456 C  CB    . TYR C 3 464 ? 17.366  65.563 6.237   1.00 60.18  ? 464  TYR A CB    1 
ATOM   4457 C  CG    . TYR C 3 464 ? 17.409  67.032 6.570   1.00 60.83  ? 464  TYR A CG    1 
ATOM   4458 C  CD1   . TYR C 3 464 ? 17.522  67.999 5.563   1.00 61.27  ? 464  TYR A CD1   1 
ATOM   4459 C  CD2   . TYR C 3 464 ? 17.341  67.463 7.892   1.00 61.07  ? 464  TYR A CD2   1 
ATOM   4460 C  CE1   . TYR C 3 464 ? 17.556  69.356 5.870   1.00 61.14  ? 464  TYR A CE1   1 
ATOM   4461 C  CE2   . TYR C 3 464 ? 17.378  68.815 8.211   1.00 60.73  ? 464  TYR A CE2   1 
ATOM   4462 C  CZ    . TYR C 3 464 ? 17.487  69.753 7.200   1.00 60.75  ? 464  TYR A CZ    1 
ATOM   4463 O  OH    . TYR C 3 464 ? 17.529  71.089 7.525   1.00 60.90  ? 464  TYR A OH    1 
ATOM   4464 N  N     . LYS C 3 465 ? 16.708  63.458 3.844   1.00 62.05  ? 465  LYS A N     1 
ATOM   4465 C  CA    . LYS C 3 465 ? 17.015  62.107 3.384   1.00 62.95  ? 465  LYS A CA    1 
ATOM   4466 C  C     . LYS C 3 465 ? 18.525  61.867 3.397   1.00 64.10  ? 465  LYS A C     1 
ATOM   4467 O  O     . LYS C 3 465 ? 18.977  60.736 3.631   1.00 64.38  ? 465  LYS A O     1 
ATOM   4468 C  CB    . LYS C 3 465 ? 16.452  61.869 1.992   1.00 62.56  ? 465  LYS A CB    1 
ATOM   4469 C  CG    . LYS C 3 465 ? 15.042  62.363 1.828   1.00 61.72  ? 465  LYS A CG    1 
ATOM   4470 C  CD    . LYS C 3 465 ? 14.331  61.589 0.761   1.00 61.02  ? 465  LYS A CD    1 
ATOM   4471 C  CE    . LYS C 3 465 ? 14.859  61.919 -0.611  1.00 60.44  ? 465  LYS A CE    1 
ATOM   4472 N  NZ    . LYS C 3 465 ? 14.062  61.193 -1.619  1.00 59.90  ? 465  LYS A NZ    1 
ATOM   4473 N  N     . ASP C 3 466 ? 19.290  62.933 3.135   1.00 65.17  ? 466  ASP A N     1 
ATOM   4474 C  CA    . ASP C 3 466 ? 20.755  62.913 3.261   1.00 66.21  ? 466  ASP A CA    1 
ATOM   4475 C  C     . ASP C 3 466 ? 21.205  62.305 4.605   1.00 67.08  ? 466  ASP A C     1 
ATOM   4476 O  O     . ASP C 3 466 ? 21.406  61.089 4.693   1.00 66.98  ? 466  ASP A O     1 
ATOM   4477 C  CB    . ASP C 3 466 ? 21.380  64.312 3.004   1.00 66.03  ? 466  ASP A CB    1 
ATOM   4478 C  CG    . ASP C 3 466 ? 20.682  65.448 3.775   1.00 65.41  ? 466  ASP A CG    1 
ATOM   4479 O  OD1   . ASP C 3 466 ? 19.477  65.694 3.541   1.00 64.83  ? 466  ASP A OD1   1 
ATOM   4480 O  OD2   . ASP C 3 466 ? 21.351  66.115 4.596   1.00 63.69  ? 466  ASP A OD2   1 
ATOM   4481 N  N     . ARG C 3 467 ? 21.328  63.135 5.645   1.00 68.12  ? 467  ARG A N     1 
ATOM   4482 C  CA    . ARG C 3 467 ? 21.755  62.662 6.977   1.00 69.16  ? 467  ARG A CA    1 
ATOM   4483 C  C     . ARG C 3 467 ? 20.803  61.609 7.566   1.00 69.02  ? 467  ARG A C     1 
ATOM   4484 O  O     . ARG C 3 467 ? 19.635  61.527 7.165   1.00 69.48  ? 467  ARG A O     1 
ATOM   4485 C  CB    . ARG C 3 467 ? 22.006  63.841 7.955   1.00 69.27  ? 467  ARG A CB    1 
ATOM   4486 C  CG    . ARG C 3 467 ? 20.839  64.811 8.182   1.00 70.14  ? 467  ARG A CG    1 
ATOM   4487 C  CD    . ARG C 3 467 ? 21.330  66.199 8.644   1.00 71.11  ? 467  ARG A CD    1 
ATOM   4488 N  NE    . ARG C 3 467 ? 21.533  67.127 7.518   1.00 73.71  ? 467  ARG A NE    1 
ATOM   4489 C  CZ    . ARG C 3 467 ? 21.730  68.444 7.629   1.00 74.15  ? 467  ARG A CZ    1 
ATOM   4490 N  NH1   . ARG C 3 467 ? 21.761  69.029 8.823   1.00 74.15  ? 467  ARG A NH1   1 
ATOM   4491 N  NH2   . ARG C 3 467 ? 21.893  69.184 6.535   1.00 74.44  ? 467  ARG A NH2   1 
ATOM   4492 N  N     . ASP C 3 468 ? 21.312  60.785 8.483   1.00 68.75  ? 468  ASP A N     1 
ATOM   4493 C  CA    . ASP C 3 468 ? 20.484  59.764 9.138   1.00 68.21  ? 468  ASP A CA    1 
ATOM   4494 C  C     . ASP C 3 468 ? 20.211  60.143 10.599  1.00 67.03  ? 468  ASP A C     1 
ATOM   4495 O  O     . ASP C 3 468 ? 21.031  60.811 11.239  1.00 67.08  ? 468  ASP A O     1 
ATOM   4496 C  CB    . ASP C 3 468 ? 21.115  58.368 9.016   1.00 68.70  ? 468  ASP A CB    1 
ATOM   4497 C  CG    . ASP C 3 468 ? 20.065  57.260 8.837   1.00 71.01  ? 468  ASP A CG    1 
ATOM   4498 O  OD1   . ASP C 3 468 ? 18.950  57.374 9.407   1.00 72.49  ? 468  ASP A OD1   1 
ATOM   4499 O  OD2   . ASP C 3 468 ? 20.351  56.265 8.122   1.00 73.62  ? 468  ASP A OD2   1 
ATOM   4500 N  N     . GLY C 3 469 ? 19.053  59.731 11.114  1.00 65.61  ? 469  GLY A N     1 
ATOM   4501 C  CA    . GLY C 3 469 ? 18.596  60.178 12.430  1.00 63.67  ? 469  GLY A CA    1 
ATOM   4502 C  C     . GLY C 3 469 ? 18.928  59.273 13.598  1.00 62.40  ? 469  GLY A C     1 
ATOM   4503 O  O     . GLY C 3 469 ? 18.917  58.052 13.475  1.00 62.33  ? 469  GLY A O     1 
ATOM   4504 N  N     . VAL C 3 470 ? 19.202  59.888 14.741  1.00 61.14  ? 470  VAL A N     1 
ATOM   4505 C  CA    . VAL C 3 470 ? 19.451  59.174 15.992  1.00 60.25  ? 470  VAL A CA    1 
ATOM   4506 C  C     . VAL C 3 470 ? 18.361  58.152 16.293  1.00 59.40  ? 470  VAL A C     1 
ATOM   4507 O  O     . VAL C 3 470 ? 18.645  57.017 16.680  1.00 59.34  ? 470  VAL A O     1 
ATOM   4508 C  CB    . VAL C 3 470 ? 19.486  60.145 17.194  1.00 60.39  ? 470  VAL A CB    1 
ATOM   4509 C  CG1   . VAL C 3 470 ? 20.126  59.479 18.404  1.00 60.36  ? 470  VAL A CG1   1 
ATOM   4510 C  CG2   . VAL C 3 470 ? 20.220  61.429 16.833  1.00 61.22  ? 470  VAL A CG2   1 
ATOM   4511 N  N     . VAL C 3 471 ? 17.110  58.575 16.127  1.00 58.33  ? 471  VAL A N     1 
ATOM   4512 C  CA    . VAL C 3 471 ? 15.965  57.750 16.490  1.00 56.98  ? 471  VAL A CA    1 
ATOM   4513 C  C     . VAL C 3 471 ? 15.753  56.617 15.479  1.00 56.31  ? 471  VAL A C     1 
ATOM   4514 O  O     . VAL C 3 471 ? 15.735  55.452 15.877  1.00 56.51  ? 471  VAL A O     1 
ATOM   4515 C  CB    . VAL C 3 471 ? 14.684  58.597 16.739  1.00 56.84  ? 471  VAL A CB    1 
ATOM   4516 C  CG1   . VAL C 3 471 ? 13.508  57.701 17.066  1.00 56.90  ? 471  VAL A CG1   1 
ATOM   4517 C  CG2   . VAL C 3 471 ? 14.906  59.570 17.877  1.00 55.68  ? 471  VAL A CG2   1 
ATOM   4518 N  N     . PRO C 3 472 ? 15.603  56.941 14.178  1.00 55.65  ? 472  PRO A N     1 
ATOM   4519 C  CA    . PRO C 3 472 ? 15.592  55.859 13.194  1.00 55.29  ? 472  PRO A CA    1 
ATOM   4520 C  C     . PRO C 3 472 ? 16.729  54.852 13.439  1.00 55.06  ? 472  PRO A C     1 
ATOM   4521 O  O     . PRO C 3 472 ? 16.483  53.641 13.485  1.00 54.98  ? 472  PRO A O     1 
ATOM   4522 C  CB    . PRO C 3 472 ? 15.797  56.594 11.872  1.00 55.34  ? 472  PRO A CB    1 
ATOM   4523 C  CG    . PRO C 3 472 ? 15.220  57.942 12.102  1.00 55.27  ? 472  PRO A CG    1 
ATOM   4524 C  CD    . PRO C 3 472 ? 15.408  58.261 13.547  1.00 55.58  ? 472  PRO A CD    1 
ATOM   4525 N  N     . THR C 3 473 ? 17.947  55.361 13.630  1.00 54.46  ? 473  THR A N     1 
ATOM   4526 C  CA    . THR C 3 473 ? 19.105  54.524 13.908  1.00 53.94  ? 473  THR A CA    1 
ATOM   4527 C  C     . THR C 3 473 ? 18.781  53.599 15.053  1.00 53.41  ? 473  THR A C     1 
ATOM   4528 O  O     . THR C 3 473 ? 18.676  52.401 14.851  1.00 53.73  ? 473  THR A O     1 
ATOM   4529 C  CB    . THR C 3 473 ? 20.374  55.362 14.237  1.00 54.02  ? 473  THR A CB    1 
ATOM   4530 O  OG1   . THR C 3 473 ? 20.760  56.104 13.081  1.00 54.81  ? 473  THR A OG1   1 
ATOM   4531 C  CG2   . THR C 3 473 ? 21.531  54.482 14.632  1.00 53.57  ? 473  THR A CG2   1 
ATOM   4532 N  N     . GLU C 3 474 ? 18.578  54.155 16.243  1.00 52.99  ? 474  GLU A N     1 
ATOM   4533 C  CA    . GLU C 3 474 ? 18.418  53.326 17.440  1.00 52.61  ? 474  GLU A CA    1 
ATOM   4534 C  C     . GLU C 3 474 ? 17.192  52.454 17.396  1.00 52.02  ? 474  GLU A C     1 
ATOM   4535 O  O     . GLU C 3 474 ? 17.211  51.330 17.887  1.00 51.64  ? 474  GLU A O     1 
ATOM   4536 C  CB    . GLU C 3 474 ? 18.424  54.157 18.714  1.00 52.42  ? 474  GLU A CB    1 
ATOM   4537 C  CG    . GLU C 3 474 ? 19.773  54.787 19.014  1.00 54.16  ? 474  GLU A CG    1 
ATOM   4538 C  CD    . GLU C 3 474 ? 20.974  53.851 18.771  1.00 56.56  ? 474  GLU A CD    1 
ATOM   4539 O  OE1   . GLU C 3 474 ? 21.038  52.739 19.372  1.00 56.83  ? 474  GLU A OE1   1 
ATOM   4540 O  OE2   . GLU C 3 474 ? 21.872  54.253 17.984  1.00 56.85  ? 474  GLU A OE2   1 
ATOM   4541 N  N     . ILE C 3 475 ? 16.131  52.954 16.779  1.00 51.64  ? 475  ILE A N     1 
ATOM   4542 C  CA    . ILE C 3 475 ? 14.936  52.145 16.676  1.00 51.61  ? 475  ILE A CA    1 
ATOM   4543 C  C     . ILE C 3 475 ? 15.154  50.923 15.754  1.00 51.32  ? 475  ILE A C     1 
ATOM   4544 O  O     . ILE C 3 475 ? 14.575  49.859 15.984  1.00 51.11  ? 475  ILE A O     1 
ATOM   4545 C  CB    . ILE C 3 475 ? 13.694  52.983 16.313  1.00 51.37  ? 475  ILE A CB    1 
ATOM   4546 C  CG1   . ILE C 3 475 ? 12.452  52.319 16.892  1.00 51.28  ? 475  ILE A CG1   1 
ATOM   4547 C  CG2   . ILE C 3 475 ? 13.570  53.166 14.813  1.00 51.98  ? 475  ILE A CG2   1 
ATOM   4548 C  CD1   . ILE C 3 475 ? 11.295  53.260 17.152  1.00 51.60  ? 475  ILE A CD1   1 
ATOM   4549 N  N     . THR C 3 476 ? 16.022  51.069 14.753  1.00 51.11  ? 476  THR A N     1 
ATOM   4550 C  CA    . THR C 3 476 ? 16.291  49.972 13.813  1.00 51.14  ? 476  THR A CA    1 
ATOM   4551 C  C     . THR C 3 476 ? 17.015  48.768 14.441  1.00 50.86  ? 476  THR A C     1 
ATOM   4552 O  O     . THR C 3 476 ? 16.689  47.616 14.135  1.00 50.38  ? 476  THR A O     1 
ATOM   4553 C  CB    . THR C 3 476 ? 17.049  50.456 12.578  1.00 51.04  ? 476  THR A CB    1 
ATOM   4554 O  OG1   . THR C 3 476 ? 16.368  51.586 12.030  1.00 51.80  ? 476  THR A OG1   1 
ATOM   4555 C  CG2   . THR C 3 476 ? 17.087  49.370 11.529  1.00 50.89  ? 476  THR A CG2   1 
ATOM   4556 N  N     . LYS C 3 477 ? 17.975  49.037 15.325  1.00 50.68  ? 477  LYS A N     1 
ATOM   4557 C  CA    . LYS C 3 477 ? 18.737  47.966 15.970  1.00 50.69  ? 477  LYS A CA    1 
ATOM   4558 C  C     . LYS C 3 477 ? 17.822  47.049 16.759  1.00 50.30  ? 477  LYS A C     1 
ATOM   4559 O  O     . LYS C 3 477 ? 17.870  45.821 16.616  1.00 50.53  ? 477  LYS A O     1 
ATOM   4560 C  CB    . LYS C 3 477 ? 19.822  48.521 16.891  1.00 50.96  ? 477  LYS A CB    1 
ATOM   4561 C  CG    . LYS C 3 477 ? 21.014  49.149 16.197  1.00 52.03  ? 477  LYS A CG    1 
ATOM   4562 C  CD    . LYS C 3 477 ? 22.131  49.338 17.212  1.00 55.27  ? 477  LYS A CD    1 
ATOM   4563 C  CE    . LYS C 3 477 ? 22.992  50.572 16.887  1.00 57.00  ? 477  LYS A CE    1 
ATOM   4564 N  NZ    . LYS C 3 477 ? 23.751  51.046 18.096  1.00 56.82  ? 477  LYS A NZ    1 
ATOM   4565 N  N     . VAL C 3 478 ? 16.977  47.654 17.585  1.00 49.94  ? 478  VAL A N     1 
ATOM   4566 C  CA    . VAL C 3 478 ? 16.068  46.892 18.435  1.00 49.13  ? 478  VAL A CA    1 
ATOM   4567 C  C     . VAL C 3 478 ? 14.992  46.235 17.582  1.00 48.91  ? 478  VAL A C     1 
ATOM   4568 O  O     . VAL C 3 478 ? 14.594  45.113 17.867  1.00 48.97  ? 478  VAL A O     1 
ATOM   4569 C  CB    . VAL C 3 478 ? 15.487  47.759 19.578  1.00 48.99  ? 478  VAL A CB    1 
ATOM   4570 C  CG1   . VAL C 3 478 ? 14.659  46.933 20.535  1.00 47.96  ? 478  VAL A CG1   1 
ATOM   4571 C  CG2   . VAL C 3 478 ? 16.620  48.432 20.338  1.00 48.29  ? 478  VAL A CG2   1 
ATOM   4572 N  N     . PHE C 3 479 ? 14.560  46.898 16.513  1.00 48.77  ? 479  PHE A N     1 
ATOM   4573 C  CA    . PHE C 3 479 ? 13.594  46.271 15.616  1.00 49.17  ? 479  PHE A CA    1 
ATOM   4574 C  C     . PHE C 3 479 ? 14.105  44.931 15.080  1.00 49.53  ? 479  PHE A C     1 
ATOM   4575 O  O     . PHE C 3 479 ? 13.367  43.944 15.051  1.00 49.59  ? 479  PHE A O     1 
ATOM   4576 C  CB    . PHE C 3 479 ? 13.183  47.176 14.450  1.00 48.90  ? 479  PHE A CB    1 
ATOM   4577 C  CG    . PHE C 3 479 ? 12.509  46.426 13.321  1.00 49.17  ? 479  PHE A CG    1 
ATOM   4578 C  CD1   . PHE C 3 479 ? 11.218  45.923 13.469  1.00 48.72  ? 479  PHE A CD1   1 
ATOM   4579 C  CD2   . PHE C 3 479 ? 13.178  46.191 12.121  1.00 49.89  ? 479  PHE A CD2   1 
ATOM   4580 C  CE1   . PHE C 3 479 ? 10.592  45.214 12.433  1.00 48.64  ? 479  PHE A CE1   1 
ATOM   4581 C  CE2   . PHE C 3 479 ? 12.561  45.486 11.071  1.00 50.05  ? 479  PHE A CE2   1 
ATOM   4582 C  CZ    . PHE C 3 479 ? 11.263  44.998 11.228  1.00 49.28  ? 479  PHE A CZ    1 
ATOM   4583 N  N     . ASN C 3 480 ? 15.365  44.906 14.655  1.00 50.03  ? 480  ASN A N     1 
ATOM   4584 C  CA    . ASN C 3 480 ? 15.971  43.683 14.133  1.00 50.30  ? 480  ASN A CA    1 
ATOM   4585 C  C     . ASN C 3 480 ? 16.049  42.565 15.179  1.00 50.37  ? 480  ASN A C     1 
ATOM   4586 O  O     . ASN C 3 480 ? 15.838  41.397 14.852  1.00 50.44  ? 480  ASN A O     1 
ATOM   4587 C  CB    . ASN C 3 480 ? 17.337  43.981 13.515  1.00 50.33  ? 480  ASN A CB    1 
ATOM   4588 C  CG    . ASN C 3 480 ? 17.235  44.843 12.250  1.00 50.45  ? 480  ASN A CG    1 
ATOM   4589 O  OD1   . ASN C 3 480 ? 16.562  44.484 11.287  1.00 50.47  ? 480  ASN A OD1   1 
ATOM   4590 N  ND2   . ASN C 3 480 ? 17.917  45.977 12.253  1.00 50.04  ? 480  ASN A ND2   1 
ATOM   4591 N  N     . GLN C 3 481 ? 16.315  42.928 16.431  1.00 50.25  ? 481  GLN A N     1 
ATOM   4592 C  CA    . GLN C 3 481 ? 16.269  41.968 17.528  1.00 50.60  ? 481  GLN A CA    1 
ATOM   4593 C  C     . GLN C 3 481 ? 14.872  41.406 17.697  1.00 50.85  ? 481  GLN A C     1 
ATOM   4594 O  O     . GLN C 3 481 ? 14.695  40.189 17.859  1.00 50.80  ? 481  GLN A O     1 
ATOM   4595 C  CB    . GLN C 3 481 ? 16.704  42.612 18.827  1.00 50.72  ? 481  GLN A CB    1 
ATOM   4596 C  CG    . GLN C 3 481 ? 18.191  42.765 18.958  1.00 52.00  ? 481  GLN A CG    1 
ATOM   4597 C  CD    . GLN C 3 481 ? 18.569  43.549 20.183  1.00 54.87  ? 481  GLN A CD    1 
ATOM   4598 O  OE1   . GLN C 3 481 ? 18.045  43.323 21.279  1.00 55.66  ? 481  GLN A OE1   1 
ATOM   4599 N  NE2   . GLN C 3 481 ? 19.491  44.488 20.011  1.00 57.92  ? 481  GLN A NE2   1 
ATOM   4600 N  N     . ARG C 3 482 ? 13.882  42.297 17.643  1.00 50.76  ? 482  ARG A N     1 
ATOM   4601 C  CA    . ARG C 3 482 ? 12.486  41.889 17.637  1.00 50.56  ? 482  ARG A CA    1 
ATOM   4602 C  C     . ARG C 3 482 ? 12.263  40.891 16.525  1.00 50.77  ? 482  ARG A C     1 
ATOM   4603 O  O     . ARG C 3 482 ? 11.749  39.808 16.765  1.00 50.66  ? 482  ARG A O     1 
ATOM   4604 C  CB    . ARG C 3 482 ? 11.568  43.101 17.448  1.00 50.50  ? 482  ARG A CB    1 
ATOM   4605 C  CG    . ARG C 3 482 ? 10.100  42.863 17.797  1.00 49.53  ? 482  ARG A CG    1 
ATOM   4606 C  CD    . ARG C 3 482 ? 9.244   42.673 16.544  1.00 48.15  ? 482  ARG A CD    1 
ATOM   4607 N  NE    . ARG C 3 482 ? 7.892   42.216 16.867  1.00 46.16  ? 482  ARG A NE    1 
ATOM   4608 C  CZ    . ARG C 3 482 ? 6.816   42.445 16.117  1.00 45.38  ? 482  ARG A CZ    1 
ATOM   4609 N  NH1   . ARG C 3 482 ? 6.903   43.151 14.991  1.00 45.42  ? 482  ARG A NH1   1 
ATOM   4610 N  NH2   . ARG C 3 482 ? 5.637   41.986 16.503  1.00 44.04  ? 482  ARG A NH2   1 
ATOM   4611 N  N     . LYS C 3 483 ? 12.679  41.254 15.316  1.00 51.42  ? 483  LYS A N     1 
ATOM   4612 C  CA    . LYS C 3 483 ? 12.420  40.452 14.120  1.00 52.26  ? 483  LYS A CA    1 
ATOM   4613 C  C     . LYS C 3 483 ? 12.990  39.044 14.246  1.00 52.40  ? 483  LYS A C     1 
ATOM   4614 O  O     . LYS C 3 483 ? 12.342  38.065 13.871  1.00 52.45  ? 483  LYS A O     1 
ATOM   4615 C  CB    . LYS C 3 483 ? 12.989  41.146 12.882  1.00 52.47  ? 483  LYS A CB    1 
ATOM   4616 C  CG    . LYS C 3 483 ? 12.545  40.526 11.573  1.00 54.54  ? 483  LYS A CG    1 
ATOM   4617 C  CD    . LYS C 3 483 ? 13.430  40.966 10.405  1.00 58.48  ? 483  LYS A CD    1 
ATOM   4618 C  CE    . LYS C 3 483 ? 13.201  40.094 9.149   1.00 60.05  ? 483  LYS A CE    1 
ATOM   4619 N  NZ    . LYS C 3 483 ? 14.205  40.364 8.050   1.00 60.83  ? 483  LYS A NZ    1 
ATOM   4620 N  N     . GLU C 3 484 ? 14.201  38.953 14.792  1.00 52.73  ? 484  GLU A N     1 
ATOM   4621 C  CA    . GLU C 3 484 ? 14.886  37.677 14.969  1.00 52.82  ? 484  GLU A CA    1 
ATOM   4622 C  C     . GLU C 3 484 ? 14.091  36.737 15.869  1.00 52.52  ? 484  GLU A C     1 
ATOM   4623 O  O     . GLU C 3 484 ? 13.796  35.600 15.478  1.00 53.19  ? 484  GLU A O     1 
ATOM   4624 C  CB    . GLU C 3 484 ? 16.276  37.901 15.558  1.00 53.16  ? 484  GLU A CB    1 
ATOM   4625 C  CG    . GLU C 3 484 ? 17.165  36.671 15.507  1.00 54.82  ? 484  GLU A CG    1 
ATOM   4626 C  CD    . GLU C 3 484 ? 18.265  36.688 16.557  1.00 58.12  ? 484  GLU A CD    1 
ATOM   4627 O  OE1   . GLU C 3 484 ? 18.604  37.788 17.076  1.00 58.80  ? 484  GLU A OE1   1 
ATOM   4628 O  OE2   . GLU C 3 484 ? 18.791  35.589 16.865  1.00 58.62  ? 484  GLU A OE2   1 
ATOM   4629 N  N     . HIS C 3 485 ? 13.754  37.219 17.067  1.00 51.71  ? 485  HIS A N     1 
ATOM   4630 C  CA    . HIS C 3 485 ? 12.975  36.458 18.040  1.00 50.76  ? 485  HIS A CA    1 
ATOM   4631 C  C     . HIS C 3 485 ? 11.550  36.165 17.575  1.00 50.71  ? 485  HIS A C     1 
ATOM   4632 O  O     . HIS C 3 485 ? 10.992  35.124 17.925  1.00 50.70  ? 485  HIS A O     1 
ATOM   4633 C  CB    . HIS C 3 485 ? 12.942  37.185 19.377  1.00 50.54  ? 485  HIS A CB    1 
ATOM   4634 C  CG    . HIS C 3 485 ? 14.288  37.337 20.008  1.00 50.61  ? 485  HIS A CG    1 
ATOM   4635 N  ND1   . HIS C 3 485 ? 14.992  36.270 20.522  1.00 51.03  ? 485  HIS A ND1   1 
ATOM   4636 C  CD2   . HIS C 3 485 ? 15.058  38.430 20.215  1.00 50.49  ? 485  HIS A CD2   1 
ATOM   4637 C  CE1   . HIS C 3 485 ? 16.137  36.700 21.020  1.00 50.69  ? 485  HIS A CE1   1 
ATOM   4638 N  NE2   . HIS C 3 485 ? 16.203  38.006 20.841  1.00 50.48  ? 485  HIS A NE2   1 
ATOM   4639 N  N     . LYS C 3 486 ? 10.948  37.067 16.797  1.00 50.30  ? 486  LYS A N     1 
ATOM   4640 C  CA    . LYS C 3 486 ? 9.662   36.749 16.204  1.00 50.09  ? 486  LYS A CA    1 
ATOM   4641 C  C     . LYS C 3 486 ? 9.784   35.536 15.277  1.00 50.15  ? 486  LYS A C     1 
ATOM   4642 O  O     . LYS C 3 486 ? 8.880   34.680 15.241  1.00 49.74  ? 486  LYS A O     1 
ATOM   4643 C  CB    . LYS C 3 486 ? 9.033   37.931 15.466  1.00 49.99  ? 486  LYS A CB    1 
ATOM   4644 C  CG    . LYS C 3 486 ? 7.551   37.682 15.234  1.00 50.47  ? 486  LYS A CG    1 
ATOM   4645 C  CD    . LYS C 3 486 ? 6.850   38.757 14.460  1.00 52.38  ? 486  LYS A CD    1 
ATOM   4646 C  CE    . LYS C 3 486 ? 5.390   38.351 14.260  1.00 53.50  ? 486  LYS A CE    1 
ATOM   4647 N  NZ    . LYS C 3 486 ? 4.593   39.244 13.360  1.00 53.80  ? 486  LYS A NZ    1 
ATOM   4648 N  N     . GLY C 3 487 ? 10.905  35.475 14.549  1.00 50.06  ? 487  GLY A N     1 
ATOM   4649 C  CA    . GLY C 3 487 ? 11.199  34.368 13.643  1.00 50.67  ? 487  GLY A CA    1 
ATOM   4650 C  C     . GLY C 3 487 ? 11.190  33.032 14.360  1.00 50.97  ? 487  GLY A C     1 
ATOM   4651 O  O     . GLY C 3 487 ? 10.480  32.094 13.961  1.00 50.68  ? 487  GLY A O     1 
ATOM   4652 N  N     . TYR C 3 488 ? 11.967  32.964 15.439  1.00 51.41  ? 488  TYR A N     1 
ATOM   4653 C  CA    . TYR C 3 488 ? 12.028  31.779 16.294  1.00 51.96  ? 488  TYR A CA    1 
ATOM   4654 C  C     . TYR C 3 488 ? 10.658  31.417 16.867  1.00 52.36  ? 488  TYR A C     1 
ATOM   4655 O  O     . TYR C 3 488 ? 10.245  30.266 16.779  1.00 53.23  ? 488  TYR A O     1 
ATOM   4656 C  CB    . TYR C 3 488 ? 13.044  31.950 17.434  1.00 52.01  ? 488  TYR A CB    1 
ATOM   4657 C  CG    . TYR C 3 488 ? 14.458  32.322 17.009  1.00 52.07  ? 488  TYR A CG    1 
ATOM   4658 C  CD1   . TYR C 3 488 ? 14.907  32.095 15.704  1.00 51.93  ? 488  TYR A CD1   1 
ATOM   4659 C  CD2   . TYR C 3 488 ? 15.353  32.870 17.931  1.00 52.46  ? 488  TYR A CD2   1 
ATOM   4660 C  CE1   . TYR C 3 488 ? 16.189  32.430 15.316  1.00 52.87  ? 488  TYR A CE1   1 
ATOM   4661 C  CE2   . TYR C 3 488 ? 16.652  33.201 17.566  1.00 53.36  ? 488  TYR A CE2   1 
ATOM   4662 C  CZ    . TYR C 3 488 ? 17.066  32.981 16.251  1.00 53.60  ? 488  TYR A CZ    1 
ATOM   4663 O  OH    . TYR C 3 488 ? 18.351  33.309 15.865  1.00 52.48  ? 488  TYR A OH    1 
ATOM   4664 N  N     . MET C 3 489 ? 9.954   32.396 17.435  1.00 52.37  ? 489  MET A N     1 
ATOM   4665 C  CA    . MET C 3 489 ? 8.604   32.183 17.957  1.00 51.98  ? 489  MET A CA    1 
ATOM   4666 C  C     . MET C 3 489 ? 7.692   31.483 16.933  1.00 51.95  ? 489  MET A C     1 
ATOM   4667 O  O     . MET C 3 489 ? 7.117   30.436 17.227  1.00 51.79  ? 489  MET A O     1 
ATOM   4668 C  CB    . MET C 3 489 ? 7.986   33.516 18.413  1.00 52.08  ? 489  MET A CB    1 
ATOM   4669 C  CG    . MET C 3 489 ? 6.745   33.356 19.303  1.00 51.55  ? 489  MET A CG    1 
ATOM   4670 S  SD    . MET C 3 489 ? 5.618   34.772 19.291  1.00 51.34  ? 489  MET A SD    1 
ATOM   4671 C  CE    . MET C 3 489 ? 5.252   34.939 17.551  1.00 51.72  ? 489  MET A CE    1 
ATOM   4672 N  N     . LEU C 3 490 ? 7.584   32.066 15.739  1.00 51.92  ? 490  LEU A N     1 
ATOM   4673 C  CA    . LEU C 3 490 ? 6.708   31.573 14.677  1.00 51.65  ? 490  LEU A CA    1 
ATOM   4674 C  C     . LEU C 3 490 ? 7.110   30.189 14.191  1.00 51.92  ? 490  LEU A C     1 
ATOM   4675 O  O     . LEU C 3 490 ? 6.262   29.396 13.779  1.00 52.08  ? 490  LEU A O     1 
ATOM   4676 C  CB    . LEU C 3 490 ? 6.741   32.538 13.499  1.00 51.59  ? 490  LEU A CB    1 
ATOM   4677 C  CG    . LEU C 3 490 ? 5.965   33.850 13.621  1.00 51.64  ? 490  LEU A CG    1 
ATOM   4678 C  CD1   . LEU C 3 490 ? 6.534   34.945 12.714  1.00 51.61  ? 490  LEU A CD1   1 
ATOM   4679 C  CD2   . LEU C 3 490 ? 4.508   33.610 13.310  1.00 51.22  ? 490  LEU A CD2   1 
ATOM   4680 N  N     . ALA C 3 491 ? 8.412   29.908 14.216  1.00 51.98  ? 491  ALA A N     1 
ATOM   4681 C  CA    . ALA C 3 491 ? 8.910   28.579 13.876  1.00 51.81  ? 491  ALA A CA    1 
ATOM   4682 C  C     . ALA C 3 491 ? 8.501   27.571 14.949  1.00 51.74  ? 491  ALA A C     1 
ATOM   4683 O  O     . ALA C 3 491 ? 8.024   26.484 14.633  1.00 52.11  ? 491  ALA A O     1 
ATOM   4684 C  CB    . ALA C 3 491 ? 10.422  28.600 13.677  1.00 51.46  ? 491  ALA A CB    1 
ATOM   4685 N  N     . ALA C 3 492 ? 8.653   27.951 16.214  1.00 51.64  ? 492  ALA A N     1 
ATOM   4686 C  CA    . ALA C 3 492 ? 8.269   27.096 17.345  1.00 51.62  ? 492  ALA A CA    1 
ATOM   4687 C  C     . ALA C 3 492 ? 6.804   26.731 17.311  1.00 51.55  ? 492  ALA A C     1 
ATOM   4688 O  O     . ALA C 3 492 ? 6.414   25.652 17.761  1.00 51.60  ? 492  ALA A O     1 
ATOM   4689 C  CB    . ALA C 3 492 ? 8.602   27.775 18.675  1.00 51.74  ? 492  ALA A CB    1 
ATOM   4690 N  N     . GLN C 3 493 ? 6.006   27.651 16.776  1.00 51.43  ? 493  GLN A N     1 
ATOM   4691 C  CA    . GLN C 3 493 ? 4.564   27.526 16.753  1.00 51.42  ? 493  GLN A CA    1 
ATOM   4692 C  C     . GLN C 3 493 ? 4.160   26.570 15.647  1.00 51.40  ? 493  GLN A C     1 
ATOM   4693 O  O     . GLN C 3 493 ? 3.178   25.829 15.781  1.00 51.13  ? 493  GLN A O     1 
ATOM   4694 C  CB    . GLN C 3 493 ? 3.951   28.908 16.551  1.00 51.50  ? 493  GLN A CB    1 
ATOM   4695 C  CG    . GLN C 3 493 ? 2.449   28.945 16.459  1.00 51.81  ? 493  GLN A CG    1 
ATOM   4696 C  CD    . GLN C 3 493 ? 1.914   30.365 16.442  1.00 52.27  ? 493  GLN A CD    1 
ATOM   4697 O  OE1   . GLN C 3 493 ? 2.678   31.326 16.359  1.00 49.70  ? 493  GLN A OE1   1 
ATOM   4698 N  NE2   . GLN C 3 493 ? 0.582   30.505 16.532  1.00 54.03  ? 493  GLN A NE2   1 
ATOM   4699 N  N     . ARG C 3 494 ? 4.936   26.594 14.565  1.00 51.69  ? 494  ARG A N     1 
ATOM   4700 C  CA    . ARG C 3 494 ? 4.769   25.668 13.455  1.00 52.24  ? 494  ARG A CA    1 
ATOM   4701 C  C     . ARG C 3 494 ? 5.222   24.269 13.845  1.00 53.01  ? 494  ARG A C     1 
ATOM   4702 O  O     . ARG C 3 494 ? 4.505   23.275 13.617  1.00 53.00  ? 494  ARG A O     1 
ATOM   4703 C  CB    . ARG C 3 494 ? 5.540   26.147 12.241  1.00 51.93  ? 494  ARG A CB    1 
ATOM   4704 C  CG    . ARG C 3 494 ? 4.819   27.201 11.450  1.00 51.39  ? 494  ARG A CG    1 
ATOM   4705 C  CD    . ARG C 3 494 ? 5.507   27.426 10.130  1.00 51.16  ? 494  ARG A CD    1 
ATOM   4706 N  NE    . ARG C 3 494 ? 6.906   27.806 10.327  1.00 53.21  ? 494  ARG A NE    1 
ATOM   4707 C  CZ    . ARG C 3 494 ? 7.346   29.053 10.506  1.00 52.94  ? 494  ARG A CZ    1 
ATOM   4708 N  NH1   . ARG C 3 494 ? 6.501   30.077 10.516  1.00 52.13  ? 494  ARG A NH1   1 
ATOM   4709 N  NH2   . ARG C 3 494 ? 8.645   29.279 10.667  1.00 51.99  ? 494  ARG A NH2   1 
ATOM   4710 N  N     . ASN C 3 495 ? 6.403   24.191 14.449  1.00 53.77  ? 495  ASN A N     1 
ATOM   4711 C  CA    . ASN C 3 495 ? 6.870   22.933 15.004  1.00 54.84  ? 495  ASN A CA    1 
ATOM   4712 C  C     . ASN C 3 495 ? 5.851   22.374 16.005  1.00 55.80  ? 495  ASN A C     1 
ATOM   4713 O  O     . ASN C 3 495 ? 5.663   21.163 16.090  1.00 56.09  ? 495  ASN A O     1 
ATOM   4714 C  CB    . ASN C 3 495 ? 8.275   23.074 15.615  1.00 54.49  ? 495  ASN A CB    1 
ATOM   4715 C  CG    . ASN C 3 495 ? 9.351   23.427 14.563  1.00 54.98  ? 495  ASN A CG    1 
ATOM   4716 O  OD1   . ASN C 3 495 ? 9.094   23.413 13.347  1.00 54.84  ? 495  ASN A OD1   1 
ATOM   4717 N  ND2   . ASN C 3 495 ? 10.556  23.762 15.036  1.00 53.85  ? 495  ASN A ND2   1 
ATOM   4718 N  N     . GLY C 3 496 ? 5.165   23.258 16.727  1.00 56.86  ? 496  GLY A N     1 
ATOM   4719 C  CA    . GLY C 3 496 ? 4.087   22.850 17.624  1.00 58.01  ? 496  GLY A CA    1 
ATOM   4720 C  C     . GLY C 3 496 ? 2.939   22.177 16.888  1.00 59.05  ? 496  GLY A C     1 
ATOM   4721 O  O     . GLY C 3 496 ? 2.424   21.151 17.349  1.00 59.07  ? 496  GLY A O     1 
ATOM   4722 N  N     . GLU C 3 497 ? 2.548   22.750 15.744  1.00 59.85  ? 497  GLU A N     1 
ATOM   4723 C  CA    . GLU C 3 497 ? 1.454   22.215 14.927  1.00 60.68  ? 497  GLU A CA    1 
ATOM   4724 C  C     . GLU C 3 497 ? 1.801   20.891 14.255  1.00 61.28  ? 497  GLU A C     1 
ATOM   4725 O  O     . GLU C 3 497 ? 0.927   20.049 14.064  1.00 61.14  ? 497  GLU A O     1 
ATOM   4726 C  CB    . GLU C 3 497 ? 0.987   23.226 13.876  1.00 60.63  ? 497  GLU A CB    1 
ATOM   4727 C  CG    . GLU C 3 497 ? 0.247   24.453 14.425  1.00 61.39  ? 497  GLU A CG    1 
ATOM   4728 C  CD    . GLU C 3 497 ? -0.727  24.162 15.582  1.00 62.74  ? 497  GLU A CD    1 
ATOM   4729 O  OE1   . GLU C 3 497 ? -1.530  23.197 15.510  1.00 63.20  ? 497  GLU A OE1   1 
ATOM   4730 O  OE2   . GLU C 3 497 ? -0.699  24.929 16.570  1.00 62.83  ? 497  GLU A OE2   1 
ATOM   4731 N  N     . ILE C 3 498 ? 3.074   20.721 13.904  1.00 62.28  ? 498  ILE A N     1 
ATOM   4732 C  CA    . ILE C 3 498 ? 3.591   19.456 13.378  1.00 63.45  ? 498  ILE A CA    1 
ATOM   4733 C  C     . ILE C 3 498 ? 3.519   18.333 14.428  1.00 64.49  ? 498  ILE A C     1 
ATOM   4734 O  O     . ILE C 3 498 ? 3.253   17.174 14.091  1.00 64.20  ? 498  ILE A O     1 
ATOM   4735 C  CB    . ILE C 3 498 ? 5.055   19.603 12.882  1.00 63.43  ? 498  ILE A CB    1 
ATOM   4736 C  CG1   . ILE C 3 498 ? 5.142   20.594 11.731  1.00 62.72  ? 498  ILE A CG1   1 
ATOM   4737 C  CG2   . ILE C 3 498 ? 5.625   18.261 12.431  1.00 63.65  ? 498  ILE A CG2   1 
ATOM   4738 C  CD1   . ILE C 3 498 ? 6.556   21.034 11.428  1.00 63.41  ? 498  ILE A CD1   1 
ATOM   4739 N  N     . ILE C 3 499 ? 3.763   18.671 15.695  1.00 65.80  ? 499  ILE A N     1 
ATOM   4740 C  CA    . ILE C 3 499 ? 3.701   17.668 16.761  1.00 67.12  ? 499  ILE A CA    1 
ATOM   4741 C  C     . ILE C 3 499 ? 2.239   17.335 17.032  1.00 68.41  ? 499  ILE A C     1 
ATOM   4742 O  O     . ILE C 3 499 ? 1.910   16.208 17.399  1.00 68.81  ? 499  ILE A O     1 
ATOM   4743 C  CB    . ILE C 3 499 ? 4.436   18.104 18.072  1.00 66.88  ? 499  ILE A CB    1 
ATOM   4744 C  CG1   . ILE C 3 499 ? 5.869   18.536 17.786  1.00 66.42  ? 499  ILE A CG1   1 
ATOM   4745 C  CG2   . ILE C 3 499 ? 4.503   16.957 19.076  1.00 66.76  ? 499  ILE A CG2   1 
ATOM   4746 C  CD1   . ILE C 3 499 ? 6.471   19.376 18.893  1.00 65.97  ? 499  ILE A CD1   1 
ATOM   4747 N  N     . LYS C 3 500 ? 1.359   18.305 16.818  1.00 69.97  ? 500  LYS A N     1 
ATOM   4748 C  CA    . LYS C 3 500 ? -0.060  18.101 17.076  1.00 71.57  ? 500  LYS A CA    1 
ATOM   4749 C  C     . LYS C 3 500 ? -0.714  17.099 16.129  1.00 73.00  ? 500  LYS A C     1 
ATOM   4750 O  O     . LYS C 3 500 ? -1.588  16.338 16.552  1.00 73.07  ? 500  LYS A O     1 
ATOM   4751 C  CB    . LYS C 3 500 ? -0.813  19.430 17.101  1.00 71.31  ? 500  LYS A CB    1 
ATOM   4752 C  CG    . LYS C 3 500 ? -0.871  20.025 18.495  1.00 70.55  ? 500  LYS A CG    1 
ATOM   4753 C  CD    . LYS C 3 500 ? -0.936  21.530 18.449  1.00 69.48  ? 500  LYS A CD    1 
ATOM   4754 C  CE    . LYS C 3 500 ? -1.021  22.120 19.842  1.00 68.13  ? 500  LYS A CE    1 
ATOM   4755 N  NZ    . LYS C 3 500 ? -1.085  23.602 19.777  1.00 66.16  ? 500  LYS A NZ    1 
ATOM   4756 N  N     . GLU C 3 501 ? -0.284  17.090 14.867  1.00 74.85  ? 501  GLU A N     1 
ATOM   4757 C  CA    . GLU C 3 501 ? -0.778  16.107 13.894  1.00 76.87  ? 501  GLU A CA    1 
ATOM   4758 C  C     . GLU C 3 501 ? -0.192  14.714 14.158  1.00 78.10  ? 501  GLU A C     1 
ATOM   4759 O  O     . GLU C 3 501 ? -0.829  13.691 13.865  1.00 78.26  ? 501  GLU A O     1 
ATOM   4760 C  CB    . GLU C 3 501 ? -0.525  16.550 12.437  1.00 76.99  ? 501  GLU A CB    1 
ATOM   4761 C  CG    . GLU C 3 501 ? 0.905   17.018 12.081  1.00 78.21  ? 501  GLU A CG    1 
ATOM   4762 C  CD    . GLU C 3 501 ? 1.894   15.889 11.705  1.00 80.27  ? 501  GLU A CD    1 
ATOM   4763 O  OE1   . GLU C 3 501 ? 1.591   14.686 11.894  1.00 80.08  ? 501  GLU A OE1   1 
ATOM   4764 O  OE2   . GLU C 3 501 ? 3.005   16.217 11.225  1.00 80.91  ? 501  GLU A OE2   1 
ATOM   4765 N  N     . ALA C 3 502 ? 1.019   14.694 14.718  1.00 79.57  ? 502  ALA A N     1 
ATOM   4766 C  CA    . ALA C 3 502 ? 1.741   13.455 15.012  1.00 80.85  ? 502  ALA A CA    1 
ATOM   4767 C  C     . ALA C 3 502 ? 1.045   12.620 16.069  1.00 81.83  ? 502  ALA A C     1 
ATOM   4768 O  O     . ALA C 3 502 ? 1.125   11.391 16.032  1.00 82.09  ? 502  ALA A O     1 
ATOM   4769 C  CB    . ALA C 3 502 ? 3.169   13.747 15.431  1.00 80.74  ? 502  ALA A CB    1 
ATOM   4770 N  N     . LEU C 3 503 ? 0.365   13.274 17.007  1.00 83.07  ? 503  LEU A N     1 
ATOM   4771 C  CA    . LEU C 3 503 ? -0.361  12.531 18.031  1.00 84.51  ? 503  LEU A CA    1 
ATOM   4772 C  C     . LEU C 3 503 ? -1.856  12.328 17.741  1.00 85.67  ? 503  LEU A C     1 
ATOM   4773 O  O     . LEU C 3 503 ? -2.652  12.064 18.651  1.00 85.89  ? 503  LEU A O     1 
ATOM   4774 C  CB    . LEU C 3 503 ? -0.083  13.054 19.453  1.00 84.43  ? 503  LEU A CB    1 
ATOM   4775 C  CG    . LEU C 3 503 ? 0.242   14.507 19.788  1.00 84.40  ? 503  LEU A CG    1 
ATOM   4776 C  CD1   . LEU C 3 503 ? -0.989  15.397 19.666  1.00 84.85  ? 503  LEU A CD1   1 
ATOM   4777 C  CD2   . LEU C 3 503 ? 0.802   14.553 21.195  1.00 84.07  ? 503  LEU A CD2   1 
ATOM   4778 N  N     . HIS C 3 504 ? -2.226  12.415 16.464  1.00 87.05  ? 504  HIS A N     1 
ATOM   4779 C  CA    . HIS C 3 504 ? -3.543  11.933 16.029  1.00 88.38  ? 504  HIS A CA    1 
ATOM   4780 C  C     . HIS C 3 504 ? -3.542  10.396 15.947  1.00 88.94  ? 504  HIS A C     1 
ATOM   4781 O  O     . HIS C 3 504 ? -4.572  9.759  16.175  1.00 89.35  ? 504  HIS A O     1 
ATOM   4782 C  CB    . HIS C 3 504 ? -3.987  12.594 14.720  1.00 88.44  ? 504  HIS A CB    1 
ATOM   4783 C  CG    . HIS C 3 504 ? -4.562  13.970 14.902  1.00 89.39  ? 504  HIS A CG    1 
ATOM   4784 N  ND1   . HIS C 3 504 ? -4.025  14.894 15.779  1.00 90.06  ? 504  HIS A ND1   1 
ATOM   4785 C  CD2   . HIS C 3 504 ? -5.618  14.583 14.307  1.00 90.22  ? 504  HIS A CD2   1 
ATOM   4786 C  CE1   . HIS C 3 504 ? -4.730  16.012 15.723  1.00 90.03  ? 504  HIS A CE1   1 
ATOM   4787 N  NE2   . HIS C 3 504 ? -5.698  15.852 14.834  1.00 90.31  ? 504  HIS A NE2   1 
ATOM   4788 N  N     . ASN C 3 505 ? -2.386  9.814  15.626  1.00 89.39  ? 505  ASN A N     1 
ATOM   4789 C  CA    . ASN C 3 505 ? -2.129  8.388  15.878  1.00 89.81  ? 505  ASN A CA    1 
ATOM   4790 C  C     . ASN C 3 505 ? -0.650  8.118  16.178  1.00 90.00  ? 505  ASN A C     1 
ATOM   4791 O  O     . ASN C 3 505 ? 0.153   7.934  15.264  1.00 89.97  ? 505  ASN A O     1 
ATOM   4792 C  CB    . ASN C 3 505 ? -2.695  7.454  14.782  1.00 89.86  ? 505  ASN A CB    1 
ATOM   4793 C  CG    . ASN C 3 505 ? -2.462  7.970  13.361  1.00 90.14  ? 505  ASN A CG    1 
ATOM   4794 O  OD1   . ASN C 3 505 ? -2.647  9.155  13.066  1.00 90.49  ? 505  ASN A OD1   1 
ATOM   4795 N  ND2   . ASN C 3 505 ? -2.088  7.063  12.466  1.00 89.98  ? 505  ASN A ND2   1 
ATOM   4796 N  N     . PRO C 3 506 ? -0.289  8.119  17.474  1.00 90.29  ? 506  PRO A N     1 
ATOM   4797 C  CA    . PRO C 3 506 ? 1.088   7.921  17.915  1.00 90.65  ? 506  PRO A CA    1 
ATOM   4798 C  C     . PRO C 3 506 ? 1.516   6.464  17.808  1.00 91.08  ? 506  PRO A C     1 
ATOM   4799 O  O     . PRO C 3 506 ? 0.793   5.568  18.251  1.00 91.14  ? 506  PRO A O     1 
ATOM   4800 C  CB    . PRO C 3 506 ? 1.046   8.346  19.379  1.00 90.64  ? 506  PRO A CB    1 
ATOM   4801 C  CG    . PRO C 3 506 ? -0.351  8.056  19.809  1.00 90.43  ? 506  PRO A CG    1 
ATOM   4802 C  CD    . PRO C 3 506 ? -1.210  8.318  18.609  1.00 90.30  ? 506  PRO A CD    1 
ATOM   4803 N  N     . ASN C 3 507 ? 2.688   6.236  17.225  1.00 91.53  ? 507  ASN A N     1 
ATOM   4804 C  CA    . ASN C 3 507 ? 3.224   4.886  17.075  1.00 91.86  ? 507  ASN A CA    1 
ATOM   4805 C  C     . ASN C 3 507 ? 3.431   4.179  18.412  1.00 92.02  ? 507  ASN A C     1 
ATOM   4806 O  O     . ASN C 3 507 ? 4.159   4.683  19.268  1.00 92.15  ? 507  ASN A O     1 
ATOM   4807 C  CB    . ASN C 3 507 ? 4.534   4.918  16.283  1.00 91.89  ? 507  ASN A CB    1 
ATOM   4808 C  CG    . ASN C 3 507 ? 4.325   4.644  14.810  1.00 92.04  ? 507  ASN A CG    1 
ATOM   4809 O  OD1   . ASN C 3 507 ? 3.998   3.523  14.420  1.00 92.92  ? 507  ASN A OD1   1 
ATOM   4810 N  ND2   . ASN C 3 507 ? 4.510   5.663  13.982  1.00 91.52  ? 507  ASN A ND2   1 
ATOM   4811 N  N     . LEU C 3 508 ? 2.761   3.034  18.589  1.00 92.10  ? 508  LEU A N     1 
ATOM   4812 C  CA    . LEU C 3 508 ? 2.984   2.144  19.738  1.00 92.04  ? 508  LEU A CA    1 
ATOM   4813 C  C     . LEU C 3 508 ? 4.485   1.858  19.862  1.00 91.87  ? 508  LEU A C     1 
ATOM   4814 O  O     . LEU C 3 508 ? 5.043   1.081  19.081  1.00 91.84  ? 508  LEU A O     1 
ATOM   4815 C  CB    . LEU C 3 508 ? 2.195   0.832  19.571  1.00 92.09  ? 508  LEU A CB    1 
ATOM   4816 C  CG    . LEU C 3 508 ? 0.849   0.532  20.260  1.00 92.58  ? 508  LEU A CG    1 
ATOM   4817 C  CD1   . LEU C 3 508 ? 1.063   0.026  21.694  1.00 92.78  ? 508  LEU A CD1   1 
ATOM   4818 C  CD2   . LEU C 3 508 ? -0.163  1.696  20.227  1.00 92.79  ? 508  LEU A CD2   1 
ATOM   4819 N  N     . SER C 3 509 ? 5.137   2.510  20.825  1.00 91.63  ? 509  SER A N     1 
ATOM   4820 C  CA    . SER C 3 509 ? 6.603   2.500  20.902  1.00 91.38  ? 509  SER A CA    1 
ATOM   4821 C  C     . SER C 3 509 ? 7.142   2.901  22.281  1.00 91.17  ? 509  SER A C     1 
ATOM   4822 O  O     . SER C 3 509 ? 6.471   3.606  23.038  1.00 91.12  ? 509  SER A O     1 
ATOM   4823 C  CB    . SER C 3 509 ? 7.186   3.426  19.821  1.00 91.40  ? 509  SER A CB    1 
ATOM   4824 O  OG    . SER C 3 509 ? 8.573   3.206  19.630  1.00 91.36  ? 509  SER A OG    1 
ATOM   4825 N  N     . VAL C 3 510 ? 8.349   2.424  22.595  1.00 90.92  ? 510  VAL A N     1 
ATOM   4826 C  CA    . VAL C 3 510 ? 9.115   2.867  23.768  1.00 90.72  ? 510  VAL A CA    1 
ATOM   4827 C  C     . VAL C 3 510 ? 10.338  3.635  23.262  1.00 90.60  ? 510  VAL A C     1 
ATOM   4828 O  O     . VAL C 3 510 ? 11.336  3.030  22.868  1.00 90.62  ? 510  VAL A O     1 
ATOM   4829 C  CB    . VAL C 3 510 ? 9.564   1.680  24.668  1.00 90.69  ? 510  VAL A CB    1 
ATOM   4830 C  CG1   . VAL C 3 510 ? 10.330  2.185  25.897  1.00 90.45  ? 510  VAL A CG1   1 
ATOM   4831 C  CG2   . VAL C 3 510 ? 8.365   0.838  25.094  1.00 90.61  ? 510  VAL A CG2   1 
ATOM   4832 N  N     . ASP C 3 511 ? 10.257  4.966  23.277  1.00 90.49  ? 511  ASP A N     1 
ATOM   4833 C  CA    . ASP C 3 511 ? 11.227  5.805  22.551  1.00 90.26  ? 511  ASP A CA    1 
ATOM   4834 C  C     . ASP C 3 511 ? 11.828  7.003  23.314  1.00 89.80  ? 511  ASP A C     1 
ATOM   4835 O  O     . ASP C 3 511 ? 11.956  6.984  24.540  1.00 89.82  ? 511  ASP A O     1 
ATOM   4836 C  CB    . ASP C 3 511 ? 10.641  6.248  21.197  1.00 90.26  ? 511  ASP A CB    1 
ATOM   4837 C  CG    . ASP C 3 511 ? 9.149   6.550  21.268  1.00 90.94  ? 511  ASP A CG    1 
ATOM   4838 O  OD1   . ASP C 3 511 ? 8.635   6.846  22.372  1.00 91.34  ? 511  ASP A OD1   1 
ATOM   4839 O  OD2   . ASP C 3 511 ? 8.488   6.483  20.211  1.00 91.73  ? 511  ASP A OD2   1 
ATOM   4840 N  N     . GLU C 3 512 ? 12.185  8.040  22.562  1.00 89.20  ? 512  GLU A N     1 
ATOM   4841 C  CA    . GLU C 3 512 ? 13.101  9.071  23.019  1.00 88.54  ? 512  GLU A CA    1 
ATOM   4842 C  C     . GLU C 3 512 ? 12.756  10.404 22.379  1.00 87.74  ? 512  GLU A C     1 
ATOM   4843 O  O     . GLU C 3 512 ? 12.650  10.472 21.153  1.00 88.03  ? 512  GLU A O     1 
ATOM   4844 C  CB    . GLU C 3 512 ? 14.516  8.682  22.592  1.00 88.79  ? 512  GLU A CB    1 
ATOM   4845 C  CG    . GLU C 3 512 ? 15.393  8.198  23.715  1.00 89.45  ? 512  GLU A CG    1 
ATOM   4846 C  CD    . GLU C 3 512 ? 16.126  9.341  24.375  1.00 90.11  ? 512  GLU A CD    1 
ATOM   4847 O  OE1   . GLU C 3 512 ? 17.047  9.900  23.732  1.00 90.47  ? 512  GLU A OE1   1 
ATOM   4848 O  OE2   . GLU C 3 512 ? 15.776  9.678  25.529  1.00 89.93  ? 512  GLU A OE2   1 
ATOM   4849 N  N     . PRO C 3 513 ? 12.564  11.466 23.191  1.00 86.77  ? 513  PRO A N     1 
ATOM   4850 C  CA    . PRO C 3 513 ? 12.322  12.784 22.600  1.00 85.89  ? 513  PRO A CA    1 
ATOM   4851 C  C     . PRO C 3 513 ? 13.570  13.285 21.885  1.00 84.94  ? 513  PRO A C     1 
ATOM   4852 O  O     . PRO C 3 513 ? 14.650  13.314 22.478  1.00 84.93  ? 513  PRO A O     1 
ATOM   4853 C  CB    . PRO C 3 513 ? 11.987  13.666 23.814  1.00 85.81  ? 513  PRO A CB    1 
ATOM   4854 C  CG    . PRO C 3 513 ? 11.637  12.710 24.906  1.00 86.10  ? 513  PRO A CG    1 
ATOM   4855 C  CD    . PRO C 3 513 ? 12.521  11.524 24.662  1.00 86.80  ? 513  PRO A CD    1 
ATOM   4856 N  N     . LEU C 3 514 ? 13.415  13.652 20.616  1.00 83.75  ? 514  LEU A N     1 
ATOM   4857 C  CA    . LEU C 3 514 ? 14.545  14.034 19.769  1.00 82.89  ? 514  LEU A CA    1 
ATOM   4858 C  C     . LEU C 3 514 ? 15.313  15.244 20.307  1.00 82.21  ? 514  LEU A C     1 
ATOM   4859 O  O     . LEU C 3 514 ? 14.723  16.135 20.925  1.00 82.26  ? 514  LEU A O     1 
ATOM   4860 C  CB    . LEU C 3 514 ? 14.070  14.312 18.338  1.00 82.97  ? 514  LEU A CB    1 
ATOM   4861 C  CG    . LEU C 3 514 ? 13.981  13.170 17.313  1.00 83.19  ? 514  LEU A CG    1 
ATOM   4862 C  CD1   . LEU C 3 514 ? 12.884  12.155 17.631  1.00 83.05  ? 514  LEU A CD1   1 
ATOM   4863 C  CD2   . LEU C 3 514 ? 13.780  13.739 15.917  1.00 82.84  ? 514  LEU A CD2   1 
ATOM   4864 N  N     . ASP C 3 515 ? 16.627  15.256 20.078  1.00 81.00  ? 515  ASP A N     1 
ATOM   4865 C  CA    . ASP C 3 515 ? 17.486  16.378 20.447  1.00 79.75  ? 515  ASP A CA    1 
ATOM   4866 C  C     . ASP C 3 515 ? 17.478  17.409 19.312  1.00 78.62  ? 515  ASP A C     1 
ATOM   4867 O  O     . ASP C 3 515 ? 18.177  17.236 18.305  1.00 78.85  ? 515  ASP A O     1 
ATOM   4868 C  CB    . ASP C 3 515 ? 18.915  15.885 20.739  1.00 80.12  ? 515  ASP A CB    1 
ATOM   4869 C  CG    . ASP C 3 515 ? 19.923  17.033 20.949  1.00 81.31  ? 515  ASP A CG    1 
ATOM   4870 O  OD1   . ASP C 3 515 ? 19.544  18.081 21.526  1.00 82.60  ? 515  ASP A OD1   1 
ATOM   4871 O  OD2   . ASP C 3 515 ? 21.104  16.879 20.544  1.00 82.06  ? 515  ASP A OD2   1 
ATOM   4872 N  N     . VAL C 3 516 ? 16.682  18.471 19.474  1.00 76.82  ? 516  VAL A N     1 
ATOM   4873 C  CA    . VAL C 3 516 ? 16.533  19.505 18.434  1.00 74.96  ? 516  VAL A CA    1 
ATOM   4874 C  C     . VAL C 3 516 ? 16.320  20.927 18.945  1.00 73.54  ? 516  VAL A C     1 
ATOM   4875 O  O     . VAL C 3 516 ? 15.814  21.135 20.045  1.00 73.25  ? 516  VAL A O     1 
ATOM   4876 C  CB    . VAL C 3 516 ? 15.388  19.178 17.425  1.00 75.12  ? 516  VAL A CB    1 
ATOM   4877 C  CG1   . VAL C 3 516 ? 15.904  18.272 16.309  1.00 75.41  ? 516  VAL A CG1   1 
ATOM   4878 C  CG2   . VAL C 3 516 ? 14.158  18.597 18.136  1.00 74.37  ? 516  VAL A CG2   1 
ATOM   4879 N  N     . ASP C 3 517 ? 16.710  21.891 18.110  1.00 71.89  ? 517  ASP A N     1 
ATOM   4880 C  CA    . ASP C 3 517 ? 16.454  23.306 18.343  1.00 70.26  ? 517  ASP A CA    1 
ATOM   4881 C  C     . ASP C 3 517 ? 15.079  23.696 17.782  1.00 69.42  ? 517  ASP A C     1 
ATOM   4882 O  O     . ASP C 3 517 ? 14.911  23.849 16.560  1.00 69.05  ? 517  ASP A O     1 
ATOM   4883 C  CB    . ASP C 3 517 ? 17.555  24.160 17.709  1.00 70.04  ? 517  ASP A CB    1 
ATOM   4884 C  CG    . ASP C 3 517 ? 17.655  25.541 18.331  1.00 69.82  ? 517  ASP A CG    1 
ATOM   4885 O  OD1   . ASP C 3 517 ? 16.602  26.172 18.570  1.00 68.91  ? 517  ASP A OD1   1 
ATOM   4886 O  OD2   . ASP C 3 517 ? 18.791  26.000 18.578  1.00 69.35  ? 517  ASP A OD2   1 
ATOM   4887 N  N     . TYR C 3 518 ? 14.114  23.866 18.694  1.00 68.16  ? 518  TYR A N     1 
ATOM   4888 C  CA    . TYR C 3 518 ? 12.719  24.191 18.360  1.00 66.88  ? 518  TYR A CA    1 
ATOM   4889 C  C     . TYR C 3 518 ? 12.522  25.571 17.730  1.00 66.34  ? 518  TYR A C     1 
ATOM   4890 O  O     . TYR C 3 518 ? 11.418  25.888 17.288  1.00 66.07  ? 518  TYR A O     1 
ATOM   4891 C  CB    . TYR C 3 518 ? 11.820  24.068 19.591  1.00 66.42  ? 518  TYR A CB    1 
ATOM   4892 C  CG    . TYR C 3 518 ? 11.657  22.656 20.100  1.00 66.35  ? 518  TYR A CG    1 
ATOM   4893 C  CD1   . TYR C 3 518 ? 10.683  21.811 19.573  1.00 65.85  ? 518  TYR A CD1   1 
ATOM   4894 C  CD2   . TYR C 3 518 ? 12.479  22.161 21.113  1.00 66.12  ? 518  TYR A CD2   1 
ATOM   4895 C  CE1   . TYR C 3 518 ? 10.528  20.506 20.043  1.00 65.82  ? 518  TYR A CE1   1 
ATOM   4896 C  CE2   . TYR C 3 518 ? 12.338  20.861 21.585  1.00 65.66  ? 518  TYR A CE2   1 
ATOM   4897 C  CZ    . TYR C 3 518 ? 11.359  20.038 21.048  1.00 65.89  ? 518  TYR A CZ    1 
ATOM   4898 O  OH    . TYR C 3 518 ? 11.211  18.751 21.524  1.00 65.50  ? 518  TYR A OH    1 
ATOM   4899 N  N     . ARG C 3 519 ? 13.584  26.377 17.675  1.00 65.58  ? 519  ARG A N     1 
ATOM   4900 C  CA    . ARG C 3 519 ? 13.495  27.721 17.105  1.00 64.92  ? 519  ARG A CA    1 
ATOM   4901 C  C     . ARG C 3 519 ? 13.443  27.704 15.580  1.00 64.72  ? 519  ARG A C     1 
ATOM   4902 O  O     . ARG C 3 519 ? 12.980  28.664 14.954  1.00 64.73  ? 519  ARG A O     1 
ATOM   4903 C  CB    . ARG C 3 519 ? 14.642  28.604 17.604  1.00 64.78  ? 519  ARG A CB    1 
ATOM   4904 C  CG    . ARG C 3 519 ? 14.596  28.879 19.109  1.00 64.34  ? 519  ARG A CG    1 
ATOM   4905 C  CD    . ARG C 3 519 ? 15.836  29.612 19.604  1.00 64.92  ? 519  ARG A CD    1 
ATOM   4906 N  NE    . ARG C 3 519 ? 17.058  29.030 19.053  1.00 66.29  ? 519  ARG A NE    1 
ATOM   4907 C  CZ    . ARG C 3 519 ? 18.284  29.517 19.219  1.00 65.99  ? 519  ARG A CZ    1 
ATOM   4908 N  NH1   . ARG C 3 519 ? 18.492  30.615 19.939  1.00 65.86  ? 519  ARG A NH1   1 
ATOM   4909 N  NH2   . ARG C 3 519 ? 19.307  28.893 18.655  1.00 65.54  ? 519  ARG A NH2   1 
ATOM   4910 N  N     . PHE C 3 520 ? 13.902  26.600 14.990  1.00 64.52  ? 520  PHE A N     1 
ATOM   4911 C  CA    . PHE C 3 520 ? 14.055  26.491 13.539  1.00 63.91  ? 520  PHE A CA    1 
ATOM   4912 C  C     . PHE C 3 520 ? 13.125  25.448 12.971  1.00 63.93  ? 520  PHE A C     1 
ATOM   4913 O  O     . PHE C 3 520 ? 12.725  24.527 13.681  1.00 63.95  ? 520  PHE A O     1 
ATOM   4914 C  CB    . PHE C 3 520 ? 15.513  26.191 13.196  1.00 63.72  ? 520  PHE A CB    1 
ATOM   4915 C  CG    . PHE C 3 520 ? 16.466  27.198 13.754  1.00 62.80  ? 520  PHE A CG    1 
ATOM   4916 C  CD1   . PHE C 3 520 ? 16.727  28.380 13.063  1.00 61.71  ? 520  PHE A CD1   1 
ATOM   4917 C  CD2   . PHE C 3 520 ? 17.061  26.994 14.994  1.00 62.80  ? 520  PHE A CD2   1 
ATOM   4918 C  CE1   . PHE C 3 520 ? 17.587  29.332 13.580  1.00 61.57  ? 520  PHE A CE1   1 
ATOM   4919 C  CE2   . PHE C 3 520 ? 17.929  27.949 15.534  1.00 63.35  ? 520  PHE A CE2   1 
ATOM   4920 C  CZ    . PHE C 3 520 ? 18.196  29.120 14.820  1.00 62.69  ? 520  PHE A CZ    1 
ATOM   4921 N  N     . ASP C 3 521 ? 12.765  25.605 11.701  1.00 64.14  ? 521  ASP A N     1 
ATOM   4922 C  CA    . ASP C 3 521 ? 11.800  24.719 11.065  1.00 64.64  ? 521  ASP A CA    1 
ATOM   4923 C  C     . ASP C 3 521 ? 12.335  23.312 10.990  1.00 64.84  ? 521  ASP A C     1 
ATOM   4924 O  O     . ASP C 3 521 ? 13.397  23.075 10.407  1.00 64.99  ? 521  ASP A O     1 
ATOM   4925 C  CB    . ASP C 3 521 ? 11.431  25.205 9.663   1.00 64.80  ? 521  ASP A CB    1 
ATOM   4926 C  CG    . ASP C 3 521 ? 10.456  26.382 9.679   1.00 65.57  ? 521  ASP A CG    1 
ATOM   4927 O  OD1   . ASP C 3 521 ? 9.421   26.329 10.400  1.00 64.58  ? 521  ASP A OD1   1 
ATOM   4928 O  OD2   . ASP C 3 521 ? 10.731  27.363 8.947   1.00 66.01  ? 521  ASP A OD2   1 
ATOM   4929 N  N     . PHE C 3 522 ? 11.598  22.385 11.597  1.00 65.19  ? 522  PHE A N     1 
ATOM   4930 C  CA    . PHE C 3 522 ? 11.939  20.968 11.557  1.00 65.62  ? 522  PHE A CA    1 
ATOM   4931 C  C     . PHE C 3 522 ? 12.319  20.580 10.135  1.00 66.56  ? 522  PHE A C     1 
ATOM   4932 O  O     . PHE C 3 522 ? 11.535  20.793 9.205   1.00 66.76  ? 522  PHE A O     1 
ATOM   4933 C  CB    . PHE C 3 522 ? 10.752  20.110 12.023  1.00 64.84  ? 522  PHE A CB    1 
ATOM   4934 C  CG    . PHE C 3 522 ? 10.576  20.031 13.529  1.00 63.47  ? 522  PHE A CG    1 
ATOM   4935 C  CD1   . PHE C 3 522 ? 11.603  20.379 14.406  1.00 61.87  ? 522  PHE A CD1   1 
ATOM   4936 C  CD2   . PHE C 3 522 ? 9.378   19.559 14.069  1.00 61.98  ? 522  PHE A CD2   1 
ATOM   4937 C  CE1   . PHE C 3 522 ? 11.429  20.284 15.794  1.00 60.52  ? 522  PHE A CE1   1 
ATOM   4938 C  CE2   . PHE C 3 522 ? 9.206   19.456 15.451  1.00 60.88  ? 522  PHE A CE2   1 
ATOM   4939 C  CZ    . PHE C 3 522 ? 10.241  19.817 16.314  1.00 60.44  ? 522  PHE A CZ    1 
ATOM   4940 N  N     . SER C 3 523 ? 13.523  20.044 9.958   1.00 67.86  ? 523  SER A N     1 
ATOM   4941 C  CA    . SER C 3 523 ? 13.948  19.570 8.636   1.00 69.49  ? 523  SER A CA    1 
ATOM   4942 C  C     . SER C 3 523 ? 13.293  18.227 8.321   1.00 70.38  ? 523  SER A C     1 
ATOM   4943 O  O     . SER C 3 523 ? 12.826  17.534 9.235   1.00 70.45  ? 523  SER A O     1 
ATOM   4944 C  CB    . SER C 3 523 ? 15.470  19.442 8.562   1.00 69.49  ? 523  SER A CB    1 
ATOM   4945 O  OG    . SER C 3 523 ? 15.905  18.207 9.109   1.00 69.86  ? 523  SER A OG    1 
ATOM   4946 N  N     . ASP C 3 524 ? 13.273  17.864 7.036   1.00 71.59  ? 524  ASP A N     1 
ATOM   4947 C  CA    . ASP C 3 524 ? 12.603  16.634 6.562   1.00 72.79  ? 524  ASP A CA    1 
ATOM   4948 C  C     . ASP C 3 524 ? 12.899  15.363 7.370   1.00 73.43  ? 524  ASP A C     1 
ATOM   4949 O  O     . ASP C 3 524 ? 11.971  14.680 7.829   1.00 73.23  ? 524  ASP A O     1 
ATOM   4950 C  CB    . ASP C 3 524 ? 12.879  16.392 5.075   1.00 72.80  ? 524  ASP A CB    1 
ATOM   4951 C  CG    . ASP C 3 524 ? 12.003  17.239 4.175   1.00 73.83  ? 524  ASP A CG    1 
ATOM   4952 O  OD1   . ASP C 3 524 ? 10.759  17.072 4.198   1.00 74.98  ? 524  ASP A OD1   1 
ATOM   4953 O  OD2   . ASP C 3 524 ? 12.563  18.074 3.435   1.00 74.78  ? 524  ASP A OD2   1 
ATOM   4954 N  N     . GLU C 3 525 ? 14.184  15.053 7.540   1.00 74.46  ? 525  GLU A N     1 
ATOM   4955 C  CA    . GLU C 3 525 ? 14.586  13.863 8.285   1.00 75.63  ? 525  GLU A CA    1 
ATOM   4956 C  C     . GLU C 3 525 ? 13.782  13.775 9.574   1.00 75.88  ? 525  GLU A C     1 
ATOM   4957 O  O     . GLU C 3 525 ? 13.090  12.778 9.820   1.00 75.98  ? 525  GLU A O     1 
ATOM   4958 C  CB    . GLU C 3 525 ? 16.093  13.867 8.592   1.00 75.68  ? 525  GLU A CB    1 
ATOM   4959 C  CG    . GLU C 3 525 ? 16.635  12.488 9.044   1.00 76.55  ? 525  GLU A CG    1 
ATOM   4960 C  CD    . GLU C 3 525 ? 18.104  12.508 9.495   1.00 77.11  ? 525  GLU A CD    1 
ATOM   4961 O  OE1   . GLU C 3 525 ? 18.721  13.601 9.586   1.00 78.33  ? 525  GLU A OE1   1 
ATOM   4962 O  OE2   . GLU C 3 525 ? 18.642  11.411 9.768   1.00 77.21  ? 525  GLU A OE2   1 
ATOM   4963 N  N     . ILE C 3 526 ? 13.855  14.851 10.360  1.00 76.36  ? 526  ILE A N     1 
ATOM   4964 C  CA    . ILE C 3 526 ? 13.241  14.926 11.689  1.00 76.44  ? 526  ILE A CA    1 
ATOM   4965 C  C     . ILE C 3 526 ? 11.712  14.910 11.691  1.00 76.50  ? 526  ILE A C     1 
ATOM   4966 O  O     . ILE C 3 526 ? 11.108  14.386 12.624  1.00 76.57  ? 526  ILE A O     1 
ATOM   4967 C  CB    . ILE C 3 526 ? 13.808  16.098 12.538  1.00 76.52  ? 526  ILE A CB    1 
ATOM   4968 C  CG1   . ILE C 3 526 ? 12.700  16.760 13.361  1.00 76.54  ? 526  ILE A CG1   1 
ATOM   4969 C  CG2   . ILE C 3 526 ? 14.530  17.127 11.662  1.00 76.52  ? 526  ILE A CG2   1 
ATOM   4970 C  CD1   . ILE C 3 526 ? 13.162  17.269 14.697  1.00 76.46  ? 526  ILE A CD1   1 
ATOM   4971 N  N     . LYS C 3 527 ? 11.090  15.458 10.650  1.00 76.67  ? 527  LYS A N     1 
ATOM   4972 C  CA    . LYS C 3 527 ? 9.640   15.325 10.483  1.00 76.62  ? 527  LYS A CA    1 
ATOM   4973 C  C     . LYS C 3 527 ? 9.291   13.855 10.307  1.00 76.63  ? 527  LYS A C     1 
ATOM   4974 O  O     . LYS C 3 527 ? 8.296   13.380 10.849  1.00 76.61  ? 527  LYS A O     1 
ATOM   4975 C  CB    . LYS C 3 527 ? 9.146   16.117 9.270   1.00 76.65  ? 527  LYS A CB    1 
ATOM   4976 C  CG    . LYS C 3 527 ? 9.154   17.621 9.440   1.00 76.46  ? 527  LYS A CG    1 
ATOM   4977 C  CD    . LYS C 3 527 ? 9.777   18.298 8.234   1.00 76.96  ? 527  LYS A CD    1 
ATOM   4978 C  CE    . LYS C 3 527 ? 9.039   18.002 6.929   1.00 77.42  ? 527  LYS A CE    1 
ATOM   4979 N  NZ    . LYS C 3 527 ? 8.198   19.148 6.491   1.00 77.41  ? 527  LYS A NZ    1 
ATOM   4980 N  N     . GLU C 3 528 ? 10.120  13.143 9.548   1.00 76.67  ? 528  GLU A N     1 
ATOM   4981 C  CA    . GLU C 3 528 ? 9.892   11.725 9.295   1.00 77.00  ? 528  GLU A CA    1 
ATOM   4982 C  C     . GLU C 3 528 ? 10.296  10.840 10.483  1.00 76.79  ? 528  GLU A C     1 
ATOM   4983 O  O     . GLU C 3 528 ? 9.902   9.675  10.570  1.00 76.65  ? 528  GLU A O     1 
ATOM   4984 C  CB    . GLU C 3 528 ? 10.567  11.275 7.988   1.00 77.22  ? 528  GLU A CB    1 
ATOM   4985 C  CG    . GLU C 3 528 ? 9.917   10.038 7.343   1.00 78.05  ? 528  GLU A CG    1 
ATOM   4986 C  CD    . GLU C 3 528 ? 8.379   10.023 7.469   1.00 79.24  ? 528  GLU A CD    1 
ATOM   4987 O  OE1   . GLU C 3 528 ? 7.719   10.988 6.998   1.00 79.70  ? 528  GLU A OE1   1 
ATOM   4988 O  OE2   . GLU C 3 528 ? 7.841   9.043  8.046   1.00 78.21  ? 528  GLU A OE2   1 
ATOM   4989 N  N     . LYS C 3 529 ? 11.076  11.397 11.398  1.00 76.61  ? 529  LYS A N     1 
ATOM   4990 C  CA    . LYS C 3 529 ? 11.354  10.717 12.645  1.00 76.61  ? 529  LYS A CA    1 
ATOM   4991 C  C     . LYS C 3 529 ? 10.228  10.974 13.633  1.00 76.75  ? 529  LYS A C     1 
ATOM   4992 O  O     . LYS C 3 529 ? 10.018  10.183 14.555  1.00 76.67  ? 529  LYS A O     1 
ATOM   4993 C  CB    . LYS C 3 529 ? 12.688  11.177 13.222  1.00 76.57  ? 529  LYS A CB    1 
ATOM   4994 C  CG    . LYS C 3 529 ? 13.886  10.712 12.419  1.00 77.21  ? 529  LYS A CG    1 
ATOM   4995 C  CD    . LYS C 3 529 ? 15.179  10.997 13.145  1.00 78.39  ? 529  LYS A CD    1 
ATOM   4996 C  CE    . LYS C 3 529 ? 16.358  10.370 12.423  1.00 79.77  ? 529  LYS A CE    1 
ATOM   4997 N  NZ    . LYS C 3 529 ? 17.653  10.737 13.072  1.00 80.65  ? 529  LYS A NZ    1 
ATOM   4998 N  N     . ILE C 3 530 ? 9.502   12.076 13.415  1.00 77.01  ? 530  ILE A N     1 
ATOM   4999 C  CA    . ILE C 3 530 ? 8.464   12.560 14.335  1.00 77.15  ? 530  ILE A CA    1 
ATOM   5000 C  C     . ILE C 3 530 ? 7.321   11.567 14.495  1.00 77.32  ? 530  ILE A C     1 
ATOM   5001 O  O     . ILE C 3 530 ? 6.983   11.197 15.616  1.00 77.23  ? 530  ILE A O     1 
ATOM   5002 C  CB    . ILE C 3 530 ? 7.911   13.980 13.923  1.00 77.27  ? 530  ILE A CB    1 
ATOM   5003 C  CG1   . ILE C 3 530 ? 8.891   15.110 14.291  1.00 77.50  ? 530  ILE A CG1   1 
ATOM   5004 C  CG2   . ILE C 3 530 ? 6.531   14.258 14.518  1.00 76.61  ? 530  ILE A CG2   1 
ATOM   5005 C  CD1   . ILE C 3 530 ? 9.101   15.362 15.790  1.00 77.94  ? 530  ILE A CD1   1 
ATOM   5006 N  N     . LYS C 3 531 ? 6.739   11.128 13.380  1.00 77.79  ? 531  LYS A N     1 
ATOM   5007 C  CA    . LYS C 3 531 ? 5.529   10.288 13.427  1.00 78.35  ? 531  LYS A CA    1 
ATOM   5008 C  C     . LYS C 3 531 ? 5.783   8.855  13.918  1.00 78.30  ? 531  LYS A C     1 
ATOM   5009 O  O     . LYS C 3 531 ? 4.848   8.173  14.363  1.00 78.39  ? 531  LYS A O     1 
ATOM   5010 C  CB    . LYS C 3 531 ? 4.751   10.303 12.096  1.00 78.50  ? 531  LYS A CB    1 
ATOM   5011 C  CG    . LYS C 3 531 ? 5.560   9.940  10.846  1.00 79.19  ? 531  LYS A CG    1 
ATOM   5012 C  CD    . LYS C 3 531 ? 6.283   11.152 10.244  1.00 80.83  ? 531  LYS A CD    1 
ATOM   5013 C  CE    . LYS C 3 531 ? 5.326   12.217 9.687   1.00 81.04  ? 531  LYS A CE    1 
ATOM   5014 N  NZ    . LYS C 3 531 ? 4.768   11.860 8.350   1.00 81.44  ? 531  LYS A NZ    1 
ATOM   5015 N  N     . LYS C 3 532 ? 7.046   8.421  13.855  1.00 78.04  ? 532  LYS A N     1 
ATOM   5016 C  CA    . LYS C 3 532 ? 7.450   7.120  14.393  1.00 77.76  ? 532  LYS A CA    1 
ATOM   5017 C  C     . LYS C 3 532 ? 7.486   7.087  15.937  1.00 77.58  ? 532  LYS A C     1 
