data_2P18
# 
_entry.id   2P18 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P18         
RCSB  RCSB041839   
WWPDB D_1000041839 
# 
_pdbx_database_status.entry_id                        2P18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Trincao, J.'   1 
'Barata, L.'    2 
'Najmudin, S.'  3 
'Bonifacio, C.' 4 
'Romao, M.J.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            47 
_citation.page_first                195 
_citation.page_last                 204 
_citation.year                      2008 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18052346 
_citation.pdbx_database_id_DOI      10.1021/bi700989m 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Silva, M.S.'    1 
primary 'Barata, L.'     2 
primary 'Ferreira, A.E.' 3 
primary 'Romao, S.'      4 
primary 'Tomas, A.M.'    5 
primary 'Freire, A.P.'   6 
primary 'Cordeiro, C.'   7 
# 
_cell.length_a           66.705 
_cell.length_b           88.989 
_cell.length_c           85.864 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2P18 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         2P18 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glyoxalase II' 34422.695 1   3.1.2.6 ? ? ? 
2 non-polymer syn 'ZINC ION'      65.409    2   ?       ? ? ? 
3 non-polymer syn SPERMIDINE      145.246   1   ?       ? ? ? 
4 non-polymer syn 'ACETIC ACID'   60.052    1   ?       ? ? ? 
5 water       nat water           18.015    111 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHSSGLVPRGSHMRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGNAD
VTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHV
LYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTF
PDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNACD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHSSGLVPRGSHMRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGNAD
VTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHV
LYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTF
PDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNACD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   SER n 
1 8   SER n 
1 9   GLY n 
1 10  LEU n 
1 11  VAL n 
1 12  PRO n 
1 13  ARG n 
1 14  GLY n 
1 15  SER n 
1 16  HIS n 
1 17  MET n 
1 18  ARG n 
1 19  ASN n 
1 20  TYR n 
1 21  CYS n 
1 22  THR n 
1 23  LYS n 
1 24  THR n 
1 25  PHE n 
1 26  GLY n 
1 27  SER n 
1 28  ALA n 
1 29  PHE n 
1 30  SER n 
1 31  VAL n 
1 32  THR n 
1 33  VAL n 
1 34  VAL n 
1 35  PRO n 
1 36  THR n 
1 37  LEU n 
1 38  LYS n 
1 39  ASP n 
1 40  ASN n 
1 41  PHE n 
1 42  SER n 
1 43  TYR n 
1 44  LEU n 
1 45  ILE n 
1 46  ASN n 
1 47  ASP n 
1 48  HIS n 
1 49  THR n 
1 50  THR n 
1 51  HIS n 
1 52  THR n 
1 53  LEU n 
1 54  ALA n 
1 55  ALA n 
1 56  VAL n 
1 57  ASP n 
1 58  VAL n 
1 59  ASN n 
1 60  ALA n 
1 61  ASP n 
1 62  TYR n 
1 63  LYS n 
1 64  PRO n 
1 65  ILE n 
1 66  LEU n 
1 67  THR n 
1 68  TYR n 
1 69  ILE n 
1 70  GLU n 
1 71  GLU n 
1 72  HIS n 
1 73  LEU n 
1 74  LYS n 
1 75  GLN n 
1 76  GLN n 
1 77  GLY n 
1 78  ASN n 
1 79  ALA n 
1 80  ASP n 
1 81  VAL n 
1 82  THR n 
1 83  TYR n 
1 84  THR n 
1 85  PHE n 
1 86  SER n 
1 87  THR n 
1 88  ILE n 
1 89  LEU n 
1 90  SER n 
1 91  THR n 
1 92  HIS n 
1 93  LYS n 
1 94  HIS n 
1 95  TRP n 
1 96  ASP n 
1 97  HIS n 
1 98  SER n 
1 99  GLY n 
1 100 GLY n 
1 101 ASN n 
1 102 ALA n 
1 103 LYS n 
1 104 LEU n 
1 105 LYS n 
1 106 ALA n 
1 107 GLU n 
1 108 LEU n 
1 109 GLU n 
1 110 ALA n 
1 111 MET n 
1 112 ASN n 
1 113 SER n 
1 114 THR n 
1 115 VAL n 
1 116 PRO n 
1 117 VAL n 
1 118 VAL n 
1 119 VAL n 
1 120 VAL n 
1 121 GLY n 
1 122 GLY n 
1 123 ALA n 
1 124 ASN n 
1 125 ASP n 
1 126 SER n 
1 127 ILE n 
1 128 PRO n 
1 129 ALA n 
1 130 VAL n 
1 131 THR n 
1 132 LYS n 
1 133 PRO n 
1 134 VAL n 
1 135 ARG n 
1 136 GLU n 
1 137 GLY n 
1 138 ASP n 
1 139 ARG n 
1 140 VAL n 
1 141 GLN n 
1 142 VAL n 
1 143 GLY n 
1 144 ASP n 
1 145 LEU n 
1 146 SER n 
1 147 VAL n 
1 148 GLU n 
1 149 VAL n 
1 150 ILE n 
1 151 ASP n 
1 152 ALA n 
1 153 PRO n 
1 154 CYS n 
1 155 HIS n 
1 156 THR n 
1 157 ARG n 
1 158 GLY n 
1 159 HIS n 
1 160 VAL n 
1 161 LEU n 
1 162 TYR n 
1 163 LYS n 
1 164 VAL n 
1 165 GLN n 
1 166 HIS n 
1 167 PRO n 
1 168 GLN n 
1 169 HIS n 
1 170 PRO n 
1 171 ASN n 
1 172 ASP n 
1 173 GLY n 
1 174 VAL n 
1 175 ALA n 
1 176 LEU n 
1 177 PHE n 
1 178 THR n 
1 179 GLY n 
1 180 ASP n 
1 181 THR n 
1 182 MET n 
1 183 PHE n 
1 184 ILE n 
1 185 ALA n 
1 186 GLY n 
1 187 ILE n 
1 188 GLY n 
1 189 ALA n 
1 190 PHE n 
1 191 PHE n 
1 192 GLU n 
1 193 GLY n 
1 194 ASP n 
1 195 GLU n 
1 196 LYS n 
1 197 ASP n 
1 198 MET n 
1 199 CYS n 
1 200 ARG n 
1 201 ALA n 
1 202 MET n 
1 203 GLU n 
1 204 LYS n 
1 205 VAL n 
1 206 TYR n 
1 207 HIS n 
1 208 ILE n 
1 209 HIS n 
1 210 LYS n 
1 211 GLY n 
1 212 ASN n 
1 213 ASP n 
1 214 TYR n 
1 215 ALA n 
1 216 LEU n 
1 217 ASP n 
1 218 LYS n 
1 219 VAL n 
1 220 THR n 
1 221 PHE n 
1 222 ILE n 
1 223 PHE n 
1 224 PRO n 
1 225 GLY n 
1 226 HIS n 
1 227 GLU n 
1 228 TYR n 
1 229 THR n 
1 230 SER n 
1 231 GLY n 
1 232 PHE n 
1 233 MET n 
1 234 THR n 
1 235 PHE n 
1 236 SER n 
1 237 GLU n 
1 238 LYS n 
1 239 THR n 
1 240 PHE n 
1 241 PRO n 
1 242 ASP n 
1 243 ARG n 
1 244 ALA n 
1 245 SER n 
1 246 ASP n 
1 247 ASP n 
1 248 LEU n 
1 249 ALA n 
1 250 PHE n 
1 251 ILE n 
1 252 GLN n 
1 253 ALA n 
1 254 GLN n 
1 255 ARG n 
1 256 ALA n 
1 257 LYS n 
1 258 TYR n 
1 259 ALA n 
1 260 ALA n 
1 261 ALA n 
1 262 VAL n 
1 263 LYS n 
1 264 THR n 
1 265 GLY n 
1 266 ASP n 
1 267 PRO n 
1 268 SER n 
1 269 VAL n 
1 270 PRO n 
1 271 SER n 
1 272 SER n 
1 273 LEU n 
1 274 ALA n 
1 275 GLU n 
1 276 GLU n 
1 277 LYS n 
1 278 ARG n 
1 279 GLN n 
1 280 ASN n 
1 281 LEU n 
1 282 PHE n 
1 283 LEU n 
1 284 ARG n 
1 285 VAL n 
1 286 ALA n 
1 287 ASP n 
1 288 PRO n 
1 289 ALA n 
1 290 PHE n 
1 291 VAL n 
1 292 ALA n 
1 293 LYS n 
1 294 MET n 
1 295 ASN n 
1 296 GLN n 
1 297 GLY n 
1 298 ASN n 
1 299 ALA n 
1 300 HIS n 
1 301 ALA n 
1 302 LEU n 
1 303 MET n 
1 304 MET n 
1 305 TYR n 
1 306 LEU n 
1 307 TYR n 
1 308 ASN n 
1 309 ALA n 
1 310 CYS n 
1 311 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Leishmania 
_entity_src_gen.pdbx_gene_src_gene                 GLO2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Leishmania infantum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5671 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Codon Plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q2PYN0_LEIIN 
_struct_ref.pdbx_db_accession          Q2PYN0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLKQQGNADVTYTFSTILSTHKHWD
HSGGNAKLKAELEAMNSTVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVAL
FTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRA
KYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNACD
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2P18 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 17 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 311 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q2PYN0 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  295 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       295 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P18 HIS A 1  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -15 1  
1 2P18 HIS A 2  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -14 2  
1 2P18 HIS A 3  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -13 3  
1 2P18 HIS A 4  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -12 4  
1 2P18 HIS A 5  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -11 5  
1 2P18 HIS A 6  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -10 6  
1 2P18 SER A 7  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -9  7  
1 2P18 SER A 8  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -8  8  
1 2P18 GLY A 9  ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -7  9  
1 2P18 LEU A 10 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -6  10 
1 2P18 VAL A 11 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -5  11 
1 2P18 PRO A 12 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -4  12 
1 2P18 ARG A 13 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -3  13 
1 2P18 GLY A 14 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -2  14 
1 2P18 SER A 15 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' -1  15 
1 2P18 HIS A 16 ? UNP Q2PYN0 ? ? 'EXPRESSION TAG' 0   16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'   ?                                              'C2 H4 O2'       60.052  
ALA 'L-peptide linking' y ALANINE         ?                                              'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                                              'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                                              'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                              'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                                              'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                                              'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                              'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                                              'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                                              'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                                              'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                                              'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                                              'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                                              'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                                              'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                                              'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                                              'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                                              'C3 H7 N O3'     105.093 
SPD non-polymer         . SPERMIDINE      'N-(2-AMINO-PROPYL)-1,4-DIAMINOBUTANE; PA(34)' 'C7 H19 N3'      145.246 
THR 'L-peptide linking' y THREONINE       ?                                              'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                                              'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                                              'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                                              'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                                              'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P18 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.85 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   33.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'30% PEG 4K, 0.2M MgCl2, 0.1M Ammonium Acetate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 288K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-02-17 
_diffrn_detector.details                Undulator 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111) CRYSTAL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9538 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_wavelength             0.9538 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
# 
_reflns.entry_id                     2P18 
_reflns.d_resolution_high            1.800 
_reflns.d_resolution_low             53.376 
_reflns.number_obs                   23962 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_netI_over_sigmaI        6.500 
_reflns.pdbx_Rsym_value              0.069 
_reflns.pdbx_redundancy              5.700 
_reflns.percent_possible_obs         99.800 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   23962 
_reflns.B_iso_Wilson_estimate        22.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.90 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    20168 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.468 
_reflns_shell.meanI_over_sigI_obs    1.6 
_reflns_shell.pdbx_Rsym_value        0.468 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        5.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3459 
_reflns_shell.percent_possible_all   100.00 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P18 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             53.380 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.650 
_refine.ls_number_reflns_obs                     23955 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.172 
_refine.ls_R_factor_R_work                       0.171 
_refine.ls_R_factor_R_free                       0.196 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1224 
_refine.B_iso_mean                               23.921 
_refine.aniso_B[1][1]                            -0.570 
_refine.aniso_B[2][2]                            0.130 
_refine.aniso_B[3][3]                            0.440 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.pdbx_overall_ESU_R                       0.130 
_refine.pdbx_overall_ESU_R_Free                  0.115 
_refine.overall_SU_ML                            0.076 
_refine.overall_SU_B                             4.535 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     23955 
_refine.ls_R_factor_all                          0.246 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1QH3' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2176 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               2303 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        53.380 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2261 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3070 1.519  1.939  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   284  11.759 5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   103  33.453 23.883 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   344  12.019 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   10   19.042 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           340  0.107  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1744 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1117 0.209  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1532 0.310  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    121  0.108  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      2    0.048  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   35   0.235  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 9    0.205  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1454 0.987  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2277 1.009  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              903  2.123  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             792  2.954  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             1653 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.R_factor_R_free                  0.286 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1748 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P18 
_struct.title                     'Crystal structure of the Leishmania infantum glyoxalase II' 
_struct.pdbx_descriptor           'Glyoxalase II (E.C.3.1.2.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P18 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'metalloprotein, beta sandwich, alpha-helical domain, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 62  ? HIS A 72  ? TYR A 46  HIS A 56  1 ? 11 
HELX_P HELX_P2  2  HIS A 94  ? GLY A 99  ? HIS A 78  GLY A 83  1 ? 6  
HELX_P HELX_P3  3  GLY A 100 ? ALA A 110 ? GLY A 84  ALA A 94  1 ? 11 
HELX_P HELX_P4  4  ASN A 124 ? SER A 126 ? ASN A 108 SER A 110 5 ? 3  
HELX_P HELX_P5  5  HIS A 169 ? ASP A 172 ? HIS A 153 ASP A 156 5 ? 4  
HELX_P HELX_P6  6  ASP A 194 ? HIS A 207 ? ASP A 178 HIS A 191 1 ? 14 
HELX_P HELX_P7  7  HIS A 209 ? ASP A 213 ? HIS A 193 ASP A 197 5 ? 5  
HELX_P HELX_P8  8  TYR A 214 ? LYS A 218 ? TYR A 198 LYS A 202 5 ? 5  
HELX_P HELX_P9  9  TYR A 228 ? PHE A 240 ? TYR A 212 PHE A 224 1 ? 13 
HELX_P HELX_P10 10 SER A 245 ? THR A 264 ? SER A 229 THR A 248 1 ? 20 
HELX_P HELX_P11 11 LEU A 273 ? ASN A 280 ? LEU A 257 ASN A 264 1 ? 8  
HELX_P HELX_P12 12 PHE A 282 ? ALA A 286 ? PHE A 266 ALA A 270 5 ? 5  
HELX_P HELX_P13 13 ASP A 287 ? ASN A 295 ? ASP A 271 ASN A 279 1 ? 9  
HELX_P HELX_P14 14 ASN A 298 ? ALA A 309 ? ASN A 282 ALA A 293 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 92  NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 76  A ZN  302  1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc2  metalc ? ? A HIS 94  ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 78  A ZN  302  1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc3  metalc ? ? A ASP 96  OD2 ? ? ? 1_555 B ZN  . ZN ? ? A ASP 80  A ZN  301  1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc4  metalc ? ? A HIS 97  NE2 ? ? ? 1_555 B ZN  . ZN ? ? A HIS 81  A ZN  301  1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc5  metalc ? ? A HIS 155 NE2 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 139 A ZN  302  1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc6  metalc ? ? A ASP 180 OD2 ? ? ? 1_555 B ZN  . ZN ? ? A ASP 164 A ZN  301  1_555 ? ? ? ? ? ? ? 2.105 ? 
metalc7  metalc ? ? A HIS 226 NE2 ? ? ? 1_555 B ZN  . ZN ? ? A HIS 210 A ZN  301  1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc8  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 E ACY . O  ? ? A ZN  301 A ACY 1022 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc9  metalc ? ? B ZN  .   ZN  ? ? ? 1_555 F HOH . O  ? ? A ZN  301 A HOH 1023 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc10 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 F HOH . O  ? ? A ZN  302 A HOH 1023 1_555 ? ? ? ? ? ? ? 1.952 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 115 A . ? VAL 99  A PRO 116 A ? PRO 100 A 1 7.50  
2 VAL 269 A . ? VAL 253 A PRO 270 A ? PRO 254 A 1 1.02  
3 ASN 308 A . ? ASN 292 A ALA 309 A ? ALA 293 A 1 16.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 21  ? PHE A 25  ? CYS A 5   PHE A 9   
A 2 PHE A 29  ? THR A 36  ? PHE A 13  THR A 20  
A 3 ASN A 40  ? ASP A 47  ? ASN A 24  ASP A 31  
A 4 THR A 52  ? VAL A 56  ? THR A 36  VAL A 40  
A 5 THR A 84  ? SER A 90  ? THR A 68  SER A 74  
A 6 VAL A 118 ? GLY A 122 ? VAL A 102 GLY A 106 
A 7 LYS A 132 ? VAL A 134 ? LYS A 116 VAL A 118 
B 1 ARG A 139 ? VAL A 142 ? ARG A 123 VAL A 126 
B 2 LEU A 145 ? ASP A 151 ? LEU A 129 ASP A 135 
B 3 VAL A 160 ? GLN A 165 ? VAL A 144 GLN A 149 
B 4 VAL A 174 ? GLY A 179 ? VAL A 158 GLY A 163 
B 5 THR A 220 ? PRO A 224 ? THR A 204 PRO A 208 
B 6 SER A 271 ? SER A 272 ? SER A 255 SER A 256 
C 1 MET A 182 ? PHE A 183 ? MET A 166 PHE A 167 
C 2 GLY A 186 ? ILE A 187 ? GLY A 170 ILE A 171 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 21  ? N CYS A 5   O VAL A 33  ? O VAL A 17  
A 2 3 N THR A 32  ? N THR A 16  O LEU A 44  ? O LEU A 28  
A 3 4 N ILE A 45  ? N ILE A 29  O ALA A 54  ? O ALA A 38  
A 4 5 N LEU A 53  ? N LEU A 37  O THR A 84  ? O THR A 68  
A 5 6 N ILE A 88  ? N ILE A 72  O VAL A 120 ? O VAL A 104 
A 6 7 O VAL A 119 ? O VAL A 103 N LYS A 132 ? N LYS A 116 
B 1 2 N VAL A 140 ? N VAL A 124 O VAL A 147 ? O VAL A 131 
B 2 3 N GLU A 148 ? N GLU A 132 O LYS A 163 ? O LYS A 147 
B 3 4 N VAL A 164 ? N VAL A 148 O ALA A 175 ? O ALA A 159 
B 4 5 N LEU A 176 ? N LEU A 160 O PHE A 221 ? O PHE A 205 
B 5 6 N ILE A 222 ? N ILE A 206 O SER A 271 ? O SER A 255 
C 1 2 N PHE A 183 ? N PHE A 167 O GLY A 186 ? O GLY A 170 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ZN A 301'   
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE ZN A 302'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SPD A 304'  
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ACY A 1022' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 96  ? ASP A 80   . ? 1_555 ? 
2  AC1 7  HIS A 97  ? HIS A 81   . ? 1_555 ? 
3  AC1 7  ASP A 180 ? ASP A 164  . ? 1_555 ? 
4  AC1 7  HIS A 226 ? HIS A 210  . ? 1_555 ? 
5  AC1 7  ZN  C .   ? ZN  A 302  . ? 1_555 ? 
6  AC1 7  ACY E .   ? ACY A 1022 . ? 1_555 ? 
7  AC1 7  HOH F .   ? HOH A 1023 . ? 1_555 ? 
8  AC2 7  HIS A 92  ? HIS A 76   . ? 1_555 ? 
9  AC2 7  HIS A 94  ? HIS A 78   . ? 1_555 ? 
10 AC2 7  HIS A 155 ? HIS A 139  . ? 1_555 ? 
11 AC2 7  ASP A 180 ? ASP A 164  . ? 1_555 ? 
12 AC2 7  ZN  B .   ? ZN  A 301  . ? 1_555 ? 
13 AC2 7  ACY E .   ? ACY A 1022 . ? 1_555 ? 
14 AC2 7  HOH F .   ? HOH A 1023 . ? 1_555 ? 
15 AC3 5  ILE A 187 ? ILE A 171  . ? 1_555 ? 
16 AC3 5  ALA A 189 ? ALA A 173  . ? 1_555 ? 
17 AC3 5  TYR A 228 ? TYR A 212  . ? 1_555 ? 
18 AC3 5  PHE A 232 ? PHE A 216  . ? 1_555 ? 
19 AC3 5  LEU A 306 ? LEU A 290  . ? 1_555 ? 
20 AC4 10 HIS A 94  ? HIS A 78   . ? 1_555 ? 
21 AC4 10 ASP A 96  ? ASP A 80   . ? 1_555 ? 
22 AC4 10 HIS A 155 ? HIS A 139  . ? 1_555 ? 
23 AC4 10 ASP A 180 ? ASP A 164  . ? 1_555 ? 
24 AC4 10 PHE A 191 ? PHE A 175  . ? 1_555 ? 
25 AC4 10 HIS A 226 ? HIS A 210  . ? 1_555 ? 
26 AC4 10 ZN  B .   ? ZN  A 301  . ? 1_555 ? 
27 AC4 10 ZN  C .   ? ZN  A 302  . ? 1_555 ? 
28 AC4 10 HOH F .   ? HOH A 1023 . ? 1_555 ? 
29 AC4 10 HOH F .   ? HOH A 1060 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P18 
_atom_sites.fract_transf_matrix[1][1]   0.014991 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011237 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011646 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 17  ? 15.111 21.307 72.426 1.00 25.29 ? 1    MET A N   1 
ATOM   2    C  CA  . MET A 1 17  ? 16.497 20.745 72.503 1.00 24.74 ? 1    MET A CA  1 
ATOM   3    C  C   . MET A 1 17  ? 17.410 21.250 71.362 1.00 23.94 ? 1    MET A C   1 
ATOM   4    O  O   . MET A 1 17  ? 18.617 20.980 71.364 1.00 24.47 ? 1    MET A O   1 
ATOM   5    C  CB  . MET A 1 17  ? 16.440 19.210 72.519 1.00 25.25 ? 1    MET A CB  1 
ATOM   6    N  N   . ARG A 1 18  ? 16.850 22.001 70.421 1.00 22.89 ? 2    ARG A N   1 
ATOM   7    C  CA  . ARG A 1 18  ? 17.620 22.532 69.297 1.00 21.96 ? 2    ARG A CA  1 
ATOM   8    C  C   . ARG A 1 18  ? 18.297 23.858 69.651 1.00 21.68 ? 2    ARG A C   1 
ATOM   9    O  O   . ARG A 1 18  ? 17.644 24.815 70.053 1.00 22.25 ? 2    ARG A O   1 
ATOM   10   C  CB  . ARG A 1 18  ? 16.734 22.694 68.046 1.00 21.41 ? 2    ARG A CB  1 
ATOM   11   C  CG  . ARG A 1 18  ? 16.013 21.426 67.638 1.00 20.62 ? 2    ARG A CG  1 
ATOM   12   C  CD  . ARG A 1 18  ? 15.094 21.685 66.462 1.00 21.95 ? 2    ARG A CD  1 
ATOM   13   N  NE  . ARG A 1 18  ? 15.888 21.969 65.266 1.00 22.29 ? 2    ARG A NE  1 
ATOM   14   C  CZ  . ARG A 1 18  ? 15.489 22.715 64.235 1.00 23.00 ? 2    ARG A CZ  1 
ATOM   15   N  NH1 . ARG A 1 18  ? 14.286 23.284 64.238 1.00 23.70 ? 2    ARG A NH1 1 
ATOM   16   N  NH2 . ARG A 1 18  ? 16.315 22.918 63.218 1.00 22.62 ? 2    ARG A NH2 1 
ATOM   17   N  N   . ASN A 1 19  ? 19.613 23.902 69.494 1.00 21.64 ? 3    ASN A N   1 
ATOM   18   C  CA  . ASN A 1 19  ? 20.397 25.091 69.841 1.00 22.49 ? 3    ASN A CA  1 
ATOM   19   C  C   . ASN A 1 19  ? 20.599 26.052 68.672 1.00 23.12 ? 3    ASN A C   1 
ATOM   20   O  O   . ASN A 1 19  ? 20.565 25.656 67.505 1.00 22.84 ? 3    ASN A O   1 
ATOM   21   C  CB  . ASN A 1 19  ? 21.784 24.665 70.354 1.00 22.02 ? 3    ASN A CB  1 
ATOM   22   C  CG  . ASN A 1 19  ? 21.709 23.788 71.582 1.00 22.38 ? 3    ASN A CG  1 
ATOM   23   O  OD1 . ASN A 1 19  ? 20.792 23.913 72.373 1.00 20.63 ? 3    ASN A OD1 1 
ATOM   24   N  ND2 . ASN A 1 19  ? 22.689 22.913 71.756 1.00 21.43 ? 3    ASN A ND2 1 
ATOM   25   N  N   . TYR A 1 20  ? 20.862 27.316 69.008 1.00 23.79 ? 4    TYR A N   1 
ATOM   26   C  CA  . TYR A 1 20  ? 21.390 28.271 68.023 1.00 24.36 ? 4    TYR A CA  1 
ATOM   27   C  C   . TYR A 1 20  ? 22.897 28.021 67.855 1.00 24.06 ? 4    TYR A C   1 
ATOM   28   O  O   . TYR A 1 20  ? 23.553 27.406 68.731 1.00 22.38 ? 4    TYR A O   1 
ATOM   29   C  CB  . TYR A 1 20  ? 21.166 29.727 68.491 1.00 25.53 ? 4    TYR A CB  1 
ATOM   30   C  CG  . TYR A 1 20  ? 21.887 30.064 69.764 1.00 29.04 ? 4    TYR A CG  1 
ATOM   31   C  CD1 . TYR A 1 20  ? 21.268 29.905 71.017 1.00 30.41 ? 4    TYR A CD1 1 
ATOM   32   C  CD2 . TYR A 1 20  ? 23.216 30.533 69.750 1.00 30.68 ? 4    TYR A CD2 1 
ATOM   33   C  CE1 . TYR A 1 20  ? 21.931 30.189 72.198 1.00 33.26 ? 4    TYR A CE1 1 
ATOM   34   C  CE2 . TYR A 1 20  ? 23.878 30.817 70.920 1.00 31.71 ? 4    TYR A CE2 1 
ATOM   35   C  CZ  . TYR A 1 20  ? 23.248 30.657 72.145 1.00 32.49 ? 4    TYR A CZ  1 
ATOM   36   O  OH  . TYR A 1 20  ? 23.883 30.936 73.336 1.00 36.08 ? 4    TYR A OH  1 
ATOM   37   N  N   . CYS A 1 21  ? 23.441 28.514 66.741 1.00 23.08 ? 5    CYS A N   1 
ATOM   38   C  CA  . CYS A 1 21  ? 24.891 28.722 66.628 1.00 23.63 ? 5    CYS A CA  1 
ATOM   39   C  C   . CYS A 1 21  ? 25.203 29.880 65.679 1.00 23.64 ? 5    CYS A C   1 
ATOM   40   O  O   . CYS A 1 21  ? 24.372 30.240 64.841 0.50 20.81 ? 5    CYS A O   1 
ATOM   41   C  CB  . CYS A 1 21  ? 25.602 27.445 66.184 1.00 24.03 ? 5    CYS A CB  1 
ATOM   42   S  SG  . CYS A 1 21  ? 25.401 27.068 64.427 1.00 29.86 ? 5    CYS A SG  1 
ATOM   43   N  N   . THR A 1 22  ? 26.401 30.450 65.825 1.00 23.06 ? 6    THR A N   1 
ATOM   44   C  CA  . THR A 1 22  ? 26.809 31.609 65.020 1.00 24.40 ? 6    THR A CA  1 
ATOM   45   C  C   . THR A 1 22  ? 28.118 31.367 64.267 1.00 24.87 ? 6    THR A C   1 
ATOM   46   O  O   . THR A 1 22  ? 29.138 31.020 64.868 1.00 24.83 ? 6    THR A O   1 
ATOM   47   C  CB  . THR A 1 22  ? 26.900 32.909 65.873 1.00 24.31 ? 6    THR A CB  1 
ATOM   48   O  OG1 . THR A 1 22  ? 25.623 33.185 66.462 1.00 24.45 ? 6    THR A OG1 1 
ATOM   49   C  CG2 . THR A 1 22  ? 27.284 34.101 65.004 1.00 25.61 ? 6    THR A CG2 1 
ATOM   50   N  N   . LYS A 1 23  ? 28.063 31.525 62.951 1.00 24.68 ? 7    LYS A N   1 
ATOM   51   C  CA  . LYS A 1 23  ? 29.257 31.504 62.094 1.00 25.28 ? 7    LYS A CA  1 
ATOM   52   C  C   . LYS A 1 23  ? 29.665 32.945 61.790 1.00 24.64 ? 7    LYS A C   1 
ATOM   53   O  O   . LYS A 1 23  ? 28.842 33.748 61.332 1.00 24.59 ? 7    LYS A O   1 
ATOM   54   C  CB  . LYS A 1 23  ? 28.959 30.739 60.773 1.00 25.55 ? 7    LYS A CB  1 
ATOM   55   C  CG  . LYS A 1 23  ? 30.137 30.731 59.756 1.00 27.91 ? 7    LYS A CG  1 
ATOM   56   C  CD  . LYS A 1 23  ? 31.220 29.721 60.147 1.00 31.75 ? 7    LYS A CD  1 
ATOM   57   C  CE  . LYS A 1 23  ? 32.568 30.127 59.595 1.00 35.56 ? 7    LYS A CE  1 
ATOM   58   N  NZ  . LYS A 1 23  ? 33.691 29.235 60.095 1.00 37.11 ? 7    LYS A NZ  1 
ATOM   59   N  N   . THR A 1 24  ? 30.930 33.280 62.027 1.00 24.83 ? 8    THR A N   1 
ATOM   60   C  CA  . THR A 1 24  ? 31.395 34.661 61.825 1.00 24.98 ? 8    THR A CA  1 
ATOM   61   C  C   . THR A 1 24  ? 32.383 34.763 60.658 1.00 25.02 ? 8    THR A C   1 
ATOM   62   O  O   . THR A 1 24  ? 33.229 33.891 60.465 1.00 25.10 ? 8    THR A O   1 
ATOM   63   C  CB  . THR A 1 24  ? 32.008 35.229 63.123 1.00 26.23 ? 8    THR A CB  1 
ATOM   64   O  OG1 . THR A 1 24  ? 31.046 35.127 64.179 1.00 27.53 ? 8    THR A OG1 1 
ATOM   65   C  CG2 . THR A 1 24  ? 32.412 36.697 62.957 1.00 26.58 ? 8    THR A CG2 1 
ATOM   66   N  N   . PHE A 1 25  ? 32.260 35.831 59.876 1.00 23.94 ? 9    PHE A N   1 
ATOM   67   C  CA  . PHE A 1 25  ? 33.125 36.045 58.724 1.00 22.98 ? 9    PHE A CA  1 
ATOM   68   C  C   . PHE A 1 25  ? 34.069 37.216 58.987 1.00 22.52 ? 9    PHE A C   1 
ATOM   69   O  O   . PHE A 1 25  ? 33.664 38.364 58.885 1.00 21.56 ? 9    PHE A O   1 
ATOM   70   C  CB  . PHE A 1 25  ? 32.249 36.321 57.496 1.00 23.21 ? 9    PHE A CB  1 
ATOM   71   C  CG  . PHE A 1 25  ? 31.329 35.172 57.162 1.00 23.65 ? 9    PHE A CG  1 
ATOM   72   C  CD1 . PHE A 1 25  ? 30.149 34.967 57.875 1.00 24.19 ? 9    PHE A CD1 1 
ATOM   73   C  CD2 . PHE A 1 25  ? 31.665 34.285 56.155 1.00 25.00 ? 9    PHE A CD2 1 
ATOM   74   C  CE1 . PHE A 1 25  ? 29.299 33.882 57.582 1.00 26.38 ? 9    PHE A CE1 1 
ATOM   75   C  CE2 . PHE A 1 25  ? 30.824 33.199 55.839 1.00 25.35 ? 9    PHE A CE2 1 
ATOM   76   C  CZ  . PHE A 1 25  ? 29.642 33.005 56.553 1.00 26.21 ? 9    PHE A CZ  1 
ATOM   77   N  N   . GLY A 1 26  ? 35.321 36.921 59.326 1.00 22.36 ? 10   GLY A N   1 
ATOM   78   C  CA  . GLY A 1 26  ? 36.270 37.946 59.784 1.00 23.42 ? 10   GLY A CA  1 
ATOM   79   C  C   . GLY A 1 26  ? 35.650 38.885 60.815 1.00 23.64 ? 10   GLY A C   1 
ATOM   80   O  O   . GLY A 1 26  ? 34.995 38.433 61.749 1.00 23.48 ? 10   GLY A O   1 
ATOM   81   N  N   . SER A 1 27  ? 35.840 40.189 60.630 1.00 23.51 ? 11   SER A N   1 
ATOM   82   C  CA  . SER A 1 27  ? 35.215 41.211 61.485 1.00 23.91 ? 11   SER A CA  1 
ATOM   83   C  C   . SER A 1 27  ? 34.016 41.848 60.771 1.00 23.82 ? 11   SER A C   1 
ATOM   84   O  O   . SER A 1 27  ? 33.460 42.854 61.231 1.00 24.49 ? 11   SER A O   1 
ATOM   85   C  CB  . SER A 1 27  ? 36.236 42.300 61.786 1.00 23.71 ? 11   SER A CB  1 
ATOM   86   O  OG  . SER A 1 27  ? 37.398 41.727 62.368 1.00 27.05 ? 11   SER A OG  1 
ATOM   87   N  N   . ALA A 1 28  ? 33.634 41.269 59.637 1.00 23.01 ? 12   ALA A N   1 
ATOM   88   C  CA  . ALA A 1 28  ? 32.710 41.917 58.700 1.00 22.67 ? 12   ALA A CA  1 
ATOM   89   C  C   . ALA A 1 28  ? 31.252 41.666 59.052 1.00 22.50 ? 12   ALA A C   1 
ATOM   90   O  O   . ALA A 1 28  ? 30.456 42.604 59.160 1.00 22.30 ? 12   ALA A O   1 
ATOM   91   C  CB  . ALA A 1 28  ? 32.999 41.431 57.278 1.00 23.05 ? 12   ALA A CB  1 
ATOM   92   N  N   . PHE A 1 29  ? 30.895 40.394 59.216 1.00 22.49 ? 13   PHE A N   1 
ATOM   93   C  CA  . PHE A 1 29  ? 29.510 40.029 59.527 1.00 22.35 ? 13   PHE A CA  1 
ATOM   94   C  C   . PHE A 1 29  ? 29.436 38.626 60.105 1.00 23.14 ? 13   PHE A C   1 
ATOM   95   O  O   . PHE A 1 29  ? 30.416 37.889 60.084 1.00 22.42 ? 13   PHE A O   1 
ATOM   96   C  CB  . PHE A 1 29  ? 28.579 40.152 58.289 1.00 22.76 ? 13   PHE A CB  1 
ATOM   97   C  CG  . PHE A 1 29  ? 28.809 39.102 57.217 1.00 22.55 ? 13   PHE A CG  1 
ATOM   98   C  CD1 . PHE A 1 29  ? 27.883 38.055 57.030 1.00 24.20 ? 13   PHE A CD1 1 
ATOM   99   C  CD2 . PHE A 1 29  ? 29.932 39.173 56.372 1.00 23.08 ? 13   PHE A CD2 1 
ATOM   100  C  CE1 . PHE A 1 29  ? 28.082 37.096 56.043 1.00 23.12 ? 13   PHE A CE1 1 
ATOM   101  C  CE2 . PHE A 1 29  ? 30.121 38.209 55.369 1.00 22.44 ? 13   PHE A CE2 1 
ATOM   102  C  CZ  . PHE A 1 29  ? 29.201 37.177 55.216 1.00 23.74 ? 13   PHE A CZ  1 
ATOM   103  N  N   . SER A 1 30  ? 28.256 38.260 60.606 1.00 23.27 ? 14   SER A N   1 
ATOM   104  C  CA  . SER A 1 30  ? 28.052 36.913 61.102 1.00 23.87 ? 14   SER A CA  1 
ATOM   105  C  C   . SER A 1 30  ? 26.665 36.419 60.696 1.00 22.95 ? 14   SER A C   1 
ATOM   106  O  O   . SER A 1 30  ? 25.777 37.211 60.364 1.00 22.23 ? 14   SER A O   1 
ATOM   107  C  CB  . SER A 1 30  ? 28.235 36.879 62.614 1.00 24.15 ? 14   SER A CB  1 
ATOM   108  O  OG  . SER A 1 30  ? 27.207 37.635 63.212 1.00 27.73 ? 14   SER A OG  1 
ATOM   109  N  N   . VAL A 1 31  ? 26.492 35.108 60.717 1.00 22.19 ? 15   VAL A N   1 
ATOM   110  C  CA  . VAL A 1 31  ? 25.177 34.512 60.427 1.00 22.63 ? 15   VAL A CA  1 
ATOM   111  C  C   . VAL A 1 31  ? 24.812 33.588 61.581 1.00 23.18 ? 15   VAL A C   1 
ATOM   112  O  O   . VAL A 1 31  ? 25.567 32.646 61.910 1.00 23.41 ? 15   VAL A O   1 
ATOM   113  C  CB  . VAL A 1 31  ? 25.197 33.706 59.120 1.00 21.84 ? 15   VAL A CB  1 
ATOM   114  C  CG1 . VAL A 1 31  ? 23.862 32.950 58.921 1.00 21.84 ? 15   VAL A CG1 1 
ATOM   115  C  CG2 . VAL A 1 31  ? 25.496 34.617 57.936 1.00 24.22 ? 15   VAL A CG2 1 
ATOM   116  N  N   . THR A 1 32  ? 23.663 33.860 62.196 1.00 22.87 ? 16   THR A N   1 
ATOM   117  C  CA  . THR A 1 32  ? 23.184 33.048 63.310 1.00 22.73 ? 16   THR A CA  1 
ATOM   118  C  C   . THR A 1 32  ? 22.183 32.016 62.791 1.00 22.45 ? 16   THR A C   1 
ATOM   119  O  O   . THR A 1 32  ? 21.196 32.367 62.134 1.00 22.81 ? 16   THR A O   1 
ATOM   120  C  CB  . THR A 1 32  ? 22.563 33.921 64.436 1.00 22.55 ? 16   THR A CB  1 
ATOM   121  O  OG1 . THR A 1 32  ? 23.564 34.792 64.981 1.00 22.38 ? 16   THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 32  ? 21.966 33.047 65.551 1.00 22.88 ? 16   THR A CG2 1 
ATOM   123  N  N   . VAL A 1 33  ? 22.464 30.750 63.082 1.00 21.36 ? 17   VAL A N   1 
ATOM   124  C  CA  . VAL A 1 33  ? 21.575 29.654 62.722 1.00 21.45 ? 17   VAL A CA  1 
ATOM   125  C  C   . VAL A 1 33  ? 20.484 29.507 63.791 1.00 21.23 ? 17   VAL A C   1 
ATOM   126  O  O   . VAL A 1 33  ? 20.771 29.132 64.927 1.00 21.66 ? 17   VAL A O   1 
ATOM   127  C  CB  . VAL A 1 33  ? 22.339 28.329 62.570 1.00 20.92 ? 17   VAL A CB  1 
ATOM   128  C  CG1 . VAL A 1 33  ? 21.371 27.222 62.186 1.00 22.76 ? 17   VAL A CG1 1 
ATOM   129  C  CG2 . VAL A 1 33  ? 23.474 28.446 61.514 1.00 20.60 ? 17   VAL A CG2 1 
ATOM   130  N  N   . VAL A 1 34  ? 19.239 29.803 63.425 1.00 21.42 ? 18   VAL A N   1 
ATOM   131  C  CA  . VAL A 1 34  ? 18.113 29.804 64.375 1.00 21.43 ? 18   VAL A CA  1 
ATOM   132  C  C   . VAL A 1 34  ? 17.176 28.605 64.075 1.00 21.72 ? 18   VAL A C   1 
ATOM   133  O  O   . VAL A 1 34  ? 16.481 28.614 63.083 1.00 22.64 ? 18   VAL A O   1 
ATOM   134  C  CB  . VAL A 1 34  ? 17.317 31.157 64.320 1.00 21.24 ? 18   VAL A CB  1 
ATOM   135  C  CG1 . VAL A 1 34  ? 16.207 31.184 65.355 1.00 20.42 ? 18   VAL A CG1 1 
ATOM   136  C  CG2 . VAL A 1 34  ? 18.251 32.367 64.488 1.00 22.35 ? 18   VAL A CG2 1 
ATOM   137  N  N   . PRO A 1 35  ? 17.184 27.560 64.917 1.00 22.22 ? 19   PRO A N   1 
ATOM   138  C  CA  . PRO A 1 35  ? 16.279 26.429 64.658 1.00 22.01 ? 19   PRO A CA  1 
ATOM   139  C  C   . PRO A 1 35  ? 14.823 26.851 64.840 1.00 22.68 ? 19   PRO A C   1 
ATOM   140  O  O   . PRO A 1 35  ? 14.468 27.407 65.887 1.00 22.42 ? 19   PRO A O   1 
ATOM   141  C  CB  . PRO A 1 35  ? 16.671 25.399 65.733 1.00 21.88 ? 19   PRO A CB  1 
ATOM   142  C  CG  . PRO A 1 35  ? 17.276 26.230 66.852 1.00 22.22 ? 19   PRO A CG  1 
ATOM   143  C  CD  . PRO A 1 35  ? 17.987 27.366 66.142 1.00 22.36 ? 19   PRO A CD  1 
ATOM   144  N  N   . THR A 1 36  ? 13.977 26.569 63.852 1.00 22.53 ? 20   THR A N   1 
ATOM   145  C  CA  . THR A 1 36  ? 12.562 26.941 63.929 1.00 23.01 ? 20   THR A CA  1 
ATOM   146  C  C   . THR A 1 36  ? 11.698 25.749 63.534 1.00 22.95 ? 20   THR A C   1 
ATOM   147  O  O   . THR A 1 36  ? 12.180 24.826 62.869 1.00 23.32 ? 20   THR A O   1 
ATOM   148  C  CB  . THR A 1 36  ? 12.228 28.165 63.043 1.00 23.58 ? 20   THR A CB  1 
ATOM   149  O  OG1 . THR A 1 36  ? 12.592 27.892 61.678 1.00 25.36 ? 20   THR A OG1 1 
ATOM   150  C  CG2 . THR A 1 36  ? 12.968 29.429 63.536 1.00 24.21 ? 20   THR A CG2 1 
ATOM   151  N  N   . LEU A 1 37  ? 10.433 25.764 63.962 1.00 22.57 ? 21   LEU A N   1 