ATOM   5018 O  O     . LYS C 3 532 ? 7.770   6.039  16.530  1.00 77.82  ? 532  LYS A O     1 
ATOM   5019 C  CB    . LYS C 3 532 ? 8.796   6.679  13.799  1.00 77.59  ? 532  LYS A CB    1 
ATOM   5020 N  N     . LEU C 3 533 ? 7.177   8.221  16.579  1.00 77.12  ? 533  LEU A N     1 
ATOM   5021 C  CA    . LEU C 3 533 ? 7.273   8.355  18.047  1.00 76.42  ? 533  LEU A CA    1 
ATOM   5022 C  C     . LEU C 3 533 ? 5.980   8.088  18.813  1.00 75.94  ? 533  LEU A C     1 
ATOM   5023 O  O     . LEU C 3 533 ? 4.883   8.054  18.240  1.00 75.81  ? 533  LEU A O     1 
ATOM   5024 C  CB    . LEU C 3 533 ? 7.814   9.733  18.455  1.00 76.33  ? 533  LEU A CB    1 
ATOM   5025 C  CG    . LEU C 3 533 ? 9.287   10.104 18.284  1.00 76.09  ? 533  LEU A CG    1 
ATOM   5026 C  CD1   . LEU C 3 533 ? 9.477   11.546 18.717  1.00 75.53  ? 533  LEU A CD1   1 
ATOM   5027 C  CD2   . LEU C 3 533 ? 10.211  9.189  19.074  1.00 75.57  ? 533  LEU A CD2   1 
ATOM   5028 N  N     . SER C 3 534 ? 6.143   7.915  20.123  1.00 75.44  ? 534  SER A N     1 
ATOM   5029 C  CA    . SER C 3 534 ? 5.049   7.619  21.041  1.00 75.14  ? 534  SER A CA    1 
ATOM   5030 C  C     . SER C 3 534 ? 4.417   8.884  21.614  1.00 75.16  ? 534  SER A C     1 
ATOM   5031 O  O     . SER C 3 534 ? 5.082   9.924  21.722  1.00 75.32  ? 534  SER A O     1 
ATOM   5032 C  CB    . SER C 3 534 ? 5.565   6.762  22.196  1.00 74.95  ? 534  SER A CB    1 
ATOM   5033 O  OG    . SER C 3 534 ? 6.287   7.548  23.126  1.00 74.19  ? 534  SER A OG    1 
ATOM   5034 N  N     . ALA C 3 535 ? 3.147   8.778  22.008  1.00 74.80  ? 535  ALA A N     1 
ATOM   5035 C  CA    . ALA C 3 535 ? 2.449   9.860  22.717  1.00 74.60  ? 535  ALA A CA    1 
ATOM   5036 C  C     . ALA C 3 535 ? 3.273   10.458 23.867  1.00 74.44  ? 535  ALA A C     1 
ATOM   5037 O  O     . ALA C 3 535 ? 3.324   11.678 24.020  1.00 74.20  ? 535  ALA A O     1 
ATOM   5038 C  CB    . ALA C 3 535 ? 1.094   9.383  23.224  1.00 74.50  ? 535  ALA A CB    1 
ATOM   5039 N  N     . LYS C 3 536 ? 3.924   9.595  24.652  1.00 74.33  ? 536  LYS A N     1 
ATOM   5040 C  CA    . LYS C 3 536 ? 4.779   10.030 25.766  1.00 74.19  ? 536  LYS A CA    1 
ATOM   5041 C  C     . LYS C 3 536 ? 5.920   10.890 25.267  1.00 73.50  ? 536  LYS A C     1 
ATOM   5042 O  O     . LYS C 3 536 ? 6.138   11.998 25.757  1.00 73.31  ? 536  LYS A O     1 
ATOM   5043 C  CB    . LYS C 3 536 ? 5.345   8.842  26.560  1.00 74.48  ? 536  LYS A CB    1 
ATOM   5044 C  CG    . LYS C 3 536 ? 4.301   8.050  27.376  1.00 75.65  ? 536  LYS A CG    1 
ATOM   5045 C  CD    . LYS C 3 536 ? 3.777   6.817  26.601  1.00 76.31  ? 536  LYS A CD    1 
ATOM   5046 C  CE    . LYS C 3 536 ? 2.658   6.093  27.356  1.00 76.50  ? 536  LYS A CE    1 
ATOM   5047 N  NZ    . LYS C 3 536 ? 1.409   6.917  27.508  1.00 76.29  ? 536  LYS A NZ    1 
ATOM   5048 N  N     . SER C 3 537 ? 6.637   10.372 24.279  1.00 72.88  ? 537  SER A N     1 
ATOM   5049 C  CA    . SER C 3 537 ? 7.755   11.086 23.685  1.00 72.29  ? 537  SER A CA    1 
ATOM   5050 C  C     . SER C 3 537 ? 7.274   12.383 23.013  1.00 71.61  ? 537  SER A C     1 
ATOM   5051 O  O     . SER C 3 537 ? 7.911   13.436 23.154  1.00 71.26  ? 537  SER A O     1 
ATOM   5052 C  CB    . SER C 3 537 ? 8.474   10.176 22.684  1.00 72.52  ? 537  SER A CB    1 
ATOM   5053 O  OG    . SER C 3 537 ? 9.734   10.693 22.286  1.00 72.95  ? 537  SER A OG    1 
ATOM   5054 N  N     . LEU C 3 538 ? 6.137   12.300 22.314  1.00 70.67  ? 538  LEU A N     1 
ATOM   5055 C  CA    . LEU C 3 538 ? 5.617   13.429 21.545  1.00 69.54  ? 538  LEU A CA    1 
ATOM   5056 C  C     . LEU C 3 538 ? 5.074   14.555 22.417  1.00 68.98  ? 538  LEU A C     1 
ATOM   5057 O  O     . LEU C 3 538 ? 5.249   15.733 22.091  1.00 69.13  ? 538  LEU A O     1 
ATOM   5058 C  CB    . LEU C 3 538 ? 4.573   12.975 20.522  1.00 69.45  ? 538  LEU A CB    1 
ATOM   5059 C  CG    . LEU C 3 538 ? 5.091   12.315 19.236  1.00 68.94  ? 538  LEU A CG    1 
ATOM   5060 C  CD1   . LEU C 3 538 ? 3.948   11.668 18.480  1.00 68.55  ? 538  LEU A CD1   1 
ATOM   5061 C  CD2   . LEU C 3 538 ? 5.801   13.304 18.340  1.00 68.27  ? 538  LEU A CD2   1 
ATOM   5062 N  N     . ASN C 3 539 ? 4.432   14.209 23.525  1.00 68.03  ? 539  ASN A N     1 
ATOM   5063 C  CA    . ASN C 3 539 ? 3.906   15.234 24.421  1.00 67.12  ? 539  ASN A CA    1 
ATOM   5064 C  C     . ASN C 3 539 ? 5.002   16.069 25.041  1.00 66.48  ? 539  ASN A C     1 
ATOM   5065 O  O     . ASN C 3 539 ? 4.897   17.293 25.114  1.00 66.65  ? 539  ASN A O     1 
ATOM   5066 C  CB    . ASN C 3 539 ? 3.013   14.629 25.495  1.00 67.10  ? 539  ASN A CB    1 
ATOM   5067 C  CG    . ASN C 3 539 ? 1.596   14.425 25.010  1.00 67.24  ? 539  ASN A CG    1 
ATOM   5068 O  OD1   . ASN C 3 539 ? 1.041   13.333 25.127  1.00 67.29  ? 539  ASN A OD1   1 
ATOM   5069 N  ND2   . ASN C 3 539 ? 1.007   15.474 24.433  1.00 66.89  ? 539  ASN A ND2   1 
ATOM   5070 N  N     . GLU C 3 540 ? 6.061   15.398 25.469  1.00 65.64  ? 540  GLU A N     1 
ATOM   5071 C  CA    . GLU C 3 540 ? 7.257   16.069 25.950  1.00 64.98  ? 540  GLU A CA    1 
ATOM   5072 C  C     . GLU C 3 540 ? 7.814   17.029 24.880  1.00 64.06  ? 540  GLU A C     1 
ATOM   5073 O  O     . GLU C 3 540 ? 8.213   18.153 25.186  1.00 64.19  ? 540  GLU A O     1 
ATOM   5074 C  CB    . GLU C 3 540 ? 8.298   15.023 26.360  1.00 65.17  ? 540  GLU A CB    1 
ATOM   5075 C  CG    . GLU C 3 540 ? 9.586   15.590 26.955  1.00 67.01  ? 540  GLU A CG    1 
ATOM   5076 C  CD    . GLU C 3 540 ? 9.354   16.403 28.217  1.00 68.80  ? 540  GLU A CD    1 
ATOM   5077 O  OE1   . GLU C 3 540 ? 8.526   15.991 29.067  1.00 69.40  ? 540  GLU A OE1   1 
ATOM   5078 O  OE2   . GLU C 3 540 ? 10.007  17.459 28.351  1.00 69.04  ? 540  GLU A OE2   1 
ATOM   5079 N  N     . MET C 3 541 ? 7.816   16.586 23.628  1.00 62.73  ? 541  MET A N     1 
ATOM   5080 C  CA    . MET C 3 541 ? 8.261   17.422 22.519  1.00 61.47  ? 541  MET A CA    1 
ATOM   5081 C  C     . MET C 3 541 ? 7.361   18.652 22.348  1.00 60.08  ? 541  MET A C     1 
ATOM   5082 O  O     . MET C 3 541 ? 7.837   19.755 22.096  1.00 60.16  ? 541  MET A O     1 
ATOM   5083 C  CB    . MET C 3 541 ? 8.327   16.610 21.213  1.00 61.61  ? 541  MET A CB    1 
ATOM   5084 C  CG    . MET C 3 541 ? 9.441   15.545 21.153  1.00 61.73  ? 541  MET A CG    1 
ATOM   5085 S  SD    . MET C 3 541 ? 9.988   15.133 19.461  1.00 62.66  ? 541  MET A SD    1 
ATOM   5086 C  CE    . MET C 3 541 ? 11.024  16.536 19.031  1.00 61.57  ? 541  MET A CE    1 
ATOM   5087 N  N     . LEU C 3 542 ? 6.059   18.454 22.477  1.00 58.37  ? 542  LEU A N     1 
ATOM   5088 C  CA    . LEU C 3 542 ? 5.112   19.544 22.353  1.00 56.76  ? 542  LEU A CA    1 
ATOM   5089 C  C     . LEU C 3 542 ? 5.412   20.528 23.473  1.00 56.17  ? 542  LEU A C     1 
ATOM   5090 O  O     . LEU C 3 542 ? 5.704   21.702 23.219  1.00 55.76  ? 542  LEU A O     1 
ATOM   5091 C  CB    . LEU C 3 542 ? 3.686   18.996 22.450  1.00 56.78  ? 542  LEU A CB    1 
ATOM   5092 C  CG    . LEU C 3 542 ? 2.436   19.871 22.377  1.00 56.50  ? 542  LEU A CG    1 
ATOM   5093 C  CD1   . LEU C 3 542 ? 2.347   20.581 21.037  1.00 57.44  ? 542  LEU A CD1   1 
ATOM   5094 C  CD2   . LEU C 3 542 ? 1.162   19.046 22.637  1.00 55.35  ? 542  LEU A CD2   1 
ATOM   5095 N  N     . PHE C 3 543 ? 5.392   20.025 24.710  1.00 55.24  ? 543  PHE A N     1 
ATOM   5096 C  CA    . PHE C 3 543 ? 5.679   20.837 25.882  1.00 54.18  ? 543  PHE A CA    1 
ATOM   5097 C  C     . PHE C 3 543 ? 6.878   21.729 25.619  1.00 53.92  ? 543  PHE A C     1 
ATOM   5098 O  O     . PHE C 3 543 ? 6.823   22.927 25.858  1.00 54.09  ? 543  PHE A O     1 
ATOM   5099 C  CB    . PHE C 3 543 ? 5.931   19.973 27.119  1.00 53.79  ? 543  PHE A CB    1 
ATOM   5100 C  CG    . PHE C 3 543 ? 6.454   20.753 28.317  1.00 52.95  ? 543  PHE A CG    1 
ATOM   5101 C  CD1   . PHE C 3 543 ? 5.569   21.350 29.218  1.00 50.68  ? 543  PHE A CD1   1 
ATOM   5102 C  CD2   . PHE C 3 543 ? 7.832   20.892 28.535  1.00 52.73  ? 543  PHE A CD2   1 
ATOM   5103 C  CE1   . PHE C 3 543 ? 6.032   22.069 30.303  1.00 49.88  ? 543  PHE A CE1   1 
ATOM   5104 C  CE2   . PHE C 3 543 ? 8.316   21.613 29.632  1.00 52.34  ? 543  PHE A CE2   1 
ATOM   5105 C  CZ    . PHE C 3 543 ? 7.403   22.203 30.518  1.00 51.84  ? 543  PHE A CZ    1 
ATOM   5106 N  N     . ARG C 3 544 ? 7.952   21.142 25.112  1.00 53.61  ? 544  ARG A N     1 
ATOM   5107 C  CA    . ARG C 3 544 ? 9.178   21.887 24.879  1.00 53.37  ? 544  ARG A CA    1 
ATOM   5108 C  C     . ARG C 3 544 ? 9.042   22.910 23.754  1.00 52.93  ? 544  ARG A C     1 
ATOM   5109 O  O     . ARG C 3 544 ? 9.480   24.052 23.895  1.00 53.19  ? 544  ARG A O     1 
ATOM   5110 C  CB    . ARG C 3 544 ? 10.333  20.938 24.626  1.00 53.48  ? 544  ARG A CB    1 
ATOM   5111 C  CG    . ARG C 3 544 ? 10.756  20.158 25.852  1.00 54.84  ? 544  ARG A CG    1 
ATOM   5112 C  CD    . ARG C 3 544 ? 12.056  19.418 25.576  1.00 58.52  ? 544  ARG A CD    1 
ATOM   5113 N  NE    . ARG C 3 544 ? 12.123  18.136 26.280  1.00 60.42  ? 544  ARG A NE    1 
ATOM   5114 C  CZ    . ARG C 3 544 ? 12.953  17.146 25.964  1.00 61.31  ? 544  ARG A CZ    1 
ATOM   5115 N  NH1   . ARG C 3 544 ? 13.797  17.263 24.949  1.00 61.95  ? 544  ARG A NH1   1 
ATOM   5116 N  NH2   . ARG C 3 544 ? 12.933  16.025 26.663  1.00 62.49  ? 544  ARG A NH2   1 
ATOM   5117 N  N     . ALA C 3 545 ? 8.412   22.510 22.653  1.00 52.26  ? 545  ALA A N     1 
ATOM   5118 C  CA    . ALA C 3 545 ? 8.115   23.436 21.567  1.00 51.42  ? 545  ALA A CA    1 
ATOM   5119 C  C     . ALA C 3 545 ? 7.419   24.652 22.133  1.00 50.95  ? 545  ALA A C     1 
ATOM   5120 O  O     . ALA C 3 545 ? 7.740   25.794 21.769  1.00 51.18  ? 545  ALA A O     1 
ATOM   5121 C  CB    . ALA C 3 545 ? 7.232   22.776 20.533  1.00 51.27  ? 545  ALA A CB    1 
ATOM   5122 N  N     . GLN C 3 546 ? 6.475   24.392 23.037  1.00 49.77  ? 546  GLN A N     1 
ATOM   5123 C  CA    . GLN C 3 546 ? 5.662   25.440 23.631  1.00 48.86  ? 546  GLN A CA    1 
ATOM   5124 C  C     . GLN C 3 546 ? 6.452   26.372 24.509  1.00 48.31  ? 546  GLN A C     1 
ATOM   5125 O  O     . GLN C 3 546 ? 6.163   27.565 24.577  1.00 48.60  ? 546  GLN A O     1 
ATOM   5126 C  CB    . GLN C 3 546 ? 4.530   24.837 24.439  1.00 48.81  ? 546  GLN A CB    1 
ATOM   5127 C  CG    . GLN C 3 546 ? 3.178   25.073 23.820  1.00 48.52  ? 546  GLN A CG    1 
ATOM   5128 C  CD    . GLN C 3 546 ? 2.225   23.914 24.006  1.00 48.25  ? 546  GLN A CD    1 
ATOM   5129 O  OE1   . GLN C 3 546 ? 1.394   23.656 23.141  1.00 49.14  ? 546  GLN A OE1   1 
ATOM   5130 N  NE2   . GLN C 3 546 ? 2.343   23.202 25.124  1.00 47.98  ? 546  GLN A NE2   1 
ATOM   5131 N  N     . ARG C 3 547 ? 7.448   25.824 25.185  1.00 47.56  ? 547  ARG A N     1 
ATOM   5132 C  CA    . ARG C 3 547 ? 8.248   26.604 26.106  1.00 46.71  ? 547  ARG A CA    1 
ATOM   5133 C  C     . ARG C 3 547 ? 9.153   27.525 25.313  1.00 46.30  ? 547  ARG A C     1 
ATOM   5134 O  O     . ARG C 3 547 ? 9.407   28.669 25.707  1.00 45.51  ? 547  ARG A O     1 
ATOM   5135 C  CB    . ARG C 3 547 ? 9.027   25.680 27.047  1.00 46.70  ? 547  ARG A CB    1 
ATOM   5136 C  CG    . ARG C 3 547 ? 8.177   25.137 28.197  1.00 45.72  ? 547  ARG A CG    1 
ATOM   5137 C  CD    . ARG C 3 547 ? 7.642   26.279 29.060  1.00 45.07  ? 547  ARG A CD    1 
ATOM   5138 N  NE    . ARG C 3 547 ? 6.823   25.823 30.186  1.00 44.77  ? 547  ARG A NE    1 
ATOM   5139 C  CZ    . ARG C 3 547 ? 7.251   25.742 31.448  1.00 45.64  ? 547  ARG A CZ    1 
ATOM   5140 N  NH1   . ARG C 3 547 ? 8.506   26.084 31.773  1.00 43.69  ? 547  ARG A NH1   1 
ATOM   5141 N  NH2   . ARG C 3 547 ? 6.421   25.315 32.396  1.00 45.81  ? 547  ARG A NH2   1 
ATOM   5142 N  N     . THR C 3 548 ? 9.598   27.019 24.168  1.00 46.21  ? 548  THR A N     1 
ATOM   5143 C  CA    . THR C 3 548 ? 10.381  27.793 23.223  1.00 46.35  ? 548  THR A CA    1 
ATOM   5144 C  C     . THR C 3 548 ? 9.528   28.917 22.666  1.00 46.38  ? 548  THR A C     1 
ATOM   5145 O  O     . THR C 3 548 ? 9.934   30.086 22.683  1.00 46.27  ? 548  THR A O     1 
ATOM   5146 C  CB    . THR C 3 548 ? 10.823  26.932 22.058  1.00 46.21  ? 548  THR A CB    1 
ATOM   5147 O  OG1   . THR C 3 548 ? 11.370  25.713 22.558  1.00 47.31  ? 548  THR A OG1   1 
ATOM   5148 C  CG2   . THR C 3 548 ? 11.867  27.642 21.243  1.00 46.38  ? 548  THR A CG2   1 
ATOM   5149 N  N     . GLU C 3 549 ? 8.340   28.560 22.182  1.00 46.12  ? 549  GLU A N     1 
ATOM   5150 C  CA    . GLU C 3 549 ? 7.445   29.549 21.606  1.00 46.01  ? 549  GLU A CA    1 
ATOM   5151 C  C     . GLU C 3 549 ? 7.180   30.697 22.573  1.00 45.07  ? 549  GLU A C     1 
ATOM   5152 O  O     . GLU C 3 549 ? 7.292   31.863 22.204  1.00 44.83  ? 549  GLU A O     1 
ATOM   5153 C  CB    . GLU C 3 549 ? 6.138   28.911 21.187  1.00 46.23  ? 549  GLU A CB    1 
ATOM   5154 C  CG    . GLU C 3 549 ? 5.382   29.796 20.250  1.00 48.53  ? 549  GLU A CG    1 
ATOM   5155 C  CD    . GLU C 3 549 ? 3.896   29.769 20.501  1.00 52.97  ? 549  GLU A CD    1 
ATOM   5156 O  OE1   . GLU C 3 549 ? 3.375   28.673 20.851  1.00 54.32  ? 549  GLU A OE1   1 
ATOM   5157 O  OE2   . GLU C 3 549 ? 3.257   30.849 20.352  1.00 53.89  ? 549  GLU A OE2   1 
ATOM   5158 N  N     . VAL C 3 550 ? 6.841   30.345 23.809  1.00 44.28  ? 550  VAL A N     1 
ATOM   5159 C  CA    . VAL C 3 550 ? 6.589   31.322 24.856  1.00 43.84  ? 550  VAL A CA    1 
ATOM   5160 C  C     . VAL C 3 550 ? 7.800   32.200 25.111  1.00 43.93  ? 550  VAL A C     1 
ATOM   5161 O  O     . VAL C 3 550 ? 7.659   33.418 25.268  1.00 44.14  ? 550  VAL A O     1 
ATOM   5162 C  CB    . VAL C 3 550 ? 6.184   30.633 26.158  1.00 43.60  ? 550  VAL A CB    1 
ATOM   5163 C  CG1   . VAL C 3 550 ? 6.357   31.572 27.352  1.00 42.90  ? 550  VAL A CG1   1 
ATOM   5164 C  CG2   . VAL C 3 550 ? 4.751   30.142 26.049  1.00 44.42  ? 550  VAL A CG2   1 
ATOM   5165 N  N     . ALA C 3 551 ? 8.984   31.586 25.160  1.00 43.56  ? 551  ALA A N     1 
ATOM   5166 C  CA    . ALA C 3 551 ? 10.211  32.329 25.391  1.00 43.34  ? 551  ALA A CA    1 
ATOM   5167 C  C     . ALA C 3 551 ? 10.464  33.289 24.239  1.00 43.18  ? 551  ALA A C     1 
ATOM   5168 O  O     . ALA C 3 551 ? 10.846  34.433 24.462  1.00 43.39  ? 551  ALA A O     1 
ATOM   5169 C  CB    . ALA C 3 551 ? 11.397  31.386 25.578  1.00 43.56  ? 551  ALA A CB    1 
ATOM   5170 N  N     . GLY C 3 552 ? 10.240  32.817 23.012  1.00 43.02  ? 552  GLY A N     1 
ATOM   5171 C  CA    . GLY C 3 552 ? 10.329  33.658 21.813  1.00 42.95  ? 552  GLY A CA    1 
ATOM   5172 C  C     . GLY C 3 552 ? 9.299   34.771 21.870  1.00 43.08  ? 552  GLY A C     1 
ATOM   5173 O  O     . GLY C 3 552 ? 9.601   35.923 21.546  1.00 43.06  ? 552  GLY A O     1 
ATOM   5174 N  N     . MET C 3 553 ? 8.089   34.418 22.305  1.00 43.04  ? 553  MET A N     1 
ATOM   5175 C  CA    . MET C 3 553 ? 7.013   35.373 22.543  1.00 43.24  ? 553  MET A CA    1 
ATOM   5176 C  C     . MET C 3 553 ? 7.480   36.581 23.365  1.00 42.86  ? 553  MET A C     1 
ATOM   5177 O  O     . MET C 3 553 ? 7.402   37.723 22.894  1.00 42.01  ? 553  MET A O     1 
ATOM   5178 C  CB    . MET C 3 553 ? 5.878   34.671 23.283  1.00 43.95  ? 553  MET A CB    1 
ATOM   5179 C  CG    . MET C 3 553 ? 4.497   34.906 22.725  1.00 45.25  ? 553  MET A CG    1 
ATOM   5180 S  SD    . MET C 3 553 ? 4.155   36.641 22.484  1.00 48.20  ? 553  MET A SD    1 
ATOM   5181 C  CE    . MET C 3 553 ? 2.820   36.530 21.283  1.00 46.64  ? 553  MET A CE    1 
ATOM   5182 N  N     . THR C 3 554 ? 7.964   36.303 24.583  1.00 42.63  ? 554  THR A N     1 
ATOM   5183 C  CA    . THR C 3 554 ? 8.440   37.321 25.531  1.00 42.47  ? 554  THR A CA    1 
ATOM   5184 C  C     . THR C 3 554 ? 9.421   38.262 24.869  1.00 42.60  ? 554  THR A C     1 
ATOM   5185 O  O     . THR C 3 554 ? 9.197   39.474 24.821  1.00 42.94  ? 554  THR A O     1 
ATOM   5186 C  CB    . THR C 3 554 ? 9.188   36.682 26.709  1.00 42.38  ? 554  THR A CB    1 
ATOM   5187 O  OG1   . THR C 3 554 ? 8.292   35.853 27.435  1.00 43.17  ? 554  THR A OG1   1 
ATOM   5188 C  CG2   . THR C 3 554 ? 9.754   37.735 27.651  1.00 41.58  ? 554  THR A CG2   1 
ATOM   5189 N  N     . ALA C 3 555 ? 10.505  37.679 24.368  1.00 41.97  ? 555  ALA A N     1 
ATOM   5190 C  CA    . ALA C 3 555 ? 11.561  38.399 23.692  1.00 41.97  ? 555  ALA A CA    1 
ATOM   5191 C  C     . ALA C 3 555 ? 11.050  39.329 22.570  1.00 41.88  ? 555  ALA A C     1 
ATOM   5192 O  O     . ALA C 3 555 ? 11.497  40.484 22.419  1.00 41.50  ? 555  ALA A O     1 
ATOM   5193 C  CB    . ALA C 3 555 ? 12.561  37.385 23.131  1.00 42.13  ? 555  ALA A CB    1 
ATOM   5194 N  N     . GLN C 3 556 ? 10.123  38.791 21.789  1.00 41.71  ? 556  GLN A N     1 
ATOM   5195 C  CA    . GLN C 3 556 ? 9.542   39.454 20.644  1.00 41.89  ? 556  GLN A CA    1 
ATOM   5196 C  C     . GLN C 3 556 ? 8.620   40.602 21.082  1.00 41.74  ? 556  GLN A C     1 
ATOM   5197 O  O     . GLN C 3 556 ? 8.867   41.770 20.773  1.00 42.07  ? 556  GLN A O     1 
ATOM   5198 C  CB    . GLN C 3 556 ? 8.787   38.384 19.836  1.00 42.11  ? 556  GLN A CB    1 
ATOM   5199 C  CG    . GLN C 3 556 ? 8.006   38.851 18.646  1.00 42.63  ? 556  GLN A CG    1 
ATOM   5200 C  CD    . GLN C 3 556 ? 6.632   39.354 19.004  1.00 44.75  ? 556  GLN A CD    1 
ATOM   5201 O  OE1   . GLN C 3 556 ? 6.318   40.497 18.727  1.00 48.61  ? 556  GLN A OE1   1 
ATOM   5202 N  NE2   . GLN C 3 556 ? 5.817   38.524 19.645  1.00 45.05  ? 556  GLN A NE2   1 
ATOM   5203 N  N     . ILE C 3 557 ? 7.566   40.267 21.818  1.00 41.50  ? 557  ILE A N     1 
ATOM   5204 C  CA    . ILE C 3 557 ? 6.513   41.228 22.112  1.00 41.05  ? 557  ILE A CA    1 
ATOM   5205 C  C     . ILE C 3 557 ? 7.011   42.398 22.973  1.00 41.64  ? 557  ILE A C     1 
ATOM   5206 O  O     . ILE C 3 557 ? 6.593   43.540 22.759  1.00 41.84  ? 557  ILE A O     1 
ATOM   5207 C  CB    . ILE C 3 557 ? 5.258   40.536 22.713  1.00 40.92  ? 557  ILE A CB    1 
ATOM   5208 C  CG1   . ILE C 3 557 ? 4.019   41.431 22.557  1.00 40.51  ? 557  ILE A CG1   1 
ATOM   5209 C  CG2   . ILE C 3 557 ? 5.514   40.061 24.159  1.00 40.74  ? 557  ILE A CG2   1 
ATOM   5210 C  CD1   . ILE C 3 557 ? 2.679   40.768 22.825  1.00 39.53  ? 557  ILE A CD1   1 
ATOM   5211 N  N     . ASN C 3 558 ? 7.924   42.125 23.912  1.00 41.71  ? 558  ASN A N     1 
ATOM   5212 C  CA    . ASN C 3 558 ? 8.492   43.175 24.757  1.00 41.53  ? 558  ASN A CA    1 
ATOM   5213 C  C     . ASN C 3 558 ? 9.454   44.096 24.052  1.00 41.76  ? 558  ASN A C     1 
ATOM   5214 O  O     . ASN C 3 558 ? 9.523   45.287 24.374  1.00 41.95  ? 558  ASN A O     1 
ATOM   5215 C  CB    . ASN C 3 558 ? 9.157   42.586 25.966  1.00 41.49  ? 558  ASN A CB    1 
ATOM   5216 C  CG    . ASN C 3 558 ? 8.155   42.001 26.939  1.00 42.04  ? 558  ASN A CG    1 
ATOM   5217 O  OD1   . ASN C 3 558 ? 7.363   42.717 27.553  1.00 41.96  ? 558  ASN A OD1   1 
ATOM   5218 N  ND2   . ASN C 3 558 ? 8.200   40.693 27.101  1.00 41.53  ? 558  ASN A ND2   1 
ATOM   5219 N  N     . ARG C 3 559 ? 10.191  43.575 23.081  1.00 41.79  ? 559  ARG A N     1 
ATOM   5220 C  CA    . ARG C 3 559 ? 11.013  44.455 22.263  1.00 42.34  ? 559  ARG A CA    1 
ATOM   5221 C  C     . ARG C 3 559 ? 10.116  45.284 21.340  1.00 41.80  ? 559  ARG A C     1 
ATOM   5222 O  O     . ARG C 3 559 ? 10.393  46.463 21.071  1.00 41.65  ? 559  ARG A O     1 
ATOM   5223 C  CB    . ARG C 3 559 ? 12.067  43.669 21.486  1.00 42.59  ? 559  ARG A CB    1 
ATOM   5224 C  CG    . ARG C 3 559 ? 13.306  43.352 22.326  1.00 44.04  ? 559  ARG A CG    1 
ATOM   5225 C  CD    . ARG C 3 559 ? 14.283  42.427 21.588  1.00 45.46  ? 559  ARG A CD    1 
ATOM   5226 N  NE    . ARG C 3 559 ? 15.418  42.050 22.434  1.00 48.63  ? 559  ARG A NE    1 
ATOM   5227 C  CZ    . ARG C 3 559 ? 15.338  41.208 23.469  1.00 49.30  ? 559  ARG A CZ    1 
ATOM   5228 N  NH1   . ARG C 3 559 ? 14.170  40.657 23.798  1.00 48.41  ? 559  ARG A NH1   1 
ATOM   5229 N  NH2   . ARG C 3 559 ? 16.426  40.930 24.186  1.00 49.10  ? 559  ARG A NH2   1 
ATOM   5230 N  N     . LYS C 3 560 ? 9.028   44.669 20.881  1.00 41.18  ? 560  LYS A N     1 
ATOM   5231 C  CA    . LYS C 3 560 ? 7.996   45.399 20.162  1.00 40.60  ? 560  LYS A CA    1 
ATOM   5232 C  C     . LYS C 3 560 ? 7.475   46.545 21.012  1.00 40.46  ? 560  LYS A C     1 
ATOM   5233 O  O     . LYS C 3 560 ? 7.257   47.647 20.514  1.00 40.53  ? 560  LYS A O     1 
ATOM   5234 C  CB    . LYS C 3 560 ? 6.846   44.470 19.778  1.00 40.65  ? 560  LYS A CB    1 
ATOM   5235 C  CG    . LYS C 3 560 ? 5.524   45.178 19.553  1.00 39.19  ? 560  LYS A CG    1 
ATOM   5236 C  CD    . LYS C 3 560 ? 4.514   44.264 18.905  1.00 37.85  ? 560  LYS A CD    1 
ATOM   5237 C  CE    . LYS C 3 560 ? 3.185   44.957 18.772  1.00 37.18  ? 560  LYS A CE    1 
ATOM   5238 N  NZ    . LYS C 3 560 ? 2.204   44.059 18.150  1.00 34.46  ? 560  LYS A NZ    1 
ATOM   5239 N  N     . LEU C 3 561 ? 7.283   46.290 22.297  1.00 40.29  ? 561  LEU A N     1 
ATOM   5240 C  CA    . LEU C 3 561 ? 6.706   47.302 23.154  1.00 40.58  ? 561  LEU A CA    1 
ATOM   5241 C  C     . LEU C 3 561 ? 7.671   48.462 23.247  1.00 41.17  ? 561  LEU A C     1 
ATOM   5242 O  O     . LEU C 3 561 ? 7.287   49.627 23.078  1.00 41.88  ? 561  LEU A O     1 
ATOM   5243 C  CB    . LEU C 3 561 ? 6.418   46.739 24.541  1.00 40.45  ? 561  LEU A CB    1 
ATOM   5244 C  CG    . LEU C 3 561 ? 5.832   47.662 25.618  1.00 39.59  ? 561  LEU A CG    1 
ATOM   5245 C  CD1   . LEU C 3 561 ? 4.347   47.850 25.411  1.00 38.36  ? 561  LEU A CD1   1 
ATOM   5246 C  CD2   . LEU C 3 561 ? 6.096   47.044 26.995  1.00 39.45  ? 561  LEU A CD2   1 
ATOM   5247 N  N     . LEU C 3 562 ? 8.935   48.137 23.488  1.00 41.37  ? 562  LEU A N     1 
ATOM   5248 C  CA    . LEU C 3 562 ? 9.938   49.156 23.735  1.00 41.26  ? 562  LEU A CA    1 
ATOM   5249 C  C     . LEU C 3 562 ? 10.001  50.175 22.605  1.00 41.36  ? 562  LEU A C     1 
ATOM   5250 O  O     . LEU C 3 562 ? 10.106  51.379 22.864  1.00 41.27  ? 562  LEU A O     1 
ATOM   5251 C  CB    . LEU C 3 562 ? 11.299  48.512 23.970  1.00 41.22  ? 562  LEU A CB    1 
ATOM   5252 C  CG    . LEU C 3 562 ? 12.466  49.421 24.321  1.00 40.42  ? 562  LEU A CG    1 
ATOM   5253 C  CD1   . LEU C 3 562 ? 12.287  50.071 25.668  1.00 39.02  ? 562  LEU A CD1   1 
ATOM   5254 C  CD2   . LEU C 3 562 ? 13.737  48.609 24.294  1.00 40.35  ? 562  LEU A CD2   1 
ATOM   5255 N  N     . ILE C 3 563 ? 9.912   49.710 21.361  1.00 41.33  ? 563  ILE A N     1 
ATOM   5256 C  CA    . ILE C 3 563 ? 10.048  50.633 20.233  1.00 41.49  ? 563  ILE A CA    1 
ATOM   5257 C  C     . ILE C 3 563 ? 8.760   51.395 20.033  1.00 41.73  ? 563  ILE A C     1 
ATOM   5258 O  O     . ILE C 3 563 ? 8.769   52.594 19.703  1.00 41.69  ? 563  ILE A O     1 
ATOM   5259 C  CB    . ILE C 3 563 ? 10.480  49.950 18.927  1.00 41.50  ? 563  ILE A CB    1 
ATOM   5260 C  CG1   . ILE C 3 563 ? 9.492   48.863 18.515  1.00 41.51  ? 563  ILE A CG1   1 
ATOM   5261 C  CG2   . ILE C 3 563 ? 11.868  49.377 19.086  1.00 41.66  ? 563  ILE A CG2   1 
ATOM   5262 C  CD1   . ILE C 3 563 ? 10.083  47.821 17.598  1.00 41.82  ? 563  ILE A CD1   1 
ATOM   5263 N  N     . ASN C 3 564 ? 7.642   50.717 20.262  1.00 41.59  ? 564  ASN A N     1 
ATOM   5264 C  CA    . ASN C 3 564 ? 6.382   51.411 20.125  1.00 41.50  ? 564  ASN A CA    1 
ATOM   5265 C  C     . ASN C 3 564 ? 6.328   52.471 21.185  1.00 41.25  ? 564  ASN A C     1 
ATOM   5266 O  O     . ASN C 3 564 ? 5.764   53.541 20.968  1.00 40.94  ? 564  ASN A O     1 
ATOM   5267 C  CB    . ASN C 3 564 ? 5.206   50.448 20.162  1.00 41.35  ? 564  ASN A CB    1 
ATOM   5268 C  CG    . ASN C 3 564 ? 4.950   49.805 18.801  1.00 42.87  ? 564  ASN A CG    1 
ATOM   5269 O  OD1   . ASN C 3 564 ? 3.992   49.058 18.627  1.00 46.02  ? 564  ASN A OD1   1 
ATOM   5270 N  ND2   . ASN C 3 564 ? 5.810   50.100 17.825  1.00 43.56  ? 564  ASN A ND2   1 
ATOM   5271 N  N     . SER C 3 565 ? 6.997   52.178 22.299  1.00 41.36  ? 565  SER A N     1 
ATOM   5272 C  CA    . SER C 3 565 ? 7.140   53.113 23.409  1.00 41.99  ? 565  SER A CA    1 
ATOM   5273 C  C     . SER C 3 565 ? 8.059   54.307 23.131  1.00 42.11  ? 565  SER A C     1 
ATOM   5274 O  O     . SER C 3 565 ? 7.937   55.353 23.788  1.00 41.88  ? 565  SER A O     1 
ATOM   5275 C  CB    . SER C 3 565 ? 7.631   52.375 24.637  1.00 41.81  ? 565  SER A CB    1 
ATOM   5276 O  OG    . SER C 3 565 ? 6.573   51.626 25.189  1.00 43.39  ? 565  SER A OG    1 
ATOM   5277 N  N     . LEU C 3 566 ? 8.979   54.152 22.178  1.00 41.78  ? 566  LEU A N     1 
ATOM   5278 C  CA    . LEU C 3 566 ? 9.739   55.295 21.706  1.00 41.87  ? 566  LEU A CA    1 
ATOM   5279 C  C     . LEU C 3 566 ? 8.800   56.266 21.003  1.00 41.91  ? 566  LEU A C     1 
ATOM   5280 O  O     . LEU C 3 566 ? 8.862   57.474 21.222  1.00 42.28  ? 566  LEU A O     1 
ATOM   5281 C  CB    . LEU C 3 566 ? 10.860  54.862 20.771  1.00 42.27  ? 566  LEU A CB    1 
ATOM   5282 C  CG    . LEU C 3 566 ? 11.853  55.903 20.259  1.00 41.97  ? 566  LEU A CG    1 
ATOM   5283 C  CD1   . LEU C 3 566 ? 12.262  56.856 21.367  1.00 42.07  ? 566  LEU A CD1   1 
ATOM   5284 C  CD2   . LEU C 3 566 ? 13.061  55.177 19.708  1.00 42.56  ? 566  LEU A CD2   1 
ATOM   5285 N  N     . TYR C 3 567 ? 7.922   55.742 20.159  1.00 41.78  ? 567  TYR A N     1 
ATOM   5286 C  CA    . TYR C 3 567 ? 6.926   56.592 19.556  1.00 41.43  ? 567  TYR A CA    1 
ATOM   5287 C  C     . TYR C 3 567 ? 6.159   57.306 20.666  1.00 41.31  ? 567  TYR A C     1 
ATOM   5288 O  O     . TYR C 3 567 ? 6.019   58.527 20.639  1.00 41.43  ? 567  TYR A O     1 
ATOM   5289 C  CB    . TYR C 3 567 ? 5.959   55.814 18.661  1.00 41.32  ? 567  TYR A CB    1 
ATOM   5290 C  CG    . TYR C 3 567 ? 4.573   56.415 18.687  1.00 41.70  ? 567  TYR A CG    1 
ATOM   5291 C  CD1   . TYR C 3 567 ? 4.298   57.595 18.009  1.00 41.29  ? 567  TYR A CD1   1 
ATOM   5292 C  CD2   . TYR C 3 567 ? 3.547   55.832 19.452  1.00 41.64  ? 567  TYR A CD2   1 
ATOM   5293 C  CE1   . TYR C 3 567 ? 3.038   58.165 18.070  1.00 42.49  ? 567  TYR A CE1   1 
ATOM   5294 C  CE2   . TYR C 3 567 ? 2.283   56.385 19.501  1.00 40.63  ? 567  TYR A CE2   1 
ATOM   5295 C  CZ    . TYR C 3 567 ? 2.034   57.549 18.810  1.00 41.53  ? 567  TYR A CZ    1 
ATOM   5296 O  OH    . TYR C 3 567 ? 0.785   58.122 18.858  1.00 42.49  ? 567  TYR A OH    1 
ATOM   5297 N  N     . GLY C 3 568 ? 5.661   56.544 21.631  1.00 40.93  ? 568  GLY A N     1 
ATOM   5298 C  CA    . GLY C 3 568 ? 4.768   57.098 22.643  1.00 40.85  ? 568  GLY A CA    1 
ATOM   5299 C  C     . GLY C 3 568 ? 5.504   58.107 23.489  1.00 41.22  ? 568  GLY A C     1 
ATOM   5300 O  O     . GLY C 3 568 ? 4.886   59.010 24.060  1.00 40.76  ? 568  GLY A O     1 
ATOM   5301 N  N     . ALA C 3 569 ? 6.836   57.945 23.545  1.00 41.32  ? 569  ALA A N     1 
ATOM   5302 C  CA    . ALA C 3 569 ? 7.728   58.858 24.259  1.00 41.28  ? 569  ALA A CA    1 
ATOM   5303 C  C     . ALA C 3 569 ? 7.772   60.232 23.593  1.00 41.52  ? 569  ALA A C     1 
ATOM   5304 O  O     . ALA C 3 569 ? 7.934   61.261 24.275  1.00 41.85  ? 569  ALA A O     1 
ATOM   5305 C  CB    . ALA C 3 569 ? 9.114   58.283 24.344  1.00 41.02  ? 569  ALA A CB    1 
ATOM   5306 N  N     . LEU C 3 570 ? 7.635   60.242 22.265  1.00 41.12  ? 570  LEU A N     1 
ATOM   5307 C  CA    . LEU C 3 570 ? 7.590   61.485 21.504  1.00 40.97  ? 570  LEU A CA    1 
ATOM   5308 C  C     . LEU C 3 570 ? 6.414   62.360 21.908  1.00 40.74  ? 570  LEU A C     1 
ATOM   5309 O  O     . LEU C 3 570 ? 6.482   63.581 21.786  1.00 40.25  ? 570  LEU A O     1 
ATOM   5310 C  CB    . LEU C 3 570 ? 7.561   61.205 19.991  1.00 41.21  ? 570  LEU A CB    1 
ATOM   5311 C  CG    . LEU C 3 570 ? 8.838   60.567 19.413  1.00 41.58  ? 570  LEU A CG    1 
ATOM   5312 C  CD1   . LEU C 3 570 ? 8.699   60.374 17.932  1.00 40.60  ? 570  LEU A CD1   1 
ATOM   5313 C  CD2   . LEU C 3 570 ? 10.092  61.403 19.715  1.00 42.37  ? 570  LEU A CD2   1 
ATOM   5314 N  N     . GLY C 3 571 ? 5.347   61.729 22.400  1.00 40.82  ? 571  GLY A N     1 
ATOM   5315 C  CA    . GLY C 3 571 ? 4.140   62.449 22.776  1.00 41.05  ? 571  GLY A CA    1 
ATOM   5316 C  C     . GLY C 3 571 ? 4.019   62.643 24.273  1.00 41.12  ? 571  GLY A C     1 
ATOM   5317 O  O     . GLY C 3 571 ? 2.927   62.916 24.772  1.00 40.50  ? 571  GLY A O     1 
ATOM   5318 N  N     . ASN C 3 572 ? 5.143   62.485 24.978  1.00 41.63  ? 572  ASN A N     1 
ATOM   5319 C  CA    . ASN C 3 572 ? 5.188   62.539 26.445  1.00 42.31  ? 572  ASN A CA    1 
ATOM   5320 C  C     . ASN C 3 572 ? 6.059   63.678 26.972  1.00 43.02  ? 572  ASN A C     1 
ATOM   5321 O  O     . ASN C 3 572 ? 7.283   63.677 26.791  1.00 43.37  ? 572  ASN A O     1 
ATOM   5322 C  CB    . ASN C 3 572 ? 5.699   61.217 27.006  1.00 42.18  ? 572  ASN A CB    1 
ATOM   5323 C  CG    . ASN C 3 572 ? 5.634   61.163 28.505  1.00 41.69  ? 572  ASN A CG    1 
ATOM   5324 O  OD1   . ASN C 3 572 ? 6.305   61.914 29.207  1.00 42.50  ? 572  ASN A OD1   1 
ATOM   5325 N  ND2   . ASN C 3 572 ? 4.833   60.258 29.010  1.00 42.74  ? 572  ASN A ND2   1 
ATOM   5326 N  N     . VAL C 3 573 ? 5.425   64.628 27.652  1.00 43.57  ? 573  VAL A N     1 
ATOM   5327 C  CA    . VAL C 3 573 ? 6.082   65.870 28.078  1.00 44.26  ? 573  VAL A CA    1 
ATOM   5328 C  C     . VAL C 3 573 ? 7.389   65.667 28.865  1.00 44.98  ? 573  VAL A C     1 
ATOM   5329 O  O     . VAL C 3 573 ? 8.233   66.564 28.901  1.00 45.49  ? 573  VAL A O     1 
ATOM   5330 C  CB    . VAL C 3 573 ? 5.099   66.800 28.853  1.00 43.88  ? 573  VAL A CB    1 
ATOM   5331 C  CG1   . VAL C 3 573 ? 3.899   67.129 27.982  1.00 43.75  ? 573  VAL A CG1   1 
ATOM   5332 C  CG2   . VAL C 3 573 ? 4.639   66.152 30.157  1.00 43.25  ? 573  VAL A CG2   1 
ATOM   5333 N  N     . TRP C 3 574 ? 7.552   64.497 29.481  1.00 45.37  ? 574  TRP A N     1 
ATOM   5334 C  CA    . TRP C 3 574 ? 8.723   64.228 30.329  1.00 45.99  ? 574  TRP A CA    1 
ATOM   5335 C  C     . TRP C 3 574 ? 9.943   63.725 29.567  1.00 45.92  ? 574  TRP A C     1 
ATOM   5336 O  O     . TRP C 3 574 ? 11.009  63.511 30.151  1.00 45.92  ? 574  TRP A O     1 
ATOM   5337 C  CB    . TRP C 3 574 ? 8.373   63.250 31.450  1.00 46.16  ? 574  TRP A CB    1 
ATOM   5338 C  CG    . TRP C 3 574 ? 7.429   63.837 32.404  1.00 47.31  ? 574  TRP A CG    1 
ATOM   5339 C  CD1   . TRP C 3 574 ? 6.153   63.435 32.639  1.00 48.22  ? 574  TRP A CD1   1 
ATOM   5340 C  CD2   . TRP C 3 574 ? 7.652   64.979 33.236  1.00 48.19  ? 574  TRP A CD2   1 
ATOM   5341 N  NE1   . TRP C 3 574 ? 5.567   64.244 33.585  1.00 47.67  ? 574  TRP A NE1   1 
ATOM   5342 C  CE2   . TRP C 3 574 ? 6.465   65.201 33.967  1.00 47.67  ? 574  TRP A CE2   1 
ATOM   5343 C  CE3   . TRP C 3 574 ? 8.743   65.833 33.444  1.00 48.91  ? 574  TRP A CE3   1 
ATOM   5344 C  CZ2   . TRP C 3 574 ? 6.336   66.238 34.893  1.00 47.55  ? 574  TRP A CZ2   1 
ATOM   5345 C  CZ3   . TRP C 3 574 ? 8.610   66.875 34.368  1.00 47.94  ? 574  TRP A CZ3   1 
ATOM   5346 C  CH2   . TRP C 3 574 ? 7.418   67.061 35.077  1.00 47.57  ? 574  TRP A CH2   1 
ATOM   5347 N  N     . PHE C 3 575 ? 9.779   63.549 28.264  1.00 45.78  ? 575  PHE A N     1 
ATOM   5348 C  CA    . PHE C 3 575 ? 10.815  62.966 27.435  1.00 45.47  ? 575  PHE A CA    1 
ATOM   5349 C  C     . PHE C 3 575 ? 11.681  64.074 26.878  1.00 45.50  ? 575  PHE A C     1 
ATOM   5350 O  O     . PHE C 3 575 ? 11.178  65.019 26.269  1.00 44.85  ? 575  PHE A O     1 
ATOM   5351 C  CB    . PHE C 3 575 ? 10.166  62.169 26.302  1.00 45.23  ? 575  PHE A CB    1 
ATOM   5352 C  CG    . PHE C 3 575 ? 11.129  61.388 25.448  1.00 44.50  ? 575  PHE A CG    1 
ATOM   5353 C  CD1   . PHE C 3 575 ? 12.106  60.571 26.021  1.00 43.37  ? 575  PHE A CD1   1 
ATOM   5354 C  CD2   . PHE C 3 575 ? 11.021  61.430 24.059  1.00 44.16  ? 575  PHE A CD2   1 
ATOM   5355 C  CE1   . PHE C 3 575 ? 12.974  59.838 25.224  1.00 41.38  ? 575  PHE A CE1   1 
ATOM   5356 C  CE2   . PHE C 3 575 ? 11.879  60.688 23.258  1.00 43.10  ? 575  PHE A CE2   1 
ATOM   5357 C  CZ    . PHE C 3 575 ? 12.856  59.893 23.846  1.00 42.27  ? 575  PHE A CZ    1 
ATOM   5358 N  N     . ARG C 3 576 ? 12.987  63.942 27.099  1.00 46.04  ? 576  ARG A N     1 
ATOM   5359 C  CA    . ARG C 3 576 ? 13.992  64.850 26.530  1.00 46.51  ? 576  ARG A CA    1 
ATOM   5360 C  C     . ARG C 3 576 ? 13.674  65.301 25.104  1.00 46.89  ? 576  ARG A C     1 
ATOM   5361 O  O     . ARG C 3 576 ? 13.743  66.488 24.822  1.00 47.49  ? 576  ARG A O     1 
ATOM   5362 C  CB    . ARG C 3 576 ? 15.380  64.224 26.577  1.00 46.20  ? 576  ARG A CB    1 
ATOM   5363 C  CG    . ARG C 3 576 ? 16.512  65.214 26.380  1.00 45.59  ? 576  ARG A CG    1 
ATOM   5364 C  CD    . ARG C 3 576 ? 17.843  64.504 26.434  1.00 44.74  ? 576  ARG A CD    1 
ATOM   5365 N  NE    . ARG C 3 576 ? 17.999  63.853 27.731  1.00 43.66  ? 576  ARG A NE    1 
ATOM   5366 C  CZ    . ARG C 3 576 ? 18.475  64.465 28.804  1.00 42.94  ? 576  ARG A CZ    1 
ATOM   5367 N  NH1   . ARG C 3 576 ? 18.850  65.736 28.727  1.00 43.33  ? 576  ARG A NH1   1 
ATOM   5368 N  NH2   . ARG C 3 576 ? 18.574  63.817 29.950  1.00 41.70  ? 576  ARG A NH2   1 
ATOM   5369 N  N     . TYR C 3 577 ? 13.304  64.376 24.223  1.00 47.18  ? 577  TYR A N     1 
ATOM   5370 C  CA    . TYR C 3 577 ? 12.959  64.741 22.845  1.00 47.55  ? 577  TYR A CA    1 
ATOM   5371 C  C     . TYR C 3 577 ? 11.458  64.801 22.598  1.00 47.64  ? 577  TYR A C     1 
ATOM   5372 O  O     . TYR C 3 577 ? 10.986  64.486 21.512  1.00 47.76  ? 577  TYR A O     1 
ATOM   5373 C  CB    . TYR C 3 577 ? 13.644  63.795 21.857  1.00 47.85  ? 577  TYR A CB    1 
ATOM   5374 C  CG    . TYR C 3 577 ? 15.076  63.531 22.254  1.00 48.73  ? 577  TYR A CG    1 
ATOM   5375 C  CD1   . TYR C 3 577 ? 15.388  62.517 23.164  1.00 49.68  ? 577  TYR A CD1   1 
ATOM   5376 C  CD2   . TYR C 3 577 ? 16.107  64.320 21.776  1.00 48.48  ? 577  TYR A CD2   1 
ATOM   5377 C  CE1   . TYR C 3 577 ? 16.684  62.291 23.569  1.00 49.41  ? 577  TYR A CE1   1 
ATOM   5378 C  CE2   . TYR C 3 577 ? 17.413  64.093 22.173  1.00 49.13  ? 577  TYR A CE2   1 
ATOM   5379 C  CZ    . TYR C 3 577 ? 17.692  63.076 23.070  1.00 48.81  ? 577  TYR A CZ    1 
ATOM   5380 O  OH    . TYR C 3 577 ? 18.983  62.832 23.462  1.00 48.71  ? 577  TYR A OH    1 
ATOM   5381 N  N     . TYR C 3 578 ? 10.712  65.206 23.617  1.00 47.89  ? 578  TYR A N     1 
ATOM   5382 C  CA    . TYR C 3 578 ? 9.275   65.359 23.493  1.00 48.38  ? 578  TYR A CA    1 
ATOM   5383 C  C     . TYR C 3 578 ? 8.984   66.328 22.368  1.00 48.59  ? 578  TYR A C     1 
ATOM   5384 O  O     . TYR C 3 578 ? 9.495   67.452 22.381  1.00 48.87  ? 578  TYR A O     1 
ATOM   5385 C  CB    . TYR C 3 578 ? 8.675   65.879 24.806  1.00 48.54  ? 578  TYR A CB    1 
ATOM   5386 C  CG    . TYR C 3 578 ? 7.301   66.475 24.658  1.00 48.77  ? 578  TYR A CG    1 
ATOM   5387 C  CD1   . TYR C 3 578 ? 6.181   65.661 24.527  1.00 49.81  ? 578  TYR A CD1   1 
ATOM   5388 C  CD2   . TYR C 3 578 ? 7.118   67.851 24.630  1.00 49.59  ? 578  TYR A CD2   1 
ATOM   5389 C  CE1   . TYR C 3 578 ? 4.903   66.199 24.391  1.00 49.42  ? 578  TYR A CE1   1 
ATOM   5390 C  CE2   . TYR C 3 578 ? 5.844   68.402 24.485  1.00 49.94  ? 578  TYR A CE2   1 
ATOM   5391 C  CZ    . TYR C 3 578 ? 4.740   67.567 24.365  1.00 49.30  ? 578  TYR A CZ    1 
ATOM   5392 O  OH    . TYR C 3 578 ? 3.473   68.100 24.219  1.00 49.90  ? 578  TYR A OH    1 
ATOM   5393 N  N     . ASP C 3 579 ? 8.170   65.899 21.401  1.00 48.86  ? 579  ASP A N     1 
ATOM   5394 C  CA    . ASP C 3 579 ? 7.842   66.742 20.241  1.00 49.00  ? 579  ASP A CA    1 
ATOM   5395 C  C     . ASP C 3 579 ? 6.622   66.308 19.413  1.00 48.55  ? 579  ASP A C     1 
ATOM   5396 O  O     . ASP C 3 579 ? 6.652   65.287 18.711  1.00 48.32  ? 579  ASP A O     1 
ATOM   5397 C  CB    . ASP C 3 579 ? 9.057   66.890 19.331  1.00 49.37  ? 579  ASP A CB    1 
ATOM   5398 C  CG    . ASP C 3 579 ? 8.842   67.915 18.257  1.00 51.04  ? 579  ASP A CG    1 
ATOM   5399 O  OD1   . ASP C 3 579 ? 7.795   68.591 18.295  1.00 52.08  ? 579  ASP A OD1   1 
ATOM   5400 O  OD2   . ASP C 3 579 ? 9.718   68.044 17.371  1.00 54.35  ? 579  ASP A OD2   1 
ATOM   5401 N  N     . LEU C 3 580 ? 5.577   67.132 19.462  1.00 48.07  ? 580  LEU A N     1 
ATOM   5402 C  CA    . LEU C 3 580 ? 4.283   66.801 18.856  1.00 47.53  ? 580  LEU A CA    1 
ATOM   5403 C  C     . LEU C 3 580 ? 4.243   66.842 17.328  1.00 46.95  ? 580  LEU A C     1 
ATOM   5404 O  O     . LEU C 3 580 ? 3.370   66.229 16.719  1.00 47.44  ? 580  LEU A O     1 
ATOM   5405 C  CB    . LEU C 3 580 ? 3.166   67.676 19.441  1.00 47.76  ? 580  LEU A CB    1 
ATOM   5406 C  CG    . LEU C 3 580 ? 2.246   67.106 20.528  1.00 47.62  ? 580  LEU A CG    1 
ATOM   5407 C  CD1   . LEU C 3 580 ? 2.937   66.044 21.347  1.00 47.49  ? 580  LEU A CD1   1 
ATOM   5408 C  CD2   . LEU C 3 580 ? 1.776   68.222 21.429  1.00 48.11  ? 580  LEU A CD2   1 
ATOM   5409 N  N     . ARG C 3 581 ? 5.168   67.566 16.712  1.00 45.87  ? 581  ARG A N     1 
ATOM   5410 C  CA    . ARG C 3 581 ? 5.227   67.633 15.263  1.00 44.87  ? 581  ARG A CA    1 
ATOM   5411 C  C     . ARG C 3 581 ? 5.672   66.275 14.736  1.00 44.34  ? 581  ARG A C     1 
ATOM   5412 O  O     . ARG C 3 581 ? 5.196   65.810 13.705  1.00 44.22  ? 581  ARG A O     1 
ATOM   5413 C  CB    . ARG C 3 581 ? 6.178   68.744 14.817  1.00 44.71  ? 581  ARG A CB    1 
ATOM   5414 C  CG    . ARG C 3 581 ? 5.741   70.145 15.225  1.00 44.85  ? 581  ARG A CG    1 
ATOM   5415 C  CD    . ARG C 3 581 ? 6.840   71.186 14.993  1.00 45.17  ? 581  ARG A CD    1 
ATOM   5416 N  NE    . ARG C 3 581 ? 8.010   70.910 15.833  1.00 46.54  ? 581  ARG A NE    1 
ATOM   5417 C  CZ    . ARG C 3 581 ? 9.250   71.358 15.614  1.00 45.10  ? 581  ARG A CZ    1 
ATOM   5418 N  NH1   . ARG C 3 581 ? 9.524   72.124 14.570  1.00 43.82  ? 581  ARG A NH1   1 
ATOM   5419 N  NH2   . ARG C 3 581 ? 10.225  71.022 16.449  1.00 42.56  ? 581  ARG A NH2   1 
ATOM   5420 N  N     . ASN C 3 582 ? 6.574   65.633 15.469  1.00 43.93  ? 582  ASN A N     1 
ATOM   5421 C  CA    . ASN C 3 582 ? 7.028   64.284 15.128  1.00 43.61  ? 582  ASN A CA    1 
ATOM   5422 C  C     . ASN C 3 582 ? 5.975   63.216 15.458  1.00 43.22  ? 582  ASN A C     1 
ATOM   5423 O  O     . ASN C 3 582 ? 5.650   62.357 14.625  1.00 42.47  ? 582  ASN A O     1 
ATOM   5424 C  CB    . ASN C 3 582 ? 8.354   63.962 15.840  1.00 43.58  ? 582  ASN A CB    1 
ATOM   5425 C  CG    . ASN C 3 582 ? 9.533   64.787 15.317  1.00 43.68  ? 582  ASN A CG    1 
ATOM   5426 O  OD1   . ASN C 3 582 ? 9.608   65.141 14.133  1.00 42.67  ? 582  ASN A OD1   1 
ATOM   5427 N  ND2   . ASN C 3 582 ? 10.468  65.087 16.209  1.00 45.53  ? 582  ASN A ND2   1 
ATOM   5428 N  N     . ALA C 3 583 ? 5.440   63.296 16.677  1.00 43.08  ? 583  ALA A N     1 
ATOM   5429 C  CA    . ALA C 3 583 ? 4.433   62.355 17.151  1.00 42.88  ? 583  ALA A CA    1 
ATOM   5430 C  C     . ALA C 3 583 ? 3.244   62.299 16.202  1.00 42.86  ? 583  ALA A C     1 
ATOM   5431 O  O     . ALA C 3 583 ? 2.796   61.206 15.850  1.00 43.29  ? 583  ALA A O     1 
ATOM   5432 C  CB    . ALA C 3 583 ? 3.993   62.698 18.558  1.00 42.83  ? 583  ALA A CB    1 
ATOM   5433 N  N     . THR C 3 584 ? 2.758   63.460 15.761  1.00 42.29  ? 584  THR A N     1 
ATOM   5434 C  CA    . THR C 3 584 ? 1.639   63.509 14.813  1.00 42.20  ? 584  THR A CA    1 
ATOM   5435 C  C     . THR C 3 584 ? 2.048   63.191 13.349  1.00 42.43  ? 584  THR A C     1 
ATOM   5436 O  O     . THR C 3 584 ? 1.222   62.735 12.531  1.00 42.41  ? 584  THR A O     1 
ATOM   5437 C  CB    . THR C 3 584 ? 0.886   64.850 14.879  1.00 42.01  ? 584  THR A CB    1 
ATOM   5438 O  OG1   . THR C 3 584 ? 1.785   65.902 14.526  1.00 42.54  ? 584  THR A OG1   1 
ATOM   5439 C  CG2   . THR C 3 584 ? 0.327   65.103 16.297  1.00 40.95  ? 584  THR A CG2   1 
ATOM   5440 N  N     . ALA C 3 585 ? 3.315   63.425 13.015  1.00 41.93  ? 585  ALA A N     1 
ATOM   5441 C  CA    . ALA C 3 585 ? 3.793   63.046 11.699  1.00 41.42  ? 585  ALA A CA    1 
ATOM   5442 C  C     . ALA C 3 585 ? 3.651   61.547 11.557  1.00 41.27  ? 585  ALA A C     1 
ATOM   5443 O  O     . ALA C 3 585 ? 3.311   61.057 10.479  1.00 41.34  ? 585  ALA A O     1 
ATOM   5444 C  CB    . ALA C 3 585 ? 5.233   63.475 11.495  1.00 41.51  ? 585  ALA A CB    1 
ATOM   5445 N  N     . ILE C 3 586 ? 3.880   60.829 12.661  1.00 41.00  ? 586  ILE A N     1 
ATOM   5446 C  CA    . ILE C 3 586 ? 3.798   59.363 12.686  1.00 40.63  ? 586  ILE A CA    1 
ATOM   5447 C  C     . ILE C 3 586 ? 2.367   58.891 12.516  1.00 41.00  ? 586  ILE A C     1 
ATOM   5448 O  O     . ILE C 3 586 ? 2.072   58.063 11.660  1.00 40.59  ? 586  ILE A O     1 
ATOM   5449 C  CB    . ILE C 3 586 ? 4.370   58.778 13.999  1.00 40.51  ? 586  ILE A CB    1 
ATOM   5450 C  CG1   . ILE C 3 586 ? 5.876   59.077 14.107  1.00 40.97  ? 586  ILE A CG1   1 
ATOM   5451 C  CG2   . ILE C 3 586 ? 4.134   57.295 14.072  1.00 39.05  ? 586  ILE A CG2   1 
ATOM   5452 C  CD1   . ILE C 3 586 ? 6.502   58.797 15.472  1.00 39.46  ? 586  ILE A CD1   1 
ATOM   5453 N  N     . THR C 3 587 ? 1.480   59.433 13.335  1.00 41.87  ? 587  THR A N     1 
ATOM   5454 C  CA    . THR C 3 587 ? 0.112   58.938 13.406  1.00 42.73  ? 587  THR A CA    1 
ATOM   5455 C  C     . THR C 3 587 ? -0.680  59.350 12.165  1.00 43.26  ? 587  THR A C     1 
ATOM   5456 O  O     . THR C 3 587 ? -1.492  58.578 11.666  1.00 43.25  ? 587  THR A O     1 
ATOM   5457 C  CB    . THR C 3 587 ? -0.582  59.389 14.711  1.00 42.60  ? 587  THR A CB    1 
ATOM   5458 O  OG1   . THR C 3 587 ? -0.524  60.814 14.808  1.00 43.82  ? 587  THR A OG1   1 
ATOM   5459 C  CG2   . THR C 3 587 ? 0.133   58.828 15.916  1.00 41.48  ? 587  THR A CG2   1 
ATOM   5460 N  N     . THR C 3 588 ? -0.405  60.547 11.654  1.00 44.20  ? 588  THR A N     1 
ATOM   5461 C  CA    . THR C 3 588 ? -1.120  61.089 10.499  1.00 45.32  ? 588  THR A CA    1 
ATOM   5462 C  C     . THR C 3 588 ? -0.701  60.317 9.269   1.00 45.98  ? 588  THR A C     1 
ATOM   5463 O  O     . THR C 3 588 ? -1.508  60.045 8.388   1.00 46.31  ? 588  THR A O     1 
ATOM   5464 C  CB    . THR C 3 588 ? -0.806  62.599 10.276  1.00 45.55  ? 588  THR A CB    1 
ATOM   5465 O  OG1   . THR C 3 588 ? -0.900  63.317 11.515  1.00 46.29  ? 588  THR A OG1   1 
ATOM   5466 C  CG2   . THR C 3 588 ? -1.756  63.218 9.271   1.00 45.03  ? 588  THR A CG2   1 
ATOM   5467 N  N     . PHE C 3 589 ? 0.580   59.975 9.214   1.00 47.01  ? 589  PHE A N     1 
ATOM   5468 C  CA    . PHE C 3 589 ? 1.117   59.146 8.141   1.00 47.93  ? 589  PHE A CA    1 
ATOM   5469 C  C     . PHE C 3 589 ? 0.488   57.765 8.224   1.00 48.49  ? 589  PHE A C     1 
ATOM   5470 O  O     . PHE C 3 589 ? 0.110   57.182 7.208   1.00 48.68  ? 589  PHE A O     1 
ATOM   5471 C  CB    . PHE C 3 589 ? 2.634   59.034 8.268   1.00 47.73  ? 589  PHE A CB    1 
ATOM   5472 C  CG    . PHE C 3 589 ? 3.285   58.338 7.115   1.00 48.54  ? 589  PHE A CG    1 
ATOM   5473 C  CD1   . PHE C 3 589 ? 3.267   56.942 7.017   1.00 48.67  ? 589  PHE A CD1   1 
ATOM   5474 C  CD2   . PHE C 3 589 ? 3.927   59.072 6.117   1.00 48.72  ? 589  PHE A CD2   1 
ATOM   5475 C  CE1   . PHE C 3 589 ? 3.874   56.292 5.939   1.00 48.69  ? 589  PHE A CE1   1 
ATOM   5476 C  CE2   . PHE C 3 589 ? 4.536   58.424 5.032   1.00 47.82  ? 589  PHE A CE2   1 
ATOM   5477 C  CZ    . PHE C 3 589 ? 4.508   57.039 4.945   1.00 47.47  ? 589  PHE A CZ    1 
ATOM   5478 N  N     . GLY C 3 590 ? 0.377   57.258 9.453   1.00 49.29  ? 590  GLY A N     1 
ATOM   5479 C  CA    . GLY C 3 590 ? -0.289  55.994 9.735   1.00 49.48  ? 590  GLY A CA    1 
ATOM   5480 C  C     . GLY C 3 590 ? -1.689  56.001 9.174   1.00 49.84  ? 590  GLY A C     1 
ATOM   5481 O  O     . GLY C 3 590 ? -2.075  55.053 8.494   1.00 49.77  ? 590  GLY A O     1 
ATOM   5482 N  N     . GLN C 3 591 ? -2.439  57.075 9.435   1.00 50.22  ? 591  GLN A N     1 
ATOM   5483 C  CA    . GLN C 3 591 ? -3.804  57.213 8.903   1.00 51.13  ? 591  GLN A CA    1 
ATOM   5484 C  C     . GLN C 3 591 ? -3.855  57.174 7.373   1.00 51.49  ? 591  GLN A C     1 
ATOM   5485 O  O     . GLN C 3 591 ? -4.603  56.386 6.799   1.00 51.24  ? 591  GLN A O     1 
ATOM   5486 C  CB    . GLN C 3 591 ? -4.490  58.484 9.410   1.00 51.27  ? 591  GLN A CB    1 
ATOM   5487 C  CG    . GLN C 3 591 ? -4.985  58.422 10.854  1.00 52.54  ? 591  GLN A CG    1 
ATOM   5488 C  CD    . GLN C 3 591 ? -6.119  59.404 11.133  1.00 54.00  ? 591  GLN A CD    1 
ATOM   5489 O  OE1   . GLN C 3 591 ? -6.937  59.694 10.255  1.00 55.71  ? 591  GLN A OE1   1 
ATOM   5490 N  NE2   . GLN C 3 591 ? -6.179  59.907 12.356  1.00 53.41  ? 591  GLN A NE2   1 
ATOM   5491 N  N     . MET C 3 592 ? -3.057  58.013 6.718   1.00 51.96  ? 592  MET A N     1 
ATOM   5492 C  CA    . MET C 3 592 ? -2.956  57.970 5.260   1.00 53.16  ? 592  MET A CA    1 
ATOM   5493 C  C     . MET C 3 592 ? -2.614  56.575 4.738   1.00 53.09  ? 592  MET A C     1 
ATOM   5494 O  O     . MET C 3 592 ? -3.350  56.010 3.940   1.00 53.13  ? 592  MET A O     1 
ATOM   5495 C  CB    . MET C 3 592 ? -1.917  58.960 4.762   1.00 53.07  ? 592  MET A CB    1 
ATOM   5496 C  CG    . MET C 3 592 ? -1.716  58.921 3.266   1.00 53.96  ? 592  MET A CG    1 
ATOM   5497 S  SD    . MET C 3 592 ? -0.323  59.970 2.828   1.00 56.23  ? 592  MET A SD    1 
ATOM   5498 C  CE    . MET C 3 592 ? 1.022   58.947 3.446   1.00 58.67  ? 592  MET A CE    1 
ATOM   5499 N  N     . ALA C 3 593 ? -1.498  56.027 5.205   1.00 53.47  ? 593  ALA A N     1 
ATOM   5500 C  CA    . ALA C 3 593 ? -1.041  54.690 4.806   1.00 53.70  ? 593  ALA A CA    1 
ATOM   5501 C  C     . ALA C 3 593 ? -2.110  53.586 4.887   1.00 53.95  ? 593  ALA A C     1 
ATOM   5502 O  O     . ALA C 3 593 ? -2.138  52.695 4.046   1.00 54.09  ? 593  ALA A O     1 
ATOM   5503 C  CB    . ALA C 3 593 ? 0.178   54.301 5.617   1.00 53.43  ? 593  ALA A CB    1 
ATOM   5504 N  N     . LEU C 3 594 ? -2.983  53.644 5.891   1.00 54.35  ? 594  LEU A N     1 
ATOM   5505 C  CA    . LEU C 3 594 ? -4.003  52.608 6.073   1.00 54.70  ? 594  LEU A CA    1 
ATOM   5506 C  C     . LEU C 3 594 ? -5.183  52.762 5.113   1.00 55.07  ? 594  LEU A C     1 
ATOM   5507 O  O     . LEU C 3 594 ? -5.695  51.763 4.599   1.00 55.48  ? 594  LEU A O     1 
ATOM   5508 C  CB    . LEU C 3 594 ? -4.471  52.536 7.535   1.00 54.55  ? 594  LEU A CB    1 
ATOM   5509 C  CG    . LEU C 3 594 ? -5.322  51.353 8.013   1.00 54.34  ? 594  LEU A CG    1 
ATOM   5510 C  CD1   . LEU C 3 594 ? -6.791  51.720 8.117   1.00 54.82  ? 594  LEU A CD1   1 
ATOM   5511 C  CD2   . LEU C 3 594 ? -5.117  50.097 7.148   1.00 54.60  ? 594  LEU A CD2   1 
ATOM   5512 N  N     . GLN C 3 595 ? -5.595  53.999 4.865   1.00 55.36  ? 595  GLN A N     1 
ATOM   5513 C  CA    . GLN C 3 595 ? -6.685  54.271 3.941   1.00 56.35  ? 595  GLN A CA    1 
ATOM   5514 C  C     . GLN C 3 595 ? -6.242  54.224 2.485   1.00 56.98  ? 595  GLN A C     1 
ATOM   5515 O  O     . GLN C 3 595 ? -6.949  53.686 1.628   1.00 56.91  ? 595  GLN A O     1 
ATOM   5516 C  CB    . GLN C 3 595 ? -7.316  55.615 4.256   1.00 56.54  ? 595  GLN A CB    1 
ATOM   5517 C  CG    . GLN C 3 595 ? -8.428  55.523 5.269   1.00 56.93  ? 595  GLN A CG    1 
ATOM   5518 C  CD    . GLN C 3 595 ? -8.506  56.736 6.156   1.00 57.53  ? 595  GLN A CD    1 
ATOM   5519 O  OE1   . GLN C 3 595 ? -9.588  57.273 6.396   1.00 58.00  ? 595  GLN A OE1   1 
ATOM   5520 N  NE2   . GLN C 3 595 ? -7.357  57.177 6.658   1.00 57.73  ? 595  GLN A NE2   1 
ATOM   5521 N  N     . TRP C 3 596 ? -5.077  54.809 2.220   1.00 57.87  ? 596  TRP A N     1 
ATOM   5522 C  CA    . TRP C 3 596 ? -4.390  54.696 0.938   1.00 58.64  ? 596  TRP A CA    1 
ATOM   5523 C  C     . TRP C 3 596 ? -4.435  53.263 0.430   1.00 59.19  ? 596  TRP A C     1 
ATOM   5524 O  O     . TRP C 3 596 ? -4.882  53.016 -0.690  1.00 59.70  ? 596  TRP A O     1 
ATOM   5525 C  CB    . TRP C 3 596 ? -2.921  55.116 1.085   1.00 58.76  ? 596  TRP A CB    1 
ATOM   5526 C  CG    . TRP C 3 596 ? -2.100  54.862 -0.141  1.00 59.07  ? 596  TRP A CG    1 
ATOM   5527 C  CD1   . TRP C 3 596 ? -1.581  53.663 -0.554  1.00 59.71  ? 596  TRP A CD1   1 
ATOM   5528 C  CD2   . TRP C 3 596 ? -1.714  55.822 -1.122  1.00 58.81  ? 596  TRP A CD2   1 
ATOM   5529 N  NE1   . TRP C 3 596 ? -0.893  53.823 -1.733  1.00 59.76  ? 596  TRP A NE1   1 
ATOM   5530 C  CE2   . TRP C 3 596 ? -0.959  55.140 -2.103  1.00 59.56  ? 596  TRP A CE2   1 
ATOM   5531 C  CE3   . TRP C 3 596 ? -1.928  57.193 -1.266  1.00 58.79  ? 596  TRP A CE3   1 
ATOM   5532 C  CZ2   . TRP C 3 596 ? -0.415  55.785 -3.207  1.00 59.62  ? 596  TRP A CZ2   1 
ATOM   5533 C  CZ3   . TRP C 3 596 ? -1.389  57.831 -2.363  1.00 59.90  ? 596  TRP A CZ3   1 
ATOM   5534 C  CH2   . TRP C 3 596 ? -0.639  57.127 -3.322  1.00 59.74  ? 596  TRP A CH2   1 
ATOM   5535 N  N     . ILE C 3 597 ? -3.968  52.326 1.257   1.00 59.41  ? 597  ILE A N     1 
ATOM   5536 C  CA    . ILE C 3 597 ? -3.836  50.939 0.833   1.00 59.70  ? 597  ILE A CA    1 
ATOM   5537 C  C     . ILE C 3 597 ? -5.180  50.247 0.773   1.00 59.82  ? 597  ILE A C     1 
ATOM   5538 O  O     . ILE C 3 597 ? -5.331  49.255 0.064   1.00 59.93  ? 597  ILE A O     1 
ATOM   5539 C  CB    . ILE C 3 597 ? -2.848  50.135 1.724   1.00 59.83  ? 597  ILE A CB    1 
ATOM   5540 C  CG1   . ILE C 3 597 ? -2.371  48.858 1.007   1.00 59.32  ? 597  ILE A CG1   1 
ATOM   5541 C  CG2   . ILE C 3 597 ? -3.460  49.836 3.083   1.00 60.25  ? 597  ILE A CG2   1 
ATOM   5542 C  CD1   . ILE C 3 597 ? -1.425  49.108 -0.194  1.00 58.47  ? 597  ILE A CD1   1 
ATOM   5543 N  N     . GLU C 3 598 ? -6.152  50.765 1.514   1.00 59.98  ? 598  GLU A N     1 
ATOM   5544 C  CA    . GLU C 3 598 ? -7.510  50.273 1.378   1.00 60.28  ? 598  GLU A CA    1 
ATOM   5545 C  C     . GLU C 3 598 ? -7.936  50.517 -0.070  1.00 60.48  ? 598  GLU A C     1 
ATOM   5546 O  O     . GLU C 3 598 ? -8.264  49.567 -0.791  1.00 60.56  ? 598  GLU A O     1 
ATOM   5547 C  CB    . GLU C 3 598 ? -8.451  50.946 2.383   1.00 60.11  ? 598  GLU A CB    1 
ATOM   5548 C  CG    . GLU C 3 598 ? -9.924  50.557 2.260   1.00 60.11  ? 598  GLU A CG    1 
ATOM   5549 C  CD    . GLU C 3 598 ? -10.866 51.413 3.137   1.00 61.01  ? 598  GLU A CD    1 
ATOM   5550 O  OE1   . GLU C 3 598 ? -10.474 52.499 3.632   1.00 59.91  ? 598  GLU A OE1   1 
ATOM   5551 O  OE2   . GLU C 3 598 ? -12.025 50.990 3.331   1.00 62.80  ? 598  GLU A OE2   1 
ATOM   5552 N  N     . ARG C 3 599 ? -7.876  51.777 -0.505  1.00 60.62  ? 599  ARG A N     1 
ATOM   5553 C  CA    . ARG C 3 599 ? -8.246  52.143 -1.869  1.00 60.67  ? 599  ARG A CA    1 
ATOM   5554 C  C     . ARG C 3 599 ? -7.608  51.184 -2.872  1.00 60.97  ? 599  ARG A C     1 
ATOM   5555 O  O     . ARG C 3 599 ? -8.310  50.527 -3.631  1.00 60.86  ? 599  ARG A O     1 
ATOM   5556 C  CB    . ARG C 3 599 ? -7.860  53.592 -2.164  1.00 60.49  ? 599  ARG A CB    1 
ATOM   5557 C  CG    . ARG C 3 599 ? -8.194  54.052 -3.567  1.00 60.50  ? 599  ARG A CG    1 
ATOM   5558 C  CD    . ARG C 3 599 ? -8.025  55.567 -3.775  1.00 60.83  ? 599  ARG A CD    1 
ATOM   5559 N  NE    . ARG C 3 599 ? -6.691  56.060 -3.434  1.00 60.62  ? 599  ARG A NE    1 
ATOM   5560 C  CZ    . ARG C 3 599 ? -5.571  55.686 -4.049  1.00 60.05  ? 599  ARG A CZ    1 
ATOM   5561 N  NH1   . ARG C 3 599 ? -5.608  54.796 -5.036  1.00 59.15  ? 599  ARG A NH1   1 
ATOM   5562 N  NH2   . ARG C 3 599 ? -4.409  56.196 -3.664  1.00 59.00  ? 599  ARG A NH2   1 
ATOM   5563 N  N     . LYS C 3 600 ? -6.285  51.081 -2.842  1.00 61.50  ? 600  LYS A N     1 
ATOM   5564 C  CA    . LYS C 3 600 ? -5.563  50.188 -3.750  1.00 62.52  ? 600  LYS A CA    1 
ATOM   5565 C  C     . LYS C 3 600 ? -6.045  48.734 -3.673  1.00 63.13  ? 600  LYS A C     1 
ATOM   5566 O  O     . LYS C 3 600 ? -6.324  48.125 -4.710  1.00 63.31  ? 600  LYS A O     1 
ATOM   5567 C  CB    . LYS C 3 600 ? -4.048  50.244 -3.508  1.00 62.38  ? 600  LYS A CB    1 
ATOM   5568 C  CG    . LYS C 3 600 ? -3.398  51.604 -3.704  1.00 62.67  ? 600  LYS A CG    1 
ATOM   5569 C  CD    . LYS C 3 600 ? -3.120  51.934 -5.158  1.00 62.25  ? 600  LYS A CD    1 
ATOM   5570 C  CE    . LYS C 3 600 ? -1.994  52.950 -5.255  1.00 62.89  ? 600  LYS A CE    1 
ATOM   5571 N  NZ    . LYS C 3 600 ? -2.122  53.792 -6.473  1.00 63.88  ? 600  LYS A NZ    1 
ATOM   5572 N  N     . VAL C 3 601 ? -6.129  48.182 -2.457  1.00 63.70  ? 601  VAL A N     1 
ATOM   5573 C  CA    . VAL C 3 601 ? -6.622  46.815 -2.260  1.00 64.18  ? 601  VAL A CA    1 
ATOM   5574 C  C     . VAL C 3 601 ? -8.025  46.666 -2.839  1.00 64.68  ? 601  VAL A C     1 
ATOM   5575 O  O     . VAL C 3 601 ? -8.313  45.682 -3.515  1.00 64.88  ? 601  VAL A O     1 
ATOM   5576 C  CB    . VAL C 3 601 ? -6.548  46.345 -0.766  1.00 64.21  ? 601  VAL A CB    1 
ATOM   5577 C  CG1   . VAL C 3 601 ? -7.600  45.287 -0.449  1.00 63.61  ? 601  VAL A CG1   1 
ATOM   5578 C  CG2   . VAL C 3 601 ? -5.163  45.794 -0.453  1.00 63.82  ? 601  VAL A CG2   1 