ATOM   152  C  CA  . LEU A 1 37  ? 9.501  24.663 63.692 1.00 23.06 ? 21   LEU A CA  1 
ATOM   153  C  C   . LEU A 1 37  ? 10.110 23.336 64.171 1.00 23.27 ? 21   LEU A C   1 
ATOM   154  O  O   . LEU A 1 37  ? 10.647 23.283 65.281 1.00 24.34 ? 21   LEU A O   1 
ATOM   155  C  CB  . LEU A 1 37  ? 9.045  24.639 62.230 1.00 22.70 ? 21   LEU A CB  1 
ATOM   156  C  CG  . LEU A 1 37  ? 8.227  25.842 61.730 1.00 23.41 ? 21   LEU A CG  1 
ATOM   157  C  CD1 . LEU A 1 37  ? 8.055  25.763 60.242 1.00 24.71 ? 21   LEU A CD1 1 
ATOM   158  C  CD2 . LEU A 1 37  ? 6.851  25.978 62.392 1.00 24.97 ? 21   LEU A CD2 1 
ATOM   159  N  N   . LYS A 1 38  ? 10.029 22.272 63.376 1.00 22.57 ? 22   LYS A N   1 
ATOM   160  C  CA  . LYS A 1 38  ? 10.493 20.965 63.855 1.00 22.26 ? 22   LYS A CA  1 
ATOM   161  C  C   . LYS A 1 38  ? 11.941 20.735 63.434 1.00 21.36 ? 22   LYS A C   1 
ATOM   162  O  O   . LYS A 1 38  ? 12.779 20.280 64.227 1.00 21.26 ? 22   LYS A O   1 
ATOM   163  C  CB  . LYS A 1 38  ? 9.616  19.843 63.302 1.00 21.92 ? 22   LYS A CB  1 
ATOM   164  N  N   . ASP A 1 39  ? 12.205 21.003 62.158 1.00 21.20 ? 23   ASP A N   1 
ATOM   165  C  CA  . ASP A 1 39  ? 13.524 20.794 61.572 1.00 21.30 ? 23   ASP A CA  1 
ATOM   166  C  C   . ASP A 1 39  ? 13.942 21.903 60.589 1.00 21.01 ? 23   ASP A C   1 
ATOM   167  O  O   . ASP A 1 39  ? 14.873 21.711 59.801 1.00 20.04 ? 23   ASP A O   1 
ATOM   168  C  CB  . ASP A 1 39  ? 13.622 19.390 60.930 1.00 20.79 ? 23   ASP A CB  1 
ATOM   169  C  CG  . ASP A 1 39  ? 12.577 19.144 59.838 1.00 22.11 ? 23   ASP A CG  1 
ATOM   170  O  OD1 . ASP A 1 39  ? 12.217 20.071 59.105 1.00 22.12 ? 23   ASP A OD1 1 
ATOM   171  O  OD2 . ASP A 1 39  ? 12.102 18.004 59.725 1.00 25.54 ? 23   ASP A OD2 1 
ATOM   172  N  N   . ASN A 1 40  ? 13.260 23.048 60.634 1.00 20.88 ? 24   ASN A N   1 
ATOM   173  C  CA  . ASN A 1 40  ? 13.612 24.195 59.782 1.00 21.94 ? 24   ASN A CA  1 
ATOM   174  C  C   . ASN A 1 40  ? 14.763 24.976 60.378 1.00 22.58 ? 24   ASN A C   1 
ATOM   175  O  O   . ASN A 1 40  ? 15.020 24.876 61.596 1.00 22.45 ? 24   ASN A O   1 
ATOM   176  C  CB  . ASN A 1 40  ? 12.409 25.138 59.582 1.00 21.95 ? 24   ASN A CB  1 
ATOM   177  C  CG  . ASN A 1 40  ? 11.469 24.637 58.502 1.00 22.87 ? 24   ASN A CG  1 
ATOM   178  O  OD1 . ASN A 1 40  ? 10.724 23.691 58.716 1.00 22.15 ? 24   ASN A OD1 1 
ATOM   179  N  ND2 . ASN A 1 40  ? 11.552 25.238 57.304 1.00 22.66 ? 24   ASN A ND2 1 
ATOM   180  N  N   . PHE A 1 41  ? 15.461 25.702 59.505 1.00 22.37 ? 25   PHE A N   1 
ATOM   181  C  CA  . PHE A 1 41  ? 16.399 26.734 59.924 1.00 22.88 ? 25   PHE A CA  1 
ATOM   182  C  C   . PHE A 1 41  ? 15.946 28.053 59.350 1.00 22.90 ? 25   PHE A C   1 
ATOM   183  O  O   . PHE A 1 41  ? 15.710 28.177 58.133 1.00 23.90 ? 25   PHE A O   1 
ATOM   184  C  CB  . PHE A 1 41  ? 17.819 26.478 59.413 1.00 22.23 ? 25   PHE A CB  1 
ATOM   185  C  CG  . PHE A 1 41  ? 18.492 25.271 60.022 1.00 23.87 ? 25   PHE A CG  1 
ATOM   186  C  CD1 . PHE A 1 41  ? 18.877 24.203 59.217 1.00 23.06 ? 25   PHE A CD1 1 
ATOM   187  C  CD2 . PHE A 1 41  ? 18.723 25.204 61.398 1.00 21.84 ? 25   PHE A CD2 1 
ATOM   188  C  CE1 . PHE A 1 41  ? 19.514 23.096 59.782 1.00 22.92 ? 25   PHE A CE1 1 
ATOM   189  C  CE2 . PHE A 1 41  ? 19.350 24.116 61.972 1.00 23.92 ? 25   PHE A CE2 1 
ATOM   190  C  CZ  . PHE A 1 41  ? 19.759 23.056 61.168 1.00 23.56 ? 25   PHE A CZ  1 
ATOM   191  N  N   . SER A 1 42  ? 15.876 29.048 60.224 1.00 23.57 ? 26   SER A N   1 
ATOM   192  C  CA  . SER A 1 42  ? 15.814 30.446 59.826 1.00 23.54 ? 26   SER A CA  1 
ATOM   193  C  C   . SER A 1 42  ? 17.188 31.027 60.183 1.00 23.68 ? 26   SER A C   1 
ATOM   194  O  O   . SER A 1 42  ? 17.925 30.425 60.940 1.00 24.22 ? 26   SER A O   1 
ATOM   195  C  CB  . SER A 1 42  ? 14.719 31.189 60.599 1.00 23.87 ? 26   SER A CB  1 
ATOM   196  O  OG  . SER A 1 42  ? 13.438 30.650 60.341 1.00 24.13 ? 26   SER A OG  1 
ATOM   197  N  N   . TYR A 1 43  ? 17.546 32.170 59.614 1.00 24.10 ? 27   TYR A N   1 
ATOM   198  C  CA  . TYR A 1 43  ? 18.863 32.756 59.870 1.00 23.14 ? 27   TYR A CA  1 
ATOM   199  C  C   . TYR A 1 43  ? 18.771 34.245 60.173 1.00 23.44 ? 27   TYR A C   1 
ATOM   200  O  O   . TYR A 1 43  ? 17.899 34.945 59.636 1.00 24.15 ? 27   TYR A O   1 
ATOM   201  C  CB  . TYR A 1 43  ? 19.792 32.529 58.670 1.00 22.43 ? 27   TYR A CB  1 
ATOM   202  C  CG  . TYR A 1 43  ? 19.990 31.052 58.354 1.00 23.55 ? 27   TYR A CG  1 
ATOM   203  C  CD1 . TYR A 1 43  ? 19.213 30.408 57.383 1.00 22.71 ? 27   TYR A CD1 1 
ATOM   204  C  CD2 . TYR A 1 43  ? 20.935 30.307 59.043 1.00 20.31 ? 27   TYR A CD2 1 
ATOM   205  C  CE1 . TYR A 1 43  ? 19.388 29.054 57.122 1.00 22.20 ? 27   TYR A CE1 1 
ATOM   206  C  CE2 . TYR A 1 43  ? 21.095 28.963 58.809 1.00 19.88 ? 27   TYR A CE2 1 
ATOM   207  C  CZ  . TYR A 1 43  ? 20.339 28.346 57.841 1.00 21.58 ? 27   TYR A CZ  1 
ATOM   208  O  OH  . TYR A 1 43  ? 20.534 27.022 57.592 1.00 20.11 ? 27   TYR A OH  1 
ATOM   209  N  N   . LEU A 1 44  ? 19.697 34.730 61.000 1.00 23.50 ? 28   LEU A N   1 
ATOM   210  C  CA  . LEU A 1 44  ? 19.842 36.156 61.212 1.00 23.46 ? 28   LEU A CA  1 
ATOM   211  C  C   . LEU A 1 44  ? 21.238 36.586 60.720 1.00 24.35 ? 28   LEU A C   1 
ATOM   212  O  O   . LEU A 1 44  ? 22.245 36.139 61.258 1.00 24.43 ? 28   LEU A O   1 
ATOM   213  C  CB  . LEU A 1 44  ? 19.662 36.510 62.695 1.00 24.22 ? 28   LEU A CB  1 
ATOM   214  C  CG  . LEU A 1 44  ? 19.723 38.007 63.037 1.00 23.56 ? 28   LEU A CG  1 
ATOM   215  C  CD1 . LEU A 1 44  ? 18.450 38.721 62.614 1.00 24.81 ? 28   LEU A CD1 1 
ATOM   216  C  CD2 . LEU A 1 44  ? 19.992 38.200 64.528 1.00 25.25 ? 28   LEU A CD2 1 
ATOM   217  N  N   . ILE A 1 45  ? 21.272 37.424 59.682 1.00 23.49 ? 29   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 45  ? 22.495 38.070 59.207 1.00 23.54 ? 29   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 45  ? 22.726 39.335 60.022 1.00 23.71 ? 29   ILE A C   1 
ATOM   220  O  O   . ILE A 1 45  ? 21.794 40.134 60.254 1.00 23.96 ? 29   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 45  ? 22.376 38.460 57.692 1.00 23.48 ? 29   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 45  ? 22.063 37.234 56.824 1.00 24.57 ? 29   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 45  ? 23.654 39.201 57.191 1.00 22.42 ? 29   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 45  ? 21.397 37.571 55.463 1.00 21.18 ? 29   ILE A CD1 1 
ATOM   225  N  N   . ASN A 1 46  ? 23.967 39.525 60.466 1.00 22.77 ? 30   ASN A N   1 
ATOM   226  C  CA  . ASN A 1 46  ? 24.320 40.697 61.248 1.00 22.89 ? 30   ASN A CA  1 
ATOM   227  C  C   . ASN A 1 46  ? 25.535 41.353 60.604 1.00 22.37 ? 30   ASN A C   1 
ATOM   228  O  O   . ASN A 1 46  ? 26.612 40.792 60.615 1.00 21.99 ? 30   ASN A O   1 
ATOM   229  C  CB  . ASN A 1 46  ? 24.560 40.268 62.705 1.00 22.92 ? 30   ASN A CB  1 
ATOM   230  C  CG  . ASN A 1 46  ? 25.037 41.387 63.604 1.00 23.50 ? 30   ASN A CG  1 
ATOM   231  O  OD1 . ASN A 1 46  ? 25.313 42.517 63.172 1.00 24.29 ? 30   ASN A OD1 1 
ATOM   232  N  ND2 . ASN A 1 46  ? 25.120 41.079 64.897 1.00 27.20 ? 30   ASN A ND2 1 
ATOM   233  N  N   . ASP A 1 47  ? 25.334 42.521 59.995 1.00 23.05 ? 31   ASP A N   1 
ATOM   234  C  CA  . ASP A 1 47  ? 26.447 43.329 59.466 1.00 22.98 ? 31   ASP A CA  1 
ATOM   235  C  C   . ASP A 1 47  ? 27.085 44.108 60.622 1.00 23.44 ? 31   ASP A C   1 
ATOM   236  O  O   . ASP A 1 47  ? 26.490 45.048 61.133 1.00 23.49 ? 31   ASP A O   1 
ATOM   237  C  CB  . ASP A 1 47  ? 25.935 44.289 58.373 1.00 23.44 ? 31   ASP A CB  1 
ATOM   238  C  CG  . ASP A 1 47  ? 27.018 45.229 57.843 1.00 23.80 ? 31   ASP A CG  1 
ATOM   239  O  OD1 . ASP A 1 47  ? 28.218 44.922 57.970 1.00 26.06 ? 31   ASP A OD1 1 
ATOM   240  O  OD2 . ASP A 1 47  ? 26.666 46.290 57.282 1.00 26.22 ? 31   ASP A OD2 1 
ATOM   241  N  N   . HIS A 1 48  ? 28.297 43.708 61.011 1.00 22.88 ? 32   HIS A N   1 
ATOM   242  C  CA  . HIS A 1 48  ? 29.034 44.335 62.108 1.00 23.65 ? 32   HIS A CA  1 
ATOM   243  C  C   . HIS A 1 48  ? 29.497 45.761 61.809 1.00 23.93 ? 32   HIS A C   1 
ATOM   244  O  O   . HIS A 1 48  ? 29.795 46.519 62.720 1.00 23.53 ? 32   HIS A O   1 
ATOM   245  C  CB  . HIS A 1 48  ? 30.269 43.505 62.495 1.00 23.42 ? 32   HIS A CB  1 
ATOM   246  C  CG  . HIS A 1 48  ? 29.968 42.097 62.915 1.00 25.27 ? 32   HIS A CG  1 
ATOM   247  N  ND1 . HIS A 1 48  ? 30.957 41.219 63.310 1.00 28.36 ? 32   HIS A ND1 1 
ATOM   248  C  CD2 . HIS A 1 48  ? 28.804 41.410 63.000 1.00 26.00 ? 32   HIS A CD2 1 
ATOM   249  C  CE1 . HIS A 1 48  ? 30.414 40.051 63.610 1.00 26.99 ? 32   HIS A CE1 1 
ATOM   250  N  NE2 . HIS A 1 48  ? 29.110 40.143 63.440 1.00 24.71 ? 32   HIS A NE2 1 
ATOM   251  N  N   . THR A 1 49  ? 29.600 46.109 60.534 1.00 24.68 ? 33   THR A N   1 
ATOM   252  C  CA  . THR A 1 49  ? 30.196 47.391 60.151 1.00 25.49 ? 33   THR A CA  1 
ATOM   253  C  C   . THR A 1 49  ? 29.173 48.529 60.253 1.00 25.57 ? 33   THR A C   1 
ATOM   254  O  O   . THR A 1 49  ? 29.561 49.683 60.392 1.00 26.08 ? 33   THR A O   1 
ATOM   255  C  CB  . THR A 1 49  ? 30.820 47.344 58.727 1.00 25.58 ? 33   THR A CB  1 
ATOM   256  O  OG1 . THR A 1 49  ? 29.790 47.134 57.755 1.00 28.24 ? 33   THR A OG1 1 
ATOM   257  C  CG2 . THR A 1 49  ? 31.821 46.206 58.599 1.00 26.72 ? 33   THR A CG2 1 
ATOM   258  N  N   . THR A 1 50  ? 27.883 48.192 60.190 1.00 25.30 ? 34   THR A N   1 
ATOM   259  C  CA  . THR A 1 50  ? 26.786 49.166 60.257 1.00 25.37 ? 34   THR A CA  1 
ATOM   260  C  C   . THR A 1 50  ? 25.707 48.809 61.297 1.00 25.16 ? 34   THR A C   1 
ATOM   261  O  O   . THR A 1 50  ? 24.742 49.562 61.480 1.00 25.18 ? 34   THR A O   1 
ATOM   262  C  CB  . THR A 1 50  ? 26.061 49.283 58.886 1.00 25.22 ? 34   THR A CB  1 
ATOM   263  O  OG1 . THR A 1 50  ? 25.424 48.037 58.567 1.00 24.71 ? 34   THR A OG1 1 
ATOM   264  C  CG2 . THR A 1 50  ? 27.028 49.676 57.782 1.00 26.57 ? 34   THR A CG2 1 
ATOM   265  N  N   . HIS A 1 51  ? 25.849 47.649 61.942 1.00 24.73 ? 35   HIS A N   1 
ATOM   266  C  CA  . HIS A 1 51  ? 24.833 47.118 62.866 1.00 24.48 ? 35   HIS A CA  1 
ATOM   267  C  C   . HIS A 1 51  ? 23.456 47.020 62.202 1.00 24.62 ? 35   HIS A C   1 
ATOM   268  O  O   . HIS A 1 51  ? 22.448 47.516 62.728 1.00 24.55 ? 35   HIS A O   1 
ATOM   269  C  CB  . HIS A 1 51  ? 24.779 47.931 64.159 1.00 25.20 ? 35   HIS A CB  1 
ATOM   270  C  CG  . HIS A 1 51  ? 26.127 48.231 64.723 1.00 26.03 ? 35   HIS A CG  1 
ATOM   271  N  ND1 . HIS A 1 51  ? 26.977 47.243 65.169 1.00 27.11 ? 35   HIS A ND1 1 
ATOM   272  C  CD2 . HIS A 1 51  ? 26.784 49.404 64.899 1.00 26.87 ? 35   HIS A CD2 1 
ATOM   273  C  CE1 . HIS A 1 51  ? 28.094 47.794 65.610 1.00 26.62 ? 35   HIS A CE1 1 
ATOM   274  N  NE2 . HIS A 1 51  ? 28.007 49.102 65.444 1.00 27.06 ? 35   HIS A NE2 1 
ATOM   275  N  N   . THR A 1 52  ? 23.443 46.392 61.031 1.00 23.80 ? 36   THR A N   1 
ATOM   276  C  CA  . THR A 1 52  ? 22.221 46.152 60.276 1.00 23.58 ? 36   THR A CA  1 
ATOM   277  C  C   . THR A 1 52  ? 21.940 44.669 60.343 1.00 23.92 ? 36   THR A C   1 
ATOM   278  O  O   . THR A 1 52  ? 22.875 43.858 60.215 1.00 23.54 ? 36   THR A O   1 
ATOM   279  C  CB  . THR A 1 52  ? 22.356 46.663 58.815 1.00 23.25 ? 36   THR A CB  1 
ATOM   280  O  OG1 . THR A 1 52  ? 22.716 48.068 58.831 1.00 24.05 ? 36   THR A OG1 1 
ATOM   281  C  CG2 . THR A 1 52  ? 21.038 46.476 58.024 1.00 23.40 ? 36   THR A CG2 1 
ATOM   282  N  N   . LEU A 1 53  ? 20.665 44.321 60.561 1.00 23.79 ? 37   LEU A N   1 
ATOM   283  C  CA  . LEU A 1 53  ? 20.229 42.931 60.691 1.00 23.92 ? 37   LEU A CA  1 
ATOM   284  C  C   . LEU A 1 53  ? 19.263 42.570 59.590 1.00 23.84 ? 37   LEU A C   1 
ATOM   285  O  O   . LEU A 1 53  ? 18.432 43.395 59.184 1.00 24.04 ? 37   LEU A O   1 
ATOM   286  C  CB  . LEU A 1 53  ? 19.540 42.697 62.042 1.00 23.58 ? 37   LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 53  ? 20.309 43.035 63.325 1.00 25.47 ? 37   LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 53  ? 19.397 42.918 64.532 1.00 24.88 ? 37   LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 53  ? 21.527 42.109 63.434 1.00 26.48 ? 37   LEU A CD2 1 
ATOM   290  N  N   . ALA A 1 54  ? 19.358 41.328 59.126 1.00 23.90 ? 38   ALA A N   1 
ATOM   291  C  CA  . ALA A 1 54  ? 18.409 40.771 58.158 1.00 24.41 ? 38   ALA A CA  1 
ATOM   292  C  C   . ALA A 1 54  ? 18.065 39.340 58.581 1.00 24.21 ? 38   ALA A C   1 
ATOM   293  O  O   . ALA A 1 54  ? 18.912 38.615 59.086 1.00 24.68 ? 38   ALA A O   1 
ATOM   294  C  CB  . ALA A 1 54  ? 19.012 40.776 56.726 1.00 24.41 ? 38   ALA A CB  1 
ATOM   295  N  N   . ALA A 1 55  ? 16.826 38.930 58.356 1.00 24.45 ? 39   ALA A N   1 
ATOM   296  C  CA  . ALA A 1 55  ? 16.415 37.569 58.647 1.00 24.05 ? 39   ALA A CA  1 
ATOM   297  C  C   . ALA A 1 55  ? 16.151 36.791 57.354 1.00 23.54 ? 39   ALA A C   1 
ATOM   298  O  O   . ALA A 1 55  ? 15.657 37.350 56.373 1.00 24.72 ? 39   ALA A O   1 
ATOM   299  C  CB  . ALA A 1 55  ? 15.167 37.579 59.506 1.00 24.01 ? 39   ALA A CB  1 
ATOM   300  N  N   . VAL A 1 56  ? 16.481 35.504 57.348 1.00 23.83 ? 40   VAL A N   1 
ATOM   301  C  CA  . VAL A 1 56  ? 16.260 34.650 56.185 1.00 23.10 ? 40   VAL A CA  1 
ATOM   302  C  C   . VAL A 1 56  ? 15.278 33.520 56.521 1.00 23.38 ? 40   VAL A C   1 
ATOM   303  O  O   . VAL A 1 56  ? 15.442 32.846 57.540 1.00 22.51 ? 40   VAL A O   1 
ATOM   304  C  CB  . VAL A 1 56  ? 17.581 34.009 55.694 1.00 24.03 ? 40   VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 56  ? 17.338 33.204 54.390 1.00 24.78 ? 40   VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 56  ? 18.653 35.094 55.443 1.00 23.28 ? 40   VAL A CG2 1 
ATOM   307  N  N   . ASP A 1 57  ? 14.272 33.325 55.668 1.00 21.73 ? 41   ASP A N   1 
ATOM   308  C  CA  . ASP A 1 57  ? 13.324 32.193 55.802 1.00 22.70 ? 41   ASP A CA  1 
ATOM   309  C  C   . ASP A 1 57  ? 12.563 32.171 57.139 1.00 22.94 ? 41   ASP A C   1 
ATOM   310  O  O   . ASP A 1 57  ? 12.599 31.192 57.910 1.00 22.65 ? 41   ASP A O   1 
ATOM   311  C  CB  . ASP A 1 57  ? 14.002 30.868 55.472 1.00 22.39 ? 41   ASP A CB  1 
ATOM   312  C  CG  . ASP A 1 57  ? 14.208 30.703 53.964 1.00 23.15 ? 41   ASP A CG  1 
ATOM   313  O  OD1 . ASP A 1 57  ? 13.895 31.676 53.219 1.00 23.02 ? 41   ASP A OD1 1 
ATOM   314  O  OD2 . ASP A 1 57  ? 14.712 29.646 53.537 1.00 23.68 ? 41   ASP A OD2 1 
ATOM   315  N  N   . VAL A 1 58  ? 11.821 33.264 57.343 1.00 23.09 ? 42   VAL A N   1 
ATOM   316  C  CA  . VAL A 1 58  ? 11.018 33.475 58.517 1.00 22.85 ? 42   VAL A CA  1 
ATOM   317  C  C   . VAL A 1 58  ? 9.670  32.788 58.341 1.00 23.32 ? 42   VAL A C   1 
ATOM   318  O  O   . VAL A 1 58  ? 8.884  33.098 57.420 1.00 23.57 ? 42   VAL A O   1 
ATOM   319  C  CB  . VAL A 1 58  ? 10.819 34.992 58.801 1.00 22.66 ? 42   VAL A CB  1 