ATOM   5579 N  N     . ASN C 3 602 ? -8.874  47.657 -2.592  1.00 65.20  ? 602  ASN A N     1 
ATOM   5580 C  CA    . ASN C 3 602 ? -10.203 47.700 -3.172  1.00 65.86  ? 602  ASN A CA    1 
ATOM   5581 C  C     . ASN C 3 602 ? -10.196 47.819 -4.697  1.00 66.44  ? 602  ASN A C     1 
ATOM   5582 O  O     . ASN C 3 602 ? -11.081 47.283 -5.354  1.00 66.71  ? 602  ASN A O     1 
ATOM   5583 C  CB    . ASN C 3 602 ? -11.004 48.861 -2.574  1.00 66.04  ? 602  ASN A CB    1 
ATOM   5584 C  CG    . ASN C 3 602 ? -11.846 48.448 -1.377  1.00 65.98  ? 602  ASN A CG    1 
ATOM   5585 O  OD1   . ASN C 3 602 ? -12.096 47.263 -1.139  1.00 66.66  ? 602  ASN A OD1   1 
ATOM   5586 N  ND2   . ASN C 3 602 ? -12.297 49.435 -0.621  1.00 65.35  ? 602  ASN A ND2   1 
ATOM   5587 N  N     . GLU C 3 603 ? -9.216  48.531 -5.252  1.00 67.08  ? 603  GLU A N     1 
ATOM   5588 C  CA    . GLU C 3 603 ? -9.143  48.756 -6.698  1.00 67.82  ? 603  GLU A CA    1 
ATOM   5589 C  C     . GLU C 3 603 ? -8.728  47.483 -7.424  1.00 68.39  ? 603  GLU A C     1 
ATOM   5590 O  O     . GLU C 3 603 ? -9.433  47.019 -8.319  1.00 68.34  ? 603  GLU A O     1 
ATOM   5591 C  CB    . GLU C 3 603 ? -8.190  49.916 -7.037  1.00 67.75  ? 603  GLU A CB    1 
ATOM   5592 C  CG    . GLU C 3 603 ? -8.712  51.293 -6.619  1.00 67.84  ? 603  GLU A CG    1 
ATOM   5593 C  CD    . GLU C 3 603 ? -7.663  52.403 -6.685  1.00 68.08  ? 603  GLU A CD    1 
ATOM   5594 O  OE1   . GLU C 3 603 ? -6.457  52.100 -6.808  1.00 67.97  ? 603  GLU A OE1   1 
ATOM   5595 O  OE2   . GLU C 3 603 ? -8.055  53.593 -6.608  1.00 68.14  ? 603  GLU A OE2   1 
ATOM   5596 N  N     . TYR C 3 604 ? -7.588  46.923 -7.018  1.00 69.37  ? 604  TYR A N     1 
ATOM   5597 C  CA    . TYR C 3 604 ? -7.056  45.679 -7.584  1.00 70.44  ? 604  TYR A CA    1 
ATOM   5598 C  C     . TYR C 3 604 ? -8.047  44.513 -7.607  1.00 71.23  ? 604  TYR A C     1 
ATOM   5599 O  O     . TYR C 3 604 ? -8.105  43.760 -8.580  1.00 71.27  ? 604  TYR A O     1 
ATOM   5600 C  CB    . TYR C 3 604 ? -5.788  45.246 -6.841  1.00 70.36  ? 604  TYR A CB    1 
ATOM   5601 C  CG    . TYR C 3 604 ? -5.309  43.848 -7.197  1.00 70.53  ? 604  TYR A CG    1 
ATOM   5602 C  CD1   . TYR C 3 604 ? -4.433  43.643 -8.259  1.00 70.33  ? 604  TYR A CD1   1 
ATOM   5603 C  CD2   . TYR C 3 604 ? -5.738  42.727 -6.464  1.00 70.95  ? 604  TYR A CD2   1 
ATOM   5604 C  CE1   . TYR C 3 604 ? -3.989  42.362 -8.583  1.00 71.32  ? 604  TYR A CE1   1 
ATOM   5605 C  CE2   . TYR C 3 604 ? -5.306  41.440 -6.783  1.00 70.44  ? 604  TYR A CE2   1 
ATOM   5606 C  CZ    . TYR C 3 604 ? -4.430  41.270 -7.843  1.00 71.13  ? 604  TYR A CZ    1 
ATOM   5607 O  OH    . TYR C 3 604 ? -3.989  40.014 -8.174  1.00 71.48  ? 604  TYR A OH    1 
ATOM   5608 N  N     . LEU C 3 605 ? -8.796  44.339 -6.524  1.00 72.34  ? 605  LEU A N     1 
ATOM   5609 C  CA    . LEU C 3 605 ? -9.701  43.197 -6.435  1.00 73.47  ? 605  LEU A CA    1 
ATOM   5610 C  C     . LEU C 3 605 ? -10.910 43.373 -7.345  1.00 74.21  ? 605  LEU A C     1 
ATOM   5611 O  O     . LEU C 3 605 ? -11.278 42.448 -8.057  1.00 74.50  ? 605  LEU A O     1 
ATOM   5612 C  CB    . LEU C 3 605 ? -10.116 42.899 -4.987  1.00 73.54  ? 605  LEU A CB    1 
ATOM   5613 C  CG    . LEU C 3 605 ? -9.056  42.310 -4.036  1.00 73.38  ? 605  LEU A CG    1 
ATOM   5614 C  CD1   . LEU C 3 605 ? -9.678  42.025 -2.680  1.00 72.16  ? 605  LEU A CD1   1 
ATOM   5615 C  CD2   . LEU C 3 605 ? -8.377  41.052 -4.597  1.00 72.60  ? 605  LEU A CD2   1 
ATOM   5616 N  N     . ASN C 3 606 ? -11.503 44.565 -7.344  1.00 74.86  ? 606  ASN A N     1 
ATOM   5617 C  CA    . ASN C 3 606 ? -12.553 44.889 -8.303  1.00 75.46  ? 606  ASN A CA    1 
ATOM   5618 C  C     . ASN C 3 606 ? -12.094 44.639 -9.739  1.00 76.08  ? 606  ASN A C     1 
ATOM   5619 O  O     . ASN C 3 606 ? -12.876 44.189 -10.587 1.00 76.30  ? 606  ASN A O     1 
ATOM   5620 C  CB    . ASN C 3 606 ? -13.017 46.333 -8.125  1.00 75.24  ? 606  ASN A CB    1 
ATOM   5621 C  CG    . ASN C 3 606 ? -14.236 46.448 -7.237  1.00 75.69  ? 606  ASN A CG    1 
ATOM   5622 O  OD1   . ASN C 3 606 ? -14.391 47.425 -6.504  1.00 75.82  ? 606  ASN A OD1   1 
ATOM   5623 N  ND2   . ASN C 3 606 ? -15.120 45.451 -7.302  1.00 75.77  ? 606  ASN A ND2   1 
ATOM   5624 N  N     . GLU C 3 607 ? -10.821 44.920 -9.999  1.00 76.65  ? 607  GLU A N     1 
ATOM   5625 C  CA    . GLU C 3 607 ? -10.233 44.626 -11.291 1.00 77.56  ? 607  GLU A CA    1 
ATOM   5626 C  C     . GLU C 3 607 ? -10.206 43.121 -11.516 1.00 77.83  ? 607  GLU A C     1 
ATOM   5627 O  O     . GLU C 3 607 ? -11.069 42.582 -12.207 1.00 77.79  ? 607  GLU A O     1 
ATOM   5628 C  CB    . GLU C 3 607 ? -8.825  45.224 -11.410 1.00 77.62  ? 607  GLU A CB    1 
ATOM   5629 C  CG    . GLU C 3 607 ? -8.797  46.638 -11.961 1.00 78.66  ? 607  GLU A CG    1 
ATOM   5630 C  CD    . GLU C 3 607 ? -7.913  46.773 -13.196 1.00 80.40  ? 607  GLU A CD    1 
ATOM   5631 O  OE1   . GLU C 3 607 ? -6.876  46.074 -13.267 1.00 82.14  ? 607  GLU A OE1   1 
ATOM   5632 O  OE2   . GLU C 3 607 ? -8.258  47.572 -14.101 1.00 80.02  ? 607  GLU A OE2   1 
ATOM   5633 N  N     . VAL C 3 608 ? -9.230  42.456 -10.899 1.00 78.51  ? 608  VAL A N     1 
ATOM   5634 C  CA    . VAL C 3 608 ? -9.030  41.011 -11.015 1.00 79.16  ? 608  VAL A CA    1 
ATOM   5635 C  C     . VAL C 3 608 ? -10.328 40.215 -10.872 1.00 79.55  ? 608  VAL A C     1 
ATOM   5636 O  O     . VAL C 3 608 ? -10.443 39.101 -11.383 1.00 79.76  ? 608  VAL A O     1 
ATOM   5637 C  CB    . VAL C 3 608 ? -8.016  40.509 -9.965  1.00 78.98  ? 608  VAL A CB    1 
ATOM   5638 N  N     . CYS C 3 609 ? -11.304 40.809 -10.194 1.00 80.12  ? 609  CYS A N     1 
ATOM   5639 C  CA    . CYS C 3 609 ? -12.580 40.159 -9.901  1.00 80.43  ? 609  CYS A CA    1 
ATOM   5640 C  C     . CYS C 3 609 ? -13.647 40.359 -10.990 1.00 80.44  ? 609  CYS A C     1 
ATOM   5641 O  O     . CYS C 3 609 ? -14.359 39.417 -11.338 1.00 80.35  ? 609  CYS A O     1 
ATOM   5642 C  CB    . CYS C 3 609 ? -13.098 40.663 -8.558  1.00 80.56  ? 609  CYS A CB    1 
ATOM   5643 S  SG    . CYS C 3 609 ? -14.469 39.758 -7.866  1.00 81.40  ? 609  CYS A SG    1 
ATOM   5644 N  N     . GLY C 3 610 ? -13.765 41.580 -11.511 1.00 80.43  ? 610  GLY A N     1 
ATOM   5645 C  CA    . GLY C 3 610 ? -14.677 41.842 -12.619 1.00 80.48  ? 610  GLY A CA    1 
ATOM   5646 C  C     . GLY C 3 610 ? -15.593 43.039 -12.446 1.00 80.51  ? 610  GLY A C     1 
ATOM   5647 O  O     . GLY C 3 610 ? -15.873 43.753 -13.410 1.00 80.54  ? 610  GLY A O     1 
ATOM   5648 N  N     . THR C 3 611 ? -16.071 43.264 -11.226 1.00 80.47  ? 611  THR A N     1 
ATOM   5649 C  CA    . THR C 3 611 ? -16.976 44.387 -10.966 1.00 80.47  ? 611  THR A CA    1 
ATOM   5650 C  C     . THR C 3 611 ? -16.231 45.718 -10.852 1.00 80.25  ? 611  THR A C     1 
ATOM   5651 O  O     . THR C 3 611 ? -15.108 45.858 -11.347 1.00 80.14  ? 611  THR A O     1 
ATOM   5652 C  CB    . THR C 3 611 ? -17.865 44.159 -9.709  1.00 80.62  ? 611  THR A CB    1 
ATOM   5653 O  OG1   . THR C 3 611 ? -17.106 43.496 -8.686  1.00 81.19  ? 611  THR A OG1   1 
ATOM   5654 C  CG2   . THR C 3 611 ? -19.110 43.332 -10.058 1.00 80.48  ? 611  THR A CG2   1 
ATOM   5655 N  N     . GLU C 3 612 ? -16.873 46.689 -10.202 1.00 79.99  ? 612  GLU A N     1 
ATOM   5656 C  CA    . GLU C 3 612 ? -16.325 48.026 -10.041 1.00 79.91  ? 612  GLU A CA    1 
ATOM   5657 C  C     . GLU C 3 612 ? -17.052 48.744 -8.901  1.00 79.36  ? 612  GLU A C     1 
ATOM   5658 O  O     . GLU C 3 612 ? -18.275 48.866 -8.924  1.00 79.39  ? 612  GLU A O     1 
ATOM   5659 C  CB    . GLU C 3 612 ? -16.486 48.801 -11.346 1.00 80.21  ? 612  GLU A CB    1 
ATOM   5660 C  CG    . GLU C 3 612 ? -15.468 49.904 -11.557 1.00 82.15  ? 612  GLU A CG    1 
ATOM   5661 C  CD    . GLU C 3 612 ? -15.994 51.023 -12.454 1.00 84.83  ? 612  GLU A CD    1 
ATOM   5662 O  OE1   . GLU C 3 612 ? -16.430 50.736 -13.601 1.00 85.88  ? 612  GLU A OE1   1 
ATOM   5663 O  OE2   . GLU C 3 612 ? -15.965 52.195 -12.004 1.00 85.22  ? 612  GLU A OE2   1 
ATOM   5664 N  N     . GLY C 3 613 ? -16.304 49.207 -7.901  1.00 78.77  ? 613  GLY A N     1 
ATOM   5665 C  CA    . GLY C 3 613 ? -16.895 49.905 -6.756  1.00 77.93  ? 613  GLY A CA    1 
ATOM   5666 C  C     . GLY C 3 613 ? -17.458 48.986 -5.679  1.00 77.41  ? 613  GLY A C     1 
ATOM   5667 O  O     . GLY C 3 613 ? -18.306 49.400 -4.881  1.00 77.39  ? 613  GLY A O     1 
ATOM   5668 N  N     . GLU C 3 614 ? -16.991 47.736 -5.662  1.00 76.78  ? 614  GLU A N     1 
ATOM   5669 C  CA    . GLU C 3 614 ? -17.302 46.785 -4.581  1.00 75.95  ? 614  GLU A CA    1 
ATOM   5670 C  C     . GLU C 3 614 ? -16.316 46.927 -3.417  1.00 74.77  ? 614  GLU A C     1 
ATOM   5671 O  O     . GLU C 3 614 ? -15.096 46.846 -3.611  1.00 74.65  ? 614  GLU A O     1 
ATOM   5672 C  CB    . GLU C 3 614 ? -17.280 45.341 -5.093  1.00 76.25  ? 614  GLU A CB    1 
ATOM   5673 C  CG    . GLU C 3 614 ? -18.488 44.947 -5.914  1.00 77.84  ? 614  GLU A CG    1 
ATOM   5674 C  CD    . GLU C 3 614 ? -19.769 44.949 -5.096  1.00 80.54  ? 614  GLU A CD    1 
ATOM   5675 O  OE1   . GLU C 3 614 ? -19.805 44.301 -4.018  1.00 81.08  ? 614  GLU A OE1   1 
ATOM   5676 O  OE2   . GLU C 3 614 ? -20.743 45.599 -5.539  1.00 81.47  ? 614  GLU A OE2   1 
ATOM   5677 N  N     . ALA C 3 615 ? -16.849 47.138 -2.215  1.00 73.16  ? 615  ALA A N     1 
ATOM   5678 C  CA    . ALA C 3 615 ? -16.027 47.251 -1.010  1.00 71.50  ? 615  ALA A CA    1 
ATOM   5679 C  C     . ALA C 3 615 ? -15.568 45.886 -0.480  1.00 70.08  ? 615  ALA A C     1 
ATOM   5680 O  O     . ALA C 3 615 ? -16.341 45.131 0.100   1.00 69.80  ? 615  ALA A O     1 
ATOM   5681 C  CB    . ALA C 3 615 ? -16.762 48.037 0.068   1.00 71.76  ? 615  ALA A CB    1 
ATOM   5682 N  N     . PHE C 3 616 ? -14.298 45.579 -0.692  1.00 68.58  ? 616  PHE A N     1 
ATOM   5683 C  CA    . PHE C 3 616 ? -13.727 44.315 -0.243  1.00 67.31  ? 616  PHE A CA    1 
ATOM   5684 C  C     . PHE C 3 616 ? -13.131 44.433 1.167   1.00 65.85  ? 616  PHE A C     1 
ATOM   5685 O  O     . PHE C 3 616 ? -13.230 43.501 1.967   1.00 65.62  ? 616  PHE A O     1 
ATOM   5686 C  CB    . PHE C 3 616 ? -12.688 43.806 -1.250  1.00 67.51  ? 616  PHE A CB    1 
ATOM   5687 C  CG    . PHE C 3 616 ? -13.281 43.343 -2.568  1.00 68.08  ? 616  PHE A CG    1 
ATOM   5688 C  CD1   . PHE C 3 616 ? -13.866 42.075 -2.686  1.00 68.72  ? 616  PHE A CD1   1 
ATOM   5689 C  CD2   . PHE C 3 616 ? -13.245 44.164 -3.692  1.00 68.08  ? 616  PHE A CD2   1 
ATOM   5690 C  CE1   . PHE C 3 616 ? -14.406 41.634 -3.906  1.00 67.77  ? 616  PHE A CE1   1 
ATOM   5691 C  CE2   . PHE C 3 616 ? -13.786 43.732 -4.913  1.00 68.34  ? 616  PHE A CE2   1 
ATOM   5692 C  CZ    . PHE C 3 616 ? -14.364 42.465 -5.018  1.00 67.91  ? 616  PHE A CZ    1 
ATOM   5693 N  N     . VAL C 3 617 ? -12.530 45.582 1.470   1.00 64.01  ? 617  VAL A N     1 
ATOM   5694 C  CA    . VAL C 3 617 ? -12.055 45.847 2.824   1.00 62.22  ? 617  VAL A CA    1 
ATOM   5695 C  C     . VAL C 3 617 ? -13.250 46.153 3.713   1.00 60.93  ? 617  VAL A C     1 
ATOM   5696 O  O     . VAL C 3 617 ? -13.855 47.215 3.613   1.00 60.26  ? 617  VAL A O     1 
ATOM   5697 C  CB    . VAL C 3 617 ? -11.002 46.984 2.884   1.00 62.19  ? 617  VAL A CB    1 
ATOM   5698 C  CG1   . VAL C 3 617 ? -10.726 47.389 4.319   1.00 62.01  ? 617  VAL A CG1   1 
ATOM   5699 C  CG2   . VAL C 3 617 ? -9.713  46.541 2.234   1.00 61.94  ? 617  VAL A CG2   1 
ATOM   5700 N  N     . LEU C 3 618 ? -13.602 45.201 4.569   1.00 59.91  ? 618  LEU A N     1 
ATOM   5701 C  CA    . LEU C 3 618 ? -14.711 45.422 5.482   1.00 59.01  ? 618  LEU A CA    1 
ATOM   5702 C  C     . LEU C 3 618 ? -14.324 46.203 6.729   1.00 58.28  ? 618  LEU A C     1 
ATOM   5703 O  O     . LEU C 3 618 ? -15.188 46.793 7.386   1.00 58.40  ? 618  LEU A O     1 
ATOM   5704 C  CB    . LEU C 3 618 ? -15.464 44.125 5.836   1.00 59.24  ? 618  LEU A CB    1 
ATOM   5705 C  CG    . LEU C 3 618 ? -15.056 42.805 6.519   1.00 59.00  ? 618  LEU A CG    1 
ATOM   5706 C  CD1   . LEU C 3 618 ? -14.257 41.911 5.600   1.00 60.24  ? 618  LEU A CD1   1 
ATOM   5707 C  CD2   . LEU C 3 618 ? -14.376 42.934 7.874   1.00 60.01  ? 618  LEU A CD2   1 
ATOM   5708 N  N     . TYR C 3 619 ? -13.030 46.228 7.033   1.00 56.81  ? 619  TYR A N     1 
ATOM   5709 C  CA    . TYR C 3 619 ? -12.570 46.780 8.286   1.00 55.72  ? 619  TYR A CA    1 
ATOM   5710 C  C     . TYR C 3 619 ? -11.058 46.943 8.295   1.00 55.55  ? 619  TYR A C     1 
ATOM   5711 O  O     . TYR C 3 619 ? -10.348 46.357 7.473   1.00 55.49  ? 619  TYR A O     1 
ATOM   5712 C  CB    . TYR C 3 619 ? -13.026 45.874 9.432   1.00 55.20  ? 619  TYR A CB    1 
ATOM   5713 C  CG    . TYR C 3 619 ? -12.697 46.341 10.829  1.00 54.01  ? 619  TYR A CG    1 
ATOM   5714 C  CD1   . TYR C 3 619 ? -13.368 47.406 11.409  1.00 53.24  ? 619  TYR A CD1   1 
ATOM   5715 C  CD2   . TYR C 3 619 ? -11.728 45.682 11.586  1.00 53.27  ? 619  TYR A CD2   1 
ATOM   5716 C  CE1   . TYR C 3 619 ? -13.068 47.812 12.710  1.00 53.49  ? 619  TYR A CE1   1 
ATOM   5717 C  CE2   . TYR C 3 619 ? -11.421 46.074 12.882  1.00 52.02  ? 619  TYR A CE2   1 
ATOM   5718 C  CZ    . TYR C 3 619 ? -12.090 47.133 13.438  1.00 52.88  ? 619  TYR A CZ    1 
ATOM   5719 O  OH    . TYR C 3 619 ? -11.784 47.513 14.719  1.00 52.77  ? 619  TYR A OH    1 
ATOM   5720 N  N     . GLY C 3 620 ? -10.587 47.754 9.237   1.00 55.02  ? 620  GLY A N     1 
ATOM   5721 C  CA    . GLY C 3 620 ? -9.178  48.018 9.432   1.00 54.50  ? 620  GLY A CA    1 
ATOM   5722 C  C     . GLY C 3 620 ? -8.970  48.929 10.626  1.00 54.21  ? 620  GLY A C     1 
ATOM   5723 O  O     . GLY C 3 620 ? -9.812  49.782 10.917  1.00 54.48  ? 620  GLY A O     1 
ATOM   5724 N  N     . ASP C 3 621 ? -7.848  48.743 11.318  1.00 53.67  ? 621  ASP A N     1 
ATOM   5725 C  CA    . ASP C 3 621 ? -7.554  49.473 12.546  1.00 53.05  ? 621  ASP A CA    1 
ATOM   5726 C  C     . ASP C 3 621 ? -6.060  49.784 12.599  1.00 52.69  ? 621  ASP A C     1 
ATOM   5727 O  O     . ASP C 3 621 ? -5.227  48.864 12.654  1.00 52.73  ? 621  ASP A O     1 
ATOM   5728 C  CB    . ASP C 3 621 ? -7.994  48.640 13.761  1.00 52.95  ? 621  ASP A CB    1 
ATOM   5729 C  CG    . ASP C 3 621 ? -7.861  49.387 15.083  1.00 52.84  ? 621  ASP A CG    1 
ATOM   5730 O  OD1   . ASP C 3 621 ? -7.233  50.462 15.119  1.00 53.49  ? 621  ASP A OD1   1 
ATOM   5731 O  OD2   . ASP C 3 621 ? -8.391  48.889 16.102  1.00 52.82  ? 621  ASP A OD2   1 
ATOM   5732 N  N     . THR C 3 622 ? -5.736  51.077 12.576  1.00 52.12  ? 622  THR A N     1 
ATOM   5733 C  CA    . THR C 3 622 ? -4.358  51.557 12.603  1.00 51.81  ? 622  THR A CA    1 
ATOM   5734 C  C     . THR C 3 622 ? -3.552  51.052 11.407  1.00 52.12  ? 622  THR A C     1 
ATOM   5735 O  O     . THR C 3 622 ? -3.203  51.832 10.519  1.00 52.26  ? 622  THR A O     1 
ATOM   5736 C  CB    . THR C 3 622 ? -3.630  51.145 13.889  1.00 51.67  ? 622  THR A CB    1 
ATOM   5737 O  OG1   . THR C 3 622 ? -4.477  51.357 15.018  1.00 51.83  ? 622  THR A OG1   1 
ATOM   5738 C  CG2   . THR C 3 622 ? -2.362  51.930 14.061  1.00 51.95  ? 622  THR A CG2   1 
ATOM   5739 N  N     . ASP C 3 623 ? -3.277  49.746 11.385  1.00 52.04  ? 623  ASP A N     1 
ATOM   5740 C  CA    . ASP C 3 623 ? -2.367  49.162 10.422  1.00 52.50  ? 623  ASP A CA    1 
ATOM   5741 C  C     . ASP C 3 623 ? -2.835  47.831 9.837   1.00 52.91  ? 623  ASP A C     1 
ATOM   5742 O  O     . ASP C 3 623 ? -2.024  47.042 9.346   1.00 52.87  ? 623  ASP A O     1 
ATOM   5743 C  CB    . ASP C 3 623 ? -0.986  48.982 11.070  1.00 52.68  ? 623  ASP A CB    1 
ATOM   5744 C  CG    . ASP C 3 623 ? -0.910  47.776 11.998  1.00 52.85  ? 623  ASP A CG    1 
ATOM   5745 O  OD1   . ASP C 3 623 ? -1.933  47.419 12.621  1.00 54.67  ? 623  ASP A OD1   1 
ATOM   5746 O  OD2   . ASP C 3 623 ? 0.187   47.191 12.116  1.00 51.64  ? 623  ASP A OD2   1 
ATOM   5747 N  N     . SER C 3 624 ? -4.132  47.569 9.884   1.00 53.51  ? 624  SER A N     1 
ATOM   5748 C  CA    . SER C 3 624 ? -4.624  46.254 9.479   1.00 54.00  ? 624  SER A CA    1 
ATOM   5749 C  C     . SER C 3 624 ? -5.740  46.388 8.468   1.00 54.28  ? 624  SER A C     1 
ATOM   5750 O  O     . SER C 3 624 ? -6.476  47.359 8.509   1.00 54.65  ? 624  SER A O     1 
ATOM   5751 C  CB    . SER C 3 624 ? -5.113  45.459 10.701  1.00 54.10  ? 624  SER A CB    1 
ATOM   5752 O  OG    . SER C 3 624 ? -6.324  45.983 11.220  1.00 53.06  ? 624  SER A OG    1 
ATOM   5753 N  N     . ILE C 3 625 ? -5.846  45.438 7.548   1.00 54.59  ? 625  ILE A N     1 
ATOM   5754 C  CA    . ILE C 3 625 ? -7.064  45.303 6.752   1.00 55.13  ? 625  ILE A CA    1 
ATOM   5755 C  C     . ILE C 3 625 ? -7.604  43.876 6.715   1.00 55.78  ? 625  ILE A C     1 
ATOM   5756 O  O     . ILE C 3 625 ? -6.864  42.896 6.544   1.00 55.88  ? 625  ILE A O     1 
ATOM   5757 C  CB    . ILE C 3 625 ? -6.953  45.862 5.317   1.00 54.94  ? 625  ILE A CB    1 
ATOM   5758 C  CG1   . ILE C 3 625 ? -5.756  45.272 4.587   1.00 54.95  ? 625  ILE A CG1   1 
ATOM   5759 C  CG2   . ILE C 3 625 ? -6.944  47.383 5.317   1.00 54.74  ? 625  ILE A CG2   1 
ATOM   5760 C  CD1   . ILE C 3 625 ? -5.778  45.555 3.116   1.00 55.92  ? 625  ILE A CD1   1 
ATOM   5761 N  N     . TYR C 3 626 ? -8.914  43.787 6.895   1.00 56.43  ? 626  TYR A N     1 
ATOM   5762 C  CA    . TYR C 3 626 ? -9.626  42.532 6.837   1.00 57.38  ? 626  TYR A CA    1 
ATOM   5763 C  C     . TYR C 3 626 ? -10.415 42.525 5.534   1.00 58.36  ? 626  TYR A C     1 
ATOM   5764 O  O     . TYR C 3 626 ? -11.379 43.274 5.380   1.00 58.50  ? 626  TYR A O     1 
ATOM   5765 C  CB    . TYR C 3 626 ? -10.541 42.387 8.066   1.00 57.17  ? 626  TYR A CB    1 
ATOM   5766 C  CG    . TYR C 3 626 ? -9.775  42.206 9.363   1.00 56.21  ? 626  TYR A CG    1 
ATOM   5767 C  CD1   . TYR C 3 626 ? -9.171  43.290 9.995   1.00 55.55  ? 626  TYR A CD1   1 
ATOM   5768 C  CD2   . TYR C 3 626 ? -9.653  40.949 9.952   1.00 55.87  ? 626  TYR A CD2   1 
ATOM   5769 C  CE1   . TYR C 3 626 ? -8.456  43.134 11.171  1.00 56.16  ? 626  TYR A CE1   1 
ATOM   5770 C  CE2   . TYR C 3 626 ? -8.937  40.771 11.130  1.00 56.04  ? 626  TYR A CE2   1 
ATOM   5771 C  CZ    . TYR C 3 626 ? -8.335  41.870 11.733  1.00 56.99  ? 626  TYR A CZ    1 
ATOM   5772 O  OH    . TYR C 3 626 ? -7.623  41.714 12.903  1.00 57.32  ? 626  TYR A OH    1 
ATOM   5773 N  N     . VAL C 3 627 ? -9.990  41.705 4.582   1.00 59.54  ? 627  VAL A N     1 
ATOM   5774 C  CA    . VAL C 3 627 ? -10.690 41.631 3.306   1.00 60.99  ? 627  VAL A CA    1 
ATOM   5775 C  C     . VAL C 3 627 ? -11.701 40.488 3.246   1.00 61.98  ? 627  VAL A C     1 
ATOM   5776 O  O     . VAL C 3 627 ? -11.412 39.356 3.644   1.00 62.49  ? 627  VAL A O     1 
ATOM   5777 C  CB    . VAL C 3 627 ? -9.718  41.500 2.134   1.00 61.03  ? 627  VAL A CB    1 
ATOM   5778 C  CG1   . VAL C 3 627 ? -10.440 41.799 0.847   1.00 61.20  ? 627  VAL A CG1   1 
ATOM   5779 C  CG2   . VAL C 3 627 ? -8.532  42.460 2.303   1.00 61.58  ? 627  VAL A CG2   1 
ATOM   5780 N  N     . SER C 3 628 ? -12.892 40.797 2.751   1.00 63.16  ? 628  SER A N     1 
ATOM   5781 C  CA    . SER C 3 628 ? -13.909 39.787 2.475   1.00 64.36  ? 628  SER A CA    1 
ATOM   5782 C  C     . SER C 3 628 ? -13.453 38.919 1.314   1.00 64.91  ? 628  SER A C     1 
ATOM   5783 O  O     . SER C 3 628 ? -13.095 39.437 0.256   1.00 65.06  ? 628  SER A O     1 
ATOM   5784 C  CB    . SER C 3 628 ? -15.238 40.459 2.117   1.00 64.39  ? 628  SER A CB    1 
ATOM   5785 O  OG    . SER C 3 628 ? -16.289 39.505 2.062   1.00 65.50  ? 628  SER A OG    1 
ATOM   5786 N  N     . ALA C 3 629 ? -13.473 37.606 1.502   1.00 65.72  ? 629  ALA A N     1 
ATOM   5787 C  CA    . ALA C 3 629 ? -12.955 36.696 0.481   1.00 66.77  ? 629  ALA A CA    1 
ATOM   5788 C  C     . ALA C 3 629 ? -14.026 35.859 -0.236  1.00 67.47  ? 629  ALA A C     1 
ATOM   5789 O  O     . ALA C 3 629 ? -13.701 34.907 -0.946  1.00 67.38  ? 629  ALA A O     1 
ATOM   5790 C  CB    . ALA C 3 629 ? -11.850 35.805 1.073   1.00 66.79  ? 629  ALA A CB    1 
ATOM   5791 N  N     . ASP C 3 630 ? -15.296 36.228 -0.067  1.00 68.58  ? 630  ASP A N     1 
ATOM   5792 C  CA    . ASP C 3 630 ? -16.398 35.494 -0.700  1.00 69.69  ? 630  ASP A CA    1 
ATOM   5793 C  C     . ASP C 3 630 ? -16.277 35.434 -2.232  1.00 70.12  ? 630  ASP A C     1 
ATOM   5794 O  O     . ASP C 3 630 ? -16.213 34.346 -2.800  1.00 70.28  ? 630  ASP A O     1 
ATOM   5795 C  CB    . ASP C 3 630 ? -17.761 36.067 -0.289  1.00 69.79  ? 630  ASP A CB    1 
ATOM   5796 C  CG    . ASP C 3 630 ? -18.098 35.831 1.189   1.00 71.65  ? 630  ASP A CG    1 
ATOM   5797 O  OD1   . ASP C 3 630 ? -17.197 35.520 2.008   1.00 73.17  ? 630  ASP A OD1   1 
ATOM   5798 O  OD2   . ASP C 3 630 ? -19.293 35.974 1.540   1.00 72.70  ? 630  ASP A OD2   1 
ATOM   5799 N  N     . LYS C 3 631 ? -16.220 36.590 -2.896  1.00 70.81  ? 631  LYS A N     1 
ATOM   5800 C  CA    . LYS C 3 631 ? -16.264 36.643 -4.366  1.00 71.40  ? 631  LYS A CA    1 
ATOM   5801 C  C     . LYS C 3 631 ? -15.072 35.946 -5.024  1.00 72.26  ? 631  LYS A C     1 
ATOM   5802 O  O     . LYS C 3 631 ? -15.179 35.464 -6.150  1.00 72.53  ? 631  LYS A O     1 
ATOM   5803 C  CB    . LYS C 3 631 ? -16.404 38.079 -4.871  1.00 71.06  ? 631  LYS A CB    1 
ATOM   5804 C  CG    . LYS C 3 631 ? -17.665 38.773 -4.388  1.00 70.32  ? 631  LYS A CG    1 
ATOM   5805 C  CD    . LYS C 3 631 ? -17.739 40.209 -4.879  1.00 68.75  ? 631  LYS A CD    1 
ATOM   5806 C  CE    . LYS C 3 631 ? -18.646 41.063 -3.988  1.00 68.11  ? 631  LYS A CE    1 
ATOM   5807 N  NZ    . LYS C 3 631 ? -20.062 40.612 -4.017  1.00 66.37  ? 631  LYS A NZ    1 
ATOM   5808 N  N     . ILE C 3 632 ? -13.951 35.882 -4.311  1.00 73.16  ? 632  ILE A N     1 
ATOM   5809 C  CA    . ILE C 3 632 ? -12.770 35.160 -4.787  1.00 74.22  ? 632  ILE A CA    1 
ATOM   5810 C  C     . ILE C 3 632 ? -12.960 33.640 -4.682  1.00 75.08  ? 632  ILE A C     1 
ATOM   5811 O  O     . ILE C 3 632 ? -12.605 32.896 -5.602  1.00 75.42  ? 632  ILE A O     1 
ATOM   5812 C  CB    . ILE C 3 632 ? -11.488 35.633 -4.060  1.00 74.11  ? 632  ILE A CB    1 
ATOM   5813 C  CG1   . ILE C 3 632 ? -11.184 37.077 -4.451  1.00 74.26  ? 632  ILE A CG1   1 
ATOM   5814 C  CG2   . ILE C 3 632 ? -10.290 34.757 -4.405  1.00 73.64  ? 632  ILE A CG2   1 
ATOM   5815 C  CD1   . ILE C 3 632 ? -10.373 37.822 -3.430  1.00 75.32  ? 632  ILE A CD1   1 
ATOM   5816 N  N     . ILE C 3 633 ? -13.520 33.190 -3.562  1.00 76.06  ? 633  ILE A N     1 
ATOM   5817 C  CA    . ILE C 3 633 ? -13.972 31.807 -3.410  1.00 76.89  ? 633  ILE A CA    1 
ATOM   5818 C  C     . ILE C 3 633 ? -15.084 31.512 -4.438  1.00 77.71  ? 633  ILE A C     1 
ATOM   5819 O  O     . ILE C 3 633 ? -15.132 30.419 -5.013  1.00 77.89  ? 633  ILE A O     1 
ATOM   5820 C  CB    . ILE C 3 633 ? -14.474 31.531 -1.951  1.00 76.82  ? 633  ILE A CB    1 
ATOM   5821 C  CG1   . ILE C 3 633 ? -13.334 31.664 -0.925  1.00 76.86  ? 633  ILE A CG1   1 
ATOM   5822 C  CG2   . ILE C 3 633 ? -15.152 30.168 -1.829  1.00 76.77  ? 633  ILE A CG2   1 
ATOM   5823 C  CD1   . ILE C 3 633 ? -12.460 30.425 -0.751  1.00 76.59  ? 633  ILE A CD1   1 
ATOM   5824 N  N     . ASP C 3 634 ? -15.955 32.493 -4.685  1.00 78.47  ? 634  ASP A N     1 
ATOM   5825 C  CA    . ASP C 3 634 ? -17.062 32.324 -5.623  1.00 79.48  ? 634  ASP A CA    1 
ATOM   5826 C  C     . ASP C 3 634 ? -16.601 32.130 -7.064  1.00 80.15  ? 634  ASP A C     1 
ATOM   5827 O  O     . ASP C 3 634 ? -17.349 31.618 -7.901  1.00 80.24  ? 634  ASP A O     1 
ATOM   5828 C  CB    . ASP C 3 634 ? -18.054 33.486 -5.519  1.00 79.48  ? 634  ASP A CB    1 
ATOM   5829 C  CG    . ASP C 3 634 ? -19.061 33.306 -4.372  1.00 80.12  ? 634  ASP A CG    1 
ATOM   5830 O  OD1   . ASP C 3 634 ? -19.029 32.262 -3.658  1.00 80.31  ? 634  ASP A OD1   1 
ATOM   5831 O  OD2   . ASP C 3 634 ? -19.892 34.222 -4.184  1.00 79.56  ? 634  ASP A OD2   1 
ATOM   5832 N  N     . LYS C 3 635 ? -15.360 32.524 -7.335  1.00 81.04  ? 635  LYS A N     1 
ATOM   5833 C  CA    . LYS C 3 635 ? -14.751 32.369 -8.650  1.00 81.87  ? 635  LYS A CA    1 
ATOM   5834 C  C     . LYS C 3 635 ? -14.195 30.946 -8.910  1.00 82.66  ? 635  LYS A C     1 
ATOM   5835 O  O     . LYS C 3 635 ? -13.393 30.741 -9.826  1.00 82.67  ? 635  LYS A O     1 
ATOM   5836 C  CB    . LYS C 3 635 ? -13.669 33.433 -8.836  1.00 81.67  ? 635  LYS A CB    1 
ATOM   5837 C  CG    . LYS C 3 635 ? -13.385 33.777 -10.285 1.00 81.73  ? 635  LYS A CG    1 
ATOM   5838 C  CD    . LYS C 3 635 ? -12.583 35.059 -10.421 1.00 81.42  ? 635  LYS A CD    1 
ATOM   5839 C  CE    . LYS C 3 635 ? -13.478 36.288 -10.346 1.00 81.45  ? 635  LYS A CE    1 
ATOM   5840 N  NZ    . LYS C 3 635 ? -14.302 36.462 -11.574 1.00 80.77  ? 635  LYS A NZ    1 
ATOM   5841 N  N     . VAL C 3 636 ? -14.619 29.973 -8.098  1.00 83.64  ? 636  VAL A N     1 
ATOM   5842 C  CA    . VAL C 3 636 ? -14.327 28.550 -8.335  1.00 84.73  ? 636  VAL A CA    1 
ATOM   5843 C  C     . VAL C 3 636 ? -15.421 27.647 -7.756  1.00 85.60  ? 636  VAL A C     1 
ATOM   5844 O  O     . VAL C 3 636 ? -15.323 26.414 -7.825  1.00 85.72  ? 636  VAL A O     1 
ATOM   5845 C  CB    . VAL C 3 636 ? -12.956 28.079 -7.755  1.00 84.74  ? 636  VAL A CB    1 
ATOM   5846 C  CG1   . VAL C 3 636 ? -12.171 27.297 -8.821  1.00 84.70  ? 636  VAL A CG1   1 
ATOM   5847 C  CG2   . VAL C 3 636 ? -12.125 29.238 -7.218  1.00 85.00  ? 636  VAL A CG2   1 
ATOM   5848 N  N     . GLY C 3 637 ? -16.451 28.266 -7.178  1.00 86.67  ? 637  GLY A N     1 
ATOM   5849 C  CA    . GLY C 3 637 ? -17.573 27.552 -6.561  1.00 87.96  ? 637  GLY A CA    1 
ATOM   5850 C  C     . GLY C 3 637 ? -17.212 26.745 -5.321  1.00 88.92  ? 637  GLY A C     1 
ATOM   5851 O  O     . GLY C 3 637 ? -16.038 26.666 -4.935  1.00 88.90  ? 637  GLY A O     1 
ATOM   5852 N  N     . GLU C 3 638 ? -18.234 26.146 -4.701  1.00 89.81  ? 638  GLU A N     1 
ATOM   5853 C  CA    . GLU C 3 638 ? -18.062 25.245 -3.547  1.00 90.60  ? 638  GLU A CA    1 
ATOM   5854 C  C     . GLU C 3 638 ? -17.451 23.903 -3.946  1.00 90.83  ? 638  GLU A C     1 
ATOM   5855 O  O     . GLU C 3 638 ? -16.696 23.293 -3.175  1.00 91.02  ? 638  GLU A O     1 
ATOM   5856 C  CB    . GLU C 3 638 ? -19.404 24.975 -2.862  1.00 90.74  ? 638  GLU A CB    1 
ATOM   5857 C  CG    . GLU C 3 638 ? -19.258 24.291 -1.500  1.00 91.75  ? 638  GLU A CG    1 
ATOM   5858 C  CD    . GLU C 3 638 ? -20.029 22.982 -1.404  1.00 92.65  ? 638  GLU A CD    1 
ATOM   5859 O  OE1   . GLU C 3 638 ? -20.969 22.783 -2.209  1.00 93.19  ? 638  GLU A OE1   1 
ATOM   5860 O  OE2   . GLU C 3 638 ? -19.691 22.153 -0.526  1.00 92.18  ? 638  GLU A OE2   1 
ATOM   5861 N  N     . SER C 3 639 ? -17.812 23.451 -5.146  1.00 90.93  ? 639  SER A N     1 
ATOM   5862 C  CA    . SER C 3 639 ? -17.378 22.174 -5.702  1.00 90.78  ? 639  SER A CA    1 
ATOM   5863 C  C     . SER C 3 639 ? -15.853 21.964 -5.721  1.00 90.54  ? 639  SER A C     1 
ATOM   5864 O  O     . SER C 3 639 ? -15.336 21.135 -4.967  1.00 90.57  ? 639  SER A O     1 
ATOM   5865 C  CB    . SER C 3 639 ? -17.948 22.022 -7.113  1.00 90.95  ? 639  SER A CB    1 
ATOM   5866 O  OG    . SER C 3 639 ? -17.641 23.172 -7.891  1.00 91.47  ? 639  SER A OG    1 
ATOM   5867 N  N     . LYS C 3 640 ? -15.142 22.727 -6.557  1.00 90.11  ? 640  LYS A N     1 
ATOM   5868 C  CA    . LYS C 3 640 ? -13.739 22.425 -6.906  1.00 89.67  ? 640  LYS A CA    1 
ATOM   5869 C  C     . LYS C 3 640 ? -12.766 22.214 -5.725  1.00 89.01  ? 640  LYS A C     1 
ATOM   5870 O  O     . LYS C 3 640 ? -11.632 21.751 -5.915  1.00 89.05  ? 640  LYS A O     1 
ATOM   5871 C  CB    . LYS C 3 640 ? -13.182 23.462 -7.902  1.00 89.87  ? 640  LYS A CB    1 
ATOM   5872 C  CG    . LYS C 3 640 ? -11.890 23.021 -8.608  1.00 90.55  ? 640  LYS A CG    1 
ATOM   5873 C  CD    . LYS C 3 640 ? -12.095 21.714 -9.387  1.00 91.64  ? 640  LYS A CD    1 
ATOM   5874 C  CE    . LYS C 3 640 ? -11.071 20.653 -8.996  1.00 92.38  ? 640  LYS A CE    1 
ATOM   5875 N  NZ    . LYS C 3 640 ? -9.656  21.073 -9.258  1.00 93.47  ? 640  LYS A NZ    1 
ATOM   5876 N  N     . PHE C 3 641 ? -13.211 22.541 -4.513  1.00 87.97  ? 641  PHE A N     1 
ATOM   5877 C  CA    . PHE C 3 641 ? -12.378 22.354 -3.332  1.00 86.88  ? 641  PHE A CA    1 
ATOM   5878 C  C     . PHE C 3 641 ? -12.711 21.055 -2.643  1.00 86.19  ? 641  PHE A C     1 
ATOM   5879 O  O     . PHE C 3 641 ? -13.845 20.848 -2.195  1.00 86.03  ? 641  PHE A O     1 
ATOM   5880 C  CB    . PHE C 3 641 ? -12.495 23.540 -2.373  1.00 86.81  ? 641  PHE A CB    1 
ATOM   5881 C  CG    . PHE C 3 641 ? -12.115 24.846 -2.999  1.00 86.47  ? 641  PHE A CG    1 
ATOM   5882 C  CD1   . PHE C 3 641 ? -10.816 25.061 -3.447  1.00 85.68  ? 641  PHE A CD1   1 
ATOM   5883 C  CD2   . PHE C 3 641 ? -13.060 25.852 -3.166  1.00 86.00  ? 641  PHE A CD2   1 
ATOM   5884 C  CE1   . PHE C 3 641 ? -10.464 26.260 -4.042  1.00 85.92  ? 641  PHE A CE1   1 
ATOM   5885 C  CE2   . PHE C 3 641 ? -12.713 27.060 -3.758  1.00 85.91  ? 641  PHE A CE2   1 
ATOM   5886 C  CZ    . PHE C 3 641 ? -11.415 27.264 -4.197  1.00 85.85  ? 641  PHE A CZ    1 
ATOM   5887 N  N     . ARG C 3 642 ? -11.703 20.185 -2.575  1.00 85.15  ? 642  ARG A N     1 
ATOM   5888 C  CA    . ARG C 3 642 ? -11.837 18.856 -1.997  1.00 84.11  ? 642  ARG A CA    1 
ATOM   5889 C  C     . ARG C 3 642 ? -12.312 18.962 -0.552  1.00 82.88  ? 642  ARG A C     1 
ATOM   5890 O  O     . ARG C 3 642 ? -13.440 18.575 -0.235  1.00 82.62  ? 642  ARG A O     1 
ATOM   5891 C  CB    . ARG C 3 642 ? -10.502 18.113 -2.083  1.00 84.19  ? 642  ARG A CB    1 
ATOM   5892 C  CG    . ARG C 3 642 ? -10.621 16.599 -2.099  1.00 84.88  ? 642  ARG A CG    1 
ATOM   5893 C  CD    . ARG C 3 642 ? -9.235  15.947 -2.041  1.00 85.61  ? 642  ARG A CD    1 
ATOM   5894 N  NE    . ARG C 3 642 ? -9.273  14.540 -1.626  1.00 87.27  ? 642  ARG A NE    1 
ATOM   5895 C  CZ    . ARG C 3 642 ? -9.478  14.109 -0.377  1.00 87.53  ? 642  ARG A CZ    1 
ATOM   5896 N  NH1   . ARG C 3 642 ? -9.694  14.964 0.620   1.00 87.36  ? 642  ARG A NH1   1 
ATOM   5897 N  NH2   . ARG C 3 642 ? -9.483  12.807 -0.124  1.00 87.74  ? 642  ARG A NH2   1 
ATOM   5898 N  N     . ASP C 3 643 ? -11.454 19.520 0.301   1.00 81.50  ? 643  ASP A N     1 
ATOM   5899 C  CA    . ASP C 3 643 ? -11.741 19.690 1.729   1.00 79.99  ? 643  ASP A CA    1 
ATOM   5900 C  C     . ASP C 3 643 ? -11.573 21.152 2.163   1.00 78.84  ? 643  ASP A C     1 
ATOM   5901 O  O     . ASP C 3 643 ? -11.263 22.010 1.335   1.00 78.52  ? 643  ASP A O     1 
ATOM   5902 C  CB    . ASP C 3 643 ? -10.868 18.742 2.573   1.00 80.08  ? 643  ASP A CB    1 
ATOM   5903 C  CG    . ASP C 3 643 ? -9.382  18.762 2.168   1.00 80.31  ? 643  ASP A CG    1 
ATOM   5904 O  OD1   . ASP C 3 643 ? -9.067  18.972 0.973   1.00 80.15  ? 643  ASP A OD1   1 
ATOM   5905 O  OD2   . ASP C 3 643 ? -8.524  18.543 3.056   1.00 79.98  ? 643  ASP A OD2   1 
ATOM   5906 N  N     . THR C 3 644 ? -11.809 21.428 3.451   1.00 77.58  ? 644  THR A N     1 
ATOM   5907 C  CA    . THR C 3 644 ? -11.607 22.760 4.047   1.00 76.12  ? 644  THR A CA    1 
ATOM   5908 C  C     . THR C 3 644 ? -10.227 23.285 3.689   1.00 75.15  ? 644  THR A C     1 
ATOM   5909 O  O     . THR C 3 644 ? -10.088 24.362 3.110   1.00 74.93  ? 644  THR A O     1 
ATOM   5910 C  CB    . THR C 3 644 ? -11.699 22.724 5.597   1.00 76.24  ? 644  THR A CB    1 
ATOM   5911 O  OG1   . THR C 3 644 ? -12.924 22.106 6.014   1.00 76.30  ? 644  THR A OG1   1 
ATOM   5912 C  CG2   . THR C 3 644 ? -11.605 24.133 6.186   1.00 75.82  ? 644  THR A CG2   1 
ATOM   5913 N  N     . ASN C 3 645 ? -9.218  22.491 4.032   1.00 74.03  ? 645  ASN A N     1 
ATOM   5914 C  CA    . ASN C 3 645 ? -7.819  22.810 3.790   1.00 73.08  ? 645  ASN A CA    1 
ATOM   5915 C  C     . ASN C 3 645 ? -7.506  23.189 2.333   1.00 72.52  ? 645  ASN A C     1 
ATOM   5916 O  O     . ASN C 3 645 ? -6.502  23.860 2.068   1.00 72.31  ? 645  ASN A O     1 
ATOM   5917 C  CB    . ASN C 3 645 ? -6.939  21.639 4.258   1.00 73.03  ? 645  ASN A CB    1 
ATOM   5918 C  CG    . ASN C 3 645 ? -5.467  22.015 4.383   1.00 72.80  ? 645  ASN A CG    1 
ATOM   5919 O  OD1   . ASN C 3 645 ? -5.108  22.958 5.087   1.00 72.83  ? 645  ASN A OD1   1 
ATOM   5920 N  ND2   . ASN C 3 645 ? -4.606  21.266 3.701   1.00 72.48  ? 645  ASN A ND2   1 
ATOM   5921 N  N     . HIS C 3 646 ? -8.365  22.771 1.399   1.00 71.82  ? 646  HIS A N     1 
ATOM   5922 C  CA    . HIS C 3 646 ? -8.189  23.111 -0.018  1.00 71.34  ? 646  HIS A CA    1 
ATOM   5923 C  C     . HIS C 3 646 ? -8.465  24.581 -0.330  1.00 70.43  ? 646  HIS A C     1 
ATOM   5924 O  O     . HIS C 3 646 ? -7.766  25.185 -1.141  1.00 70.29  ? 646  HIS A O     1 
ATOM   5925 C  CB    . HIS C 3 646 ? -9.029  22.207 -0.920  1.00 71.66  ? 646  HIS A CB    1 
ATOM   5926 C  CG    . HIS C 3 646 ? -8.248  21.104 -1.568  1.00 73.39  ? 646  HIS A CG    1 
ATOM   5927 N  ND1   . HIS C 3 646 ? -8.262  20.885 -2.931  1.00 74.79  ? 646  HIS A ND1   1 
ATOM   5928 C  CD2   . HIS C 3 646 ? -7.424  20.162 -1.043  1.00 74.36  ? 646  HIS A CD2   1 
ATOM   5929 C  CE1   . HIS C 3 646 ? -7.486  19.852 -3.217  1.00 75.23  ? 646  HIS A CE1   1 
ATOM   5930 N  NE2   . HIS C 3 646 ? -6.967  19.395 -2.089  1.00 75.05  ? 646  HIS A NE2   1 
ATOM   5931 N  N     . TRP C 3 647 ? -9.471  25.161 0.312   1.00 69.51  ? 647  TRP A N     1 
ATOM   5932 C  CA    . TRP C 3 647 ? -9.753  26.571 0.075   1.00 68.72  ? 647  TRP A CA    1 
ATOM   5933 C  C     . TRP C 3 647 ? -8.813  27.500 0.858   1.00 68.02  ? 647  TRP A C     1 
ATOM   5934 O  O     . TRP C 3 647 ? -8.591  28.644 0.468   1.00 67.84  ? 647  TRP A O     1 
ATOM   5935 C  CB    . TRP C 3 647 ? -11.240 26.899 0.275   1.00 68.75  ? 647  TRP A CB    1 
ATOM   5936 C  CG    . TRP C 3 647 ? -11.824 26.687 1.654   1.00 69.19  ? 647  TRP A CG    1 
ATOM   5937 C  CD1   . TRP C 3 647 ? -12.667 25.680 2.046   1.00 69.50  ? 647  TRP A CD1   1 
ATOM   5938 C  CD2   . TRP C 3 647 ? -11.666 27.539 2.797   1.00 69.50  ? 647  TRP A CD2   1 
ATOM   5939 N  NE1   . TRP C 3 647 ? -13.024 25.841 3.367   1.00 68.97  ? 647  TRP A NE1   1 
ATOM   5940 C  CE2   . TRP C 3 647 ? -12.420 26.972 3.851   1.00 69.39  ? 647  TRP A CE2   1 
ATOM   5941 C  CE3   . TRP C 3 647 ? -10.949 28.719 3.039   1.00 68.73  ? 647  TRP A CE3   1 
ATOM   5942 C  CZ2   . TRP C 3 647 ? -12.470 27.544 5.125   1.00 69.29  ? 647  TRP A CZ2   1 
ATOM   5943 C  CZ3   . TRP C 3 647 ? -10.995 29.278 4.301   1.00 68.61  ? 647  TRP A CZ3   1 
ATOM   5944 C  CH2   . TRP C 3 647 ? -11.751 28.693 5.329   1.00 69.02  ? 647  TRP A CH2   1 
ATOM   5945 N  N     . VAL C 3 648 ? -8.254  26.982 1.950   1.00 67.14  ? 648  VAL A N     1 
ATOM   5946 C  CA    . VAL C 3 648 ? -7.263  27.695 2.757   1.00 66.09  ? 648  VAL A CA    1 
ATOM   5947 C  C     . VAL C 3 648 ? -5.968  27.842 1.966   1.00 65.66  ? 648  VAL A C     1 
ATOM   5948 O  O     . VAL C 3 648 ? -5.445  28.945 1.822   1.00 65.33  ? 648  VAL A O     1 
ATOM   5949 C  CB    . VAL C 3 648 ? -6.979  26.973 4.106   1.00 65.79  ? 648  VAL A CB    1 
ATOM   5950 C  CG1   . VAL C 3 648 ? -6.029  27.784 4.954   1.00 65.52  ? 648  VAL A CG1   1 
ATOM   5951 C  CG2   . VAL C 3 648 ? -8.257  26.737 4.871   1.00 65.34  ? 648  VAL A CG2   1 
ATOM   5952 N  N     . ASP C 3 649 ? -5.468  26.715 1.466   1.00 65.30  ? 649  ASP A N     1 
ATOM   5953 C  CA    . ASP C 3 649 ? -4.298  26.676 0.597   1.00 65.10  ? 649  ASP A CA    1 
ATOM   5954 C  C     . ASP C 3 649 ? -4.447  27.610 -0.591  1.00 64.70  ? 649  ASP A C     1 
ATOM   5955 O  O     . ASP C 3 649 ? -3.493  28.297 -0.982  1.00 64.29  ? 649  ASP A O     1 
ATOM   5956 C  CB    . ASP C 3 649 ? -4.060  25.248 0.100   1.00 65.30  ? 649  ASP A CB    1 
ATOM   5957 C  CG    . ASP C 3 649 ? -3.009  24.536 0.903   1.00 66.24  ? 649  ASP A CG    1 
ATOM   5958 O  OD1   . ASP C 3 649 ? -1.965  25.172 1.165   1.00 68.26  ? 649  ASP A OD1   1 
ATOM   5959 O  OD2   . ASP C 3 649 ? -3.218  23.358 1.282   1.00 66.40  ? 649  ASP A OD2   1 
ATOM   5960 N  N     . PHE C 3 650 ? -5.656  27.623 -1.151  1.00 64.29  ? 650  PHE A N     1 
ATOM   5961 C  CA    . PHE C 3 650 ? -6.004  28.508 -2.245  1.00 64.01  ? 650  PHE A CA    1 
ATOM   5962 C  C     . PHE C 3 650 ? -5.784  29.960 -1.854  1.00 63.59  ? 650  PHE A C     1 
ATOM   5963 O  O     . PHE C 3 650 ? -4.932  30.627 -2.428  1.00 63.64  ? 650  PHE A O     1 
ATOM   5964 C  CB    . PHE C 3 650 ? -7.452  28.271 -2.678  1.00 64.23  ? 650  PHE A CB    1 
ATOM   5965 C  CG    . PHE C 3 650 ? -8.025  29.375 -3.524  1.00 64.61  ? 650  PHE A CG    1 
ATOM   5966 C  CD1   . PHE C 3 650 ? -7.440  29.715 -4.744  1.00 64.88  ? 650  PHE A CD1   1 
ATOM   5967 C  CD2   . PHE C 3 650 ? -9.163  30.066 -3.103  1.00 64.94  ? 650  PHE A CD2   1 
ATOM   5968 C  CE1   . PHE C 3 650 ? -7.972  30.740 -5.539  1.00 65.28  ? 650  PHE A CE1   1 
ATOM   5969 C  CE2   . PHE C 3 650 ? -9.711  31.085 -3.886  1.00 65.60  ? 650  PHE A CE2   1 
ATOM   5970 C  CZ    . PHE C 3 650 ? -9.108  31.423 -5.114  1.00 65.66  ? 650  PHE A CZ    1 
ATOM   5971 N  N     . LEU C 3 651 ? -6.538  30.431 -0.864  1.00 63.20  ? 651  LEU A N     1 
ATOM   5972 C  CA    . LEU C 3 651 ? -6.438  31.808 -0.384  1.00 62.95  ? 651  LEU A CA    1 
ATOM   5973 C  C     . LEU C 3 651 ? -4.992  32.208 -0.050  1.00 63.09  ? 651  LEU A C     1 
ATOM   5974 O  O     . LEU C 3 651 ? -4.506  33.255 -0.487  1.00 62.99  ? 651  LEU A O     1 
ATOM   5975 C  CB    . LEU C 3 651 ? -7.370  32.030 0.815   1.00 62.51  ? 651  LEU A CB    1 
ATOM   5976 C  CG    . LEU C 3 651 ? -8.876  31.969 0.545   1.00 61.16  ? 651  LEU A CG    1 
ATOM   5977 C  CD1   . LEU C 3 651 ? -9.661  32.120 1.822   1.00 60.42  ? 651  LEU A CD1   1 
ATOM   5978 C  CD2   . LEU C 3 651 ? -9.290  33.033 -0.439  1.00 60.84  ? 651  LEU A CD2   1 
ATOM   5979 N  N     . ASP C 3 652 ? -4.312  31.355 0.704   1.00 63.34  ? 652  ASP A N     1 
ATOM   5980 C  CA    . ASP C 3 652 ? -2.899  31.525 0.966   1.00 63.80  ? 652  ASP A CA    1 
ATOM   5981 C  C     . ASP C 3 652 ? -2.127  31.719 -0.344  1.00 64.43  ? 652  ASP A C     1 
ATOM   5982 O  O     . ASP C 3 652 ? -1.399  32.706 -0.481  1.00 64.76  ? 652  ASP A O     1 
ATOM   5983 C  CB    . ASP C 3 652 ? -2.370  30.339 1.770   1.00 63.54  ? 652  ASP A CB    1 
ATOM   5984 C  CG    . ASP C 3 652 ? -0.886  30.446 2.089   1.00 63.73  ? 652  ASP A CG    1 
ATOM   5985 O  OD1   . ASP C 3 652 ? -0.293  31.542 1.996   1.00 64.80  ? 652  ASP A OD1   1 
ATOM   5986 O  OD2   . ASP C 3 652 ? -0.301  29.409 2.445   1.00 63.16  ? 652  ASP A OD2   1 
ATOM   5987 N  N     . LYS C 3 653 ? -2.307  30.810 -1.309  1.00 64.99  ? 653  LYS A N     1 
ATOM   5988 C  CA    . LYS C 3 653 ? -1.637  30.925 -2.623  1.00 65.28  ? 653  LYS A CA    1 
ATOM   5989 C  C     . LYS C 3 653 ? -2.057  32.192 -3.358  1.00 65.56  ? 653  LYS A C     1 
ATOM   5990 O  O     . LYS C 3 653 ? -1.281  32.752 -4.132  1.00 65.75  ? 653  LYS A O     1 
ATOM   5991 C  CB    . LYS C 3 653 ? -1.896  29.697 -3.513  1.00 65.06  ? 653  LYS A CB    1 
ATOM   5992 N  N     . PHE C 3 654 ? -3.284  32.646 -3.117  1.00 65.88  ? 654  PHE A N     1 
ATOM   5993 C  CA    . PHE C 3 654 ? -3.773  33.833 -3.789  1.00 66.24  ? 654  PHE A CA    1 
ATOM   5994 C  C     . PHE C 3 654 ? -3.162  35.081 -3.190  1.00 66.66  ? 654  PHE A C     1 
ATOM   5995 O  O     . PHE C 3 654 ? -2.730  35.987 -3.922  1.00 66.97  ? 654  PHE A O     1 
ATOM   5996 C  CB    . PHE C 3 654 ? -5.291  33.925 -3.734  1.00 66.23  ? 654  PHE A CB    1 
ATOM   5997 C  CG    . PHE C 3 654 ? -5.847  35.085 -4.517  1.00 66.32  ? 654  PHE A CG    1 
ATOM   5998 C  CD1   . PHE C 3 654 ? -5.687  35.148 -5.899  1.00 65.82  ? 654  PHE A CD1   1 
ATOM   5999 C  CD2   . PHE C 3 654 ? -6.527  36.108 -3.876  1.00 66.50  ? 654  PHE A CD2   1 
ATOM   6000 C  CE1   . PHE C 3 654 ? -6.192  36.205 -6.632  1.00 66.36  ? 654  PHE A CE1   1 
ATOM   6001 C  CE2   . PHE C 3 654 ? -7.039  37.174 -4.601  1.00 67.39  ? 654  PHE A CE2   1 
ATOM   6002 C  CZ    . PHE C 3 654 ? -6.871  37.223 -5.988  1.00 67.00  ? 654  PHE A CZ    1 
ATOM   6003 N  N     . ALA C 3 655 ? -3.133  35.121 -1.859  1.00 66.73  ? 655  ALA A N     1 
ATOM   6004 C  CA    . ALA C 3 655 ? -2.543  36.230 -1.131  1.00 66.81  ? 655  ALA A CA    1 
ATOM   6005 C  C     . ALA C 3 655 ? -1.079  36.410 -1.529  1.00 67.14  ? 655  ALA A C     1 
ATOM   6006 O  O     . ALA C 3 655 ? -0.649  37.515 -1.876  1.00 67.26  ? 655  ALA A O     1 
ATOM   6007 C  CB    . ALA C 3 655 ? -2.671  36.003 0.363   1.00 66.65  ? 655  ALA A CB    1 
ATOM   6008 N  N     . ARG C 3 656 ? -0.334  35.309 -1.513  1.00 67.33  ? 656  ARG A N     1 
ATOM   6009 C  CA    . ARG C 3 656 ? 1.108   35.333 -1.710  1.00 67.80  ? 656  ARG A CA    1 
ATOM   6010 C  C     . ARG C 3 656 ? 1.489   35.754 -3.124  1.00 68.36  ? 656  ARG A C     1 
ATOM   6011 O  O     . ARG C 3 656 ? 2.392   36.570 -3.318  1.00 68.30  ? 656  ARG A O     1 
ATOM   6012 C  CB    . ARG C 3 656 ? 1.684   33.955 -1.376  1.00 67.62  ? 656  ARG A CB    1 
ATOM   6013 C  CG    . ARG C 3 656 ? 3.190   33.826 -1.467  1.00 67.20  ? 656  ARG A CG    1 
ATOM   6014 C  CD    . ARG C 3 656 ? 3.696   32.752 -0.494  1.00 67.16  ? 656  ARG A CD    1 
ATOM   6015 N  NE    . ARG C 3 656 ? 2.870   31.541 -0.474  1.00 66.18  ? 656  ARG A NE    1 
ATOM   6016 C  CZ    . ARG C 3 656 ? 2.859   30.607 -1.429  1.00 66.20  ? 656  ARG A CZ    1 
ATOM   6017 N  NH1   . ARG C 3 656 ? 3.621   30.732 -2.513  1.00 64.99  ? 656  ARG A NH1   1 
ATOM   6018 N  NH2   . ARG C 3 656 ? 2.065   29.546 -1.308  1.00 65.45  ? 656  ARG A NH2   1 
ATOM   6019 N  N     . GLU C 3 657 ? 0.766   35.214 -4.101  1.00 69.21  ? 657  GLU A N     1 
ATOM   6020 C  CA    . GLU C 3 657 ? 1.167   35.288 -5.502  1.00 70.02  ? 657  GLU A CA    1 
ATOM   6021 C  C     . GLU C 3 657 ? 0.462   36.369 -6.337  1.00 70.24  ? 657  GLU A C     1 
ATOM   6022 O  O     . GLU C 3 657 ? 0.898   36.667 -7.454  1.00 70.15  ? 657  GLU A O     1 
ATOM   6023 C  CB    . GLU C 3 657 ? 1.009   33.911 -6.159  1.00 69.95  ? 657  GLU A CB    1 
ATOM   6024 C  CG    . GLU C 3 657 ? 2.179   32.964 -5.896  1.00 70.96  ? 657  GLU A CG    1 
ATOM   6025 C  CD    . GLU C 3 657 ? 1.843   31.504 -6.170  1.00 71.34  ? 657  GLU A CD    1 
ATOM   6026 O  OE1   . GLU C 3 657 ? 0.818   31.239 -6.836  1.00 72.05  ? 657  GLU A OE1   1 
ATOM   6027 O  OE2   . GLU C 3 657 ? 2.607   30.623 -5.713  1.00 71.65  ? 657  GLU A OE2   1 
ATOM   6028 N  N     . ARG C 3 658 ? -0.617  36.947 -5.812  1.00 70.59  ? 658  ARG A N     1 
ATOM   6029 C  CA    . ARG C 3 658 ? -1.354  37.961 -6.569  1.00 71.04  ? 658  ARG A CA    1 
ATOM   6030 C  C     . ARG C 3 658 ? -1.504  39.281 -5.805  1.00 71.02  ? 658  ARG A C     1 
ATOM   6031 O  O     . ARG C 3 658 ? -1.103  40.343 -6.300  1.00 70.93  ? 658  ARG A O     1 
ATOM   6032 C  CB    . ARG C 3 658 ? -2.726  37.430 -7.019  1.00 71.29  ? 658  ARG A CB    1 
ATOM   6033 C  CG    . ARG C 3 658 ? -2.743  35.980 -7.575  1.00 72.13  ? 658  ARG A CG    1 
ATOM   6034 C  CD    . ARG C 3 658 ? -2.213  35.818 -9.013  1.00 72.54  ? 658  ARG A CD    1 
ATOM   6035 N  NE    . ARG C 3 658 ? -2.981  36.563 -10.015 1.00 72.71  ? 658  ARG A NE    1 
ATOM   6036 C  CZ    . ARG C 3 658 ? -3.104  36.207 -11.293 1.00 72.19  ? 658  ARG A CZ    1 
ATOM   6037 N  NH1   . ARG C 3 658 ? -2.528  35.104 -11.735 1.00 71.90  ? 658  ARG A NH1   1 
ATOM   6038 N  NH2   . ARG C 3 658 ? -3.812  36.951 -12.132 1.00 72.52  ? 658  ARG A NH2   1 
ATOM   6039 N  N     . MET C 3 659 ? -2.058  39.196 -4.596  1.00 70.92  ? 659  MET A N     1 
ATOM   6040 C  CA    . MET C 3 659 ? -2.401  40.369 -3.793  1.00 70.82  ? 659  MET A CA    1 
ATOM   6041 C  C     . MET C 3 659 ? -1.216  41.101 -3.199  1.00 70.71  ? 659  MET A C     1 
ATOM   6042 O  O     . MET C 3 659 ? -1.130  42.328 -3.285  1.00 70.72  ? 659  MET A O     1 
ATOM   6043 C  CB    . MET C 3 659 ? -3.327  39.971 -2.663  1.00 70.50  ? 659  MET A CB    1 
ATOM   6044 C  CG    . MET C 3 659 ? -4.728  39.781 -3.101  1.00 70.83  ? 659  MET A CG    1 
ATOM   6045 S  SD    . MET C 3 659 ? -5.792  39.764 -1.662  1.00 72.16  ? 659  MET A SD    1 
ATOM   6046 C  CE    . MET C 3 659 ? -5.819  38.014 -1.275  1.00 72.44  ? 659  MET A CE    1 
ATOM   6047 N  N     . GLU C 3 660 ? -0.319  40.352 -2.572  1.00 70.64  ? 660  GLU A N     1 
ATOM   6048 C  CA    . GLU C 3 660 ? 0.853   40.942 -1.952  1.00 70.83  ? 660  GLU A CA    1 
ATOM   6049 C  C     . GLU C 3 660 ? 1.636   41.869 -2.906  1.00 70.51  ? 660  GLU A C     1 
ATOM   6050 O  O     . GLU C 3 660 ? 1.899   43.022 -2.547  1.00 70.63  ? 660  GLU A O     1 
ATOM   6051 C  CB    . GLU C 3 660 ? 1.766   39.862 -1.376  1.00 71.07  ? 660  GLU A CB    1 
ATOM   6052 C  CG    . GLU C 3 660 ? 2.693   40.378 -0.288  1.00 72.80  ? 660  GLU A CG    1 
ATOM   6053 C  CD    . GLU C 3 660 ? 2.210   40.028 1.109   1.00 74.98  ? 660  GLU A CD    1 
ATOM   6054 O  OE1   . GLU C 3 660 ? 1.009   39.705 1.269   1.00 74.99  ? 660  GLU A OE1   1 
ATOM   6055 O  OE2   . GLU C 3 660 ? 3.047   40.057 2.045   1.00 76.25  ? 660  GLU A OE2   1 
ATOM   6056 N  N     . PRO C 3 661 ? 1.993   41.390 -4.125  1.00 70.07  ? 661  PRO A N     1 
ATOM   6057 C  CA    . PRO C 3 661 ? 2.792   42.265 -4.994  1.00 69.52  ? 661  PRO A CA    1 
ATOM   6058 C  C     . PRO C 3 661 ? 2.018   43.522 -5.404  1.00 68.97  ? 661  PRO A C     1 
ATOM   6059 O  O     . PRO C 3 661 ? 2.619   44.595 -5.573  1.00 68.59  ? 661  PRO A O     1 
ATOM   6060 C  CB    . PRO C 3 661 ? 3.079   41.384 -6.215  1.00 69.67  ? 661  PRO A CB    1 
ATOM   6061 C  CG    . PRO C 3 661 ? 2.826   39.973 -5.761  1.00 69.76  ? 661  PRO A CG    1 
ATOM   6062 C  CD    . PRO C 3 661 ? 1.711   40.098 -4.782  1.00 70.13  ? 661  PRO A CD    1 
ATOM   6063 N  N     . ALA C 3 662 ? 0.697   43.374 -5.543  1.00 68.19  ? 662  ALA A N     1 
ATOM   6064 C  CA    . ALA C 3 662 ? -0.207  44.495 -5.791  1.00 67.63  ? 662  ALA A CA    1 
ATOM   6065 C  C     . ALA C 3 662 ? -0.093  45.519 -4.675  1.00 67.31  ? 662  ALA A C     1 
ATOM   6066 O  O     . ALA C 3 662 ? 0.114   46.709 -4.923  1.00 67.22  ? 662  ALA A O     1 
ATOM   6067 C  CB    . ALA C 3 662 ? -1.631  44.004 -5.913  1.00 67.45  ? 662  ALA A CB    1 
ATOM   6068 N  N     . ILE C 3 663 ? -0.215  45.035 -3.445  1.00 67.11  ? 663  ILE A N     1 
ATOM   6069 C  CA    . ILE C 3 663 ? -0.005  45.854 -2.259  1.00 66.89  ? 663  ILE A CA    1 
ATOM   6070 C  C     . ILE C 3 663 ? 1.340   46.545 -2.352  1.00 66.49  ? 663  ILE A C     1 
ATOM   6071 O  O     . ILE C 3 663 ? 1.432   47.760 -2.170  1.00 66.46  ? 663  ILE A O     1 
ATOM   6072 C  CB    . ILE C 3 663 ? -0.070  45.018 -0.949  1.00 66.89  ? 663  ILE A CB    1 
ATOM   6073 C  CG1   . ILE C 3 663 ? -1.517  44.659 -0.617  1.00 66.51  ? 663  ILE A CG1   1 
ATOM   6074 C  CG2   . ILE C 3 663 ? 0.583   45.770 0.225   1.00 66.84  ? 663  ILE A CG2   1 
ATOM   6075 C  CD1   . ILE C 3 663 ? -1.657  43.685 0.544   1.00 67.78  ? 663  ILE A CD1   1 
ATOM   6076 N  N     . ASP C 3 664 ? 2.377   45.768 -2.653  1.00 66.08  ? 664  ASP A N     1 
ATOM   6077 C  CA    . ASP C 3 664 ? 3.723   46.311 -2.707  1.00 65.66  ? 664  ASP A CA    1 
ATOM   6078 C  C     . ASP C 3 664 ? 3.823   47.439 -3.730  1.00 65.54  ? 664  ASP A C     1 
ATOM   6079 O  O     . ASP C 3 664 ? 4.432   48.474 -3.454  1.00 65.44  ? 664  ASP A O     1 
ATOM   6080 C  CB    . ASP C 3 664 ? 4.753   45.228 -2.993  1.00 65.54  ? 664  ASP A CB    1 
ATOM   6081 C  CG    . ASP C 3 664 ? 6.155   45.702 -2.729  1.00 65.44  ? 664  ASP A CG    1 
ATOM   6082 O  OD1   . ASP C 3 664 ? 6.493   45.908 -1.546  1.00 65.73  ? 664  ASP A OD1   1 
ATOM   6083 O  OD2   . ASP C 3 664 ? 6.911   45.895 -3.703  1.00 65.26  ? 664  ASP A OD2   1 
ATOM   6084 N  N     . ARG C 3 665 ? 3.209   47.236 -4.895  1.00 65.34  ? 665  ARG A N     1 
ATOM   6085 C  CA    . ARG C 3 665 ? 3.160   48.256 -5.937  1.00 64.89  ? 665  ARG A CA    1 
ATOM   6086 C  C     . ARG C 3 665 ? 2.504   49.515 -5.393  1.00 64.57  ? 665  ARG A C     1 
ATOM   6087 O  O     . ARG C 3 665 ? 3.031   50.624 -5.549  1.00 64.77  ? 665  ARG A O     1 
ATOM   6088 C  CB    . ARG C 3 665 ? 2.395   47.744 -7.162  1.00 65.05  ? 665  ARG A CB    1 
ATOM   6089 C  CG    . ARG C 3 665 ? 3.194   46.792 -8.050  1.00 65.11  ? 665  ARG A CG    1 
ATOM   6090 C  CD    . ARG C 3 665 ? 2.529   46.572 -9.415  1.00 65.01  ? 665  ARG A CD    1 
ATOM   6091 N  NE    . ARG C 3 665 ? 1.219   45.912 -9.325  1.00 65.85  ? 665  ARG A NE    1 
ATOM   6092 C  CZ    . ARG C 3 665 ? 1.029   44.592 -9.230  1.00 65.25  ? 665  ARG A CZ    1 
ATOM   6093 N  NH1   . ARG C 3 665 ? 2.067   43.758 -9.194  1.00 65.27  ? 665  ARG A NH1   1 
ATOM   6094 N  NH2   . ARG C 3 665 ? -0.203  44.101 -9.159  1.00 64.40  ? 665  ARG A NH2   1 
ATOM   6095 N  N     . GLY C 3 666 ? 1.368   49.334 -4.726  1.00 64.09  ? 666  GLY A N     1 
ATOM   6096 C  CA    . GLY C 3 666 ? 0.655   50.445 -4.108  1.00 63.60  ? 666  GLY A CA    1 
ATOM   6097 C  C     . GLY C 3 666 ? 1.496   51.245 -3.133  1.00 63.11  ? 666  GLY A C     1 
ATOM   6098 O  O     . GLY C 3 666 ? 1.499   52.471 -3.173  1.00 63.13  ? 666  GLY A O     1 
ATOM   6099 N  N     . PHE C 3 667 ? 2.218   50.545 -2.268  1.00 62.83  ? 667  PHE A N     1 
ATOM   6100 C  CA    . PHE C 3 667 ? 2.957   51.190 -1.193  1.00 62.91  ? 667  PHE A CA    1 
ATOM   6101 C  C     . PHE C 3 667 ? 4.227   51.855 -1.657  1.00 63.17  ? 667  PHE A C     1 
ATOM   6102 O  O     . PHE C 3 667 ? 4.663   52.833 -1.046  1.00 63.37  ? 667  PHE A O     1 
ATOM   6103 C  CB    . PHE C 3 667 ? 3.310   50.204 -0.077  1.00 62.97  ? 667  PHE A CB    1 
ATOM   6104 C  CG    . PHE C 3 667 ? 2.321   50.177 1.053   1.00 62.29  ? 667  PHE A CG    1 
ATOM   6105 C  CD1   . PHE C 3 667 ? 1.898   51.356 1.658   1.00 62.17  ? 667  PHE A CD1   1 
ATOM   6106 C  CD2   . PHE C 3 667 ? 1.837   48.965 1.534   1.00 61.83  ? 667  PHE A CD2   1 
ATOM   6107 C  CE1   . PHE C 3 667 ? 0.984   51.334 2.714   1.00 61.72  ? 667  PHE A CE1   1 
ATOM   6108 C  CE2   . PHE C 3 667 ? 0.934   48.925 2.589   1.00 61.78  ? 667  PHE A CE2   1 
ATOM   6109 C  CZ    . PHE C 3 667 ? 0.503   50.117 3.179   1.00 62.31  ? 667  PHE A CZ    1 
ATOM   6110 N  N     . ARG C 3 668 ? 4.846   51.331 -2.710  1.00 63.39  ? 668  ARG A N     1 
ATOM   6111 C  CA    . ARG C 3 668 ? 6.077   51.960 -3.196  1.00 63.64  ? 668  ARG A CA    1 
ATOM   6112 C  C     . ARG C 3 668 ? 5.761   53.222 -3.991  1.00 63.21  ? 668  ARG A C     1 
ATOM   6113 O  O     . ARG C 3 668 ? 6.554   54.167 -3.992  1.00 63.08  ? 668  ARG A O     1 
ATOM   6114 C  CB    . ARG C 3 668 ? 7.023   50.987 -3.925  1.00 63.59  ? 668  ARG A CB    1 
ATOM   6115 C  CG    . ARG C 3 668 ? 6.417   50.138 -5.022  1.00 64.50  ? 668  ARG A CG    1 
ATOM   6116 C  CD    . ARG C 3 668 ? 7.469   49.216 -5.642  1.00 65.29  ? 668  ARG A CD    1 
ATOM   6117 N  NE    . ARG C 3 668 ? 7.886   48.145 -4.728  1.00 67.80  ? 668  ARG A NE    1 
ATOM   6118 C  CZ    . ARG C 3 668 ? 9.033   48.127 -4.044  1.00 68.17  ? 668  ARG A CZ    1 
ATOM   6119 N  NH1   . ARG C 3 668 ? 9.904   49.126 -4.156  1.00 68.40  ? 668  ARG A NH1   1 
ATOM   6120 N  NH2   . ARG C 3 668 ? 9.312   47.105 -3.243  1.00 67.35  ? 668  ARG A NH2   1 
ATOM   6121 N  N     . GLU C 3 669 ? 4.581   53.238 -4.617  1.00 62.86  ? 669  GLU A N     1 
ATOM   6122 C  CA    . GLU C 3 669 ? 4.034   54.453 -5.230  1.00 62.72  ? 669  GLU A CA    1 
ATOM   6123 C  C     . GLU C 3 669 ? 3.805   55.578 -4.204  1.00 62.57  ? 669  GLU A C     1 
ATOM   6124 O  O     . GLU C 3 669 ? 4.187   56.731 -4.431  1.00 62.08  ? 669  GLU A O     1 
ATOM   6125 C  CB    . GLU C 3 669 ? 2.734   54.135 -5.962  1.00 62.61  ? 669  GLU A CB    1 
ATOM   6126 C  CG    . GLU C 3 669 ? 2.102   55.335 -6.637  1.00 62.78  ? 669  GLU A CG    1 
ATOM   6127 C  CD    . GLU C 3 669 ? 0.696   55.064 -7.136  1.00 63.56  ? 669  GLU A CD    1 
ATOM   6128 O  OE1   . GLU C 3 669 ? 0.432   53.941 -7.624  1.00 64.22  ? 669  GLU A OE1   1 
ATOM   6129 O  OE2   . GLU C 3 669 ? -0.148  55.980 -7.050  1.00 63.20  ? 669  GLU A OE2   1 
ATOM   6130 N  N     . MET C 3 670 ? 3.177   55.228 -3.084  1.00 62.65  ? 670  MET A N     1 
ATOM   6131 C  CA    . MET C 3 670 ? 3.008   56.140 -1.950  1.00 62.83  ? 670  MET A CA    1 
ATOM   6132 C  C     . MET C 3 670 ? 4.350   56.626 -1.401  1.00 62.73  ? 670  MET A C     1 
ATOM   6133 O  O     . MET C 3 670 ? 4.490   57.788 -1.017  1.00 62.45  ? 670  MET A O     1 
ATOM   6134 C  CB    . MET C 3 670 ? 2.228   55.452 -0.830  1.00 62.96  ? 670  MET A CB    1 
ATOM   6135 C  CG    . MET C 3 670 ? 1.696   56.408 0.243   1.00 63.46  ? 670  MET A CG    1 
ATOM   6136 S  SD    . MET C 3 670 ? 1.027   55.583 1.712   1.00 62.81  ? 670  MET A SD    1 
ATOM   6137 C  CE    . MET C 3 670 ? 2.556   55.087 2.512   1.00 63.20  ? 670  MET A CE    1 
ATOM   6138 N  N     . CYS C 3 671 ? 5.331   55.729 -1.360  1.00 62.71  ? 671  CYS A N     1 
ATOM   6139 C  CA    . CYS C 3 671 ? 6.666   56.085 -0.904  1.00 62.82  ? 671  CYS A CA    1 
ATOM   6140 C  C     . CYS C 3 671 ? 7.270   57.174 -1.791  1.00 62.95  ? 671  CYS A C     1 