ATOM   320  C  CG1 . VAL A 1 58  ? 10.001 35.195 60.085 1.00 22.65 ? 42   VAL A CG1 1 
ATOM   321  C  CG2 . VAL A 1 58  ? 12.151 35.679 58.942 1.00 23.35 ? 42   VAL A CG2 1 
ATOM   322  N  N   . ASN A 1 59  ? 9.415  31.843 59.226 1.00 23.27 ? 43   ASN A N   1 
ATOM   323  C  CA  . ASN A 1 59  ? 8.142  31.120 59.229 1.00 23.28 ? 43   ASN A CA  1 
ATOM   324  C  C   . ASN A 1 59  ? 7.261  31.521 60.421 1.00 23.35 ? 43   ASN A C   1 
ATOM   325  O  O   . ASN A 1 59  ? 7.537  32.524 61.096 1.00 23.18 ? 43   ASN A O   1 
ATOM   326  C  CB  . ASN A 1 59  ? 8.407  29.604 59.166 1.00 23.52 ? 43   ASN A CB  1 
ATOM   327  C  CG  . ASN A 1 59  ? 9.346  29.120 60.276 1.00 23.21 ? 43   ASN A CG  1 
ATOM   328  O  OD1 . ASN A 1 59  ? 9.139  29.408 61.464 1.00 23.47 ? 43   ASN A OD1 1 
ATOM   329  N  ND2 . ASN A 1 59  ? 10.372 28.383 59.895 1.00 22.11 ? 43   ASN A ND2 1 
ATOM   330  N  N   . ALA A 1 60  ? 6.211  30.741 60.682 1.00 22.91 ? 44   ALA A N   1 
ATOM   331  C  CA  . ALA A 1 60  ? 5.260  31.037 61.746 1.00 23.92 ? 44   ALA A CA  1 
ATOM   332  C  C   . ALA A 1 60  ? 5.939  31.063 63.125 1.00 23.97 ? 44   ALA A C   1 
ATOM   333  O  O   . ALA A 1 60  ? 5.492  31.755 64.038 1.00 24.20 ? 44   ALA A O   1 
ATOM   334  C  CB  . ALA A 1 60  ? 4.088  30.032 61.722 1.00 24.68 ? 44   ALA A CB  1 
ATOM   335  N  N   . ASP A 1 61  ? 7.020  30.302 63.254 1.00 23.57 ? 45   ASP A N   1 
ATOM   336  C  CA  . ASP A 1 61  ? 7.803  30.225 64.488 1.00 23.86 ? 45   ASP A CA  1 
ATOM   337  C  C   . ASP A 1 61  ? 8.985  31.224 64.397 1.00 23.86 ? 45   ASP A C   1 
ATOM   338  O  O   . ASP A 1 61  ? 10.151 30.826 64.223 1.00 24.02 ? 45   ASP A O   1 
ATOM   339  C  CB  . ASP A 1 61  ? 8.302  28.793 64.619 1.00 23.91 ? 45   ASP A CB  1 
ATOM   340  C  CG  . ASP A 1 61  ? 9.057  28.533 65.909 1.00 25.64 ? 45   ASP A CG  1 
ATOM   341  O  OD1 . ASP A 1 61  ? 8.842  29.241 66.926 1.00 22.48 ? 45   ASP A OD1 1 
ATOM   342  O  OD2 . ASP A 1 61  ? 9.855  27.583 65.901 1.00 26.40 ? 45   ASP A OD2 1 
ATOM   343  N  N   . TYR A 1 62  ? 8.688  32.515 64.448 1.00 22.85 ? 46   TYR A N   1 
ATOM   344  C  CA  . TYR A 1 62  ? 9.731  33.531 64.270 1.00 22.84 ? 46   TYR A CA  1 
ATOM   345  C  C   . TYR A 1 62  ? 10.273 34.114 65.572 1.00 22.25 ? 46   TYR A C   1 
ATOM   346  O  O   . TYR A 1 62  ? 11.321 34.788 65.564 1.00 22.00 ? 46   TYR A O   1 
ATOM   347  C  CB  . TYR A 1 62  ? 9.261  34.671 63.357 1.00 22.61 ? 46   TYR A CB  1 
ATOM   348  C  CG  . TYR A 1 62  ? 8.084  35.464 63.869 1.00 24.16 ? 46   TYR A CG  1 
ATOM   349  C  CD1 . TYR A 1 62  ? 8.266  36.568 64.714 1.00 23.62 ? 46   TYR A CD1 1 
ATOM   350  C  CD2 . TYR A 1 62  ? 6.785  35.127 63.491 1.00 24.73 ? 46   TYR A CD2 1 
ATOM   351  C  CE1 . TYR A 1 62  ? 7.186  37.302 65.177 1.00 26.04 ? 46   TYR A CE1 1 
ATOM   352  C  CE2 . TYR A 1 62  ? 5.703  35.855 63.940 1.00 25.95 ? 46   TYR A CE2 1 
ATOM   353  C  CZ  . TYR A 1 62  ? 5.908  36.937 64.789 1.00 26.38 ? 46   TYR A CZ  1 
ATOM   354  O  OH  . TYR A 1 62  ? 4.833  37.650 65.229 1.00 27.34 ? 46   TYR A OH  1 
ATOM   355  N  N   . LYS A 1 63  ? 9.577  33.848 66.676 1.00 21.88 ? 47   LYS A N   1 
ATOM   356  C  CA  . LYS A 1 63  ? 9.945  34.414 67.972 1.00 21.98 ? 47   LYS A CA  1 
ATOM   357  C  C   . LYS A 1 63  ? 11.377 34.057 68.412 1.00 22.27 ? 47   LYS A C   1 
ATOM   358  O  O   . LYS A 1 63  ? 12.043 34.896 69.010 1.00 22.34 ? 47   LYS A O   1 
ATOM   359  C  CB  . LYS A 1 63  ? 8.883  34.111 69.058 1.00 21.49 ? 47   LYS A CB  1 
ATOM   360  C  CG  . LYS A 1 63  ? 7.581  34.881 68.837 1.00 21.57 ? 47   LYS A CG  1 
ATOM   361  C  CD  . LYS A 1 63  ? 6.597  34.705 69.985 1.00 24.53 ? 47   LYS A CD  1 
ATOM   362  C  CE  . LYS A 1 63  ? 5.395  35.649 69.817 1.00 24.73 ? 47   LYS A CE  1 
ATOM   363  N  NZ  . LYS A 1 63  ? 4.274  35.262 70.698 1.00 26.48 ? 47   LYS A NZ  1 
ATOM   364  N  N   . PRO A 1 64  ? 11.873 32.830 68.081 1.00 22.85 ? 48   PRO A N   1 
ATOM   365  C  CA  . PRO A 1 64  ? 13.263 32.513 68.406 1.00 22.90 ? 48   PRO A CA  1 
ATOM   366  C  C   . PRO A 1 64  ? 14.300 33.473 67.794 1.00 22.95 ? 48   PRO A C   1 
ATOM   367  O  O   . PRO A 1 64  ? 15.362 33.640 68.372 1.00 23.10 ? 48   PRO A O   1 
ATOM   368  C  CB  . PRO A 1 64  ? 13.437 31.099 67.834 1.00 23.01 ? 48   PRO A CB  1 
ATOM   369  C  CG  . PRO A 1 64  ? 12.078 30.514 67.896 1.00 23.04 ? 48   PRO A CG  1 
ATOM   370  C  CD  . PRO A 1 64  ? 11.199 31.657 67.482 1.00 22.81 ? 48   PRO A CD  1 
ATOM   371  N  N   . ILE A 1 65  ? 13.997 34.078 66.648 1.00 23.25 ? 49   ILE A N   1 
ATOM   372  C  CA  . ILE A 1 65  ? 14.869 35.105 66.050 1.00 23.46 ? 49   ILE A CA  1 
ATOM   373  C  C   . ILE A 1 65  ? 14.931 36.321 66.999 1.00 24.24 ? 49   ILE A C   1 
ATOM   374  O  O   . ILE A 1 65  ? 16.014 36.812 67.349 1.00 25.07 ? 49   ILE A O   1 
ATOM   375  C  CB  . ILE A 1 65  ? 14.374 35.547 64.652 1.00 23.48 ? 49   ILE A CB  1 
ATOM   376  C  CG1 . ILE A 1 65  ? 14.235 34.322 63.708 1.00 22.64 ? 49   ILE A CG1 1 
ATOM   377  C  CG2 . ILE A 1 65  ? 15.322 36.628 64.053 1.00 24.25 ? 49   ILE A CG2 1 
ATOM   378  C  CD1 . ILE A 1 65  ? 13.792 34.626 62.239 1.00 21.78 ? 49   ILE A CD1 1 
ATOM   379  N  N   . LEU A 1 66  ? 13.760 36.772 67.426 1.00 24.23 ? 50   LEU A N   1 
ATOM   380  C  CA  . LEU A 1 66  ? 13.637 37.872 68.380 1.00 23.96 ? 50   LEU A CA  1 
ATOM   381  C  C   . LEU A 1 66  ? 14.300 37.557 69.721 1.00 23.87 ? 50   LEU A C   1 
ATOM   382  O  O   . LEU A 1 66  ? 14.977 38.417 70.292 1.00 24.29 ? 50   LEU A O   1 
ATOM   383  C  CB  . LEU A 1 66  ? 12.171 38.257 68.551 1.00 24.42 ? 50   LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 66  ? 11.462 38.794 67.301 1.00 23.52 ? 50   LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 66  ? 10.040 39.207 67.655 1.00 22.87 ? 50   LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 66  ? 12.223 39.983 66.701 1.00 23.40 ? 50   LEU A CD2 1 
ATOM   387  N  N   . THR A 1 67  ? 14.124 36.325 70.212 1.00 23.64 ? 51   THR A N   1 
ATOM   388  C  CA  . THR A 1 67  ? 14.727 35.914 71.488 1.00 23.39 ? 51   THR A CA  1 
ATOM   389  C  C   . THR A 1 67  ? 16.252 36.027 71.398 1.00 22.35 ? 51   THR A C   1 
ATOM   390  O  O   . THR A 1 67  ? 16.909 36.518 72.333 1.00 21.76 ? 51   THR A O   1 
ATOM   391  C  CB  . THR A 1 67  ? 14.287 34.491 71.945 1.00 23.46 ? 51   THR A CB  1 
ATOM   392  O  OG1 . THR A 1 67  ? 12.870 34.472 72.147 1.00 24.20 ? 51   THR A OG1 1 
ATOM   393  C  CG2 . THR A 1 67  ? 14.948 34.115 73.278 1.00 23.25 ? 51   THR A CG2 1 
ATOM   394  N  N   . TYR A 1 68  ? 16.801 35.606 70.257 1.00 22.34 ? 52   TYR A N   1 
ATOM   395  C  CA  . TYR A 1 68  ? 18.232 35.695 70.045 1.00 21.37 ? 52   TYR A CA  1 
ATOM   396  C  C   . TYR A 1 68  ? 18.753 37.150 70.100 1.00 22.22 ? 52   TYR A C   1 
ATOM   397  O  O   . TYR A 1 68  ? 19.755 37.448 70.789 1.00 21.79 ? 52   TYR A O   1 
ATOM   398  C  CB  . TYR A 1 68  ? 18.652 35.001 68.737 1.00 20.73 ? 52   TYR A CB  1 
ATOM   399  C  CG  . TYR A 1 68  ? 20.094 35.256 68.504 1.00 18.67 ? 52   TYR A CG  1 
ATOM   400  C  CD1 . TYR A 1 68  ? 21.065 34.446 69.084 1.00 15.04 ? 52   TYR A CD1 1 
ATOM   401  C  CD2 . TYR A 1 68  ? 20.501 36.356 67.753 1.00 17.36 ? 52   TYR A CD2 1 
ATOM   402  C  CE1 . TYR A 1 68  ? 22.396 34.722 68.904 1.00 15.79 ? 52   TYR A CE1 1 
ATOM   403  C  CE2 . TYR A 1 68  ? 21.813 36.629 67.566 1.00 15.52 ? 52   TYR A CE2 1 
ATOM   404  C  CZ  . TYR A 1 68  ? 22.757 35.816 68.138 1.00 15.99 ? 52   TYR A CZ  1 
ATOM   405  O  OH  . TYR A 1 68  ? 24.070 36.117 67.942 1.00 18.22 ? 52   TYR A OH  1 
ATOM   406  N  N   . ILE A 1 69  ? 18.073 38.046 69.386 1.00 22.52 ? 53   ILE A N   1 
ATOM   407  C  CA  . ILE A 1 69  ? 18.396 39.489 69.391 1.00 22.51 ? 53   ILE A CA  1 
ATOM   408  C  C   . ILE A 1 69  ? 18.338 40.149 70.764 1.00 23.40 ? 53   ILE A C   1 
ATOM   409  O  O   . ILE A 1 69  ? 19.045 41.132 71.029 1.00 23.13 ? 53   ILE A O   1 
ATOM   410  C  CB  . ILE A 1 69  ? 17.464 40.245 68.420 1.00 22.85 ? 53   ILE A CB  1 
ATOM   411  C  CG1 . ILE A 1 69  ? 17.525 39.584 67.025 1.00 22.63 ? 53   ILE A CG1 1 
ATOM   412  C  CG2 . ILE A 1 69  ? 17.792 41.741 68.392 1.00 22.03 ? 53   ILE A CG2 1 
ATOM   413  C  CD1 . ILE A 1 69  ? 16.735 40.280 65.932 1.00 22.55 ? 53   ILE A CD1 1 
ATOM   414  N  N   . GLU A 1 70  ? 17.516 39.616 71.661 1.00 23.50 ? 54   GLU A N   1 
ATOM   415  C  CA  . GLU A 1 70  ? 17.313 40.303 72.921 1.00 24.39 ? 54   GLU A CA  1 
ATOM   416  C  C   . GLU A 1 70  ? 18.058 39.689 74.183 1.00 24.77 ? 54   GLU A C   1 
ATOM   417  O  O   . GLU A 1 70  ? 18.817 40.604 74.737 1.00 25.19 ? 54   GLU A O   1 
ATOM   418  C  CB  . GLU A 1 70  ? 15.731 40.305 73.245 1.00 23.56 ? 54   GLU A CB  1 
ATOM   419  N  N   . GLU A 1 71  ? 18.157 38.211 74.265 1.00 26.11 ? 55   GLU A N   1 
ATOM   420  C  CA  . GLU A 1 71  ? 19.717 37.902 74.776 1.00 26.22 ? 55   GLU A CA  1 
ATOM   421  C  C   . GLU A 1 71  ? 20.995 38.510 74.122 1.00 26.75 ? 55   GLU A C   1 
ATOM   422  O  O   . GLU A 1 71  ? 21.803 39.160 74.852 1.00 26.12 ? 55   GLU A O   1 
ATOM   423  C  CB  . GLU A 1 71  ? 19.869 36.355 74.856 1.00 26.38 ? 55   GLU A CB  1 
ATOM   424  N  N   . HIS A 1 72  ? 21.252 38.197 72.814 1.00 26.54 ? 56   HIS A N   1 
ATOM   425  C  CA  . HIS A 1 72  ? 22.673 38.394 72.437 1.00 27.13 ? 56   HIS A CA  1 
ATOM   426  C  C   . HIS A 1 72  ? 23.095 39.765 71.928 1.00 27.06 ? 56   HIS A C   1 
ATOM   427  O  O   . HIS A 1 72  ? 24.228 40.208 72.173 1.00 27.16 ? 56   HIS A O   1 
ATOM   428  C  CB  . HIS A 1 72  ? 23.123 37.268 71.475 1.00 27.56 ? 56   HIS A CB  1 
ATOM   429  C  CG  . HIS A 1 72  ? 23.101 35.924 72.134 1.00 28.70 ? 56   HIS A CG  1 
ATOM   430  N  ND1 . HIS A 1 72  ? 24.195 35.470 72.877 1.00 31.18 ? 56   HIS A ND1 1 
ATOM   431  C  CD2 . HIS A 1 72  ? 22.103 34.947 72.193 1.00 30.67 ? 56   HIS A CD2 1 
ATOM   432  C  CE1 . HIS A 1 72  ? 23.883 34.261 73.348 1.00 31.76 ? 56   HIS A CE1 1 
ATOM   433  N  NE2 . HIS A 1 72  ? 22.622 33.920 72.942 1.00 30.72 ? 56   HIS A NE2 1 
ATOM   434  N  N   . LEU A 1 73  ? 22.194 40.426 71.212 1.00 26.95 ? 57   LEU A N   1 
ATOM   435  C  CA  . LEU A 1 73  ? 22.517 41.728 70.646 1.00 26.59 ? 57   LEU A CA  1 
ATOM   436  C  C   . LEU A 1 73  ? 22.033 42.861 71.553 1.00 26.28 ? 57   LEU A C   1 
ATOM   437  O  O   . LEU A 1 73  ? 22.546 43.994 71.399 1.00 26.00 ? 57   LEU A O   1 
ATOM   438  C  CB  . LEU A 1 73  ? 21.941 41.850 69.235 1.00 26.63 ? 57   LEU A CB  1 
ATOM   439  C  CG  . LEU A 1 73  ? 22.655 41.086 68.102 1.00 26.58 ? 57   LEU A CG  1 
ATOM   440  C  CD1 . LEU A 1 73  ? 23.149 39.724 68.535 1.00 27.53 ? 57   LEU A CD1 1 
ATOM   441  C  CD2 . LEU A 1 73  ? 21.740 40.941 66.897 1.00 25.80 ? 57   LEU A CD2 1 
ATOM   442  N  N   . THR A 1 82  ? 22.498 50.892 69.102 1.00 26.65 ? 66   THR A N   1 
ATOM   443  C  CA  . THR A 1 82  ? 21.275 50.652 68.361 1.00 26.63 ? 66   THR A CA  1 
ATOM   444  C  C   . THR A 1 82  ? 21.575 49.867 67.042 1.00 26.74 ? 66   THR A C   1 
ATOM   445  O  O   . THR A 1 82  ? 22.549 50.187 66.290 1.00 27.35 ? 66   THR A O   1 
ATOM   446  C  CB  . THR A 1 82  ? 20.546 51.975 67.971 1.00 26.67 ? 66   THR A CB  1 
ATOM   447  N  N   . TYR A 1 83  ? 20.710 48.866 66.771 1.00 26.61 ? 67   TYR A N   1 
ATOM   448  C  CA  . TYR A 1 83  ? 20.716 48.039 65.541 1.00 26.39 ? 67   TYR A CA  1 
ATOM   449  C  C   . TYR A 1 83  ? 19.542 48.406 64.623 1.00 26.01 ? 67   TYR A C   1 
ATOM   450  O  O   . TYR A 1 83  ? 18.517 48.916 65.104 1.00 26.43 ? 67   TYR A O   1 
ATOM   451  C  CB  . TYR A 1 83  ? 20.536 46.565 65.904 1.00 26.77 ? 67   TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 83  ? 21.747 45.909 66.520 1.00 28.13 ? 67   TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 83  ? 21.892 45.820 67.905 1.00 30.00 ? 67   TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 83  ? 22.745 45.359 65.718 1.00 30.05 ? 67   TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 83  ? 23.001 45.207 68.469 1.00 30.72 ? 67   TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 83  ? 23.858 44.742 66.274 1.00 30.16 ? 67   TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 83  ? 23.977 44.672 67.647 1.00 31.04 ? 67   TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 83  ? 25.078 44.069 68.199 1.00 32.71 ? 67   TYR A OH  1 
ATOM   459  N  N   . THR A 1 84  ? 19.695 48.149 63.303 1.00 24.67 ? 68   THR A N   1 
ATOM   460  C  CA  . THR A 1 84  ? 18.620 48.361 62.336 1.00 24.27 ? 68   THR A CA  1 
ATOM   461  C  C   . THR A 1 84  ? 18.215 47.025 61.700 1.00 24.46 ? 68   THR A C   1 
ATOM   462  O  O   . THR A 1 84  ? 19.016 46.383 61.025 1.00 24.19 ? 68   THR A O   1 
ATOM   463  C  CB  . THR A 1 84  ? 19.034 49.347 61.221 1.00 24.23 ? 68   THR A CB  1 
ATOM   464  O  OG1 . THR A 1 84  ? 19.463 50.591 61.813 1.00 23.15 ? 68   THR A OG1 1 
ATOM   465  C  CG2 . THR A 1 84  ? 17.849 49.630 60.286 1.00 24.22 ? 68   THR A CG2 1 
ATOM   466  N  N   . PHE A 1 85  ? 16.974 46.611 61.919 1.00 24.63 ? 69   PHE A N   1 
ATOM   467  C  CA  . PHE A 1 85  ? 16.504 45.338 61.396 1.00 25.01 ? 69   PHE A CA  1 
ATOM   468  C  C   . PHE A 1 85  ? 15.718 45.623 60.107 1.00 25.57 ? 69   PHE A C   1 
ATOM   469  O  O   . PHE A 1 85  ? 14.489 45.806 60.129 1.00 26.28 ? 69   PHE A O   1 
ATOM   470  C  CB  . PHE A 1 85  ? 15.671 44.612 62.462 1.00 24.77 ? 69   PHE A CB  1 
ATOM   471  C  CG  . PHE A 1 85  ? 15.420 43.152 62.172 1.00 26.15 ? 69   PHE A CG  1 
ATOM   472  C  CD1 . PHE A 1 85  ? 15.134 42.268 63.210 1.00 26.35 ? 69   PHE A CD1 1 
ATOM   473  C  CD2 . PHE A 1 85  ? 15.437 42.660 60.867 1.00 23.27 ? 69   PHE A CD2 1 
ATOM   474  C  CE1 . PHE A 1 85  ? 14.872 40.926 62.940 1.00 26.66 ? 69   PHE A CE1 1 
ATOM   475  C  CE2 . PHE A 1 85  ? 15.173 41.323 60.601 1.00 26.01 ? 69   PHE A CE2 1 
ATOM   476  C  CZ  . PHE A 1 85  ? 14.907 40.461 61.648 1.00 26.90 ? 69   PHE A CZ  1 
ATOM   477  N  N   . SER A 1 86  ? 16.439 45.645 58.983 1.00 25.06 ? 70   SER A N   1 
ATOM   478  C  CA  . SER A 1 86  ? 15.946 46.294 57.763 1.00 25.13 ? 70   SER A CA  1 
ATOM   479  C  C   . SER A 1 86  ? 15.310 45.370 56.722 1.00 24.67 ? 70   SER A C   1 
ATOM   480  O  O   . SER A 1 86  ? 14.482 45.819 55.940 1.00 23.95 ? 70   SER A O   1 
ATOM   481  C  CB  . SER A 1 86  ? 17.083 47.069 57.090 1.00 24.71 ? 70   SER A CB  1 
ATOM   482  O  OG  . SER A 1 86  ? 18.017 46.159 56.516 1.00 27.33 ? 70   SER A OG  1 
ATOM   483  N  N   . THR A 1 87  ? 15.718 44.097 56.703 1.00 24.28 ? 71   THR A N   1 
ATOM   484  C  CA  . THR A 1 87  ? 15.417 43.208 55.587 1.00 23.57 ? 71   THR A CA  1 
ATOM   485  C  C   . THR A 1 87  ? 14.968 41.807 56.026 1.00 23.01 ? 71   THR A C   1 
ATOM   486  O  O   . THR A 1 87  ? 15.481 41.238 56.992 1.00 21.91 ? 71   THR A O   1 
ATOM   487  C  CB  . THR A 1 87  ? 16.639 43.143 54.596 1.00 23.45 ? 71   THR A CB  1 
ATOM   488  O  OG1 . THR A 1 87  ? 16.996 44.475 54.192 1.00 23.59 ? 71   THR A OG1 1 
ATOM   489  C  CG2 . THR A 1 87  ? 16.330 42.307 53.346 1.00 24.68 ? 71   THR A CG2 1 
ATOM   490  N  N   . ILE A 1 88  ? 13.967 41.284 55.328 1.00 22.60 ? 72   ILE A N   1 
ATOM   491  C  CA  . ILE A 1 88  ? 13.644 39.861 55.398 1.00 23.29 ? 72   ILE A CA  1 
ATOM   492  C  C   . ILE A 1 88  ? 13.850 39.258 54.008 1.00 23.08 ? 72   ILE A C   1 
ATOM   493  O  O   . ILE A 1 88  ? 13.360 39.812 53.025 1.00 23.83 ? 72   ILE A O   1 
ATOM   494  C  CB  . ILE A 1 88  ? 12.153 39.629 55.819 1.00 22.88 ? 72   ILE A CB  1 
ATOM   495  C  CG1 . ILE A 1 88  ? 11.869 40.275 57.181 1.00 24.48 ? 72   ILE A CG1 1 
ATOM   496  C  CG2 . ILE A 1 88  ? 11.819 38.131 55.752 1.00 23.71 ? 72   ILE A CG2 1 
ATOM   497  C  CD1 . ILE A 1 88  ? 10.414 40.348 57.557 1.00 24.77 ? 72   ILE A CD1 1 
ATOM   498  N  N   . LEU A 1 89  ? 14.528 38.109 53.925 1.00 22.38 ? 73   LEU A N   1 
ATOM   499  C  CA  . LEU A 1 89  ? 14.733 37.431 52.637 1.00 23.29 ? 73   LEU A CA  1 
ATOM   500  C  C   . LEU A 1 89  ? 14.144 36.037 52.652 1.00 23.46 ? 73   LEU A C   1 
ATOM   501  O  O   . LEU A 1 89  ? 14.391 35.268 53.587 1.00 23.09 ? 73   LEU A O   1 
ATOM   502  C  CB  . LEU A 1 89  ? 16.209 37.347 52.326 1.00 23.65 ? 73   LEU A CB  1 
ATOM   503  C  CG  . LEU A 1 89  ? 16.865 38.723 52.331 1.00 24.19 ? 73   LEU A CG  1 
ATOM   504  C  CD1 . LEU A 1 89  ? 17.629 38.914 53.624 1.00 27.05 ? 73   LEU A CD1 1 
ATOM   505  C  CD2 . LEU A 1 89  ? 17.749 38.828 51.129 1.00 25.92 ? 73   LEU A CD2 1 
ATOM   506  N  N   . SER A 1 90  ? 13.384 35.703 51.622 1.00 23.29 ? 74   SER A N   1 
ATOM   507  C  CA  . SER A 1 90  ? 12.757 34.368 51.546 1.00 23.73 ? 74   SER A CA  1 
ATOM   508  C  C   . SER A 1 90  ? 13.342 33.649 50.375 1.00 23.22 ? 74   SER A C   1 
ATOM   509  O  O   . SER A 1 90  ? 13.316 34.181 49.244 1.00 22.15 ? 74   SER A O   1 
ATOM   510  C  CB  . SER A 1 90  ? 11.231 34.473 51.373 1.00 24.27 ? 74   SER A CB  1 
ATOM   511  O  OG  . SER A 1 90  ? 10.622 35.241 52.419 1.00 27.26 ? 74   SER A OG  1 
ATOM   512  N  N   . THR A 1 91  ? 13.855 32.446 50.615 1.00 22.62 ? 75   THR A N   1 
ATOM   513  C  CA  . THR A 1 91  ? 14.411 31.646 49.502 1.00 22.66 ? 75   THR A CA  1 
ATOM   514  C  C   . THR A 1 91  ? 13.330 31.124 48.558 1.00 22.73 ? 75   THR A C   1 
ATOM   515  O  O   . THR A 1 91  ? 13.568 30.975 47.358 1.00 23.24 ? 75   THR A O   1 
ATOM   516  C  CB  . THR A 1 91  ? 15.209 30.427 49.994 1.00 22.96 ? 75   THR A CB  1 
ATOM   517  O  OG1 . THR A 1 91  ? 14.371 29.566 50.785 1.00 22.59 ? 75   THR A OG1 1 
ATOM   518  C  CG2 . THR A 1 91  ? 16.451 30.878 50.782 1.00 21.78 ? 75   THR A CG2 1 
ATOM   519  N  N   . HIS A 1 92  ? 12.154 30.849 49.125 1.00 22.68 ? 76   HIS A N   1 
ATOM   520  C  CA  . HIS A 1 92  ? 11.031 30.320 48.348 1.00 23.07 ? 76   HIS A CA  1 
ATOM   521  C  C   . HIS A 1 92  ? 9.697  30.465 49.071 1.00 22.98 ? 76   HIS A C   1 
ATOM   522  O  O   . HIS A 1 92  ? 9.679  30.826 50.222 1.00 22.81 ? 76   HIS A O   1 
ATOM   523  C  CB  . HIS A 1 92  ? 11.269 28.887 47.855 1.00 22.62 ? 76   HIS A CB  1 
ATOM   524  C  CG  . HIS A 1 92  ? 11.300 27.831 48.917 1.00 24.06 ? 76   HIS A CG  1 
ATOM   525  N  ND1 . HIS A 1 92  ? 12.266 27.772 49.902 1.00 24.08 ? 76   HIS A ND1 1 
ATOM   526  C  CD2 . HIS A 1 92  ? 10.547 26.709 49.060 1.00 21.96 ? 76   HIS A CD2 1 
ATOM   527  C  CE1 . HIS A 1 92  ? 12.088 26.673 50.622 1.00 24.09 ? 76   HIS A CE1 1 
ATOM   528  N  NE2 . HIS A 1 92  ? 11.047 26.016 50.134 1.00 22.47 ? 76   HIS A NE2 1 
ATOM   529  N  N   . LYS A 1 93  ? 8.603  30.204 48.352 1.00 21.91 ? 77   LYS A N   1 
ATOM   530  C  CA  . LYS A 1 93  ? 7.244  30.539 48.839 1.00 22.87 ? 77   LYS A CA  1 
ATOM   531  C  C   . LYS A 1 93  ? 6.686  29.646 49.941 1.00 22.06 ? 77   LYS A C   1 
ATOM   532  O  O   . LYS A 1 93  ? 5.708  30.026 50.622 1.00 22.71 ? 77   LYS A O   1 
ATOM   533  C  CB  . LYS A 1 93  ? 6.278  30.533 47.651 1.00 22.10 ? 77   LYS A CB  1 
ATOM   534  C  CG  . LYS A 1 93  ? 6.057  29.121 47.085 1.00 24.19 ? 77   LYS A CG  1 
ATOM   535  C  CD  . LYS A 1 93  ? 4.984  29.121 46.013 1.00 27.37 ? 77   LYS A CD  1 
ATOM   536  C  CE  . LYS A 1 93  ? 4.814  27.700 45.523 1.00 27.24 ? 77   LYS A CE  1 
ATOM   537  N  NZ  . LYS A 1 93  ? 3.766  27.636 44.525 1.00 25.46 ? 77   LYS A NZ  1 
ATOM   538  N  N   . HIS A 1 94  ? 7.257  28.436 50.100 1.00 21.29 ? 78   HIS A N   1 
ATOM   539  C  CA  . HIS A 1 94  ? 6.655  27.445 50.994 1.00 21.76 ? 78   HIS A CA  1 
ATOM   540  C  C   . HIS A 1 94  ? 6.476  28.057 52.374 1.00 22.30 ? 78   HIS A C   1 
ATOM   541  O  O   . HIS A 1 94  ? 7.322  28.863 52.810 1.00 22.55 ? 78   HIS A O   1 
ATOM   542  C  CB  . HIS A 1 94  ? 7.534  26.195 51.067 1.00 22.23 ? 78   HIS A CB  1 
ATOM   543  C  CG  . HIS A 1 94  ? 7.410  25.318 49.861 1.00 22.62 ? 78   HIS A CG  1 
ATOM   544  N  ND1 . HIS A 1 94  ? 8.368  24.387 49.506 1.00 23.76 ? 78   HIS A ND1 1 
ATOM   545  C  CD2 . HIS A 1 94  ? 6.440  25.246 48.914 1.00 23.56 ? 78   HIS A CD2 1 
ATOM   546  C  CE1 . HIS A 1 94  ? 7.996  23.788 48.388 1.00 25.88 ? 78   HIS A CE1 1 
ATOM   547  N  NE2 . HIS A 1 94  ? 6.822  24.273 48.021 1.00 23.84 ? 78   HIS A NE2 1 
ATOM   548  N  N   . TRP A 1 95  ? 5.384  27.677 53.046 1.00 22.43 ? 79   TRP A N   1 
ATOM   549  C  CA  . TRP A 1 95  ? 4.952  28.370 54.267 1.00 22.98 ? 79   TRP A CA  1 
ATOM   550  C  C   . TRP A 1 95  ? 5.991  28.265 55.364 1.00 22.97 ? 79   TRP A C   1 
ATOM   551  O  O   . TRP A 1 95  ? 6.077  29.143 56.201 1.00 22.62 ? 79   TRP A O   1 
ATOM   552  C  CB  . TRP A 1 95  ? 3.599  27.823 54.798 1.00 22.66 ? 79   TRP A CB  1 
ATOM   553  C  CG  . TRP A 1 95  ? 2.869  28.815 55.714 1.00 24.64 ? 79   TRP A CG  1 
ATOM   554  C  CD1 . TRP A 1 95  ? 2.527  28.628 57.035 1.00 25.24 ? 79   TRP A CD1 1 
ATOM   555  C  CD2 . TRP A 1 95  ? 2.400  30.129 55.365 1.00 25.96 ? 79   TRP A CD2 1 
ATOM   556  N  NE1 . TRP A 1 95  ? 1.881  29.747 57.525 1.00 25.21 ? 79   TRP A NE1 1 
ATOM   557  C  CE2 . TRP A 1 95  ? 1.799  30.683 56.524 1.00 27.70 ? 79   TRP A CE2 1 
ATOM   558  C  CE3 . TRP A 1 95  ? 2.447  30.901 54.188 1.00 28.80 ? 79   TRP A CE3 1 
ATOM   559  C  CZ2 . TRP A 1 95  ? 1.245  31.958 56.538 1.00 28.52 ? 79   TRP A CZ2 1 
ATOM   560  C  CZ3 . TRP A 1 95  ? 1.885  32.175 54.205 1.00 29.55 ? 79   TRP A CZ3 1 
ATOM   561  C  CH2 . TRP A 1 95  ? 1.298  32.688 55.373 1.00 29.50 ? 79   TRP A CH2 1 
ATOM   562  N  N   . ASP A 1 96  ? 6.765  27.178 55.360 1.00 23.30 ? 80   ASP A N   1 
ATOM   563  C  CA  . ASP A 1 96  ? 7.798  26.992 56.383 1.00 22.75 ? 80   ASP A CA  1 
ATOM   564  C  C   . ASP A 1 96  ? 9.021  27.884 56.137 1.00 22.72 ? 80   ASP A C   1 
ATOM   565  O  O   . ASP A 1 96  ? 9.999  27.857 56.899 1.00 22.48 ? 80   ASP A O   1 
ATOM   566  C  CB  . ASP A 1 96  ? 8.195  25.518 56.537 1.00 22.69 ? 80   ASP A CB  1 
ATOM   567  C  CG  . ASP A 1 96  ? 8.678  24.896 55.240 1.00 24.25 ? 80   ASP A CG  1 
ATOM   568  O  OD1 . ASP A 1 96  ? 7.967  25.039 54.214 1.00 23.44 ? 80   ASP A OD1 1 
ATOM   569  O  OD2 . ASP A 1 96  ? 9.720  24.194 55.274 1.00 20.06 ? 80   ASP A OD2 1 
ATOM   570  N  N   . HIS A 1 97  ? 8.957  28.685 55.082 1.00 22.93 ? 81   HIS A N   1 
ATOM   571  C  CA  . HIS A 1 97  ? 10.007 29.673 54.804 1.00 24.21 ? 81   HIS A CA  1 
ATOM   572  C  C   . HIS A 1 97  ? 9.479  31.084 54.639 1.00 24.20 ? 81   HIS A C   1 
ATOM   573  O  O   . HIS A 1 97  ? 10.264 31.996 54.701 1.00 25.52 ? 81   HIS A O   1 
ATOM   574  C  CB  . HIS A 1 97  ? 10.854 29.302 53.580 1.00 24.56 ? 81   HIS A CB  1 
ATOM   575  C  CG  . HIS A 1 97  ? 11.398 27.913 53.652 1.00 23.62 ? 81   HIS A CG  1 
ATOM   576  N  ND1 . HIS A 1 97  ? 12.726 27.643 53.893 1.00 23.22 ? 81   HIS A ND1 1 
ATOM   577  C  CD2 . HIS A 1 97  ? 10.774 26.713 53.533 1.00 22.50 ? 81   HIS A CD2 1 
ATOM   578  C  CE1 . HIS A 1 97  ? 12.899 26.326 53.934 1.00 24.12 ? 81   HIS A CE1 1 
ATOM   579  N  NE2 . HIS A 1 97  ? 11.730 25.739 53.725 1.00 22.38 ? 81   HIS A NE2 1 
ATOM   580  N  N   . SER A 1 98  ? 8.176  31.262 54.431 1.00 23.88 ? 82   SER A N   1 
ATOM   581  C  CA  . SER A 1 98  ? 7.615  32.603 54.244 1.00 23.65 ? 82   SER A CA  1 
ATOM   582  C  C   . SER A 1 98  ? 6.491  32.968 55.227 1.00 23.40 ? 82   SER A C   1 
ATOM   583  O  O   . SER A 1 98  ? 6.026  34.127 55.247 1.00 22.72 ? 82   SER A O   1 
ATOM   584  C  CB  . SER A 1 98  ? 7.058  32.728 52.847 1.00 23.73 ? 82   SER A CB  1 
ATOM   585  O  OG  . SER A 1 98  ? 5.968  31.833 52.712 1.00 26.16 ? 82   SER A OG  1 
ATOM   586  N  N   . GLY A 1 99  ? 6.012  31.973 55.983 1.00 23.48 ? 83   GLY A N   1 
ATOM   587  C  CA  . GLY A 1 99  ? 4.822  32.134 56.841 1.00 23.66 ? 83   GLY A CA  1 
ATOM   588  C  C   . GLY A 1 99  ? 4.893  33.151 57.968 1.00 23.55 ? 83   GLY A C   1 
ATOM   589  O  O   . GLY A 1 99  ? 3.881  33.407 58.650 1.00 23.44 ? 83   GLY A O   1 
ATOM   590  N  N   . GLY A 1 100 ? 6.071  33.732 58.167 1.00 23.09 ? 84   GLY A N   1 
ATOM   591  C  CA  . GLY A 1 100 ? 6.257  34.753 59.203 1.00 23.09 ? 84   GLY A CA  1 
ATOM   592  C  C   . GLY A 1 100 ? 6.581  36.130 58.667 1.00 23.33 ? 84   GLY A C   1 
ATOM   593  O  O   . GLY A 1 100 ? 6.730  37.061 59.441 1.00 23.79 ? 84   GLY A O   1 
ATOM   594  N  N   . ASN A 1 101 ? 6.714  36.253 57.341 1.00 23.29 ? 85   ASN A N   1 
ATOM   595  C  CA  . ASN A 1 101 ? 7.047  37.546 56.705 1.00 22.85 ? 85   ASN A CA  1 
ATOM   596  C  C   . ASN A 1 101 ? 6.176  38.731 57.132 1.00 23.16 ? 85   ASN A C   1 
ATOM   597  O  O   . ASN A 1 101 ? 6.690  39.733 57.660 1.00 22.19 ? 85   ASN A O   1 
ATOM   598  C  CB  . ASN A 1 101 ? 7.008  37.417 55.167 1.00 22.55 ? 85   ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 101 ? 8.159  36.601 54.609 1.00 23.44 ? 85   ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 101 ? 9.032  36.133 55.339 1.00 22.17 ? 85   ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 101 ? 8.170  36.448 53.284 1.00 23.68 ? 85   ASN A ND2 1 
ATOM   602  N  N   . ALA A 1 102 ? 4.873  38.607 56.895 1.00 22.76 ? 86   ALA A N   1 
ATOM   603  C  CA  . ALA A 1 102 ? 3.903  39.646 57.230 1.00 23.92 ? 86   ALA A CA  1 
ATOM   604  C  C   . ALA A 1 102 ? 3.928  39.964 58.726 1.00 24.12 ? 86   ALA A C   1 
ATOM   605  O  O   . ALA A 1 102 ? 3.947  41.137 59.113 1.00 24.31 ? 86   ALA A O   1 
ATOM   606  C  CB  . ALA A 1 102 ? 2.495  39.219 56.773 1.00 24.17 ? 86   ALA A CB  1 
ATOM   607  N  N   . LYS A 1 103 ? 3.956  38.923 59.564 1.00 24.26 ? 87   LYS A N   1 
ATOM   608  C  CA  . LYS A 1 103 ? 3.892  39.107 61.026 1.00 25.35 ? 87   LYS A CA  1 
ATOM   609  C  C   . LYS A 1 103 ? 5.149  39.743 61.586 1.00 24.53 ? 87   LYS A C   1 
ATOM   610  O  O   . LYS A 1 103 ? 5.065  40.653 62.408 1.00 24.60 ? 87   LYS A O   1 
ATOM   611  C  CB  . LYS A 1 103 ? 3.635  37.775 61.756 1.00 26.19 ? 87   LYS A CB  1 
ATOM   612  C  CG  . LYS A 1 103 ? 2.199  37.277 61.686 1.00 28.34 ? 87   LYS A CG  1 
ATOM   613  C  CD  . LYS A 1 103 ? 2.036  35.954 62.442 1.00 31.85 ? 87   LYS A CD  1 
ATOM   614  C  CE  . LYS A 1 103 ? 0.776  35.199 62.013 1.00 32.70 ? 87   LYS A CE  1 
ATOM   615  N  NZ  . LYS A 1 103 ? -0.451 36.024 62.096 1.00 34.65 ? 87   LYS A NZ  1 
ATOM   616  N  N   . LEU A 1 104 ? 6.310  39.249 61.161 1.00 24.19 ? 88   LEU A N   1 
ATOM   617  C  CA  . LEU A 1 104 ? 7.577  39.811 61.612 1.00 23.59 ? 88   LEU A CA  1 
ATOM   618  C  C   . LEU A 1 104 ? 7.723  41.235 61.094 1.00 23.78 ? 88   LEU A C   1 
ATOM   619  O  O   . LEU A 1 104 ? 8.122  42.107 61.849 1.00 22.77 ? 88   LEU A O   1 
ATOM   620  C  CB  . LEU A 1 104 ? 8.788  38.935 61.234 1.00 23.14 ? 88   LEU A CB  1 
ATOM   621  C  CG  . LEU A 1 104 ? 10.163 39.482 61.677 1.00 22.88 ? 88   LEU A CG  1 
ATOM   622  C  CD1 . LEU A 1 104 ? 10.223 39.682 63.181 1.00 25.02 ? 88   LEU A CD1 1 
ATOM   623  C  CD2 . LEU A 1 104 ? 11.353 38.618 61.193 1.00 24.76 ? 88   LEU A CD2 1 
ATOM   624  N  N   . LYS A 1 105 ? 7.365  41.483 59.830 1.00 23.87 ? 89   LYS A N   1 
ATOM   625  C  CA  . LYS A 1 105 ? 7.408  42.849 59.302 1.00 24.50 ? 89   LYS A CA  1 
ATOM   626  C  C   . LYS A 1 105 ? 6.552  43.806 60.139 1.00 25.02 ? 89   LYS A C   1 
ATOM   627  O  O   . LYS A 1 105 ? 7.001  44.910 60.445 1.00 24.80 ? 89   LYS A O   1 
ATOM   628  C  CB  . LYS A 1 105 ? 7.002  42.907 57.826 1.00 24.58 ? 89   LYS A CB  1 
ATOM   629  C  CG  . LYS A 1 105 ? 6.959  44.331 57.275 1.00 25.24 ? 89   LYS A CG  1 
ATOM   630  C  CD  . LYS A 1 105 ? 6.724  44.370 55.782 1.00 26.35 ? 89   LYS A CD  1 
ATOM   631  C  CE  . LYS A 1 105 ? 6.828  45.793 55.306 1.00 26.83 ? 89   LYS A CE  1 
ATOM   632  N  NZ  . LYS A 1 105 ? 6.849  45.906 53.851 1.00 28.96 ? 89   LYS A NZ  1 
ATOM   633  N  N   . ALA A 1 106 ? 5.348  43.376 60.523 1.00 24.86 ? 90   ALA A N   1 
ATOM   634  C  CA  . ALA A 1 106 ? 4.449  44.198 61.340 1.00 25.96 ? 90   ALA A CA  1 
ATOM   635  C  C   . ALA A 1 106 ? 5.142  44.534 62.655 1.00 25.95 ? 90   ALA A C   1 
ATOM   636  O  O   . ALA A 1 106 ? 5.124  45.693 63.090 1.00 26.48 ? 90   ALA A O   1 
ATOM   637  C  CB  . ALA A 1 106 ? 3.117  43.476 61.594 1.00 25.59 ? 90   ALA A CB  1 
ATOM   638  N  N   . GLU A 1 107 ? 5.813  43.535 63.240 1.00 25.94 ? 91   GLU A N   1 
ATOM   639  C  CA  . GLU A 1 107 ? 6.385  43.664 64.593 1.00 25.99 ? 91   GLU A CA  1 
ATOM   640  C  C   . GLU A 1 107 ? 7.219  44.923 64.892 1.00 25.87 ? 91   GLU A C   1 
ATOM   641  O  O   . GLU A 1 107 ? 7.385  45.276 66.060 1.00 26.03 ? 91   GLU A O   1 
ATOM   642  C  CB  . GLU A 1 107 ? 6.968  42.355 65.133 1.00 26.15 ? 91   GLU A CB  1 
ATOM   643  C  CG  . GLU A 1 107 ? 5.851  41.403 65.566 1.00 26.45 ? 91   GLU A CG  1 
ATOM   644  C  CD  . GLU A 1 107 ? 6.145  40.629 66.839 1.00 28.05 ? 91   GLU A CD  1 
ATOM   645  O  OE1 . GLU A 1 107 ? 7.126  40.947 67.557 1.00 28.94 ? 91   GLU A OE1 1 
ATOM   646  O  OE2 . GLU A 1 107 ? 5.363  39.697 67.132 1.00 28.69 ? 91   GLU A OE2 1 
ATOM   647  N  N   . LEU A 1 108 ? 7.828  45.570 63.890 1.00 25.62 ? 92   LEU A N   1 
ATOM   648  C  CA  . LEU A 1 108 ? 9.213  45.391 63.448 1.00 24.89 ? 92   LEU A CA  1 
ATOM   649  C  C   . LEU A 1 108 ? 9.205  46.806 62.865 1.00 25.32 ? 92   LEU A C   1 
ATOM   650  O  O   . LEU A 1 108 ? 10.114 47.612 63.104 1.00 25.02 ? 92   LEU A O   1 
ATOM   651  C  CB  . LEU A 1 108 ? 9.484  44.340 62.369 1.00 24.85 ? 92   LEU A CB  1 
ATOM   652  C  CG  . LEU A 1 108 ? 10.990 43.968 62.260 1.00 23.07 ? 92   LEU A CG  1 
ATOM   653  C  CD1 . LEU A 1 108 ? 11.528 43.290 63.524 1.00 20.09 ? 92   LEU A CD1 1 
ATOM   654  C  CD2 . LEU A 1 108 ? 11.379 43.130 61.016 1.00 20.64 ? 92   LEU A CD2 1 
ATOM   655  N  N   . GLU A 1 109 ? 8.106  47.095 62.151 1.00 25.25 ? 93   GLU A N   1 