ATOM   6141 O  O     . CYS C 3 671 ? 7.890   58.123 -1.299  1.00 62.96  ? 671  CYS A O     1 
ATOM   6142 C  CB    . CYS C 3 671 ? 7.567   54.858 -0.871  1.00 62.80  ? 671  CYS A CB    1 
ATOM   6143 S  SG    . CYS C 3 671 ? 9.201   55.193 -0.214  1.00 63.01  ? 671  CYS A SG    1 
ATOM   6144 N  N     . GLU C 3 672 ? 7.074   57.030 -3.098  1.00 63.07  ? 672  GLU A N     1 
ATOM   6145 C  CA    . GLU C 3 672 ? 7.540   58.018 -4.056  1.00 63.40  ? 672  GLU A CA    1 
ATOM   6146 C  C     . GLU C 3 672 ? 6.769   59.309 -3.848  1.00 62.82  ? 672  GLU A C     1 
ATOM   6147 O  O     . GLU C 3 672 ? 7.351   60.361 -3.590  1.00 62.85  ? 672  GLU A O     1 
ATOM   6148 C  CB    . GLU C 3 672 ? 7.353   57.500 -5.485  1.00 63.95  ? 672  GLU A CB    1 
ATOM   6149 C  CG    . GLU C 3 672 ? 8.431   56.511 -5.946  1.00 66.48  ? 672  GLU A CG    1 
ATOM   6150 C  CD    . GLU C 3 672 ? 9.646   57.197 -6.580  1.00 69.92  ? 672  GLU A CD    1 
ATOM   6151 O  OE1   . GLU C 3 672 ? 10.331  58.013 -5.907  1.00 69.93  ? 672  GLU A OE1   1 
ATOM   6152 O  OE2   . GLU C 3 672 ? 9.918   56.904 -7.767  1.00 71.49  ? 672  GLU A OE2   1 
ATOM   6153 N  N     . TYR C 3 673 ? 5.449   59.204 -3.930  1.00 62.31  ? 673  TYR A N     1 
ATOM   6154 C  CA    . TYR C 3 673 ? 4.548   60.329 -3.734  1.00 61.80  ? 673  TYR A CA    1 
ATOM   6155 C  C     . TYR C 3 673 ? 4.920   61.170 -2.515  1.00 61.50  ? 673  TYR A C     1 
ATOM   6156 O  O     . TYR C 3 673 ? 4.764   62.393 -2.536  1.00 61.43  ? 673  TYR A O     1 
ATOM   6157 C  CB    . TYR C 3 673 ? 3.123   59.803 -3.624  1.00 61.72  ? 673  TYR A CB    1 
ATOM   6158 C  CG    . TYR C 3 673 ? 2.033   60.836 -3.483  1.00 61.81  ? 673  TYR A CG    1 
ATOM   6159 C  CD1   . TYR C 3 673 ? 2.103   62.070 -4.137  1.00 61.63  ? 673  TYR A CD1   1 
ATOM   6160 C  CD2   . TYR C 3 673 ? 0.895   60.557 -2.717  1.00 61.89  ? 673  TYR A CD2   1 
ATOM   6161 C  CE1   . TYR C 3 673 ? 1.075   63.008 -4.008  1.00 61.55  ? 673  TYR A CE1   1 
ATOM   6162 C  CE2   . TYR C 3 673 ? -0.134  61.478 -2.588  1.00 61.80  ? 673  TYR A CE2   1 
ATOM   6163 C  CZ    . TYR C 3 673 ? -0.039  62.696 -3.238  1.00 62.04  ? 673  TYR A CZ    1 
ATOM   6164 O  OH    . TYR C 3 673 ? -1.060  63.599 -3.104  1.00 62.80  ? 673  TYR A OH    1 
ATOM   6165 N  N     . MET C 3 674 ? 5.436   60.511 -1.475  1.00 61.12  ? 674  MET A N     1 
ATOM   6166 C  CA    . MET C 3 674 ? 5.846   61.192 -0.241  1.00 60.57  ? 674  MET A CA    1 
ATOM   6167 C  C     . MET C 3 674 ? 7.344   61.451 -0.138  1.00 59.99  ? 674  MET A C     1 
ATOM   6168 O  O     . MET C 3 674 ? 7.793   62.043 0.847   1.00 59.93  ? 674  MET A O     1 
ATOM   6169 C  CB    . MET C 3 674 ? 5.372   60.419 0.992   1.00 60.95  ? 674  MET A CB    1 
ATOM   6170 C  CG    . MET C 3 674 ? 3.907   60.661 1.364   1.00 61.57  ? 674  MET A CG    1 
ATOM   6171 S  SD    . MET C 3 674 ? 3.600   62.372 1.842   1.00 63.13  ? 674  MET A SD    1 
ATOM   6172 C  CE    . MET C 3 674 ? 1.912   62.579 1.287   1.00 62.09  ? 674  MET A CE    1 
ATOM   6173 N  N     . ASN C 3 675 ? 8.103   61.002 -1.142  1.00 59.09  ? 675  ASN A N     1 
ATOM   6174 C  CA    . ASN C 3 675 ? 9.549   61.230 -1.219  1.00 58.41  ? 675  ASN A CA    1 
ATOM   6175 C  C     . ASN C 3 675 ? 10.309  60.763 0.028   1.00 58.25  ? 675  ASN A C     1 
ATOM   6176 O  O     . ASN C 3 675 ? 11.161  61.489 0.561   1.00 58.02  ? 675  ASN A O     1 
ATOM   6177 C  CB    . ASN C 3 675 ? 9.840   62.716 -1.494  1.00 58.48  ? 675  ASN A CB    1 
ATOM   6178 C  CG    . ASN C 3 675 ? 11.216  62.951 -2.127  1.00 57.48  ? 675  ASN A CG    1 
ATOM   6179 O  OD1   . ASN C 3 675 ? 11.583  62.306 -3.113  1.00 55.03  ? 675  ASN A OD1   1 
ATOM   6180 N  ND2   . ASN C 3 675 ? 11.970  63.892 -1.564  1.00 56.55  ? 675  ASN A ND2   1 
ATOM   6181 N  N     . ASN C 3 676 ? 9.997   59.555 0.495   1.00 57.85  ? 676  ASN A N     1 
ATOM   6182 C  CA    . ASN C 3 676 ? 10.579  59.055 1.739   1.00 57.34  ? 676  ASN A CA    1 
ATOM   6183 C  C     . ASN C 3 676 ? 11.954  58.470 1.526   1.00 57.33  ? 676  ASN A C     1 
ATOM   6184 O  O     . ASN C 3 676 ? 12.229  57.908 0.470   1.00 57.67  ? 676  ASN A O     1 
ATOM   6185 C  CB    . ASN C 3 676 ? 9.678   58.001 2.374   1.00 57.22  ? 676  ASN A CB    1 
ATOM   6186 C  CG    . ASN C 3 676 ? 8.341   58.562 2.822   1.00 56.07  ? 676  ASN A CG    1 
ATOM   6187 O  OD1   . ASN C 3 676 ? 7.289   58.014 2.486   1.00 54.09  ? 676  ASN A OD1   1 
ATOM   6188 N  ND2   . ASN C 3 676 ? 8.371   59.655 3.574   1.00 54.52  ? 676  ASN A ND2   1 
ATOM   6189 N  N     . LYS C 3 677 ? 12.809  58.606 2.537   1.00 57.13  ? 677  LYS A N     1 
ATOM   6190 C  CA    . LYS C 3 677 ? 14.139  58.008 2.542   1.00 56.55  ? 677  LYS A CA    1 
ATOM   6191 C  C     . LYS C 3 677 ? 14.110  56.585 2.004   1.00 56.52  ? 677  LYS A C     1 
ATOM   6192 O  O     . LYS C 3 677 ? 14.763  56.307 1.010   1.00 57.15  ? 677  LYS A O     1 
ATOM   6193 C  CB    . LYS C 3 677 ? 14.738  58.036 3.947   1.00 56.40  ? 677  LYS A CB    1 
ATOM   6194 C  CG    . LYS C 3 677 ? 16.197  57.623 4.028   1.00 56.37  ? 677  LYS A CG    1 
ATOM   6195 C  CD    . LYS C 3 677 ? 16.802  58.085 5.344   1.00 56.59  ? 677  LYS A CD    1 
ATOM   6196 C  CE    . LYS C 3 677 ? 18.313  57.923 5.372   1.00 57.62  ? 677  LYS A CE    1 
ATOM   6197 N  NZ    . LYS C 3 677 ? 18.720  56.499 5.569   1.00 59.22  ? 677  LYS A NZ    1 
ATOM   6198 N  N     . GLN C 3 678 ? 13.335  55.700 2.625   1.00 56.24  ? 678  GLN A N     1 
ATOM   6199 C  CA    . GLN C 3 678 ? 13.323  54.283 2.238   1.00 56.25  ? 678  GLN A CA    1 
ATOM   6200 C  C     . GLN C 3 678 ? 11.922  53.686 2.267   1.00 56.32  ? 678  GLN A C     1 
ATOM   6201 O  O     . GLN C 3 678 ? 11.112  54.045 3.131   1.00 56.47  ? 678  GLN A O     1 
ATOM   6202 C  CB    . GLN C 3 678 ? 14.233  53.494 3.169   1.00 55.83  ? 678  GLN A CB    1 
ATOM   6203 C  CG    . GLN C 3 678 ? 14.398  52.030 2.848   1.00 55.96  ? 678  GLN A CG    1 
ATOM   6204 C  CD    . GLN C 3 678 ? 15.277  51.329 3.879   1.00 57.07  ? 678  GLN A CD    1 
ATOM   6205 O  OE1   . GLN C 3 678 ? 15.878  51.981 4.729   1.00 58.41  ? 678  GLN A OE1   1 
ATOM   6206 N  NE2   . GLN C 3 678 ? 15.349  49.999 3.815   1.00 57.21  ? 678  GLN A NE2   1 
ATOM   6207 N  N     . HIS C 3 679 ? 11.637  52.786 1.324   1.00 56.23  ? 679  HIS A N     1 
ATOM   6208 C  CA    . HIS C 3 679 ? 10.395  52.008 1.380   1.00 56.11  ? 679  HIS A CA    1 
ATOM   6209 C  C     . HIS C 3 679 ? 10.463  50.855 2.396   1.00 56.12  ? 679  HIS A C     1 
ATOM   6210 O  O     . HIS C 3 679 ? 11.271  49.933 2.252   1.00 56.11  ? 679  HIS A O     1 
ATOM   6211 C  CB    . HIS C 3 679 ? 9.980   51.475 0.011   1.00 55.77  ? 679  HIS A CB    1 
ATOM   6212 C  CG    . HIS C 3 679 ? 8.786   50.576 0.070   1.00 55.46  ? 679  HIS A CG    1 
ATOM   6213 N  ND1   . HIS C 3 679 ? 8.878   49.205 -0.051  1.00 54.82  ? 679  HIS A ND1   1 
ATOM   6214 C  CD2   . HIS C 3 679 ? 7.478   50.847 0.293   1.00 54.58  ? 679  HIS A CD2   1 
ATOM   6215 C  CE1   . HIS C 3 679 ? 7.673   48.675 0.063   1.00 53.97  ? 679  HIS A CE1   1 
ATOM   6216 N  NE2   . HIS C 3 679 ? 6.806   49.650 0.276   1.00 53.67  ? 679  HIS A NE2   1 
ATOM   6217 N  N     . LEU C 3 680 ? 9.589   50.917 3.402   1.00 56.04  ? 680  LEU A N     1 
ATOM   6218 C  CA    . LEU C 3 680 ? 9.568   49.962 4.511   1.00 56.03  ? 680  LEU A CA    1 
ATOM   6219 C  C     . LEU C 3 680 ? 8.161   49.524 4.905   1.00 56.28  ? 680  LEU A C     1 
ATOM   6220 O  O     . LEU C 3 680 ? 7.992   48.868 5.934   1.00 56.52  ? 680  LEU A O     1 
ATOM   6221 C  CB    . LEU C 3 680 ? 10.229  50.578 5.740   1.00 55.83  ? 680  LEU A CB    1 
ATOM   6222 C  CG    . LEU C 3 680 ? 11.711  50.912 5.633   1.00 55.83  ? 680  LEU A CG    1 
ATOM   6223 C  CD1   . LEU C 3 680 ? 12.102  51.900 6.700   1.00 54.73  ? 680  LEU A CD1   1 
ATOM   6224 C  CD2   . LEU C 3 680 ? 12.536  49.639 5.743   1.00 56.82  ? 680  LEU A CD2   1 
ATOM   6225 N  N     . MET C 3 681 ? 7.158   49.889 4.105   1.00 56.24  ? 681  MET A N     1 
ATOM   6226 C  CA    . MET C 3 681 ? 5.771   49.519 4.380   1.00 56.02  ? 681  MET A CA    1 
ATOM   6227 C  C     . MET C 3 681 ? 5.453   48.110 3.890   1.00 56.43  ? 681  MET A C     1 
ATOM   6228 O  O     . MET C 3 681 ? 5.246   47.905 2.695   1.00 56.22  ? 681  MET A O     1 
ATOM   6229 C  CB    . MET C 3 681 ? 4.819   50.509 3.728   1.00 55.60  ? 681  MET A CB    1 
ATOM   6230 C  CG    . MET C 3 681 ? 4.915   51.917 4.253   1.00 55.92  ? 681  MET A CG    1 
ATOM   6231 S  SD    . MET C 3 681 ? 4.385   52.093 5.969   1.00 56.11  ? 681  MET A SD    1 
ATOM   6232 C  CE    . MET C 3 681 ? 5.962   52.230 6.814   1.00 54.27  ? 681  MET A CE    1 
ATOM   6233 N  N     . PHE C 3 682 ? 5.406   47.153 4.823   1.00 56.95  ? 682  PHE A N     1 
ATOM   6234 C  CA    . PHE C 3 682 ? 5.136   45.749 4.509   1.00 57.58  ? 682  PHE A CA    1 
ATOM   6235 C  C     . PHE C 3 682 ? 3.884   45.227 5.216   1.00 58.28  ? 682  PHE A C     1 
ATOM   6236 O  O     . PHE C 3 682 ? 3.824   45.227 6.450   1.00 58.49  ? 682  PHE A O     1 
ATOM   6237 C  CB    . PHE C 3 682 ? 6.311   44.841 4.913   1.00 57.43  ? 682  PHE A CB    1 
ATOM   6238 C  CG    . PHE C 3 682 ? 7.674   45.354 4.524   1.00 57.45  ? 682  PHE A CG    1 
ATOM   6239 C  CD1   . PHE C 3 682 ? 7.918   45.877 3.261   1.00 57.14  ? 682  PHE A CD1   1 
ATOM   6240 C  CD2   . PHE C 3 682 ? 8.733   45.259 5.421   1.00 57.43  ? 682  PHE A CD2   1 
ATOM   6241 C  CE1   . PHE C 3 682 ? 9.184   46.333 2.913   1.00 57.52  ? 682  PHE A CE1   1 
ATOM   6242 C  CE2   . PHE C 3 682 ? 10.001  45.701 5.080   1.00 57.05  ? 682  PHE A CE2   1 
ATOM   6243 C  CZ    . PHE C 3 682 ? 10.228  46.241 3.820   1.00 57.37  ? 682  PHE A CZ    1 
ATOM   6244 N  N     . MET C 3 683 ? 2.904   44.754 4.444   1.00 58.68  ? 683  MET A N     1 
ATOM   6245 C  CA    . MET C 3 683 ? 1.745   44.076 5.017   1.00 59.11  ? 683  MET A CA    1 
ATOM   6246 C  C     . MET C 3 683 ? 1.879   42.567 4.880   1.00 59.23  ? 683  MET A C     1 
ATOM   6247 O  O     . MET C 3 683 ? 1.688   42.024 3.791   1.00 59.83  ? 683  MET A O     1 
ATOM   6248 C  CB    . MET C 3 683 ? 0.462   44.476 4.294   1.00 59.14  ? 683  MET A CB    1 
ATOM   6249 C  CG    . MET C 3 683 ? -0.025  45.874 4.512   1.00 59.44  ? 683  MET A CG    1 
ATOM   6250 S  SD    . MET C 3 683 ? -1.822  45.892 4.343   1.00 60.65  ? 683  MET A SD    1 
ATOM   6251 C  CE    . MET C 3 683 ? -2.339  45.940 6.066   1.00 61.06  ? 683  MET A CE    1 
ATOM   6252 N  N     . ASP C 3 684 ? 2.163   41.865 5.964   1.00 59.12  ? 684  ASP A N     1 
ATOM   6253 C  CA    . ASP C 3 684 ? 2.164   40.410 5.881   1.00 59.12  ? 684  ASP A CA    1 
ATOM   6254 C  C     . ASP C 3 684 ? 0.745   39.845 6.004   1.00 58.71  ? 684  ASP A C     1 
ATOM   6255 O  O     . ASP C 3 684 ? -0.069  40.346 6.794   1.00 58.68  ? 684  ASP A O     1 
ATOM   6256 C  CB    . ASP C 3 684 ? 3.140   39.798 6.896   1.00 59.38  ? 684  ASP A CB    1 
ATOM   6257 C  CG    . ASP C 3 684 ? 4.599   40.245 6.652   1.00 61.62  ? 684  ASP A CG    1 
ATOM   6258 O  OD1   . ASP C 3 684 ? 5.045   40.327 5.474   1.00 62.40  ? 684  ASP A OD1   1 
ATOM   6259 O  OD2   . ASP C 3 684 ? 5.304   40.536 7.648   1.00 64.12  ? 684  ASP A OD2   1 
ATOM   6260 N  N     . ARG C 3 685 ? 0.440   38.836 5.186   1.00 58.19  ? 685  ARG A N     1 
ATOM   6261 C  CA    . ARG C 3 685 ? -0.817  38.098 5.313   1.00 57.92  ? 685  ARG A CA    1 
ATOM   6262 C  C     . ARG C 3 685 ? -0.898  37.504 6.714   1.00 58.01  ? 685  ARG A C     1 
ATOM   6263 O  O     . ARG C 3 685 ? 0.049   36.867 7.199   1.00 58.36  ? 685  ARG A O     1 
ATOM   6264 C  CB    . ARG C 3 685 ? -0.925  36.990 4.266   1.00 57.60  ? 685  ARG A CB    1 
ATOM   6265 C  CG    . ARG C 3 685 ? -2.283  36.307 4.204   1.00 57.24  ? 685  ARG A CG    1 
ATOM   6266 C  CD    . ARG C 3 685 ? -2.508  35.285 5.338   1.00 56.80  ? 685  ARG A CD    1 
ATOM   6267 N  NE    . ARG C 3 685 ? -1.881  33.992 5.073   1.00 55.89  ? 685  ARG A NE    1 
ATOM   6268 C  CZ    . ARG C 3 685 ? -1.809  32.985 5.945   1.00 55.80  ? 685  ARG A CZ    1 
ATOM   6269 N  NH1   . ARG C 3 685 ? -2.327  33.095 7.164   1.00 54.53  ? 685  ARG A NH1   1 
ATOM   6270 N  NH2   . ARG C 3 685 ? -1.215  31.852 5.588   1.00 55.39  ? 685  ARG A NH2   1 
ATOM   6271 N  N     . GLU C 3 686 ? -2.025  37.713 7.370   1.00 57.68  ? 686  GLU A N     1 
ATOM   6272 C  CA    . GLU C 3 686 ? -2.120  37.318 8.741   1.00 57.81  ? 686  GLU A CA    1 
ATOM   6273 C  C     . GLU C 3 686 ? -3.032  36.138 8.888   1.00 57.27  ? 686  GLU A C     1 
ATOM   6274 O  O     . GLU C 3 686 ? -2.572  35.022 9.120   1.00 57.03  ? 686  GLU A O     1 
ATOM   6275 C  CB    . GLU C 3 686 ? -2.615  38.486 9.589   1.00 58.40  ? 686  GLU A CB    1 
ATOM   6276 C  CG    . GLU C 3 686 ? -1.932  38.578 10.930  1.00 61.00  ? 686  GLU A CG    1 
ATOM   6277 C  CD    . GLU C 3 686 ? -0.536  39.194 10.850  1.00 65.84  ? 686  GLU A CD    1 
ATOM   6278 O  OE1   . GLU C 3 686 ? 0.076   39.194 9.755   1.00 66.80  ? 686  GLU A OE1   1 
ATOM   6279 O  OE2   . GLU C 3 686 ? -0.037  39.681 11.895  1.00 69.04  ? 686  GLU A OE2   1 
ATOM   6280 N  N     . ALA C 3 687 ? -4.327  36.397 8.727   1.00 56.85  ? 687  ALA A N     1 
ATOM   6281 C  CA    . ALA C 3 687 ? -5.374  35.420 9.015   1.00 56.41  ? 687  ALA A CA    1 
ATOM   6282 C  C     . ALA C 3 687 ? -6.090  34.920 7.772   1.00 55.58  ? 687  ALA A C     1 
ATOM   6283 O  O     . ALA C 3 687 ? -6.328  35.686 6.844   1.00 55.34  ? 687  ALA A O     1 
ATOM   6284 C  CB    . ALA C 3 687 ? -6.389  36.007 9.989   1.00 56.49  ? 687  ALA A CB    1 
ATOM   6285 N  N     . ILE C 3 688 ? -6.422  33.626 7.780   1.00 54.94  ? 688  ILE A N     1 
ATOM   6286 C  CA    . ILE C 3 688 ? -7.318  33.030 6.792   1.00 54.23  ? 688  ILE A CA    1 
ATOM   6287 C  C     . ILE C 3 688 ? -8.472  32.342 7.516   1.00 54.28  ? 688  ILE A C     1 
ATOM   6288 O  O     . ILE C 3 688 ? -8.290  31.306 8.147   1.00 54.11  ? 688  ILE A O     1 
ATOM   6289 C  CB    . ILE C 3 688 ? -6.608  32.023 5.871   1.00 53.96  ? 688  ILE A CB    1 
ATOM   6290 C  CG1   . ILE C 3 688 ? -5.256  32.557 5.409   1.00 52.97  ? 688  ILE A CG1   1 
ATOM   6291 C  CG2   . ILE C 3 688 ? -7.503  31.686 4.684   1.00 53.60  ? 688  ILE A CG2   1 
ATOM   6292 C  CD1   . ILE C 3 688 ? -4.461  31.579 4.595   1.00 52.76  ? 688  ILE A CD1   1 
ATOM   6293 N  N     . ALA C 3 689 ? -9.661  32.925 7.398   1.00 54.56  ? 689  ALA A N     1 
ATOM   6294 C  CA    . ALA C 3 689 ? -10.808 32.531 8.209   1.00 54.96  ? 689  ALA A CA    1 
ATOM   6295 C  C     . ALA C 3 689 ? -12.080 32.259 7.411   1.00 55.35  ? 689  ALA A C     1 
ATOM   6296 O  O     . ALA C 3 689 ? -12.397 32.950 6.439   1.00 55.19  ? 689  ALA A O     1 
ATOM   6297 C  CB    . ALA C 3 689 ? -11.078 33.584 9.272   1.00 54.96  ? 689  ALA A CB    1 
ATOM   6298 N  N     . GLY C 3 690 ? -12.817 31.253 7.860   1.00 55.83  ? 690  GLY A N     1 
ATOM   6299 C  CA    . GLY C 3 690 ? -14.083 30.887 7.250   1.00 56.72  ? 690  GLY A CA    1 
ATOM   6300 C  C     . GLY C 3 690 ? -14.701 29.703 7.969   1.00 57.40  ? 690  GLY A C     1 
ATOM   6301 O  O     . GLY C 3 690 ? -14.169 29.247 8.995   1.00 57.24  ? 690  GLY A O     1 
ATOM   6302 N  N     . PRO C 3 691 ? -15.829 29.192 7.443   1.00 57.83  ? 691  PRO A N     1 
ATOM   6303 C  CA    . PRO C 3 691 ? -16.464 28.025 8.048   1.00 58.23  ? 691  PRO A CA    1 
ATOM   6304 C  C     . PRO C 3 691 ? -15.827 26.731 7.518   1.00 58.63  ? 691  PRO A C     1 
ATOM   6305 O  O     . PRO C 3 691 ? -15.171 26.778 6.478   1.00 58.64  ? 691  PRO A O     1 
ATOM   6306 C  CB    . PRO C 3 691 ? -17.932 28.148 7.593   1.00 58.16  ? 691  PRO A CB    1 
ATOM   6307 C  CG    . PRO C 3 691 ? -17.983 29.328 6.630   1.00 58.04  ? 691  PRO A CG    1 
ATOM   6308 C  CD    . PRO C 3 691 ? -16.573 29.660 6.263   1.00 57.70  ? 691  PRO A CD    1 
ATOM   6309 N  N     . PRO C 3 692 ? -16.003 25.588 8.230   1.00 59.18  ? 692  PRO A N     1 
ATOM   6310 C  CA    . PRO C 3 692 ? -15.551 24.313 7.645   1.00 59.57  ? 692  PRO A CA    1 
ATOM   6311 C  C     . PRO C 3 692 ? -16.477 23.903 6.492   1.00 60.00  ? 692  PRO A C     1 
ATOM   6312 O  O     . PRO C 3 692 ? -17.663 24.248 6.515   1.00 59.81  ? 692  PRO A O     1 
ATOM   6313 C  CB    . PRO C 3 692 ? -15.662 23.312 8.807   1.00 59.53  ? 692  PRO A CB    1 
ATOM   6314 C  CG    . PRO C 3 692 ? -16.067 24.112 10.028  1.00 59.09  ? 692  PRO A CG    1 
ATOM   6315 C  CD    . PRO C 3 692 ? -16.632 25.400 9.555   1.00 58.99  ? 692  PRO A CD    1 
ATOM   6316 N  N     . LEU C 3 693 ? -15.939 23.175 5.510   1.00 60.66  ? 693  LEU A N     1 
ATOM   6317 C  CA    . LEU C 3 693 ? -16.669 22.826 4.271   1.00 61.46  ? 693  LEU A CA    1 
ATOM   6318 C  C     . LEU C 3 693 ? -18.103 22.266 4.407   1.00 62.08  ? 693  LEU A C     1 
ATOM   6319 O  O     . LEU C 3 693 ? -18.371 21.350 5.207   1.00 61.95  ? 693  LEU A O     1 
ATOM   6320 C  CB    . LEU C 3 693 ? -15.822 21.923 3.366   1.00 61.27  ? 693  LEU A CB    1 
ATOM   6321 C  CG    . LEU C 3 693 ? -15.210 22.604 2.131   1.00 61.27  ? 693  LEU A CG    1 
ATOM   6322 C  CD1   . LEU C 3 693 ? -14.787 21.551 1.113   1.00 61.31  ? 693  LEU A CD1   1 
ATOM   6323 C  CD2   . LEU C 3 693 ? -16.166 23.598 1.474   1.00 59.52  ? 693  LEU A CD2   1 
ATOM   6324 N  N     . GLY C 3 694 ? -19.019 22.820 3.612   1.00 62.51  ? 694  GLY A N     1 
ATOM   6325 C  CA    . GLY C 3 694 ? -20.423 22.398 3.664   1.00 63.43  ? 694  GLY A CA    1 
ATOM   6326 C  C     . GLY C 3 694 ? -20.931 22.204 5.090   1.00 63.90  ? 694  GLY A C     1 
ATOM   6327 O  O     . GLY C 3 694 ? -21.441 21.137 5.445   1.00 64.13  ? 694  GLY A O     1 
ATOM   6328 N  N     . SER C 3 695 ? -20.751 23.233 5.916   1.00 63.99  ? 695  SER A N     1 
ATOM   6329 C  CA    . SER C 3 695 ? -21.325 23.274 7.256   1.00 63.60  ? 695  SER A CA    1 
ATOM   6330 C  C     . SER C 3 695 ? -22.183 24.524 7.321   1.00 63.22  ? 695  SER A C     1 
ATOM   6331 O  O     . SER C 3 695 ? -22.000 25.448 6.528   1.00 63.07  ? 695  SER A O     1 
ATOM   6332 C  CB    . SER C 3 695 ? -20.230 23.313 8.329   1.00 63.60  ? 695  SER A CB    1 
ATOM   6333 O  OG    . SER C 3 695 ? -19.585 24.579 8.365   1.00 63.53  ? 695  SER A OG    1 
ATOM   6334 N  N     . LYS C 3 696 ? -23.112 24.554 8.267   1.00 63.02  ? 696  LYS A N     1 
ATOM   6335 C  CA    . LYS C 3 696 ? -24.014 25.695 8.401   1.00 63.05  ? 696  LYS A CA    1 
ATOM   6336 C  C     . LYS C 3 696 ? -23.408 26.803 9.288   1.00 62.75  ? 696  LYS A C     1 
ATOM   6337 O  O     . LYS C 3 696 ? -24.131 27.581 9.909   1.00 62.71  ? 696  LYS A O     1 
ATOM   6338 C  CB    . LYS C 3 696 ? -25.396 25.237 8.895   1.00 62.87  ? 696  LYS A CB    1 
ATOM   6339 N  N     . GLY C 3 697 ? -22.076 26.865 9.315   1.00 62.51  ? 697  GLY A N     1 
ATOM   6340 C  CA    . GLY C 3 697 ? -21.337 27.828 10.135  1.00 61.93  ? 697  GLY A CA    1 
ATOM   6341 C  C     . GLY C 3 697 ? -21.133 29.156 9.434   1.00 61.44  ? 697  GLY A C     1 
ATOM   6342 O  O     . GLY C 3 697 ? -20.996 29.208 8.206   1.00 61.46  ? 697  GLY A O     1 
ATOM   6343 N  N     . ILE C 3 698 ? -21.099 30.229 10.224  1.00 60.92  ? 698  ILE A N     1 
ATOM   6344 C  CA    . ILE C 3 698 ? -21.065 31.604 9.685   1.00 60.23  ? 698  ILE A CA    1 
ATOM   6345 C  C     . ILE C 3 698 ? -19.668 32.203 9.418   1.00 59.80  ? 698  ILE A C     1 
ATOM   6346 O  O     . ILE C 3 698 ? -19.568 33.285 8.838   1.00 59.82  ? 698  ILE A O     1 
ATOM   6347 C  CB    . ILE C 3 698 ? -21.910 32.578 10.543  1.00 60.13  ? 698  ILE A CB    1 
ATOM   6348 C  CG1   . ILE C 3 698 ? -21.273 32.789 11.918  1.00 60.29  ? 698  ILE A CG1   1 
ATOM   6349 C  CG2   . ILE C 3 698 ? -23.333 32.060 10.674  1.00 59.84  ? 698  ILE A CG2   1 
ATOM   6350 C  CD1   . ILE C 3 698 ? -21.883 33.918 12.730  1.00 59.91  ? 698  ILE A CD1   1 
ATOM   6351 N  N     . GLY C 3 699 ? -18.607 31.508 9.833   1.00 59.02  ? 699  GLY A N     1 
ATOM   6352 C  CA    . GLY C 3 699 ? -17.243 31.963 9.571   1.00 58.33  ? 699  GLY A CA    1 
ATOM   6353 C  C     . GLY C 3 699 ? -16.771 33.062 10.518  1.00 57.89  ? 699  GLY A C     1 
ATOM   6354 O  O     . GLY C 3 699 ? -15.991 32.804 11.439  1.00 57.79  ? 699  GLY A O     1 
ATOM   6355 N  N     . GLY C 3 700 ? -17.236 34.289 10.282  1.00 57.14  ? 700  GLY A N     1 
ATOM   6356 C  CA    . GLY C 3 700 ? -16.944 35.421 11.158  1.00 56.03  ? 700  GLY A CA    1 
ATOM   6357 C  C     . GLY C 3 700 ? -18.111 36.371 11.345  1.00 55.19  ? 700  GLY A C     1 
ATOM   6358 O  O     . GLY C 3 700 ? -19.173 36.179 10.766  1.00 55.15  ? 700  GLY A O     1 
ATOM   6359 N  N     . PHE C 3 701 ? -17.907 37.384 12.183  1.00 54.60  ? 701  PHE A N     1 
ATOM   6360 C  CA    . PHE C 3 701 ? -18.881 38.459 12.388  1.00 54.06  ? 701  PHE A CA    1 
ATOM   6361 C  C     . PHE C 3 701 ? -18.260 39.672 13.079  1.00 53.78  ? 701  PHE A C     1 
ATOM   6362 O  O     . PHE C 3 701 ? -17.414 39.520 13.951  1.00 54.22  ? 701  PHE A O     1 
ATOM   6363 C  CB    . PHE C 3 701 ? -20.135 37.969 13.143  1.00 53.85  ? 701  PHE A CB    1 
ATOM   6364 C  CG    . PHE C 3 701 ? -19.939 37.727 14.627  1.00 53.19  ? 701  PHE A CG    1 
ATOM   6365 C  CD1   . PHE C 3 701 ? -20.097 38.765 15.552  1.00 52.46  ? 701  PHE A CD1   1 
ATOM   6366 C  CD2   . PHE C 3 701 ? -19.661 36.448 15.104  1.00 53.57  ? 701  PHE A CD2   1 
ATOM   6367 C  CE1   . PHE C 3 701 ? -19.946 38.550 16.933  1.00 51.13  ? 701  PHE A CE1   1 
ATOM   6368 C  CE2   . PHE C 3 701 ? -19.501 36.214 16.486  1.00 53.43  ? 701  PHE A CE2   1 
ATOM   6369 C  CZ    . PHE C 3 701 ? -19.651 37.277 17.402  1.00 52.82  ? 701  PHE A CZ    1 
ATOM   6370 N  N     . TRP C 3 702 ? -18.664 40.867 12.659  1.00 53.23  ? 702  TRP A N     1 
ATOM   6371 C  CA    . TRP C 3 702 ? -18.340 42.107 13.365  1.00 52.56  ? 702  TRP A CA    1 
ATOM   6372 C  C     . TRP C 3 702 ? -19.567 42.669 14.058  1.00 52.11  ? 702  TRP A C     1 
ATOM   6373 O  O     . TRP C 3 702 ? -20.682 42.623 13.503  1.00 51.40  ? 702  TRP A O     1 
ATOM   6374 C  CB    . TRP C 3 702 ? -17.839 43.160 12.391  1.00 52.46  ? 702  TRP A CB    1 
ATOM   6375 C  CG    . TRP C 3 702 ? -16.395 43.190 12.284  1.00 52.86  ? 702  TRP A CG    1 
ATOM   6376 C  CD1   . TRP C 3 702 ? -15.556 44.148 12.779  1.00 53.39  ? 702  TRP A CD1   1 
ATOM   6377 C  CD2   . TRP C 3 702 ? -15.566 42.216 11.646  1.00 53.80  ? 702  TRP A CD2   1 
ATOM   6378 N  NE1   . TRP C 3 702 ? -14.248 43.834 12.486  1.00 53.45  ? 702  TRP A NE1   1 
ATOM   6379 C  CE2   . TRP C 3 702 ? -14.224 42.655 11.784  1.00 54.02  ? 702  TRP A CE2   1 
ATOM   6380 C  CE3   . TRP C 3 702 ? -15.822 41.012 10.973  1.00 53.29  ? 702  TRP A CE3   1 
ATOM   6381 C  CZ2   . TRP C 3 702 ? -13.143 41.931 11.275  1.00 53.47  ? 702  TRP A CZ2   1 
ATOM   6382 C  CZ3   . TRP C 3 702 ? -14.747 40.295 10.461  1.00 53.31  ? 702  TRP A CZ3   1 
ATOM   6383 C  CH2   . TRP C 3 702 ? -13.422 40.754 10.621  1.00 53.76  ? 702  TRP A CH2   1 
ATOM   6384 N  N     . THR C 3 703 ? -19.364 43.212 15.257  1.00 51.59  ? 703  THR A N     1 
ATOM   6385 C  CA    . THR C 3 703 ? -20.447 43.935 15.947  1.00 51.51  ? 703  THR A CA    1 
ATOM   6386 C  C     . THR C 3 703 ? -20.313 45.462 15.837  1.00 50.69  ? 703  THR A C     1 
ATOM   6387 O  O     . THR C 3 703 ? -21.292 46.158 15.626  1.00 50.58  ? 703  THR A O     1 
ATOM   6388 C  CB    . THR C 3 703 ? -20.682 43.462 17.424  1.00 51.62  ? 703  THR A CB    1 
ATOM   6389 O  OG1   . THR C 3 703 ? -19.765 44.111 18.314  1.00 52.82  ? 703  THR A OG1   1 
ATOM   6390 C  CG2   . THR C 3 703 ? -20.561 41.944 17.546  1.00 50.98  ? 703  THR A CG2   1 
ATOM   6391 N  N     . GLY C 3 704 ? -19.090 45.957 15.972  1.00 50.33  ? 704  GLY A N     1 
ATOM   6392 C  CA    . GLY C 3 704 ? -18.737 47.350 15.669  1.00 49.19  ? 704  GLY A CA    1 
ATOM   6393 C  C     . GLY C 3 704 ? -17.221 47.424 15.624  1.00 48.62  ? 704  GLY A C     1 
ATOM   6394 O  O     . GLY C 3 704 ? -16.543 46.379 15.525  1.00 48.04  ? 704  GLY A O     1 
ATOM   6395 N  N     . LYS C 3 705 ? -16.689 48.648 15.700  1.00 48.23  ? 705  LYS A N     1 
ATOM   6396 C  CA    . LYS C 3 705 ? -15.250 48.886 15.944  1.00 47.72  ? 705  LYS A CA    1 
ATOM   6397 C  C     . LYS C 3 705 ? -14.720 48.054 17.120  1.00 48.17  ? 705  LYS A C     1 
ATOM   6398 O  O     . LYS C 3 705 ? -15.372 47.945 18.156  1.00 48.16  ? 705  LYS A O     1 
ATOM   6399 C  CB    . LYS C 3 705 ? -14.988 50.369 16.224  1.00 47.03  ? 705  LYS A CB    1 
ATOM   6400 C  CG    . LYS C 3 705 ? -15.061 51.258 15.019  1.00 44.37  ? 705  LYS A CG    1 
ATOM   6401 C  CD    . LYS C 3 705 ? -15.024 52.727 15.404  1.00 40.45  ? 705  LYS A CD    1 
ATOM   6402 C  CE    . LYS C 3 705 ? -14.814 53.599 14.157  1.00 38.36  ? 705  LYS A CE    1 
ATOM   6403 N  NZ    . LYS C 3 705 ? -14.807 55.071 14.421  1.00 33.62  ? 705  LYS A NZ    1 
ATOM   6404 N  N     . LYS C 3 706 ? -13.546 47.452 16.941  1.00 49.13  ? 706  LYS A N     1 
ATOM   6405 C  CA    . LYS C 3 706 ? -12.825 46.750 18.031  1.00 50.00  ? 706  LYS A CA    1 
ATOM   6406 C  C     . LYS C 3 706 ? -13.568 45.522 18.596  1.00 50.57  ? 706  LYS A C     1 
ATOM   6407 O  O     . LYS C 3 706 ? -13.237 45.027 19.683  1.00 50.85  ? 706  LYS A O     1 
ATOM   6408 C  CB    . LYS C 3 706 ? -12.497 47.716 19.191  1.00 49.79  ? 706  LYS A CB    1 
ATOM   6409 C  CG    . LYS C 3 706 ? -11.886 49.053 18.801  1.00 49.18  ? 706  LYS A CG    1 
ATOM   6410 C  CD    . LYS C 3 706 ? -10.380 49.120 18.989  1.00 47.85  ? 706  LYS A CD    1 
ATOM   6411 C  CE    . LYS C 3 706 ? -9.902  50.548 18.799  1.00 47.55  ? 706  LYS A CE    1 
ATOM   6412 N  NZ    . LYS C 3 706 ? -8.580  50.619 18.128  1.00 46.94  ? 706  LYS A NZ    1 
ATOM   6413 N  N     . ARG C 3 707 ? -14.571 45.045 17.870  1.00 50.91  ? 707  ARG A N     1 
ATOM   6414 C  CA    . ARG C 3 707 ? -15.417 43.967 18.359  1.00 51.67  ? 707  ARG A CA    1 
ATOM   6415 C  C     . ARG C 3 707 ? -15.781 43.010 17.237  1.00 51.54  ? 707  ARG A C     1 
ATOM   6416 O  O     . ARG C 3 707 ? -16.685 43.284 16.451  1.00 52.05  ? 707  ARG A O     1 
ATOM   6417 C  CB    . ARG C 3 707 ? -16.697 44.532 18.979  1.00 51.37  ? 707  ARG A CB    1 
ATOM   6418 C  CG    . ARG C 3 707 ? -16.640 44.815 20.461  1.00 52.11  ? 707  ARG A CG    1 
ATOM   6419 C  CD    . ARG C 3 707 ? -18.007 45.321 20.946  1.00 54.50  ? 707  ARG A CD    1 
ATOM   6420 N  NE    . ARG C 3 707 ? -18.176 45.191 22.397  1.00 59.43  ? 707  ARG A NE    1 
ATOM   6421 C  CZ    . ARG C 3 707 ? -18.767 44.158 23.006  1.00 60.95  ? 707  ARG A CZ    1 
ATOM   6422 N  NH1   . ARG C 3 707 ? -19.271 43.139 22.311  1.00 60.87  ? 707  ARG A NH1   1 
ATOM   6423 N  NH2   . ARG C 3 707 ? -18.856 44.141 24.325  1.00 61.90  ? 707  ARG A NH2   1 
ATOM   6424 N  N     . TYR C 3 708 ? -15.079 41.887 17.167  1.00 51.44  ? 708  TYR A N     1 
ATOM   6425 C  CA    . TYR C 3 708 ? -15.336 40.897 16.135  1.00 51.44  ? 708  TYR A CA    1 
ATOM   6426 C  C     . TYR C 3 708 ? -14.783 39.540 16.538  1.00 51.60  ? 708  TYR A C     1 
ATOM   6427 O  O     . TYR C 3 708 ? -13.881 39.457 17.375  1.00 51.33  ? 708  TYR A O     1 
ATOM   6428 C  CB    . TYR C 3 708 ? -14.716 41.331 14.810  1.00 51.57  ? 708  TYR A CB    1 
ATOM   6429 C  CG    . TYR C 3 708 ? -13.203 41.496 14.840  1.00 52.08  ? 708  TYR A CG    1 
ATOM   6430 C  CD1   . TYR C 3 708 ? -12.615 42.688 15.279  1.00 52.62  ? 708  TYR A CD1   1 
ATOM   6431 C  CD2   . TYR C 3 708 ? -12.363 40.472 14.416  1.00 51.43  ? 708  TYR A CD2   1 
ATOM   6432 C  CE1   . TYR C 3 708 ? -11.228 42.849 15.302  1.00 52.34  ? 708  TYR A CE1   1 
ATOM   6433 C  CE2   . TYR C 3 708 ? -10.974 40.622 14.441  1.00 52.19  ? 708  TYR A CE2   1 
ATOM   6434 C  CZ    . TYR C 3 708 ? -10.416 41.812 14.884  1.00 52.42  ? 708  TYR A CZ    1 
ATOM   6435 O  OH    . TYR C 3 708 ? -9.048  41.962 14.920  1.00 52.29  ? 708  TYR A OH    1 
ATOM   6436 N  N     . ALA C 3 709 ? -15.336 38.485 15.940  1.00 51.85  ? 709  ALA A N     1 
ATOM   6437 C  CA    . ALA C 3 709 ? -14.803 37.127 16.068  1.00 52.02  ? 709  ALA A CA    1 
ATOM   6438 C  C     . ALA C 3 709 ? -14.696 36.466 14.704  1.00 52.27  ? 709  ALA A C     1 
ATOM   6439 O  O     . ALA C 3 709 ? -15.513 36.726 13.822  1.00 52.44  ? 709  ALA A O     1 
ATOM   6440 C  CB    . ALA C 3 709 ? -15.668 36.316 16.957  1.00 51.98  ? 709  ALA A CB    1 
ATOM   6441 N  N     . LEU C 3 710 ? -13.670 35.636 14.536  1.00 52.70  ? 710  LEU A N     1 
ATOM   6442 C  CA    . LEU C 3 710 ? -13.442 34.878 13.302  1.00 53.13  ? 710  LEU A CA    1 
ATOM   6443 C  C     . LEU C 3 710 ? -12.990 33.455 13.590  1.00 53.39  ? 710  LEU A C     1 
ATOM   6444 O  O     . LEU C 3 710 ? -12.447 33.150 14.662  1.00 53.56  ? 710  LEU A O     1 
ATOM   6445 C  CB    . LEU C 3 710 ? -12.365 35.536 12.436  1.00 53.50  ? 710  LEU A CB    1 
ATOM   6446 C  CG    . LEU C 3 710 ? -12.523 36.926 11.824  1.00 53.38  ? 710  LEU A CG    1 
ATOM   6447 C  CD1   . LEU C 3 710 ? -11.274 37.248 11.051  1.00 53.96  ? 710  LEU A CD1   1 
ATOM   6448 C  CD2   . LEU C 3 710 ? -13.703 36.955 10.912  1.00 54.09  ? 710  LEU A CD2   1 
ATOM   6449 N  N     . ASN C 3 711 ? -13.197 32.587 12.614  1.00 53.65  ? 711  ASN A N     1 
ATOM   6450 C  CA    . ASN C 3 711 ? -12.784 31.215 12.747  1.00 54.21  ? 711  ASN A CA    1 
ATOM   6451 C  C     . ASN C 3 711 ? -11.596 30.995 11.836  1.00 54.36  ? 711  ASN A C     1 
ATOM   6452 O  O     . ASN C 3 711 ? -11.730 30.938 10.607  1.00 54.39  ? 711  ASN A O     1 
ATOM   6453 C  CB    . ASN C 3 711 ? -13.924 30.265 12.414  1.00 54.36  ? 711  ASN A CB    1 
ATOM   6454 C  CG    . ASN C 3 711 ? -13.582 28.835 12.729  1.00 55.69  ? 711  ASN A CG    1 
ATOM   6455 O  OD1   . ASN C 3 711 ? -13.486 28.443 13.901  1.00 57.04  ? 711  ASN A OD1   1 
ATOM   6456 N  ND2   . ASN C 3 711 ? -13.375 28.040 11.684  1.00 56.39  ? 711  ASN A ND2   1 
ATOM   6457 N  N     . VAL C 3 712 ? -10.427 30.875 12.455  1.00 54.45  ? 712  VAL A N     1 
ATOM   6458 C  CA    . VAL C 3 712 ? -9.175  30.980 11.730  1.00 54.08  ? 712  VAL A CA    1 
ATOM   6459 C  C     . VAL C 3 712 ? -8.570  29.601 11.526  1.00 54.30  ? 712  VAL A C     1 
ATOM   6460 O  O     . VAL C 3 712 ? -8.589  28.766 12.436  1.00 54.10  ? 712  VAL A O     1 
ATOM   6461 C  CB    . VAL C 3 712 ? -8.193  31.929 12.461  1.00 53.71  ? 712  VAL A CB    1 
ATOM   6462 C  CG1   . VAL C 3 712 ? -6.882  32.021 11.715  1.00 54.19  ? 712  VAL A CG1   1 
ATOM   6463 C  CG2   . VAL C 3 712 ? -8.804  33.310 12.615  1.00 52.72  ? 712  VAL A CG2   1 
ATOM   6464 N  N     . TRP C 3 713 ? -8.041  29.388 10.319  1.00 54.49  ? 713  TRP A N     1 
ATOM   6465 C  CA    . TRP C 3 713 ? -7.394  28.140 9.918   1.00 54.47  ? 713  TRP A CA    1 
ATOM   6466 C  C     . TRP C 3 713 ? -5.884  28.288 9.761   1.00 54.95  ? 713  TRP A C     1 
ATOM   6467 O  O     . TRP C 3 713 ? -5.137  27.327 9.955   1.00 55.04  ? 713  TRP A O     1 
ATOM   6468 C  CB    . TRP C 3 713 ? -8.001  27.640 8.609   1.00 54.27  ? 713  TRP A CB    1 
ATOM   6469 C  CG    . TRP C 3 713 ? -9.455  27.443 8.702   1.00 53.48  ? 713  TRP A CG    1 
ATOM   6470 C  CD1   . TRP C 3 713 ? -10.424 28.351 8.409   1.00 53.34  ? 713  TRP A CD1   1 
ATOM   6471 C  CD2   . TRP C 3 713 ? -10.123 26.269 9.152   1.00 53.99  ? 713  TRP A CD2   1 
ATOM   6472 N  NE1   . TRP C 3 713 ? -11.665 27.813 8.635   1.00 53.00  ? 713  TRP A NE1   1 
ATOM   6473 C  CE2   . TRP C 3 713 ? -11.509 26.532 9.095   1.00 54.02  ? 713  TRP A CE2   1 
ATOM   6474 C  CE3   . TRP C 3 713 ? -9.688  25.011 9.597   1.00 54.01  ? 713  TRP A CE3   1 
ATOM   6475 C  CZ2   . TRP C 3 713 ? -12.470 25.576 9.464   1.00 54.45  ? 713  TRP A CZ2   1 
ATOM   6476 C  CZ3   . TRP C 3 713 ? -10.646 24.057 9.952   1.00 53.28  ? 713  TRP A CZ3   1 
ATOM   6477 C  CH2   . TRP C 3 713 ? -12.015 24.348 9.892   1.00 53.36  ? 713  TRP A CH2   1 
ATOM   6478 N  N     . ASP C 3 714 ? -5.443  29.488 9.396   1.00 55.67  ? 714  ASP A N     1 
ATOM   6479 C  CA    . ASP C 3 714 ? -4.021  29.797 9.240   1.00 56.44  ? 714  ASP A CA    1 
ATOM   6480 C  C     . ASP C 3 714 ? -3.783  31.211 9.734   1.00 57.08  ? 714  ASP A C     1 
ATOM   6481 O  O     . ASP C 3 714 ? -4.409  32.154 9.239   1.00 57.38  ? 714  ASP A O     1 
ATOM   6482 C  CB    . ASP C 3 714 ? -3.604  29.681 7.763   1.00 56.46  ? 714  ASP A CB    1 
ATOM   6483 C  CG    . ASP C 3 714 ? -2.092  29.716 7.561   1.00 56.93  ? 714  ASP A CG    1 
ATOM   6484 O  OD1   . ASP C 3 714 ? -1.427  30.713 7.928   1.00 57.32  ? 714  ASP A OD1   1 
ATOM   6485 O  OD2   . ASP C 3 714 ? -1.562  28.738 7.005   1.00 57.62  ? 714  ASP A OD2   1 
ATOM   6486 N  N     . MET C 3 715 ? -2.888  31.361 10.709  1.00 57.98  ? 715  MET A N     1 
ATOM   6487 C  CA    . MET C 3 715 ? -2.453  32.688 11.170  1.00 58.78  ? 715  MET A CA    1 
ATOM   6488 C  C     . MET C 3 715 ? -0.960  32.893 10.889  1.00 59.32  ? 715  MET A C     1 
ATOM   6489 O  O     . MET C 3 715 ? -0.126  32.164 11.418  1.00 59.50  ? 715  MET A O     1 
ATOM   6490 C  CB    . MET C 3 715 ? -2.776  32.878 12.654  1.00 58.59  ? 715  MET A CB    1 
ATOM   6491 C  CG    . MET C 3 715 ? -2.291  34.201 13.266  1.00 59.15  ? 715  MET A CG    1 
ATOM   6492 S  SD    . MET C 3 715 ? -3.161  35.719 12.772  1.00 60.87  ? 715  MET A SD    1 
ATOM   6493 C  CE    . MET C 3 715 ? -4.863  35.313 13.168  1.00 60.96  ? 715  MET A CE    1 
ATOM   6494 N  N     . GLU C 3 716 ? -0.635  33.872 10.042  1.00 60.07  ? 716  GLU A N     1 
ATOM   6495 C  CA    . GLU C 3 716 ? 0.754   34.163 9.651   1.00 60.73  ? 716  GLU A CA    1 
ATOM   6496 C  C     . GLU C 3 716 ? 1.556   32.904 9.334   1.00 60.36  ? 716  GLU A C     1 
ATOM   6497 O  O     . GLU C 3 716 ? 2.460   32.546 10.084  1.00 60.85  ? 716  GLU A O     1 
ATOM   6498 C  CB    . GLU C 3 716 ? 1.469   34.946 10.754  1.00 60.65  ? 716  GLU A CB    1 
ATOM   6499 C  CG    . GLU C 3 716 ? 1.178   36.436 10.755  1.00 62.56  ? 716  GLU A CG    1 
ATOM   6500 C  CD    . GLU C 3 716 ? 2.123   37.234 11.667  1.00 62.71  ? 716  GLU A CD    1 
ATOM   6501 O  OE1   . GLU C 3 716 ? 1.965   37.156 12.909  1.00 62.72  ? 716  GLU A OE1   1 
ATOM   6502 O  OE2   . GLU C 3 716 ? 3.014   37.945 11.136  1.00 63.45  ? 716  GLU A OE2   1 
ATOM   6503 N  N     . GLY C 3 717 ? 1.217   32.219 8.248   1.00 59.99  ? 717  GLY A N     1 
ATOM   6504 C  CA    . GLY C 3 717 ? 1.944   31.008 7.852   1.00 59.14  ? 717  GLY A CA    1 
ATOM   6505 C  C     . GLY C 3 717 ? 1.843   29.773 8.747   1.00 58.71  ? 717  GLY A C     1 
ATOM   6506 O  O     . GLY C 3 717 ? 2.518   28.785 8.489   1.00 58.89  ? 717  GLY A O     1 
ATOM   6507 N  N     . THR C 3 718 ? 1.017   29.812 9.792   1.00 58.18  ? 718  THR A N     1 
ATOM   6508 C  CA    . THR C 3 718 ? 0.831   28.657 10.685  1.00 57.38  ? 718  THR A CA    1 
ATOM   6509 C  C     . THR C 3 718 ? -0.486  27.968 10.382  1.00 57.42  ? 718  THR A C     1 
ATOM   6510 O  O     . THR C 3 718 ? -1.557  28.564 10.534  1.00 57.42  ? 718  THR A O     1 
ATOM   6511 C  CB    . THR C 3 718 ? 0.810   29.052 12.189  1.00 57.28  ? 718  THR A CB    1 
ATOM   6512 O  OG1   . THR C 3 718 ? 1.877   29.958 12.480  1.00 57.09  ? 718  THR A OG1   1 
ATOM   6513 C  CG2   . THR C 3 718 ? 0.940   27.830 13.080  1.00 56.16  ? 718  THR A CG2   1 
ATOM   6514 N  N     . ARG C 3 719 ? -0.404  26.700 9.996   1.00 57.36  ? 719  ARG A N     1 
ATOM   6515 C  CA    . ARG C 3 719 ? -1.576  25.940 9.608   1.00 57.51  ? 719  ARG A CA    1 
ATOM   6516 C  C     . ARG C 3 719 ? -2.096  25.059 10.732  1.00 57.70  ? 719  ARG A C     1 
ATOM   6517 O  O     . ARG C 3 719 ? -1.829  23.863 10.748  1.00 58.58  ? 719  ARG A O     1 
ATOM   6518 C  CB    . ARG C 3 719 ? -1.256  25.084 8.384   1.00 57.44  ? 719  ARG A CB    1 
ATOM   6519 C  CG    . ARG C 3 719 ? -2.473  24.491 7.704   1.00 57.83  ? 719  ARG A CG    1 
ATOM   6520 C  CD    . ARG C 3 719 ? -3.352  25.557 7.059   1.00 58.63  ? 719  ARG A CD    1 
ATOM   6521 N  NE    . ARG C 3 719 ? -2.637  26.344 6.051   1.00 60.04  ? 719  ARG A NE    1 
ATOM   6522 C  CZ    . ARG C 3 719 ? -2.471  25.982 4.780   1.00 60.92  ? 719  ARG A CZ    1 
ATOM   6523 N  NH1   . ARG C 3 719 ? -2.952  24.824 4.335   1.00 61.84  ? 719  ARG A NH1   1 
ATOM   6524 N  NH2   . ARG C 3 719 ? -1.822  26.780 3.945   1.00 60.50  ? 719  ARG A NH2   1 
ATOM   6525 N  N     . TYR C 3 720 ? -2.863  25.634 11.652  1.00 57.68  ? 720  TYR A N     1 
ATOM   6526 C  CA    . TYR C 3 720 ? -3.422  24.877 12.780  1.00 57.69  ? 720  TYR A CA    1 
ATOM   6527 C  C     . TYR C 3 720 ? -4.089  23.551 12.403  1.00 57.73  ? 720  TYR A C     1 
ATOM   6528 O  O     . TYR C 3 720 ? -4.841  23.468 11.426  1.00 57.77  ? 720  TYR A O     1 
ATOM   6529 C  CB    . TYR C 3 720 ? -4.453  25.709 13.534  1.00 57.87  ? 720  TYR A CB    1 
ATOM   6530 C  CG    . TYR C 3 720 ? -3.999  27.076 14.001  1.00 58.05  ? 720  TYR A CG    1 
ATOM   6531 C  CD1   . TYR C 3 720 ? -3.084  27.219 15.050  1.00 58.20  ? 720  TYR A CD1   1 
ATOM   6532 C  CD2   . TYR C 3 720 ? -4.512  28.226 13.410  1.00 57.19  ? 720  TYR A CD2   1 
ATOM   6533 C  CE1   . TYR C 3 720 ? -2.680  28.488 15.478  1.00 58.89  ? 720  TYR A CE1   1 
ATOM   6534 C  CE2   . TYR C 3 720 ? -4.127  29.482 13.827  1.00 57.64  ? 720  TYR A CE2   1 
ATOM   6535 C  CZ    . TYR C 3 720 ? -3.219  29.618 14.858  1.00 57.91  ? 720  TYR A CZ    1 
ATOM   6536 O  OH    . TYR C 3 720 ? -2.854  30.886 15.253  1.00 57.49  ? 720  TYR A OH    1 
ATOM   6537 N  N     . ALA C 3 721 ? -3.816  22.524 13.205  1.00 57.52  ? 721  ALA A N     1 
ATOM   6538 C  CA    . ALA C 3 721 ? -4.451  21.215 13.055  1.00 57.12  ? 721  ALA A CA    1 
ATOM   6539 C  C     . ALA C 3 721 ? -5.906  21.290 13.507  1.00 56.82  ? 721  ALA A C     1 
ATOM   6540 O  O     . ALA C 3 721 ? -6.743  20.504 13.079  1.00 57.28  ? 721  ALA A O     1 
ATOM   6541 C  CB    . ALA C 3 721 ? -3.695  20.172 13.854  1.00 57.02  ? 721  ALA A CB    1 
ATOM   6542 N  N     . GLU C 3 722 ? -6.187  22.254 14.375  1.00 56.32  ? 722  GLU A N     1 
ATOM   6543 C  CA    . GLU C 3 722 ? -7.526  22.541 14.861  1.00 55.83  ? 722  GLU A CA    1 
ATOM   6544 C  C     . GLU C 3 722 ? -7.815  23.999 14.515  1.00 54.43  ? 722  GLU A C     1 
ATOM   6545 O  O     . GLU C 3 722 ? -6.977  24.855 14.776  1.00 54.44  ? 722  GLU A O     1 
ATOM   6546 C  CB    . GLU C 3 722 ? -7.542  22.396 16.386  1.00 56.68  ? 722  GLU A CB    1 
ATOM   6547 C  CG    . GLU C 3 722 ? -8.827  21.872 16.995  1.00 59.06  ? 722  GLU A CG    1 
ATOM   6548 C  CD    . GLU C 3 722 ? -8.965  20.376 16.800  1.00 62.92  ? 722  GLU A CD    1 
ATOM   6549 O  OE1   . GLU C 3 722 ? -7.935  19.719 16.527  1.00 64.28  ? 722  GLU A OE1   1 
ATOM   6550 O  OE2   . GLU C 3 722 ? -10.098 19.855 16.912  1.00 65.34  ? 722  GLU A OE2   1 
ATOM   6551 N  N     . PRO C 3 723 ? -8.993  24.298 13.934  1.00 52.96  ? 723  PRO A N     1 
ATOM   6552 C  CA    . PRO C 3 723 ? -9.330  25.710 13.780  1.00 52.01  ? 723  PRO A CA    1 
ATOM   6553 C  C     . PRO C 3 723 ? -9.343  26.435 15.143  1.00 51.22  ? 723  PRO A C     1 
ATOM   6554 O  O     . PRO C 3 723 ? -9.848  25.896 16.134  1.00 51.14  ? 723  PRO A O     1 
ATOM   6555 C  CB    . PRO C 3 723 ? -10.738 25.674 13.166  1.00 51.69  ? 723  PRO A CB    1 
ATOM   6556 C  CG    . PRO C 3 723 ? -11.249 24.315 13.463  1.00 52.05  ? 723  PRO A CG    1 
ATOM   6557 C  CD    . PRO C 3 723 ? -10.056 23.426 13.415  1.00 52.62  ? 723  PRO A CD    1 
ATOM   6558 N  N     . LYS C 3 724 ? -8.757  27.627 15.188  1.00 50.31  ? 724  LYS A N     1 
ATOM   6559 C  CA    . LYS C 3 724 ? -8.760  28.450 16.394  1.00 49.67  ? 724  LYS A CA    1 
ATOM   6560 C  C     . LYS C 3 724 ? -9.581  29.710 16.190  1.00 48.37  ? 724  LYS A C     1 
ATOM   6561 O  O     . LYS C 3 724 ? -9.546  30.342 15.128  1.00 47.82  ? 724  LYS A O     1 
ATOM   6562 C  CB    . LYS C 3 724 ? -7.329  28.794 16.835  1.00 50.18  ? 724  LYS A CB    1 
ATOM   6563 C  CG    . LYS C 3 724 ? -6.823  27.939 18.017  1.00 51.44  ? 724  LYS A CG    1 
ATOM   6564 C  CD    . LYS C 3 724 ? -5.277  27.795 18.120  1.00 52.15  ? 724  LYS A CD    1 
ATOM   6565 C  CE    . LYS C 3 724 ? -4.527  29.118 18.399  1.00 53.97  ? 724  LYS A CE    1 
ATOM   6566 N  NZ    . LYS C 3 724 ? -5.303  30.162 19.161  1.00 54.64  ? 724  LYS A NZ    1 
ATOM   6567 N  N     . LEU C 3 725 ? -10.353 30.049 17.212  1.00 47.15  ? 725  LEU A N     1 
ATOM   6568 C  CA    . LEU C 3 725 ? -11.163 31.238 17.160  1.00 45.80  ? 725  LEU A CA    1 
ATOM   6569 C  C     . LEU C 3 725 ? -10.256 32.400 17.412  1.00 45.04  ? 725  LEU A C     1 
ATOM   6570 O  O     . LEU C 3 725 ? -9.440  32.362 18.322  1.00 44.85  ? 725  LEU A O     1 
ATOM   6571 C  CB    . LEU C 3 725 ? -12.219 31.212 18.249  1.00 45.87  ? 725  LEU A CB    1 
ATOM   6572 C  CG    . LEU C 3 725 ? -13.263 30.105 18.273  1.00 45.46  ? 725  LEU A CG    1 
ATOM   6573 C  CD1   . LEU C 3 725 ? -14.188 30.376 19.436  1.00 44.54  ? 725  LEU A CD1   1 
ATOM   6574 C  CD2   . LEU C 3 725 ? -14.038 30.069 16.976  1.00 45.42  ? 725  LEU A CD2   1 
ATOM   6575 N  N     . LYS C 3 726 ? -10.386 33.434 16.601  1.00 44.09  ? 726  LYS A N     1 
ATOM   6576 C  CA    . LYS C 3 726 ? -9.732  34.681 16.904  1.00 43.14  ? 726  LYS A CA    1 
ATOM   6577 C  C     . LYS C 3 726 ? -10.866 35.583 17.310  1.00 42.55  ? 726  LYS A C     1 
ATOM   6578 O  O     . LYS C 3 726 ? -11.714 35.916 16.490  1.00 42.62  ? 726  LYS A O     1 
ATOM   6579 C  CB    . LYS C 3 726 ? -9.023  35.203 15.671  1.00 43.20  ? 726  LYS A CB    1 
ATOM   6580 C  CG    . LYS C 3 726 ? -8.729  36.680 15.675  1.00 44.34  ? 726  LYS A CG    1 
ATOM   6581 C  CD    . LYS C 3 726 ? -7.266  36.959 15.844  1.00 45.91  ? 726  LYS A CD    1 
ATOM   6582 C  CE    . LYS C 3 726 ? -7.003  38.417 15.528  1.00 48.93  ? 726  LYS A CE    1 
ATOM   6583 N  NZ    . LYS C 3 726 ? -6.138  39.050 16.592  1.00 49.83  ? 726  LYS A NZ    1 
ATOM   6584 N  N     . ILE C 3 727 ? -10.920 35.925 18.588  1.00 41.74  ? 727  ILE A N     1 
ATOM   6585 C  CA    . ILE C 3 727 ? -11.941 36.830 19.072  1.00 41.28  ? 727  ILE A CA    1 
ATOM   6586 C  C     . ILE C 3 727 ? -11.242 38.046 19.623  1.00 41.72  ? 727  ILE A C     1 
ATOM   6587 O  O     . ILE C 3 727 ? -10.306 37.928 20.422  1.00 41.96  ? 727  ILE A O     1 
ATOM   6588 C  CB    . ILE C 3 727 ? -12.807 36.231 20.197  1.00 41.22  ? 727  ILE A CB    1 
ATOM   6589 C  CG1   . ILE C 3 727 ? -13.413 34.880 19.801  1.00 40.16  ? 727  ILE A CG1   1 
ATOM   6590 C  CG2   . ILE C 3 727 ? -13.919 37.196 20.579  1.00 41.19  ? 727  ILE A CG2   1 
ATOM   6591 C  CD1   . ILE C 3 727 ? -13.891 34.079 20.996  1.00 38.06  ? 727  ILE A CD1   1 
ATOM   6592 N  N     . MET C 3 728 ? -11.717 39.212 19.188  1.00 41.76  ? 728  MET A N     1 
ATOM   6593 C  CA    . MET C 3 728 ? -11.182 40.515 19.560  1.00 41.42  ? 728  MET A CA    1 
ATOM   6594 C  C     . MET C 3 728 ? -12.281 41.366 20.200  1.00 41.48  ? 728  MET A C     1 
ATOM   6595 O  O     . MET C 3 728 ? -13.379 41.534 19.628  1.00 41.42  ? 728  MET A O     1 
ATOM   6596 C  CB    . MET C 3 728 ? -10.634 41.216 18.315  1.00 41.14  ? 728  MET A CB    1 
ATOM   6597 C  CG    . MET C 3 728 ? -9.129  41.213 18.175  1.00 42.51  ? 728  MET A CG    1 
ATOM   6598 S  SD    . MET C 3 728 ? -8.274  39.689 18.667  1.00 44.26  ? 728  MET A SD    1 
ATOM   6599 C  CE    . MET C 3 728 ? -6.911  40.462 19.524  1.00 43.57  ? 728  MET A CE    1 
ATOM   6600 N  N     . GLY C 3 729 ? -11.995 41.882 21.392  1.00 41.21  ? 729  GLY A N     1 
ATOM   6601 C  CA    . GLY C 3 729 ? -12.869 42.844 22.041  1.00 41.24  ? 729  GLY A CA    1 
ATOM   6602 C  C     . GLY C 3 729 ? -14.065 42.312 22.806  1.00 41.23  ? 729  GLY A C     1 
ATOM   6603 O  O     . GLY C 3 729 ? -14.411 42.851 23.854  1.00 41.64  ? 729  GLY A O     1 
ATOM   6604 N  N     . LEU C 3 730 ? -14.703 41.272 22.285  1.00 41.45  ? 730  LEU A N     1 
ATOM   6605 C  CA    . LEU C 3 730 ? -15.941 40.750 22.855  1.00 41.76  ? 730  LEU A CA    1 
ATOM   6606 C  C     . LEU C 3 730 ? -15.708 40.296 24.289  1.00 42.65  ? 730  LEU A C     1 
ATOM   6607 O  O     . LEU C 3 730 ? -14.582 40.025 24.687  1.00 42.74  ? 730  LEU A O     1 
ATOM   6608 C  CB    . LEU C 3 730 ? -16.507 39.617 21.992  1.00 41.21  ? 730  LEU A CB    1 
ATOM   6609 C  CG    . LEU C 3 730 ? -16.577 39.812 20.465  1.00 40.52  ? 730  LEU A CG    1 
ATOM   6610 C  CD1   . LEU C 3 730 ? -17.185 38.607 19.755  1.00 40.78  ? 730  LEU A CD1   1 
ATOM   6611 C  CD2   . LEU C 3 730 ? -17.339 41.040 20.073  1.00 39.09  ? 730  LEU A CD2   1 
ATOM   6612 N  N     . GLU C 3 731 ? -16.771 40.225 25.078  1.00 44.14  ? 731  GLU A N     1 
ATOM   6613 C  CA    . GLU C 3 731 ? -16.614 39.976 26.527  1.00 45.53  ? 731  GLU A CA    1 
ATOM   6614 C  C     . GLU C 3 731 ? -15.818 38.721 26.928  1.00 45.55  ? 731  GLU A C     1 
ATOM   6615 O  O     . GLU C 3 731 ? -15.238 38.687 28.021  1.00 46.53  ? 731  GLU A O     1 
ATOM   6616 C  CB    . GLU C 3 731 ? -17.943 40.096 27.298  1.00 45.55  ? 731  GLU A CB    1 
ATOM   6617 C  CG    . GLU C 3 731 ? -19.190 40.173 26.433  1.00 47.99  ? 731  GLU A CG    1 
ATOM   6618 C  CD    . GLU C 3 731 ? -19.409 41.552 25.818  1.00 50.44  ? 731  GLU A CD    1 
ATOM   6619 O  OE1   . GLU C 3 731 ? -19.675 42.527 26.569  1.00 50.48  ? 731  GLU A OE1   1 
ATOM   6620 O  OE2   . GLU C 3 731 ? -19.322 41.652 24.570  1.00 51.95  ? 731  GLU A OE2   1 
ATOM   6621 N  N     . THR C 3 732 ? -15.763 37.717 26.051  1.00 45.03  ? 732  THR A N     1 
ATOM   6622 C  CA    . THR C 3 732 ? -14.905 36.540 26.253  1.00 44.85  ? 732  THR A CA    1 
ATOM   6623 C  C     . THR C 3 732 ? -13.440 36.909 26.558  1.00 44.98  ? 732  THR A C     1 
ATOM   6624 O  O     . THR C 3 732 ? -12.739 36.206 27.299  1.00 44.67  ? 732  THR A O     1 
ATOM   6625 C  CB    . THR C 3 732 ? -14.919 35.623 25.015  1.00 44.76  ? 732  THR A CB    1 
ATOM   6626 O  OG1   . THR C 3 732 ? -14.916 36.429 23.830  1.00 43.34  ? 732  THR A OG1   1 
ATOM   6627 C  CG2   . THR C 3 732 ? -16.153 34.731 25.020  1.00 44.91  ? 732  THR A CG2   1 
ATOM   6628 N  N     . GLN C 3 733 ? -13.005 38.028 25.980  1.00 45.02  ? 733  GLN A N     1 
ATOM   6629 C  CA    . GLN C 3 733 ? -11.639 38.500 26.074  1.00 44.77  ? 733  GLN A CA    1 
ATOM   6630 C  C     . GLN C 3 733 ? -11.384 39.485 27.221  1.00 44.58  ? 733  GLN A C     1 
ATOM   6631 O  O     . GLN C 3 733 ? -10.257 39.950 27.397  1.00 44.51  ? 733  GLN A O     1 
ATOM   6632 C  CB    . GLN C 3 733 ? -11.244 39.100 24.732  1.00 44.84  ? 733  GLN A CB    1 
ATOM   6633 C  CG    . GLN C 3 733 ? -10.561 38.098 23.814  1.00 46.11  ? 733  GLN A CG    1 
ATOM   6634 C  CD    . GLN C 3 733 ? -11.319 36.794 23.678  1.00 48.96  ? 733  GLN A CD    1 
ATOM   6635 O  OE1   . GLN C 3 733 ? -12.531 36.790 23.488  1.00 51.58  ? 733  GLN A OE1   1 
ATOM   6636 N  NE2   . GLN C 3 733 ? -10.608 35.679 23.768  1.00 48.99  ? 733  GLN A NE2   1 
ATOM   6637 N  N     . LYS C 3 734 ? -12.412 39.760 28.025  1.00 44.33  ? 734  LYS A N     1 
ATOM   6638 C  CA    . LYS C 3 734 ? -12.299 40.754 29.098  1.00 44.20  ? 734  LYS A CA    1 
ATOM   6639 C  C     . LYS C 3 734 ? -12.284 40.154 30.488  1.00 43.83  ? 734  LYS A C     1 
ATOM   6640 O  O     . LYS C 3 734 ? -13.149 39.356 30.847  1.00 44.12  ? 734  LYS A O     1 
ATOM   6641 C  CB    . LYS C 3 734 ? -13.417 41.788 28.996  1.00 44.42  ? 734  LYS A CB    1 
ATOM   6642 C  CG    . LYS C 3 734 ? -13.422 42.538 27.685  1.00 44.72  ? 734  LYS A CG    1 
ATOM   6643 C  CD    . LYS C 3 734 ? -14.339 43.706 27.734  1.00 46.99  ? 734  LYS A CD    1 
ATOM   6644 C  CE    . LYS C 3 734 ? -14.012 44.608 28.909  1.00 49.10  ? 734  LYS A CE    1 
ATOM   6645 N  NZ    . LYS C 3 734 ? -14.698 45.931 28.785  1.00 50.69  ? 734  LYS A NZ    1 
ATOM   6646 N  N     . SER C 3 735 ? -11.293 40.560 31.266  1.00 43.46  ? 735  SER A N     1 
ATOM   6647 C  CA    . SER C 3 735 ? -11.085 40.072 32.620  1.00 43.04  ? 735  SER A CA    1 
ATOM   6648 C  C     . SER C 3 735 ? -12.186 40.513 33.596  1.00 43.63  ? 735  SER A C     1 
ATOM   6649 O  O     . SER C 3 735 ? -12.219 40.075 34.755  1.00 43.21  ? 735  SER A O     1 
ATOM   6650 C  CB    . SER C 3 735 ? -9.724  40.546 33.129  1.00 42.64  ? 735  SER A CB    1 
ATOM   6651 O  OG    . SER C 3 735 ? -9.744  41.937 33.362  1.00 40.53  ? 735  SER A OG    1 
ATOM   6652 N  N     . SER C 3 736 ? -13.074 41.395 33.144  1.00 44.28  ? 736  SER A N     1 
ATOM   6653 C  CA    . SER C 3 736 ? -14.227 41.778 33.968  1.00 44.77  ? 736  SER A CA    1 
ATOM   6654 C  C     . SER C 3 736 ? -15.355 40.726 33.892  1.00 44.76  ? 736  SER A C     1 
ATOM   6655 O  O     . SER C 3 736 ? -16.157 40.588 34.833  1.00 44.98  ? 736  SER A O     1 
ATOM   6656 C  CB    . SER C 3 736 ? -14.729 43.164 33.574  1.00 44.54  ? 736  SER A CB    1 
ATOM   6657 O  OG    . SER C 3 736 ? -15.056 43.181 32.206  1.00 45.50  ? 736  SER A OG    1 
ATOM   6658 N  N     . THR C 3 737 ? -15.386 39.983 32.781  1.00 44.41  ? 737  THR A N     1 
ATOM   6659 C  CA    . THR C 3 737 ? -16.405 38.979 32.515  1.00 44.45  ? 737  THR A CA    1 
ATOM   6660 C  C     . THR C 3 737 ? -16.219 37.768 33.425  1.00 45.39  ? 737  THR A C     1 
ATOM   6661 O  O     . THR C 3 737 ? -15.102 37.280 33.604  1.00 45.66  ? 737  THR A O     1 
ATOM   6662 C  CB    . THR C 3 737 ? -16.365 38.569 31.037  1.00 43.98  ? 737  THR A CB    1 
ATOM   6663 O  OG1   . THR C 3 737 ? -16.583 39.731 30.234  1.00 43.95  ? 737  THR A OG1   1 
ATOM   6664 C  CG2   . THR C 3 737 ? -17.422 37.532 30.693  1.00 43.38  ? 737  THR A CG2   1 
ATOM   6665 N  N     . PRO C 3 738 ? -17.311 37.289 34.033  1.00 46.16  ? 738  PRO A N     1 
ATOM   6666 C  CA    . PRO C 3 738 ? -17.183 36.100 34.884  1.00 46.66  ? 738  PRO A CA    1 
ATOM   6667 C  C     . PRO C 3 738 ? -16.609 34.907 34.124  1.00 47.01  ? 738  PRO A C     1 
ATOM   6668 O  O     . PRO C 3 738 ? -16.893 34.720 32.936  1.00 47.14  ? 738  PRO A O     1 
ATOM   6669 C  CB    . PRO C 3 738 ? -18.628 35.817 35.315  1.00 47.02  ? 738  PRO A CB    1 
ATOM   6670 C  CG    . PRO C 3 738 ? -19.329 37.166 35.201  1.00 46.87  ? 738  PRO A CG    1 
ATOM   6671 C  CD    . PRO C 3 738 ? -18.693 37.812 33.997  1.00 46.21  ? 738  PRO A CD    1 
ATOM   6672 N  N     . LYS C 3 739 ? -15.820 34.100 34.825  1.00 47.22  ? 739  LYS A N     1 
ATOM   6673 C  CA    . LYS C 3 739 ? -15.048 33.028 34.205  1.00 47.19  ? 739  LYS A CA    1 
ATOM   6674 C  C     . LYS C 3 739 ? -15.902 32.069 33.409  1.00 46.95  ? 739  LYS A C     1 
ATOM   6675 O  O     . LYS C 3 739 ? -15.680 31.885 32.215  1.00 47.43  ? 739  LYS A O     1 
ATOM   6676 C  CB    . LYS C 3 739 ? -14.243 32.260 35.249  1.00 47.20  ? 739  LYS A CB    1 
ATOM   6677 C  CG    . LYS C 3 739 ? -12.870 31.805 34.733  1.00 48.20  ? 739  LYS A CG    1 
ATOM   6678 C  CD    . LYS C 3 739 ? -11.853 32.943 34.773  1.00 48.56  ? 739  LYS A CD    1 
ATOM   6679 C  CE    . LYS C 3 739 ? -10.598 32.569 34.008  1.00 50.25  ? 739  LYS A CE    1 
ATOM   6680 N  NZ    . LYS C 3 739 ? -9.548  33.625 34.156  1.00 51.25  ? 739  LYS A NZ    1 
ATOM   6681 N  N     . ALA C 3 740 ? -16.882 31.466 34.069  1.00 46.46  ? 740  ALA A N     1 
ATOM   6682 C  CA    . ALA C 3 740 ? -17.719 30.474 33.435  1.00 45.79  ? 740  ALA A CA    1 
ATOM   6683 C  C     . ALA C 3 740 ? -18.472 31.101 32.267  1.00 45.66  ? 740  ALA A C     1 
ATOM   6684 O  O     . ALA C 3 740 ? -18.744 30.443 31.248  1.00 45.84  ? 740  ALA A O     1 
ATOM   6685 C  CB    . ALA C 3 740 ? -18.661 29.892 34.439  1.00 45.93  ? 740  ALA A CB    1 
ATOM   6686 N  N     . VAL C 3 741 ? -18.771 32.387 32.399  1.00 45.17  ? 741  VAL A N     1 
ATOM   6687 C  CA    . VAL C 3 741 ? -19.446 33.105 31.328  1.00 44.93  ? 741  VAL A CA    1 
ATOM   6688 C  C     . VAL C 3 741 ? -18.522 33.319 30.131  1.00 44.39  ? 741  VAL A C     1 
ATOM   6689 O  O     . VAL C 3 741 ? -18.974 33.283 29.002  1.00 44.81  ? 741  VAL A O     1 
ATOM   6690 C  CB    . VAL C 3 741 ? -20.097 34.422 31.837  1.00 45.15  ? 741  VAL A CB    1 
ATOM   6691 C  CG1   . VAL C 3 741 ? -20.632 35.263 30.698  1.00 45.08  ? 741  VAL A CG1   1 
ATOM   6692 C  CG2   . VAL C 3 741 ? -21.236 34.095 32.788  1.00 45.64  ? 741  VAL A CG2   1 
ATOM   6693 N  N     . GLN C 3 742 ? -17.232 33.517 30.363  1.00 44.11  ? 742  GLN A N     1 
ATOM   6694 C  CA    . GLN C 3 742 ? -16.294 33.671 29.248  1.00 43.91  ? 742  GLN A CA    1 
ATOM   6695 C  C     . GLN C 3 742 ? -16.271 32.380 28.455  1.00 43.95  ? 742  GLN A C     1 
ATOM   6696 O  O     . GLN C 3 742 ? -16.260 32.383 27.223  1.00 43.74  ? 742  GLN A O     1 
ATOM   6697 C  CB    . GLN C 3 742 ? -14.887 33.956 29.753  1.00 43.90  ? 742  GLN A CB    1 
ATOM   6698 C  CG    . GLN C 3 742 ? -14.795 35.101 30.694  1.00 43.37  ? 742  GLN A CG    1 
ATOM   6699 C  CD    . GLN C 3 742 ? -13.375 35.497 30.967  1.00 43.55  ? 742  GLN A CD    1 
ATOM   6700 O  OE1   . GLN C 3 742 ? -12.661 34.812 31.695  1.00 44.03  ? 742  GLN A OE1   1 
ATOM   6701 N  NE2   . GLN C 3 742 ? -12.953 36.622 30.393  1.00 42.64  ? 742  GLN A NE2   1 
ATOM   6702 N  N     . LYS C 3 743 ? -16.289 31.277 29.192  1.00 44.10  ? 743  LYS A N     1 
ATOM   6703 C  CA    . LYS C 3 743 ? -16.270 29.947 28.621  1.00 44.44  ? 743  LYS A CA    1 
ATOM   6704 C  C     . LYS C 3 743 ? -17.541 29.649 27.836  1.00 44.28  ? 743  LYS A C     1 
ATOM   6705 O  O     . LYS C 3 743 ? -17.478 28.983 26.809  1.00 44.35  ? 743  LYS A O     1 
ATOM   6706 C  CB    . LYS C 3 743 ? -16.080 28.914 29.727  1.00 44.47  ? 743  LYS A CB    1 
ATOM   6707 C  CG    . LYS C 3 743 ? -15.502 27.608 29.217  1.00 46.64  ? 743  LYS A CG    1 
ATOM   6708 C  CD    . LYS C 3 743 ? -15.575 26.491 30.262  1.00 49.24  ? 743  LYS A CD    1 
ATOM   6709 C  CE    . LYS C 3 743 ? -15.062 25.180 29.682  1.00 51.23  ? 743  LYS A CE    1 
ATOM   6710 N  NZ    . LYS C 3 743 ? -15.313 24.050 30.629  1.00 54.55  ? 743  LYS A NZ    1 
ATOM   6711 N  N     . ALA C 3 744 ? -18.681 30.143 28.323  1.00 44.00  ? 744  ALA A N     1 
ATOM   6712 C  CA    . ALA C 3 744 ? -19.972 29.907 27.681  1.00 44.03  ? 744  ALA A CA    1 
ATOM   6713 C  C     . ALA C 3 744 ? -20.150 30.728 26.403  1.00 44.22  ? 744  ALA A C     1 
ATOM   6714 O  O     . ALA C 3 744 ? -20.459 30.180 25.345  1.00 44.13  ? 744  ALA A O     1 
ATOM   6715 C  CB    . ALA C 3 744 ? -21.087 30.190 28.647  1.00 44.10  ? 744  ALA A CB    1 
ATOM   6716 N  N     . LEU C 3 745 ? -19.939 32.037 26.507  1.00 44.30  ? 745  LEU A N     1 
ATOM   6717 C  CA    . LEU C 3 745 ? -20.002 32.935 25.359  1.00 44.81  ? 745  LEU A CA    1 
ATOM   6718 C  C     . LEU C 3 745 ? -19.048 32.480 24.265  1.00 45.70  ? 745  LEU A C     1 
ATOM   6719 O  O     . LEU C 3 745 ? -19.280 32.706 23.065  1.00 45.07  ? 745  LEU A O     1 
ATOM   6720 C  CB    . LEU C 3 745 ? -19.635 34.351 25.777  1.00 44.54  ? 745  LEU A CB    1 
ATOM   6721 C  CG    . LEU C 3 745 ? -20.644 35.118 26.614  1.00 44.10  ? 745  LEU A CG    1 
ATOM   6722 C  CD1   . LEU C 3 745 ? -19.991 36.343 27.193  1.00 44.14  ? 745  LEU A CD1   1 
ATOM   6723 C  CD2   . LEU C 3 745 ? -21.843 35.495 25.765  1.00 44.08  ? 745  LEU A CD2   1 
ATOM   6724 N  N     . LYS C 3 746 ? -17.964 31.843 24.697  1.00 46.95  ? 746  LYS A N     1 
ATOM   6725 C  CA    . LYS C 3 746 ? -16.980 31.338 23.764  1.00 47.99  ? 746  LYS A CA    1 
ATOM   6726 C  C     . LYS C 3 746 ? -17.528 30.119 23.073  1.00 48.12  ? 746  LYS A C     1 
ATOM   6727 O  O     . LYS C 3 746 ? -17.430 30.010 21.849  1.00 48.30  ? 746  LYS A O     1 
ATOM   6728 C  CB    . LYS C 3 746 ? -15.660 31.000 24.446  1.00 48.07  ? 746  LYS A CB    1 
ATOM   6729 C  CG    . LYS C 3 746 ? -14.499 31.237 23.526  1.00 49.44  ? 746  LYS A CG    1 
ATOM   6730 C  CD    . LYS C 3 746 ? -13.349 30.313 23.808  1.00 51.49  ? 746  LYS A CD    1 
ATOM   6731 C  CE    . LYS C 3 746 ? -12.157 30.737 22.974  1.00 52.16  ? 746  LYS A CE    1 
ATOM   6732 N  NZ    . LYS C 3 746 ? -10.908 30.132 23.508  1.00 54.08  ? 746  LYS A NZ    1 
ATOM   6733 N  N     . GLU C 3 747 ? -18.120 29.207 23.840  1.00 48.37  ? 747  GLU A N     1 
ATOM   6734 C  CA    . GLU C 3 747 ? -18.639 28.004 23.207  1.00 49.34  ? 747  GLU A CA    1 
ATOM   6735 C  C     . GLU C 3 747 ? -19.748 28.382 22.246  1.00 49.22  ? 747  GLU A C     1 
ATOM   6736 O  O     . GLU C 3 747 ? -19.941 27.719 21.228  1.00 48.61  ? 747  GLU A O     1 
ATOM   6737 C  CB    . GLU C 3 747 ? -19.087 26.933 24.209  1.00 49.61  ? 747  GLU A CB    1 
ATOM   6738 C  CG    . GLU C 3 747 ? -19.615 25.629 23.544  1.00 51.69  ? 747  GLU A CG    1 
ATOM   6739 C  CD    . GLU C 3 747 ? -18.700 25.035 22.454  1.00 53.73  ? 747  GLU A CD    1 
ATOM   6740 O  OE1   . GLU C 3 747 ? -17.467 25.229 22.495  1.00 55.02  ? 747  GLU A OE1   1 
ATOM   6741 O  OE2   . GLU C 3 747 ? -19.220 24.358 21.544  1.00 55.11  ? 747  GLU A OE2   1 
ATOM   6742 N  N     . CYS C 3 748 ? -20.443 29.474 22.564  1.00 49.74  ? 748  CYS A N     1 
ATOM   6743 C  CA    . CYS C 3 748 ? -21.457 30.014 21.668  1.00 50.52  ? 748  CYS A CA    1 
ATOM   6744 C  C     . CYS C 3 748 ? -20.843 30.477 20.374  1.00 50.50  ? 748  CYS A C     1 
ATOM   6745 O  O     . CYS C 3 748 ? -21.294 30.084 19.299  1.00 50.85  ? 748  CYS A O     1 
ATOM   6746 C  CB    . CYS C 3 748 ? -22.210 31.168 22.306  1.00 50.53  ? 748  CYS A CB    1 
ATOM   6747 S  SG    . CYS C 3 748 ? -23.385 30.625 23.565  1.00 53.43  ? 748  CYS A SG    1 
ATOM   6748 N  N     . ILE C 3 749 ? -19.814 31.309 20.471  1.00 50.51  ? 749  ILE A N     1 
ATOM   6749 C  CA    . ILE C 3 749 ? -19.243 31.890 19.269  1.00 50.49  ? 749  ILE A CA    1 
ATOM   6750 C  C     . ILE C 3 749 ? -18.676 30.761 18.428  1.00 50.86  ? 749  ILE A C     1 
ATOM   6751 O  O     . ILE C 3 749 ? -18.872 30.734 17.205  1.00 50.95  ? 749  ILE A O     1 
ATOM   6752 C  CB    . ILE C 3 749 ? -18.233 33.011 19.586  1.00 50.42  ? 749  ILE A CB    1 
ATOM   6753 C  CG1   . ILE C 3 749 ? -18.985 34.211 20.163  1.00 50.22  ? 749  ILE A CG1   1 
ATOM   6754 C  CG2   . ILE C 3 749 ? -17.494 33.445 18.348  1.00 48.84  ? 749  ILE A CG2   1 
ATOM   6755 C  CD1   . ILE C 3 749 ? -18.190 35.017 21.150  1.00 50.20  ? 749  ILE A CD1   1 
ATOM   6756 N  N     . ARG C 3 750 ? -18.040 29.800 19.097  1.00 50.94  ? 750  ARG A N     1 
ATOM   6757 C  CA    . ARG C 3 750 ? -17.549 28.610 18.417  1.00 51.67  ? 750  ARG A CA    1 
ATOM   6758 C  C     . ARG C 3 750 ? -18.686 27.859 17.743  1.00 52.18  ? 750  ARG A C     1 
ATOM   6759 O  O     . ARG C 3 750 ? -18.491 27.243 16.702  1.00 52.18  ? 750  ARG A O     1 
ATOM   6760 C  CB    . ARG C 3 750 ? -16.843 27.657 19.376  1.00 51.53  ? 750  ARG A CB    1 
ATOM   6761 C  CG    . ARG C 3 750 ? -16.095 26.536 18.635  1.00 52.39  ? 750  ARG A CG    1 
ATOM   6762 C  CD    . ARG C 3 750 ? -15.899 25.277 19.482  1.00 54.61  ? 750  ARG A CD    1 
ATOM   6763 N  NE    . ARG C 3 750 ? -17.160 24.552 19.682  1.00 56.07  ? 750  ARG A NE    1 
ATOM   6764 C  CZ    . ARG C 3 750 ? -17.694 23.694 18.814  1.00 55.34  ? 750  ARG A CZ    1 
ATOM   6765 N  NH1   . ARG C 3 750 ? -17.084 23.418 17.662  1.00 53.95  ? 750  ARG A NH1   1 
ATOM   6766 N  NH2   . ARG C 3 750 ? -18.844 23.106 19.111  1.00 55.18  ? 750  ARG A NH2   1 
ATOM   6767 N  N     . ARG C 3 751 ? -19.869 27.899 18.350  1.00 52.82  ? 751  ARG A N     1 
ATOM   6768 C  CA    . ARG C 3 751 ? -21.006 27.208 17.784  1.00 53.67  ? 751  ARG A CA    1 
ATOM   6769 C  C     . ARG C 3 751 ? -21.586 27.934 16.575  1.00 54.29  ? 751  ARG A C     1 
ATOM   6770 O  O     . ARG C 3 751 ? -21.896 27.290 15.579  1.00 54.62  ? 751  ARG A O     1 
ATOM   6771 C  CB    . ARG C 3 751 ? -22.056 26.894 18.850  1.00 53.64  ? 751  ARG A CB    1 
ATOM   6772 C  CG    . ARG C 3 751 ? -21.793 25.552 19.532  1.00 54.00  ? 751  ARG A CG    1 
ATOM   6773 C  CD    . ARG C 3 751 ? -22.521 25.414 20.844  1.00 53.66  ? 751  ARG A CD    1 
ATOM   6774 N  NE    . ARG C 3 751 ? -22.106 24.205 21.552  1.00 54.81  ? 751  ARG A NE    1 
ATOM   6775 C  CZ    . ARG C 3 751 ? -22.723 23.025 21.480  1.00 54.88  ? 751  ARG A CZ    1 
ATOM   6776 N  NH1   . ARG C 3 751 ? -23.807 22.874 20.730  1.00 54.55  ? 751  ARG A NH1   1 
ATOM   6777 N  NH2   . ARG C 3 751 ? -22.254 21.987 22.167  1.00 54.92  ? 751  ARG A NH2   1 
ATOM   6778 N  N     . MET C 3 752 ? -21.685 29.263 16.642  1.00 54.86  ? 752  MET A N     1 
ATOM   6779 C  CA    . MET C 3 752 ? -22.181 30.052 15.512  1.00 55.52  ? 752  MET A CA    1 
ATOM   6780 C  C     . MET C 3 752 ? -21.313 29.939 14.275  1.00 56.01  ? 752  MET A C     1 
ATOM   6781 O  O     . MET C 3 752 ? -21.826 29.839 13.161  1.00 56.16  ? 752  MET A O     1 
ATOM   6782 C  CB    . MET C 3 752 ? -22.256 31.527 15.852  1.00 55.42  ? 752  MET A CB    1 
ATOM   6783 C  CG    . MET C 3 752 ? -23.093 31.874 17.030  1.00 55.28  ? 752  MET A CG    1 
ATOM   6784 S  SD    . MET C 3 752 ? -23.013 33.658 17.115  1.00 55.68  ? 752  MET A SD    1 
ATOM   6785 C  CE    . MET C 3 752 ? -23.208 33.919 18.875  1.00 55.58  ? 752  MET A CE    1 
ATOM   6786 N  N     . LEU C 3 753 ? -20.001 29.967 14.473  1.00 56.66  ? 753  LEU A N     1 
ATOM   6787 C  CA    . LEU C 3 753 ? -19.087 30.125 13.361  1.00 57.37  ? 753  LEU A CA    1 
ATOM   6788 C  C     . LEU C 3 753 ? -18.732 28.799 12.721  1.00 58.27  ? 753  LEU A C     1 
ATOM   6789 O  O     . LEU C 3 753 ? -18.452 28.752 11.527  1.00 58.76  ? 753  LEU A O     1 
ATOM   6790 C  CB    . LEU C 3 753 ? -17.810 30.842 13.802  1.00 57.46  ? 753  LEU A CB    1 
ATOM   6791 C  CG    . LEU C 3 753 ? -17.824 32.073 14.726  1.00 56.71  ? 753  LEU A CG    1 
ATOM   6792 C  CD1   . LEU C 3 753 ? -16.410 32.335 15.200  1.00 55.12  ? 753  LEU A CD1   1 
ATOM   6793 C  CD2   . LEU C 3 753 ? -18.406 33.316 14.064  1.00 55.57  ? 753  LEU A CD2   1 
ATOM   6794 N  N     . GLN C 3 754 ? -18.739 27.721 13.502  1.00 59.04  ? 754  GLN A N     1 
ATOM   6795 C  CA    . GLN C 3 754 ? -18.306 26.414 12.987  1.00 59.80  ? 754  GLN A CA    1 
ATOM   6796 C  C     . GLN C 3 754 ? -19.455 25.489 12.607  1.00 60.02  ? 754  GLN A C     1 
ATOM   6797 O  O     . GLN C 3 754 ? -19.333 24.683 11.683  1.00 60.14  ? 754  GLN A O     1 
ATOM   6798 C  CB    . GLN C 3 754 ? -17.383 25.706 13.987  1.00 59.64  ? 754  GLN A CB    1 
ATOM   6799 C  CG    . GLN C 3 754 ? -15.981 26.297 14.057  1.00 60.39  ? 754  GLN A CG    1 
ATOM   6800 C  CD    . GLN C 3 754 ? -15.101 25.653 15.117  1.00 61.02  ? 754  GLN A CD    1 
ATOM   6801 O  OE1   . GLN C 3 754 ? -15.572 24.916 15.990  1.00 62.08  ? 754  GLN A OE1   1 
ATOM   6802 N  NE2   . GLN C 3 754 ? -13.807 25.937 15.045  1.00 61.78  ? 754  GLN A NE2   1 
ATOM   6803 N  N     . GLU C 3 755 ? -20.563 25.601 13.330  1.00 60.52  ? 755  GLU A N     1 
ATOM   6804 C  CA    . GLU C 3 755 ? -21.660 24.651 13.190  1.00 60.96  ? 755  GLU A CA    1 
ATOM   6805 C  C     . GLU C 3 755 ? -22.919 25.350 12.677  1.00 61.39  ? 755  GLU A C     1 
ATOM   6806 O  O     . GLU C 3 755 ? -23.447 24.997 11.619  1.00 61.59  ? 755  GLU A O     1 
ATOM   6807 C  CB    . GLU C 3 755 ? -21.896 23.914 14.514  1.00 60.93  ? 755  GLU A CB    1 
ATOM   6808 C  CG    . GLU C 3 755 ? -20.582 23.454 15.178  1.00 60.66  ? 755  GLU A CG    1 
ATOM   6809 C  CD    . GLU C 3 755 ? -20.765 22.430 16.290  1.00 60.60  ? 755  GLU A CD    1 
ATOM   6810 O  OE1   . GLU C 3 755 ? -21.793 22.453 17.005  1.00 58.92  ? 755  GLU A OE1   1 
ATOM   6811 O  OE2   . GLU C 3 755 ? -19.855 21.593 16.452  1.00 60.79  ? 755  GLU A OE2   1 
ATOM   6812 N  N     . GLY C 3 756 ? -23.382 26.351 13.413  1.00 61.64  ? 756  GLY A N     1 
ATOM   6813 C  CA    . GLY C 3 756 ? -24.466 27.191 12.940  1.00 62.19  ? 756  GLY A CA    1 
ATOM   6814 C  C     . GLY C 3 756 ? -25.535 27.483 13.971  1.00 62.56  ? 756  GLY A C     1 
ATOM   6815 O  O     . GLY C 3 756 ? -25.397 27.131 15.154  1.00 62.50  ? 756  GLY A O     1 
ATOM   6816 N  N     . GLU C 3 757 ? -26.603 28.122 13.494  1.00 62.73  ? 757  GLU A N     1 
ATOM   6817 C  CA    . GLU C 3 757 ? -27.734 28.562 14.301  1.00 63.00  ? 757  GLU A CA    1 
ATOM   6818 C  C     . GLU C 3 757 ? -28.329 27.446 15.148  1.00 62.84  ? 757  GLU A C     1 
ATOM   6819 O  O     . GLU C 3 757 ? -28.689 27.665 16.314  1.00 62.38  ? 757  GLU A O     1 
ATOM   6820 C  CB    . GLU C 3 757 ? -28.804 29.135 13.380  1.00 63.31  ? 757  GLU A CB    1 
ATOM   6821 C  CG    . GLU C 3 757 ? -29.932 29.839 14.102  1.00 65.16  ? 757  GLU A CG    1 
ATOM   6822 C  CD    . GLU C 3 757 ? -31.017 30.315 13.158  1.00 67.17  ? 757  GLU A CD    1 
ATOM   6823 O  OE1   . GLU C 3 757 ? -31.475 29.500 12.329  1.00 68.43  ? 757  GLU A OE1   1 
ATOM   6824 O  OE2   . GLU C 3 757 ? -31.416 31.499 13.248  1.00 68.21  ? 757  GLU A OE2   1 
ATOM   6825 N  N     . GLU C 3 758 ? -28.425 26.259 14.541  1.00 63.05  ? 758  GLU A N     1 
ATOM   6826 C  CA    . GLU C 3 758 ? -28.961 25.053 15.186  1.00 63.36  ? 758  GLU A CA    1 
ATOM   6827 C  C     . GLU C 3 758 ? -28.248 24.758 16.492  1.00 62.50  ? 758  GLU A C     1 
ATOM   6828 O  O     . GLU C 3 758 ? -28.871 24.673 17.559  1.00 62.23  ? 758  GLU A O     1 
ATOM   6829 C  CB    . GLU C 3 758 ? -28.792 23.854 14.256  1.00 63.98  ? 758  GLU A CB    1 
ATOM   6830 C  CG    . GLU C 3 758 ? -29.962 23.583 13.342  1.00 67.07  ? 758  GLU A CG    1 
ATOM   6831 C  CD    . GLU C 3 758 ? -30.645 22.264 13.666  1.00 71.26  ? 758  GLU A CD    1 
ATOM   6832 O  OE1   . GLU C 3 758 ? -29.955 21.335 14.169  1.00 73.52  ? 758  GLU A OE1   1 
ATOM   6833 O  OE2   . GLU C 3 758 ? -31.865 22.150 13.405  1.00 71.71  ? 758  GLU A OE2   1 
ATOM   6834 N  N     . SER C 3 759 ? -26.929 24.612 16.387  1.00 61.55  ? 759  SER A N     1 
ATOM   6835 C  CA    . SER C 3 759 ? -26.089 24.284 17.527  1.00 60.77  ? 759  SER A CA    1 
ATOM   6836 C  C     . SER C 3 759 ? -26.164 25.323 18.652  1.00 60.09  ? 759  SER A C     1 
ATOM   6837 O  O     . SER C 3 759 ? -26.155 24.969 19.841  1.00 59.49  ? 759  SER A O     1 
ATOM   6838 C  CB    . SER C 3 759 ? -24.655 24.108 17.068  1.00 60.75  ? 759  SER A CB    1 
ATOM   6839 O  OG    . SER C 3 759 ? -23.833 23.832 18.176  1.00 61.36  ? 759  SER A OG    1 
ATOM   6840 N  N     . LEU C 3 760 ? -26.260 26.596 18.262  1.00 59.44  ? 760  LEU A N     1 
ATOM   6841 C  CA    . LEU C 3 760 ? -26.293 27.703 19.204  1.00 58.73  ? 760  LEU A CA    1 
ATOM   6842 C  C     . LEU C 3 760 ? -27.448 27.551 20.176  1.00 58.88  ? 760  LEU A C     1 
ATOM   6843 O  O     . LEU C 3 760 ? -27.235 27.457 21.387  1.00 58.61  ? 760  LEU A O     1 
ATOM   6844 C  CB    . LEU C 3 760 ? -26.419 29.028 18.469  1.00 58.26  ? 760  LEU A CB    1 
ATOM   6845 C  CG    . LEU C 3 760 ? -25.887 30.334 19.074  1.00 57.57  ? 760  LEU A CG    1 
ATOM   6846 C  CD1   . LEU C 3 760 ? -26.710 31.493 18.556  1.00 57.02  ? 760  LEU A CD1   1 
ATOM   6847 C  CD2   . LEU C 3 760 ? -25.835 30.403 20.589  1.00 56.82  ? 760  LEU A CD2   1 
ATOM   6848 N  N     . GLN C 3 761 ? -28.662 27.514 19.630  1.00 59.25  ? 761  GLN A N     1 
ATOM   6849 C  CA    . GLN C 3 761 ? -29.890 27.458 20.426  1.00 59.75  ? 761  GLN A CA    1 
ATOM   6850 C  C     . GLN C 3 761 ? -29.891 26.249 21.339  1.00 59.98  ? 761  GLN A C     1 
ATOM   6851 O  O     . GLN C 3 761 ? -30.237 26.350 22.512  1.00 60.42  ? 761  GLN A O     1 
ATOM   6852 C  CB    . GLN C 3 761 ? -31.109 27.434 19.514  1.00 59.66  ? 761  GLN A CB    1 
ATOM   6853 C  CG    . GLN C 3 761 ? -31.137 28.595 18.527  1.00 60.72  ? 761  GLN A CG    1 
ATOM   6854 C  CD    . GLN C 3 761 ? -31.923 28.298 17.265  1.00 61.72  ? 761  GLN A CD    1 
ATOM   6855 O  OE1   . GLN C 3 761 ? -32.188 29.194 16.464  1.00 61.42  ? 761  GLN A OE1   1 
ATOM   6856 N  NE2   . GLN C 3 761 ? -32.293 27.034 17.077  1.00 62.53  ? 761  GLN A NE2   1 
ATOM   6857 N  N     . GLU C 3 762 ? -29.471 25.119 20.789  1.00 60.35  ? 762  GLU A N     1 
ATOM   6858 C  CA    . GLU C 3 762 ? -29.279 23.894 21.530  1.00 60.95  ? 762  GLU A CA    1 
ATOM   6859 C  C     . GLU C 3 762 ? -28.423 24.112 22.773  1.00 61.17  ? 762  GLU A C     1 
ATOM   6860 O  O     . GLU C 3 762 ? -28.798 23.712 23.871  1.00 61.25  ? 762  GLU A O     1 
ATOM   6861 C  CB    . GLU C 3 762 ? -28.600 22.901 20.613  1.00 61.23  ? 762  GLU A CB    1 
ATOM   6862 C  CG    . GLU C 3 762 ? -28.644 21.469 21.065  1.00 62.97  ? 762  GLU A CG    1 
ATOM   6863 C  CD    . GLU C 3 762 ? -27.948 20.567 20.059  1.00 66.13  ? 762  GLU A CD    1 
ATOM   6864 O  OE1   . GLU C 3 762 ? -26.701 20.404 20.160  1.00 66.66  ? 762  GLU A OE1   1 
ATOM   6865 O  OE2   . GLU C 3 762 ? -28.651 20.043 19.156  1.00 67.08  ? 762  GLU A OE2   1 
ATOM   6866 N  N     . TYR C 3 763 ? -27.270 24.753 22.596  1.00 61.55  ? 763  TYR A N     1 
ATOM   6867 C  CA    . TYR C 3 763 ? -26.342 24.972 23.694  1.00 61.60  ? 763  TYR A CA    1 
ATOM   6868 C  C     . TYR C 3 763 ? -26.810 26.088 24.583  1.00 61.93  ? 763  TYR A C     1 
ATOM   6869 O  O     . TYR C 3 763 ? -26.609 26.055 25.802  1.00 61.83  ? 763  TYR A O     1 
ATOM   6870 C  CB    . TYR C 3 763 ? -24.961 25.313 23.162  1.00 61.68  ? 763  TYR A CB    1 
ATOM   6871 C  CG    . TYR C 3 763 ? -23.911 25.484 24.237  1.00 61.58  ? 763  TYR A CG    1 
ATOM   6872 C  CD1   . TYR C 3 763 ? -23.295 24.380 24.818  1.00 60.46  ? 763  TYR A CD1   1 
ATOM   6873 C  CD2   . TYR C 3 763 ? -23.526 26.752 24.666  1.00 61.89  ? 763  TYR A CD2   1 
ATOM   6874 C  CE1   . TYR C 3 763 ? -22.337 24.531 25.806  1.00 60.82  ? 763  TYR A CE1   1 
ATOM   6875 C  CE2   . TYR C 3 763 ? -22.552 26.915 25.649  1.00 62.15  ? 763  TYR A CE2   1 
ATOM   6876 C  CZ    . TYR C 3 763 ? -21.967 25.799 26.214  1.00 61.68  ? 763  TYR A CZ    1 
ATOM   6877 O  OH    . TYR C 3 763 ? -21.008 25.955 27.187  1.00 62.89  ? 763  TYR A OH    1 
ATOM   6878 N  N     . PHE C 3 764 ? -27.417 27.097 23.972  1.00 62.49  ? 764  PHE A N     1 
ATOM   6879 C  CA    . PHE C 3 764 ? -27.955 28.179 24.753  1.00 63.05  ? 764  PHE A CA    1 
ATOM   6880 C  C     . PHE C 3 764 ? -28.952 27.631 25.768  1.00 63.29  ? 764  PHE A C     1 
ATOM   6881 O  O     . PHE C 3 764 ? -28.861 27.952 26.965  1.00 63.30  ? 764  PHE A O     1 
ATOM   6882 C  CB    . PHE C 3 764 ? -28.619 29.247 23.893  1.00 63.28  ? 764  PHE A CB    1 
ATOM   6883 C  CG    . PHE C 3 764 ? -29.389 30.244 24.705  1.00 64.20  ? 764  PHE A CG    1 
ATOM   6884 C  CD1   . PHE C 3 764 ? -28.743 31.316 25.300  1.00 64.51  ? 764  PHE A CD1   1 
ATOM   6885 C  CD2   . PHE C 3 764 ? -30.751 30.070 24.935  1.00 65.19  ? 764  PHE A CD2   1 
ATOM   6886 C  CE1   . PHE C 3 764 ? -29.438 32.223 26.080  1.00 64.56  ? 764  PHE A CE1   1 
ATOM   6887 C  CE2   . PHE C 3 764 ? -31.453 30.968 25.712  1.00 65.39  ? 764  PHE A CE2   1 
ATOM   6888 C  CZ    . PHE C 3 764 ? -30.794 32.049 26.285  1.00 65.17  ? 764  PHE A CZ    1 
ATOM   6889 N  N     . LYS C 3 765 ? -29.880 26.797 25.286  1.00 63.26  ? 765  LYS A N     1 
ATOM   6890 C  CA    . LYS C 3 765 ? -30.927 26.210 26.129  1.00 63.50  ? 765  LYS A CA    1 
ATOM   6891 C  C     . LYS C 3 765 ? -30.346 25.423 27.300  1.00 63.14  ? 765  LYS A C     1 
ATOM   6892 O  O     . LYS C 3 765 ? -30.850 25.503 28.422  1.00 63.07  ? 765  LYS A O     1 
ATOM   6893 C  CB    . LYS C 3 765 ? -31.887 25.337 25.308  1.00 63.82  ? 765  LYS A CB    1 
ATOM   6894 C  CG    . LYS C 3 765 ? -33.327 25.356 25.840  1.00 64.55  ? 765  LYS A CG    1 
ATOM   6895 C  CD    . LYS C 3 765 ? -34.347 24.646 24.931  1.00 65.07  ? 765  LYS A CD    1 
ATOM   6896 C  CE    . LYS C 3 765 ? -35.789 25.098 25.303  1.00 66.53  ? 765  LYS A CE    1 
ATOM   6897 N  NZ    . LYS C 3 765 ? -36.861 24.048 25.150  1.00 66.86  ? 765  LYS A NZ    1 
ATOM   6898 N  N     . GLU C 3 766 ? -29.275 24.682 27.034  1.00 63.00  ? 766  GLU A N     1 
ATOM   6899 C  CA    . GLU C 3 766 ? -28.587 23.925 28.077  1.00 62.82  ? 766  GLU A CA    1 
ATOM   6900 C  C     . GLU C 3 766 ? -27.969 24.827 29.147  1.00 62.65  ? 766  GLU A C     1 
ATOM   6901 O  O     . GLU C 3 766 ? -28.171 24.612 30.352  1.00 62.27  ? 766  GLU A O     1 
ATOM   6902 C  CB    . GLU C 3 766 ? -27.507 23.039 27.470  1.00 62.74  ? 766  GLU A CB    1 
ATOM   6903 C  CG    . GLU C 3 766 ? -27.132 21.893 28.360  1.00 63.29  ? 766  GLU A CG    1 
ATOM   6904 C  CD    . GLU C 3 766 ? -28.268 20.905 28.508  1.00 64.44  ? 766  GLU A CD    1 
ATOM   6905 O  OE1   . GLU C 3 766 ? -28.757 20.412 27.473  1.00 64.35  ? 766  GLU A OE1   1 
ATOM   6906 O  OE2   . GLU C 3 766 ? -28.678 20.628 29.655  1.00 65.06  ? 766  GLU A OE2   1 
ATOM   6907 N  N     . PHE C 3 767 ? -27.221 25.838 28.703  1.00 62.42  ? 767  PHE A N     1 
ATOM   6908 C  CA    . PHE C 3 767 ? -26.515 26.708 29.635  1.00 62.45  ? 767  PHE A CA    1 
ATOM   6909 C  C     . PHE C 3 767 ? -27.420 27.393 30.679  1.00 62.85  ? 767  PHE A C     1 
ATOM   6910 O  O     . PHE C 3 767 ? -27.154 27.323 31.893  1.00 62.48  ? 767  PHE A O     1 
ATOM   6911 C  CB    . PHE C 3 767 ? -25.647 27.740 28.906  1.00 62.02  ? 767  PHE A CB    1 
ATOM   6912 C  CG    . PHE C 3 767 ? -24.790 28.536 29.832  1.00 61.32  ? 767  PHE A CG    1 
ATOM   6913 C  CD1   . PHE C 3 767 ? -23.640 27.981 30.383  1.00 61.29  ? 767  PHE A CD1   1 
ATOM   6914 C  CD2   . PHE C 3 767 ? -25.151 29.826 30.201  1.00 61.87  ? 767  PHE A CD2   1 
ATOM   6915 C  CE1   . PHE C 3 767 ? -22.845 28.709 31.275  1.00 61.53  ? 767  PHE A CE1   1 
ATOM   6916 C  CE2   . PHE C 3 767 ? -24.359 30.572 31.095  1.00 61.78  ? 767  PHE A CE2   1 
ATOM   6917 C  CZ    . PHE C 3 767 ? -23.205 30.009 31.627  1.00 61.74  ? 767  PHE A CZ    1 
ATOM   6918 N  N     . GLU C 3 768 ? -28.479 28.054 30.211  1.00 63.20  ? 768  GLU A N     1 
ATOM   6919 C  CA    . GLU C 3 768 ? -29.382 28.736 31.135  1.00 64.06  ? 768  GLU A CA    1 
ATOM   6920 C  C     . GLU C 3 768 ? -30.100 27.755 32.052  1.00 63.48  ? 768  GLU A C     1 
ATOM   6921 O  O     . GLU C 3 768 ? -30.410 28.083 33.194  1.00 63.16  ? 768  GLU A O     1 
ATOM   6922 C  CB    . GLU C 3 768 ? -30.368 29.653 30.406  1.00 64.04  ? 768  GLU A CB    1 
ATOM   6923 C  CG    . GLU C 3 768 ? -31.387 28.942 29.525  1.00 65.98  ? 768  GLU A CG    1 
ATOM   6924 C  CD    . GLU C 3 768 ? -32.644 29.787 29.270  1.00 67.20  ? 768  GLU A CD    1 
ATOM   6925 O  OE1   . GLU C 3 768 ? -32.864 30.796 29.998  1.00 69.01  ? 768  GLU A OE1   1 
ATOM   6926 O  OE2   . GLU C 3 768 ? -33.417 29.426 28.345  1.00 69.31  ? 768  GLU A OE2   1 
ATOM   6927 N  N     . LYS C 3 769 ? -30.344 26.552 31.536  1.00 63.57  ? 769  LYS A N     1 
ATOM   6928 C  CA    . LYS C 3 769 ? -30.876 25.449 32.322  1.00 63.56  ? 769  LYS A CA    1 
ATOM   6929 C  C     . LYS C 3 769 ? -29.926 25.146 33.506  1.00 63.33  ? 769  LYS A C     1 
ATOM   6930 O  O     . LYS C 3 769 ? -30.373 25.038 34.648  1.00 62.99  ? 769  LYS A O     1 
ATOM   6931 C  CB    . LYS C 3 769 ? -31.082 24.213 31.424  1.00 63.81  ? 769  LYS A CB    1 
ATOM   6932 C  CG    . LYS C 3 769 ? -32.474 23.575 31.466  1.00 64.53  ? 769  LYS A CG    1 
ATOM   6933 C  CD    . LYS C 3 769 ? -32.614 22.599 32.632  1.00 66.77  ? 769  LYS A CD    1 
ATOM   6934 C  CE    . LYS C 3 769 ? -34.067 22.470 33.118  1.00 67.35  ? 769  LYS A CE    1 
ATOM   6935 N  NZ    . LYS C 3 769 ? -34.150 22.077 34.572  1.00 66.21  ? 769  LYS A NZ    1 
ATOM   6936 N  N     . GLU C 3 770 ? -28.620 25.057 33.241  1.00 62.99  ? 770  GLU A N     1 
ATOM   6937 C  CA    . GLU C 3 770 ? -27.652 24.635 34.274  1.00 62.89  ? 770  GLU A CA    1 
ATOM   6938 C  C     . GLU C 3 770 ? -27.009 25.765 35.086  1.00 62.37  ? 770  GLU A C     1 
ATOM   6939 O  O     . GLU C 3 770 ? -26.431 25.543 36.154  1.00 61.91  ? 770  GLU A O     1 
ATOM   6940 C  CB    . GLU C 3 770 ? -26.576 23.738 33.659  1.00 63.08  ? 770  GLU A CB    1 
ATOM   6941 C  CG    . GLU C 3 770 ? -27.144 22.528 32.882  1.00 64.63  ? 770  GLU A CG    1 
ATOM   6942 C  CD    . GLU C 3 770 ? -27.818 21.471 33.778  1.00 66.63  ? 770  GLU A CD    1 
ATOM   6943 O  OE1   . GLU C 3 770 ? -27.700 21.567 35.031  1.00 66.73  ? 770  GLU A OE1   1 
ATOM   6944 O  OE2   . GLU C 3 770 ? -28.467 20.546 33.215  1.00 66.84  ? 770  GLU A OE2   1 
ATOM   6945 N  N     . PHE C 3 771 ? -27.140 26.978 34.575  1.00 62.10  ? 771  PHE A N     1 
ATOM   6946 C  CA    . PHE C 3 771 ? -26.542 28.141 35.179  1.00 62.10  ? 771  PHE A CA    1 
ATOM   6947 C  C     . PHE C 3 771 ? -26.536 28.153 36.717  1.00 62.01  ? 771  PHE A C     1 
ATOM   6948 O  O     . PHE C 3 771 ? -25.486 28.332 37.324  1.00 61.50  ? 771  PHE A O     1 
ATOM   6949 C  CB    . PHE C 3 771 ? -27.228 29.385 34.637  1.00 62.43  ? 771  PHE A CB    1 
ATOM   6950 C  CG    . PHE C 3 771 ? -26.645 30.656 35.149  1.00 63.59  ? 771  PHE A CG    1 
ATOM   6951 C  CD1   . PHE C 3 771 ? -25.591 31.269 34.476  1.00 64.67  ? 771  PHE A CD1   1 
ATOM   6952 C  CD2   . PHE C 3 771 ? -27.138 31.244 36.312  1.00 64.47  ? 771  PHE A CD2   1 
ATOM   6953 C  CE1   . PHE C 3 771 ? -25.035 32.459 34.950  1.00 65.64  ? 771  PHE A CE1   1 
ATOM   6954 C  CE2   . PHE C 3 771 ? -26.589 32.433 36.797  1.00 65.85  ? 771  PHE A CE2   1 
ATOM   6955 C  CZ    . PHE C 3 771 ? -25.529 33.044 36.116  1.00 64.96  ? 771  PHE A CZ    1 
ATOM   6956 N  N     . ARG C 3 772 ? -27.696 27.946 37.341  1.00 62.15  ? 772  ARG A N     1 
ATOM   6957 C  CA    . ARG C 3 772 ? -27.844 28.171 38.795  1.00 62.22  ? 772  ARG A CA    1 
ATOM   6958 C  C     . ARG C 3 772 ? -26.957 27.259 39.624  1.00 61.84  ? 772  ARG A C     1 
ATOM   6959 O  O     . ARG C 3 772 ? -26.768 27.484 40.827  1.00 61.67  ? 772  ARG A O     1 
ATOM   6960 C  CB    . ARG C 3 772 ? -29.301 28.004 39.257  1.00 62.73  ? 772  ARG A CB    1 
ATOM   6961 C  CG    . ARG C 3 772 ? -30.327 28.816 38.465  1.00 64.02  ? 772  ARG A CG    1 
ATOM   6962 C  CD    . ARG C 3 772 ? -31.336 29.551 39.391  1.00 65.86  ? 772  ARG A CD    1 
ATOM   6963 N  NE    . ARG C 3 772 ? -31.991 30.715 38.755  1.00 68.15  ? 772  ARG A NE    1 
ATOM   6964 C  CZ    . ARG C 3 772 ? -32.064 30.986 37.440  1.00 68.75  ? 772  ARG A CZ    1 
ATOM   6965 N  NH1   . ARG C 3 772 ? -31.545 30.180 36.514  1.00 69.00  ? 772  ARG A NH1   1 
ATOM   6966 N  NH2   . ARG C 3 772 ? -32.681 32.092 37.039  1.00 69.72  ? 772  ARG A NH2   1 
ATOM   6967 N  N     . GLN C 3 773 ? -26.419 26.229 38.973  1.00 61.31  ? 773  GLN A N     1 
ATOM   6968 C  CA    . GLN C 3 773 ? -25.582 25.238 39.650  1.00 60.87  ? 773  GLN A CA    1 
ATOM   6969 C  C     . GLN C 3 773 ? -24.101 25.623 39.766  1.00 60.11  ? 773  GLN A C     1 
ATOM   6970 O  O     . GLN C 3 773 ? -23.372 25.052 40.590  1.00 60.36  ? 773  GLN A O     1 
ATOM   6971 C  CB    . GLN C 3 773 ? -25.731 23.865 38.989  1.00 60.82  ? 773  GLN A CB    1 
ATOM   6972 C  CG    . GLN C 3 773 ? -27.144 23.301 39.089  1.00 61.97  ? 773  GLN A CG    1 
ATOM   6973 C  CD    . GLN C 3 773 ? -27.665 23.266 40.525  1.00 63.03  ? 773  GLN A CD    1 
ATOM   6974 O  OE1   . GLN C 3 773 ? -26.935 22.928 41.464  1.00 63.03  ? 773  GLN A OE1   1 
ATOM   6975 N  NE2   . GLN C 3 773 ? -28.933 23.624 40.698  1.00 64.05  ? 773  GLN A NE2   1 
ATOM   6976 N  N     . LEU C 3 774 ? -23.680 26.601 38.963  1.00 58.75  ? 774  LEU A N     1 
ATOM   6977 C  CA    . LEU C 3 774 ? -22.279 26.986 38.847  1.00 57.33  ? 774  LEU A CA    1 
ATOM   6978 C  C     . LEU C 3 774 ? -21.743 27.593 40.124  1.00 56.80  ? 774  LEU A C     1 
ATOM   6979 O  O     . LEU C 3 774 ? -22.498 28.122 40.945  1.00 56.62  ? 774  LEU A O     1 
ATOM   6980 C  CB    . LEU C 3 774 ? -22.079 27.960 37.685  1.00 57.08  ? 774  LEU A CB    1 
ATOM   6981 C  CG    . LEU C 3 774 ? -22.165 27.371 36.278  1.00 56.06  ? 774  LEU A CG    1 
ATOM   6982 C  CD1   . LEU C 3 774 ? -22.353 28.478 35.267  1.00 55.81  ? 774  LEU A CD1   1 
ATOM   6983 C  CD2   . LEU C 3 774 ? -20.930 26.551 35.957  1.00 54.70  ? 774  LEU A CD2   1 
ATOM   6984 N  N     . ASN C 3 775 ? -20.427 27.508 40.273  1.00 56.05  ? 775  ASN A N     1 
ATOM   6985 C  CA    . ASN C 3 775 ? -19.727 28.021 41.435  1.00 55.40  ? 775  ASN A CA    1 
ATOM   6986 C  C     . ASN C 3 775 ? -19.740 29.545 41.456  1.00 54.74  ? 775  ASN A C     1 
ATOM   6987 O  O     . ASN C 3 775 ? -19.391 30.198 40.466  1.00 54.87  ? 775  ASN A O     1 
ATOM   6988 C  CB    . ASN C 3 775 ? -18.297 27.498 41.428  1.00 55.58  ? 775  ASN A CB    1 
ATOM   6989 C  CG    . ASN C 3 775 ? -17.488 28.025 42.571  1.00 56.63  ? 775  ASN A CG    1 
ATOM   6990 O  OD1   . ASN C 3 775 ? -17.651 27.596 43.715  1.00 57.74  ? 775  ASN A OD1   1 
ATOM   6991 N  ND2   . ASN C 3 775 ? -16.593 28.964 42.274  1.00 58.18  ? 775  ASN A ND2   1 
ATOM   6992 N  N     . TYR C 3 776 ? -20.144 30.106 42.589  1.00 53.85  ? 776  TYR A N     1 
ATOM   6993 C  CA    . TYR C 3 776 ? -20.353 31.542 42.706  1.00 53.18  ? 776  TYR A CA    1 
ATOM   6994 C  C     . TYR C 3 776 ? -19.181 32.370 42.191  1.00 52.90  ? 776  TYR A C     1 
ATOM   6995 O  O     . TYR C 3 776 ? -19.397 33.374 41.495  1.00 52.96  ? 776  TYR A O     1 
ATOM   6996 C  CB    . TYR C 3 776 ? -20.725 31.936 44.145  1.00 53.42  ? 776  TYR A CB    1 
ATOM   6997 C  CG    . TYR C 3 776 ? -19.598 31.912 45.149  1.00 53.54  ? 776  TYR A CG    1 
ATOM   6998 C  CD1   . TYR C 3 776 ? -19.154 30.711 45.715  1.00 53.31  ? 776  TYR A CD1   1 
ATOM   6999 C  CD2   . TYR C 3 776 ? -18.983 33.093 45.549  1.00 54.54  ? 776  TYR A CD2   1 
ATOM   7000 C  CE1   . TYR C 3 776 ? -18.119 30.693 46.639  1.00 53.16  ? 776  TYR A CE1   1 
ATOM   7001 C  CE2   . TYR C 3 776 ? -17.938 33.085 46.473  1.00 54.92  ? 776  TYR A CE2   1 
ATOM   7002 C  CZ    . TYR C 3 776 ? -17.516 31.884 47.014  1.00 54.30  ? 776  TYR A CZ    1 
ATOM   7003 O  OH    . TYR C 3 776 ? -16.488 31.896 47.927  1.00 54.87  ? 776  TYR A OH    1 
ATOM   7004 N  N     . ILE C 3 777 ? -17.957 31.944 42.524  1.00 52.17  ? 777  ILE A N     1 
ATOM   7005 C  CA    . ILE C 3 777 ? -16.741 32.601 42.055  1.00 51.59  ? 777  ILE A CA    1 
ATOM   7006 C  C     . ILE C 3 777 ? -16.667 32.598 40.525  1.00 51.76  ? 777  ILE A C     1 
ATOM   7007 O  O     . ILE C 3 777 ? -16.406 33.643 39.918  1.00 51.63  ? 777  ILE A O     1 
ATOM   7008 C  CB    . ILE C 3 777 ? -15.461 31.971 42.662  1.00 51.47  ? 777  ILE A CB    1 
ATOM   7009 C  CG1   . ILE C 3 777 ? -15.389 32.269 44.163  1.00 51.74  ? 777  ILE A CG1   1 
ATOM   7010 C  CG2   . ILE C 3 777 ? -14.213 32.510 41.971  1.00 50.28  ? 777  ILE A CG2   1 
ATOM   7011 C  CD1   . ILE C 3 777 ? -14.422 31.397 44.934  1.00 50.95  ? 777  ILE A CD1   1 
ATOM   7012 N  N     . SER C 3 778 ? -16.939 31.439 39.914  1.00 51.39  ? 778  SER A N     1 
ATOM   7013 C  CA    . SER C 3 778 ? -16.810 31.259 38.471  1.00 51.34  ? 778  SER A CA    1 
ATOM   7014 C  C     . SER C 3 778 ? -17.786 32.135 37.694  1.00 50.93  ? 778  SER A C     1 
ATOM   7015 O  O     . SER C 3 778 ? -17.635 32.354 36.502  1.00 50.67  ? 778  SER A O     1 
ATOM   7016 C  CB    . SER C 3 778 ? -16.999 29.783 38.104  1.00 51.64  ? 778  SER A CB    1 
ATOM   7017 O  OG    . SER C 3 778 ? -18.375 29.453 37.963  1.00 53.04  ? 778  SER A OG    1 
ATOM   7018 N  N     . ILE C 3 779 ? -18.795 32.634 38.382  1.00 51.15  ? 779  ILE A N     1 
ATOM   7019 C  CA    . ILE C 3 779 ? -19.808 33.454 37.731  1.00 51.48  ? 779  ILE A CA    1 
ATOM   7020 C  C     . ILE C 3 779 ? -19.908 34.874 38.300  1.00 51.52  ? 779  ILE A C     1 
ATOM   7021 O  O     . ILE C 3 779 ? -20.871 35.591 38.002  1.00 51.65  ? 779  ILE A O     1 
ATOM   7022 C  CB    . ILE C 3 779 ? -21.193 32.778 37.736  1.00 51.32  ? 779  ILE A CB    1 
ATOM   7023 C  CG1   . ILE C 3 779 ? -21.588 32.381 39.160  1.00 51.38  ? 779  ILE A CG1   1 
ATOM   7024 C  CG2   . ILE C 3 779 ? -21.186 31.580 36.797  1.00 51.40  ? 779  ILE A CG2   1 
ATOM   7025 C  CD1   . ILE C 3 779 ? -23.049 32.009 39.308  1.00 51.94  ? 779  ILE A CD1   1 
ATOM   7026 N  N     . ALA C 3 780 ? -18.916 35.270 39.100  1.00 51.16  ? 780  ALA A N     1 
ATOM   7027 C  CA    . ALA C 3 780 ? -18.817 36.643 39.595  1.00 50.97  ? 780  ALA A CA    1 
ATOM   7028 C  C     . ALA C 3 780 ? -18.083 37.532 38.587  1.00 50.96  ? 780  ALA A C     1 
ATOM   7029 O  O     . ALA C 3 780 ? -17.198 37.067 37.871  1.00 51.04  ? 780  ALA A O     1 
ATOM   7030 C  CB    . ALA C 3 780 ? -18.121 36.685 40.955  1.00 50.82  ? 780  ALA A CB    1 
ATOM   7031 N  N     . SER C 3 781 ? -18.478 38.804 38.529  1.00 50.82  ? 781  SER A N     1 
ATOM   7032 C  CA    . SER C 3 781 ? -17.827 39.802 37.689  1.00 50.35  ? 781  SER A CA    1 
ATOM   7033 C  C     . SER C 3 781 ? -16.616 40.294 38.450  1.00 49.78  ? 781  SER A C     1 
ATOM   7034 O  O     . SER C 3 781 ? -16.545 40.125 39.666  1.00 49.65  ? 781  SER A O     1 
ATOM   7035 C  CB    . SER C 3 781 ? -18.776 40.972 37.425  1.00 50.45  ? 781  SER A CB    1 
ATOM   7036 O  OG    . SER C 3 781 ? -20.083 40.499 37.144  1.00 51.50  ? 781  SER A OG    1 
ATOM   7037 N  N     . VAL C 3 782 ? -15.656 40.881 37.746  1.00 49.17  ? 782  VAL A N     1 
ATOM   7038 C  CA    . VAL C 3 782 ? -14.472 41.408 38.402  1.00 48.79  ? 782  VAL A CA    1 
ATOM   7039 C  C     . VAL C 3 782 ? -14.341 42.899 38.080  1.00 49.11  ? 782  VAL A C     1 
ATOM   7040 O  O     . VAL C 3 782 ? -14.650 43.329 36.969  1.00 49.04  ? 782  VAL A O     1 
ATOM   7041 C  CB    . VAL C 3 782 ? -13.196 40.652 37.962  1.00 48.58  ? 782  VAL A CB    1 
ATOM   7042 C  CG1   . VAL C 3 782 ? -12.042 41.003 38.852  1.00 48.02  ? 782  VAL A CG1   1 
ATOM   7043 C  CG2   . VAL C 3 782 ? -13.411 39.161 37.999  1.00 48.12  ? 782  VAL A CG2   1 
ATOM   7044 N  N     . SER C 3 783 ? -13.896 43.685 39.056  1.00 49.27  ? 783  SER A N     1 
ATOM   7045 C  CA    . SER C 3 783 ? -13.585 45.093 38.818  1.00 49.65  ? 783  SER A CA    1 
ATOM   7046 C  C     . SER C 3 783 ? -12.422 45.592 39.691  1.00 49.87  ? 783  SER A C     1 
ATOM   7047 O  O     . SER C 3 783 ? -11.867 44.854 40.497  1.00 49.82  ? 783  SER A O     1 
ATOM   7048 C  CB    . SER C 3 783 ? -14.824 45.944 39.035  1.00 49.29  ? 783  SER A CB    1 
ATOM   7049 O  OG    . SER C 3 783 ? -14.750 47.111 38.255  1.00 50.01  ? 783  SER A OG    1 
ATOM   7050 N  N     . SER C 3 784 ? -12.051 46.850 39.532  1.00 50.35  ? 784  SER A N     1 
ATOM   7051 C  CA    . SER C 3 784 ? -10.943 47.369 40.298  1.00 50.97  ? 784  SER A CA    1 
ATOM   7052 C  C     . SER C 3 784 ? -11.437 48.270 41.405  1.00 51.44  ? 784  SER A C     1 
ATOM   7053 O  O     . SER C 3 784 ? -12.338 49.083 41.208  1.00 50.85  ? 784  SER A O     1 
ATOM   7054 C  CB    . SER C 3 784 ? -9.970  48.110 39.388  1.00 51.13  ? 784  SER A CB    1 
ATOM   7055 O  OG    . SER C 3 784 ? -9.369  47.215 38.468  1.00 51.83  ? 784  SER A OG    1 
ATOM   7056 N  N     . ALA C 3 785 ? -10.835 48.114 42.574  1.00 52.50  ? 785  ALA A N     1 
ATOM   7057 C  CA    . ALA C 3 785 ? -11.202 48.913 43.738  1.00 53.92  ? 785  ALA A CA    1 
ATOM   7058 C  C     . ALA C 3 785 ? -10.604 50.333 43.700  1.00 54.97  ? 785  ALA A C     1 
ATOM   7059 O  O     . ALA C 3 785 ? -9.671  50.638 44.457  1.00 55.20  ? 785  ALA A O     1 
ATOM   7060 C  CB    . ALA C 3 785 ? -10.789 48.182 45.025  1.00 53.66  ? 785  ALA A CB    1 
ATOM   7061 N  N     . ASN C 3 786 ? -11.131 51.202 42.833  1.00 56.13  ? 786  ASN A N     1 
ATOM   7062 C  CA    . ASN C 3 786 ? -10.579 52.559 42.716  1.00 57.30  ? 786  ASN A CA    1 
ATOM   7063 C  C     . ASN C 3 786 ? -11.456 53.626 43.334  1.00 58.38  ? 786  ASN A C     1 
ATOM   7064 O  O     . ASN C 3 786 ? -12.673 53.574 43.206  1.00 58.72  ? 786  ASN A O     1 
ATOM   7065 C  CB    . ASN C 3 786 ? -10.252 52.909 41.261  1.00 56.95  ? 786  ASN A CB    1 
ATOM   7066 C  CG    . ASN C 3 786 ? -9.059  52.131 40.723  1.00 56.64  ? 786  ASN A CG    1 
ATOM   7067 O  OD1   . ASN C 3 786 ? -8.767  52.165 39.524  1.00 55.62  ? 786  ASN A OD1   1 
ATOM   7068 N  ND2   . ASN C 3 786 ? -8.367  51.419 41.607  1.00 56.43  ? 786  ASN A ND2   1 
ATOM   7069 N  N     . ASN C 3 787 ? -10.828 54.583 44.015  1.00 59.76  ? 787  ASN A N     1 
ATOM   7070 C  CA    . ASN C 3 787 ? -11.517 55.762 44.549  1.00 61.06  ? 787  ASN A CA    1 
ATOM   7071 C  C     . ASN C 3 787 ? -12.601 55.499 45.587  1.00 61.70  ? 787  ASN A C     1 
ATOM   7072 O  O     . ASN C 3 787 ? -13.559 56.281 45.694  1.00 61.77  ? 787  ASN A O     1 
ATOM   7073 C  CB    . ASN C 3 787 ? -12.106 56.594 43.405  1.00 61.30  ? 787  ASN A CB    1 
ATOM   7074 C  CG    . ASN C 3 787 ? -11.071 57.436 42.720  1.00 62.75  ? 787  ASN A CG    1 
ATOM   7075 O  OD1   . ASN C 3 787 ? -10.962 57.437 41.489  1.00 63.34  ? 787  ASN A OD1   1 
ATOM   7076 N  ND2   . ASN C 3 787 ? -10.274 58.152 43.518  1.00 64.30  ? 787  ASN A ND2   1 
ATOM   7077 N  N     . ILE C 3 788 ? -12.458 54.416 46.350  1.00 62.48  ? 788  ILE A N     1 
ATOM   7078 C  CA    . ILE C 3 788 ? -13.440 54.090 47.391  1.00 63.34  ? 788  ILE A CA    1 
ATOM   7079 C  C     . ILE C 3 788 ? -13.654 55.321 48.265  1.00 63.92  ? 788  ILE A C     1 
ATOM   7080 O  O     . ILE C 3 788 ? -14.780 55.784 48.428  1.00 63.99  ? 788  ILE A O     1 
ATOM   7081 C  CB    . ILE C 3 788 ? -13.009 52.883 48.278  1.00 63.44  ? 788  ILE A CB    1 
ATOM   7082 C  CG1   . ILE C 3 788 ? -12.914 51.595 47.454  1.00 63.02  ? 788  ILE A CG1   1 
ATOM   7083 C  CG2   . ILE C 3 788 ? -13.979 52.698 49.454  1.00 63.13  ? 788  ILE A CG2   1 
ATOM   7084 C  CD1   . ILE C 3 788 ? -11.919 50.600 48.007  1.00 62.84  ? 788  ILE A CD1   1 
ATOM   7085 N  N     . ALA C 3 789 ? -12.560 55.858 48.795  1.00 64.69  ? 789  ALA A N     1 
ATOM   7086 C  CA    . ALA C 3 789 ? -12.609 57.036 49.641  1.00 65.53  ? 789  ALA A CA    1 
ATOM   7087 C  C     . ALA C 3 789 ? -13.531 58.099 49.052  1.00 66.21  ? 789  ALA A C     1 
ATOM   7088 O  O     . ALA C 3 789 ? -14.522 58.488 49.681  1.00 66.46  ? 789  ALA A O     1 
ATOM   7089 C  CB    . ALA C 3 789 ? -11.216 57.589 49.827  1.00 65.52  ? 789  ALA A CB    1 
ATOM   7090 N  N     . LYS C 3 790 ? -13.215 58.527 47.827  1.00 66.87  ? 790  LYS A N     1 
ATOM   7091 C  CA    . LYS C 3 790 ? -13.919 59.605 47.132  1.00 67.28  ? 790  LYS A CA    1 
ATOM   7092 C  C     . LYS C 3 790 ? -15.437 59.473 47.171  1.00 67.80  ? 790  LYS A C     1 
ATOM   7093 O  O     . LYS C 3 790 ? -16.140 60.477 47.275  1.00 68.21  ? 790  LYS A O     1 
ATOM   7094 C  CB    . LYS C 3 790 ? -13.434 59.697 45.682  1.00 67.24  ? 790  LYS A CB    1 
ATOM   7095 C  CG    . LYS C 3 790 ? -14.289 60.561 44.759  1.00 66.72  ? 790  LYS A CG    1 
ATOM   7096 C  CD    . LYS C 3 790 ? -14.058 60.163 43.317  1.00 66.02  ? 790  LYS A CD    1 
ATOM   7097 C  CE    . LYS C 3 790 ? -14.618 61.189 42.350  1.00 65.20  ? 790  LYS A CE    1 
ATOM   7098 N  NZ    . LYS C 3 790 ? -14.044 60.973 40.990  1.00 63.70  ? 790  LYS A NZ    1 
ATOM   7099 N  N     . TYR C 3 791 ? -15.940 58.245 47.089  1.00 68.24  ? 791  TYR A N     1 
ATOM   7100 C  CA    . TYR C 3 791 ? -17.381 58.022 47.015  1.00 68.80  ? 791  TYR A CA    1 
ATOM   7101 C  C     . TYR C 3 791 ? -17.993 57.594 48.354  1.00 69.47  ? 791  TYR A C     1 
ATOM   7102 O  O     . TYR C 3 791 ? -19.165 57.191 48.413  1.00 69.60  ? 791  TYR A O     1 
ATOM   7103 C  CB    . TYR C 3 791 ? -17.728 57.012 45.902  1.00 68.53  ? 791  TYR A CB    1 
ATOM   7104 C  CG    . TYR C 3 791 ? -17.477 57.503 44.482  1.00 68.08  ? 791  TYR A CG    1 
ATOM   7105 C  CD1   . TYR C 3 791 ? -18.275 58.499 43.916  1.00 68.36  ? 791  TYR A CD1   1 
ATOM   7106 C  CD2   . TYR C 3 791 ? -16.452 56.963 43.704  1.00 66.80  ? 791  TYR A CD2   1 
ATOM   7107 C  CE1   . TYR C 3 791 ? -18.058 58.952 42.614  1.00 67.94  ? 791  TYR A CE1   1 
ATOM   7108 C  CE2   . TYR C 3 791 ? -16.226 57.404 42.406  1.00 67.10  ? 791  TYR A CE2   1 
ATOM   7109 C  CZ    . TYR C 3 791 ? -17.033 58.400 41.864  1.00 67.99  ? 791  TYR A CZ    1 
ATOM   7110 O  OH    . TYR C 3 791 ? -16.823 58.849 40.576  1.00 67.80  ? 791  TYR A OH    1 
ATOM   7111 N  N     . ASP C 3 792 ? -17.218 57.696 49.430  1.00 70.18  ? 792  ASP A N     1 
ATOM   7112 C  CA    . ASP C 3 792 ? -17.696 57.218 50.733  1.00 71.09  ? 792  ASP A CA    1 
ATOM   7113 C  C     . ASP C 3 792 ? -18.402 58.290 51.564  1.00 71.41  ? 792  ASP A C     1 
ATOM   7114 O  O     . ASP C 3 792 ? -17.743 59.102 52.227  1.00 71.87  ? 792  ASP A O     1 
ATOM   7115 C  CB    . ASP C 3 792 ? -16.559 56.584 51.542  1.00 71.27  ? 792  ASP A CB    1 
ATOM   7116 C  CG    . ASP C 3 792 ? -17.041 55.963 52.842  1.00 71.97  ? 792  ASP A CG    1 
ATOM   7117 O  OD1   . ASP C 3 792 ? -18.275 55.799 53.016  1.00 72.59  ? 792  ASP A OD1   1 
ATOM   7118 O  OD2   . ASP C 3 792 ? -16.180 55.638 53.688  1.00 72.22  ? 792  ASP A OD2   1 
ATOM   7119 N  N     . VAL C 3 793 ? -19.736 58.280 51.526  1.00 71.42  ? 793  VAL A N     1 
ATOM   7120 C  CA    . VAL C 3 793 ? -20.553 59.162 52.368  1.00 71.31  ? 793  VAL A CA    1 
ATOM   7121 C  C     . VAL C 3 793 ? -20.662 58.558 53.781  1.00 71.22  ? 793  VAL A C     1 
ATOM   7122 O  O     . VAL C 3 793 ? -21.655 57.906 54.137  1.00 71.05  ? 793  VAL A O     1 
ATOM   7123 C  CB    . VAL C 3 793 ? -21.928 59.497 51.693  1.00 71.32  ? 793  VAL A CB    1 
ATOM   7124 C  CG1   . VAL C 3 793 ? -23.036 59.818 52.714  1.00 71.13  ? 793  VAL A CG1   1 
ATOM   7125 C  CG2   . VAL C 3 793 ? -21.754 60.650 50.708  1.00 71.58  ? 793  VAL A CG2   1 
ATOM   7126 N  N     . GLY C 3 794 ? -19.596 58.758 54.556  1.00 71.04  ? 794  GLY A N     1 
ATOM   7127 C  CA    . GLY C 3 794 ? -19.489 58.263 55.925  1.00 70.99  ? 794  GLY A CA    1 
ATOM   7128 C  C     . GLY C 3 794 ? -19.997 56.850 56.151  1.00 70.95  ? 794  GLY A C     1 
ATOM   7129 O  O     . GLY C 3 794 ? -20.546 56.554 57.214  1.00 71.03  ? 794  GLY A O     1 
ATOM   7130 N  N     . GLY C 3 795 ? -19.819 55.980 55.152  1.00 70.86  ? 795  GLY A N     1 
ATOM   7131 C  CA    . GLY C 3 795 ? -20.227 54.572 55.249  1.00 70.33  ? 795  GLY A CA    1 
ATOM   7132 C  C     . GLY C 3 795 ? -21.126 54.079 54.126  1.00 70.03  ? 795  GLY A C     1 
ATOM   7133 O  O     . GLY C 3 795 ? -21.209 52.871 53.880  1.00 70.28  ? 795  GLY A O     1 
ATOM   7134 N  N     . PHE C 3 796 ? -21.797 55.010 53.447  1.00 69.47  ? 796  PHE A N     1 
ATOM   7135 C  CA    . PHE C 3 796 ? -22.767 54.689 52.403  1.00 68.80  ? 796  PHE A CA    1 
ATOM   7136 C  C     . PHE C 3 796 ? -22.340 55.313 51.071  1.00 68.20  ? 796  PHE A C     1 
ATOM   7137 O  O     . PHE C 3 796 ? -21.510 56.222 51.070  1.00 68.21  ? 796  PHE A O     1 
ATOM   7138 C  CB    . PHE C 3 796 ? -24.134 55.228 52.806  1.00 69.05  ? 796  PHE A CB    1 
ATOM   7139 C  CG    . PHE C 3 796 ? -24.854 54.383 53.822  1.00 69.89  ? 796  PHE A CG    1 
ATOM   7140 C  CD1   . PHE C 3 796 ? -24.419 54.329 55.148  1.00 70.34  ? 796  PHE A CD1   1 
ATOM   7141 C  CD2   . PHE C 3 796 ? -25.997 53.666 53.458  1.00 70.81  ? 796  PHE A CD2   1 
ATOM   7142 C  CE1   . PHE C 3 796 ? -25.098 53.548 56.093  1.00 70.74  ? 796  PHE A CE1   1 
ATOM   7143 C  CE2   . PHE C 3 796 ? -26.689 52.886 54.392  1.00 70.74  ? 796  PHE A CE2   1 
ATOM   7144 C  CZ    . PHE C 3 796 ? -26.238 52.825 55.711  1.00 70.60  ? 796  PHE A CZ    1 
ATOM   7145 N  N     . PRO C 3 797 ? -22.897 54.825 49.934  1.00 67.54  ? 797  PRO A N     1 
ATOM   7146 C  CA    . PRO C 3 797 ? -22.631 55.398 48.600  1.00 67.08  ? 797  PRO A CA    1 
ATOM   7147 C  C     . PRO C 3 797 ? -22.778 56.916 48.521  1.00 66.58  ? 797  PRO A C     1 
ATOM   7148 O  O     . PRO C 3 797 ? -23.714 57.480 49.084  1.00 66.56  ? 797  PRO A O     1 
ATOM   7149 C  CB    . PRO C 3 797 ? -23.692 54.744 47.713  1.00 66.57  ? 797  PRO A CB    1 
ATOM   7150 C  CG    . PRO C 3 797 ? -23.989 53.481 48.365  1.00 67.17  ? 797  PRO A CG    1 
ATOM   7151 C  CD    . PRO C 3 797 ? -23.812 53.672 49.845  1.00 67.55  ? 797  PRO A CD    1 
ATOM   7152 N  N     . GLY C 3 798 ? -21.843 57.558 47.826  1.00 66.29  ? 798  GLY A N     1 
ATOM   7153 C  CA    . GLY C 3 798 ? -21.928 58.987 47.532  1.00 65.60  ? 798  GLY A CA    1 
ATOM   7154 C  C     . GLY C 3 798 ? -22.610 59.246 46.198  1.00 64.98  ? 798  GLY A C     1 
ATOM   7155 O  O     . GLY C 3 798 ? -23.155 58.321 45.580  1.00 65.02  ? 798  GLY A O     1 
ATOM   7156 N  N     . PRO C 3 799 ? -22.599 60.513 45.750  1.00 64.32  ? 799  PRO A N     1 
ATOM   7157 C  CA    . PRO C 3 799 ? -23.102 60.868 44.419  1.00 63.47  ? 799  PRO A CA    1 
ATOM   7158 C  C     . PRO C 3 799 ? -22.323 60.170 43.298  1.00 62.42  ? 799  PRO A C     1 
ATOM   7159 O  O     . PRO C 3 799 ? -21.103 60.035 43.389  1.00 62.01  ? 799  PRO A O     1 
ATOM   7160 C  CB    . PRO C 3 799 ? -22.881 62.388 44.351  1.00 63.57  ? 799  PRO A CB    1 
ATOM   7161 C  CG    . PRO C 3 799 ? -22.789 62.829 45.789  1.00 63.92  ? 799  PRO A CG    1 
ATOM   7162 C  CD    . PRO C 3 799 ? -22.127 61.693 46.499  1.00 64.33  ? 799  PRO A CD    1 
ATOM   7163 N  N     . LYS C 3 800 ? -23.044 59.727 42.264  1.00 61.40  ? 800  LYS A N     1 
ATOM   7164 C  CA    . LYS C 3 800 ? -22.472 59.106 41.057  1.00 60.20  ? 800  LYS A CA    1 
ATOM   7165 C  C     . LYS C 3 800 ? -21.917 57.701 41.303  1.00 59.35  ? 800  LYS A C     1 
ATOM   7166 O  O     . LYS C 3 800 ? -21.785 56.904 40.377  1.00 59.35  ? 800  LYS A O     1 
ATOM   7167 C  CB    . LYS C 3 800 ? -21.394 59.989 40.431  1.00 60.20  ? 800  LYS A CB    1 
ATOM   7168 C  CG    . LYS C 3 800 ? -21.854 61.383 40.053  1.00 60.92  ? 800  LYS A CG    1 
ATOM   7169 C  CD    . LYS C 3 800 ? -20.644 62.245 39.682  1.00 62.30  ? 800  LYS A CD    1 
ATOM   7170 C  CE    . LYS C 3 800 ? -21.053 63.636 39.212  1.00 62.59  ? 800  LYS A CE    1 
ATOM   7171 N  NZ    . LYS C 3 800 ? -21.905 63.573 37.994  1.00 61.72  ? 800  LYS A NZ    1 
ATOM   7172 N  N     . CYS C 3 801 ? -21.618 57.412 42.562  1.00 58.19  ? 801  CYS A N     1 
ATOM   7173 C  CA    . CYS C 3 801 ? -20.975 56.181 42.986  1.00 57.22  ? 801  CYS A CA    1 
ATOM   7174 C  C     . CYS C 3 801 ? -21.303 54.956 42.129  1.00 56.45  ? 801  CYS A C     1 
ATOM   7175 O  O     . CYS C 3 801 ? -22.462 54.596 42.002  1.00 56.72  ? 801  CYS A O     1 
ATOM   7176 C  CB    . CYS C 3 801 ? -21.321 55.922 44.445  1.00 57.23  ? 801  CYS A CB    1 
ATOM   7177 S  SG    . CYS C 3 801 ? -20.664 54.393 45.062  1.00 57.94  ? 801  CYS A SG    1 
ATOM   7178 N  N     . PRO C 3 802 ? -20.266 54.321 41.537  1.00 55.73  ? 802  PRO A N     1 
ATOM   7179 C  CA    . PRO C 3 802 ? -20.345 53.148 40.643  1.00 54.83  ? 802  PRO A CA    1 
ATOM   7180 C  C     . PRO C 3 802 ? -20.784 51.848 41.315  1.00 54.15  ? 802  PRO A C     1 
ATOM   7181 O  O     . PRO C 3 802 ? -20.644 51.688 42.528  1.00 54.16  ? 802  PRO A O     1 
ATOM   7182 C  CB    . PRO C 3 802 ? -18.902 52.988 40.156  1.00 54.88  ? 802  PRO A CB    1 
ATOM   7183 C  CG    . PRO C 3 802 ? -18.234 54.320 40.437  1.00 54.91  ? 802  PRO A CG    1 
ATOM   7184 C  CD    . PRO C 3 802 ? -18.871 54.774 41.699  1.00 55.61  ? 802  PRO A CD    1 
ATOM   7185 N  N     . PHE C 3 803 ? -21.286 50.920 40.509  1.00 53.08  ? 803  PHE A N     1 
ATOM   7186 C  CA    . PHE C 3 803 ? -21.730 49.618 40.984  1.00 52.35  ? 803  PHE A CA    1 
ATOM   7187 C  C     . PHE C 3 803 ? -20.718 48.933 41.928  1.00 51.62  ? 803  PHE A C     1 
ATOM   7188 O  O     . PHE C 3 803 ? -21.027 48.629 43.085  1.00 51.26  ? 803  PHE A O     1 
ATOM   7189 C  CB    . PHE C 3 803 ? -22.013 48.731 39.776  1.00 52.45  ? 803  PHE A CB    1 
ATOM   7190 C  CG    . PHE C 3 803 ? -23.072 47.679 40.007  1.00 54.07  ? 803  PHE A CG    1 
ATOM   7191 C  CD1   . PHE C 3 803 ? -24.418 48.037 40.168  1.00 55.21  ? 803  PHE A CD1   1 
ATOM   7192 C  CD2   . PHE C 3 803 ? -22.738 46.323 40.004  1.00 54.41  ? 803  PHE A CD2   1 
ATOM   7193 C  CE1   . PHE C 3 803 ? -25.407 47.059 40.351  1.00 54.56  ? 803  PHE A CE1   1 
ATOM   7194 C  CE2   . PHE C 3 803 ? -23.719 45.340 40.181  1.00 54.44  ? 803  PHE A CE2   1 
ATOM   7195 C  CZ    . PHE C 3 803 ? -25.058 45.715 40.362  1.00 54.56  ? 803  PHE A CZ    1 
ATOM   7196 N  N     . HIS C 3 804 ? -19.505 48.711 41.432  1.00 50.74  ? 804  HIS A N     1 
ATOM   7197 C  CA    . HIS C 3 804 ? -18.528 47.877 42.129  1.00 49.79  ? 804  HIS A CA    1 
ATOM   7198 C  C     . HIS C 3 804 ? -18.073 48.570 43.393  1.00 49.67  ? 804  HIS A C     1 
ATOM   7199 O  O     . HIS C 3 804 ? -17.931 47.949 44.439  1.00 48.80  ? 804  HIS A O     1 
ATOM   7200 C  CB    . HIS C 3 804 ? -17.355 47.497 41.201  1.00 49.36  ? 804  HIS A CB    1 
ATOM   7201 C  CG    . HIS C 3 804 ? -16.548 48.665 40.713  1.00 48.27  ? 804  HIS A CG    1 
ATOM   7202 N  ND1   . HIS C 3 804 ? -17.050 49.613 39.848  1.00 47.09  ? 804  HIS A ND1   1 
ATOM   7203 C  CD2   . HIS C 3 804 ? -15.268 49.030 40.965  1.00 46.68  ? 804  HIS A CD2   1 
ATOM   7204 C  CE1   . HIS C 3 804 ? -16.120 50.520 39.603  1.00 46.03  ? 804  HIS A CE1   1 
ATOM   7205 N  NE2   . HIS C 3 804 ? -15.028 50.187 40.264  1.00 45.30  ? 804  HIS A NE2   1 
ATOM   7206 N  N     . ILE C 3 805 ? -17.890 49.879 43.283  1.00 50.40  ? 805  ILE A N     1 
ATOM   7207 C  CA    . ILE C 3 805 ? -17.584 50.731 44.426  1.00 51.36  ? 805  ILE A CA    1 
ATOM   7208 C  C     . ILE C 3 805 ? -18.690 50.607 45.466  1.00 52.18  ? 805  ILE A C     1 
ATOM   7209 O  O     . ILE C 3 805 ? -18.408 50.408 46.644  1.00 52.35  ? 805  ILE A O     1 
ATOM   7210 C  CB    . ILE C 3 805 ? -17.404 52.214 44.013  1.00 51.04  ? 805  ILE A CB    1 
ATOM   7211 C  CG1   . ILE C 3 805 ? -16.225 52.376 43.036  1.00 51.29  ? 805  ILE A CG1   1 
ATOM   7212 C  CG2   . ILE C 3 805 ? -17.219 53.086 45.231  1.00 51.03  ? 805  ILE A CG2   1 
ATOM   7213 C  CD1   . ILE C 3 805 ? -14.950 51.574 43.395  1.00 50.31  ? 805  ILE A CD1   1 
ATOM   7214 N  N     . ARG C 3 806 ? -19.941 50.698 45.014  1.00 53.07  ? 806  ARG A N     1 
ATOM   7215 C  CA    . ARG C 3 806 ? -21.092 50.506 45.878  1.00 54.20  ? 806  ARG A CA    1 
ATOM   7216 C  C     . ARG C 3 806 ? -20.994 49.163 46.582  1.00 54.79  ? 806  ARG A C     1 
ATOM   7217 O  O     . ARG C 3 806 ? -21.242 49.078 47.792  1.00 55.00  ? 806  ARG A O     1 
ATOM   7218 C  CB    . ARG C 3 806 ? -22.386 50.607 45.069  1.00 54.28  ? 806  ARG A CB    1 
ATOM   7219 C  CG    . ARG C 3 806 ? -23.664 50.284 45.838  1.00 55.00  ? 806  ARG A CG    1 
ATOM   7220 C  CD    . ARG C 3 806 ? -24.891 50.240 44.903  1.00 55.53  ? 806  ARG A CD    1 
ATOM   7221 N  NE    . ARG C 3 806 ? -25.309 51.576 44.457  1.00 56.68  ? 806  ARG A NE    1 
ATOM   7222 C  CZ    . ARG C 3 806 ? -26.053 52.425 45.172  1.00 56.01  ? 806  ARG A CZ    1 
ATOM   7223 N  NH1   . ARG C 3 806 ? -26.481 52.101 46.395  1.00 55.49  ? 806  ARG A NH1   1 
ATOM   7224 N  NH2   . ARG C 3 806 ? -26.364 53.609 44.661  1.00 54.69  ? 806  ARG A NH2   1 
ATOM   7225 N  N     . GLY C 3 807 ? -20.610 48.131 45.822  1.00 55.45  ? 807  GLY A N     1 
ATOM   7226 C  CA    . GLY C 3 807 ? -20.426 46.774 46.343  1.00 55.94  ? 807  GLY A CA    1 
ATOM   7227 C  C     . GLY C 3 807 ? -19.426 46.717 47.477  1.00 56.66  ? 807  GLY A C     1 
ATOM   7228 O  O     . GLY C 3 807 ? -19.628 46.004 48.457  1.00 56.84  ? 807  GLY A O     1 
ATOM   7229 N  N     . ILE C 3 808 ? -18.350 47.487 47.345  1.00 57.56  ? 808  ILE A N     1 
ATOM   7230 C  CA    . ILE C 3 808 ? -17.269 47.527 48.337  1.00 58.23  ? 808  ILE A CA    1 
ATOM   7231 C  C     . ILE C 3 808 ? -17.725 48.178 49.646  1.00 58.90  ? 808  ILE A C     1 
ATOM   7232 O  O     . ILE C 3 808 ? -17.293 47.782 50.740  1.00 59.16  ? 808  ILE A O     1 
ATOM   7233 C  CB    . ILE C 3 808 ? -16.033 48.270 47.769  1.00 58.16  ? 808  ILE A CB    1 
ATOM   7234 C  CG1   . ILE C 3 808 ? -15.387 47.439 46.659  1.00 58.04  ? 808  ILE A CG1   1 
ATOM   7235 C  CG2   . ILE C 3 808 ? -15.012 48.585 48.870  1.00 58.32  ? 808  ILE A CG2   1 
ATOM   7236 C  CD1   . ILE C 3 808 ? -14.451 48.202 45.747  1.00 57.32  ? 808  ILE A CD1   1 
ATOM   7237 N  N     . LEU C 3 809 ? -18.597 49.177 49.525  1.00 59.42  ? 809  LEU A N     1 
ATOM   7238 C  CA    . LEU C 3 809 ? -19.125 49.874 50.680  1.00 59.78  ? 809  LEU A CA    1 
ATOM   7239 C  C     . LEU C 3 809 ? -20.015 48.961 51.501  1.00 60.13  ? 809  LEU A C     1 
ATOM   7240 O  O     . LEU C 3 809 ? -19.974 48.993 52.731  1.00 60.27  ? 809  LEU A O     1 
ATOM   7241 C  CB    . LEU C 3 809 ? -19.891 51.117 50.255  1.00 59.62  ? 809  LEU A CB    1 
ATOM   7242 C  CG    . LEU C 3 809 ? -19.017 52.261 49.757  1.00 60.13  ? 809  LEU A CG    1 
ATOM   7243 C  CD1   . LEU C 3 809 ? -19.885 53.256 49.011  1.00 61.55  ? 809  LEU A CD1   1 
ATOM   7244 C  CD2   . LEU C 3 809 ? -18.245 52.952 50.890  1.00 60.46  ? 809  LEU A CD2   1 
ATOM   7245 N  N     . THR C 3 810 ? -20.802 48.135 50.823  1.00 60.54  ? 810  THR A N     1 
ATOM   7246 C  CA    . THR C 3 810 ? -21.719 47.249 51.527  1.00 61.52  ? 810  THR A CA    1 
ATOM   7247 C  C     . THR C 3 810 ? -20.918 46.194 52.284  1.00 62.34  ? 810  THR A C     1 
ATOM   7248 O  O     . THR C 3 810 ? -21.268 45.816 53.419  1.00 62.39  ? 810  THR A O     1 
ATOM   7249 C  CB    . THR C 3 810 ? -22.751 46.582 50.586  1.00 61.37  ? 810  THR A CB    1 
ATOM   7250 O  OG1   . THR C 3 810 ? -22.377 45.225 50.339  1.00 62.25  ? 810  THR A OG1   1 
ATOM   7251 C  CG2   . THR C 3 810 ? -22.866 47.327 49.264  1.00 61.15  ? 810  THR A CG2   1 
ATOM   7252 N  N     . TYR C 3 811 ? -19.841 45.734 51.641  1.00 63.20  ? 811  TYR A N     1 
ATOM   7253 C  CA    . TYR C 3 811 ? -18.892 44.807 52.245  1.00 63.88  ? 811  TYR A CA    1 
ATOM   7254 C  C     . TYR C 3 811 ? -18.411 45.367 53.583  1.00 64.50  ? 811  TYR A C     1 
ATOM   7255 O  O     . TYR C 3 811 ? -18.600 44.749 54.632  1.00 64.48  ? 811  TYR A O     1 
ATOM   7256 C  CB    . TYR C 3 811 ? -17.713 44.573 51.295  1.00 63.57  ? 811  TYR A CB    1 
ATOM   7257 C  CG    . TYR C 3 811 ? -16.695 43.557 51.769  1.00 63.51  ? 811  TYR A CG    1 
ATOM   7258 C  CD1   . TYR C 3 811 ? -17.016 42.194 51.850  1.00 64.11  ? 811  TYR A CD1   1 
ATOM   7259 C  CD2   . TYR C 3 811 ? -15.406 43.949 52.121  1.00 62.77  ? 811  TYR A CD2   1 
ATOM   7260 C  CE1   . TYR C 3 811 ? -16.070 41.244 52.277  1.00 63.36  ? 811  TYR A CE1   1 
ATOM   7261 C  CE2   . TYR C 3 811 ? -14.459 43.017 52.561  1.00 63.48  ? 811  TYR A CE2   1 
ATOM   7262 C  CZ    . TYR C 3 811 ? -14.792 41.663 52.632  1.00 63.80  ? 811  TYR A CZ    1 
ATOM   7263 O  OH    . TYR C 3 811 ? -13.850 40.735 53.062  1.00 64.00  ? 811  TYR A OH    1 