ATOM   656  C  CA  . GLU A 1 109 ? 7.667  48.451 61.804 1.00 25.55 ? 93   GLU A CA  1 
ATOM   657  C  C   . GLU A 1 109 ? 7.038  49.156 63.018 1.00 25.63 ? 93   GLU A C   1 
ATOM   658  O  O   . GLU A 1 109 ? 7.169  50.377 63.171 1.00 25.14 ? 93   GLU A O   1 
ATOM   659  C  CB  . GLU A 1 109 ? 6.669  48.432 60.629 1.00 25.64 ? 93   GLU A CB  1 
ATOM   660  C  CG  . GLU A 1 109 ? 7.284  48.000 59.288 1.00 27.08 ? 93   GLU A CG  1 
ATOM   661  C  CD  . GLU A 1 109 ? 6.350  48.152 58.079 1.00 28.72 ? 93   GLU A CD  1 
ATOM   662  O  OE1 . GLU A 1 109 ? 6.878  48.387 56.959 1.00 29.40 ? 93   GLU A OE1 1 
ATOM   663  O  OE2 . GLU A 1 109 ? 5.111  48.019 58.232 1.00 27.78 ? 93   GLU A OE2 1 
ATOM   664  N  N   . ALA A 1 110 ? 6.357  48.387 63.871 1.00 25.60 ? 94   ALA A N   1 
ATOM   665  C  CA  . ALA A 1 110 ? 5.801  48.915 65.118 1.00 25.71 ? 94   ALA A CA  1 
ATOM   666  C  C   . ALA A 1 110 ? 6.894  49.280 66.120 1.00 25.84 ? 94   ALA A C   1 
ATOM   667  O  O   . ALA A 1 110 ? 6.719  50.206 66.917 1.00 25.60 ? 94   ALA A O   1 
ATOM   668  C  CB  . ALA A 1 110 ? 4.812  47.936 65.738 1.00 25.68 ? 94   ALA A CB  1 
ATOM   669  N  N   . MET A 1 111 ? 8.017  48.563 66.081 1.00 25.78 ? 95   MET A N   1 
ATOM   670  C  CA  . MET A 1 111 ? 9.136  48.869 66.980 1.00 26.25 ? 95   MET A CA  1 
ATOM   671  C  C   . MET A 1 111 ? 10.262 49.690 66.322 1.00 26.20 ? 95   MET A C   1 
ATOM   672  O  O   . MET A 1 111 ? 11.225 50.072 66.984 1.00 26.02 ? 95   MET A O   1 
ATOM   673  C  CB  . MET A 1 111 ? 9.658  47.601 67.685 1.00 26.31 ? 95   MET A CB  1 
ATOM   674  C  CG  . MET A 1 111 ? 10.644 46.741 66.899 1.00 27.02 ? 95   MET A CG  1 
ATOM   675  S  SD  . MET A 1 111 ? 11.382 45.426 67.907 1.00 27.79 ? 95   MET A SD  1 
ATOM   676  C  CE  . MET A 1 111 ? 10.207 44.091 67.666 1.00 28.01 ? 95   MET A CE  1 
ATOM   677  N  N   . ASN A 1 112 ? 10.122 49.974 65.027 1.00 26.23 ? 96   ASN A N   1 
ATOM   678  C  CA  . ASN A 1 112 ? 11.052 50.863 64.330 1.00 26.45 ? 96   ASN A CA  1 
ATOM   679  C  C   . ASN A 1 112 ? 10.370 51.835 63.360 1.00 26.67 ? 96   ASN A C   1 
ATOM   680  O  O   . ASN A 1 112 ? 10.130 53.011 63.711 1.00 26.27 ? 96   ASN A O   1 
ATOM   681  C  CB  . ASN A 1 112 ? 12.154 50.075 63.622 1.00 26.95 ? 96   ASN A CB  1 
ATOM   682  N  N   . VAL A 1 115 ? 12.611 49.246 60.209 1.00 24.41 ? 99   VAL A N   1 
ATOM   683  C  CA  . VAL A 1 115 ? 11.702 49.828 59.226 1.00 23.66 ? 99   VAL A CA  1 
ATOM   684  C  C   . VAL A 1 115 ? 12.277 51.120 58.622 1.00 23.14 ? 99   VAL A C   1 
ATOM   685  O  O   . VAL A 1 115 ? 12.893 51.915 59.342 1.00 23.46 ? 99   VAL A O   1 
ATOM   686  C  CB  . VAL A 1 115 ? 10.323 50.069 59.828 1.00 23.86 ? 99   VAL A CB  1 
ATOM   687  N  N   . PRO A 1 116 ? 12.077 51.338 57.300 1.00 22.56 ? 100  PRO A N   1 
ATOM   688  C  CA  . PRO A 1 116 ? 11.242 50.567 56.365 1.00 22.31 ? 100  PRO A CA  1 
ATOM   689  C  C   . PRO A 1 116 ? 11.757 49.137 56.143 1.00 22.21 ? 100  PRO A C   1 
ATOM   690  O  O   . PRO A 1 116 ? 12.924 48.943 55.764 1.00 22.10 ? 100  PRO A O   1 
ATOM   691  C  CB  . PRO A 1 116 ? 11.336 51.367 55.066 1.00 22.36 ? 100  PRO A CB  1 
ATOM   692  C  CG  . PRO A 1 116 ? 12.621 52.111 55.171 1.00 22.51 ? 100  PRO A CG  1 
ATOM   693  C  CD  . PRO A 1 116 ? 12.771 52.446 56.618 1.00 22.56 ? 100  PRO A CD  1 
ATOM   694  N  N   . VAL A 1 117 ? 10.889 48.158 56.392 1.00 21.72 ? 101  VAL A N   1 
ATOM   695  C  CA  . VAL A 1 117 ? 11.282 46.757 56.306 1.00 21.68 ? 101  VAL A CA  1 
ATOM   696  C  C   . VAL A 1 117 ? 11.094 46.264 54.889 1.00 21.71 ? 101  VAL A C   1 
ATOM   697  O  O   . VAL A 1 117 ? 9.995  46.315 54.322 1.00 22.04 ? 101  VAL A O   1 
ATOM   698  C  CB  . VAL A 1 117 ? 10.525 45.865 57.314 1.00 21.92 ? 101  VAL A CB  1 
ATOM   699  C  CG1 . VAL A 1 117 ? 10.774 44.380 57.043 1.00 21.21 ? 101  VAL A CG1 1 
ATOM   700  C  CG2 . VAL A 1 117 ? 10.929 46.235 58.739 1.00 21.97 ? 101  VAL A CG2 1 
ATOM   701  N  N   . VAL A 1 118 ? 12.195 45.815 54.310 1.00 20.88 ? 102  VAL A N   1 
ATOM   702  C  CA  . VAL A 1 118 ? 12.185 45.343 52.958 1.00 20.25 ? 102  VAL A CA  1 
ATOM   703  C  C   . VAL A 1 118 ? 12.050 43.812 52.987 1.00 20.24 ? 102  VAL A C   1 
ATOM   704  O  O   . VAL A 1 118 ? 12.765 43.123 53.732 1.00 21.67 ? 102  VAL A O   1 
ATOM   705  C  CB  . VAL A 1 118 ? 13.462 45.786 52.237 1.00 19.83 ? 102  VAL A CB  1 
ATOM   706  C  CG1 . VAL A 1 118 ? 13.704 44.934 51.019 1.00 20.13 ? 102  VAL A CG1 1 
ATOM   707  C  CG2 . VAL A 1 118 ? 13.391 47.278 51.881 1.00 19.48 ? 102  VAL A CG2 1 
ATOM   708  N  N   . VAL A 1 119 ? 11.126 43.292 52.182 1.00 20.10 ? 103  VAL A N   1 
ATOM   709  C  CA  . VAL A 1 119 ? 10.937 41.849 52.073 1.00 19.56 ? 103  VAL A CA  1 
ATOM   710  C  C   . VAL A 1 119 ? 11.363 41.409 50.673 1.00 20.60 ? 103  VAL A C   1 
ATOM   711  O  O   . VAL A 1 119 ? 10.726 41.762 49.679 1.00 21.29 ? 103  VAL A O   1 
ATOM   712  C  CB  . VAL A 1 119 ? 9.480  41.383 52.394 1.00 19.70 ? 103  VAL A CB  1 
ATOM   713  C  CG1 . VAL A 1 119 ? 9.357  39.848 52.286 1.00 18.49 ? 103  VAL A CG1 1 
ATOM   714  C  CG2 . VAL A 1 119 ? 9.028  41.862 53.778 1.00 18.32 ? 103  VAL A CG2 1 
ATOM   715  N  N   . VAL A 1 120 ? 12.438 40.619 50.615 1.00 20.77 ? 104  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 120 ? 13.005 40.153 49.358 1.00 20.98 ? 104  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 120 ? 12.540 38.713 49.028 1.00 22.06 ? 104  VAL A C   1 
ATOM   718  O  O   . VAL A 1 120 ? 12.547 37.812 49.880 1.00 22.34 ? 104  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 120 ? 14.564 40.196 49.430 1.00 21.00 ? 104  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 120 ? 15.179 39.641 48.130 1.00 22.60 ? 104  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 120 ? 15.031 41.630 49.773 1.00 21.84 ? 104  VAL A CG2 1 
ATOM   722  N  N   . GLY A 1 121 ? 12.137 38.498 47.788 1.00 22.28 ? 105  GLY A N   1 
ATOM   723  C  CA  . GLY A 1 121 ? 11.747 37.160 47.353 1.00 23.27 ? 105  GLY A CA  1 
ATOM   724  C  C   . GLY A 1 121 ? 11.879 37.001 45.861 1.00 22.95 ? 105  GLY A C   1 
ATOM   725  O  O   . GLY A 1 121 ? 11.849 37.980 45.107 1.00 23.20 ? 105  GLY A O   1 
ATOM   726  N  N   . GLY A 1 122 ? 12.037 35.763 45.419 1.00 23.44 ? 106  GLY A N   1 
ATOM   727  C  CA  . GLY A 1 122 ? 12.101 35.471 43.988 1.00 23.11 ? 106  GLY A CA  1 
ATOM   728  C  C   . GLY A 1 122 ? 10.846 35.956 43.276 1.00 23.61 ? 106  GLY A C   1 
ATOM   729  O  O   . GLY A 1 122 ? 9.720  35.619 43.685 1.00 23.92 ? 106  GLY A O   1 
ATOM   730  N  N   . ALA A 1 123 ? 11.031 36.706 42.192 1.00 22.83 ? 107  ALA A N   1 
ATOM   731  C  CA  . ALA A 1 123 ? 9.905  37.288 41.445 1.00 23.61 ? 107  ALA A CA  1 
ATOM   732  C  C   . ALA A 1 123 ? 8.845  36.268 41.031 1.00 23.65 ? 107  ALA A C   1 
ATOM   733  O  O   . ALA A 1 123 ? 7.661  36.593 41.017 1.00 24.25 ? 107  ALA A O   1 
ATOM   734  C  CB  . ALA A 1 123 ? 10.377 38.079 40.227 1.00 22.91 ? 107  ALA A CB  1 
ATOM   735  N  N   . ASN A 1 124 ? 9.270  35.054 40.689 1.00 23.46 ? 108  ASN A N   1 
ATOM   736  C  CA  . ASN A 1 124 ? 8.359  34.069 40.122 1.00 23.65 ? 108  ASN A CA  1 
ATOM   737  C  C   . ASN A 1 124 ? 7.725  33.139 41.164 1.00 23.71 ? 108  ASN A C   1 
ATOM   738  O  O   . ASN A 1 124 ? 6.993  32.234 40.797 1.00 24.23 ? 108  ASN A O   1 
ATOM   739  C  CB  . ASN A 1 124 ? 9.094  33.273 39.044 1.00 24.45 ? 108  ASN A CB  1 
ATOM   740  C  CG  . ASN A 1 124 ? 9.733  34.172 38.014 1.00 25.67 ? 108  ASN A CG  1 
ATOM   741  O  OD1 . ASN A 1 124 ? 9.137  35.158 37.596 1.00 26.20 ? 108  ASN A OD1 1 
ATOM   742  N  ND2 . ASN A 1 124 ? 10.969 33.864 37.627 1.00 25.81 ? 108  ASN A ND2 1 
ATOM   743  N  N   . ASP A 1 125 ? 8.002  33.378 42.440 1.00 22.31 ? 109  ASP A N   1 
ATOM   744  C  CA  . ASP A 1 125 ? 7.389  32.602 43.520 1.00 23.62 ? 109  ASP A CA  1 
ATOM   745  C  C   . ASP A 1 125 ? 6.255  33.327 44.214 1.00 24.64 ? 109  ASP A C   1 
ATOM   746  O  O   . ASP A 1 125 ? 5.620  32.727 45.060 1.00 25.65 ? 109  ASP A O   1 
ATOM   747  C  CB  . ASP A 1 125 ? 8.417  32.151 44.565 1.00 23.64 ? 109  ASP A CB  1 
ATOM   748  C  CG  . ASP A 1 125 ? 8.658  30.621 44.555 1.00 25.38 ? 109  ASP A CG  1 
ATOM   749  O  OD1 . ASP A 1 125 ? 8.245  29.953 43.594 1.00 23.28 ? 109  ASP A OD1 1 
ATOM   750  O  OD2 . ASP A 1 125 ? 9.280  30.100 45.511 1.00 23.00 ? 109  ASP A OD2 1 
ATOM   751  N  N   . SER A 1 126 ? 5.994  34.596 43.861 1.00 24.73 ? 110  SER A N   1 
ATOM   752  C  CA  . SER A 1 126 ? 4.890  35.375 44.494 1.00 26.45 ? 110  SER A CA  1 
ATOM   753  C  C   . SER A 1 126 ? 4.926  35.237 46.022 1.00 26.16 ? 110  SER A C   1 
ATOM   754  O  O   . SER A 1 126 ? 3.944  34.813 46.655 1.00 27.71 ? 110  SER A O   1 
ATOM   755  C  CB  . SER A 1 126 ? 3.523  34.930 43.951 1.00 26.21 ? 110  SER A CB  1 
ATOM   756  O  OG  . SER A 1 126 ? 3.408  35.267 42.572 1.00 30.35 ? 110  SER A OG  1 
ATOM   757  N  N   . ILE A 1 127 ? 6.058  35.598 46.622 1.00 25.40 ? 111  ILE A N   1 
ATOM   758  C  CA  . ILE A 1 127 ? 6.267  35.298 48.031 1.00 25.25 ? 111  ILE A CA  1 
ATOM   759  C  C   . ILE A 1 127 ? 5.427  36.257 48.896 1.00 24.53 ? 111  ILE A C   1 
ATOM   760  O  O   . ILE A 1 127 ? 5.361  37.451 48.590 1.00 24.12 ? 111  ILE A O   1 
ATOM   761  C  CB  . ILE A 1 127 ? 7.759  35.317 48.389 1.00 26.16 ? 111  ILE A CB  1 
ATOM   762  C  CG1 . ILE A 1 127 ? 8.472  34.142 47.669 1.00 27.42 ? 111  ILE A CG1 1 
ATOM   763  C  CG2 . ILE A 1 127 ? 7.963  35.268 49.911 1.00 26.14 ? 111  ILE A CG2 1 
ATOM   764  C  CD1 . ILE A 1 127 ? 9.762  33.834 48.179 1.00 30.27 ? 111  ILE A CD1 1 
ATOM   765  N  N   . PRO A 1 128 ? 4.721  35.720 49.914 1.00 24.21 ? 112  PRO A N   1 
ATOM   766  C  CA  . PRO A 1 128 ? 3.943  36.561 50.828 1.00 23.77 ? 112  PRO A CA  1 
ATOM   767  C  C   . PRO A 1 128 ? 4.719  37.788 51.326 1.00 23.35 ? 112  PRO A C   1 
ATOM   768  O  O   . PRO A 1 128 ? 5.857  37.654 51.823 1.00 21.85 ? 112  PRO A O   1 
ATOM   769  C  CB  . PRO A 1 128 ? 3.626  35.614 51.985 1.00 25.12 ? 112  PRO A CB  1 
ATOM   770  C  CG  . PRO A 1 128 ? 3.609  34.236 51.339 1.00 23.58 ? 112  PRO A CG  1 
ATOM   771  C  CD  . PRO A 1 128 ? 4.593  34.275 50.226 1.00 24.75 ? 112  PRO A CD  1 
ATOM   772  N  N   . ALA A 1 129 ? 4.097  38.958 51.149 1.00 21.91 ? 113  ALA A N   1 
ATOM   773  C  CA  . ALA A 1 129 ? 4.559  40.248 51.708 1.00 21.50 ? 113  ALA A CA  1 
ATOM   774  C  C   . ALA A 1 129 ? 5.800  40.820 50.991 1.00 22.03 ? 113  ALA A C   1 
ATOM   775  O  O   . ALA A 1 129 ? 6.387  41.813 51.462 1.00 21.30 ? 113  ALA A O   1 
ATOM   776  C  CB  . ALA A 1 129 ? 4.805  40.121 53.206 1.00 21.14 ? 113  ALA A CB  1 
ATOM   777  N  N   . VAL A 1 130 ? 6.177  40.221 49.859 1.00 21.76 ? 114  VAL A N   1 
ATOM   778  C  CA  . VAL A 1 130 ? 7.390  40.681 49.135 1.00 23.15 ? 114  VAL A CA  1 
ATOM   779  C  C   . VAL A 1 130 ? 7.251  42.137 48.656 1.00 22.96 ? 114  VAL A C   1 
ATOM   780  O  O   . VAL A 1 130 ? 6.198  42.554 48.111 1.00 22.24 ? 114  VAL A O   1 
ATOM   781  C  CB  . VAL A 1 130 ? 7.831  39.716 48.025 1.00 23.41 ? 114  VAL A CB  1 
ATOM   782  C  CG1 . VAL A 1 130 ? 8.916  40.320 47.111 1.00 23.84 ? 114  VAL A CG1 1 
ATOM   783  C  CG2 . VAL A 1 130 ? 8.470  38.477 48.678 1.00 26.86 ? 114  VAL A CG2 1 
ATOM   784  N  N   . THR A 1 131 ? 8.315  42.909 48.890 1.00 22.27 ? 115  THR A N   1 
ATOM   785  C  CA  . THR A 1 131 ? 8.388  44.301 48.414 1.00 21.46 ? 115  THR A CA  1 
ATOM   786  C  C   . THR A 1 131 ? 9.542  44.496 47.426 1.00 20.36 ? 115  THR A C   1 
ATOM   787  O  O   . THR A 1 131 ? 9.595  45.502 46.712 1.00 20.37 ? 115  THR A O   1 
ATOM   788  C  CB  . THR A 1 131 ? 8.540  45.328 49.567 1.00 21.89 ? 115  THR A CB  1 
ATOM   789  O  OG1 . THR A 1 131 ? 9.816  45.164 50.202 1.00 22.09 ? 115  THR A OG1 1 
ATOM   790  C  CG2 . THR A 1 131 ? 7.414  45.181 50.595 1.00 22.77 ? 115  THR A CG2 1 
ATOM   791  N  N   A LYS A 1 132 ? 10.477 43.546 47.416 0.50 20.41 ? 116  LYS A N   1 
ATOM   792  N  N   B LYS A 1 132 ? 10.473 43.551 47.416 0.50 20.43 ? 116  LYS A N   1 
ATOM   793  C  CA  A LYS A 1 132 ? 11.615 43.536 46.472 0.50 20.48 ? 116  LYS A CA  1 
ATOM   794  C  CA  B LYS A 1 132 ? 11.554 43.548 46.427 0.50 20.52 ? 116  LYS A CA  1 
ATOM   795  C  C   A LYS A 1 132 ? 11.664 42.201 45.687 0.50 20.56 ? 116  LYS A C   1 
ATOM   796  C  C   B LYS A 1 132 ? 11.619 42.202 45.702 0.50 20.61 ? 116  LYS A C   1 
ATOM   797  O  O   A LYS A 1 132 ? 12.383 41.262 46.096 0.50 21.30 ? 116  LYS A O   1 
ATOM   798  O  O   B LYS A 1 132 ? 12.290 41.258 46.171 0.50 21.48 ? 116  LYS A O   1 
ATOM   799  C  CB  A LYS A 1 132 ? 12.954 43.744 47.212 0.50 20.00 ? 116  LYS A CB  1 
ATOM   800  C  CB  B LYS A 1 132 ? 12.901 43.887 47.068 0.50 20.08 ? 116  LYS A CB  1 
ATOM   801  C  CG  A LYS A 1 132 ? 13.245 45.155 47.755 0.50 19.65 ? 116  LYS A CG  1 
ATOM   802  C  CG  B LYS A 1 132 ? 14.092 43.776 46.100 0.50 19.48 ? 116  LYS A CG  1 
ATOM   803  C  CD  A LYS A 1 132 ? 14.780 45.392 48.041 0.50 18.30 ? 116  LYS A CD  1 
ATOM   804  C  CD  B LYS A 1 132 ? 13.964 44.750 44.913 0.50 20.34 ? 116  LYS A CD  1 
ATOM   805  C  CE  A LYS A 1 132 ? 15.056 46.811 48.606 0.50 18.95 ? 116  LYS A CE  1 
ATOM   806  C  CE  B LYS A 1 132 ? 15.239 44.869 44.112 0.50 19.47 ? 116  LYS A CE  1 
ATOM   807  N  NZ  A LYS A 1 132 ? 16.483 47.088 49.130 0.50 15.18 ? 116  LYS A NZ  1 
ATOM   808  N  NZ  B LYS A 1 132 ? 15.414 43.760 43.138 0.50 16.92 ? 116  LYS A NZ  1 
ATOM   809  N  N   . PRO A 1 133 ? 10.888 42.080 44.574 1.00 21.05 ? 117  PRO A N   1 
ATOM   810  C  CA  . PRO A 1 133 ? 10.983 40.830 43.799 1.00 21.26 ? 117  PRO A CA  1 
ATOM   811  C  C   . PRO A 1 133 ? 12.348 40.799 43.126 1.00 22.76 ? 117  PRO A C   1 
ATOM   812  O  O   . PRO A 1 133 ? 12.812 41.849 42.642 1.00 24.33 ? 117  PRO A O   1 
ATOM   813  C  CB  . PRO A 1 133 ? 9.841  40.921 42.786 1.00 21.04 ? 117  PRO A CB  1 
ATOM   814  C  CG  . PRO A 1 133 ? 9.573  42.413 42.652 1.00 20.44 ? 117  PRO A CG  1 
ATOM   815  C  CD  . PRO A 1 133 ? 9.905  43.021 43.995 1.00 21.13 ? 117  PRO A CD  1 
ATOM   816  N  N   . VAL A 1 134 ? 13.017 39.647 43.161 1.00 22.64 ? 118  VAL A N   1 
ATOM   817  C  CA  . VAL A 1 134 ? 14.373 39.526 42.567 1.00 23.03 ? 118  VAL A CA  1 
ATOM   818  C  C   . VAL A 1 134 ? 14.510 38.389 41.550 1.00 22.83 ? 118  VAL A C   1 
ATOM   819  O  O   . VAL A 1 134 ? 13.744 37.399 41.560 1.00 22.89 ? 118  VAL A O   1 
ATOM   820  C  CB  . VAL A 1 134 ? 15.496 39.363 43.637 1.00 22.99 ? 118  VAL A CB  1 
ATOM   821  C  CG1 . VAL A 1 134 ? 15.622 40.634 44.534 1.00 23.58 ? 118  VAL A CG1 1 
ATOM   822  C  CG2 . VAL A 1 134 ? 15.264 38.100 44.516 1.00 24.30 ? 118  VAL A CG2 1 
ATOM   823  N  N   . ARG A 1 135 ? 15.498 38.566 40.673 1.00 23.90 ? 119  ARG A N   1 
ATOM   824  C  CA  . ARG A 1 135 ? 15.832 37.654 39.585 1.00 23.50 ? 119  ARG A CA  1 