ATOM   7264 N  N     . ASN C 3 812 ? -17.835 46.562 53.536  1.00 65.37  ? 812  ASN A N     1 
ATOM   7265 C  CA    . ASN C 3 812 ? -17.203 47.172 54.702  1.00 66.45  ? 812  ASN A CA    1 
ATOM   7266 C  C     . ASN C 3 812 ? -18.133 47.439 55.884  1.00 67.24  ? 812  ASN A C     1 
ATOM   7267 O  O     . ASN C 3 812 ? -17.687 47.499 57.031  1.00 67.50  ? 812  ASN A O     1 
ATOM   7268 C  CB    . ASN C 3 812 ? -16.485 48.451 54.290  1.00 66.34  ? 812  ASN A CB    1 
ATOM   7269 C  CG    . ASN C 3 812 ? -15.357 48.194 53.311  1.00 65.85  ? 812  ASN A CG    1 
ATOM   7270 O  OD1   . ASN C 3 812 ? -14.851 49.118 52.692  1.00 66.53  ? 812  ASN A OD1   1 
ATOM   7271 N  ND2   . ASN C 3 812 ? -14.949 46.940 53.177  1.00 64.58  ? 812  ASN A ND2   1 
ATOM   7272 N  N     . ARG C 3 813 ? -19.421 47.593 55.601  1.00 68.17  ? 813  ARG A N     1 
ATOM   7273 C  CA    . ARG C 3 813 ? -20.418 47.698 56.652  1.00 68.85  ? 813  ARG A CA    1 
ATOM   7274 C  C     . ARG C 3 813 ? -20.722 46.323 57.225  1.00 69.45  ? 813  ARG A C     1 
ATOM   7275 O  O     . ARG C 3 813 ? -20.860 46.178 58.438  1.00 69.72  ? 813  ARG A O     1 
ATOM   7276 C  CB    . ARG C 3 813 ? -21.688 48.357 56.133  1.00 68.72  ? 813  ARG A CB    1 
ATOM   7277 C  CG    . ARG C 3 813 ? -21.502 49.818 55.743  1.00 69.01  ? 813  ARG A CG    1 
ATOM   7278 C  CD    . ARG C 3 813 ? -22.836 50.492 55.459  1.00 67.84  ? 813  ARG A CD    1 
ATOM   7279 N  NE    . ARG C 3 813 ? -23.677 49.696 54.563  1.00 66.57  ? 813  ARG A NE    1 
ATOM   7280 C  CZ    . ARG C 3 813 ? -23.665 49.770 53.234  1.00 65.61  ? 813  ARG A CZ    1 
ATOM   7281 N  NH1   . ARG C 3 813 ? -22.843 50.606 52.603  1.00 64.96  ? 813  ARG A NH1   1 
ATOM   7282 N  NH2   . ARG C 3 813 ? -24.486 48.997 52.535  1.00 64.58  ? 813  ARG A NH2   1 
ATOM   7283 N  N     . ALA C 3 814 ? -20.810 45.317 56.355  1.00 70.17  ? 814  ALA A N     1 
ATOM   7284 C  CA    . ALA C 3 814 ? -21.099 43.938 56.780  1.00 70.91  ? 814  ALA A CA    1 
ATOM   7285 C  C     . ALA C 3 814 ? -19.929 43.263 57.503  1.00 71.48  ? 814  ALA A C     1 
ATOM   7286 O  O     . ALA C 3 814 ? -20.069 42.138 57.987  1.00 71.55  ? 814  ALA A O     1 
ATOM   7287 C  CB    . ALA C 3 814 ? -21.551 43.089 55.594  1.00 70.82  ? 814  ALA A CB    1 
ATOM   7288 N  N     . ILE C 3 815 ? -18.780 43.939 57.558  1.00 72.14  ? 815  ILE A N     1 
ATOM   7289 C  CA    . ILE C 3 815 ? -17.620 43.446 58.314  1.00 72.86  ? 815  ILE A CA    1 
ATOM   7290 C  C     . ILE C 3 815 ? -17.116 44.472 59.344  1.00 73.47  ? 815  ILE A C     1 
ATOM   7291 O  O     . ILE C 3 815 ? -15.946 44.440 59.762  1.00 73.41  ? 815  ILE A O     1 
ATOM   7292 C  CB    . ILE C 3 815 ? -16.447 42.936 57.393  1.00 72.94  ? 815  ILE A CB    1 
ATOM   7293 C  CG1   . ILE C 3 815 ? -15.846 44.070 56.541  1.00 72.76  ? 815  ILE A CG1   1 
ATOM   7294 C  CG2   . ILE C 3 815 ? -16.899 41.743 56.537  1.00 72.93  ? 815  ILE A CG2   1 
ATOM   7295 C  CD1   . ILE C 3 815 ? -14.326 43.985 56.375  1.00 71.63  ? 815  ILE A CD1   1 
ATOM   7296 N  N     . LYS C 3 816 ? -18.019 45.372 59.744  1.00 74.21  ? 816  LYS A N     1 
ATOM   7297 C  CA    . LYS C 3 816 ? -17.781 46.359 60.804  1.00 74.71  ? 816  LYS A CA    1 
ATOM   7298 C  C     . LYS C 3 816 ? -17.036 45.773 62.010  1.00 74.93  ? 816  LYS A C     1 
ATOM   7299 O  O     . LYS C 3 816 ? -17.451 44.743 62.558  1.00 74.87  ? 816  LYS A O     1 
ATOM   7300 C  CB    . LYS C 3 816 ? -19.124 46.933 61.272  1.00 74.86  ? 816  LYS A CB    1 
ATOM   7301 C  CG    . LYS C 3 816 ? -19.521 48.246 60.630  1.00 75.33  ? 816  LYS A CG    1 
ATOM   7302 C  CD    . LYS C 3 816 ? -18.722 49.411 61.212  1.00 76.75  ? 816  LYS A CD    1 
ATOM   7303 C  CE    . LYS C 3 816 ? -19.217 50.747 60.668  1.00 77.41  ? 816  LYS A CE    1 
ATOM   7304 N  NZ    . LYS C 3 816 ? -18.481 51.895 61.261  1.00 77.67  ? 816  LYS A NZ    1 
ATOM   7305 N  N     . GLY C 3 817 ? -15.934 46.415 62.403  1.00 75.02  ? 817  GLY A N     1 
ATOM   7306 C  CA    . GLY C 3 817 ? -15.202 46.040 63.614  1.00 75.57  ? 817  GLY A CA    1 
ATOM   7307 C  C     . GLY C 3 817 ? -14.511 44.681 63.612  1.00 76.26  ? 817  GLY A C     1 
ATOM   7308 O  O     . GLY C 3 817 ? -13.511 44.496 64.310  1.00 76.42  ? 817  GLY A O     1 
ATOM   7309 N  N     . ASN C 3 818 ? -15.051 43.718 62.860  1.00 76.79  ? 818  ASN A N     1 
ATOM   7310 C  CA    . ASN C 3 818 ? -14.391 42.425 62.645  1.00 77.20  ? 818  ASN A CA    1 
ATOM   7311 C  C     . ASN C 3 818 ? -13.039 42.634 61.960  1.00 77.54  ? 818  ASN A C     1 
ATOM   7312 O  O     . ASN C 3 818 ? -12.984 43.021 60.786  1.00 77.60  ? 818  ASN A O     1 
ATOM   7313 C  CB    . ASN C 3 818 ? -15.268 41.500 61.789  1.00 77.12  ? 818  ASN A CB    1 
ATOM   7314 C  CG    . ASN C 3 818 ? -16.587 41.148 62.458  1.00 77.25  ? 818  ASN A CG    1 
ATOM   7315 O  OD1   . ASN C 3 818 ? -16.790 40.014 62.900  1.00 76.71  ? 818  ASN A OD1   1 
ATOM   7316 N  ND2   . ASN C 3 818 ? -17.493 42.119 62.531  1.00 77.16  ? 818  ASN A ND2   1 
ATOM   7317 N  N     . ILE C 3 819 ? -11.953 42.408 62.694  1.00 77.84  ? 819  ILE A N     1 
ATOM   7318 C  CA    . ILE C 3 819 ? -10.616 42.651 62.142  1.00 78.31  ? 819  ILE A CA    1 
ATOM   7319 C  C     . ILE C 3 819 ? -9.956  41.364 61.596  1.00 78.30  ? 819  ILE A C     1 
ATOM   7320 O  O     . ILE C 3 819 ? -8.854  41.397 61.038  1.00 78.53  ? 819  ILE A O     1 
ATOM   7321 C  CB    . ILE C 3 819 ? -9.698  43.432 63.157  1.00 78.68  ? 819  ILE A CB    1 
ATOM   7322 C  CG1   . ILE C 3 819 ? -8.632  44.284 62.427  1.00 79.06  ? 819  ILE A CG1   1 
ATOM   7323 C  CG2   . ILE C 3 819 ? -9.087  42.482 64.226  1.00 78.55  ? 819  ILE A CG2   1 
ATOM   7324 C  CD1   . ILE C 3 819 ? -9.163  45.493 61.625  1.00 79.46  ? 819  ILE A CD1   1 
ATOM   7325 N  N     . ASP C 3 820 ? -10.645 40.237 61.749  1.00 78.07  ? 820  ASP A N     1 
ATOM   7326 C  CA    . ASP C 3 820 ? -10.187 38.966 61.188  1.00 77.80  ? 820  ASP A CA    1 
ATOM   7327 C  C     . ASP C 3 820 ? -10.465 38.883 59.678  1.00 77.13  ? 820  ASP A C     1 
ATOM   7328 O  O     . ASP C 3 820 ? -9.685  38.284 58.930  1.00 77.05  ? 820  ASP A O     1 
ATOM   7329 C  CB    . ASP C 3 820 ? -10.813 37.772 61.940  1.00 78.16  ? 820  ASP A CB    1 
ATOM   7330 C  CG    . ASP C 3 820 ? -12.328 37.934 62.184  1.00 79.67  ? 820  ASP A CG    1 
ATOM   7331 O  OD1   . ASP C 3 820 ? -12.897 39.030 61.929  1.00 80.45  ? 820  ASP A OD1   1 
ATOM   7332 O  OD2   . ASP C 3 820 ? -12.954 36.947 62.643  1.00 81.09  ? 820  ASP A OD2   1 
ATOM   7333 N  N     . ALA C 3 821 ? -11.573 39.494 59.245  1.00 76.23  ? 821  ALA A N     1 
ATOM   7334 C  CA    . ALA C 3 821 ? -11.984 39.534 57.833  1.00 75.05  ? 821  ALA A CA    1 
ATOM   7335 C  C     . ALA C 3 821 ? -10.982 40.276 56.949  1.00 74.23  ? 821  ALA A C     1 
ATOM   7336 O  O     . ALA C 3 821 ? -10.353 41.237 57.405  1.00 74.01  ? 821  ALA A O     1 
ATOM   7337 C  CB    . ALA C 3 821 ? -13.354 40.176 57.708  1.00 75.08  ? 821  ALA A CB    1 
ATOM   7338 N  N     . PRO C 3 822 ? -10.825 39.831 55.682  1.00 73.50  ? 822  PRO A N     1 
ATOM   7339 C  CA    . PRO C 3 822 ? -9.931  40.543 54.770  1.00 72.91  ? 822  PRO A CA    1 
ATOM   7340 C  C     . PRO C 3 822 ? -10.536 41.873 54.327  1.00 72.30  ? 822  PRO A C     1 
ATOM   7341 O  O     . PRO C 3 822 ? -11.607 41.890 53.712  1.00 72.13  ? 822  PRO A O     1 
ATOM   7342 C  CB    . PRO C 3 822 ? -9.797  39.589 53.565  1.00 72.88  ? 822  PRO A CB    1 
ATOM   7343 C  CG    . PRO C 3 822 ? -10.496 38.327 53.937  1.00 73.10  ? 822  PRO A CG    1 
ATOM   7344 C  CD    . PRO C 3 822 ? -11.457 38.669 55.030  1.00 73.55  ? 822  PRO A CD    1 
ATOM   7345 N  N     . GLN C 3 823 ? -9.861  42.973 54.671  1.00 71.64  ? 823  GLN A N     1 
ATOM   7346 C  CA    . GLN C 3 823 ? -10.194 44.307 54.153  1.00 71.08  ? 823  GLN A CA    1 
ATOM   7347 C  C     . GLN C 3 823 ? -9.957  44.313 52.642  1.00 70.33  ? 823  GLN A C     1 
ATOM   7348 O  O     . GLN C 3 823 ? -9.346  43.387 52.100  1.00 70.58  ? 823  GLN A O     1 
ATOM   7349 C  CB    . GLN C 3 823 ? -9.336  45.402 54.818  1.00 71.22  ? 823  GLN A CB    1 
ATOM   7350 C  CG    . GLN C 3 823 ? -9.374  45.444 56.354  1.00 72.15  ? 823  GLN A CG    1 
ATOM   7351 C  CD    . GLN C 3 823 ? -10.745 45.792 56.907  1.00 74.34  ? 823  GLN A CD    1 
ATOM   7352 O  OE1   . GLN C 3 823 ? -11.282 45.084 57.769  1.00 74.41  ? 823  GLN A OE1   1 
ATOM   7353 N  NE2   . GLN C 3 823 ? -11.326 46.885 56.408  1.00 74.95  ? 823  GLN A NE2   1 
ATOM   7354 N  N     . VAL C 3 824 ? -10.446 45.341 51.957  1.00 69.11  ? 824  VAL A N     1 
ATOM   7355 C  CA    . VAL C 3 824 ? -10.235 45.446 50.519  1.00 67.85  ? 824  VAL A CA    1 
ATOM   7356 C  C     . VAL C 3 824 ? -9.249  46.564 50.238  1.00 66.88  ? 824  VAL A C     1 
ATOM   7357 O  O     . VAL C 3 824 ? -9.379  47.657 50.773  1.00 67.13  ? 824  VAL A O     1 
ATOM   7358 C  CB    . VAL C 3 824 ? -11.560 45.613 49.754  1.00 67.85  ? 824  VAL A CB    1 
ATOM   7359 C  CG1   . VAL C 3 824 ? -12.522 46.491 50.531  1.00 68.59  ? 824  VAL A CG1   1 
ATOM   7360 C  CG2   . VAL C 3 824 ? -11.316 46.165 48.365  1.00 68.31  ? 824  VAL A CG2   1 
ATOM   7361 N  N     . VAL C 3 825 ? -8.250  46.274 49.412  1.00 65.74  ? 825  VAL A N     1 
ATOM   7362 C  CA    . VAL C 3 825 ? -7.133  47.188 49.180  1.00 64.38  ? 825  VAL A CA    1 
ATOM   7363 C  C     . VAL C 3 825 ? -7.400  48.076 47.970  1.00 63.40  ? 825  VAL A C     1 
ATOM   7364 O  O     . VAL C 3 825 ? -8.011  47.637 46.996  1.00 63.01  ? 825  VAL A O     1 
ATOM   7365 C  CB    . VAL C 3 825 ? -5.807  46.417 48.954  1.00 64.59  ? 825  VAL A CB    1 
ATOM   7366 C  CG1   . VAL C 3 825 ? -4.637  47.210 49.499  1.00 64.53  ? 825  VAL A CG1   1 
ATOM   7367 C  CG2   . VAL C 3 825 ? -5.857  45.029 49.598  1.00 64.12  ? 825  VAL A CG2   1 
ATOM   7368 N  N     . GLU C 3 826 ? -6.931  49.320 48.047  1.00 62.37  ? 826  GLU A N     1 
ATOM   7369 C  CA    . GLU C 3 826 ? -7.128  50.320 47.001  1.00 61.62  ? 826  GLU A CA    1 
ATOM   7370 C  C     . GLU C 3 826 ? -6.329  49.993 45.760  1.00 60.78  ? 826  GLU A C     1 
ATOM   7371 O  O     . GLU C 3 826 ? -5.114  49.854 45.828  1.00 60.64  ? 826  GLU A O     1 
ATOM   7372 C  CB    . GLU C 3 826 ? -6.709  51.694 47.508  1.00 61.87  ? 826  GLU A CB    1 
ATOM   7373 C  CG    . GLU C 3 826 ? -7.848  52.664 47.650  1.00 63.39  ? 826  GLU A CG    1 
ATOM   7374 C  CD    . GLU C 3 826 ? -8.069  53.487 46.388  1.00 65.37  ? 826  GLU A CD    1 
ATOM   7375 O  OE1   . GLU C 3 826 ? -7.069  53.963 45.805  1.00 65.96  ? 826  GLU A OE1   1 
ATOM   7376 O  OE2   . GLU C 3 826 ? -9.242  53.670 45.988  1.00 65.97  ? 826  GLU A OE2   1 
ATOM   7377 N  N     . GLY C 3 827 ? -7.017  49.866 44.629  1.00 59.95  ? 827  GLY A N     1 
ATOM   7378 C  CA    . GLY C 3 827 ? -6.358  49.595 43.353  1.00 59.02  ? 827  GLY A CA    1 
ATOM   7379 C  C     . GLY C 3 827 ? -6.402  48.141 42.929  1.00 58.37  ? 827  GLY A C     1 
ATOM   7380 O  O     . GLY C 3 827 ? -6.330  47.831 41.734  1.00 58.43  ? 827  GLY A O     1 
ATOM   7381 N  N     . GLU C 3 828 ? -6.519  47.246 43.904  1.00 57.54  ? 828  GLU A N     1 
ATOM   7382 C  CA    . GLU C 3 828 ? -6.607  45.815 43.623  1.00 56.88  ? 828  GLU A CA    1 
ATOM   7383 C  C     . GLU C 3 828 ? -8.001  45.378 43.192  1.00 55.54  ? 828  GLU A C     1 
ATOM   7384 O  O     . GLU C 3 828 ? -8.960  46.141 43.298  1.00 55.43  ? 828  GLU A O     1 
ATOM   7385 C  CB    . GLU C 3 828 ? -6.119  45.012 44.816  1.00 57.37  ? 828  GLU A CB    1 
ATOM   7386 C  CG    . GLU C 3 828 ? -4.596  44.873 44.847  1.00 59.69  ? 828  GLU A CG    1 
ATOM   7387 C  CD    . GLU C 3 828 ? -4.064  44.712 46.253  1.00 62.33  ? 828  GLU A CD    1 
ATOM   7388 O  OE1   . GLU C 3 828 ? -4.394  43.693 46.909  1.00 62.99  ? 828  GLU A OE1   1 
ATOM   7389 O  OE2   . GLU C 3 828 ? -3.320  45.614 46.700  1.00 63.80  ? 828  GLU A OE2   1 
ATOM   7390 N  N     . LYS C 3 829 ? -8.103  44.154 42.680  1.00 54.12  ? 829  LYS A N     1 
ATOM   7391 C  CA    . LYS C 3 829 ? -9.349  43.698 42.062  1.00 52.65  ? 829  LYS A CA    1 
ATOM   7392 C  C     . LYS C 3 829 ? -10.331 43.165 43.089  1.00 52.32  ? 829  LYS A C     1 
ATOM   7393 O  O     . LYS C 3 829 ? -9.930  42.619 44.120  1.00 52.36  ? 829  LYS A O     1 
ATOM   7394 C  CB    . LYS C 3 829 ? -9.098  42.640 40.983  1.00 52.10  ? 829  LYS A CB    1 
ATOM   7395 C  CG    . LYS C 3 829 ? -8.106  43.024 39.897  1.00 49.44  ? 829  LYS A CG    1 
ATOM   7396 C  CD    . LYS C 3 829 ? -8.727  43.832 38.780  1.00 44.69  ? 829  LYS A CD    1 
ATOM   7397 C  CE    . LYS C 3 829 ? -7.725  44.029 37.652  1.00 42.37  ? 829  LYS A CE    1 
ATOM   7398 N  NZ    . LYS C 3 829 ? -7.937  43.123 36.500  1.00 38.34  ? 829  LYS A NZ    1 
ATOM   7399 N  N     . VAL C 3 830 ? -11.617 43.338 42.795  1.00 51.70  ? 830  VAL A N     1 
ATOM   7400 C  CA    . VAL C 3 830 ? -12.688 42.782 43.617  1.00 51.35  ? 830  VAL A CA    1 
ATOM   7401 C  C     . VAL C 3 830 ? -13.592 41.862 42.795  1.00 51.03  ? 830  VAL A C     1 
ATOM   7402 O  O     . VAL C 3 830 ? -13.781 42.087 41.601  1.00 51.09  ? 830  VAL A O     1 
ATOM   7403 C  CB    . VAL C 3 830 ? -13.560 43.902 44.267  1.00 51.62  ? 830  VAL A CB    1 
ATOM   7404 C  CG1   . VAL C 3 830 ? -12.818 44.586 45.426  1.00 50.96  ? 830  VAL A CG1   1 
ATOM   7405 C  CG2   . VAL C 3 830 ? -14.040 44.934 43.218  1.00 51.27  ? 830  VAL A CG2   1 
ATOM   7406 N  N     . TYR C 3 831 ? -14.143 40.827 43.421  1.00 50.76  ? 831  TYR A N     1 
ATOM   7407 C  CA    . TYR C 3 831 ? -15.283 40.120 42.828  1.00 50.82  ? 831  TYR A CA    1 
ATOM   7408 C  C     . TYR C 3 831 ? -16.563 40.886 43.125  1.00 51.16  ? 831  TYR A C     1 
ATOM   7409 O  O     . TYR C 3 831 ? -16.686 41.529 44.175  1.00 51.75  ? 831  TYR A O     1 
ATOM   7410 C  CB    . TYR C 3 831 ? -15.423 38.687 43.349  1.00 50.64  ? 831  TYR A CB    1 
ATOM   7411 C  CG    . TYR C 3 831 ? -14.387 37.724 42.820  1.00 49.69  ? 831  TYR A CG    1 
ATOM   7412 C  CD1   . TYR C 3 831 ? -14.233 37.521 41.452  1.00 48.31  ? 831  TYR A CD1   1 
ATOM   7413 C  CD2   . TYR C 3 831 ? -13.563 37.019 43.696  1.00 49.67  ? 831  TYR A CD2   1 
ATOM   7414 C  CE1   . TYR C 3 831 ? -13.278 36.657 40.966  1.00 50.30  ? 831  TYR A CE1   1 
ATOM   7415 C  CE2   . TYR C 3 831 ? -12.595 36.144 43.226  1.00 50.49  ? 831  TYR A CE2   1 
ATOM   7416 C  CZ    . TYR C 3 831 ? -12.460 35.965 41.859  1.00 50.72  ? 831  TYR A CZ    1 
ATOM   7417 O  OH    . TYR C 3 831 ? -11.520 35.099 41.387  1.00 49.31  ? 831  TYR A OH    1 
ATOM   7418 N  N     . VAL C 3 832 ? -17.514 40.817 42.204  1.00 51.00  ? 832  VAL A N     1 
ATOM   7419 C  CA    . VAL C 3 832 ? -18.760 41.541 42.356  1.00 51.33  ? 832  VAL A CA    1 
ATOM   7420 C  C     . VAL C 3 832 ? -19.955 40.633 42.080  1.00 52.07  ? 832  VAL A C     1 
ATOM   7421 O  O     . VAL C 3 832 ? -20.010 39.962 41.039  1.00 52.09  ? 832  VAL A O     1 
ATOM   7422 C  CB    . VAL C 3 832 ? -18.810 42.764 41.426  1.00 51.26  ? 832  VAL A CB    1 
ATOM   7423 C  CG1   . VAL C 3 832 ? -20.047 43.625 41.710  1.00 50.37  ? 832  VAL A CG1   1 
ATOM   7424 C  CG2   . VAL C 3 832 ? -17.527 43.581 41.565  1.00 50.89  ? 832  VAL A CG2   1 
ATOM   7425 N  N     . LEU C 3 833 ? -20.899 40.613 43.021  1.00 52.56  ? 833  LEU A N     1 
ATOM   7426 C  CA    . LEU C 3 833 ? -22.164 39.927 42.819  1.00 53.40  ? 833  LEU A CA    1 
ATOM   7427 C  C     . LEU C 3 833 ? -23.355 40.814 43.148  1.00 54.24  ? 833  LEU A C     1 
ATOM   7428 O  O     . LEU C 3 833 ? -23.319 41.562 44.133  1.00 54.54  ? 833  LEU A O     1 
ATOM   7429 C  CB    . LEU C 3 833 ? -22.231 38.673 43.671  1.00 53.15  ? 833  LEU A CB    1 
ATOM   7430 C  CG    . LEU C 3 833 ? -21.416 37.460 43.263  1.00 52.90  ? 833  LEU A CG    1 
ATOM   7431 C  CD1   . LEU C 3 833 ? -21.546 36.450 44.376  1.00 53.17  ? 833  LEU A CD1   1 
ATOM   7432 C  CD2   . LEU C 3 833 ? -21.907 36.875 41.947  1.00 52.36  ? 833  LEU A CD2   1 
ATOM   7433 N  N     . PRO C 3 834 ? -24.416 40.735 42.327  1.00 55.04  ? 834  PRO A N     1 
ATOM   7434 C  CA    . PRO C 3 834 ? -25.672 41.429 42.621  1.00 55.79  ? 834  PRO A CA    1 
ATOM   7435 C  C     . PRO C 3 834 ? -26.512 40.692 43.679  1.00 56.73  ? 834  PRO A C     1 
ATOM   7436 O  O     . PRO C 3 834 ? -26.544 39.453 43.703  1.00 56.63  ? 834  PRO A O     1 
ATOM   7437 C  CB    . PRO C 3 834 ? -26.393 41.438 41.269  1.00 55.58  ? 834  PRO A CB    1 
ATOM   7438 C  CG    . PRO C 3 834 ? -25.861 40.259 40.536  1.00 55.17  ? 834  PRO A CG    1 
ATOM   7439 C  CD    . PRO C 3 834 ? -24.474 39.988 41.056  1.00 55.07  ? 834  PRO A CD    1 
ATOM   7440 N  N     . LEU C 3 835 ? -27.176 41.466 44.539  1.00 57.74  ? 835  LEU A N     1 
ATOM   7441 C  CA    . LEU C 3 835 ? -28.049 40.940 45.596  1.00 58.87  ? 835  LEU A CA    1 
ATOM   7442 C  C     . LEU C 3 835 ? -29.530 41.109 45.279  1.00 59.98  ? 835  LEU A C     1 
ATOM   7443 O  O     . LEU C 3 835 ? -29.937 42.079 44.620  1.00 60.49  ? 835  LEU A O     1 
ATOM   7444 C  CB    . LEU C 3 835 ? -27.744 41.626 46.928  1.00 58.46  ? 835  LEU A CB    1 
ATOM   7445 C  CG    . LEU C 3 835 ? -26.795 40.961 47.930  1.00 57.49  ? 835  LEU A CG    1 
ATOM   7446 C  CD1   . LEU C 3 835 ? -25.894 39.872 47.326  1.00 55.90  ? 835  LEU A CD1   1 
ATOM   7447 C  CD2   . LEU C 3 835 ? -25.981 42.039 48.622  1.00 56.39  ? 835  LEU A CD2   1 
ATOM   7448 N  N     . ARG C 3 836 ? -30.339 40.168 45.757  1.00 61.16  ? 836  ARG A N     1 
ATOM   7449 C  CA    . ARG C 3 836 ? -31.792 40.268 45.597  1.00 62.20  ? 836  ARG A CA    1 
ATOM   7450 C  C     . ARG C 3 836 ? -32.414 41.264 46.583  1.00 62.83  ? 836  ARG A C     1 
ATOM   7451 O  O     . ARG C 3 836 ? -31.885 41.503 47.683  1.00 62.68  ? 836  ARG A O     1 
ATOM   7452 C  CB    . ARG C 3 836 ? -32.460 38.900 45.738  1.00 62.02  ? 836  ARG A CB    1 
ATOM   7453 C  CG    . ARG C 3 836 ? -32.415 38.027 44.493  1.00 62.30  ? 836  ARG A CG    1 
ATOM   7454 C  CD    . ARG C 3 836 ? -33.300 36.795 44.654  1.00 62.31  ? 836  ARG A CD    1 
ATOM   7455 N  NE    . ARG C 3 836 ? -32.740 35.814 45.588  1.00 62.84  ? 836  ARG A NE    1 
ATOM   7456 C  CZ    . ARG C 3 836 ? -32.806 35.891 46.917  1.00 62.78  ? 836  ARG A CZ    1 
ATOM   7457 N  NH1   . ARG C 3 836 ? -33.402 36.913 47.518  1.00 63.07  ? 836  ARG A NH1   1 
ATOM   7458 N  NH2   . ARG C 3 836 ? -32.268 34.936 47.653  1.00 63.54  ? 836  ARG A NH2   1 
ATOM   7459 N  N     . GLU C 3 837 ? -33.541 41.837 46.167  1.00 63.86  ? 837  GLU A N     1 
ATOM   7460 C  CA    . GLU C 3 837 ? -34.316 42.765 46.992  1.00 65.06  ? 837  GLU A CA    1 
ATOM   7461 C  C     . GLU C 3 837 ? -34.619 42.176 48.366  1.00 65.02  ? 837  GLU A C     1 
ATOM   7462 O  O     . GLU C 3 837 ? -35.029 41.014 48.477  1.00 65.01  ? 837  GLU A O     1 
ATOM   7463 C  CB    . GLU C 3 837 ? -35.617 43.152 46.278  1.00 65.26  ? 837  GLU A CB    1 
ATOM   7464 C  CG    . GLU C 3 837 ? -36.328 41.974 45.605  1.00 66.39  ? 837  GLU A CG    1 
ATOM   7465 C  CD    . GLU C 3 837 ? -37.678 42.350 44.996  1.00 66.54  ? 837  GLU A CD    1 
ATOM   7466 O  OE1   . GLU C 3 837 ? -37.710 43.135 44.011  1.00 68.27  ? 837  GLU A OE1   1 
ATOM   7467 O  OE2   . GLU C 3 837 ? -38.703 41.839 45.499  1.00 65.93  ? 837  GLU A OE2   1 
ATOM   7468 N  N     . GLY C 3 838 ? -34.385 42.971 49.406  1.00 65.22  ? 838  GLY A N     1 
ATOM   7469 C  CA    . GLY C 3 838 ? -34.718 42.563 50.777  1.00 65.40  ? 838  GLY A CA    1 
ATOM   7470 C  C     . GLY C 3 838 ? -33.628 41.842 51.559  1.00 65.38  ? 838  GLY A C     1 
ATOM   7471 O  O     . GLY C 3 838 ? -33.805 41.554 52.751  1.00 65.63  ? 838  GLY A O     1 
ATOM   7472 N  N     . ASN C 3 839 ? -32.512 41.541 50.890  1.00 64.90  ? 839  ASN A N     1 
ATOM   7473 C  CA    . ASN C 3 839 ? -31.316 40.986 51.529  1.00 64.13  ? 839  ASN A CA    1 
ATOM   7474 C  C     . ASN C 3 839 ? -30.888 41.800 52.764  1.00 63.94  ? 839  ASN A C     1 
ATOM   7475 O  O     . ASN C 3 839 ? -31.291 42.951 52.901  1.00 63.93  ? 839  ASN A O     1 
ATOM   7476 C  CB    . ASN C 3 839 ? -30.174 40.973 50.515  1.00 64.09  ? 839  ASN A CB    1 
ATOM   7477 C  CG    . ASN C 3 839 ? -29.712 42.366 50.156  1.00 62.44  ? 839  ASN A CG    1 
ATOM   7478 O  OD1   . ASN C 3 839 ? -28.798 42.913 50.783  1.00 59.96  ? 839  ASN A OD1   1 
ATOM   7479 N  ND2   . ASN C 3 839 ? -30.369 42.965 49.173  1.00 61.09  ? 839  ASN A ND2   1 
ATOM   7480 N  N     . PRO C 3 840 ? -30.046 41.224 53.644  1.00 63.62  ? 840  PRO A N     1 
ATOM   7481 C  CA    . PRO C 3 840 ? -29.737 41.911 54.884  1.00 63.57  ? 840  PRO A CA    1 
ATOM   7482 C  C     . PRO C 3 840 ? -28.476 42.774 54.810  1.00 63.63  ? 840  PRO A C     1 
ATOM   7483 O  O     . PRO C 3 840 ? -28.079 43.379 55.813  1.00 63.79  ? 840  PRO A O     1 
ATOM   7484 C  CB    . PRO C 3 840 ? -29.531 40.754 55.861  1.00 63.70  ? 840  PRO A CB    1 
ATOM   7485 C  CG    . PRO C 3 840 ? -29.034 39.603 55.003  1.00 63.54  ? 840  PRO A CG    1 
ATOM   7486 C  CD    . PRO C 3 840 ? -29.337 39.936 53.561  1.00 63.74  ? 840  PRO A CD    1 
ATOM   7487 N  N     . PHE C 3 841 ? -27.852 42.837 53.636  1.00 63.55  ? 841  PHE A N     1 
ATOM   7488 C  CA    . PHE C 3 841 ? -26.640 43.638 53.465  1.00 63.12  ? 841  PHE A CA    1 
ATOM   7489 C  C     . PHE C 3 841 ? -26.956 45.095 53.202  1.00 63.34  ? 841  PHE A C     1 
ATOM   7490 O  O     . PHE C 3 841 ? -26.070 45.955 53.308  1.00 63.41  ? 841  PHE A O     1 
ATOM   7491 C  CB    . PHE C 3 841 ? -25.793 43.078 52.340  1.00 62.83  ? 841  PHE A CB    1 
ATOM   7492 C  CG    . PHE C 3 841 ? -25.348 41.681 52.581  1.00 62.23  ? 841  PHE A CG    1 
ATOM   7493 C  CD1   . PHE C 3 841 ? -24.275 41.422 53.439  1.00 61.16  ? 841  PHE A CD1   1 
ATOM   7494 C  CD2   . PHE C 3 841 ? -26.015 40.616 51.978  1.00 61.16  ? 841  PHE A CD2   1 
ATOM   7495 C  CE1   . PHE C 3 841 ? -23.862 40.126 53.678  1.00 61.27  ? 841  PHE A CE1   1 
ATOM   7496 C  CE2   . PHE C 3 841 ? -25.610 39.315 52.204  1.00 60.93  ? 841  PHE A CE2   1 
ATOM   7497 C  CZ    . PHE C 3 841 ? -24.529 39.067 53.052  1.00 61.69  ? 841  PHE A CZ    1 
ATOM   7498 N  N     . GLY C 3 842 ? -28.218 45.360 52.857  1.00 63.35  ? 842  GLY A N     1 
ATOM   7499 C  CA    . GLY C 3 842 ? -28.700 46.712 52.641  1.00 63.33  ? 842  GLY A CA    1 
ATOM   7500 C  C     . GLY C 3 842 ? -28.735 47.090 51.175  1.00 63.33  ? 842  GLY A C     1 
ATOM   7501 O  O     . GLY C 3 842 ? -29.775 47.516 50.672  1.00 63.86  ? 842  GLY A O     1 
ATOM   7502 N  N     . ASP C 3 843 ? -27.605 46.938 50.482  1.00 62.87  ? 843  ASP A N     1 
ATOM   7503 C  CA    . ASP C 3 843 ? -27.513 47.351 49.076  1.00 62.34  ? 843  ASP A CA    1 
ATOM   7504 C  C     . ASP C 3 843 ? -27.898 46.247 48.099  1.00 61.46  ? 843  ASP A C     1 
ATOM   7505 O  O     . ASP C 3 843 ? -28.233 45.137 48.507  1.00 61.12  ? 843  ASP A O     1 
ATOM   7506 C  CB    . ASP C 3 843 ? -26.121 47.904 48.747  1.00 62.57  ? 843  ASP A CB    1 
ATOM   7507 C  CG    . ASP C 3 843 ? -26.033 49.422 48.899  1.00 63.81  ? 843  ASP A CG    1 
ATOM   7508 O  OD1   . ASP C 3 843 ? -27.022 50.123 48.565  1.00 64.27  ? 843  ASP A OD1   1 
ATOM   7509 O  OD2   . ASP C 3 843 ? -24.959 49.915 49.336  1.00 65.18  ? 843  ASP A OD2   1 
ATOM   7510 N  N     . LYS C 3 844 ? -27.840 46.577 46.811  1.00 60.64  ? 844  LYS A N     1 
ATOM   7511 C  CA    . LYS C 3 844 ? -28.223 45.668 45.729  1.00 59.77  ? 844  LYS A CA    1 
ATOM   7512 C  C     . LYS C 3 844 ? -27.081 44.793 45.187  1.00 59.66  ? 844  LYS A C     1 
ATOM   7513 O  O     . LYS C 3 844 ? -27.296 43.992 44.268  1.00 59.60  ? 844  LYS A O     1 
ATOM   7514 C  CB    . LYS C 3 844 ? -28.843 46.468 44.586  1.00 59.50  ? 844  LYS A CB    1 
ATOM   7515 C  CG    . LYS C 3 844 ? -27.998 47.625 44.128  1.00 57.92  ? 844  LYS A CG    1 
ATOM   7516 C  CD    . LYS C 3 844 ? -28.629 48.313 42.960  1.00 56.21  ? 844  LYS A CD    1 
ATOM   7517 C  CE    . LYS C 3 844 ? -27.686 49.339 42.391  1.00 56.45  ? 844  LYS A CE    1 
ATOM   7518 N  NZ    . LYS C 3 844 ? -28.416 50.355 41.590  1.00 57.56  ? 844  LYS A NZ    1 
ATOM   7519 N  N     . CYS C 3 845 ? -25.880 44.950 45.750  1.00 59.29  ? 845  CYS A N     1 
ATOM   7520 C  CA    . CYS C 3 845 ? -24.687 44.210 45.309  1.00 59.20  ? 845  CYS A CA    1 
ATOM   7521 C  C     . CYS C 3 845 ? -23.607 44.157 46.393  1.00 58.72  ? 845  CYS A C     1 
ATOM   7522 O  O     . CYS C 3 845 ? -23.620 44.960 47.340  1.00 58.36  ? 845  CYS A O     1 
ATOM   7523 C  CB    . CYS C 3 845 ? -24.090 44.844 44.050  1.00 58.97  ? 845  CYS A CB    1 
ATOM   7524 S  SG    . CYS C 3 845 ? -23.449 46.502 44.368  1.00 61.27  ? 845  CYS A SG    1 
ATOM   7525 N  N     . ILE C 3 846 ? -22.662 43.228 46.224  1.00 58.19  ? 846  ILE A N     1 
ATOM   7526 C  CA    . ILE C 3 846 ? -21.539 43.087 47.149  1.00 57.53  ? 846  ILE A CA    1 
ATOM   7527 C  C     . ILE C 3 846 ? -20.190 42.803 46.455  1.00 57.14  ? 846  ILE A C     1 
ATOM   7528 O  O     . ILE C 3 846 ? -20.142 42.202 45.382  1.00 57.00  ? 846  ILE A O     1 
ATOM   7529 C  CB    . ILE C 3 846 ? -21.865 42.019 48.227  1.00 57.68  ? 846  ILE A CB    1 
ATOM   7530 C  CG1   . ILE C 3 846 ? -21.000 42.238 49.469  1.00 57.36  ? 846  ILE A CG1   1 
ATOM   7531 C  CG2   . ILE C 3 846 ? -21.778 40.577 47.643  1.00 57.20  ? 846  ILE A CG2   1 
ATOM   7532 C  CD1   . ILE C 3 846 ? -21.721 41.956 50.738  1.00 57.08  ? 846  ILE A CD1   1 
ATOM   7533 N  N     . ALA C 3 847 ? -19.102 43.235 47.085  1.00 56.73  ? 847  ALA A N     1 
ATOM   7534 C  CA    . ALA C 3 847 ? -17.761 43.072 46.523  1.00 56.75  ? 847  ALA A CA    1 
ATOM   7535 C  C     . ALA C 3 847 ? -16.759 42.582 47.549  1.00 56.74  ? 847  ALA A C     1 
ATOM   7536 O  O     . ALA C 3 847 ? -16.797 42.980 48.708  1.00 56.35  ? 847  ALA A O     1 
ATOM   7537 C  CB    . ALA C 3 847 ? -17.272 44.377 45.941  1.00 56.59  ? 847  ALA A CB    1 
ATOM   7538 N  N     . TRP C 3 848 ? -15.847 41.724 47.115  1.00 56.84  ? 848  TRP A N     1 
ATOM   7539 C  CA    . TRP C 3 848 ? -14.794 41.252 48.005  1.00 56.96  ? 848  TRP A CA    1 
ATOM   7540 C  C     . TRP C 3 848 ? -13.496 41.037 47.235  1.00 57.72  ? 848  TRP A C     1 
ATOM   7541 O  O     . TRP C 3 848 ? -13.535 40.907 46.019  1.00 57.77  ? 848  TRP A O     1 
ATOM   7542 C  CB    . TRP C 3 848 ? -15.247 39.994 48.762  1.00 56.08  ? 848  TRP A CB    1 
ATOM   7543 C  CG    . TRP C 3 848 ? -15.343 38.750 47.952  1.00 54.29  ? 848  TRP A CG    1 
ATOM   7544 C  CD1   . TRP C 3 848 ? -14.441 37.740 47.916  1.00 52.82  ? 848  TRP A CD1   1 
ATOM   7545 C  CD2   . TRP C 3 848 ? -16.410 38.368 47.080  1.00 53.65  ? 848  TRP A CD2   1 
ATOM   7546 N  NE1   . TRP C 3 848 ? -14.864 36.754 47.069  1.00 51.93  ? 848  TRP A NE1   1 
ATOM   7547 C  CE2   . TRP C 3 848 ? -16.074 37.111 46.542  1.00 52.31  ? 848  TRP A CE2   1 
ATOM   7548 C  CE3   . TRP C 3 848 ? -17.613 38.976 46.684  1.00 54.59  ? 848  TRP A CE3   1 
ATOM   7549 C  CZ2   . TRP C 3 848 ? -16.896 36.437 45.632  1.00 53.40  ? 848  TRP A CZ2   1 
ATOM   7550 C  CZ3   . TRP C 3 848 ? -18.435 38.307 45.774  1.00 53.81  ? 848  TRP A CZ3   1 
ATOM   7551 C  CH2   . TRP C 3 848 ? -18.070 37.049 45.260  1.00 53.72  ? 848  TRP A CH2   1 
ATOM   7552 N  N     . PRO C 3 849 ? -12.342 41.041 47.932  1.00 58.72  ? 849  PRO A N     1 
ATOM   7553 C  CA    . PRO C 3 849 ? -11.053 40.800 47.284  1.00 59.68  ? 849  PRO A CA    1 
ATOM   7554 C  C     . PRO C 3 849 ? -11.052 39.555 46.394  1.00 60.53  ? 849  PRO A C     1 
ATOM   7555 O  O     . PRO C 3 849 ? -11.508 38.488 46.811  1.00 60.45  ? 849  PRO A O     1 
ATOM   7556 C  CB    . PRO C 3 849 ? -10.099 40.608 48.467  1.00 59.55  ? 849  PRO A CB    1 
ATOM   7557 C  CG    . PRO C 3 849 ? -10.668 41.435 49.526  1.00 59.42  ? 849  PRO A CG    1 
ATOM   7558 C  CD    . PRO C 3 849 ? -12.170 41.305 49.372  1.00 58.98  ? 849  PRO A CD    1 
ATOM   7559 N  N     . SER C 3 850 ? -10.546 39.713 45.175  1.00 61.56  ? 850  SER A N     1 
ATOM   7560 C  CA    . SER C 3 850 ? -10.491 38.628 44.218  1.00 62.81  ? 850  SER A CA    1 
ATOM   7561 C  C     . SER C 3 850 ? -9.327  37.694 44.508  1.00 64.04  ? 850  SER A C     1 
ATOM   7562 O  O     . SER C 3 850 ? -8.438  38.014 45.300  1.00 64.02  ? 850  SER A O     1 
ATOM   7563 C  CB    . SER C 3 850 ? -10.393 39.180 42.804  1.00 62.55  ? 850  SER A CB    1 
ATOM   7564 O  OG    . SER C 3 850 ? -9.226  39.955 42.669  1.00 62.27  ? 850  SER A OG    1 
ATOM   7565 N  N     . GLY C 3 851 ? -9.343  36.528 43.869  1.00 65.69  ? 851  GLY A N     1 
ATOM   7566 C  CA    . GLY C 3 851 ? -8.344  35.499 44.129  1.00 67.71  ? 851  GLY A CA    1 
ATOM   7567 C  C     . GLY C 3 851 ? -8.611  34.762 45.430  1.00 69.31  ? 851  GLY A C     1 
ATOM   7568 O  O     . GLY C 3 851 ? -8.164  33.622 45.597  1.00 69.36  ? 851  GLY A O     1 
ATOM   7569 N  N     . THR C 3 852 ? -9.327  35.417 46.354  1.00 70.64  ? 852  THR A N     1 
ATOM   7570 C  CA    . THR C 3 852 ? -9.773  34.780 47.604  1.00 72.10  ? 852  THR A CA    1 
ATOM   7571 C  C     . THR C 3 852 ? -11.301 34.599 47.624  1.00 72.92  ? 852  THR A C     1 
ATOM   7572 O  O     . THR C 3 852 ? -12.030 35.245 46.867  1.00 72.62  ? 852  THR A O     1 
ATOM   7573 C  CB    . THR C 3 852 ? -9.296  35.534 48.909  1.00 71.95  ? 852  THR A CB    1 
ATOM   7574 O  OG1   . THR C 3 852 ? -10.316 36.435 49.360  1.00 72.38  ? 852  THR A OG1   1 
ATOM   7575 C  CG2   . THR C 3 852 ? -7.976  36.299 48.698  1.00 71.85  ? 852  THR A CG2   1 
ATOM   7576 N  N     . GLU C 3 853 ? -11.766 33.700 48.488  1.00 74.19  ? 853  GLU A N     1 
ATOM   7577 C  CA    . GLU C 3 853 ? -13.194 33.539 48.750  1.00 75.11  ? 853  GLU A CA    1 
ATOM   7578 C  C     . GLU C 3 853 ? -13.656 34.555 49.805  1.00 75.49  ? 853  GLU A C     1 
ATOM   7579 O  O     . GLU C 3 853 ? -12.836 35.123 50.542  1.00 75.40  ? 853  GLU A O     1 
ATOM   7580 C  CB    . GLU C 3 853 ? -13.490 32.117 49.235  1.00 75.29  ? 853  GLU A CB    1 
ATOM   7581 C  CG    . GLU C 3 853 ? -13.073 31.001 48.278  1.00 76.75  ? 853  GLU A CG    1 
ATOM   7582 C  CD    . GLU C 3 853 ? -13.961 29.760 48.404  1.00 78.70  ? 853  GLU A CD    1 
ATOM   7583 O  OE1   . GLU C 3 853 ? -14.487 29.508 49.514  1.00 79.34  ? 853  GLU A OE1   1 
ATOM   7584 O  OE2   . GLU C 3 853 ? -14.138 29.038 47.394  1.00 78.88  ? 853  GLU A OE2   1 
ATOM   7585 N  N     . ILE C 3 854 ? -14.966 34.782 49.869  1.00 75.89  ? 854  ILE A N     1 
ATOM   7586 C  CA    . ILE C 3 854 ? -15.554 35.615 50.914  1.00 76.41  ? 854  ILE A CA    1 
ATOM   7587 C  C     . ILE C 3 854 ? -15.409 34.922 52.252  1.00 76.87  ? 854  ILE A C     1 
ATOM   7588 O  O     . ILE C 3 854 ? -15.647 33.714 52.356  1.00 77.06  ? 854  ILE A O     1 
ATOM   7589 C  CB    . ILE C 3 854 ? -17.065 35.892 50.689  1.00 76.40  ? 854  ILE A CB    1 
ATOM   7590 C  CG1   . ILE C 3 854 ? -17.626 35.038 49.554  1.00 76.96  ? 854  ILE A CG1   1 
ATOM   7591 C  CG2   . ILE C 3 854 ? -17.324 37.364 50.405  1.00 76.43  ? 854  ILE A CG2   1 
ATOM   7592 C  CD1   . ILE C 3 854 ? -18.021 33.655 49.966  1.00 77.43  ? 854  ILE A CD1   1 
ATOM   7593 N  N     . THR C 3 855 ? -15.017 35.699 53.265  1.00 77.26  ? 855  THR A N     1 
ATOM   7594 C  CA    . THR C 3 855 ? -14.941 35.246 54.654  1.00 77.64  ? 855  THR A CA    1 
ATOM   7595 C  C     . THR C 3 855 ? -16.256 34.639 55.134  1.00 77.71  ? 855  THR A C     1 
ATOM   7596 O  O     . THR C 3 855 ? -17.341 35.078 54.720  1.00 77.67  ? 855  THR A O     1 
ATOM   7597 C  CB    . THR C 3 855 ? -14.592 36.404 55.600  1.00 77.91  ? 855  THR A CB    1 
ATOM   7598 O  OG1   . THR C 3 855 ? -14.746 35.976 56.962  1.00 78.48  ? 855  THR A OG1   1 
ATOM   7599 C  CG2   . THR C 3 855 ? -15.515 37.610 55.343  1.00 78.37  ? 855  THR A CG2   1 
ATOM   7600 N  N     . ASP C 3 856 ? -16.146 33.651 56.022  1.00 77.65  ? 856  ASP A N     1 
ATOM   7601 C  CA    . ASP C 3 856 ? -17.310 32.957 56.572  1.00 77.79  ? 856  ASP A CA    1 
ATOM   7602 C  C     . ASP C 3 856 ? -18.335 33.893 57.211  1.00 77.61  ? 856  ASP A C     1 
ATOM   7603 O  O     . ASP C 3 856 ? -19.541 33.613 57.191  1.00 77.46  ? 856  ASP A O     1 
ATOM   7604 C  CB    . ASP C 3 856 ? -16.882 31.877 57.571  1.00 77.98  ? 856  ASP A CB    1 
ATOM   7605 C  CG    . ASP C 3 856 ? -16.457 30.586 56.888  1.00 78.24  ? 856  ASP A CG    1 
ATOM   7606 O  OD1   . ASP C 3 856 ? -17.230 30.049 56.059  1.00 78.32  ? 856  ASP A OD1   1 
ATOM   7607 O  OD2   . ASP C 3 856 ? -15.343 30.106 57.184  1.00 78.88  ? 856  ASP A OD2   1 
ATOM   7608 N  N     . LEU C 3 857 ? -17.850 35.005 57.763  1.00 77.59  ? 857  LEU A N     1 
ATOM   7609 C  CA    . LEU C 3 857 ? -18.723 35.992 58.397  1.00 77.68  ? 857  LEU A CA    1 
ATOM   7610 C  C     . LEU C 3 857 ? -19.928 36.396 57.539  1.00 77.57  ? 857  LEU A C     1 
ATOM   7611 O  O     . LEU C 3 857 ? -21.010 36.631 58.073  1.00 77.93  ? 857  LEU A O     1 
ATOM   7612 C  CB    . LEU C 3 857 ? -17.924 37.219 58.847  1.00 77.69  ? 857  LEU A CB    1 
ATOM   7613 C  CG    . LEU C 3 857 ? -17.393 37.303 60.292  1.00 77.96  ? 857  LEU A CG    1 
ATOM   7614 C  CD1   . LEU C 3 857 ? -17.322 35.963 61.055  1.00 77.75  ? 857  LEU A CD1   1 
ATOM   7615 C  CD2   . LEU C 3 857 ? -16.032 37.997 60.293  1.00 78.83  ? 857  LEU A CD2   1 
ATOM   7616 N  N     . ILE C 3 858 ? -19.759 36.452 56.221  1.00 77.30  ? 858  ILE A N     1 
ATOM   7617 C  CA    . ILE C 3 858 ? -20.896 36.721 55.328  1.00 76.96  ? 858  ILE A CA    1 
ATOM   7618 C  C     . ILE C 3 858 ? -21.123 35.631 54.265  1.00 76.72  ? 858  ILE A C     1 
ATOM   7619 O  O     . ILE C 3 858 ? -22.197 35.569 53.650  1.00 76.67  ? 858  ILE A O     1 
ATOM   7620 C  CB    . ILE C 3 858 ? -20.810 38.120 54.646  1.00 77.01  ? 858  ILE A CB    1 
ATOM   7621 C  CG1   . ILE C 3 858 ? -19.593 38.196 53.715  1.00 77.20  ? 858  ILE A CG1   1 
ATOM   7622 C  CG2   . ILE C 3 858 ? -20.805 39.238 55.693  1.00 76.89  ? 858  ILE A CG2   1 
ATOM   7623 C  CD1   . ILE C 3 858 ? -19.705 39.242 52.635  1.00 77.37  ? 858  ILE A CD1   1 
ATOM   7624 N  N     . LYS C 3 859 ? -20.127 34.767 54.069  1.00 76.25  ? 859  LYS A N     1 
ATOM   7625 C  CA    . LYS C 3 859 ? -20.178 33.735 53.024  1.00 76.05  ? 859  LYS A CA    1 
ATOM   7626 C  C     . LYS C 3 859 ? -21.561 33.124 52.754  1.00 75.96  ? 859  LYS A C     1 
ATOM   7627 O  O     . LYS C 3 859 ? -21.932 32.926 51.599  1.00 76.04  ? 859  LYS A O     1 
ATOM   7628 C  CB    . LYS C 3 859 ? -19.153 32.624 53.287  1.00 76.13  ? 859  LYS A CB    1 
ATOM   7629 C  CG    . LYS C 3 859 ? -19.111 31.545 52.203  1.00 75.92  ? 859  LYS A CG    1 
ATOM   7630 C  CD    . LYS C 3 859 ? -17.844 30.713 52.298  1.00 76.90  ? 859  LYS A CD    1 
ATOM   7631 C  CE    . LYS C 3 859 ? -17.434 30.162 50.940  1.00 76.95  ? 859  LYS A CE    1 
ATOM   7632 N  NZ    . LYS C 3 859 ? -18.552 29.488 50.219  1.00 77.14  ? 859  LYS A NZ    1 
ATOM   7633 N  N     . ASP C 3 860 ? -22.318 32.809 53.801  1.00 75.75  ? 860  ASP A N     1 
ATOM   7634 C  CA    . ASP C 3 860 ? -23.552 32.045 53.596  1.00 75.53  ? 860  ASP A CA    1 
ATOM   7635 C  C     . ASP C 3 860 ? -24.794 32.893 53.305  1.00 75.03  ? 860  ASP A C     1 
ATOM   7636 O  O     . ASP C 3 860 ? -25.736 32.422 52.664  1.00 74.69  ? 860  ASP A O     1 
ATOM   7637 C  CB    . ASP C 3 860 ? -23.773 31.030 54.724  1.00 75.79  ? 860  ASP A CB    1 
ATOM   7638 C  CG    . ASP C 3 860 ? -23.073 29.685 54.456  1.00 76.78  ? 860  ASP A CG    1 
ATOM   7639 O  OD1   . ASP C 3 860 ? -22.058 29.639 53.708  1.00 76.90  ? 860  ASP A OD1   1 
ATOM   7640 O  OD2   . ASP C 3 860 ? -23.547 28.663 55.002  1.00 77.99  ? 860  ASP A OD2   1 
ATOM   7641 N  N     . ASP C 3 861 ? -24.782 34.147 53.749  1.00 74.61  ? 861  ASP A N     1 
ATOM   7642 C  CA    . ASP C 3 861 ? -25.839 35.084 53.371  1.00 74.19  ? 861  ASP A CA    1 
ATOM   7643 C  C     . ASP C 3 861 ? -25.728 35.429 51.880  1.00 73.80  ? 861  ASP A C     1 
ATOM   7644 O  O     . ASP C 3 861 ? -26.661 35.180 51.112  1.00 73.82  ? 861  ASP A O     1 
ATOM   7645 C  CB    . ASP C 3 861 ? -25.803 36.350 54.239  1.00 74.32  ? 861  ASP A CB    1 
ATOM   7646 C  CG    . ASP C 3 861 ? -25.967 36.058 55.727  1.00 74.24  ? 861  ASP A CG    1 
ATOM   7647 O  OD1   . ASP C 3 861 ? -26.616 35.043 56.071  1.00 74.19  ? 861  ASP A OD1   1 
ATOM   7648 O  OD2   . ASP C 3 861 ? -25.449 36.854 56.545  1.00 73.22  ? 861  ASP A OD2   1 
ATOM   7649 N  N     . VAL C 3 862 ? -24.576 35.962 51.470  1.00 73.15  ? 862  VAL A N     1 
ATOM   7650 C  CA    . VAL C 3 862 ? -24.313 36.236 50.051  1.00 72.61  ? 862  VAL A CA    1 
ATOM   7651 C  C     . VAL C 3 862 ? -24.676 35.059 49.142  1.00 72.25  ? 862  VAL A C     1 
ATOM   7652 O  O     . VAL C 3 862 ? -25.208 35.254 48.053  1.00 72.29  ? 862  VAL A O     1 
ATOM   7653 C  CB    . VAL C 3 862 ? -22.850 36.746 49.778  1.00 72.63  ? 862  VAL A CB    1 
ATOM   7654 C  CG1   . VAL C 3 862 ? -21.827 35.958 50.559  1.00 72.93  ? 862  VAL A CG1   1 
ATOM   7655 C  CG2   . VAL C 3 862 ? -22.511 36.725 48.284  1.00 72.09  ? 862  VAL A CG2   1 
ATOM   7656 N  N     . LEU C 3 863 ? -24.421 33.841 49.598  1.00 71.84  ? 863  LEU A N     1 
ATOM   7657 C  CA    . LEU C 3 863 ? -24.744 32.677 48.791  1.00 71.61  ? 863  LEU A CA    1 
ATOM   7658 C  C     . LEU C 3 863 ? -26.259 32.473 48.676  1.00 71.45  ? 863  LEU A C     1 
ATOM   7659 O  O     . LEU C 3 863 ? -26.751 32.023 47.635  1.00 71.40  ? 863  LEU A O     1 
ATOM   7660 C  CB    . LEU C 3 863 ? -24.047 31.439 49.346  1.00 71.60  ? 863  LEU A CB    1 
ATOM   7661 C  CG    . LEU C 3 863 ? -23.532 30.446 48.302  1.00 71.88  ? 863  LEU A CG    1 
ATOM   7662 C  CD1   . LEU C 3 863 ? -22.186 29.870 48.728  1.00 71.33  ? 863  LEU A CD1   1 
ATOM   7663 C  CD2   . LEU C 3 863 ? -24.556 29.339 48.004  1.00 72.24  ? 863  LEU A CD2   1 
ATOM   7664 N  N     . HIS C 3 864 ? -26.994 32.823 49.733  1.00 71.25  ? 864  HIS A N     1 
ATOM   7665 C  CA    . HIS C 3 864 ? -28.452 32.683 49.726  1.00 71.28  ? 864  HIS A CA    1 
ATOM   7666 C  C     . HIS C 3 864 ? -29.077 33.797 48.893  1.00 70.81  ? 864  HIS A C     1 
ATOM   7667 O  O     . HIS C 3 864 ? -29.824 33.540 47.943  1.00 70.59  ? 864  HIS A O     1 
ATOM   7668 C  CB    . HIS C 3 864 ? -29.023 32.664 51.164  1.00 71.57  ? 864  HIS A CB    1 
ATOM   7669 C  CG    . HIS C 3 864 ? -30.442 32.170 51.253  1.00 72.35  ? 864  HIS A CG    1 
ATOM   7670 N  ND1   . HIS C 3 864 ? -31.478 32.954 51.718  1.00 72.78  ? 864  HIS A ND1   1 
ATOM   7671 C  CD2   . HIS C 3 864 ? -30.996 30.976 50.925  1.00 72.05  ? 864  HIS A CD2   1 
ATOM   7672 C  CE1   . HIS C 3 864 ? -32.606 32.265 51.677  1.00 72.28  ? 864  HIS A CE1   1 
ATOM   7673 N  NE2   . HIS C 3 864 ? -32.342 31.062 51.197  1.00 72.14  ? 864  HIS A NE2   1 
ATOM   7674 N  N     . TRP C 3 865 ? -28.705 35.026 49.237  1.00 70.31  ? 865  TRP A N     1 
ATOM   7675 C  CA    . TRP C 3 865 ? -29.274 36.236 48.663  1.00 70.04  ? 865  TRP A CA    1 
ATOM   7676 C  C     . TRP C 3 865 ? -28.776 36.557 47.257  1.00 69.42  ? 865  TRP A C     1 
ATOM   7677 O  O     . TRP C 3 865 ? -29.194 37.546 46.648  1.00 69.60  ? 865  TRP A O     1 
ATOM   7678 C  CB    . TRP C 3 865 ? -29.022 37.411 49.613  1.00 70.63  ? 865  TRP A CB    1 
ATOM   7679 C  CG    . TRP C 3 865 ? -29.819 37.298 50.880  1.00 71.40  ? 865  TRP A CG    1 
ATOM   7680 C  CD1   . TRP C 3 865 ? -29.360 36.922 52.112  1.00 71.35  ? 865  TRP A CD1   1 
ATOM   7681 C  CD2   . TRP C 3 865 ? -31.226 37.524 51.027  1.00 72.37  ? 865  TRP A CD2   1 
ATOM   7682 N  NE1   . TRP C 3 865 ? -30.391 36.918 53.019  1.00 71.51  ? 865  TRP A NE1   1 
ATOM   7683 C  CE2   . TRP C 3 865 ? -31.548 37.282 52.381  1.00 72.17  ? 865  TRP A CE2   1 
ATOM   7684 C  CE3   . TRP C 3 865 ? -32.245 37.919 50.146  1.00 73.12  ? 865  TRP A CE3   1 
ATOM   7685 C  CZ2   . TRP C 3 865 ? -32.851 37.423 52.880  1.00 72.11  ? 865  TRP A CZ2   1 
ATOM   7686 C  CZ3   . TRP C 3 865 ? -33.548 38.061 50.646  1.00 72.60  ? 865  TRP A CZ3   1 
ATOM   7687 C  CH2   . TRP C 3 865 ? -33.833 37.813 52.001  1.00 72.11  ? 865  TRP A CH2   1 
ATOM   7688 N  N     . MET C 3 866 ? -27.886 35.712 46.753  1.00 68.60  ? 866  MET A N     1 
ATOM   7689 C  CA    . MET C 3 866 ? -27.348 35.809 45.403  1.00 67.53  ? 866  MET A CA    1 
ATOM   7690 C  C     . MET C 3 866 ? -28.448 35.921 44.363  1.00 66.60  ? 866  MET A C     1 
ATOM   7691 O  O     . MET C 3 866 ? -29.483 35.266 44.471  1.00 66.45  ? 866  MET A O     1 
ATOM   7692 C  CB    . MET C 3 866 ? -26.544 34.556 45.120  1.00 67.73  ? 866  MET A CB    1 
ATOM   7693 C  CG    . MET C 3 866 ? -25.528 34.695 44.031  1.00 67.55  ? 866  MET A CG    1 
ATOM   7694 S  SD    . MET C 3 866 ? -24.287 33.440 44.347  1.00 68.34  ? 866  MET A SD    1 
ATOM   7695 C  CE    . MET C 3 866 ? -23.817 33.050 42.662  1.00 68.60  ? 866  MET A CE    1 
ATOM   7696 N  N     . ASP C 3 867 ? -28.198 36.738 43.348  1.00 65.45  ? 867  ASP A N     1 
ATOM   7697 C  CA    . ASP C 3 867 ? -29.193 37.036 42.332  1.00 64.69  ? 867  ASP A CA    1 
ATOM   7698 C  C     . ASP C 3 867 ? -28.838 36.503 40.922  1.00 63.82  ? 867  ASP A C     1 
ATOM   7699 O  O     . ASP C 3 867 ? -28.219 37.195 40.106  1.00 63.61  ? 867  ASP A O     1 
ATOM   7700 C  CB    . ASP C 3 867 ? -29.436 38.540 42.314  1.00 64.91  ? 867  ASP A CB    1 
ATOM   7701 C  CG    . ASP C 3 867 ? -30.719 38.914 41.629  1.00 65.48  ? 867  ASP A CG    1 
ATOM   7702 O  OD1   . ASP C 3 867 ? -31.285 38.076 40.895  1.00 66.50  ? 867  ASP A OD1   1 
ATOM   7703 O  OD2   . ASP C 3 867 ? -31.160 40.064 41.825  1.00 67.82  ? 867  ASP A OD2   1 
ATOM   7704 N  N     . TYR C 3 868 ? -29.273 35.282 40.641  1.00 62.74  ? 868  TYR A N     1 
ATOM   7705 C  CA    . TYR C 3 868 ? -28.919 34.591 39.412  1.00 62.06  ? 868  TYR A CA    1 
ATOM   7706 C  C     . TYR C 3 868 ? -29.589 35.164 38.184  1.00 61.77  ? 868  TYR A C     1 
ATOM   7707 O  O     . TYR C 3 868 ? -28.980 35.230 37.111  1.00 61.60  ? 868  TYR A O     1 
ATOM   7708 C  CB    . TYR C 3 868 ? -29.269 33.114 39.516  1.00 62.16  ? 868  TYR A CB    1 
ATOM   7709 C  CG    . TYR C 3 868 ? -28.383 32.351 40.456  1.00 62.10  ? 868  TYR A CG    1 
ATOM   7710 C  CD1   . TYR C 3 868 ? -28.569 32.422 41.840  1.00 62.06  ? 868  TYR A CD1   1 
ATOM   7711 C  CD2   . TYR C 3 868 ? -27.361 31.555 39.966  1.00 61.83  ? 868  TYR A CD2   1 
ATOM   7712 C  CE1   . TYR C 3 868 ? -27.749 31.719 42.705  1.00 62.41  ? 868  TYR A CE1   1 
ATOM   7713 C  CE2   . TYR C 3 868 ? -26.546 30.844 40.814  1.00 62.26  ? 868  TYR A CE2   1 
ATOM   7714 C  CZ    . TYR C 3 868 ? -26.741 30.929 42.180  1.00 62.25  ? 868  TYR A CZ    1 
ATOM   7715 O  OH    . TYR C 3 868 ? -25.914 30.221 43.011  1.00 62.45  ? 868  TYR A OH    1 
ATOM   7716 N  N     . THR C 3 869 ? -30.851 35.557 38.335  1.00 61.41  ? 869  THR A N     1 
ATOM   7717 C  CA    . THR C 3 869 ? -31.617 36.114 37.218  1.00 61.04  ? 869  THR A CA    1 
ATOM   7718 C  C     . THR C 3 869 ? -30.899 37.355 36.657  1.00 60.46  ? 869  THR A C     1 
ATOM   7719 O  O     . THR C 3 869 ? -30.676 37.459 35.439  1.00 60.15  ? 869  THR A O     1 
ATOM   7720 C  CB    . THR C 3 869 ? -33.100 36.395 37.632  1.00 61.17  ? 869  THR A CB    1 
ATOM   7721 O  OG1   . THR C 3 869 ? -33.772 35.145 37.811  1.00 61.36  ? 869  THR A OG1   1 
ATOM   7722 C  CG2   . THR C 3 869 ? -33.856 37.204 36.569  1.00 60.96  ? 869  THR A CG2   1 
ATOM   7723 N  N     . VAL C 3 870 ? -30.515 38.255 37.562  1.00 59.47  ? 870  VAL A N     1 
ATOM   7724 C  CA    . VAL C 3 870 ? -29.805 39.463 37.199  1.00 58.87  ? 870  VAL A CA    1 
ATOM   7725 C  C     . VAL C 3 870 ? -28.494 39.087 36.526  1.00 58.79  ? 870  VAL A C     1 
ATOM   7726 O  O     . VAL C 3 870 ? -28.228 39.557 35.416  1.00 58.63  ? 870  VAL A O     1 
ATOM   7727 C  CB    . VAL C 3 870 ? -29.576 40.401 38.419  1.00 58.92  ? 870  VAL A CB    1 
ATOM   7728 C  CG1   . VAL C 3 870 ? -28.556 41.475 38.102  1.00 58.63  ? 870  VAL A CG1   1 
ATOM   7729 C  CG2   . VAL C 3 870 ? -30.870 41.058 38.834  1.00 58.29  ? 870  VAL A CG2   1 
ATOM   7730 N  N     . LEU C 3 871 ? -27.706 38.216 37.176  1.00 58.57  ? 871  LEU A N     1 
ATOM   7731 C  CA    . LEU C 3 871 ? -26.399 37.770 36.642  1.00 57.93  ? 871  LEU A CA    1 
ATOM   7732 C  C     . LEU C 3 871 ? -26.478 37.222 35.231  1.00 57.32  ? 871  LEU A C     1 
ATOM   7733 O  O     . LEU C 3 871 ? -25.647 37.541 34.396  1.00 57.46  ? 871  LEU A O     1 
ATOM   7734 C  CB    . LEU C 3 871 ? -25.737 36.722 37.541  1.00 58.03  ? 871  LEU A CB    1 
ATOM   7735 C  CG    . LEU C 3 871 ? -24.731 37.150 38.623  1.00 58.97  ? 871  LEU A CG    1 
ATOM   7736 C  CD1   . LEU C 3 871 ? -24.389 35.959 39.513  1.00 59.09  ? 871  LEU A CD1   1 
ATOM   7737 C  CD2   . LEU C 3 871 ? -23.448 37.774 38.047  1.00 59.19  ? 871  LEU A CD2   1 
ATOM   7738 N  N     . LEU C 3 872 ? -27.484 36.403 34.967  1.00 56.80  ? 872  LEU A N     1 
ATOM   7739 C  CA    . LEU C 3 872 ? -27.619 35.768 33.673  1.00 56.48  ? 872  LEU A CA    1 
ATOM   7740 C  C     . LEU C 3 872 ? -27.897 36.794 32.580  1.00 56.27  ? 872  LEU A C     1 
ATOM   7741 O  O     . LEU C 3 872 ? -27.343 36.722 31.479  1.00 55.79  ? 872  LEU A O     1 
ATOM   7742 C  CB    . LEU C 3 872 ? -28.734 34.726 33.734  1.00 56.64  ? 872  LEU A CB    1 
ATOM   7743 C  CG    . LEU C 3 872 ? -28.997 33.840 32.520  1.00 56.22  ? 872  LEU A CG    1 
ATOM   7744 C  CD1   . LEU C 3 872 ? -27.819 32.930 32.255  1.00 56.68  ? 872  LEU A CD1   1 
ATOM   7745 C  CD2   . LEU C 3 872 ? -30.222 33.024 32.801  1.00 55.79  ? 872  LEU A CD2   1 
ATOM   7746 N  N     . GLU C 3 873 ? -28.747 37.763 32.895  1.00 56.14  ? 873  GLU A N     1 
ATOM   7747 C  CA    . GLU C 3 873 ? -29.192 38.716 31.890  1.00 56.31  ? 873  GLU A CA    1 
ATOM   7748 C  C     . GLU C 3 873 ? -28.124 39.756 31.587  1.00 55.55  ? 873  GLU A C     1 
ATOM   7749 O  O     . GLU C 3 873 ? -27.770 39.973 30.420  1.00 55.53  ? 873  GLU A O     1 
ATOM   7750 C  CB    . GLU C 3 873 ? -30.528 39.358 32.291  1.00 56.69  ? 873  GLU A CB    1 
ATOM   7751 C  CG    . GLU C 3 873 ? -30.965 40.564 31.435  1.00 59.67  ? 873  GLU A CG    1 
ATOM   7752 C  CD    . GLU C 3 873 ? -31.050 40.276 29.924  1.00 63.03  ? 873  GLU A CD    1 
ATOM   7753 O  OE1   . GLU C 3 873 ? -31.407 39.139 29.521  1.00 64.86  ? 873  GLU A OE1   1 
ATOM   7754 O  OE2   . GLU C 3 873 ? -30.776 41.212 29.135  1.00 63.99  ? 873  GLU A OE2   1 
ATOM   7755 N  N     . LYS C 3 874 ? -27.609 40.386 32.636  1.00 54.81  ? 874  LYS A N     1 
ATOM   7756 C  CA    . LYS C 3 874 ? -26.637 41.448 32.469  1.00 54.20  ? 874  LYS A CA    1 
ATOM   7757 C  C     . LYS C 3 874 ? -25.303 40.919 31.963  1.00 53.51  ? 874  LYS A C     1 
ATOM   7758 O  O     . LYS C 3 874 ? -24.690 41.553 31.091  1.00 53.49  ? 874  LYS A O     1 
ATOM   7759 C  CB    . LYS C 3 874 ? -26.466 42.272 33.753  1.00 54.48  ? 874  LYS A CB    1 
ATOM   7760 C  CG    . LYS C 3 874 ? -25.681 41.580 34.860  1.00 55.55  ? 874  LYS A CG    1 
ATOM   7761 C  CD    . LYS C 3 874 ? -24.884 42.563 35.714  1.00 56.20  ? 874  LYS A CD    1 
ATOM   7762 C  CE    . LYS C 3 874 ? -25.793 43.421 36.580  1.00 57.37  ? 874  LYS A CE    1 
ATOM   7763 N  NZ    . LYS C 3 874 ? -25.117 43.748 37.874  1.00 58.55  ? 874  LYS A NZ    1 
ATOM   7764 N  N     . THR C 3 875 ? -24.869 39.758 32.472  1.00 52.49  ? 875  THR A N     1 
ATOM   7765 C  CA    . THR C 3 875 ? -23.544 39.218 32.088  1.00 51.70  ? 875  THR A CA    1 
ATOM   7766 C  C     . THR C 3 875 ? -23.513 38.241 30.925  1.00 51.12  ? 875  THR A C     1 
ATOM   7767 O  O     . THR C 3 875 ? -22.474 38.113 30.295  1.00 51.41  ? 875  THR A O     1 
ATOM   7768 C  CB    . THR C 3 875 ? -22.696 38.609 33.274  1.00 51.67  ? 875  THR A CB    1 
ATOM   7769 O  OG1   . THR C 3 875 ? -23.167 37.296 33.607  1.00 51.49  ? 875  THR A OG1   1 
ATOM   7770 C  CG2   . THR C 3 875 ? -22.694 39.509 34.513  1.00 51.27  ? 875  THR A CG2   1 
ATOM   7771 N  N     . PHE C 3 876 ? -24.612 37.542 30.645  1.00 50.61  ? 876  PHE A N     1 
ATOM   7772 C  CA    . PHE C 3 876 ? -24.605 36.523 29.577  1.00 50.08  ? 876  PHE A CA    1 
ATOM   7773 C  C     . PHE C 3 876 ? -25.527 36.826 28.383  1.00 50.35  ? 876  PHE A C     1 
ATOM   7774 O  O     . PHE C 3 876 ? -25.121 36.692 27.238  1.00 49.86  ? 876  PHE A O     1 
ATOM   7775 C  CB    . PHE C 3 876 ? -24.879 35.120 30.161  1.00 49.65  ? 876  PHE A CB    1 
ATOM   7776 C  CG    . PHE C 3 876 ? -24.946 34.020 29.130  1.00 48.84  ? 876  PHE A CG    1 
ATOM   7777 C  CD1   . PHE C 3 876 ? -23.788 33.431 28.640  1.00 48.44  ? 876  PHE A CD1   1 
ATOM   7778 C  CD2   . PHE C 3 876 ? -26.170 33.567 28.656  1.00 49.18  ? 876  PHE A CD2   1 
ATOM   7779 C  CE1   . PHE C 3 876 ? -23.847 32.415 27.685  1.00 48.84  ? 876  PHE A CE1   1 
ATOM   7780 C  CE2   . PHE C 3 876 ? -26.240 32.551 27.692  1.00 49.54  ? 876  PHE A CE2   1 
ATOM   7781 C  CZ    . PHE C 3 876 ? -25.077 31.971 27.208  1.00 48.77  ? 876  PHE A CZ    1 
ATOM   7782 N  N     . ILE C 3 877 ? -26.762 37.238 28.650  1.00 51.04  ? 877  ILE A N     1 
ATOM   7783 C  CA    . ILE C 3 877 ? -27.749 37.353 27.577  1.00 51.73  ? 877  ILE A CA    1 
ATOM   7784 C  C     . ILE C 3 877 ? -27.655 38.670 26.831  1.00 51.86  ? 877  ILE A C     1 
ATOM   7785 O  O     . ILE C 3 877 ? -27.762 38.675 25.603  1.00 51.93  ? 877  ILE A O     1 
ATOM   7786 C  CB    . ILE C 3 877 ? -29.199 37.137 28.066  1.00 51.93  ? 877  ILE A CB    1 
ATOM   7787 C  CG1   . ILE C 3 877 ? -29.257 36.041 29.135  1.00 52.76  ? 877  ILE A CG1   1 
ATOM   7788 C  CG2   . ILE C 3 877 ? -30.099 36.765 26.901  1.00 51.68  ? 877  ILE A CG2   1 
ATOM   7789 C  CD1   . ILE C 3 877 ? -30.662 35.746 29.642  1.00 53.00  ? 877  ILE A CD1   1 
ATOM   7790 N  N     . LYS C 3 878 ? -27.478 39.777 27.563  1.00 51.80  ? 878  LYS A N     1 
ATOM   7791 C  CA    . LYS C 3 878 ? -27.217 41.074 26.933  1.00 52.28  ? 878  LYS A CA    1 
ATOM   7792 C  C     . LYS C 3 878 ? -26.032 40.940 25.972  1.00 52.23  ? 878  LYS A C     1 
ATOM   7793 O  O     . LYS C 3 878 ? -26.166 41.262 24.792  1.00 52.15  ? 878  LYS A O     1 
ATOM   7794 C  CB    . LYS C 3 878 ? -26.930 42.167 27.975  1.00 52.68  ? 878  LYS A CB    1 
ATOM   7795 C  CG    . LYS C 3 878 ? -28.143 42.774 28.686  1.00 54.54  ? 878  LYS A CG    1 
ATOM   7796 C  CD    . LYS C 3 878 ? -28.575 44.117 28.071  1.00 57.69  ? 878  LYS A CD    1 
ATOM   7797 C  CE    . LYS C 3 878 ? -27.696 45.292 28.571  1.00 59.13  ? 878  LYS A CE    1 
ATOM   7798 N  NZ    . LYS C 3 878 ? -27.646 46.461 27.619  1.00 59.95  ? 878  LYS A NZ    1 
ATOM   7799 N  N     . PRO C 3 879 ? -24.871 40.438 26.465  1.00 52.29  ? 879  PRO A N     1 
ATOM   7800 C  CA    . PRO C 3 879 ? -23.740 40.253 25.572  1.00 52.42  ? 879  PRO A CA    1 
ATOM   7801 C  C     . PRO C 3 879 ? -24.092 39.382 24.376  1.00 52.89  ? 879  PRO A C     1 
ATOM   7802 O  O     . PRO C 3 879 ? -23.879 39.801 23.244  1.00 53.13  ? 879  PRO A O     1 
ATOM   7803 C  CB    . PRO C 3 879 ? -22.722 39.546 26.452  1.00 52.17  ? 879  PRO A CB    1 
ATOM   7804 C  CG    . PRO C 3 879 ? -23.069 39.960 27.804  1.00 52.29  ? 879  PRO A CG    1 
ATOM   7805 C  CD    . PRO C 3 879 ? -24.531 40.023 27.840  1.00 52.02  ? 879  PRO A CD    1 
ATOM   7806 N  N     . LEU C 3 880 ? -24.650 38.199 24.620  1.00 53.32  ? 880  LEU A N     1 
ATOM   7807 C  CA    . LEU C 3 880 ? -24.995 37.266 23.535  1.00 54.03  ? 880  LEU A CA    1 
ATOM   7808 C  C     . LEU C 3 880 ? -25.957 37.887 22.539  1.00 54.57  ? 880  LEU A C     1 
ATOM   7809 O  O     . LEU C 3 880 ? -25.874 37.628 21.334  1.00 54.32  ? 880  LEU A O     1 
ATOM   7810 C  CB    . LEU C 3 880 ? -25.632 35.998 24.092  1.00 53.90  ? 880  LEU A CB    1 
ATOM   7811 C  CG    . LEU C 3 880 ? -25.356 34.621 23.488  1.00 53.12  ? 880  LEU A CG    1 
ATOM   7812 C  CD1   . LEU C 3 880 ? -26.338 33.657 24.142  1.00 51.85  ? 880  LEU A CD1   1 
ATOM   7813 C  CD2   . LEU C 3 880 ? -25.453 34.555 21.959  1.00 51.06  ? 880  LEU A CD2   1 
ATOM   7814 N  N     . GLU C 3 881 ? -26.863 38.713 23.053  1.00 55.31  ? 881  GLU A N     1 
ATOM   7815 C  CA    . GLU C 3 881 ? -27.805 39.418 22.206  1.00 56.33  ? 881  GLU A CA    1 
ATOM   7816 C  C     . GLU C 3 881 ? -27.064 40.325 21.231  1.00 56.14  ? 881  GLU A C     1 
ATOM   7817 O  O     . GLU C 3 881 ? -27.426 40.409 20.059  1.00 56.18  ? 881  GLU A O     1 
ATOM   7818 C  CB    . GLU C 3 881 ? -28.819 40.208 23.042  1.00 56.88  ? 881  GLU A CB    1 
ATOM   7819 C  CG    . GLU C 3 881 ? -30.266 40.010 22.583  1.00 59.67  ? 881  GLU A CG    1 
ATOM   7820 C  CD    . GLU C 3 881 ? -30.431 40.155 21.059  1.00 63.52  ? 881  GLU A CD    1 
ATOM   7821 O  OE1   . GLU C 3 881 ? -30.314 41.299 20.548  1.00 65.10  ? 881  GLU A OE1   1 
ATOM   7822 O  OE2   . GLU C 3 881 ? -30.668 39.126 20.375  1.00 64.32  ? 881  GLU A OE2   1 
ATOM   7823 N  N     . GLY C 3 882 ? -26.017 40.983 21.720  1.00 56.19  ? 882  GLY A N     1 
ATOM   7824 C  CA    . GLY C 3 882 ? -25.160 41.787 20.872  1.00 56.55  ? 882  GLY A CA    1 
ATOM   7825 C  C     . GLY C 3 882 ? -24.662 40.973 19.693  1.00 57.11  ? 882  GLY A C     1 
ATOM   7826 O  O     . GLY C 3 882 ? -24.898 41.345 18.544  1.00 57.42  ? 882  GLY A O     1 
ATOM   7827 N  N     . PHE C 3 883 ? -24.003 39.848 19.977  1.00 57.39  ? 883  PHE A N     1 
ATOM   7828 C  CA    . PHE C 3 883 ? -23.401 39.004 18.943  1.00 57.93  ? 883  PHE A CA    1 
ATOM   7829 C  C     . PHE C 3 883 ? -24.460 38.485 17.970  1.00 58.40  ? 883  PHE A C     1 
ATOM   7830 O  O     . PHE C 3 883 ? -24.239 38.441 16.745  1.00 58.19  ? 883  PHE A O     1 
ATOM   7831 C  CB    . PHE C 3 883 ? -22.675 37.779 19.541  1.00 57.84  ? 883  PHE A CB    1 
ATOM   7832 C  CG    . PHE C 3 883 ? -21.806 38.069 20.750  1.00 58.07  ? 883  PHE A CG    1 
ATOM   7833 C  CD1   . PHE C 3 883 ? -21.318 39.351 21.021  1.00 57.90  ? 883  PHE A CD1   1 
ATOM   7834 C  CD2   . PHE C 3 883 ? -21.435 37.026 21.598  1.00 57.57  ? 883  PHE A CD2   1 
ATOM   7835 C  CE1   . PHE C 3 883 ? -20.507 39.589 22.133  1.00 57.17  ? 883  PHE A CE1   1 
ATOM   7836 C  CE2   . PHE C 3 883 ? -20.621 37.255 22.705  1.00 56.87  ? 883  PHE A CE2   1 
ATOM   7837 C  CZ    . PHE C 3 883 ? -20.158 38.537 22.972  1.00 57.20  ? 883  PHE A CZ    1 
ATOM   7838 N  N     . THR C 3 884 ? -25.601 38.090 18.546  1.00 58.86  ? 884  THR A N     1 
ATOM   7839 C  CA    . THR C 3 884 ? -26.718 37.453 17.838  1.00 58.98  ? 884  THR A CA    1 
ATOM   7840 C  C     . THR C 3 884 ? -27.296 38.353 16.752  1.00 59.09  ? 884  THR A C     1 
ATOM   7841 O  O     . THR C 3 884 ? -27.413 37.952 15.589  1.00 58.78  ? 884  THR A O     1 
ATOM   7842 C  CB    . THR C 3 884 ? -27.790 37.051 18.867  1.00 58.96  ? 884  THR A CB    1 
ATOM   7843 O  OG1   . THR C 3 884 ? -27.485 35.740 19.349  1.00 59.72  ? 884  THR A OG1   1 
ATOM   7844 C  CG2   . THR C 3 884 ? -29.206 37.066 18.289  1.00 59.24  ? 884  THR A CG2   1 
ATOM   7845 N  N     . SER C 3 885 ? -27.633 39.574 17.155  1.00 59.35  ? 885  SER A N     1 
ATOM   7846 C  CA    . SER C 3 885 ? -28.193 40.569 16.278  1.00 59.83  ? 885  SER A CA    1 
ATOM   7847 C  C     . SER C 3 885 ? -27.286 40.830 15.078  1.00 60.23  ? 885  SER A C     1 
ATOM   7848 O  O     . SER C 3 885 ? -27.734 40.746 13.940  1.00 60.34  ? 885  SER A O     1 
ATOM   7849 C  CB    . SER C 3 885 ? -28.428 41.850 17.066  1.00 59.84  ? 885  SER A CB    1 
ATOM   7850 O  OG    . SER C 3 885 ? -28.145 42.987 16.267  1.00 61.18  ? 885  SER A OG    1 
ATOM   7851 N  N     . ALA C 3 886 ? -26.011 41.133 15.340  1.00 60.79  ? 886  ALA A N     1 
ATOM   7852 C  CA    . ALA C 3 886 ? -25.035 41.459 14.291  1.00 60.99  ? 886  ALA A CA    1 
ATOM   7853 C  C     . ALA C 3 886 ? -24.954 40.360 13.244  1.00 61.59  ? 886  ALA A C     1 
ATOM   7854 O  O     . ALA C 3 886 ? -24.930 40.631 12.034  1.00 61.50  ? 886  ALA A O     1 
ATOM   7855 C  CB    . ALA C 3 886 ? -23.681 41.696 14.894  1.00 60.74  ? 886  ALA A CB    1 
ATOM   7856 N  N     . ALA C 3 887 ? -24.938 39.121 13.735  1.00 62.46  ? 887  ALA A N     1 
ATOM   7857 C  CA    . ALA C 3 887 ? -24.771 37.921 12.909  1.00 63.12  ? 887  ALA A CA    1 
ATOM   7858 C  C     . ALA C 3 887 ? -26.023 37.527 12.129  1.00 63.59  ? 887  ALA A C     1 
ATOM   7859 O  O     . ALA C 3 887 ? -25.925 36.713 11.203  1.00 63.53  ? 887  ALA A O     1 
ATOM   7860 C  CB    . ALA C 3 887 ? -24.305 36.759 13.770  1.00 62.98  ? 887  ALA A CB    1 
ATOM   7861 N  N     . LYS C 3 888 ? -27.169 38.123 12.495  1.00 64.21  ? 888  LYS A N     1 
ATOM   7862 C  CA    . LYS C 3 888 ? -28.510 37.790 11.962  1.00 64.89  ? 888  LYS A CA    1 
ATOM   7863 C  C     . LYS C 3 888 ? -28.903 36.356 12.351  1.00 65.65  ? 888  LYS A C     1 
ATOM   7864 O  O     . LYS C 3 888 ? -29.040 35.474 11.499  1.00 65.95  ? 888  LYS A O     1 
ATOM   7865 C  CB    . LYS C 3 888 ? -28.627 37.993 10.434  1.00 64.65  ? 888  LYS A CB    1 
ATOM   7866 C  CG    . LYS C 3 888 ? -27.870 39.160 9.835   1.00 64.23  ? 888  LYS A CG    1 
ATOM   7867 C  CD    . LYS C 3 888 ? -28.598 40.483 9.960   1.00 64.50  ? 888  LYS A CD    1 
ATOM   7868 C  CE    . LYS C 3 888 ? -27.738 41.606 9.376   1.00 64.71  ? 888  LYS A CE    1 
ATOM   7869 N  NZ    . LYS C 3 888 ? -28.521 42.832 9.082   1.00 64.29  ? 888  LYS A NZ    1 
ATOM   7870 N  N     . LEU C 3 889 ? -29.074 36.141 13.648  1.00 66.45  ? 889  LEU A N     1 
ATOM   7871 C  CA    . LEU C 3 889 ? -29.341 34.826 14.229  1.00 67.32  ? 889  LEU A CA    1 
ATOM   7872 C  C     . LEU C 3 889 ? -30.220 35.075 15.437  1.00 67.82  ? 889  LEU A C     1 
ATOM   7873 O  O     . LEU C 3 889 ? -30.424 36.222 15.806  1.00 67.90  ? 889  LEU A O     1 
ATOM   7874 C  CB    . LEU C 3 889 ? -28.024 34.191 14.680  1.00 67.44  ? 889  LEU A CB    1 
ATOM   7875 C  CG    . LEU C 3 889 ? -27.426 32.945 14.021  1.00 67.80  ? 889  LEU A CG    1 
ATOM   7876 C  CD1   . LEU C 3 889 ? -27.336 33.018 12.502  1.00 68.45  ? 889  LEU A CD1   1 
ATOM   7877 C  CD2   . LEU C 3 889 ? -26.060 32.701 14.612  1.00 67.62  ? 889  LEU A CD2   1 
ATOM   7878 N  N     . ASP C 3 890 ? -30.722 34.028 16.082  1.00 68.86  ? 890  ASP A N     1 
ATOM   7879 C  CA    . ASP C 3 890 ? -31.668 34.260 17.177  1.00 70.18  ? 890  ASP A CA    1 
ATOM   7880 C  C     . ASP C 3 890 ? -31.353 33.716 18.570  1.00 70.86  ? 890  ASP A C     1 
ATOM   7881 O  O     . ASP C 3 890 ? -31.927 34.194 19.550  1.00 71.15  ? 890  ASP A O     1 
ATOM   7882 C  CB    . ASP C 3 890 ? -33.095 33.880 16.760  1.00 70.26  ? 890  ASP A CB    1 
ATOM   7883 C  CG    . ASP C 3 890 ? -33.808 35.014 16.060  1.00 70.47  ? 890  ASP A CG    1 
ATOM   7884 O  OD1   . ASP C 3 890 ? -33.654 36.181 16.503  1.00 69.60  ? 890  ASP A OD1   1 
ATOM   7885 O  OD2   . ASP C 3 890 ? -34.517 34.737 15.069  1.00 71.42  ? 890  ASP A OD2   1 
ATOM   7886 N  N     . TYR C 3 891 ? -30.466 32.729 18.654  1.00 71.71  ? 891  TYR A N     1 
ATOM   7887 C  CA    . TYR C 3 891 ? -30.118 32.049 19.913  1.00 72.96  ? 891  TYR A CA    1 
ATOM   7888 C  C     . TYR C 3 891 ? -31.296 31.404 20.662  1.00 74.33  ? 891  TYR A C     1 
ATOM   7889 O  O     . TYR C 3 891 ? -31.099 30.762 21.698  1.00 74.42  ? 891  TYR A O     1 
ATOM   7890 C  CB    . TYR C 3 891 ? -29.256 32.933 20.844  1.00 72.38  ? 891  TYR A CB    1 
ATOM   7891 C  CG    . TYR C 3 891 ? -29.990 33.973 21.668  1.00 71.83  ? 891  TYR A CG    1 
ATOM   7892 C  CD1   . TYR C 3 891 ? -30.653 33.631 22.844  1.00 71.94  ? 891  TYR A CD1   1 
ATOM   7893 C  CD2   . TYR C 3 891 ? -29.986 35.310 21.289  1.00 71.44  ? 891  TYR A CD2   1 
ATOM   7894 C  CE1   . TYR C 3 891 ? -31.319 34.595 23.595  1.00 71.56  ? 891  TYR A CE1   1 
ATOM   7895 C  CE2   . TYR C 3 891 ? -30.648 36.277 22.028  1.00 70.79  ? 891  TYR A CE2   1 
ATOM   7896 C  CZ    . TYR C 3 891 ? -31.308 35.918 23.178  1.00 71.22  ? 891  TYR A CZ    1 
ATOM   7897 O  OH    . TYR C 3 891 ? -31.955 36.890 23.912  1.00 70.86  ? 891  TYR A OH    1 
ATOM   7898 N  N     . GLU C 3 892 ? -32.509 31.563 20.129  1.00 76.21  ? 892  GLU A N     1 
ATOM   7899 C  CA    . GLU C 3 892 ? -33.707 30.975 20.732  1.00 77.98  ? 892  GLU A CA    1 
ATOM   7900 C  C     . GLU C 3 892 ? -34.662 30.395 19.683  1.00 79.51  ? 892  GLU A C     1 
ATOM   7901 O  O     . GLU C 3 892 ? -34.340 29.381 19.058  1.00 79.71  ? 892  GLU A O     1 
ATOM   7902 C  CB    . GLU C 3 892 ? -34.404 31.981 21.640  1.00 77.61  ? 892  GLU A CB    1 
ATOM   7903 C  CG    . GLU C 3 892 ? -34.891 31.358 22.923  1.00 77.72  ? 892  GLU A CG    1 
ATOM   7904 C  CD    . GLU C 3 892 ? -35.144 32.377 24.017  1.00 77.75  ? 892  GLU A CD    1 
ATOM   7905 O  OE1   . GLU C 3 892 ? -35.181 33.593 23.718  1.00 77.74  ? 892  GLU A OE1   1 
ATOM   7906 O  OE2   . GLU C 3 892 ? -35.310 31.954 25.182  1.00 77.49  ? 892  GLU A OE2   1 
ATOM   7907 N  N     . LYS C 3 893 ? -35.826 31.017 19.491  1.00 81.47  ? 893  LYS A N     1 
ATOM   7908 C  CA    . LYS C 3 893 ? -36.790 30.539 18.490  1.00 83.28  ? 893  LYS A CA    1 
ATOM   7909 C  C     . LYS C 3 893 ? -37.859 31.584 18.164  1.00 84.54  ? 893  LYS A C     1 
ATOM   7910 O  O     . LYS C 3 893 ? -38.499 32.126 19.064  1.00 84.76  ? 893  LYS A O     1 
ATOM   7911 C  CB    . LYS C 3 893 ? -37.442 29.227 18.953  1.00 83.24  ? 893  LYS A CB    1 
ATOM   7912 C  CG    . LYS C 3 893 ? -37.696 28.228 17.830  1.00 83.81  ? 893  LYS A CG    1 
ATOM   7913 C  CD    . LYS C 3 893 ? -36.391 27.803 17.162  1.00 84.75  ? 893  LYS A CD    1 
ATOM   7914 C  CE    . LYS C 3 893 ? -36.607 27.280 15.747  1.00 85.11  ? 893  LYS A CE    1 
ATOM   7915 N  NZ    . LYS C 3 893 ? -37.311 25.970 15.758  1.00 85.95  ? 893  LYS A NZ    1 
ATOM   7916 N  N     . LYS C 3 894 ? -38.048 31.868 16.877  1.00 86.14  ? 894  LYS A N     1 
ATOM   7917 C  CA    . LYS C 3 894 ? -39.065 32.837 16.451  1.00 87.83  ? 894  LYS A CA    1 
ATOM   7918 C  C     . LYS C 3 894 ? -40.500 32.306 16.613  1.00 88.88  ? 894  LYS A C     1 
ATOM   7919 O  O     . LYS C 3 894 ? -40.715 31.092 16.740  1.00 89.07  ? 894  LYS A O     1 
ATOM   7920 C  CB    . LYS C 3 894 ? -38.828 33.309 15.006  1.00 87.77  ? 894  LYS A CB    1 
ATOM   7921 C  CG    . LYS C 3 894 ? -37.735 34.364 14.870  1.00 88.43  ? 894  LYS A CG    1 
ATOM   7922 C  CD    . LYS C 3 894 ? -38.168 35.534 13.980  1.00 88.42  ? 894  LYS A CD    1 
ATOM   7923 C  CE    . LYS C 3 894 ? -38.794 36.664 14.799  1.00 88.35  ? 894  LYS A CE    1 
ATOM   7924 N  NZ    . LYS C 3 894 ? -37.776 37.466 15.543  1.00 87.75  ? 894  LYS A NZ    1 
ATOM   7925 N  N     . ALA C 3 895 ? -41.464 33.231 16.620  1.00 90.00  ? 895  ALA A N     1 
ATOM   7926 C  CA    . ALA C 3 895 ? -42.884 32.907 16.706  1.00 91.01  ? 895  ALA A CA    1 
ATOM   7927 C  C     . ALA C 3 895 ? -43.291 32.107 15.473  1.00 91.80  ? 895  ALA A C     1 
ATOM   7928 O  O     . ALA C 3 895 ? -43.470 32.663 14.385  1.00 91.82  ? 895  ALA A O     1 
ATOM   7929 C  CB    . ALA C 3 895 ? -43.714 34.183 16.828  1.00 91.08  ? 895  ALA A CB    1 
ATOM   7930 N  N     . SER C 3 896 ? -43.436 30.799 15.671  1.00 92.75  ? 896  SER A N     1 
ATOM   7931 C  CA    . SER C 3 896 ? -43.535 29.826 14.584  1.00 93.64  ? 896  SER A CA    1 
ATOM   7932 C  C     . SER C 3 896 ? -44.377 30.279 13.392  1.00 94.30  ? 896  SER A C     1 
ATOM   7933 O  O     . SER C 3 896 ? -43.883 30.322 12.260  1.00 94.40  ? 896  SER A O     1 
ATOM   7934 C  CB    . SER C 3 896 ? -44.071 28.481 15.100  1.00 93.70  ? 896  SER A CB    1 
ATOM   7935 O  OG    . SER C 3 896 ? -43.538 28.116 16.363  1.00 93.44  ? 896  SER A OG    1 
ATOM   7936 N  N     . LEU C 3 897 ? -45.640 30.616 13.657  1.00 95.07  ? 897  LEU A N     1 
ATOM   7937 C  CA    . LEU C 3 897 ? -46.687 30.684 12.620  1.00 95.91  ? 897  LEU A CA    1 
ATOM   7938 C  C     . LEU C 3 897 ? -46.770 29.350 11.867  1.00 96.30  ? 897  LEU A C     1 
ATOM   7939 O  O     . LEU C 3 897 ? -47.561 29.175 10.948  1.00 96.16  ? 897  LEU A O     1 
ATOM   7940 C  CB    . LEU C 3 897 ? -46.476 31.867 11.660  1.00 95.92  ? 897  LEU A CB    1 
ATOM   7941 C  CG    . LEU C 3 897 ? -47.709 32.691 11.233  1.00 96.39  ? 897  LEU A CG    1 
ATOM   7942 C  CD1   . LEU C 3 897 ? -48.652 31.947 10.264  1.00 95.54  ? 897  LEU A CD1   1 
ATOM   7943 C  CD2   . LEU C 3 897 ? -48.485 33.246 12.449  1.00 96.56  ? 897  LEU A CD2   1 
ATOM   7944 N  N     . PHE C 3 898 ? -45.927 28.416 12.284  1.00 97.08  ? 898  PHE A N     1 
ATOM   7945 C  CA    . PHE C 3 898 ? -45.932 27.066 11.783  1.00 97.94  ? 898  PHE A CA    1 
ATOM   7946 C  C     . PHE C 3 898 ? -46.071 26.138 12.979  1.00 98.52  ? 898  PHE A C     1 
ATOM   7947 O  O     . PHE C 3 898 ? -45.909 24.924 12.864  1.00 98.58  ? 898  PHE A O     1 
ATOM   7948 C  CB    . PHE C 3 898 ? -44.647 26.793 11.009  1.00 98.04  ? 898  PHE A CB    1 
ATOM   7949 C  CG    . PHE C 3 898 ? -44.681 27.275 9.581   1.00 98.41  ? 898  PHE A CG    1 
ATOM   7950 C  CD1   . PHE C 3 898 ? -44.686 28.640 9.285   1.00 98.83  ? 898  PHE A CD1   1 
ATOM   7951 C  CD2   . PHE C 3 898 ? -44.692 26.360 8.527   1.00 98.39  ? 898  PHE A CD2   1 
ATOM   7952 C  CE1   . PHE C 3 898 ? -44.718 29.087 7.957   1.00 98.85  ? 898  PHE A CE1   1 
ATOM   7953 C  CE2   . PHE C 3 898 ? -44.719 26.796 7.196   1.00 98.47  ? 898  PHE A CE2   1 
ATOM   7954 C  CZ    . PHE C 3 898 ? -44.734 28.160 6.910   1.00 98.60  ? 898  PHE A CZ    1 
ATOM   7955 N  N     . ASP C 3 899 ? -46.373 26.736 14.129  1.00 99.31  ? 899  ASP A N     1 
ATOM   7956 C  CA    . ASP C 3 899 ? -46.746 26.006 15.339  1.00 100.17 ? 899  ASP A CA    1 
ATOM   7957 C  C     . ASP C 3 899 ? -48.117 25.362 15.167  1.00 100.54 ? 899  ASP A C     1 
ATOM   7958 O  O     . ASP C 3 899 ? -48.434 24.377 15.841  1.00 100.73 ? 899  ASP A O     1 
ATOM   7959 C  CB    . ASP C 3 899 ? -46.766 26.945 16.555  1.00 100.41 ? 899  ASP A CB    1 
ATOM   7960 C  CG    . ASP C 3 899 ? -47.674 28.170 16.352  1.00 101.00 ? 899  ASP A CG    1 
ATOM   7961 O  OD1   . ASP C 3 899 ? -48.921 28.028 16.416  1.00 100.98 ? 899  ASP A OD1   1 
ATOM   7962 O  OD2   . ASP C 3 899 ? -47.134 29.281 16.146  1.00 101.49 ? 899  ASP A OD2   1 
ATOM   7963 N  N     . MET C 3 900 ? -48.919 25.933 14.265  1.00 100.83 ? 900  MET A N     1 
ATOM   7964 C  CA    . MET C 3 900 ? -50.253 25.435 13.952  1.00 101.32 ? 900  MET A CA    1 
ATOM   7965 C  C     . MET C 3 900 ? -50.158 24.023 13.406  1.00 101.44 ? 900  MET A C     1 
ATOM   7966 O  O     . MET C 3 900 ? -51.174 23.366 13.172  1.00 101.59 ? 900  MET A O     1 
ATOM   7967 C  CB    . MET C 3 900 ? -50.934 26.332 12.924  1.00 101.20 ? 900  MET A CB    1 
ATOM   7968 C  CG    . MET C 3 900 ? -50.672 27.807 13.122  1.00 101.82 ? 900  MET A CG    1 
ATOM   7969 S  SD    . MET C 3 900 ? -52.028 28.872 12.584  1.00 102.99 ? 900  MET A SD    1 
ATOM   7970 C  CE    . MET C 3 900 ? -53.073 28.884 14.047  1.00 102.79 ? 900  MET A CE    1 
ATOM   7971 N  N     . PHE C 3 901 ? -48.921 23.570 13.209  1.00 101.67 ? 901  PHE A N     1 
ATOM   7972 C  CA    . PHE C 3 901 ? -48.632 22.218 12.751  1.00 101.91 ? 901  PHE A CA    1 
ATOM   7973 C  C     . PHE C 3 901 ? -47.855 21.418 13.808  1.00 102.12 ? 901  PHE A C     1 
ATOM   7974 O  O     . PHE C 3 901 ? -46.942 20.658 13.479  1.00 102.16 ? 901  PHE A O     1 
ATOM   7975 C  CB    . PHE C 3 901 ? -47.862 22.265 11.424  1.00 101.85 ? 901  PHE A CB    1 
ATOM   7976 C  CG    . PHE C 3 901 ? -48.480 23.172 10.385  1.00 101.91 ? 901  PHE A CG    1 
ATOM   7977 C  CD1   . PHE C 3 901 ? -49.594 22.762 9.649   1.00 101.50 ? 901  PHE A CD1   1 
ATOM   7978 C  CD2   . PHE C 3 901 ? -47.942 24.434 10.134  1.00 102.07 ? 901  PHE A CD2   1 
ATOM   7979 C  CE1   . PHE C 3 901 ? -50.162 23.598 8.686   1.00 101.02 ? 901  PHE A CE1   1 
ATOM   7980 C  CE2   . PHE C 3 901 ? -48.506 25.280 9.170   1.00 101.49 ? 901  PHE A CE2   1 
ATOM   7981 C  CZ    . PHE C 3 901 ? -49.616 24.860 8.448   1.00 101.24 ? 901  PHE A CZ    1 
ATOM   7982 N  N     . ASP C 3 902 ? -48.223 21.595 15.076  1.00 102.41 ? 902  ASP A N     1 
ATOM   7983 C  CA    . ASP C 3 902 ? -47.616 20.845 16.178  1.00 102.75 ? 902  ASP A CA    1 
ATOM   7984 C  C     . ASP C 3 902 ? -48.173 19.418 16.211  1.00 102.82 ? 902  ASP A C     1 
ATOM   7985 O  O     . ASP C 3 902 ? -49.361 19.207 15.947  1.00 102.93 ? 902  ASP A O     1 
ATOM   7986 C  CB    . ASP C 3 902 ? -47.874 21.556 17.521  1.00 102.93 ? 902  ASP A CB    1 
ATOM   7987 C  CG    . ASP C 3 902 ? -47.092 20.936 18.693  1.00 103.28 ? 902  ASP A CG    1 
ATOM   7988 O  OD1   . ASP C 3 902 ? -45.843 21.028 18.706  1.00 103.64 ? 902  ASP A OD1   1 
ATOM   7989 O  OD2   . ASP C 3 902 ? -47.731 20.373 19.614  1.00 103.27 ? 902  ASP A OD2   1 
ATOM   7990 N  N     . PHE C 3 903 ? -47.304 18.455 16.530  1.00 102.93 ? 903  PHE A N     1 
ATOM   7991 C  CA    . PHE C 3 903 ? -47.663 17.037 16.708  1.00 102.98 ? 903  PHE A CA    1 
ATOM   7992 C  C     . PHE C 3 903 ? -48.304 16.438 15.453  1.00 102.97 ? 903  PHE A C     1 
ATOM   7993 O  O     . PHE C 3 903 ? -47.655 15.731 14.680  1.00 102.88 ? 903  PHE A O     1 
ATOM   7994 C  CB    . PHE C 3 903 ? -48.592 16.857 17.922  1.00 103.06 ? 903  PHE A CB    1 
ATOM   7995 C  CG    . PHE C 3 903 ? -48.295 15.633 18.753  1.00 103.33 ? 903  PHE A CG    1 
ATOM   7996 C  CD1   . PHE C 3 903 ? -48.480 14.346 18.233  1.00 103.44 ? 903  PHE A CD1   1 
ATOM   7997 C  CD2   . PHE C 3 903 ? -47.852 15.766 20.072  1.00 103.67 ? 903  PHE A CD2   1 
ATOM   7998 C  CE1   . PHE C 3 903 ? -48.211 13.206 19.008  1.00 103.19 ? 903  PHE A CE1   1 
ATOM   7999 C  CE2   . PHE C 3 903 ? -47.583 14.635 20.857  1.00 103.73 ? 903  PHE A CE2   1 
ATOM   8000 C  CZ    . PHE C 3 903 ? -47.766 13.351 20.321  1.00 103.37 ? 903  PHE A CZ    1 
HETATM 8001 MG MG    . MG  D 4 .   ? 1.363   45.866 12.944  1.00 44.27  ? 904  MG  A MG    1 
HETATM 8002 P  PG    . DTP E 5 .   ? 3.323   43.947 14.393  1.00 39.94  ? 905  DTP A PG    1 
HETATM 8003 O  O1G   . DTP E 5 .   ? 2.072   44.265 13.623  1.00 39.50  ? 905  DTP A O1G   1 
HETATM 8004 O  O2G   . DTP E 5 .   ? 4.488   43.410 13.591  1.00 40.19  ? 905  DTP A O2G   1 
HETATM 8005 O  O3G   . DTP E 5 .   ? 3.077   43.155 15.653  1.00 39.63  ? 905  DTP A O3G   1 
HETATM 8006 P  PB    . DTP E 5 .   ? 2.986   46.709 15.047  1.00 39.60  ? 905  DTP A PB    1 
HETATM 8007 O  O1B   . DTP E 5 .   ? 3.784   47.742 15.788  1.00 39.66  ? 905  DTP A O1B   1 
HETATM 8008 O  O2B   . DTP E 5 .   ? 2.348   47.105 13.742  1.00 40.86  ? 905  DTP A O2B   1 
HETATM 8009 O  O3B   . DTP E 5 .   ? 3.896   45.390 14.864  1.00 40.55  ? 905  DTP A O3B   1 
HETATM 8010 P  PA    . DTP E 5 .   ? 0.349   46.476 15.976  1.00 38.28  ? 905  DTP A PA    1 
HETATM 8011 O  O1A   . DTP E 5 .   ? -0.254  45.860 17.222  1.00 36.05  ? 905  DTP A O1A   1 
HETATM 8012 O  O2A   . DTP E 5 .   ? -0.118  46.103 14.587  1.00 39.24  ? 905  DTP A O2A   1 
HETATM 8013 O  O3A   . DTP E 5 .   ? 1.898   46.101 16.046  1.00 39.62  ? 905  DTP A O3A   1 
HETATM 8014 O  "O5'" . DTP E 5 .   ? 0.212   48.069 16.112  1.00 37.23  ? 905  DTP A "O5'" 1 
HETATM 8015 C  "C5'" . DTP E 5 .   ? 0.052   48.948 15.009  1.00 34.15  ? 905  DTP A "C5'" 1 
HETATM 8016 C  "C4'" . DTP E 5 .   ? 0.555   50.296 15.477  1.00 33.33  ? 905  DTP A "C4'" 1 
HETATM 8017 O  "O4'" . DTP E 5 .   ? -0.240  50.747 16.578  1.00 32.94  ? 905  DTP A "O4'" 1 
HETATM 8018 C  "C3'" . DTP E 5 .   ? 1.938   50.203 16.085  1.00 33.33  ? 905  DTP A "C3'" 1 
HETATM 8019 O  "O3'" . DTP E 5 .   ? 2.933   50.097 15.066  1.00 34.31  ? 905  DTP A "O3'" 1 
HETATM 8020 C  "C2'" . DTP E 5 .   ? 1.945   51.526 16.822  1.00 34.20  ? 905  DTP A "C2'" 1 
HETATM 8021 C  "C1'" . DTP E 5 .   ? 0.585   51.468 17.505  1.00 32.16  ? 905  DTP A "C1'" 1 
HETATM 8022 N  N9    . DTP E 5 .   ? 0.686   50.769 18.826  1.00 31.42  ? 905  DTP A N9    1 
HETATM 8023 C  C8    . DTP E 5 .   ? 0.368   49.497 19.085  1.00 31.43  ? 905  DTP A C8    1 
HETATM 8024 N  N7    . DTP E 5 .   ? 0.562   49.148 20.376  1.00 31.62  ? 905  DTP A N7    1 
HETATM 8025 C  C5    . DTP E 5 .   ? 1.048   50.227 21.009  1.00 29.36  ? 905  DTP A C5    1 
HETATM 8026 C  C6    . DTP E 5 .   ? 1.471   50.563 22.392  1.00 29.54  ? 905  DTP A C6    1 
HETATM 8027 N  N6    . DTP E 5 .   ? 1.456   49.680 23.429  1.00 27.49  ? 905  DTP A N6    1 
HETATM 8028 N  N1    . DTP E 5 .   ? 1.927   51.808 22.607  1.00 30.77  ? 905  DTP A N1    1 
HETATM 8029 C  C2    . DTP E 5 .   ? 1.973   52.738 21.646  1.00 31.46  ? 905  DTP A C2    1 
HETATM 8030 N  N3    . DTP E 5 .   ? 1.566   52.489 20.388  1.00 32.92  ? 905  DTP A N3    1 
HETATM 8031 C  C4    . DTP E 5 .   ? 1.119   51.275 19.993  1.00 30.51  ? 905  DTP A C4    1 
HETATM 8032 O  O     . HOH F 6 .   ? -4.558  55.590 18.391  1.00 51.49  ? 19   HOH T O     1 
HETATM 8033 O  O     . HOH F 6 .   ? -1.147  56.505 20.002  1.00 44.37  ? 20   HOH T O     1 
HETATM 8034 O  O     . HOH F 6 .   ? -4.623  62.782 22.670  1.00 45.88  ? 21   HOH T O     1 
HETATM 8035 O  O     . HOH F 6 .   ? -18.510 50.487 16.774  1.00 47.01  ? 22   HOH T O     1 
HETATM 8036 O  O     . HOH F 6 .   ? -24.048 52.464 42.078  1.00 55.22  ? 23   HOH T O     1 
HETATM 8037 O  O     . HOH F 6 .   ? -38.996 60.948 26.787  1.00 54.21  ? 24   HOH T O     1 
HETATM 8038 O  O     . HOH F 6 .   ? -25.053 52.072 28.148  1.00 42.76  ? 25   HOH T O     1 
HETATM 8039 O  O     . HOH F 6 .   ? 1.479   54.186 29.334  1.00 37.84  ? 26   HOH T O     1 
HETATM 8040 O  O     . HOH F 6 .   ? -3.216  53.327 27.584  1.00 33.92  ? 27   HOH T O     1 
HETATM 8041 O  O     . HOH F 6 .   ? -17.588 54.576 16.507  1.00 50.47  ? 28   HOH T O     1 
HETATM 8042 O  O     . HOH F 6 .   ? -12.035 57.560 24.872  1.00 51.45  ? 29   HOH T O     1 
HETATM 8043 O  O     . HOH F 6 .   ? -24.528 45.797 22.805  1.00 38.45  ? 30   HOH T O     1 
HETATM 8044 O  O     . HOH F 6 .   ? -25.111 47.482 25.037  1.00 37.58  ? 31   HOH T O     1 
HETATM 8045 O  O     . HOH F 6 .   ? -40.123 68.300 32.072  1.00 54.21  ? 32   HOH T O     1 
HETATM 8046 O  O     . HOH F 6 .   ? -29.840 55.391 34.595  1.00 67.95  ? 33   HOH T O     1 
HETATM 8047 O  O     . HOH F 6 .   ? -10.026 57.145 27.069  1.00 50.35  ? 34   HOH T O     1 
HETATM 8048 O  O     . HOH F 6 .   ? -41.731 59.890 27.730  1.00 54.34  ? 35   HOH T O     1 
HETATM 8049 O  O     . HOH F 6 .   ? -19.847 55.211 25.248  1.00 41.40  ? 36   HOH T O     1 
HETATM 8050 O  O     . HOH F 6 .   ? -18.867 57.184 24.382  1.00 24.66  ? 37   HOH T O     1 
HETATM 8051 O  O     . HOH F 6 .   ? -7.521  53.021 18.162  1.00 61.46  ? 38   HOH T O     1 
HETATM 8052 O  O     . HOH G 6 .   ? -39.966 49.584 30.190  1.00 62.28  ? 115  HOH P O     1 
HETATM 8053 O  O     . HOH G 6 .   ? -31.849 62.703 26.074  1.00 34.67  ? 116  HOH P O     1 
HETATM 8054 O  O     . HOH G 6 .   ? -11.179 55.680 32.131  1.00 43.48  ? 117  HOH P O     1 
HETATM 8055 O  O     . HOH G 6 .   ? -7.758  39.465 23.435  1.00 40.82  ? 118  HOH P O     1 
HETATM 8056 O  O     . HOH G 6 .   ? -8.932  40.128 29.960  1.00 45.37  ? 119  HOH P O     1 
HETATM 8057 O  O     . HOH G 6 .   ? -10.408 43.083 35.687  1.00 36.19  ? 120  HOH P O     1 
HETATM 8058 O  O     . HOH G 6 .   ? -42.084 55.015 31.127  1.00 52.54  ? 121  HOH P O     1 
HETATM 8059 O  O     . HOH G 6 .   ? -2.178  47.802 24.687  1.00 46.88  ? 122  HOH P O     1 
HETATM 8060 O  O     . HOH G 6 .   ? -6.187  50.422 28.846  1.00 42.45  ? 123  HOH P O     1 
HETATM 8061 O  O     . HOH G 6 .   ? -3.069  46.003 22.832  1.00 57.14  ? 124  HOH P O     1 
HETATM 8062 O  O     . HOH G 6 .   ? -4.030  52.713 17.622  1.00 51.71  ? 125  HOH P O     1 
HETATM 8063 O  O     . HOH G 6 .   ? -5.778  41.804 15.861  1.00 47.31  ? 126  HOH P O     1 
HETATM 8064 O  O     . HOH G 6 .   ? -18.385 64.803 35.725  1.00 65.39  ? 127  HOH P O     1 
HETATM 8065 O  O     . HOH G 6 .   ? -15.209 67.065 34.189  1.00 50.07  ? 128  HOH P O     1 
HETATM 8066 O  O     . HOH G 6 .   ? -20.481 58.734 36.014  1.00 56.34  ? 129  HOH P O     1 
HETATM 8067 O  O     . HOH G 6 .   ? -41.532 48.428 32.233  1.00 51.08  ? 130  HOH P O     1 
HETATM 8068 O  O     . HOH G 6 .   ? -32.490 61.112 24.048  1.00 55.79  ? 131  HOH P O     1 
HETATM 8069 O  O     . HOH G 6 .   ? -39.852 51.621 28.669  1.00 59.28  ? 132  HOH P O     1 
HETATM 8070 O  O     . HOH G 6 .   ? -31.968 55.202 30.160  1.00 62.87  ? 133  HOH P O     1 
HETATM 8071 O  O     . HOH G 6 .   ? -11.321 56.550 29.680  1.00 39.64  ? 134  HOH P O     1 
HETATM 8072 O  O     . HOH G 6 .   ? -28.547 57.032 18.814  1.00 68.41  ? 135  HOH P O     1 
HETATM 8073 O  O     . HOH G 6 .   ? -36.799 61.665 25.633  1.00 61.10  ? 136  HOH P O     1 
HETATM 8074 O  O     . HOH G 6 .   ? -25.283 55.160 27.593  1.00 47.43  ? 137  HOH P O     1 
HETATM 8075 O  O     . HOH G 6 .   ? -42.047 52.600 33.178  1.00 75.09  ? 138  HOH P O     1 
HETATM 8076 O  O     . HOH G 6 .   ? -21.066 61.945 34.140  1.00 63.61  ? 139  HOH P O     1 
HETATM 8077 O  O     . HOH G 6 .   ? -20.892 57.185 25.669  1.00 43.09  ? 140  HOH P O     1 
HETATM 8078 O  O     . HOH G 6 .   ? -21.470 55.793 27.273  1.00 46.81  ? 141  HOH P O     1 
HETATM 8079 O  O     . HOH G 6 .   ? -18.982 56.611 27.085  1.00 43.19  ? 142  HOH P O     1 
HETATM 8080 O  O     . HOH G 6 .   ? -13.136 47.430 27.486  1.00 52.81  ? 143  HOH P O     1 
HETATM 8081 O  O     . HOH H 6 .   ? 6.361   47.388 16.528  1.00 31.27  ? 906  HOH A O     1 
HETATM 8082 O  O     . HOH H 6 .   ? 10.339  29.308 28.530  1.00 36.38  ? 907  HOH A O     1 
HETATM 8083 O  O     . HOH H 6 .   ? 24.069  35.581 30.223  1.00 38.86  ? 908  HOH A O     1 
HETATM 8084 O  O     . HOH H 6 .   ? -1.546  27.564 42.931  1.00 79.04  ? 909  HOH A O     1 
HETATM 8085 O  O     . HOH H 6 .   ? -11.809 33.867 25.503  1.00 50.96  ? 910  HOH A O     1 
HETATM 8086 O  O     . HOH H 6 .   ? 8.481   34.852 46.382  1.00 54.09  ? 911  HOH A O     1 
HETATM 8087 O  O     . HOH H 6 .   ? -9.773  46.549 16.105  1.00 49.25  ? 912  HOH A O     1 
HETATM 8088 O  O     . HOH H 6 .   ? 4.812   24.184 42.239  1.00 37.06  ? 913  HOH A O     1 
HETATM 8089 O  O     . HOH H 6 .   ? 10.272  48.300 49.784  1.00 43.98  ? 914  HOH A O     1 
HETATM 8090 O  O     . HOH H 6 .   ? 17.904  44.066 24.488  1.00 71.04  ? 915  HOH A O     1 
HETATM 8091 O  O     . HOH H 6 .   ? -15.854 34.845 37.725  1.00 38.37  ? 916  HOH A O     1 
HETATM 8092 O  O     . HOH H 6 .   ? 1.397   30.634 47.031  1.00 73.11  ? 917  HOH A O     1 
HETATM 8093 O  O     . HOH H 6 .   ? 21.955  49.797 40.237  1.00 45.23  ? 918  HOH A O     1 
HETATM 8094 O  O     . HOH H 6 .   ? 26.863  39.188 45.769  1.00 49.33  ? 919  HOH A O     1 
HETATM 8095 O  O     . HOH H 6 .   ? 38.366  50.319 40.781  1.00 42.71  ? 920  HOH A O     1 
HETATM 8096 O  O     . HOH H 6 .   ? 6.837   64.429 -1.054  1.00 74.88  ? 921  HOH A O     1 
HETATM 8097 O  O     . HOH H 6 .   ? -12.705 37.218 34.710  1.00 21.16  ? 922  HOH A O     1 
HETATM 8098 O  O     . HOH H 6 .   ? 4.540   47.285 37.469  1.00 39.40  ? 923  HOH A O     1 
HETATM 8099 O  O     . HOH H 6 .   ? 15.588  65.261 31.056  1.00 43.38  ? 924  HOH A O     1 
HETATM 8100 O  O     . HOH H 6 .   ? 27.540  43.641 51.812  1.00 60.87  ? 925  HOH A O     1 
HETATM 8101 O  O     . HOH H 6 .   ? 33.385  63.847 33.186  1.00 50.58  ? 926  HOH A O     1 
HETATM 8102 O  O     . HOH H 6 .   ? -1.827  56.050 12.721  1.00 32.11  ? 927  HOH A O     1 
HETATM 8103 O  O     . HOH H 6 .   ? -9.903  27.833 20.006  1.00 45.34  ? 928  HOH A O     1 
HETATM 8104 O  O     . HOH H 6 .   ? 12.461  68.881 26.446  1.00 61.76  ? 929  HOH A O     1 
HETATM 8105 O  O     . HOH H 6 .   ? 15.907  58.142 58.976  1.00 51.46  ? 930  HOH A O     1 
HETATM 8106 O  O     . HOH H 6 .   ? 4.292   23.603 10.910  1.00 42.42  ? 931  HOH A O     1 
HETATM 8107 O  O     . HOH H 6 .   ? 23.616  18.355 48.473  1.00 56.74  ? 932  HOH A O     1 
HETATM 8108 O  O     . HOH H 6 .   ? -32.357 35.685 40.976  1.00 68.32  ? 933  HOH A O     1 
HETATM 8109 O  O     . HOH H 6 .   ? -9.609  29.220 67.347  1.00 39.42  ? 934  HOH A O     1 
HETATM 8110 O  O     . HOH H 6 .   ? -26.648 42.857 12.064  1.00 59.73  ? 935  HOH A O     1 
HETATM 8111 O  O     . HOH H 6 .   ? 17.285  23.871 66.637  1.00 65.68  ? 936  HOH A O     1 
HETATM 8112 O  O     . HOH H 6 .   ? 1.791   43.501 29.976  1.00 47.32  ? 937  HOH A O     1 
HETATM 8113 O  O     . HOH H 6 .   ? -5.507  24.852 9.637   1.00 38.82  ? 938  HOH A O     1 
HETATM 8114 O  O     . HOH H 6 .   ? -11.291 61.512 -0.067  1.00 72.98  ? 939  HOH A O     1 
HETATM 8115 O  O     . HOH H 6 .   ? 4.667   30.735 11.512  1.00 55.42  ? 940  HOH A O     1 
HETATM 8116 O  O     . HOH H 6 .   ? -6.147  43.877 -12.228 1.00 77.00  ? 941  HOH A O     1 
HETATM 8117 O  O     . HOH H 6 .   ? -27.652 44.763 14.388  1.00 48.95  ? 942  HOH A O     1 
HETATM 8118 O  O     . HOH H 6 .   ? -16.889 20.417 -0.733  1.00 67.68  ? 943  HOH A O     1 
HETATM 8119 O  O     . HOH H 6 .   ? 15.909  49.143 42.987  1.00 54.65  ? 944  HOH A O     1 
HETATM 8120 O  O     . HOH H 6 .   ? 8.090   18.019 30.680  1.00 63.19  ? 945  HOH A O     1 
HETATM 8121 O  O     . HOH H 6 .   ? -9.895  27.744 24.096  1.00 50.04  ? 946  HOH A O     1 
HETATM 8122 O  O     . HOH H 6 .   ? 3.245   2.234  23.060  1.00 58.85  ? 947  HOH A O     1 
HETATM 8123 O  O     . HOH H 6 .   ? -15.296 54.634 8.871   1.00 40.09  ? 948  HOH A O     1 
HETATM 8124 O  O     . HOH H 6 .   ? 16.775  72.786 6.338   1.00 52.15  ? 949  HOH A O     1 
HETATM 8125 O  O     . HOH H 6 .   ? 9.409   46.515 26.576  1.00 44.21  ? 950  HOH A O     1 
HETATM 8126 O  O     . HOH H 6 .   ? -28.298 29.624 50.174  1.00 71.37  ? 951  HOH A O     1 
HETATM 8127 O  O     . HOH H 6 .   ? 2.311   35.334 6.250   1.00 44.86  ? 952  HOH A O     1 
HETATM 8128 O  O     . HOH H 6 .   ? 3.087   49.040 31.899  1.00 45.14  ? 953  HOH A O     1 
HETATM 8129 O  O     . HOH H 6 .   ? 4.478   44.670 45.639  1.00 42.01  ? 954  HOH A O     1 
HETATM 8130 O  O     . HOH H 6 .   ? -5.985  18.831 1.887   1.00 59.30  ? 955  HOH A O     1 
HETATM 8131 O  O     . HOH H 6 .   ? 1.858   24.535 31.155  1.00 58.44  ? 956  HOH A O     1 
HETATM 8132 O  O     . HOH H 6 .   ? 10.118  41.758 70.225  1.00 66.51  ? 957  HOH A O     1 
HETATM 8133 O  O     . HOH H 6 .   ? 2.959   40.326 10.612  1.00 47.66  ? 958  HOH A O     1 
HETATM 8134 O  O     . HOH H 6 .   ? 32.344  62.493 23.200  1.00 38.25  ? 959  HOH A O     1 
HETATM 8135 O  O     . HOH H 6 .   ? -10.822 56.625 13.266  1.00 40.69  ? 960  HOH A O     1 
HETATM 8136 O  O     . HOH H 6 .   ? 33.354  74.375 35.732  1.00 41.30  ? 961  HOH A O     1 
HETATM 8137 O  O     . HOH H 6 .   ? -2.517  40.040 13.312  1.00 38.49  ? 962  HOH A O     1 
HETATM 8138 O  O     . HOH H 6 .   ? 24.414  55.547 29.594  1.00 55.71  ? 963  HOH A O     1 
HETATM 8139 O  O     . HOH H 6 .   ? 0.889   32.844 13.965  1.00 35.50  ? 964  HOH A O     1 
HETATM 8140 O  O     . HOH H 6 .   ? -14.898 31.857 -12.733 1.00 68.37  ? 965  HOH A O     1 
HETATM 8141 O  O     . HOH H 6 .   ? -9.005  35.334 20.508  1.00 47.34  ? 966  HOH A O     1 
HETATM 8142 O  O     . HOH H 6 .   ? 19.063  61.286 25.575  1.00 53.54  ? 967  HOH A O     1 
HETATM 8143 O  O     . HOH H 6 .   ? -1.764  64.030 25.653  1.00 43.30  ? 968  HOH A O     1 
HETATM 8144 O  O     . HOH H 6 .   ? -6.027  37.606 61.482  1.00 46.31  ? 969  HOH A O     1 
HETATM 8145 O  O     . HOH H 6 .   ? 4.270   36.489 64.221  1.00 50.11  ? 970  HOH A O     1 
HETATM 8146 O  O     . HOH H 6 .   ? -13.885 54.105 40.871  1.00 36.16  ? 971  HOH A O     1 
HETATM 8147 O  O     . HOH H 6 .   ? 25.430  67.673 15.068  1.00 55.78  ? 972  HOH A O     1 
HETATM 8148 O  O     . HOH H 6 .   ? -8.663  59.412 13.242  1.00 64.19  ? 973  HOH A O     1 
HETATM 8149 O  O     . HOH H 6 .   ? -25.965 24.518 13.412  1.00 52.50  ? 974  HOH A O     1 
HETATM 8150 O  O     . HOH H 6 .   ? 30.882  79.558 29.588  1.00 47.94  ? 975  HOH A O     1 
HETATM 8151 O  O     . HOH H 6 .   ? 12.921  27.922 10.698  1.00 39.56  ? 976  HOH A O     1 
HETATM 8152 O  O     . HOH H 6 .   ? 13.611  36.906 28.212  1.00 45.29  ? 977  HOH A O     1 
HETATM 8153 O  O     . HOH H 6 .   ? 21.687  36.229 47.920  1.00 54.31  ? 978  HOH A O     1 
HETATM 8154 O  O     . HOH H 6 .   ? -8.163  44.663 46.970  1.00 62.07  ? 979  HOH A O     1 
HETATM 8155 O  O     . HOH H 6 .   ? 16.503  50.716 7.106   1.00 62.71  ? 980  HOH A O     1 
HETATM 8156 O  O     . HOH H 6 .   ? -50.142 30.587 14.369  1.00 81.03  ? 981  HOH A O     1 
HETATM 8157 O  O     . HOH H 6 .   ? 1.653   20.632 25.657  1.00 49.49  ? 982  HOH A O     1 
HETATM 8158 O  O     . HOH H 6 .   ? 5.531   32.227 51.387  1.00 80.41  ? 983  HOH A O     1 
HETATM 8159 O  O     . HOH H 6 .   ? 11.782  55.172 48.885  1.00 71.29  ? 984  HOH A O     1 
HETATM 8160 O  O     . HOH H 6 .   ? -12.541 49.843 51.681  1.00 46.60  ? 985  HOH A O     1 
HETATM 8161 O  O     . HOH H 6 .   ? -13.054 47.539 -11.070 1.00 61.83  ? 986  HOH A O     1 
HETATM 8162 O  O     . HOH H 6 .   ? 15.284  44.864 8.607   1.00 54.96  ? 987  HOH A O     1 
HETATM 8163 O  O     . HOH H 6 .   ? 27.943  31.967 47.330  1.00 51.12  ? 988  HOH A O     1 
HETATM 8164 O  O     . HOH H 6 .   ? 13.552  17.884 22.241  1.00 75.12  ? 989  HOH A O     1 
HETATM 8165 O  O     . HOH H 6 .   ? -15.529 45.846 23.015  1.00 48.16  ? 990  HOH A O     1 
HETATM 8166 O  O     . HOH H 6 .   ? 16.783  18.527 44.879  1.00 54.70  ? 991  HOH A O     1 
HETATM 8167 O  O     . HOH H 6 .   ? -13.504 48.973 1.665   1.00 67.99  ? 992  HOH A O     1 
HETATM 8168 O  O     . HOH H 6 .   ? -33.477 36.261 19.180  1.00 110.04 ? 993  HOH A O     1 
HETATM 8169 O  O     . HOH H 6 .   ? -5.435  27.004 60.031  1.00 44.07  ? 994  HOH A O     1 
HETATM 8170 O  O     . HOH H 6 .   ? 11.312  21.310 6.591   1.00 54.99  ? 995  HOH A O     1 
HETATM 8171 O  O     . HOH H 6 .   ? 14.576  34.678 33.157  1.00 33.89  ? 996  HOH A O     1 
HETATM 8172 O  O     . HOH H 6 .   ? -14.061 62.674 3.898   1.00 58.14  ? 997  HOH A O     1 
HETATM 8173 O  O     . HOH H 6 .   ? -19.219 45.825 -1.910  1.00 55.17  ? 998  HOH A O     1 
HETATM 8174 O  O     . HOH H 6 .   ? 14.706  33.681 22.646  1.00 56.19  ? 999  HOH A O     1 
HETATM 8175 O  O     . HOH H 6 .   ? -21.924 33.608 56.427  1.00 81.86  ? 1000 HOH A O     1 
HETATM 8176 O  O     . HOH H 6 .   ? 8.542   25.964 34.701  1.00 29.56  ? 1001 HOH A O     1 
HETATM 8177 O  O     . HOH H 6 .   ? -27.067 27.681 51.195  1.00 70.87  ? 1002 HOH A O     1 
HETATM 8178 O  O     . HOH H 6 .   ? 2.843   5.479  21.231  1.00 63.17  ? 1003 HOH A O     1 
HETATM 8179 O  O     . HOH H 6 .   ? -19.901 39.896 30.746  1.00 44.94  ? 1004 HOH A O     1 
HETATM 8180 O  O     . HOH H 6 .   ? 14.228  4.887  24.383  1.00 53.02  ? 1005 HOH A O     1 
HETATM 8181 O  O     . HOH H 6 .   ? 31.679  56.626 23.102  1.00 56.98  ? 1006 HOH A O     1 
HETATM 8182 O  O     . HOH H 6 .   ? 7.405   50.439 63.016  1.00 35.49  ? 1007 HOH A O     1 
HETATM 8183 O  O     . HOH H 6 .   ? 2.375   43.396 1.451   1.00 62.75  ? 1008 HOH A O     1 
HETATM 8184 O  O     . HOH H 6 .   ? 20.047  49.848 43.364  1.00 62.93  ? 1009 HOH A O     1 
HETATM 8185 O  O     . HOH H 6 .   ? 23.239  76.809 26.345  1.00 50.85  ? 1010 HOH A O     1 
HETATM 8186 O  O     . HOH H 6 .   ? -24.534 20.110 17.699  1.00 63.74  ? 1011 HOH A O     1 
HETATM 8187 O  O     . HOH H 6 .   ? -18.162 51.514 54.349  1.00 58.10  ? 1012 HOH A O     1 
HETATM 8188 O  O     . HOH H 6 .   ? 2.586   9.150  15.234  1.00 70.54  ? 1013 HOH A O     1 
HETATM 8189 O  O     . HOH H 6 .   ? 16.863  32.325 21.194  1.00 47.65  ? 1014 HOH A O     1 
HETATM 8190 O  O     . HOH H 6 .   ? -0.602  48.010 62.821  1.00 55.55  ? 1015 HOH A O     1 
HETATM 8191 O  O     . HOH H 6 .   ? 11.782  50.115 29.208  1.00 58.01  ? 1016 HOH A O     1 
HETATM 8192 O  O     . HOH H 6 .   ? 8.079   29.188 62.386  1.00 56.33  ? 1017 HOH A O     1 
HETATM 8193 O  O     . HOH H 6 .   ? -0.534  37.621 13.538  1.00 119.71 ? 1018 HOH A O     1 
HETATM 8194 O  O     . HOH H 6 .   ? -6.731  32.864 56.491  1.00 87.26  ? 1019 HOH A O     1 
HETATM 8195 O  O     . HOH H 6 .   ? 5.192   26.300 27.316  1.00 53.60  ? 1020 HOH A O     1 
HETATM 8196 O  O     . HOH H 6 .   ? -0.603  27.209 0.478   1.00 44.99  ? 1021 HOH A O     1 
HETATM 8197 O  O     . HOH H 6 .   ? -0.132  46.641 20.392  1.00 52.17  ? 1022 HOH A O     1 
HETATM 8198 O  O     . HOH H 6 .   ? -18.985 37.617 4.093   1.00 83.65  ? 1023 HOH A O     1 
HETATM 8199 O  O     . HOH H 6 .   ? 7.955   68.535 31.228  1.00 78.75  ? 1024 HOH A O     1 
HETATM 8200 O  O     . HOH H 6 .   ? 14.505  46.839 4.844   1.00 59.46  ? 1025 HOH A O     1 
HETATM 8201 O  O     . HOH H 6 .   ? 12.662  60.598 45.678  1.00 69.76  ? 1026 HOH A O     1 
HETATM 8202 O  O     . HOH H 6 .   ? -21.800 43.983 25.829  1.00 51.28  ? 1027 HOH A O     1 
HETATM 8203 O  O     . HOH H 6 .   ? 14.088  38.573 26.099  1.00 39.01  ? 1028 HOH A O     1 
HETATM 8204 O  O     . HOH H 6 .   ? 13.242  54.426 35.886  1.00 67.90  ? 1029 HOH A O     1 
HETATM 8205 O  O     . HOH H 6 .   ? -28.711 49.502 25.876  1.00 74.61  ? 1030 HOH A O     1 
HETATM 8206 O  O     . HOH H 6 .   ? 10.517  46.776 0.042   1.00 73.21  ? 1031 HOH A O     1 
HETATM 8207 O  O     . HOH H 6 .   ? 31.136  61.898 48.229  1.00 53.72  ? 1032 HOH A O     1 
HETATM 8208 O  O     . HOH H 6 .   ? 1.584   40.456 70.078  1.00 58.44  ? 1033 HOH A O     1 
HETATM 8209 O  O     . HOH H 6 .   ? 14.202  61.650 28.267  1.00 59.20  ? 1034 HOH A O     1 
HETATM 8210 O  O     . HOH H 6 .   ? 23.800  61.152 8.426   1.00 50.89  ? 1035 HOH A O     1 
HETATM 8211 O  O     . HOH H 6 .   ? -24.837 43.996 18.419  1.00 59.82  ? 1036 HOH A O     1 
HETATM 8212 O  O     . HOH H 6 .   ? -16.498 25.814 26.763  1.00 59.53  ? 1037 HOH A O     1 
HETATM 8213 O  O     . HOH H 6 .   ? 5.768   34.062 65.074  1.00 42.08  ? 1038 HOH A O     1 
HETATM 8214 O  O     . HOH H 6 .   ? -30.275 25.712 37.009  1.00 52.47  ? 1039 HOH A O     1 
HETATM 8215 O  O     . HOH H 6 .   ? 32.757  36.511 41.911  1.00 48.82  ? 1040 HOH A O     1 
HETATM 8216 O  O     . HOH H 6 .   ? 41.396  42.411 35.794  1.00 48.98  ? 1041 HOH A O     1 
HETATM 8217 O  O     . HOH H 6 .   ? -17.966 27.461 -1.607  1.00 56.41  ? 1042 HOH A O     1 
HETATM 8218 O  O     . HOH H 6 .   ? 14.476  17.171 60.313  1.00 47.96  ? 1043 HOH A O     1 
HETATM 8219 O  O     . HOH H 6 .   ? -3.964  54.298 11.407  1.00 34.50  ? 1044 HOH A O     1 
HETATM 8220 O  O     . HOH H 6 .   ? 20.669  44.458 15.998  1.00 41.75  ? 1045 HOH A O     1 
HETATM 8221 O  O     . HOH H 6 .   ? 28.819  68.537 48.847  1.00 65.28  ? 1046 HOH A O     1 
HETATM 8222 O  O     . HOH H 6 .   ? -12.960 26.254 48.065  1.00 60.43  ? 1047 HOH A O     1 
HETATM 8223 O  O     . HOH H 6 .   ? 18.625  16.281 16.140  1.00 69.20  ? 1048 HOH A O     1 
HETATM 8224 O  O     . HOH H 6 .   ? -16.285 52.790 6.635   1.00 67.77  ? 1049 HOH A O     1 
HETATM 8225 O  O     . HOH H 6 .   ? 12.011  51.468 38.082  1.00 60.42  ? 1050 HOH A O     1 
HETATM 8226 O  O     . HOH H 6 .   ? 24.116  78.116 43.040  1.00 54.97  ? 1051 HOH A O     1 
HETATM 8227 O  O     . HOH H 6 .   ? 23.310  53.358 22.661  1.00 62.36  ? 1052 HOH A O     1 
HETATM 8228 O  O     . HOH H 6 .   ? 19.241  50.880 20.077  1.00 45.59  ? 1053 HOH A O     1 
HETATM 8229 O  O     . HOH H 6 .   ? 1.645   36.622 55.328  1.00 40.72  ? 1054 HOH A O     1 
HETATM 8230 O  O     . HOH H 6 .   ? -17.714 26.396 36.335  1.00 31.64  ? 1055 HOH A O     1 
HETATM 8231 O  O     . HOH H 6 .   ? -5.342  37.622 31.199  1.00 69.02  ? 1056 HOH A O     1 
HETATM 8232 O  O     . HOH H 6 .   ? 15.598  25.702 40.711  1.00 39.16  ? 1057 HOH A O     1 
HETATM 8233 O  O     . HOH H 6 .   ? 0.202   31.112 61.374  1.00 36.86  ? 1058 HOH A O     1 
HETATM 8234 O  O     . HOH H 6 .   ? 18.028  36.577 26.122  1.00 57.05  ? 1059 HOH A O     1 
HETATM 8235 O  O     . HOH H 6 .   ? 19.321  36.007 23.725  1.00 48.56  ? 1060 HOH A O     1 
HETATM 8236 O  O     . HOH H 6 .   ? 20.149  78.522 25.598  1.00 49.17  ? 1061 HOH A O     1 
HETATM 8237 O  O     . HOH H 6 .   ? 1.369   26.670 21.735  1.00 50.08  ? 1062 HOH A O     1 
HETATM 8238 O  O     . HOH H 6 .   ? -21.193 27.573 3.686   1.00 53.00  ? 1063 HOH A O     1 
HETATM 8239 O  O     . HOH H 6 .   ? 12.151  68.017 22.575  1.00 45.44  ? 1064 HOH A O     1 
HETATM 8240 O  O     . HOH H 6 .   ? 3.784   36.073 53.262  1.00 57.49  ? 1065 HOH A O     1 
HETATM 8241 O  O     . HOH H 6 .   ? 28.879  39.966 47.901  1.00 48.88  ? 1066 HOH A O     1 
HETATM 8242 O  O     . HOH H 6 .   ? -20.152 25.427 2.428   1.00 43.11  ? 1067 HOH A O     1 
HETATM 8243 O  O     . HOH H 6 .   ? -5.848  39.726 30.117  1.00 43.04  ? 1068 HOH A O     1 
HETATM 8244 O  O     . HOH H 6 .   ? -22.763 28.796 5.890   1.00 79.94  ? 1069 HOH A O     1 
HETATM 8245 O  O     . HOH H 6 .   ? 1.783   22.879 64.007  1.00 53.26  ? 1070 HOH A O     1 
HETATM 8246 O  O     . HOH H 6 .   ? 22.441  63.098 38.415  1.00 74.16  ? 1071 HOH A O     1 
HETATM 8247 O  O     . HOH H 6 .   ? -19.233 27.534 0.627   1.00 70.60  ? 1072 HOH A O     1 
HETATM 8248 O  O     . HOH H 6 .   ? 26.635  34.281 58.614  1.00 72.69  ? 1073 HOH A O     1 
HETATM 8249 O  O     . HOH H 6 .   ? -12.987 56.380 40.108  1.00 62.63  ? 1074 HOH A O     1 
HETATM 8250 O  O     . HOH H 6 .   ? -7.134  66.354 6.465   1.00 45.51  ? 1075 HOH A O     1 
HETATM 8251 O  O     . HOH H 6 .   ? 26.194  49.990 17.811  1.00 56.32  ? 1076 HOH A O     1 
HETATM 8252 O  O     . HOH H 6 .   ? 3.981   25.660 31.523  1.00 64.52  ? 1077 HOH A O     1 
HETATM 8253 O  O     . HOH H 6 .   ? 21.524  47.849 38.668  1.00 49.24  ? 1078 HOH A O     1 
HETATM 8254 O  O     . HOH H 6 .   ? -22.082 43.513 5.376   1.00 53.37  ? 1079 HOH A O     1 
HETATM 8255 O  O     . HOH H 6 .   ? -14.358 55.666 11.596  1.00 41.69  ? 1080 HOH A O     1 
HETATM 8256 O  O     . HOH H 6 .   ? 4.682   29.463 -6.117  1.00 68.64  ? 1081 HOH A O     1 
HETATM 8257 O  O     . HOH H 6 .   ? -24.833 43.042 56.488  1.00 65.28  ? 1082 HOH A O     1 
HETATM 8258 O  O     . HOH H 6 .   ? -34.320 33.492 46.527  1.00 62.30  ? 1083 HOH A O     1 
HETATM 8259 O  O     . HOH H 6 .   ? 18.976  25.048 70.008  1.00 71.54  ? 1084 HOH A O     1 
HETATM 8260 O  O     . HOH H 6 .   ? 9.757   41.454 9.778   1.00 72.36  ? 1085 HOH A O     1 
HETATM 8261 O  O     . HOH H 6 .   ? -18.167 46.957 6.495   1.00 79.66  ? 1086 HOH A O     1 
HETATM 8262 O  O     . HOH H 6 .   ? -19.135 25.498 38.990  1.00 42.98  ? 1087 HOH A O     1 
HETATM 8263 O  O     . HOH H 6 .   ? 34.736  59.560 49.663  1.00 54.77  ? 1088 HOH A O     1 
HETATM 8264 O  O     . HOH H 6 .   ? 2.563   6.437  23.768  1.00 82.91  ? 1089 HOH A O     1 
HETATM 8265 O  O     . HOH H 6 .   ? 30.528  79.408 26.570  1.00 52.01  ? 1090 HOH A O     1 
HETATM 8266 O  O     . HOH H 6 .   ? -19.519 20.087 8.637   1.00 58.25  ? 1091 HOH A O     1 
HETATM 8267 O  O     . HOH H 6 .   ? -9.649  54.939 48.643  1.00 59.13  ? 1092 HOH A O     1 
HETATM 8268 O  O     . HOH H 6 .   ? -21.004 39.891 4.543   1.00 76.40  ? 1093 HOH A O     1 
HETATM 8269 O  O     . HOH H 6 .   ? -16.230 39.441 -1.006  1.00 65.93  ? 1094 HOH A O     1 
HETATM 8270 O  O     . HOH H 6 .   ? 9.982   67.038 -9.190  1.00 43.82  ? 1095 HOH A O     1 
HETATM 8271 O  O     . HOH H 6 .   ? 23.471  52.237 25.201  1.00 49.32  ? 1096 HOH A O     1 
HETATM 8272 O  O     . HOH H 6 .   ? 16.195  49.488 46.102  1.00 44.73  ? 1097 HOH A O     1 
HETATM 8273 O  O     . HOH H 6 .   ? 23.616  48.852 23.414  1.00 54.09  ? 1098 HOH A O     1 
HETATM 8274 O  O     . HOH H 6 .   ? -7.267  34.157 34.075  1.00 64.52  ? 1099 HOH A O     1 
HETATM 8275 O  O     . HOH H 6 .   ? 21.506  68.341 30.594  1.00 58.85  ? 1100 HOH A O     1 
HETATM 8276 O  O     . HOH H 6 .   ? 10.881  48.694 11.572  1.00 43.42  ? 1101 HOH A O     1 
HETATM 8277 O  O     . HOH H 6 .   ? -10.630 58.751 0.689   1.00 53.17  ? 1102 HOH A O     1 
HETATM 8278 O  O     . HOH H 6 .   ? 13.830  14.693 57.865  1.00 65.45  ? 1103 HOH A O     1 
HETATM 8279 O  O     . HOH H 6 .   ? 32.601  43.257 46.152  1.00 51.76  ? 1104 HOH A O     1 
HETATM 8280 O  O     . HOH H 6 .   ? 25.575  69.022 12.371  1.00 68.04  ? 1105 HOH A O     1 
HETATM 8281 O  O     . HOH H 6 .   ? 14.563  17.924 57.922  1.00 65.04  ? 1106 HOH A O     1 
HETATM 8282 O  O     . HOH H 6 .   ? 4.646   4.824  52.555  1.00 57.23  ? 1107 HOH A O     1 
HETATM 8283 O  O     . HOH H 6 .   ? -0.266  7.324  10.511  1.00 69.65  ? 1108 HOH A O     1 
HETATM 8284 O  O     . HOH H 6 .   ? 34.171  41.231 47.303  1.00 57.75  ? 1109 HOH A O     1 
HETATM 8285 O  O     . HOH H 6 .   ? 4.415   45.951 1.189   1.00 61.59  ? 1110 HOH A O     1 
HETATM 8286 O  O     . HOH H 6 .   ? 22.454  78.655 24.757  1.00 58.88  ? 1111 HOH A O     1 
HETATM 8287 O  O     . HOH H 6 .   ? -10.281 30.243 20.472  1.00 60.32  ? 1112 HOH A O     1 
HETATM 8288 O  O     . HOH H 6 .   ? 6.753   37.392 51.603  1.00 50.66  ? 1113 HOH A O     1 
HETATM 8289 O  O     . HOH H 6 .   ? -10.388 33.194 22.749  1.00 51.91  ? 1114 HOH A O     1 
HETATM 8290 O  O     . HOH H 6 .   ? 17.787  25.519 39.993  1.00 49.82  ? 1115 HOH A O     1 
HETATM 8291 O  O     . HOH H 6 .   ? -2.797  56.417 -5.759  1.00 66.55  ? 1116 HOH A O     1 
HETATM 8292 O  O     . HOH H 6 .   ? 3.128   70.688 25.130  1.00 62.10  ? 1117 HOH A O     1 
HETATM 8293 O  O     . HOH H 6 .   ? -30.758 31.395 16.592  1.00 69.41  ? 1118 HOH A O     1 
HETATM 8294 O  O     . HOH H 6 .   ? 1.866   21.850 48.747  1.00 69.72  ? 1119 HOH A O     1 
HETATM 8295 O  O     . HOH H 6 .   ? -25.186 29.427 51.538  1.00 66.45  ? 1120 HOH A O     1 
HETATM 8296 O  O     . HOH H 6 .   ? 15.328  36.469 24.503  1.00 79.15  ? 1121 HOH A O     1 
HETATM 8297 O  O     . HOH H 6 .   ? -11.182 34.485 38.982  1.00 38.42  ? 1122 HOH A O     1 
HETATM 8298 O  O     . HOH H 6 .   ? -0.130  28.501 -6.608  1.00 61.34  ? 1123 HOH A O     1 
HETATM 8299 O  O     . HOH H 6 .   ? 1.069   63.521 26.714  1.00 44.05  ? 1124 HOH A O     1 
HETATM 8300 O  O     . HOH H 6 .   ? -2.999  45.613 37.212  1.00 51.16  ? 1125 HOH A O     1 
HETATM 8301 O  O     . HOH H 6 .   ? -15.869 56.228 16.062  1.00 37.34  ? 1126 HOH A O     1 
HETATM 8302 O  O     . HOH H 6 .   ? 32.537  42.811 49.729  1.00 52.25  ? 1127 HOH A O     1 
HETATM 8303 O  O     . HOH H 6 .   ? 2.466   28.184 24.545  1.00 58.54  ? 1128 HOH A O     1 
HETATM 8304 O  O     . HOH H 6 .   ? -9.945  29.584 62.977  1.00 58.24  ? 1129 HOH A O     1 
HETATM 8305 O  O     . HOH H 6 .   ? 19.462  29.705 22.233  1.00 65.11  ? 1130 HOH A O     1 
HETATM 8306 O  O     . HOH H 6 .   ? 9.600   20.024 34.781  1.00 82.05  ? 1131 HOH A O     1 
HETATM 8307 O  O     . HOH H 6 .   ? -19.037 41.274 34.170  1.00 49.47  ? 1132 HOH A O     1 
HETATM 8308 O  O     . HOH H 6 .   ? 20.402  27.047 62.655  1.00 66.37  ? 1133 HOH A O     1 
HETATM 8309 O  O     . HOH H 6 .   ? -0.282  10.210 13.803  1.00 63.07  ? 1134 HOH A O     1 
HETATM 8310 O  O     . HOH H 6 .   ? 9.570   10.719 26.579  1.00 84.12  ? 1135 HOH A O     1 
HETATM 8311 O  O     . HOH H 6 .   ? 25.729  52.371 19.402  1.00 51.04  ? 1136 HOH A O     1 
HETATM 8312 O  O     . HOH H 6 .   ? 23.212  51.692 21.074  1.00 40.00  ? 1137 HOH A O     1 
HETATM 8313 O  O     . HOH H 6 .   ? -19.520 38.968 -0.760  1.00 58.30  ? 1138 HOH A O     1 
HETATM 8314 O  O     . HOH H 6 .   ? -17.226 41.874 31.731  1.00 48.29  ? 1139 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  DC  T . n 
A 1 2   DG  2   2   2   DG  DG  T . n 
A 1 3   DT  3   3   3   DT  DT  T . n 
A 1 4   DC  4   4   4   DC  DC  T . n 
A 1 5   DT  5   5   5   DT  DT  T . n 
A 1 6   DT  6   6   6   DT  DT  T . n 
A 1 7   DA  7   7   7   DA  DA  T . n 
A 1 8   DT  8   8   8   DT  DT  T . n 
A 1 9   DG  9   9   9   DG  DG  T . n 
A 1 10  DA  10  10  10  DA  DA  T . n 
A 1 11  DC  11  11  11  DC  DC  T . n 
A 1 12  DA  12  12  12  DA  DA  T . n 
A 1 13  DG  13  13  13  DG  DG  T . n 
A 1 14  DC  14  14  14  DC  DC  T . n 
A 1 15  DC  15  15  15  DC  DC  T . n 
A 1 16  DG  16  16  16  DG  DG  T . n 
A 1 17  DC  17  17  17  DC  DC  T . n 
A 1 18  DG  18  18  18  DG  DG  T . n 
B 2 1   DG  1   101 101 DG  G   P . n 
B 2 2   DC  2   102 102 DC  C   P . n 
B 2 3   DG  3   103 103 DG  G   P . n 
B 2 4   DG  4   104 104 DG  G   P . n 
B 2 5   DC  5   105 105 DC  C   P . n 
B 2 6   DT  6   106 106 DT  T   P . n 
B 2 7   DG  7   107 107 DG  G   P . n 
B 2 8   DT  8   108 108 DT  T   P . n 
B 2 9   DC  9   109 109 DC  C   P . n 
B 2 10  DA  10  110 110 DA  A   P . n 
B 2 11  DT  11  111 111 DT  T   P . n 
B 2 12  DA  12  112 112 DA  A   P . n 
B 2 13  DA  13  113 113 DA  A   P . n 
B 2 14  DDG 14  114 114 DDG DDG P . n 
C 3 1   MET 1   1   1   MET MET A . n 
C 3 2   LYS 2   2   2   LYS LYS A . n 
C 3 3   GLU 3   3   3   GLU GLU A . n 
C 3 4   PHE 4   4   4   PHE PHE A . n 
C 3 5   TYR 5   5   5   TYR TYR A . n 
C 3 6   LEU 6   6   6   LEU LEU A . n 
C 3 7   THR 7   7   7   THR THR A . n 
C 3 8   VAL 8   8   8   VAL VAL A . n 
C 3 9   GLU 9   9   9   GLU GLU A . n 
C 3 10  GLN 10  10  10  GLN GLN A . n 
C 3 11  ILE 11  11  11  ILE ILE A . n 
C 3 12  GLY 12  12  12  GLY GLY A . n 
C 3 13  ASP 13  13  13  ASP ASP A . n 
C 3 14  SER 14  14  14  SER SER A . n 
C 3 15  ILE 15  15  15  ILE ILE A . n 
C 3 16  PHE 16  16  16  PHE PHE A . n 
C 3 17  GLU 17  17  17  GLU GLU A . n 
C 3 18  ARG 18  18  18  ARG ARG A . n 
C 3 19  TYR 19  19  19  TYR TYR A . n 
C 3 20  ILE 20  20  20  ILE ILE A . n 
C 3 21  ASP 21  21  21  ASP ASP A . n 
C 3 22  SER 22  22  22  SER SER A . n 
C 3 23  ASN 23  23  23  ASN ASN A . n 
C 3 24  GLY 24  24  24  GLY GLY A . n 
C 3 25  ARG 25  25  25  ARG ARG A . n 
C 3 26  GLU 26  26  26  GLU GLU A . n 
C 3 27  ARG 27  27  27  ARG ARG A . n 
C 3 28  THR 28  28  28  THR THR A . n 
C 3 29  ARG 29  29  29  ARG ARG A . n 
C 3 30  GLU 30  30  30  GLU GLU A . n 
C 3 31  VAL 31  31  31  VAL VAL A . n 
C 3 32  GLU 32  32  32  GLU GLU A . n 
C 3 33  TYR 33  33  33  TYR TYR A . n 
C 3 34  LYS 34  34  34  LYS LYS A . n 
C 3 35  PRO 35  35  35  PRO PRO A . n 
C 3 36  SER 36  36  36  SER SER A . n 
C 3 37  LEU 37  37  37  LEU LEU A . n 
C 3 38  PHE 38  38  38  PHE PHE A . n 
C 3 39  ALA 39  39  39  ALA ALA A . n 
C 3 40  HIS 40  40  40  HIS HIS A . n 
C 3 41  CYS 41  41  41  CYS CYS A . n 
C 3 42  PRO 42  42  42  PRO PRO A . n 
C 3 43  GLU 43  43  43  GLU GLU A . n 
C 3 44  SER 44  44  44  SER SER A . n 
C 3 45  GLN 45  45  45  GLN GLN A . n 
C 3 46  ALA 46  46  46  ALA ALA A . n 
C 3 47  THR 47  47  47  THR THR A . n 
C 3 48  LYS 48  48  48  LYS LYS A . n 
C 3 49  TYR 49  49  49  TYR TYR A . n 
C 3 50  PHE 50  50  50  PHE PHE A . n 
C 3 51  ASP 51  51  51  ASP ASP A . n 
C 3 52  ILE 52  52  52  ILE ILE A . n 
C 3 53  TYR 53  53  53  TYR TYR A . n 
C 3 54  GLY 54  54  54  GLY GLY A . n 
C 3 55  LYS 55  55  55  LYS LYS A . n 
C 3 56  PRO 56  56  56  PRO PRO A . n 
C 3 57  CYS 57  57  57  CYS CYS A . n 
C 3 58  THR 58  58  58  THR THR A . n 
C 3 59  ARG 59  59  59  ARG ARG A . n 
C 3 60  LYS 60  60  60  LYS LYS A . n 
C 3 61  LEU 61  61  61  LEU LEU A . n 
C 3 62  PHE 62  62  62  PHE PHE A . n 
C 3 63  ALA 63  63  63  ALA ALA A . n 
C 3 64  ASN 64  64  64  ASN ASN A . n 
C 3 65  MET 65  65  65  MET MET A . n 
C 3 66  ARG 66  66  66  ARG ARG A . n 
C 3 67  ASP 67  67  67  ASP ASP A . n 
C 3 68  ALA 68  68  68  ALA ALA A . n 
C 3 69  SER 69  69  69  SER SER A . n 
C 3 70  GLN 70  70  70  GLN GLN A . n 
C 3 71  TRP 71  71  71  TRP TRP A . n 
C 3 72  ILE 72  72  72  ILE ILE A . n 
C 3 73  LYS 73  73  73  LYS LYS A . n 
C 3 74  ARG 74  74  74  ARG ARG A . n 
C 3 75  MET 75  75  75  MET MET A . n 
C 3 76  GLU 76  76  76  GLU GLU A . n 
C 3 77  ASP 77  77  77  ASP ASP A . n 
C 3 78  ILE 78  78  78  ILE ILE A . n 
C 3 79  GLY 79  79  79  GLY GLY A . n 
C 3 80  LEU 80  80  80  LEU LEU A . n 
C 3 81  GLU 81  81  81  GLU GLU A . n 
C 3 82  ALA 82  82  82  ALA ALA A . n 
C 3 83  LEU 83  83  83  LEU LEU A . n 
C 3 84  GLY 84  84  84  GLY GLY A . n 
C 3 85  MET 85  85  85  MET MET A . n 
C 3 86  ASP 86  86  86  ASP ASP A . n 
C 3 87  ASP 87  87  87  ASP ASP A . n 
C 3 88  PHE 88  88  88  PHE PHE A . n 
C 3 89  LYS 89  89  89  LYS LYS A . n 
C 3 90  LEU 90  90  90  LEU LEU A . n 
C 3 91  ALA 91  91  91  ALA ALA A . n 
C 3 92  TYR 92  92  92  TYR TYR A . n 
C 3 93  LEU 93  93  93  LEU LEU A . n 
C 3 94  SER 94  94  94  SER SER A . n 
C 3 95  ASP 95  95  95  ASP ASP A . n 
C 3 96  THR 96  96  96  THR THR A . n 
C 3 97  TYR 97  97  97  TYR TYR A . n 
C 3 98  ASN 98  98  98  ASN ASN A . n 
C 3 99  TYR 99  99  99  TYR TYR A . n 
C 3 100 GLU 100 100 100 GLU GLU A . n 
C 3 101 ILE 101 101 101 ILE ILE A . n 
C 3 102 LYS 102 102 102 LYS LYS A . n 
C 3 103 TYR 103 103 103 TYR TYR A . n 
C 3 104 ASP 104 104 104 ASP ASP A . n 
C 3 105 HIS 105 105 105 HIS HIS A . n 
C 3 106 THR 106 106 106 THR THR A . n 
C 3 107 LYS 107 107 107 LYS LYS A . n 
C 3 108 ILE 108 108 108 ILE ILE A . n 
C 3 109 ARG 109 109 109 ARG ARG A . n 
C 3 110 VAL 110 110 110 VAL VAL A . n 
C 3 111 ALA 111 111 111 ALA ALA A . n 
C 3 112 ASN 112 112 112 ASN ASN A . n 
C 3 113 PHE 113 113 113 PHE PHE A . n 
C 3 114 ASP 114 114 114 ASP ASP A . n 
C 3 115 ILE 115 115 115 ILE ILE A . n 
C 3 116 GLU 116 116 116 GLU GLU A . n 
C 3 117 VAL 117 117 117 VAL VAL A . n 
C 3 118 THR 118 118 118 THR THR A . n 
C 3 119 SER 119 119 119 SER SER A . n 
C 3 120 PRO 120 120 120 PRO PRO A . n 
C 3 121 ASP 121 121 121 ASP ASP A . n 
C 3 122 GLY 122 122 122 GLY GLY A . n 
C 3 123 PHE 123 123 123 PHE PHE A . n 
C 3 124 PRO 124 124 124 PRO PRO A . n 
C 3 125 GLU 125 125 125 GLU GLU A . n 
C 3 126 PRO 126 126 126 PRO PRO A . n 
C 3 127 SER 127 127 127 SER SER A . n 
C 3 128 GLN 128 128 128 GLN GLN A . n 
C 3 129 ALA 129 129 129 ALA ALA A . n 
C 3 130 LYS 130 130 130 LYS LYS A . n 
C 3 131 HIS 131 131 131 HIS HIS A . n 
C 3 132 PRO 132 132 132 PRO PRO A . n 
C 3 133 ILE 133 133 133 ILE ILE A . n 
C 3 134 ASP 134 134 134 ASP ASP A . n 
C 3 135 ALA 135 135 135 ALA ALA A . n 
C 3 136 ILE 136 136 136 ILE ILE A . n 
C 3 137 THR 137 137 137 THR THR A . n 
C 3 138 HIS 138 138 138 HIS HIS A . n 
C 3 139 TYR 139 139 139 TYR TYR A . n 
C 3 140 ASP 140 140 140 ASP ASP A . n 
C 3 141 SER 141 141 141 SER SER A . n 
C 3 142 ILE 142 142 142 ILE ILE A . n 