ATOM   825  C  C   . ARG A 1 135 ? 17.350 37.541 39.526 1.00 23.25 ? 119  ARG A C   1 
ATOM   826  O  O   . ARG A 1 135 ? 18.064 38.351 40.121 1.00 21.70 ? 119  ARG A O   1 
ATOM   827  C  CB  . ARG A 1 135 ? 15.286 38.189 38.257 1.00 25.13 ? 119  ARG A CB  1 
ATOM   828  C  CG  . ARG A 1 135 ? 13.735 38.247 38.235 1.00 27.31 ? 119  ARG A CG  1 
ATOM   829  C  CD  . ARG A 1 135 ? 13.241 39.142 37.148 1.00 27.45 ? 119  ARG A CD  1 
ATOM   830  N  NE  . ARG A 1 135 ? 11.809 39.483 37.248 1.00 30.40 ? 119  ARG A NE  1 
ATOM   831  C  CZ  . ARG A 1 135 ? 11.296 40.480 37.985 1.00 30.88 ? 119  ARG A CZ  1 
ATOM   832  N  NH1 . ARG A 1 135 ? 12.081 41.236 38.746 1.00 32.05 ? 119  ARG A NH1 1 
ATOM   833  N  NH2 . ARG A 1 135 ? 9.988  40.714 37.973 1.00 30.17 ? 119  ARG A NH2 1 
ATOM   834  N  N   . GLU A 1 136 ? 17.829 36.554 38.789 1.00 22.47 ? 120  GLU A N   1 
ATOM   835  C  CA  . GLU A 1 136 ? 19.263 36.247 38.707 1.00 24.30 ? 120  GLU A CA  1 
ATOM   836  C  C   . GLU A 1 136 ? 20.089 37.504 38.465 1.00 22.97 ? 120  GLU A C   1 
ATOM   837  O  O   . GLU A 1 136 ? 19.786 38.299 37.578 1.00 22.29 ? 120  GLU A O   1 
ATOM   838  C  CB  . GLU A 1 136 ? 19.508 35.243 37.576 1.00 25.73 ? 120  GLU A CB  1 
ATOM   839  C  CG  . GLU A 1 136 ? 20.975 35.023 37.252 1.00 29.80 ? 120  GLU A CG  1 
ATOM   840  C  CD  . GLU A 1 136 ? 21.607 33.832 37.940 1.00 35.68 ? 120  GLU A CD  1 
ATOM   841  O  OE1 . GLU A 1 136 ? 20.919 32.860 38.326 1.00 33.57 ? 120  GLU A OE1 1 
ATOM   842  O  OE2 . GLU A 1 136 ? 22.865 33.847 38.041 1.00 41.87 ? 120  GLU A OE2 1 
ATOM   843  N  N   . GLY A 1 137 ? 21.137 37.676 39.256 1.00 23.33 ? 121  GLY A N   1 
ATOM   844  C  CA  . GLY A 1 137 ? 22.062 38.814 39.051 1.00 23.28 ? 121  GLY A CA  1 
ATOM   845  C  C   . GLY A 1 137 ? 21.683 40.049 39.856 1.00 22.95 ? 121  GLY A C   1 
ATOM   846  O  O   . GLY A 1 137 ? 22.492 40.979 39.987 1.00 21.90 ? 121  GLY A O   1 
ATOM   847  N  N   . ASP A 1 138 ? 20.442 40.107 40.342 1.00 22.36 ? 122  ASP A N   1 
ATOM   848  C  CA  . ASP A 1 138 ? 20.028 41.217 41.212 1.00 22.50 ? 122  ASP A CA  1 
ATOM   849  C  C   . ASP A 1 138 ? 20.880 41.225 42.475 1.00 22.67 ? 122  ASP A C   1 
ATOM   850  O  O   . ASP A 1 138 ? 21.345 40.179 42.928 1.00 22.44 ? 122  ASP A O   1 
ATOM   851  C  CB  . ASP A 1 138 ? 18.539 41.105 41.614 1.00 22.66 ? 122  ASP A CB  1 
ATOM   852  C  CG  . ASP A 1 138 ? 17.601 41.427 40.475 1.00 24.66 ? 122  ASP A CG  1 
ATOM   853  O  OD1 . ASP A 1 138 ? 18.089 41.854 39.398 1.00 24.79 ? 122  ASP A OD1 1 
ATOM   854  O  OD2 . ASP A 1 138 ? 16.372 41.256 40.648 1.00 23.70 ? 122  ASP A OD2 1 
ATOM   855  N  N   . ARG A 1 139 ? 21.122 42.408 43.023 1.00 21.94 ? 123  ARG A N   1 
ATOM   856  C  CA  A ARG A 1 139 ? 21.754 42.521 44.330 0.50 21.81 ? 123  ARG A CA  1 
ATOM   857  C  CA  B ARG A 1 139 ? 21.750 42.512 44.330 0.50 21.94 ? 123  ARG A CA  1 
ATOM   858  C  C   . ARG A 1 139 ? 20.934 43.466 45.215 1.00 22.17 ? 123  ARG A C   1 
ATOM   859  O  O   . ARG A 1 139 ? 20.307 44.406 44.724 1.00 21.88 ? 123  ARG A O   1 
ATOM   860  C  CB  A ARG A 1 139 ? 23.189 43.037 44.206 0.50 22.29 ? 123  ARG A CB  1 
ATOM   861  C  CB  B ARG A 1 139 ? 23.188 43.020 44.213 0.50 22.55 ? 123  ARG A CB  1 
ATOM   862  C  CG  A ARG A 1 139 ? 24.121 42.073 43.511 0.50 22.01 ? 123  ARG A CG  1 
ATOM   863  C  CG  B ARG A 1 139 ? 23.863 43.204 45.558 0.50 22.80 ? 123  ARG A CG  1 
ATOM   864  C  CD  A ARG A 1 139 ? 25.552 42.530 43.574 0.50 24.21 ? 123  ARG A CD  1 
ATOM   865  C  CD  B ARG A 1 139 ? 24.630 44.512 45.606 0.50 27.05 ? 123  ARG A CD  1 
ATOM   866  N  NE  A ARG A 1 139 ? 26.394 41.574 42.872 0.50 25.31 ? 123  ARG A NE  1 
ATOM   867  N  NE  B ARG A 1 139 ? 26.004 44.316 45.183 0.50 26.65 ? 123  ARG A NE  1 
ATOM   868  C  CZ  A ARG A 1 139 ? 27.692 41.745 42.632 0.50 26.61 ? 123  ARG A CZ  1 
ATOM   869  C  CZ  B ARG A 1 139 ? 27.033 45.049 45.588 0.50 24.37 ? 123  ARG A CZ  1 
ATOM   870  N  NH1 A ARG A 1 139 ? 28.304 42.840 43.043 0.50 23.78 ? 123  ARG A NH1 1 
ATOM   871  N  NH1 B ARG A 1 139 ? 26.875 46.038 46.461 0.50 25.98 ? 123  ARG A NH1 1 
ATOM   872  N  NH2 A ARG A 1 139 ? 28.384 40.806 41.991 0.50 26.39 ? 123  ARG A NH2 1 
ATOM   873  N  NH2 B ARG A 1 139 ? 28.234 44.758 45.146 0.50 24.79 ? 123  ARG A NH2 1 
ATOM   874  N  N   . VAL A 1 140 ? 20.931 43.204 46.509 1.00 22.04 ? 124  VAL A N   1 
ATOM   875  C  CA  . VAL A 1 140 ? 20.360 44.138 47.471 1.00 22.78 ? 124  VAL A CA  1 
ATOM   876  C  C   . VAL A 1 140 ? 21.400 44.292 48.569 1.00 22.45 ? 124  VAL A C   1 
ATOM   877  O  O   . VAL A 1 140 ? 22.230 43.376 48.778 1.00 21.50 ? 124  VAL A O   1 
ATOM   878  C  CB  . VAL A 1 140 ? 19.018 43.663 48.068 1.00 22.25 ? 124  VAL A CB  1 
ATOM   879  C  CG1 . VAL A 1 140 ? 17.955 43.510 46.960 1.00 24.53 ? 124  VAL A CG1 1 
ATOM   880  C  CG2 . VAL A 1 140 ? 19.189 42.347 48.860 1.00 24.60 ? 124  VAL A CG2 1 
ATOM   881  N  N   . GLN A 1 141 ? 21.373 45.441 49.238 1.00 22.27 ? 125  GLN A N   1 
ATOM   882  C  CA  . GLN A 1 141 ? 22.288 45.706 50.330 1.00 23.47 ? 125  GLN A CA  1 
ATOM   883  C  C   . GLN A 1 141 ? 21.601 45.384 51.631 1.00 24.17 ? 125  GLN A C   1 
ATOM   884  O  O   . GLN A 1 141 ? 20.391 45.648 51.794 1.00 24.10 ? 125  GLN A O   1 
ATOM   885  C  CB  . GLN A 1 141 ? 22.735 47.175 50.342 1.00 24.38 ? 125  GLN A CB  1 
ATOM   886  C  CG  . GLN A 1 141 ? 23.580 47.556 49.167 1.00 27.25 ? 125  GLN A CG  1 
ATOM   887  C  CD  . GLN A 1 141 ? 24.928 46.843 49.164 1.00 31.44 ? 125  GLN A CD  1 
ATOM   888  O  OE1 . GLN A 1 141 ? 25.227 46.075 48.262 1.00 33.17 ? 125  GLN A OE1 1 
ATOM   889  N  NE2 . GLN A 1 141 ? 25.754 47.115 50.178 1.00 33.84 ? 125  GLN A NE2 1 
ATOM   890  N  N   . VAL A 1 142 ? 22.371 44.807 52.546 1.00 23.80 ? 126  VAL A N   1 
ATOM   891  C  CA  . VAL A 1 142 ? 21.993 44.704 53.949 1.00 23.72 ? 126  VAL A CA  1 
ATOM   892  C  C   . VAL A 1 142 ? 23.119 45.417 54.700 1.00 23.57 ? 126  VAL A C   1 
ATOM   893  O  O   . VAL A 1 142 ? 24.184 44.838 54.957 1.00 23.22 ? 126  VAL A O   1 
ATOM   894  C  CB  . VAL A 1 142 ? 21.854 43.229 54.418 1.00 23.40 ? 126  VAL A CB  1 
ATOM   895  C  CG1 . VAL A 1 142 ? 21.721 43.116 55.965 1.00 22.83 ? 126  VAL A CG1 1 
ATOM   896  C  CG2 . VAL A 1 142 ? 20.676 42.547 53.742 1.00 25.44 ? 126  VAL A CG2 1 
ATOM   897  N  N   . GLY A 1 143 ? 22.885 46.675 55.059 1.00 23.17 ? 127  GLY A N   1 
ATOM   898  C  CA  . GLY A 1 143 ? 23.964 47.517 55.552 1.00 23.86 ? 127  GLY A CA  1 
ATOM   899  C  C   . GLY A 1 143 ? 25.001 47.689 54.456 1.00 23.77 ? 127  GLY A C   1 
ATOM   900  O  O   . GLY A 1 143 ? 24.675 48.129 53.354 1.00 25.10 ? 127  GLY A O   1 
ATOM   901  N  N   . ASP A 1 144 ? 26.250 47.341 54.748 1.00 23.30 ? 128  ASP A N   1 
ATOM   902  C  CA  . ASP A 1 144 ? 27.304 47.384 53.733 1.00 22.66 ? 128  ASP A CA  1 
ATOM   903  C  C   . ASP A 1 144 ? 27.488 46.046 53.021 1.00 21.75 ? 128  ASP A C   1 
ATOM   904  O  O   . ASP A 1 144 ? 28.304 45.949 52.103 1.00 20.88 ? 128  ASP A O   1 
ATOM   905  C  CB  . ASP A 1 144 ? 28.642 47.887 54.314 1.00 23.40 ? 128  ASP A CB  1 
ATOM   906  C  CG  . ASP A 1 144 ? 28.636 49.375 54.610 1.00 24.65 ? 128  ASP A CG  1 
ATOM   907  O  OD1 . ASP A 1 144 ? 27.776 50.121 54.076 1.00 25.63 ? 128  ASP A OD1 1 
ATOM   908  O  OD2 . ASP A 1 144 ? 29.504 49.806 55.391 1.00 26.97 ? 128  ASP A OD2 1 
ATOM   909  N  N   . LEU A 1 145 ? 26.727 45.019 53.425 1.00 20.47 ? 129  LEU A N   1 
ATOM   910  C  CA  . LEU A 1 145 ? 26.843 43.705 52.794 1.00 20.66 ? 129  LEU A CA  1 
ATOM   911  C  C   . LEU A 1 145 ? 26.098 43.675 51.481 1.00 21.56 ? 129  LEU A C   1 
ATOM   912  O  O   . LEU A 1 145 ? 25.043 44.305 51.346 1.00 22.20 ? 129  LEU A O   1 
ATOM   913  C  CB  . LEU A 1 145 ? 26.298 42.571 53.679 1.00 20.06 ? 129  LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 145 ? 26.783 42.493 55.133 1.00 21.15 ? 129  LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 145 ? 26.035 41.395 55.869 1.00 18.00 ? 129  LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 145 ? 28.283 42.247 55.156 1.00 21.67 ? 129  LEU A CD2 1 
ATOM   917  N  N   . SER A 1 146 ? 26.636 42.921 50.526 1.00 21.51 ? 130  SER A N   1 
ATOM   918  C  CA  . SER A 1 146 ? 25.927 42.670 49.294 1.00 22.05 ? 130  SER A CA  1 
ATOM   919  C  C   . SER A 1 146 ? 25.245 41.301 49.345 1.00 21.94 ? 130  SER A C   1 
ATOM   920  O  O   . SER A 1 146 ? 25.806 40.323 49.852 1.00 21.88 ? 130  SER A O   1 
ATOM   921  C  CB  . SER A 1 146 ? 26.870 42.744 48.096 1.00 22.53 ? 130  SER A CB  1 
ATOM   922  O  OG  . SER A 1 146 ? 27.898 41.781 48.190 1.00 25.95 ? 130  SER A OG  1 
ATOM   923  N  N   . VAL A 1 147 ? 24.031 41.265 48.816 1.00 21.46 ? 131  VAL A N   1 
ATOM   924  C  CA  . VAL A 1 147 ? 23.264 40.036 48.717 1.00 22.44 ? 131  VAL A CA  1 
ATOM   925  C  C   . VAL A 1 147 ? 22.990 39.842 47.243 1.00 22.80 ? 131  VAL A C   1 
ATOM   926  O  O   . VAL A 1 147 ? 22.212 40.588 46.651 1.00 23.15 ? 131  VAL A O   1 
ATOM   927  C  CB  . VAL A 1 147 ? 21.932 40.099 49.473 1.00 22.20 ? 131  VAL A CB  1 
ATOM   928  C  CG1 . VAL A 1 147 ? 21.179 38.754 49.304 1.00 20.60 ? 131  VAL A CG1 1 
ATOM   929  C  CG2 . VAL A 1 147 ? 22.130 40.447 50.949 1.00 22.34 ? 131  VAL A CG2 1 
ATOM   930  N  N   . GLU A 1 148 ? 23.664 38.869 46.655 1.00 22.72 ? 132  GLU A N   1 
ATOM   931  C  CA  . GLU A 1 148 ? 23.509 38.540 45.246 1.00 22.94 ? 132  GLU A CA  1 
ATOM   932  C  C   . GLU A 1 148 ? 22.525 37.388 45.072 1.00 22.64 ? 132  GLU A C   1 
ATOM   933  O  O   . GLU A 1 148 ? 22.566 36.403 45.801 1.00 23.13 ? 132  GLU A O   1 
ATOM   934  C  CB  . GLU A 1 148 ? 24.858 38.140 44.676 1.00 23.36 ? 132  GLU A CB  1 
ATOM   935  C  CG  . GLU A 1 148 ? 24.816 37.715 43.222 1.00 29.06 ? 132  GLU A CG  1 
ATOM   936  C  CD  . GLU A 1 148 ? 26.181 37.233 42.707 1.00 34.36 ? 132  GLU A CD  1 
ATOM   937  O  OE1 . GLU A 1 148 ? 27.231 37.771 43.149 1.00 34.64 ? 132  GLU A OE1 1 
ATOM   938  O  OE2 . GLU A 1 148 ? 26.173 36.310 41.861 1.00 37.80 ? 132  GLU A OE2 1 
ATOM   939  N  N   . VAL A 1 149 ? 21.663 37.514 44.073 1.00 22.21 ? 133  VAL A N   1 
ATOM   940  C  CA  . VAL A 1 149 ? 20.571 36.559 43.843 1.00 22.24 ? 133  VAL A CA  1 
ATOM   941  C  C   . VAL A 1 149 ? 20.916 35.579 42.743 1.00 21.59 ? 133  VAL A C   1 
ATOM   942  O  O   . VAL A 1 149 ? 21.383 35.982 41.679 1.00 21.74 ? 133  VAL A O   1 
ATOM   943  C  CB  . VAL A 1 149 ? 19.274 37.328 43.488 1.00 22.29 ? 133  VAL A CB  1 
ATOM   944  C  CG1 . VAL A 1 149 ? 18.139 36.354 43.160 1.00 21.22 ? 133  VAL A CG1 1 
ATOM   945  C  CG2 . VAL A 1 149 ? 18.838 38.211 44.688 1.00 22.87 ? 133  VAL A CG2 1 
ATOM   946  N  N   . ILE A 1 150 ? 20.707 34.290 43.006 1.00 20.82 ? 134  ILE A N   1 
ATOM   947  C  CA  . ILE A 1 150 ? 20.931 33.234 41.990 1.00 22.11 ? 134  ILE A CA  1 
ATOM   948  C  C   . ILE A 1 150 ? 19.601 32.531 41.732 1.00 21.53 ? 134  ILE A C   1 
ATOM   949  O  O   . ILE A 1 150 ? 18.961 32.126 42.697 1.00 23.59 ? 134  ILE A O   1 
ATOM   950  C  CB  . ILE A 1 150 ? 21.975 32.203 42.507 1.00 21.91 ? 134  ILE A CB  1 
ATOM   951  C  CG1 . ILE A 1 150 ? 23.318 32.892 42.761 1.00 22.58 ? 134  ILE A CG1 1 
ATOM   952  C  CG2 . ILE A 1 150 ? 22.124 31.011 41.540 1.00 23.77 ? 134  ILE A CG2 1 
ATOM   953  C  CD1 . ILE A 1 150 ? 24.402 31.969 43.441 1.00 27.86 ? 134  ILE A CD1 1 
ATOM   954  N  N   . ASP A 1 151 ? 19.129 32.466 40.477 1.00 22.67 ? 135  ASP A N   1 
ATOM   955  C  CA  . ASP A 1 151 ? 17.870 31.753 40.224 1.00 22.14 ? 135  ASP A CA  1 
ATOM   956  C  C   . ASP A 1 151 ? 18.129 30.250 40.304 1.00 22.51 ? 135  ASP A C   1 
ATOM   957  O  O   . ASP A 1 151 ? 19.099 29.752 39.684 1.00 23.93 ? 135  ASP A O   1 
ATOM   958  C  CB  . ASP A 1 151 ? 17.257 32.131 38.850 1.00 22.87 ? 135  ASP A CB  1 
ATOM   959  C  CG  . ASP A 1 151 ? 16.475 33.445 38.906 1.00 22.61 ? 135  ASP A CG  1 
ATOM   960  O  OD1 . ASP A 1 151 ? 15.892 33.698 39.961 1.00 24.65 ? 135  ASP A OD1 1 
ATOM   961  O  OD2 . ASP A 1 151 ? 16.456 34.231 37.914 1.00 23.05 ? 135  ASP A OD2 1 
ATOM   962  N  N   . ALA A 1 152 ? 17.278 29.541 41.063 1.00 22.36 ? 136  ALA A N   1 
ATOM   963  C  CA  . ALA A 1 152 ? 17.405 28.081 41.154 1.00 23.45 ? 136  ALA A CA  1 
ATOM   964  C  C   . ALA A 1 152 ? 16.048 27.385 41.130 1.00 23.11 ? 136  ALA A C   1 
ATOM   965  O  O   . ALA A 1 152 ? 15.689 26.680 42.087 1.00 24.92 ? 136  ALA A O   1 
ATOM   966  C  CB  . ALA A 1 152 ? 18.211 27.706 42.401 1.00 23.05 ? 136  ALA A CB  1 
ATOM   967  N  N   . PRO A 1 153 ? 15.276 27.571 40.045 1.00 24.12 ? 137  PRO A N   1 
ATOM   968  C  CA  . PRO A 1 153 ? 13.945 26.958 40.016 1.00 23.63 ? 137  PRO A CA  1 
ATOM   969  C  C   . PRO A 1 153 ? 14.097 25.440 39.997 1.00 23.63 ? 137  PRO A C   1 
ATOM   970  O  O   . PRO A 1 153 ? 14.960 24.935 39.289 1.00 22.12 ? 137  PRO A O   1 
ATOM   971  C  CB  . PRO A 1 153 ? 13.372 27.424 38.682 1.00 24.71 ? 137  PRO A CB  1 
ATOM   972  C  CG  . PRO A 1 153 ? 14.571 27.714 37.817 1.00 23.97 ? 137  PRO A CG  1 
ATOM   973  C  CD  . PRO A 1 153 ? 15.558 28.311 38.803 1.00 23.79 ? 137  PRO A CD  1 
ATOM   974  N  N   . CYS A 1 154 ? 13.290 24.758 40.810 1.00 22.14 ? 138  CYS A N   1 
ATOM   975  C  CA  . CYS A 1 154 ? 13.130 23.301 40.778 1.00 22.18 ? 138  CYS A CA  1 
ATOM   976  C  C   . CYS A 1 154 ? 12.184 22.898 41.902 1.00 22.54 ? 138  CYS A C   1 
ATOM   977  O  O   . CYS A 1 154 ? 11.056 22.454 41.656 1.00 23.74 ? 138  CYS A O   1 
ATOM   978  C  CB  . CYS A 1 154 ? 14.466 22.561 40.937 1.00 21.65 ? 138  CYS A CB  1 
ATOM   979  S  SG  . CYS A 1 154 ? 14.233 20.770 41.015 1.00 23.62 ? 138  CYS A SG  1 
ATOM   980  N  N   . HIS A 1 155 ? 12.628 23.108 43.140 1.00 21.02 ? 139  HIS A N   1 
ATOM   981  C  CA  . HIS A 1 155 ? 11.830 22.754 44.312 1.00 22.26 ? 139  HIS A CA  1 
ATOM   982  C  C   . HIS A 1 155 ? 10.538 23.604 44.295 1.00 22.18 ? 139  HIS A C   1 
ATOM   983  O  O   . HIS A 1 155 ? 9.432  23.094 44.548 1.00 22.38 ? 139  HIS A O   1 
ATOM   984  C  CB  . HIS A 1 155 ? 12.659 22.969 45.560 1.00 20.48 ? 139  HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 155 ? 11.912 22.786 46.846 1.00 23.08 ? 139  HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 155 ? 11.653 21.542 47.396 1.00 24.39 ? 139  HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 155 ? 11.441 23.696 47.738 1.00 22.33 ? 139  HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 155 ? 11.021 21.691 48.547 1.00 23.35 ? 139  HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 155 ? 10.900 22.988 48.788 1.00 23.04 ? 139  HIS A NE2 1 
ATOM   990  N  N   . THR A 1 156 ? 10.702 24.897 43.998 1.00 22.30 ? 140  THR A N   1 
ATOM   991  C  CA  . THR A 1 156 ? 9.576  25.722 43.537 1.00 22.23 ? 140  THR A CA  1 
ATOM   992  C  C   . THR A 1 156 ? 10.052 26.404 42.264 1.00 22.64 ? 140  THR A C   1 