C 3 143 ASP 143 143 143 ASP ASP A . n 
C 3 144 ASP 144 144 144 ASP ASP A . n 
C 3 145 ARG 145 145 145 ARG ARG A . n 
C 3 146 PHE 146 146 146 PHE PHE A . n 
C 3 147 TYR 147 147 147 TYR TYR A . n 
C 3 148 VAL 148 148 148 VAL VAL A . n 
C 3 149 PHE 149 149 149 PHE PHE A . n 
C 3 150 ASP 150 150 150 ASP ASP A . n 
C 3 151 LEU 151 151 151 LEU LEU A . n 
C 3 152 LEU 152 152 152 LEU LEU A . n 
C 3 153 ASN 153 153 153 ASN ASN A . n 
C 3 154 SER 154 154 154 SER SER A . n 
C 3 155 PRO 155 155 155 PRO PRO A . n 
C 3 156 TYR 156 156 156 TYR TYR A . n 
C 3 157 GLY 157 157 157 GLY GLY A . n 
C 3 158 ASN 158 158 158 ASN ASN A . n 
C 3 159 VAL 159 159 159 VAL VAL A . n 
C 3 160 GLU 160 160 160 GLU GLU A . n 
C 3 161 GLU 161 161 161 GLU GLU A . n 
C 3 162 TRP 162 162 162 TRP TRP A . n 
C 3 163 SER 163 163 163 SER SER A . n 
C 3 164 ILE 164 164 164 ILE ILE A . n 
C 3 165 GLU 165 165 165 GLU GLU A . n 
C 3 166 ILE 166 166 166 ILE ILE A . n 
C 3 167 ALA 167 167 167 ALA ALA A . n 
C 3 168 ALA 168 168 168 ALA ALA A . n 
C 3 169 LYS 169 169 169 LYS LYS A . n 
C 3 170 LEU 170 170 170 LEU LEU A . n 
C 3 171 GLN 171 171 171 GLN GLN A . n 
C 3 172 GLU 172 172 172 GLU GLU A . n 
C 3 173 GLN 173 173 173 GLN GLN A . n 
C 3 174 GLY 174 174 174 GLY GLY A . n 
C 3 175 GLY 175 175 175 GLY GLY A . n 
C 3 176 ASP 176 176 176 ASP ASP A . n 
C 3 177 GLU 177 177 177 GLU GLU A . n 
C 3 178 VAL 178 178 178 VAL VAL A . n 
C 3 179 PRO 179 179 179 PRO PRO A . n 
C 3 180 SER 180 180 180 SER SER A . n 
C 3 181 GLU 181 181 181 GLU GLU A . n 
C 3 182 ILE 182 182 182 ILE ILE A . n 
C 3 183 ILE 183 183 183 ILE ILE A . n 
C 3 184 ASP 184 184 184 ASP ASP A . n 
C 3 185 LYS 185 185 185 LYS LYS A . n 
C 3 186 ILE 186 186 186 ILE ILE A . n 
C 3 187 ILE 187 187 187 ILE ILE A . n 
C 3 188 TYR 188 188 188 TYR TYR A . n 
C 3 189 MET 189 189 189 MET MET A . n 
C 3 190 PRO 190 190 190 PRO PRO A . n 
C 3 191 PHE 191 191 191 PHE PHE A . n 
C 3 192 ASP 192 192 192 ASP ASP A . n 
C 3 193 ASN 193 193 193 ASN ASN A . n 
C 3 194 GLU 194 194 194 GLU GLU A . n 
C 3 195 LYS 195 195 195 LYS LYS A . n 
C 3 196 GLU 196 196 196 GLU GLU A . n 
C 3 197 LEU 197 197 197 LEU LEU A . n 
C 3 198 LEU 198 198 198 LEU LEU A . n 
C 3 199 MET 199 199 199 MET MET A . n 
C 3 200 GLU 200 200 200 GLU GLU A . n 
C 3 201 TYR 201 201 201 TYR TYR A . n 
C 3 202 LEU 202 202 202 LEU LEU A . n 
C 3 203 ASN 203 203 203 ASN ASN A . n 
C 3 204 PHE 204 204 204 PHE PHE A . n 
C 3 205 TRP 205 205 205 TRP TRP A . n 
C 3 206 GLN 206 206 206 GLN GLN A . n 
C 3 207 GLN 207 207 207 GLN GLN A . n 
C 3 208 LYS 208 208 208 LYS LYS A . n 
C 3 209 THR 209 209 209 THR THR A . n 
C 3 210 PRO 210 210 210 PRO PRO A . n 
C 3 211 VAL 211 211 211 VAL VAL A . n 
C 3 212 ILE 212 212 212 ILE ILE A . n 
C 3 213 LEU 213 213 213 LEU LEU A . n 
C 3 214 THR 214 214 214 THR THR A . n 
C 3 215 GLY 215 215 215 GLY GLY A . n 
C 3 216 TRP 216 216 216 TRP TRP A . n 
C 3 217 ASN 217 217 217 ASN ASN A . n 
C 3 218 VAL 218 218 218 VAL VAL A . n 
C 3 219 GLU 219 219 219 GLU GLU A . n 
C 3 220 SER 220 220 220 SER SER A . n 
C 3 221 PHE 221 221 221 PHE PHE A . n 
C 3 222 ALA 222 222 222 ALA ALA A . n 
C 3 223 ILE 223 223 223 ILE ILE A . n 
C 3 224 PRO 224 224 224 PRO PRO A . n 
C 3 225 TYR 225 225 225 TYR TYR A . n 
C 3 226 VAL 226 226 226 VAL VAL A . n 
C 3 227 TYR 227 227 227 TYR TYR A . n 
C 3 228 ASN 228 228 228 ASN ASN A . n 
C 3 229 ARG 229 229 229 ARG ARG A . n 
C 3 230 ILE 230 230 230 ILE ILE A . n 
C 3 231 LYS 231 231 231 LYS LYS A . n 
C 3 232 ASN 232 232 232 ASN ASN A . n 
C 3 233 ILE 233 233 233 ILE ILE A . n 
C 3 234 PHE 234 234 234 PHE PHE A . n 
C 3 235 GLY 235 235 235 GLY GLY A . n 
C 3 236 GLU 236 236 236 GLU GLU A . n 
C 3 237 SER 237 237 237 SER SER A . n 
C 3 238 THR 238 238 238 THR THR A . n 
C 3 239 ALA 239 239 239 ALA ALA A . n 
C 3 240 LYS 240 240 240 LYS LYS A . n 
C 3 241 ARG 241 241 241 ARG ARG A . n 
C 3 242 LEU 242 242 242 LEU LEU A . n 
C 3 243 SER 243 243 243 SER SER A . n 
C 3 244 PRO 244 244 244 PRO PRO A . n 
C 3 245 HIS 245 245 245 HIS HIS A . n 
C 3 246 ARG 246 246 246 ARG ARG A . n 
C 3 247 LYS 247 247 247 LYS LYS A . n 
C 3 248 THR 248 248 248 THR THR A . n 
C 3 249 ARG 249 249 249 ARG ARG A . n 
C 3 250 VAL 250 250 250 VAL VAL A . n 
C 3 251 LYS 251 251 251 LYS LYS A . n 
C 3 252 VAL 252 252 252 VAL VAL A . n 
C 3 253 ILE 253 253 253 ILE ILE A . n 
C 3 254 GLU 254 254 254 GLU GLU A . n 
C 3 255 ASN 255 255 255 ASN ASN A . n 
C 3 256 MET 256 256 256 MET MET A . n 
C 3 257 TYR 257 257 257 TYR TYR A . n 
C 3 258 GLY 258 258 258 GLY GLY A . n 
C 3 259 SER 259 259 259 SER SER A . n 
C 3 260 ARG 260 260 260 ARG ARG A . n 
C 3 261 GLU 261 261 261 GLU GLU A . n 
C 3 262 ILE 262 262 262 ILE ILE A . n 
C 3 263 ILE 263 263 263 ILE ILE A . n 
C 3 264 THR 264 264 264 THR THR A . n 
C 3 265 LEU 265 265 265 LEU LEU A . n 
C 3 266 PHE 266 266 266 PHE PHE A . n 
C 3 267 GLY 267 267 267 GLY GLY A . n 
C 3 268 ILE 268 268 268 ILE ILE A . n 
C 3 269 SER 269 269 269 SER SER A . n 
C 3 270 VAL 270 270 270 VAL VAL A . n 
C 3 271 LEU 271 271 271 LEU LEU A . n 
C 3 272 ASP 272 272 272 ASP ASP A . n 
C 3 273 TYR 273 273 273 TYR TYR A . n 
C 3 274 ILE 274 274 274 ILE ILE A . n 
C 3 275 ASP 275 275 275 ASP ASP A . n 
C 3 276 LEU 276 276 276 LEU LEU A . n 
C 3 277 TYR 277 277 277 TYR TYR A . n 
C 3 278 LYS 278 278 278 LYS LYS A . n 
C 3 279 LYS 279 279 279 LYS LYS A . n 
C 3 280 PHE 280 280 280 PHE PHE A . n 
C 3 281 SER 281 281 281 SER SER A . n 
C 3 282 PHE 282 282 282 PHE PHE A . n 
C 3 283 THR 283 283 283 THR THR A . n 
C 3 284 ASN 284 284 284 ASN ASN A . n 
C 3 285 GLN 285 285 285 GLN GLN A . n 
C 3 286 PRO 286 286 286 PRO PRO A . n 
C 3 287 SER 287 287 287 SER SER A . n 
C 3 288 TYR 288 288 288 TYR TYR A . n 
C 3 289 SER 289 289 289 SER SER A . n 
C 3 290 LEU 290 290 290 LEU LEU A . n 
C 3 291 ASP 291 291 291 ASP ASP A . n 
C 3 292 TYR 292 292 292 TYR TYR A . n 
C 3 293 ILE 293 293 293 ILE ILE A . n 
C 3 294 SER 294 294 294 SER SER A . n 
C 3 295 GLU 295 295 295 GLU GLU A . n 
C 3 296 PHE 296 296 296 PHE PHE A . n 
C 3 297 GLU 297 297 297 GLU GLU A . n 
C 3 298 LEU 298 298 298 LEU LEU A . n 
C 3 299 ASN 299 299 299 ASN ASN A . n 
C 3 300 VAL 300 300 300 VAL VAL A . n 
C 3 301 GLY 301 301 301 GLY GLY A . n 
C 3 302 LYS 302 302 302 LYS LYS A . n 
C 3 303 LEU 303 303 303 LEU LEU A . n 
C 3 304 LYS 304 304 304 LYS LYS A . n 
C 3 305 TYR 305 305 305 TYR TYR A . n 
C 3 306 ASP 306 306 306 ASP ASP A . n 
C 3 307 GLY 307 307 307 GLY GLY A . n 
C 3 308 PRO 308 308 308 PRO PRO A . n 
C 3 309 ILE 309 309 309 ILE ILE A . n 
C 3 310 SER 310 310 310 SER SER A . n 
C 3 311 LYS 311 311 311 LYS LYS A . n 
C 3 312 LEU 312 312 312 LEU LEU A . n 
C 3 313 ARG 313 313 313 ARG ARG A . n 
C 3 314 GLU 314 314 314 GLU GLU A . n 
C 3 315 SER 315 315 315 SER SER A . n 
C 3 316 ASN 316 316 316 ASN ASN A . n 
C 3 317 HIS 317 317 317 HIS HIS A . n 
C 3 318 GLN 318 318 318 GLN GLN A . n 
C 3 319 ARG 319 319 319 ARG ARG A . n 
C 3 320 TYR 320 320 320 TYR TYR A . n 
C 3 321 ILE 321 321 321 ILE ILE A . n 
C 3 322 SER 322 322 322 SER SER A . n 
C 3 323 TYR 323 323 323 TYR TYR A . n 
C 3 324 ASN 324 324 324 ASN ASN A . n 
C 3 325 ILE 325 325 325 ILE ILE A . n 
C 3 326 ILE 326 326 326 ILE ILE A . n 
C 3 327 ALA 327 327 327 ALA ALA A . n 
C 3 328 VAL 328 328 328 VAL VAL A . n 
C 3 329 TYR 329 329 329 TYR TYR A . n 
C 3 330 ARG 330 330 330 ARG ARG A . n 
C 3 331 VAL 331 331 331 VAL VAL A . n 
C 3 332 LEU 332 332 332 LEU LEU A . n 
C 3 333 GLN 333 333 333 GLN GLN A . n 
C 3 334 ILE 334 334 334 ILE ILE A . n 
C 3 335 ASP 335 335 335 ASP ASP A . n 
C 3 336 ALA 336 336 336 ALA ALA A . n 
C 3 337 LYS 337 337 337 LYS LYS A . n 
C 3 338 ARG 338 338 338 ARG ARG A . n 
C 3 339 GLN 339 339 339 GLN GLN A . n 
C 3 340 PHE 340 340 340 PHE PHE A . n 
C 3 341 ILE 341 341 341 ILE ILE A . n 
C 3 342 ASN 342 342 342 ASN ASN A . n 
C 3 343 LEU 343 343 343 LEU LEU A . n 
C 3 344 SER 344 344 344 SER SER A . n 
C 3 345 LEU 345 345 345 LEU LEU A . n 
C 3 346 ASP 346 346 346 ASP ASP A . n 
C 3 347 MET 347 347 347 MET MET A . n 
C 3 348 GLY 348 348 348 GLY GLY A . n 
C 3 349 TYR 349 349 349 TYR TYR A . n 
C 3 350 TYR 350 350 350 TYR TYR A . n 
C 3 351 ALA 351 351 351 ALA ALA A . n 
C 3 352 LYS 352 352 352 LYS LYS A . n 
C 3 353 ILE 353 353 353 ILE ILE A . n 
C 3 354 GLN 354 354 354 GLN GLN A . n 
C 3 355 ILE 355 355 355 ILE ILE A . n 
C 3 356 GLN 356 356 356 GLN GLN A . n 
C 3 357 SER 357 357 357 SER SER A . n 
C 3 358 VAL 358 358 358 VAL VAL A . n 
C 3 359 PHE 359 359 359 PHE PHE A . n 
C 3 360 SER 360 360 360 SER SER A . n 
C 3 361 PRO 361 361 361 PRO PRO A . n 
C 3 362 ILE 362 362 362 ILE ILE A . n 
C 3 363 LYS 363 363 363 LYS LYS A . n 
C 3 364 THR 364 364 364 THR THR A . n 
C 3 365 TRP 365 365 365 TRP TRP A . n 
C 3 366 ASP 366 366 366 ASP ASP A . n 
C 3 367 ALA 367 367 367 ALA ALA A . n 
C 3 368 ILE 368 368 368 ILE ILE A . n 
C 3 369 ILE 369 369 369 ILE ILE A . n 
C 3 370 PHE 370 370 370 PHE PHE A . n 
C 3 371 ASN 371 371 371 ASN ASN A . n 
C 3 372 SER 372 372 372 SER SER A . n 
C 3 373 LEU 373 373 373 LEU LEU A . n 
C 3 374 LYS 374 374 374 LYS LYS A . n 
C 3 375 GLU 375 375 375 GLU GLU A . n 
C 3 376 GLN 376 376 376 GLN GLN A . n 
C 3 377 ASN 377 377 377 ASN ASN A . n 
C 3 378 LYS 378 378 378 LYS LYS A . n 
C 3 379 VAL 379 379 379 VAL VAL A . n 
C 3 380 ILE 380 380 380 ILE ILE A . n 
C 3 381 PRO 381 381 381 PRO PRO A . n 
C 3 382 GLN 382 382 382 GLN GLN A . n 
C 3 383 GLY 383 383 383 GLY GLY A . n 
C 3 384 ARG 384 384 384 ARG ARG A . n 
C 3 385 SER 385 385 385 SER SER A . n 
C 3 386 HIS 386 386 386 HIS HIS A . n 
C 3 387 PRO 387 387 387 PRO PRO A . n 
C 3 388 VAL 388 388 388 VAL VAL A . n 
C 3 389 GLN 389 389 389 GLN GLN A . n 
C 3 390 PRO 390 390 390 PRO PRO A . n 
C 3 391 TYR 391 391 391 TYR TYR A . n 
C 3 392 PRO 392 392 392 PRO PRO A . n 
C 3 393 GLY 393 393 393 GLY GLY A . n 
C 3 394 ALA 394 394 394 ALA ALA A . n 
C 3 395 PHE 395 395 395 PHE PHE A . n 
C 3 396 VAL 396 396 396 VAL VAL A . n 
C 3 397 LYS 397 397 397 LYS LYS A . n 
C 3 398 GLU 398 398 398 GLU GLU A . n 
C 3 399 PRO 399 399 399 PRO PRO A . n 
C 3 400 ILE 400 400 400 ILE ILE A . n 
C 3 401 PRO 401 401 401 PRO PRO A . n 
C 3 402 ASN 402 402 402 ASN ASN A . n 
C 3 403 ARG 403 403 403 ARG ARG A . n 
C 3 404 TYR 404 404 404 TYR TYR A . n 
C 3 405 LYS 405 405 405 LYS LYS A . n 
C 3 406 TYR 406 406 406 TYR TYR A . n 
C 3 407 VAL 407 407 407 VAL VAL A . n 
C 3 408 MET 408 408 408 MET MET A . n 
C 3 409 SER 409 409 409 SER SER A . n 
C 3 410 PHE 410 410 410 PHE PHE A . n 
C 3 411 ASP 411 411 411 ASP ASP A . n 
C 3 412 LEU 412 412 412 LEU LEU A . n 
C 3 413 THR 413 413 413 THR THR A . n 
C 3 414 SER 414 414 414 SER SER A . n 
C 3 415 LEU 415 415 415 LEU LEU A . n 
C 3 416 TYR 416 416 416 TYR TYR A . n 
C 3 417 PRO 417 417 417 PRO PRO A . n 
C 3 418 SER 418 418 418 SER SER A . n 
C 3 419 ILE 419 419 419 ILE ILE A . n 
C 3 420 ILE 420 420 420 ILE ILE A . n 
C 3 421 ARG 421 421 421 ARG ARG A . n 
C 3 422 GLN 422 422 422 GLN GLN A . n 
C 3 423 VAL 423 423 423 VAL VAL A . n 
C 3 424 ASN 424 424 424 ASN ASN A . n 
C 3 425 ILE 425 425 425 ILE ILE A . n 
C 3 426 SER 426 426 426 SER SER A . n 
C 3 427 PRO 427 427 427 PRO PRO A . n 
C 3 428 GLU 428 428 428 GLU GLU A . n 
C 3 429 THR 429 429 429 THR THR A . n 
C 3 430 ILE 430 430 430 ILE ILE A . n 
C 3 431 ALA 431 431 431 ALA ALA A . n 
C 3 432 GLY 432 432 432 GLY GLY A . n 
C 3 433 THR 433 433 433 THR THR A . n 
C 3 434 PHE 434 434 434 PHE PHE A . n 
C 3 435 LYS 435 435 435 LYS LYS A . n 
C 3 436 VAL 436 436 436 VAL VAL A . n 
C 3 437 ALA 437 437 437 ALA ALA A . n 
C 3 438 PRO 438 438 438 PRO PRO A . n 
C 3 439 LEU 439 439 439 LEU LEU A . n 
C 3 440 HIS 440 440 440 HIS HIS A . n 
C 3 441 ASP 441 441 441 ASP ASP A . n 
C 3 442 TYR 442 442 442 TYR TYR A . n 
C 3 443 ILE 443 443 443 ILE ILE A . n 
C 3 444 ASN 444 444 444 ASN ASN A . n 
C 3 445 ALA 445 445 445 ALA ALA A . n 
C 3 446 VAL 446 446 446 VAL VAL A . n 
C 3 447 ALA 447 447 447 ALA ALA A . n 
C 3 448 GLU 448 448 448 GLU GLU A . n 
C 3 449 ARG 449 449 449 ARG ARG A . n 
C 3 450 PRO 450 450 450 PRO PRO A . n 
C 3 451 SER 451 451 451 SER SER A . n 
C 3 452 ASP 452 452 452 ASP ASP A . n 
C 3 453 VAL 453 453 453 VAL VAL A . n 
C 3 454 TYR 454 454 454 TYR TYR A . n 
C 3 455 SER 455 455 455 SER SER A . n 
C 3 456 CYS 456 456 456 CYS CYS A . n 
C 3 457 SER 457 457 457 SER SER A . n 
C 3 458 PRO 458 458 458 PRO PRO A . n 
C 3 459 ASN 459 459 459 ASN ASN A . n 
C 3 460 GLY 460 460 460 GLY GLY A . n 
C 3 461 MET 461 461 461 MET MET A . n 
C 3 462 MET 462 462 462 MET MET A . n 
C 3 463 TYR 463 463 463 TYR TYR A . n 
C 3 464 TYR 464 464 464 TYR TYR A . n 
C 3 465 LYS 465 465 465 LYS LYS A . n 
C 3 466 ASP 466 466 466 ASP ASP A . n 
C 3 467 ARG 467 467 467 ARG ARG A . n 
C 3 468 ASP 468 468 468 ASP ASP A . n 
C 3 469 GLY 469 469 469 GLY GLY A . n 
C 3 470 VAL 470 470 470 VAL VAL A . n 
C 3 471 VAL 471 471 471 VAL VAL A . n 
C 3 472 PRO 472 472 472 PRO PRO A . n 
C 3 473 THR 473 473 473 THR THR A . n 
C 3 474 GLU 474 474 474 GLU GLU A . n 
C 3 475 ILE 475 475 475 ILE ILE A . n 
C 3 476 THR 476 476 476 THR THR A . n 
C 3 477 LYS 477 477 477 LYS LYS A . n 
C 3 478 VAL 478 478 478 VAL VAL A . n 
C 3 479 PHE 479 479 479 PHE PHE A . n 
C 3 480 ASN 480 480 480 ASN ASN A . n 
C 3 481 GLN 481 481 481 GLN GLN A . n 
C 3 482 ARG 482 482 482 ARG ARG A . n 
C 3 483 LYS 483 483 483 LYS LYS A . n 
C 3 484 GLU 484 484 484 GLU GLU A . n 
C 3 485 HIS 485 485 485 HIS HIS A . n 
C 3 486 LYS 486 486 486 LYS LYS A . n 
C 3 487 GLY 487 487 487 GLY GLY A . n 
C 3 488 TYR 488 488 488 TYR TYR A . n 
C 3 489 MET 489 489 489 MET MET A . n 
C 3 490 LEU 490 490 490 LEU LEU A . n 
C 3 491 ALA 491 491 491 ALA ALA A . n 
C 3 492 ALA 492 492 492 ALA ALA A . n 
C 3 493 GLN 493 493 493 GLN GLN A . n 
C 3 494 ARG 494 494 494 ARG ARG A . n 
C 3 495 ASN 495 495 495 ASN ASN A . n 
C 3 496 GLY 496 496 496 GLY GLY A . n 
C 3 497 GLU 497 497 497 GLU GLU A . n 
C 3 498 ILE 498 498 498 ILE ILE A . n 
C 3 499 ILE 499 499 499 ILE ILE A . n 
C 3 500 LYS 500 500 500 LYS LYS A . n 
C 3 501 GLU 501 501 501 GLU GLU A . n 
C 3 502 ALA 502 502 502 ALA ALA A . n 
C 3 503 LEU 503 503 503 LEU LEU A . n 
C 3 504 HIS 504 504 504 HIS HIS A . n 
C 3 505 ASN 505 505 505 ASN ASN A . n 
C 3 506 PRO 506 506 506 PRO PRO A . n 
C 3 507 ASN 507 507 507 ASN ASN A . n 
C 3 508 LEU 508 508 508 LEU LEU A . n 
C 3 509 SER 509 509 509 SER SER A . n 
C 3 510 VAL 510 510 510 VAL VAL A . n 
C 3 511 ASP 511 511 511 ASP ASP A . n 
C 3 512 GLU 512 512 512 GLU GLU A . n 
C 3 513 PRO 513 513 513 PRO PRO A . n 
C 3 514 LEU 514 514 514 LEU LEU A . n 
C 3 515 ASP 515 515 515 ASP ASP A . n 
C 3 516 VAL 516 516 516 VAL VAL A . n 
C 3 517 ASP 517 517 517 ASP ASP A . n 
C 3 518 TYR 518 518 518 TYR TYR A . n 
C 3 519 ARG 519 519 519 ARG ARG A . n 
C 3 520 PHE 520 520 520 PHE PHE A . n 
C 3 521 ASP 521 521 521 ASP ASP A . n 
C 3 522 PHE 522 522 522 PHE PHE A . n 
C 3 523 SER 523 523 523 SER SER A . n 
C 3 524 ASP 524 524 524 ASP ASP A . n 
C 3 525 GLU 525 525 525 GLU GLU A . n 
C 3 526 ILE 526 526 526 ILE ILE A . n 
C 3 527 LYS 527 527 527 LYS LYS A . n 
C 3 528 GLU 528 528 528 GLU GLU A . n 
C 3 529 LYS 529 529 529 LYS LYS A . n 
C 3 530 ILE 530 530 530 ILE ILE A . n 
C 3 531 LYS 531 531 531 LYS LYS A . n 
C 3 532 LYS 532 532 532 LYS LYS A . n 
C 3 533 LEU 533 533 533 LEU LEU A . n 
C 3 534 SER 534 534 534 SER SER A . n 
C 3 535 ALA 535 535 535 ALA ALA A . n 
C 3 536 LYS 536 536 536 LYS LYS A . n 
C 3 537 SER 537 537 537 SER SER A . n 
C 3 538 LEU 538 538 538 LEU LEU A . n 
C 3 539 ASN 539 539 539 ASN ASN A . n 
C 3 540 GLU 540 540 540 GLU GLU A . n 
C 3 541 MET 541 541 541 MET MET A . n 
C 3 542 LEU 542 542 542 LEU LEU A . n 
C 3 543 PHE 543 543 543 PHE PHE A . n 
C 3 544 ARG 544 544 544 ARG ARG A . n 
C 3 545 ALA 545 545 545 ALA ALA A . n 
C 3 546 GLN 546 546 546 GLN GLN A . n 
C 3 547 ARG 547 547 547 ARG ARG A . n 
C 3 548 THR 548 548 548 THR THR A . n 
C 3 549 GLU 549 549 549 GLU GLU A . n 
C 3 550 VAL 550 550 550 VAL VAL A . n 
C 3 551 ALA 551 551 551 ALA ALA A . n 
C 3 552 GLY 552 552 552 GLY GLY A . n 
C 3 553 MET 553 553 553 MET MET A . n 
C 3 554 THR 554 554 554 THR THR A . n 
C 3 555 ALA 555 555 555 ALA ALA A . n 
C 3 556 GLN 556 556 556 GLN GLN A . n 
C 3 557 ILE 557 557 557 ILE ILE A . n 
C 3 558 ASN 558 558 558 ASN ASN A . n 
C 3 559 ARG 559 559 559 ARG ARG A . n 
C 3 560 LYS 560 560 560 LYS LYS A . n 
C 3 561 LEU 561 561 561 LEU LEU A . n 
C 3 562 LEU 562 562 562 LEU LEU A . n 
C 3 563 ILE 563 563 563 ILE ILE A . n 
C 3 564 ASN 564 564 564 ASN ASN A . n 
C 3 565 SER 565 565 565 SER SER A . n 
C 3 566 LEU 566 566 566 LEU LEU A . n 
C 3 567 TYR 567 567 567 TYR TYR A . n 
C 3 568 GLY 568 568 568 GLY GLY A . n 
C 3 569 ALA 569 569 569 ALA ALA A . n 
C 3 570 LEU 570 570 570 LEU LEU A . n 
C 3 571 GLY 571 571 571 GLY GLY A . n 
C 3 572 ASN 572 572 572 ASN ASN A . n 
C 3 573 VAL 573 573 573 VAL VAL A . n 
C 3 574 TRP 574 574 574 TRP TRP A . n 
C 3 575 PHE 575 575 575 PHE PHE A . n 
C 3 576 ARG 576 576 576 ARG ARG A . n 
C 3 577 TYR 577 577 577 TYR TYR A . n 
C 3 578 TYR 578 578 578 TYR TYR A . n 
C 3 579 ASP 579 579 579 ASP ASP A . n 
C 3 580 LEU 580 580 580 LEU LEU A . n 
C 3 581 ARG 581 581 581 ARG ARG A . n 
C 3 582 ASN 582 582 582 ASN ASN A . n 
C 3 583 ALA 583 583 583 ALA ALA A . n 
C 3 584 THR 584 584 584 THR THR A . n 
C 3 585 ALA 585 585 585 ALA ALA A . n 
C 3 586 ILE 586 586 586 ILE ILE A . n 
C 3 587 THR 587 587 587 THR THR A . n 
C 3 588 THR 588 588 588 THR THR A . n 
C 3 589 PHE 589 589 589 PHE PHE A . n 
C 3 590 GLY 590 590 590 GLY GLY A . n 
C 3 591 GLN 591 591 591 GLN GLN A . n 
C 3 592 MET 592 592 592 MET MET A . n 
C 3 593 ALA 593 593 593 ALA ALA A . n 
C 3 594 LEU 594 594 594 LEU LEU A . n 
C 3 595 GLN 595 595 595 GLN GLN A . n 
C 3 596 TRP 596 596 596 TRP TRP A . n 
C 3 597 ILE 597 597 597 ILE ILE A . n 
C 3 598 GLU 598 598 598 GLU GLU A . n 
C 3 599 ARG 599 599 599 ARG ARG A . n 
C 3 600 LYS 600 600 600 LYS LYS A . n 
C 3 601 VAL 601 601 601 VAL VAL A . n 
C 3 602 ASN 602 602 602 ASN ASN A . n 
C 3 603 GLU 603 603 603 GLU GLU A . n 
C 3 604 TYR 604 604 604 TYR TYR A . n 
C 3 605 LEU 605 605 605 LEU LEU A . n 
C 3 606 ASN 606 606 606 ASN ASN A . n 
C 3 607 GLU 607 607 607 GLU GLU A . n 
C 3 608 VAL 608 608 608 VAL VAL A . n 
C 3 609 CYS 609 609 609 CYS CYS A . n 
C 3 610 GLY 610 610 610 GLY GLY A . n 
C 3 611 THR 611 611 611 THR THR A . n 
C 3 612 GLU 612 612 612 GLU GLU A . n 
C 3 613 GLY 613 613 613 GLY GLY A . n 
C 3 614 GLU 614 614 614 GLU GLU A . n 
C 3 615 ALA 615 615 615 ALA ALA A . n 
C 3 616 PHE 616 616 616 PHE PHE A . n 
C 3 617 VAL 617 617 617 VAL VAL A . n 
C 3 618 LEU 618 618 618 LEU LEU A . n 
C 3 619 TYR 619 619 619 TYR TYR A . n 
C 3 620 GLY 620 620 620 GLY GLY A . n 
C 3 621 ASP 621 621 621 ASP ASP A . n 
C 3 622 THR 622 622 622 THR THR A . n 
C 3 623 ASP 623 623 623 ASP ASP A . n 
C 3 624 SER 624 624 624 SER SER A . n 
C 3 625 ILE 625 625 625 ILE ILE A . n 
C 3 626 TYR 626 626 626 TYR TYR A . n 
C 3 627 VAL 627 627 627 VAL VAL A . n 
C 3 628 SER 628 628 628 SER SER A . n 
C 3 629 ALA 629 629 629 ALA ALA A . n 
C 3 630 ASP 630 630 630 ASP ASP A . n 
C 3 631 LYS 631 631 631 LYS LYS A . n 
C 3 632 ILE 632 632 632 ILE ILE A . n 
C 3 633 ILE 633 633 633 ILE ILE A . n 
C 3 634 ASP 634 634 634 ASP ASP A . n 
C 3 635 LYS 635 635 635 LYS LYS A . n 
C 3 636 VAL 636 636 636 VAL VAL A . n 
C 3 637 GLY 637 637 637 GLY GLY A . n 
C 3 638 GLU 638 638 638 GLU GLU A . n 
C 3 639 SER 639 639 639 SER SER A . n 
C 3 640 LYS 640 640 640 LYS LYS A . n 
C 3 641 PHE 641 641 641 PHE PHE A . n 
C 3 642 ARG 642 642 642 ARG ARG A . n 
C 3 643 ASP 643 643 643 ASP ASP A . n 
C 3 644 THR 644 644 644 THR THR A . n 
C 3 645 ASN 645 645 645 ASN ASN A . n 
C 3 646 HIS 646 646 646 HIS HIS A . n 
C 3 647 TRP 647 647 647 TRP TRP A . n 
C 3 648 VAL 648 648 648 VAL VAL A . n 
C 3 649 ASP 649 649 649 ASP ASP A . n 
C 3 650 PHE 650 650 650 PHE PHE A . n 
C 3 651 LEU 651 651 651 LEU LEU A . n 
C 3 652 ASP 652 652 652 ASP ASP A . n 
C 3 653 LYS 653 653 653 LYS LYS A . n 
C 3 654 PHE 654 654 654 PHE PHE A . n 
C 3 655 ALA 655 655 655 ALA ALA A . n 
C 3 656 ARG 656 656 656 ARG ARG A . n 
C 3 657 GLU 657 657 657 GLU GLU A . n 
C 3 658 ARG 658 658 658 ARG ARG A . n 
C 3 659 MET 659 659 659 MET MET A . n 
C 3 660 GLU 660 660 660 GLU GLU A . n 
C 3 661 PRO 661 661 661 PRO PRO A . n 
C 3 662 ALA 662 662 662 ALA ALA A . n 
C 3 663 ILE 663 663 663 ILE ILE A . n 
C 3 664 ASP 664 664 664 ASP ASP A . n 
C 3 665 ARG 665 665 665 ARG ARG A . n 
C 3 666 GLY 666 666 666 GLY GLY A . n 
C 3 667 PHE 667 667 667 PHE PHE A . n 
C 3 668 ARG 668 668 668 ARG ARG A . n 
C 3 669 GLU 669 669 669 GLU GLU A . n 
C 3 670 MET 670 670 670 MET MET A . n 
C 3 671 CYS 671 671 671 CYS CYS A . n 
C 3 672 GLU 672 672 672 GLU GLU A . n 
C 3 673 TYR 673 673 673 TYR TYR A . n 
C 3 674 MET 674 674 674 MET MET A . n 
C 3 675 ASN 675 675 675 ASN ASN A . n 
C 3 676 ASN 676 676 676 ASN ASN A . n 
C 3 677 LYS 677 677 677 LYS LYS A . n 
C 3 678 GLN 678 678 678 GLN GLN A . n 
C 3 679 HIS 679 679 679 HIS HIS A . n 
C 3 680 LEU 680 680 680 LEU LEU A . n 
C 3 681 MET 681 681 681 MET MET A . n 
C 3 682 PHE 682 682 682 PHE PHE A . n 
C 3 683 MET 683 683 683 MET MET A . n 
C 3 684 ASP 684 684 684 ASP ASP A . n 
C 3 685 ARG 685 685 685 ARG ARG A . n 
C 3 686 GLU 686 686 686 GLU GLU A . n 
C 3 687 ALA 687 687 687 ALA ALA A . n 
C 3 688 ILE 688 688 688 ILE ILE A . n 
C 3 689 ALA 689 689 689 ALA ALA A . n 
C 3 690 GLY 690 690 690 GLY GLY A . n 
C 3 691 PRO 691 691 691 PRO PRO A . n 
C 3 692 PRO 692 692 692 PRO PRO A . n 
C 3 693 LEU 693 693 693 LEU LEU A . n 
C 3 694 GLY 694 694 694 GLY GLY A . n 
C 3 695 SER 695 695 695 SER SER A . n 
C 3 696 LYS 696 696 696 LYS LYS A . n 
C 3 697 GLY 697 697 697 GLY GLY A . n 
C 3 698 ILE 698 698 698 ILE ILE A . n 
C 3 699 GLY 699 699 699 GLY GLY A . n 
C 3 700 GLY 700 700 700 GLY GLY A . n 
C 3 701 PHE 701 701 701 PHE PHE A . n 
C 3 702 TRP 702 702 702 TRP TRP A . n 
C 3 703 THR 703 703 703 THR THR A . n 
C 3 704 GLY 704 704 704 GLY GLY A . n 
C 3 705 LYS 705 705 705 LYS LYS A . n 
C 3 706 LYS 706 706 706 LYS LYS A . n 
C 3 707 ARG 707 707 707 ARG ARG A . n 
C 3 708 TYR 708 708 708 TYR TYR A . n 
C 3 709 ALA 709 709 709 ALA ALA A . n 
C 3 710 LEU 710 710 710 LEU LEU A . n 
C 3 711 ASN 711 711 711 ASN ASN A . n 
C 3 712 VAL 712 712 712 VAL VAL A . n 
C 3 713 TRP 713 713 713 TRP TRP A . n 
C 3 714 ASP 714 714 714 ASP ASP A . n 
C 3 715 MET 715 715 715 MET MET A . n 
C 3 716 GLU 716 716 716 GLU GLU A . n 
C 3 717 GLY 717 717 717 GLY GLY A . n 
C 3 718 THR 718 718 718 THR THR A . n 
C 3 719 ARG 719 719 719 ARG ARG A . n 
C 3 720 TYR 720 720 720 TYR TYR A . n 
C 3 721 ALA 721 721 721 ALA ALA A . n 
C 3 722 GLU 722 722 722 GLU GLU A . n 
C 3 723 PRO 723 723 723 PRO PRO A . n 
C 3 724 LYS 724 724 724 LYS LYS A . n 
C 3 725 LEU 725 725 725 LEU LEU A . n 
C 3 726 LYS 726 726 726 LYS LYS A . n 
C 3 727 ILE 727 727 727 ILE ILE A . n 
C 3 728 MET 728 728 728 MET MET A . n 
C 3 729 GLY 729 729 729 GLY GLY A . n 
C 3 730 LEU 730 730 730 LEU LEU A . n 
C 3 731 GLU 731 731 731 GLU GLU A . n 
C 3 732 THR 732 732 732 THR THR A . n 
C 3 733 GLN 733 733 733 GLN GLN A . n 
C 3 734 LYS 734 734 734 LYS LYS A . n 
C 3 735 SER 735 735 735 SER SER A . n 
C 3 736 SER 736 736 736 SER SER A . n 
C 3 737 THR 737 737 737 THR THR A . n 
C 3 738 PRO 738 738 738 PRO PRO A . n 
C 3 739 LYS 739 739 739 LYS LYS A . n 
C 3 740 ALA 740 740 740 ALA ALA A . n 
C 3 741 VAL 741 741 741 VAL VAL A . n 
C 3 742 GLN 742 742 742 GLN GLN A . n 
C 3 743 LYS 743 743 743 LYS LYS A . n 
C 3 744 ALA 744 744 744 ALA ALA A . n 
C 3 745 LEU 745 745 745 LEU LEU A . n 
C 3 746 LYS 746 746 746 LYS LYS A . n 
C 3 747 GLU 747 747 747 GLU GLU A . n 
C 3 748 CYS 748 748 748 CYS CYS A . n 
C 3 749 ILE 749 749 749 ILE ILE A . n 
C 3 750 ARG 750 750 750 ARG ARG A . n 
C 3 751 ARG 751 751 751 ARG ARG A . n 
C 3 752 MET 752 752 752 MET MET A . n 
C 3 753 LEU 753 753 753 LEU LEU A . n 
C 3 754 GLN 754 754 754 GLN GLN A . n 
C 3 755 GLU 755 755 755 GLU GLU A . n 
C 3 756 GLY 756 756 756 GLY GLY A . n 
C 3 757 GLU 757 757 757 GLU GLU A . n 
C 3 758 GLU 758 758 758 GLU GLU A . n 
C 3 759 SER 759 759 759 SER SER A . n 
C 3 760 LEU 760 760 760 LEU LEU A . n 
C 3 761 GLN 761 761 761 GLN GLN A . n 
C 3 762 GLU 762 762 762 GLU GLU A . n 
C 3 763 TYR 763 763 763 TYR TYR A . n 
C 3 764 PHE 764 764 764 PHE PHE A . n 
C 3 765 LYS 765 765 765 LYS LYS A . n 
C 3 766 GLU 766 766 766 GLU GLU A . n 
C 3 767 PHE 767 767 767 PHE PHE A . n 
C 3 768 GLU 768 768 768 GLU GLU A . n 
C 3 769 LYS 769 769 769 LYS LYS A . n 
C 3 770 GLU 770 770 770 GLU GLU A . n 
C 3 771 PHE 771 771 771 PHE PHE A . n 
C 3 772 ARG 772 772 772 ARG ARG A . n 
C 3 773 GLN 773 773 773 GLN GLN A . n 
C 3 774 LEU 774 774 774 LEU LEU A . n 
C 3 775 ASN 775 775 775 ASN ASN A . n 
C 3 776 TYR 776 776 776 TYR TYR A . n 
C 3 777 ILE 777 777 777 ILE ILE A . n 
C 3 778 SER 778 778 778 SER SER A . n 
C 3 779 ILE 779 779 779 ILE ILE A . n 
C 3 780 ALA 780 780 780 ALA ALA A . n 
C 3 781 SER 781 781 781 SER SER A . n 
C 3 782 VAL 782 782 782 VAL VAL A . n 
C 3 783 SER 783 783 783 SER SER A . n 
C 3 784 SER 784 784 784 SER SER A . n 
C 3 785 ALA 785 785 785 ALA ALA A . n 
C 3 786 ASN 786 786 786 ASN ASN A . n 
C 3 787 ASN 787 787 787 ASN ASN A . n 
C 3 788 ILE 788 788 788 ILE ILE A . n 
C 3 789 ALA 789 789 789 ALA ALA A . n 
C 3 790 LYS 790 790 790 LYS LYS A . n 
C 3 791 TYR 791 791 791 TYR TYR A . n 
C 3 792 ASP 792 792 792 ASP ASP A . n 
C 3 793 VAL 793 793 793 VAL VAL A . n 
C 3 794 GLY 794 794 794 GLY GLY A . n 
C 3 795 GLY 795 795 795 GLY GLY A . n 
C 3 796 PHE 796 796 796 PHE PHE A . n 
C 3 797 PRO 797 797 797 PRO PRO A . n 
C 3 798 GLY 798 798 798 GLY GLY A . n 
C 3 799 PRO 799 799 799 PRO PRO A . n 
C 3 800 LYS 800 800 800 LYS LYS A . n 
C 3 801 CYS 801 801 801 CYS CYS A . n 
C 3 802 PRO 802 802 802 PRO PRO A . n 
C 3 803 PHE 803 803 803 PHE PHE A . n 
C 3 804 HIS 804 804 804 HIS HIS A . n 
C 3 805 ILE 805 805 805 ILE ILE A . n 
C 3 806 ARG 806 806 806 ARG ARG A . n 
C 3 807 GLY 807 807 807 GLY GLY A . n 
C 3 808 ILE 808 808 808 ILE ILE A . n 
C 3 809 LEU 809 809 809 LEU LEU A . n 
C 3 810 THR 810 810 810 THR THR A . n 
C 3 811 TYR 811 811 811 TYR TYR A . n 
C 3 812 ASN 812 812 812 ASN ASN A . n 
C 3 813 ARG 813 813 813 ARG ARG A . n 
C 3 814 ALA 814 814 814 ALA ALA A . n 
C 3 815 ILE 815 815 815 ILE ILE A . n 
C 3 816 LYS 816 816 816 LYS LYS A . n 
C 3 817 GLY 817 817 817 GLY GLY A . n 
C 3 818 ASN 818 818 818 ASN ASN A . n 
C 3 819 ILE 819 819 819 ILE ILE A . n 
C 3 820 ASP 820 820 820 ASP ASP A . n 
C 3 821 ALA 821 821 821 ALA ALA A . n 
C 3 822 PRO 822 822 822 PRO PRO A . n 
C 3 823 GLN 823 823 823 GLN GLN A . n 
C 3 824 VAL 824 824 824 VAL VAL A . n 
C 3 825 VAL 825 825 825 VAL VAL A . n 
C 3 826 GLU 826 826 826 GLU GLU A . n 
C 3 827 GLY 827 827 827 GLY GLY A . n 
C 3 828 GLU 828 828 828 GLU GLU A . n 
C 3 829 LYS 829 829 829 LYS LYS A . n 
C 3 830 VAL 830 830 830 VAL VAL A . n 
C 3 831 TYR 831 831 831 TYR TYR A . n 
C 3 832 VAL 832 832 832 VAL VAL A . n 
C 3 833 LEU 833 833 833 LEU LEU A . n 
C 3 834 PRO 834 834 834 PRO PRO A . n 
C 3 835 LEU 835 835 835 LEU LEU A . n 
C 3 836 ARG 836 836 836 ARG ARG A . n 
C 3 837 GLU 837 837 837 GLU GLU A . n 
C 3 838 GLY 838 838 838 GLY GLY A . n 
C 3 839 ASN 839 839 839 ASN ASN A . n 
C 3 840 PRO 840 840 840 PRO PRO A . n 
C 3 841 PHE 841 841 841 PHE PHE A . n 
C 3 842 GLY 842 842 842 GLY GLY A . n 
C 3 843 ASP 843 843 843 ASP ASP A . n 
C 3 844 LYS 844 844 844 LYS LYS A . n 
C 3 845 CYS 845 845 845 CYS CYS A . n 
C 3 846 ILE 846 846 846 ILE ILE A . n 
C 3 847 ALA 847 847 847 ALA ALA A . n 
C 3 848 TRP 848 848 848 TRP TRP A . n 
C 3 849 PRO 849 849 849 PRO PRO A . n 
C 3 850 SER 850 850 850 SER SER A . n 
C 3 851 GLY 851 851 851 GLY GLY A . n 
C 3 852 THR 852 852 852 THR THR A . n 
C 3 853 GLU 853 853 853 GLU GLU A . n 
C 3 854 ILE 854 854 854 ILE ILE A . n 
C 3 855 THR 855 855 855 THR THR A . n 
C 3 856 ASP 856 856 856 ASP ASP A . n 
C 3 857 LEU 857 857 857 LEU LEU A . n 
C 3 858 ILE 858 858 858 ILE ILE A . n 
C 3 859 LYS 859 859 859 LYS LYS A . n 
C 3 860 ASP 860 860 860 ASP ASP A . n 
C 3 861 ASP 861 861 861 ASP ASP A . n 
C 3 862 VAL 862 862 862 VAL VAL A . n 
C 3 863 LEU 863 863 863 LEU LEU A . n 
C 3 864 HIS 864 864 864 HIS HIS A . n 
C 3 865 TRP 865 865 865 TRP TRP A . n 
C 3 866 MET 866 866 866 MET MET A . n 
C 3 867 ASP 867 867 867 ASP ASP A . n 
C 3 868 TYR 868 868 868 TYR TYR A . n 
C 3 869 THR 869 869 869 THR THR A . n 
C 3 870 VAL 870 870 870 VAL VAL A . n 
C 3 871 LEU 871 871 871 LEU LEU A . n 
C 3 872 LEU 872 872 872 LEU LEU A . n 
C 3 873 GLU 873 873 873 GLU GLU A . n 
C 3 874 LYS 874 874 874 LYS LYS A . n 
C 3 875 THR 875 875 875 THR THR A . n 
C 3 876 PHE 876 876 876 PHE PHE A . n 
C 3 877 ILE 877 877 877 ILE ILE A . n 
C 3 878 LYS 878 878 878 LYS LYS A . n 
C 3 879 PRO 879 879 879 PRO PRO A . n 
C 3 880 LEU 880 880 880 LEU LEU A . n 
C 3 881 GLU 881 881 881 GLU GLU A . n 
C 3 882 GLY 882 882 882 GLY GLY A . n 
C 3 883 PHE 883 883 883 PHE PHE A . n 
C 3 884 THR 884 884 884 THR THR A . n 
C 3 885 SER 885 885 885 SER SER A . n 
C 3 886 ALA 886 886 886 ALA ALA A . n 
C 3 887 ALA 887 887 887 ALA ALA A . n 
C 3 888 LYS 888 888 888 LYS LYS A . n 
C 3 889 LEU 889 889 889 LEU LEU A . n 
C 3 890 ASP 890 890 890 ASP ASP A . n 
C 3 891 TYR 891 891 891 TYR TYR A . n 
C 3 892 GLU 892 892 892 GLU GLU A . n 
C 3 893 LYS 893 893 893 LYS LYS A . n 
C 3 894 LYS 894 894 894 LYS LYS A . n 
C 3 895 ALA 895 895 895 ALA ALA A . n 
C 3 896 SER 896 896 896 SER SER A . n 
C 3 897 LEU 897 897 897 LEU LEU A . n 
C 3 898 PHE 898 898 898 PHE PHE A . n 
C 3 899 ASP 899 899 899 ASP ASP A . n 
C 3 900 MET 900 900 900 MET MET A . n 
C 3 901 PHE 901 901 901 PHE PHE A . n 
C 3 902 ASP 902 902 902 ASP ASP A . n 
C 3 903 PHE 903 903 903 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   904  401 MG  MG  A . 
E 5 DTP 1   905  501 DTP DTP A . 
F 6 HOH 1   19   4   HOH HOH T . 
F 6 HOH 2   20   7   HOH HOH T . 
F 6 HOH 3   21   33  HOH HOH T . 
F 6 HOH 4   22   38  HOH HOH T . 
F 6 HOH 5   23   42  HOH HOH T . 
F 6 HOH 6   24   61  HOH HOH T . 
F 6 HOH 7   25   66  HOH HOH T . 
F 6 HOH 8   26   82  HOH HOH T . 
F 6 HOH 9   27   87  HOH HOH T . 
F 6 HOH 10  28   134 HOH HOH T . 
F 6 HOH 11  29   156 HOH HOH T . 
F 6 HOH 12  30   174 HOH HOH T . 
F 6 HOH 13  31   175 HOH HOH T . 
F 6 HOH 14  32   189 HOH HOH T . 
F 6 HOH 15  33   206 HOH HOH T . 
F 6 HOH 16  34   251 HOH HOH T . 
F 6 HOH 17  35   305 HOH HOH T . 
F 6 HOH 18  36   326 HOH HOH T . 
F 6 HOH 19  37   327 HOH HOH T . 
F 6 HOH 20  38   329 HOH HOH T . 
G 6 HOH 1   115  5   HOH HOH P . 
G 6 HOH 2   116  6   HOH HOH P . 
G 6 HOH 3   117  12  HOH HOH P . 
G 6 HOH 4   118  14  HOH HOH P . 
G 6 HOH 5   119  15  HOH HOH P . 
G 6 HOH 6   120  30  HOH HOH P . 
G 6 HOH 7   121  67  HOH HOH P . 
G 6 HOH 8   122  70  HOH HOH P . 
G 6 HOH 9   123  77  HOH HOH P . 
G 6 HOH 10  124  106 HOH HOH P . 
G 6 HOH 11  125  138 HOH HOH P . 
G 6 HOH 12  126  165 HOH HOH P . 
G 6 HOH 13  127  167 HOH HOH P . 
G 6 HOH 14  128  199 HOH HOH P . 
G 6 HOH 15  129  224 HOH HOH P . 
G 6 HOH 16  130  227 HOH HOH P . 
G 6 HOH 17  131  228 HOH HOH P . 
G 6 HOH 18  132  241 HOH HOH P . 
G 6 HOH 19  133  242 HOH HOH P . 
G 6 HOH 20  134  262 HOH HOH P . 
G 6 HOH 21  135  266 HOH HOH P . 
G 6 HOH 22  136  281 HOH HOH P . 
G 6 HOH 23  137  284 HOH HOH P . 
G 6 HOH 24  138  317 HOH HOH P . 
G 6 HOH 25  139  319 HOH HOH P . 
G 6 HOH 26  140  323 HOH HOH P . 
G 6 HOH 27  141  324 HOH HOH P . 
G 6 HOH 28  142  325 HOH HOH P . 
G 6 HOH 29  143  331 HOH HOH P . 
H 6 HOH 1   906  1   HOH HOH A . 
H 6 HOH 2   907  3   HOH HOH A . 
H 6 HOH 3   908  8   HOH HOH A . 
H 6 HOH 4   909  9   HOH HOH A . 
H 6 HOH 5   910  10  HOH HOH A . 
H 6 HOH 6   911  11  HOH HOH A . 
H 6 HOH 7   912  13  HOH HOH A . 
H 6 HOH 8   913  16  HOH HOH A . 
H 6 HOH 9   914  19  HOH HOH A . 
H 6 HOH 10  915  20  HOH HOH A . 
H 6 HOH 11  916  21  HOH HOH A . 
H 6 HOH 12  917  22  HOH HOH A . 
H 6 HOH 13  918  23  HOH HOH A . 
H 6 HOH 14  919  24  HOH HOH A . 
H 6 HOH 15  920  25  HOH HOH A . 
H 6 HOH 16  921  26  HOH HOH A . 
H 6 HOH 17  922  27  HOH HOH A . 
H 6 HOH 18  923  28  HOH HOH A . 
H 6 HOH 19  924  29  HOH HOH A . 
H 6 HOH 20  925  31  HOH HOH A . 
H 6 HOH 21  926  32  HOH HOH A . 
H 6 HOH 22  927  34  HOH HOH A . 
H 6 HOH 23  928  35  HOH HOH A . 
H 6 HOH 24  929  36  HOH HOH A . 
H 6 HOH 25  930  39  HOH HOH A . 
H 6 HOH 26  931  40  HOH HOH A . 
H 6 HOH 27  932  41  HOH HOH A . 
H 6 HOH 28  933  43  HOH HOH A . 
H 6 HOH 29  934  44  HOH HOH A . 
H 6 HOH 30  935  45  HOH HOH A . 
H 6 HOH 31  936  46  HOH HOH A . 
H 6 HOH 32  937  47  HOH HOH A . 
H 6 HOH 33  938  48  HOH HOH A . 
H 6 HOH 34  939  49  HOH HOH A . 
H 6 HOH 35  940  50  HOH HOH A . 
H 6 HOH 36  941  51  HOH HOH A . 
H 6 HOH 37  942  52  HOH HOH A . 
H 6 HOH 38  943  53  HOH HOH A . 
H 6 HOH 39  944  54  HOH HOH A . 
H 6 HOH 40  945  55  HOH HOH A . 
H 6 HOH 41  946  57  HOH HOH A . 
H 6 HOH 42  947  58  HOH HOH A . 
H 6 HOH 43  948  59  HOH HOH A . 
H 6 HOH 44  949  60  HOH HOH A . 
H 6 HOH 45  950  62  HOH HOH A . 
H 6 HOH 46  951  64  HOH HOH A . 
H 6 HOH 47  952  65  HOH HOH A . 
H 6 HOH 48  953  68  HOH HOH A . 
H 6 HOH 49  954  69  HOH HOH A . 
H 6 HOH 50  955  71  HOH HOH A . 
H 6 HOH 51  956  72  HOH HOH A . 
H 6 HOH 52  957  73  HOH HOH A . 
H 6 HOH 53  958  74  HOH HOH A . 
H 6 HOH 54  959  75  HOH HOH A . 
H 6 HOH 55  960  76  HOH HOH A . 
H 6 HOH 56  961  78  HOH HOH A . 
H 6 HOH 57  962  79  HOH HOH A . 
H 6 HOH 58  963  80  HOH HOH A . 
H 6 HOH 59  964  81  HOH HOH A . 
H 6 HOH 60  965  83  HOH HOH A . 
H 6 HOH 61  966  84  HOH HOH A . 
H 6 HOH 62  967  85  HOH HOH A . 
H 6 HOH 63  968  86  HOH HOH A . 
H 6 HOH 64  969  89  HOH HOH A . 
H 6 HOH 65  970  90  HOH HOH A . 
H 6 HOH 66  971  91  HOH HOH A . 
H 6 HOH 67  972  92  HOH HOH A . 
H 6 HOH 68  973  93  HOH HOH A . 
H 6 HOH 69  974  94  HOH HOH A . 
H 6 HOH 70  975  95  HOH HOH A . 
H 6 HOH 71  976  96  HOH HOH A . 
H 6 HOH 72  977  97  HOH HOH A . 
H 6 HOH 73  978  98  HOH HOH A . 
H 6 HOH 74  979  100 HOH HOH A . 
H 6 HOH 75  980  101 HOH HOH A . 
H 6 HOH 76  981  102 HOH HOH A . 
H 6 HOH 77  982  103 HOH HOH A . 
H 6 HOH 78  983  104 HOH HOH A . 
H 6 HOH 79  984  105 HOH HOH A . 
H 6 HOH 80  985  107 HOH HOH A . 
H 6 HOH 81  986  110 HOH HOH A . 
H 6 HOH 82  987  111 HOH HOH A . 
H 6 HOH 83  988  112 HOH HOH A . 
H 6 HOH 84  989  113 HOH HOH A . 
H 6 HOH 85  990  114 HOH HOH A . 
H 6 HOH 86  991  116 HOH HOH A . 
H 6 HOH 87  992  117 HOH HOH A . 
H 6 HOH 88  993  119 HOH HOH A . 
H 6 HOH 89  994  120 HOH HOH A . 
H 6 HOH 90  995  121 HOH HOH A . 
H 6 HOH 91  996  123 HOH HOH A . 
H 6 HOH 92  997  124 HOH HOH A . 
H 6 HOH 93  998  125 HOH HOH A . 
H 6 HOH 94  999  126 HOH HOH A . 
H 6 HOH 95  1000 127 HOH HOH A . 
H 6 HOH 96  1001 128 HOH HOH A . 
H 6 HOH 97  1002 129 HOH HOH A . 
H 6 HOH 98  1003 130 HOH HOH A . 
H 6 HOH 99  1004 131 HOH HOH A . 
H 6 HOH 100 1005 132 HOH HOH A . 
H 6 HOH 101 1006 135 HOH HOH A . 
H 6 HOH 102 1007 136 HOH HOH A . 
H 6 HOH 103 1008 137 HOH HOH A . 
H 6 HOH 104 1009 139 HOH HOH A . 
H 6 HOH 105 1010 140 HOH HOH A . 
H 6 HOH 106 1011 141 HOH HOH A . 
H 6 HOH 107 1012 142 HOH HOH A . 
H 6 HOH 108 1013 143 HOH HOH A . 
H 6 HOH 109 1014 144 HOH HOH A . 
H 6 HOH 110 1015 145 HOH HOH A . 
H 6 HOH 111 1016 146 HOH HOH A . 
H 6 HOH 112 1017 147 HOH HOH A . 
H 6 HOH 113 1018 148 HOH HOH A . 
H 6 HOH 114 1019 149 HOH HOH A . 
H 6 HOH 115 1020 151 HOH HOH A . 
H 6 HOH 116 1021 152 HOH HOH A . 
H 6 HOH 117 1022 153 HOH HOH A . 
H 6 HOH 118 1023 154 HOH HOH A . 
H 6 HOH 119 1024 155 HOH HOH A . 
H 6 HOH 120 1025 158 HOH HOH A . 
H 6 HOH 121 1026 159 HOH HOH A . 
H 6 HOH 122 1027 161 HOH HOH A . 
H 6 HOH 123 1028 162 HOH HOH A . 
H 6 HOH 124 1029 163 HOH HOH A . 
H 6 HOH 125 1030 164 HOH HOH A . 
H 6 HOH 126 1031 166 HOH HOH A . 
H 6 HOH 127 1032 170 HOH HOH A . 
H 6 HOH 128 1033 172 HOH HOH A . 
H 6 HOH 129 1034 176 HOH HOH A . 
H 6 HOH 130 1035 177 HOH HOH A . 
H 6 HOH 131 1036 178 HOH HOH A . 
H 6 HOH 132 1037 179 HOH HOH A . 
H 6 HOH 133 1038 180 HOH HOH A . 
H 6 HOH 134 1039 181 HOH HOH A . 
H 6 HOH 135 1040 182 HOH HOH A . 
H 6 HOH 136 1041 183 HOH HOH A . 
H 6 HOH 137 1042 185 HOH HOH A . 
H 6 HOH 138 1043 186 HOH HOH A . 
H 6 HOH 139 1044 188 HOH HOH A . 
H 6 HOH 140 1045 191 HOH HOH A . 
H 6 HOH 141 1046 193 HOH HOH A . 
H 6 HOH 142 1047 194 HOH HOH A . 
H 6 HOH 143 1048 195 HOH HOH A . 
H 6 HOH 144 1049 197 HOH HOH A . 
H 6 HOH 145 1050 198 HOH HOH A . 
H 6 HOH 146 1051 200 HOH HOH A . 
H 6 HOH 147 1052 202 HOH HOH A . 
H 6 HOH 148 1053 203 HOH HOH A . 
H 6 HOH 149 1054 204 HOH HOH A . 
H 6 HOH 150 1055 205 HOH HOH A . 
H 6 HOH 151 1056 207 HOH HOH A . 
H 6 HOH 152 1057 208 HOH HOH A . 
H 6 HOH 153 1058 209 HOH HOH A . 
H 6 HOH 154 1059 210 HOH HOH A . 
H 6 HOH 155 1060 211 HOH HOH A . 
H 6 HOH 156 1061 212 HOH HOH A . 
H 6 HOH 157 1062 213 HOH HOH A . 
H 6 HOH 158 1063 214 HOH HOH A . 
H 6 HOH 159 1064 215 HOH HOH A . 
H 6 HOH 160 1065 216 HOH HOH A . 
H 6 HOH 161 1066 217 HOH HOH A . 
H 6 HOH 162 1067 218 HOH HOH A . 
H 6 HOH 163 1068 219 HOH HOH A . 
H 6 HOH 164 1069 220 HOH HOH A . 
H 6 HOH 165 1070 221 HOH HOH A . 
H 6 HOH 166 1071 222 HOH HOH A . 
H 6 HOH 167 1072 223 HOH HOH A . 
H 6 HOH 168 1073 225 HOH HOH A . 
H 6 HOH 169 1074 226 HOH HOH A . 
H 6 HOH 170 1075 229 HOH HOH A . 
H 6 HOH 171 1076 230 HOH HOH A . 
H 6 HOH 172 1077 232 HOH HOH A . 
H 6 HOH 173 1078 233 HOH HOH A . 
H 6 HOH 174 1079 237 HOH HOH A . 
H 6 HOH 175 1080 238 HOH HOH A . 
H 6 HOH 176 1081 240 HOH HOH A . 
H 6 HOH 177 1082 243 HOH HOH A . 
H 6 HOH 178 1083 244 HOH HOH A . 
H 6 HOH 179 1084 245 HOH HOH A . 
H 6 HOH 180 1085 247 HOH HOH A . 
H 6 HOH 181 1086 248 HOH HOH A . 
H 6 HOH 182 1087 249 HOH HOH A . 
H 6 HOH 183 1088 250 HOH HOH A . 
H 6 HOH 184 1089 252 HOH HOH A . 
H 6 HOH 185 1090 253 HOH HOH A . 
H 6 HOH 186 1091 254 HOH HOH A . 
H 6 HOH 187 1092 256 HOH HOH A . 
H 6 HOH 188 1093 258 HOH HOH A . 
H 6 HOH 189 1094 259 HOH HOH A . 
H 6 HOH 190 1095 260 HOH HOH A . 
H 6 HOH 191 1096 261 HOH HOH A . 
H 6 HOH 192 1097 263 HOH HOH A . 
H 6 HOH 193 1098 265 HOH HOH A . 
H 6 HOH 194 1099 267 HOH HOH A . 
H 6 HOH 195 1100 269 HOH HOH A . 
H 6 HOH 196 1101 270 HOH HOH A . 
H 6 HOH 197 1102 271 HOH HOH A . 
H 6 HOH 198 1103 272 HOH HOH A . 
H 6 HOH 199 1104 273 HOH HOH A . 
H 6 HOH 200 1105 274 HOH HOH A . 
H 6 HOH 201 1106 275 HOH HOH A . 
H 6 HOH 202 1107 276 HOH HOH A . 
H 6 HOH 203 1108 277 HOH HOH A . 
H 6 HOH 204 1109 279 HOH HOH A . 
H 6 HOH 205 1110 280 HOH HOH A . 
H 6 HOH 206 1111 282 HOH HOH A . 
H 6 HOH 207 1112 283 HOH HOH A . 
H 6 HOH 208 1113 285 HOH HOH A . 
H 6 HOH 209 1114 286 HOH HOH A . 
H 6 HOH 210 1115 287 HOH HOH A . 
H 6 HOH 211 1116 290 HOH HOH A . 
H 6 HOH 212 1117 292 HOH HOH A . 
H 6 HOH 213 1118 293 HOH HOH A . 
H 6 HOH 214 1119 294 HOH HOH A . 
H 6 HOH 215 1120 295 HOH HOH A . 
H 6 HOH 216 1121 296 HOH HOH A . 
H 6 HOH 217 1122 297 HOH HOH A . 
H 6 HOH 218 1123 298 HOH HOH A . 
H 6 HOH 219 1124 300 HOH HOH A . 
H 6 HOH 220 1125 301 HOH HOH A . 
H 6 HOH 221 1126 306 HOH HOH A . 
H 6 HOH 222 1127 308 HOH HOH A . 
H 6 HOH 223 1128 309 HOH HOH A . 
H 6 HOH 224 1129 310 HOH HOH A . 
H 6 HOH 225 1130 311 HOH HOH A . 
H 6 HOH 226 1131 312 HOH HOH A . 
H 6 HOH 227 1132 313 HOH HOH A . 
H 6 HOH 228 1133 314 HOH HOH A . 
H 6 HOH 229 1134 315 HOH HOH A . 
H 6 HOH 230 1135 316 HOH HOH A . 
H 6 HOH 231 1136 320 HOH HOH A . 
H 6 HOH 232 1137 321 HOH HOH A . 
H 6 HOH 233 1138 322 HOH HOH A . 
H 6 HOH 234 1139 328 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    DDG 
_pdbx_struct_mod_residue.label_seq_id     14 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     DDG 
_pdbx_struct_mod_residue.auth_seq_id      114 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   DG 
_pdbx_struct_mod_residue.details          ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? C ASP 411 ? A ASP 411 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O   ? C LEU 412 ? A LEU 412 ? 1_555 78.8  ? 
2  OD1 ? C ASP 411 ? A ASP 411 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 OD2 ? C ASP 623 ? A ASP 623 ? 1_555 80.9  ? 
3  O   ? C LEU 412 ? A LEU 412 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 OD2 ? C ASP 623 ? A ASP 623 ? 1_555 93.2  ? 
4  OD1 ? C ASP 411 ? A ASP 411 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2A ? E DTP .   ? A DTP 905 ? 1_555 96.0  ? 
5  O   ? C LEU 412 ? A LEU 412 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2A ? E DTP .   ? A DTP 905 ? 1_555 172.7 ? 
6  OD2 ? C ASP 623 ? A ASP 623 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2A ? E DTP .   ? A DTP 905 ? 1_555 80.8  ? 
7  OD1 ? C ASP 411 ? A ASP 411 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O1G ? E DTP .   ? A DTP 905 ? 1_555 83.8  ? 
8  O   ? C LEU 412 ? A LEU 412 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O1G ? E DTP .   ? A DTP 905 ? 1_555 90.3  ? 
9  OD2 ? C ASP 623 ? A ASP 623 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O1G ? E DTP .   ? A DTP 905 ? 1_555 163.3 ? 
10 O2A ? E DTP .   ? A DTP 905 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O1G ? E DTP .   ? A DTP 905 ? 1_555 94.3  ? 
11 OD1 ? C ASP 411 ? A ASP 411 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2B ? E DTP .   ? A DTP 905 ? 1_555 172.0 ? 
12 O   ? C LEU 412 ? A LEU 412 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2B ? E DTP .   ? A DTP 905 ? 1_555 96.6  ? 
13 OD2 ? C ASP 623 ? A ASP 623 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2B ? E DTP .   ? A DTP 905 ? 1_555 92.9  ? 
14 O2A ? E DTP .   ? A DTP 905 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2B ? E DTP .   ? A DTP 905 ? 1_555 87.9  ? 
15 O1G ? E DTP .   ? A DTP 905 ? 1_555 MG ? D MG . ? A MG 904 ? 1_555 O2B ? E DTP .   ? A DTP 905 ? 1_555 102.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-10-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' software           
2 4 'Structure model' database_2         
3 4 'Structure model' struct_conn        
4 4 'Structure model' struct_conn_type   
5 4 'Structure model' struct_ref_seq     
6 4 'Structure model' struct_ref_seq_dif 
7 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_struct_conn.conn_type_id'           
4  4 'Structure model' '_struct_conn.id'                     
5  4 'Structure model' '_struct_conn.pdbx_dist_value'        
6  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
7  4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'     
8  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
9  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
10 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
12 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
13 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'     
15 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
16 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
17 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
19 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
20 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
21 4 'Structure model' '_struct_conn_type.id'                
22 4 'Structure model' '_struct_ref_seq.db_align_beg'        
23 4 'Structure model' '_struct_ref_seq.db_align_end'        
24 4 'Structure model' '_struct_ref_seq_dif.details'         
25 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
26 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
27 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .        ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC      5.3.0011 ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
HKL-2000    .        ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .        ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
HKL-2000    .        ?                ?       ?                    ?                        'data scaling'    ? ?          ? 7 
CNS         .        ?                ?       ?                    ?                        phasing           ? ?          ? 8 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    494 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    940 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" T DG 2   ? ? "C3'" T DG 2   ? ? 1.372 1.419 -0.047 0.006 N 
2 1 "O3'" P DA 112 ? ? "C3'" P DA 112 ? ? 1.365 1.419 -0.054 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" T DC  1   ? ? "C2'" T DC  1   ? ? "C1'" T DC  1   ? ? 97.31  102.40 -5.09 0.80 N 
2  1 "O4'" T DC  1   ? ? "C1'" T DC  1   ? ? N1    T DC  1   ? ? 113.69 108.30 5.39  0.30 N 
3  1 "O4'" T DG  2   ? ? "C1'" T DG  2   ? ? "C2'" T DG  2   ? ? 110.01 106.80 3.21  0.50 N 
4  1 "O4'" T DC  4   ? ? "C1'" T DC  4   ? ? N1    T DC  4   ? ? 111.71 108.30 3.41  0.30 N 
5  1 "O4'" T DT  5   ? ? "C1'" T DT  5   ? ? N1    T DT  5   ? ? 111.44 108.30 3.14  0.30 N 
6  1 "O4'" T DT  6   ? ? "C1'" T DT  6   ? ? N1    T DT  6   ? ? 111.13 108.30 2.83  0.30 N 
7  1 N3    T DT  6   ? ? C4    T DT  6   ? ? O4    T DT  6   ? ? 123.70 119.90 3.80  0.60 N 
8  1 "O4'" T DA  7   ? ? "C1'" T DA  7   ? ? N9    T DA  7   ? ? 112.94 108.30 4.64  0.30 N 
9  1 "O4'" T DT  8   ? ? "C1'" T DT  8   ? ? N1    T DT  8   ? ? 110.71 108.30 2.41  0.30 N 
10 1 "O4'" T DG  9   ? ? "C1'" T DG  9   ? ? N9    T DG  9   ? ? 110.91 108.30 2.61  0.30 N 
11 1 "C3'" T DG  9   ? ? "O3'" T DG  9   ? ? P     T DA  10  ? ? 126.92 119.70 7.22  1.20 Y 
12 1 "C3'" T DG  13  ? ? "C2'" T DG  13  ? ? "C1'" T DG  13  ? ? 94.55  102.40 -7.85 0.80 N 
13 1 "O4'" T DG  13  ? ? "C1'" T DG  13  ? ? N9    T DG  13  ? ? 111.76 108.30 3.46  0.30 N 
14 1 "O4'" T DC  14  ? ? "C1'" T DC  14  ? ? N1    T DC  14  ? ? 111.61 108.30 3.31  0.30 N 
15 1 "O4'" T DC  15  ? ? "C1'" T DC  15  ? ? N1    T DC  15  ? ? 113.57 108.30 5.27  0.30 N 
16 1 "O4'" T DG  16  ? ? "C1'" T DG  16  ? ? N9    T DG  16  ? ? 112.02 108.30 3.72  0.30 N 
17 1 "O4'" T DC  17  ? ? "C1'" T DC  17  ? ? N1    T DC  17  ? ? 112.03 108.30 3.73  0.30 N 
18 1 "O4'" P DC  102 ? ? "C1'" P DC  102 ? ? N1    P DC  102 ? ? 111.30 108.30 3.00  0.30 N 
19 1 CA    A LEU 618 ? ? CB    A LEU 618 ? ? CG    A LEU 618 ? ? 133.89 115.30 18.59 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 6   ? ? -105.07 -79.70  
2  1 GLN A 45  ? ? -152.74 83.31   
3  1 ASN A 98  ? ? -67.98  37.97   
4  1 ALA A 135 ? ? -177.48 140.49  
5  1 PRO A 155 ? ? -44.41  -18.44  
6  1 PHE A 221 ? ? -117.35 -78.51  
7  1 GLU A 254 ? ? -57.45  93.52   
8  1 TYR A 257 ? ? -97.10  -83.79  
9  1 LEU A 303 ? ? -47.65  108.01  
10 1 ASN A 316 ? ? -162.72 70.80   
11 1 LYS A 352 ? ? 61.87   60.86   
12 1 SER A 414 ? ? 34.64   75.62   
13 1 ASN A 424 ? ? 73.02   40.78   
14 1 THR A 433 ? ? -121.55 -169.38 
15 1 PRO A 438 ? ? -31.23  127.22  
16 1 ALA A 445 ? ? 82.20   6.90    
17 1 PRO A 458 ? ? -62.92  5.04    
18 1 ASP A 466 ? ? -48.34  -88.56  
19 1 LEU A 508 ? ? -51.20  103.51  
20 1 ASP A 511 ? ? -133.17 -151.06 
21 1 ASP A 579 ? ? -163.79 112.62  
22 1 GLU A 607 ? ? -65.00  -78.88  
23 1 THR A 611 ? ? -78.77  -158.84 
24 1 THR A 622 ? ? 60.29   -69.24  
25 1 VAL A 636 ? ? -151.42 1.66    
26 1 ARG A 658 ? ? -124.77 -55.11  
27 1 GLU A 686 ? ? -109.41 -72.43  
28 1 LYS A 800 ? ? 71.60   -21.26  
29 1 CYS A 801 ? ? -31.27  121.18  
30 1 LYS A 888 ? ? 64.63   65.52   
31 1 TYR A 891 ? ? 57.24   -2.30   
32 1 GLU A 892 ? ? -139.16 -110.79 
33 1 LEU A 897 ? ? 54.93   0.71    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 25  ? CG  ? C ARG 25  CG  
2  1 Y 1 A ARG 25  ? CD  ? C ARG 25  CD  
3  1 Y 1 A ARG 25  ? NE  ? C ARG 25  NE  
4  1 Y 1 A ARG 25  ? CZ  ? C ARG 25  CZ  
5  1 Y 1 A ARG 25  ? NH1 ? C ARG 25  NH1 
6  1 Y 1 A ARG 25  ? NH2 ? C ARG 25  NH2 
7  1 Y 1 A GLU 43  ? CG  ? C GLU 43  CG  
8  1 Y 1 A GLU 43  ? CD  ? C GLU 43  CD  
9  1 Y 1 A GLU 43  ? OE1 ? C GLU 43  OE1 
10 1 Y 1 A GLU 43  ? OE2 ? C GLU 43  OE2 
11 1 Y 1 A LYS 532 ? CG  ? C LYS 532 CG  
12 1 Y 1 A LYS 532 ? CD  ? C LYS 532 CD  
13 1 Y 1 A LYS 532 ? CE  ? C LYS 532 CE  
14 1 Y 1 A LYS 532 ? NZ  ? C LYS 532 NZ  
15 1 Y 1 A VAL 608 ? CG1 ? C VAL 608 CG1 
16 1 Y 1 A VAL 608 ? CG2 ? C VAL 608 CG2 
17 1 Y 1 A LYS 653 ? CG  ? C LYS 653 CG  
18 1 Y 1 A LYS 653 ? CD  ? C LYS 653 CD  
19 1 Y 1 A LYS 653 ? CE  ? C LYS 653 CE  
20 1 Y 1 A LYS 653 ? NZ  ? C LYS 653 NZ  
21 1 Y 1 A LYS 696 ? CG  ? C LYS 696 CG  
22 1 Y 1 A LYS 696 ? CD  ? C LYS 696 CD  
23 1 Y 1 A LYS 696 ? CE  ? C LYS 696 CE  
24 1 Y 1 A LYS 696 ? NZ  ? C LYS 696 NZ  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2OZS 'double helix'        
2OZS 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 4  1_555 B DDG 14 1_555 0.419  -0.156 -0.481 5.011  -5.736  -1.396 1  T_DC4:DDG114_P T 4  ? P 114 ? 19 1 
1 A DT 5  1_555 B DA  13 1_555 -0.214 -0.071 -0.204 3.743  -0.249  -7.810 2  T_DT5:DA113_P  T 5  ? P 113 ? 20 1 
1 A DT 6  1_555 B DA  12 1_555 -0.039 -0.243 0.005  10.579 -15.393 5.563  3  T_DT6:DA112_P  T 6  ? P 112 ? 20 1 
1 A DA 7  1_555 B DT  11 1_555 0.054  -0.111 0.145  -3.329 -7.178  5.801  4  T_DA7:DT111_P  T 7  ? P 111 ? 20 1 
1 A DT 8  1_555 B DA  10 1_555 -0.019 0.100  -0.117 11.540 -12.600 1.211  5  T_DT8:DA110_P  T 8  ? P 110 ? 20 1 
1 A DG 9  1_555 B DC  9  1_555 0.117  -0.308 0.082  11.128 -9.399  0.462  6  T_DG9:DC109_P  T 9  ? P 109 ? 19 1 
1 A DA 10 1_555 B DT  8  1_555 -0.114 0.005  -0.189 -0.533 -16.830 -6.553 7  T_DA10:DT108_P T 10 ? P 108 ? 20 1 
1 A DC 11 1_555 B DG  7  1_555 0.501  -0.108 0.252  -2.233 -10.164 3.751  8  T_DC11:DG107_P T 11 ? P 107 ? 19 1 
1 A DA 12 1_555 B DT  6  1_555 -0.183 -0.386 -0.206 -6.502 -10.039 -1.845 9  T_DA12:DT106_P T 12 ? P 106 ? 20 1 
1 A DG 13 1_555 B DC  5  1_555 -0.270 -0.207 -0.067 2.154  -10.154 -4.398 10 T_DG13:DC105_P T 13 ? P 105 ? 19 1 
1 A DC 14 1_555 B DG  4  1_555 0.325  -0.256 -0.055 3.344  -9.393  -4.530 11 T_DC14:DG104_P T 14 ? P 104 ? 19 1 
1 A DC 15 1_555 B DG  3  1_555 -0.517 -0.170 -0.041 -8.134 -7.450  -9.361 12 T_DC15:DG103_P T 15 ? P 103 ? 19 1 
1 A DG 16 1_555 B DC  2  1_555 0.345  -0.073 0.341  5.598  -0.605  -9.062 13 T_DG16:DC102_P T 16 ? P 102 ? 19 1 
1 A DC 17 1_555 B DG  1  1_555 0.598  -0.347 -0.314 15.956 5.766   -4.980 14 T_DC17:DG101_P T 17 ? P 101 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 4  1_555 B DDG 14 1_555 A DT 5  1_555 B DA 13 1_555 -1.398 -0.940 3.498 -1.097 5.610  27.697 -3.291 2.595  3.299 11.563 
2.261   28.269 1  TT_DC4DT5:DA113DDG114_PP  T 4  ? P 114 ? T 5  ? P 113 ? 
1 A DT 5  1_555 B DA  13 1_555 A DT 6  1_555 B DA 12 1_555 0.659  -1.011 3.278 -2.798 0.356  34.416 -1.757 -1.540 3.205 0.600  
4.719   34.528 2  TT_DT5DT6:DA112DA113_PP   T 5  ? P 113 ? T 6  ? P 112 ? 
1 A DT 6  1_555 B DA  12 1_555 A DA 7  1_555 B DT 11 1_555 0.700  -0.611 3.745 2.347  -1.781 33.969 -0.714 -0.763 3.810 -3.041 
-4.009  34.093 3  TT_DT6DA7:DT111DA112_PP   T 6  ? P 112 ? T 7  ? P 111 ? 
1 A DA 7  1_555 B DT  11 1_555 A DT 8  1_555 B DA 10 1_555 -0.945 -0.583 2.914 1.493  2.300  29.681 -1.554 2.110  2.812 4.477  
-2.906  29.805 4  TT_DA7DT8:DA110DT111_PP   T 7  ? P 111 ? T 8  ? P 110 ? 
1 A DT 8  1_555 B DA  10 1_555 A DG 9  1_555 B DC 9  1_555 -0.008 0.104  3.331 -0.104 11.806 32.548 -1.697 -0.002 3.176 20.251 
0.178   34.568 5  TT_DT8DG9:DC109DA110_PP   T 8  ? P 110 ? T 9  ? P 109 ? 
1 A DG 9  1_555 B DC  9  1_555 A DA 10 1_555 B DT 8  1_555 -1.231 -0.035 3.526 -3.537 7.718  36.599 -1.159 1.406  3.545 12.091 
5.540   37.537 6  TT_DG9DA10:DT108DC109_PP  T 9  ? P 109 ? T 10 ? P 108 ? 
1 A DA 10 1_555 B DT  8  1_555 A DC 11 1_555 B DG 7  1_555 0.989  -0.659 3.258 -2.372 7.391  35.788 -2.033 -1.890 2.998 11.856 
3.804   36.593 7  TT_DA10DC11:DG107DT108_PP T 10 ? P 108 ? T 11 ? P 107 ? 
1 A DC 11 1_555 B DG  7  1_555 A DA 12 1_555 B DT 6  1_555 -0.894 0.095  3.358 2.297  7.646  32.671 -1.113 1.931  3.228 13.345 
-4.009  33.607 8  TT_DC11DA12:DT106DG107_PP T 11 ? P 107 ? T 12 ? P 106 ? 
1 A DA 12 1_555 B DT  6  1_555 A DG 13 1_555 B DC 5  1_555 0.116  0.071  3.114 -3.205 5.918  30.301 -0.952 -0.804 3.045 11.148 
6.038   31.023 9  TT_DA12DG13:DC105DT106_PP T 12 ? P 106 ? T 13 ? P 105 ? 
1 A DG 13 1_555 B DC  5  1_555 A DC 14 1_555 B DG 4  1_555 -0.209 -0.786 3.154 -0.880 3.960  35.205 -1.845 0.220  3.054 6.521  
1.448   35.430 10 TT_DG13DC14:DG104DC105_PP T 13 ? P 105 ? T 14 ? P 104 ? 
1 A DC 14 1_555 B DG  4  1_555 A DC 15 1_555 B DG 3  1_555 0.304  -0.614 3.521 1.383  11.808 31.752 -3.050 -0.289 3.111 20.696 
-2.424  33.851 11 TT_DC14DC15:DG103DG104_PP T 14 ? P 104 ? T 15 ? P 103 ? 
1 A DC 15 1_555 B DG  3  1_555 A DG 16 1_555 B DC 2  1_555 0.697  0.501  3.199 -2.022 -1.861 42.270 0.878  -1.164 3.140 -2.578 
2.800   42.355 12 TT_DC15DG16:DC102DG103_PP T 15 ? P 103 ? T 16 ? P 102 ? 
1 A DG 16 1_555 B DC  2  1_555 A DC 17 1_555 B DG 1  1_555 1.208  -0.317 3.072 7.447  5.738  31.163 -1.544 -0.889 3.162 10.389 
-13.482 32.517 13 TT_DG16DC17:DG101DC102_PP T 16 ? P 102 ? T 17 ? P 101 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION'                     MG  
5 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
6 water                               HOH 
#