ATOM   993  O  O   . THR A 1 156 ? 11.277 26.532 42.032 1.00 22.74 ? 140  THR A O   1 
ATOM   994  C  CB  . THR A 1 156 ? 9.146  26.826 44.573 1.00 22.88 ? 140  THR A CB  1 
ATOM   995  O  OG1 . THR A 1 156 ? 10.239 27.725 44.791 1.00 22.94 ? 140  THR A OG1 1 
ATOM   996  C  CG2 . THR A 1 156 ? 8.655  26.191 45.882 1.00 20.73 ? 140  THR A CG2 1 
ATOM   997  N  N   . ARG A 1 157 ? 9.095  26.848 41.455 1.00 22.87 ? 141  ARG A N   1 
ATOM   998  C  CA  . ARG A 1 157 ? 9.404  27.493 40.175 1.00 24.23 ? 141  ARG A CA  1 
ATOM   999  C  C   . ARG A 1 157 ? 10.152 28.811 40.345 1.00 24.03 ? 141  ARG A C   1 
ATOM   1000 O  O   . ARG A 1 157 ? 10.763 29.282 39.392 1.00 22.78 ? 141  ARG A O   1 
ATOM   1001 C  CB  . ARG A 1 157 ? 8.100  27.817 39.458 1.00 25.82 ? 141  ARG A CB  1 
ATOM   1002 C  CG  . ARG A 1 157 ? 7.720  26.818 38.481 1.00 29.20 ? 141  ARG A CG  1 
ATOM   1003 C  CD  . ARG A 1 157 ? 6.428  27.279 37.789 1.00 34.38 ? 141  ARG A CD  1 
ATOM   1004 N  NE  . ARG A 1 157 ? 5.299  27.276 38.722 1.00 37.80 ? 141  ARG A NE  1 
ATOM   1005 C  CZ  . ARG A 1 157 ? 4.755  26.174 39.248 1.00 39.86 ? 141  ARG A CZ  1 
ATOM   1006 N  NH1 . ARG A 1 157 ? 5.241  24.964 38.935 1.00 42.19 ? 141  ARG A NH1 1 
ATOM   1007 N  NH2 . ARG A 1 157 ? 3.723  26.269 40.093 1.00 38.17 ? 141  ARG A NH2 1 
ATOM   1008 N  N   . GLY A 1 158 ? 10.037 29.435 41.525 1.00 22.16 ? 142  GLY A N   1 
ATOM   1009 C  CA  . GLY A 1 158 ? 10.673 30.726 41.760 1.00 23.27 ? 142  GLY A CA  1 
ATOM   1010 C  C   . GLY A 1 158 ? 11.717 30.741 42.867 1.00 22.40 ? 142  GLY A C   1 
ATOM   1011 O  O   . GLY A 1 158 ? 12.146 31.796 43.289 1.00 23.41 ? 142  GLY A O   1 
ATOM   1012 N  N   . HIS A 1 159 ? 12.183 29.565 43.287 1.00 21.96 ? 143  HIS A N   1 
ATOM   1013 C  CA  . HIS A 1 159 ? 13.233 29.454 44.324 1.00 22.09 ? 143  HIS A CA  1 
ATOM   1014 C  C   . HIS A 1 159 ? 14.501 30.192 43.884 1.00 22.67 ? 143  HIS A C   1 
ATOM   1015 O  O   . HIS A 1 159 ? 14.897 30.119 42.720 1.00 22.47 ? 143  HIS A O   1 
ATOM   1016 C  CB  . HIS A 1 159 ? 13.544 27.969 44.565 1.00 21.91 ? 143  HIS A CB  1 
ATOM   1017 C  CG  . HIS A 1 159 ? 14.199 27.660 45.894 1.00 23.56 ? 143  HIS A CG  1 
ATOM   1018 N  ND1 . HIS A 1 159 ? 15.348 28.283 46.338 1.00 21.56 ? 143  HIS A ND1 1 
ATOM   1019 C  CD2 . HIS A 1 159 ? 13.889 26.732 46.824 1.00 21.92 ? 143  HIS A CD2 1 
ATOM   1020 C  CE1 . HIS A 1 159 ? 15.698 27.771 47.510 1.00 23.17 ? 143  HIS A CE1 1 
ATOM   1021 N  NE2 . HIS A 1 159 ? 14.833 26.819 47.825 1.00 24.31 ? 143  HIS A NE2 1 
ATOM   1022 N  N   . VAL A 1 160 ? 15.102 30.920 44.825 1.00 22.76 ? 144  VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 160 ? 16.379 31.581 44.583 1.00 22.46 ? 144  VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 160 ? 17.369 31.147 45.684 1.00 21.19 ? 144  VAL A C   1 
ATOM   1025 O  O   . VAL A 1 160 ? 16.953 30.563 46.719 1.00 22.35 ? 144  VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 160 ? 16.238 33.147 44.545 1.00 21.94 ? 144  VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 160 ? 15.303 33.593 43.395 1.00 23.30 ? 144  VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 160 ? 15.733 33.726 45.887 1.00 22.10 ? 144  VAL A CG2 1 
ATOM   1029 N  N   . LEU A 1 161 ? 18.645 31.481 45.487 1.00 21.36 ? 145  LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 161 ? 19.684 31.306 46.515 1.00 21.82 ? 145  LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 161 ? 20.219 32.708 46.780 1.00 22.72 ? 145  LEU A C   1 
ATOM   1032 O  O   . LEU A 1 161 ? 20.258 33.544 45.857 1.00 23.15 ? 145  LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 161 ? 20.848 30.458 45.979 1.00 22.74 ? 145  LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 161 ? 20.448 29.215 45.186 1.00 22.44 ? 145  LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 161 ? 21.729 28.477 44.726 1.00 23.54 ? 145  LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 161 ? 19.562 28.283 46.042 1.00 23.58 ? 145  LEU A CD2 1 
ATOM   1037 N  N   . TYR A 1 162 ? 20.650 32.956 48.014 1.00 22.71 ? 146  TYR A N   1 
ATOM   1038 C  CA  . TYR A 1 162 ? 21.197 34.280 48.359 1.00 22.20 ? 146  TYR A CA  1 
ATOM   1039 C  C   . TYR A 1 162 ? 22.675 34.112 48.686 1.00 22.35 ? 146  TYR A C   1 
ATOM   1040 O  O   . TYR A 1 162 ? 23.027 33.336 49.575 1.00 21.56 ? 146  TYR A O   1 
ATOM   1041 C  CB  . TYR A 1 162 ? 20.455 34.908 49.559 1.00 22.15 ? 146  TYR A CB  1 
ATOM   1042 C  CG  . TYR A 1 162 ? 19.006 35.199 49.255 1.00 23.11 ? 146  TYR A CG  1 
ATOM   1043 C  CD1 . TYR A 1 162 ? 17.970 34.503 49.890 1.00 21.91 ? 146  TYR A CD1 1 
ATOM   1044 C  CD2 . TYR A 1 162 ? 18.670 36.188 48.306 1.00 22.16 ? 146  TYR A CD2 1 
ATOM   1045 C  CE1 . TYR A 1 162 ? 16.630 34.795 49.591 1.00 22.23 ? 146  TYR A CE1 1 
ATOM   1046 C  CE2 . TYR A 1 162 ? 17.326 36.479 48.014 1.00 22.25 ? 146  TYR A CE2 1 
ATOM   1047 C  CZ  . TYR A 1 162 ? 16.324 35.775 48.640 1.00 22.29 ? 146  TYR A CZ  1 
ATOM   1048 O  OH  . TYR A 1 162 ? 15.006 36.089 48.303 1.00 23.93 ? 146  TYR A OH  1 
ATOM   1049 N  N   . LYS A 1 163 ? 23.518 34.852 47.965 1.00 21.65 ? 147  LYS A N   1 
ATOM   1050 C  CA  . LYS A 1 163 ? 24.965 34.823 48.160 1.00 21.50 ? 147  LYS A CA  1 
ATOM   1051 C  C   . LYS A 1 163 ? 25.378 36.140 48.831 1.00 21.55 ? 147  LYS A C   1 
ATOM   1052 O  O   . LYS A 1 163 ? 25.277 37.209 48.223 1.00 21.21 ? 147  LYS A O   1 
ATOM   1053 C  CB  . LYS A 1 163 ? 25.656 34.650 46.802 1.00 22.22 ? 147  LYS A CB  1 
ATOM   1054 C  CG  . LYS A 1 163 ? 27.185 34.663 46.851 1.00 24.16 ? 147  LYS A CG  1 
ATOM   1055 C  CD  . LYS A 1 163 ? 27.737 34.831 45.417 1.00 28.06 ? 147  LYS A CD  1 
ATOM   1056 C  CE  . LYS A 1 163 ? 29.221 34.701 45.408 1.00 31.40 ? 147  LYS A CE  1 
ATOM   1057 N  NZ  . LYS A 1 163 ? 29.927 36.010 45.433 1.00 32.66 ? 147  LYS A NZ  1 
ATOM   1058 N  N   . VAL A 1 164 ? 25.827 36.046 50.081 1.00 21.85 ? 148  VAL A N   1 
ATOM   1059 C  CA  . VAL A 1 164 ? 26.038 37.227 50.919 1.00 21.20 ? 148  VAL A CA  1 
ATOM   1060 C  C   . VAL A 1 164 ? 27.514 37.383 51.252 1.00 22.02 ? 148  VAL A C   1 
ATOM   1061 O  O   . VAL A 1 164 ? 28.186 36.440 51.692 1.00 21.10 ? 148  VAL A O   1 
ATOM   1062 C  CB  . VAL A 1 164 ? 25.200 37.135 52.248 1.00 21.91 ? 148  VAL A CB  1 
ATOM   1063 C  CG1 . VAL A 1 164 ? 25.457 38.331 53.165 1.00 20.91 ? 148  VAL A CG1 1 
ATOM   1064 C  CG2 . VAL A 1 164 ? 23.699 36.972 51.924 1.00 22.51 ? 148  VAL A CG2 1 
ATOM   1065 N  N   . GLN A 1 165 ? 28.033 38.577 51.027 1.00 22.22 ? 149  GLN A N   1 
ATOM   1066 C  CA  . GLN A 1 165 ? 29.394 38.859 51.445 1.00 22.75 ? 149  GLN A CA  1 
ATOM   1067 C  C   . GLN A 1 165 ? 29.647 40.346 51.647 1.00 22.41 ? 149  GLN A C   1 
ATOM   1068 O  O   . GLN A 1 165 ? 28.809 41.169 51.328 1.00 21.91 ? 149  GLN A O   1 
ATOM   1069 C  CB  . GLN A 1 165 ? 30.415 38.252 50.491 1.00 24.02 ? 149  GLN A CB  1 
ATOM   1070 C  CG  . GLN A 1 165 ? 30.594 38.917 49.174 1.00 27.49 ? 149  GLN A CG  1 
ATOM   1071 C  CD  . GLN A 1 165 ? 31.786 38.327 48.374 1.00 32.83 ? 149  GLN A CD  1 
ATOM   1072 O  OE1 . GLN A 1 165 ? 32.817 37.879 48.922 1.00 35.26 ? 149  GLN A OE1 1 
ATOM   1073 N  NE2 . GLN A 1 165 ? 31.637 38.335 47.068 1.00 35.49 ? 149  GLN A NE2 1 
ATOM   1074 N  N   . HIS A 1 166 ? 30.799 40.668 52.213 1.00 22.38 ? 150  HIS A N   1 
ATOM   1075 C  CA  . HIS A 1 166 ? 31.169 42.066 52.346 1.00 22.99 ? 150  HIS A CA  1 
ATOM   1076 C  C   . HIS A 1 166 ? 32.086 42.454 51.193 1.00 23.34 ? 150  HIS A C   1 
ATOM   1077 O  O   . HIS A 1 166 ? 33.199 41.958 51.115 1.00 23.69 ? 150  HIS A O   1 
ATOM   1078 C  CB  . HIS A 1 166 ? 31.833 42.360 53.690 1.00 22.69 ? 150  HIS A CB  1 
ATOM   1079 C  CG  . HIS A 1 166 ? 31.782 43.809 54.061 1.00 22.68 ? 150  HIS A CG  1 
ATOM   1080 N  ND1 . HIS A 1 166 ? 32.426 44.782 53.330 1.00 23.25 ? 150  HIS A ND1 1 
ATOM   1081 C  CD2 . HIS A 1 166 ? 31.123 44.452 55.053 0.50 19.98 ? 150  HIS A CD2 1 
ATOM   1082 C  CE1 . HIS A 1 166 ? 32.190 45.962 53.874 1.00 22.44 ? 150  HIS A CE1 1 
ATOM   1083 N  NE2 . HIS A 1 166 ? 31.390 45.789 54.910 1.00 23.57 ? 150  HIS A NE2 1 
ATOM   1084 N  N   . PRO A 1 167 ? 31.618 43.356 50.308 1.00 24.52 ? 151  PRO A N   1 
ATOM   1085 C  CA  . PRO A 1 167 ? 32.362 43.880 49.147 1.00 25.66 ? 151  PRO A CA  1 
ATOM   1086 C  C   . PRO A 1 167 ? 33.761 44.402 49.482 1.00 26.50 ? 151  PRO A C   1 
ATOM   1087 O  O   . PRO A 1 167 ? 34.667 44.326 48.645 1.00 26.85 ? 151  PRO A O   1 
ATOM   1088 C  CB  . PRO A 1 167 ? 31.503 45.059 48.681 1.00 26.16 ? 151  PRO A CB  1 
ATOM   1089 C  CG  . PRO A 1 167 ? 30.141 44.742 49.131 1.00 25.87 ? 151  PRO A CG  1 
ATOM   1090 C  CD  . PRO A 1 167 ? 30.269 43.946 50.406 1.00 24.94 ? 151  PRO A CD  1 
ATOM   1091 N  N   . GLN A 1 168 ? 33.933 44.942 50.687 1.00 27.02 ? 152  GLN A N   1 
ATOM   1092 C  CA  . GLN A 1 168 ? 35.230 45.484 51.110 1.00 28.14 ? 152  GLN A CA  1 
ATOM   1093 C  C   . GLN A 1 168 ? 36.079 44.442 51.825 1.00 27.70 ? 152  GLN A C   1 
ATOM   1094 O  O   . GLN A 1 168 ? 37.261 44.676 52.101 1.00 27.81 ? 152  GLN A O   1 
ATOM   1095 C  CB  . GLN A 1 168 ? 35.044 46.722 51.993 1.00 27.98 ? 152  GLN A CB  1 
ATOM   1096 C  CG  . GLN A 1 168 ? 34.771 48.023 51.228 1.00 32.34 ? 152  GLN A CG  1 
ATOM   1097 C  CD  . GLN A 1 168 ? 33.452 48.004 50.463 1.00 37.09 ? 152  GLN A CD  1 
ATOM   1098 O  OE1 . GLN A 1 168 ? 32.365 48.030 51.059 1.00 40.03 ? 152  GLN A OE1 1 
ATOM   1099 N  NE2 . GLN A 1 168 ? 33.541 47.953 49.129 1.00 38.63 ? 152  GLN A NE2 1 
ATOM   1100 N  N   . HIS A 1 169 ? 35.481 43.290 52.123 1.00 27.52 ? 153  HIS A N   1 
ATOM   1101 C  CA  . HIS A 1 169 ? 36.204 42.212 52.806 1.00 27.32 ? 153  HIS A CA  1 
ATOM   1102 C  C   . HIS A 1 169 ? 35.908 40.855 52.140 1.00 27.38 ? 153  HIS A C   1 
ATOM   1103 O  O   . HIS A 1 169 ? 35.479 39.904 52.805 1.00 26.22 ? 153  HIS A O   1 
ATOM   1104 C  CB  . HIS A 1 169 ? 35.858 42.197 54.303 1.00 26.94 ? 153  HIS A CB  1 
ATOM   1105 C  CG  . HIS A 1 169 ? 36.108 43.499 54.999 1.00 27.31 ? 153  HIS A CG  1 
ATOM   1106 N  ND1 . HIS A 1 169 ? 37.370 43.915 55.375 1.00 24.74 ? 153  HIS A ND1 1 
ATOM   1107 C  CD2 . HIS A 1 169 ? 35.257 44.484 55.380 1.00 26.71 ? 153  HIS A CD2 1 
ATOM   1108 C  CE1 . HIS A 1 169 ? 37.284 45.095 55.963 1.00 27.08 ? 153  HIS A CE1 1 
ATOM   1109 N  NE2 . HIS A 1 169 ? 36.015 45.466 55.972 1.00 26.06 ? 153  HIS A NE2 1 
ATOM   1110 N  N   . PRO A 1 170 ? 36.167 40.753 50.815 1.00 27.78 ? 154  PRO A N   1 
ATOM   1111 C  CA  . PRO A 1 170 ? 35.679 39.587 50.073 1.00 28.07 ? 154  PRO A CA  1 
ATOM   1112 C  C   . PRO A 1 170 ? 36.290 38.280 50.580 1.00 27.69 ? 154  PRO A C   1 
ATOM   1113 O  O   . PRO A 1 170 ? 35.594 37.270 50.624 1.00 27.76 ? 154  PRO A O   1 
ATOM   1114 C  CB  . PRO A 1 170 ? 36.109 39.880 48.620 1.00 28.39 ? 154  PRO A CB  1 
ATOM   1115 C  CG  . PRO A 1 170 ? 37.217 40.824 48.730 1.00 28.13 ? 154  PRO A CG  1 
ATOM   1116 C  CD  . PRO A 1 170 ? 36.934 41.670 49.946 1.00 27.86 ? 154  PRO A CD  1 
ATOM   1117 N  N   . ASN A 1 171 ? 37.560 38.320 50.995 1.00 27.31 ? 155  ASN A N   1 
ATOM   1118 C  CA  . ASN A 1 171 ? 38.249 37.119 51.498 1.00 27.12 ? 155  ASN A CA  1 
ATOM   1119 C  C   . ASN A 1 171 ? 37.807 36.624 52.877 1.00 26.53 ? 155  ASN A C   1 
ATOM   1120 O  O   . ASN A 1 171 ? 38.217 35.545 53.285 1.00 25.81 ? 155  ASN A O   1 
ATOM   1121 C  CB  . ASN A 1 171 ? 39.782 37.278 51.484 1.00 27.73 ? 155  ASN A CB  1 
ATOM   1122 C  CG  . ASN A 1 171 ? 40.330 37.661 50.109 1.00 29.31 ? 155  ASN A CG  1 
ATOM   1123 O  OD1 . ASN A 1 171 ? 39.633 37.593 49.085 1.00 31.88 ? 155  ASN A OD1 1 
ATOM   1124 N  ND2 . ASN A 1 171 ? 41.581 38.068 50.087 1.00 31.80 ? 155  ASN A ND2 1 
ATOM   1125 N  N   . ASP A 1 172 ? 36.984 37.401 53.588 1.00 26.06 ? 156  ASP A N   1 
ATOM   1126 C  CA  . ASP A 1 172 ? 36.435 36.972 54.886 1.00 25.72 ? 156  ASP A CA  1 
ATOM   1127 C  C   . ASP A 1 172 ? 35.381 35.898 54.692 1.00 25.20 ? 156  ASP A C   1 
ATOM   1128 O  O   . ASP A 1 172 ? 34.980 35.233 55.658 1.00 25.56 ? 156  ASP A O   1 
ATOM   1129 C  CB  . ASP A 1 172 ? 35.815 38.138 55.661 1.00 25.98 ? 156  ASP A CB  1 
ATOM   1130 C  CG  . ASP A 1 172 ? 36.855 39.023 56.341 1.00 28.67 ? 156  ASP A CG  1 
ATOM   1131 O  OD1 . ASP A 1 172 ? 38.024 38.597 56.532 1.00 28.11 ? 156  ASP A OD1 1 
ATOM   1132 O  OD2 . ASP A 1 172 ? 36.485 40.164 56.696 1.00 32.81 ? 156  ASP A OD2 1 
ATOM   1133 N  N   . GLY A 1 173 ? 34.920 35.755 53.449 1.00 23.81 ? 157  GLY A N   1 
ATOM   1134 C  CA  . GLY A 1 173 ? 34.049 34.662 53.080 1.00 22.62 ? 157  GLY A CA  1 
ATOM   1135 C  C   . GLY A 1 173 ? 32.661 35.057 52.611 1.00 21.47 ? 157  GLY A C   1 
ATOM   1136 O  O   . GLY A 1 173 ? 32.303 36.247 52.499 1.00 21.26 ? 157  GLY A O   1 
ATOM   1137 N  N   . VAL A 1 174 ? 31.869 34.024 52.349 1.00 20.64 ? 158  VAL A N   1 
ATOM   1138 C  CA  . VAL A 1 174 ? 30.579 34.152 51.716 1.00 20.13 ? 158  VAL A CA  1 
ATOM   1139 C  C   . VAL A 1 174 ? 29.584 33.241 52.453 1.00 20.27 ? 158  VAL A C   1 
ATOM   1140 O  O   . VAL A 1 174 ? 29.910 32.094 52.760 1.00 19.38 ? 158  VAL A O   1 
ATOM   1141 C  CB  . VAL A 1 174 ? 30.687 33.707 50.234 1.00 19.95 ? 158  VAL A CB  1 
ATOM   1142 C  CG1 . VAL A 1 174 ? 29.323 33.656 49.569 1.00 22.58 ? 158  VAL A CG1 1 
ATOM   1143 C  CG2 . VAL A 1 174 ? 31.694 34.621 49.455 1.00 21.68 ? 158  VAL A CG2 1 
ATOM   1144 N  N   . ALA A 1 175 ? 28.385 33.750 52.711 1.00 19.20 ? 159  ALA A N   1 
ATOM   1145 C  CA  . ALA A 1 175 ? 27.278 32.957 53.224 1.00 20.41 ? 159  ALA A CA  1 
ATOM   1146 C  C   . ALA A 1 175 ? 26.324 32.663 52.072 1.00 20.41 ? 159  ALA A C   1 
ATOM   1147 O  O   . ALA A 1 175 ? 25.831 33.581 51.423 1.00 21.36 ? 159  ALA A O   1 
ATOM   1148 C  CB  . ALA A 1 175 ? 26.542 33.719 54.346 1.00 20.78 ? 159  ALA A CB  1 
ATOM   1149 N  N   . LEU A 1 176 ? 26.048 31.389 51.835 1.00 20.58 ? 160  LEU A N   1 
ATOM   1150 C  CA  . LEU A 1 176 ? 25.156 31.012 50.744 1.00 21.27 ? 160  LEU A CA  1 
ATOM   1151 C  C   . LEU A 1 176 ? 23.901 30.366 51.311 1.00 21.96 ? 160  LEU A C   1 
ATOM   1152 O  O   . LEU A 1 176 ? 23.967 29.267 51.871 1.00 21.51 ? 160  LEU A O   1 
ATOM   1153 C  CB  . LEU A 1 176 ? 25.849 30.073 49.749 1.00 20.92 ? 160  LEU A CB  1 
ATOM   1154 C  CG  . LEU A 1 176 ? 24.982 29.662 48.526 1.00 22.34 ? 160  LEU A CG  1 
ATOM   1155 C  CD1 . LEU A 1 176 ? 24.722 30.885 47.601 1.00 22.37 ? 160  LEU A CD1 1 
ATOM   1156 C  CD2 . LEU A 1 176 ? 25.668 28.542 47.753 1.00 21.98 ? 160  LEU A CD2 1 
ATOM   1157 N  N   . PHE A 1 177 ? 22.779 31.062 51.158 1.00 20.85 ? 161  PHE A N   1 
ATOM   1158 C  CA  . PHE A 1 177 ? 21.494 30.579 51.682 1.00 22.29 ? 161  PHE A CA  1 
ATOM   1159 C  C   . PHE A 1 177 ? 20.813 29.818 50.563 1.00 22.96 ? 161  PHE A C   1 
ATOM   1160 O  O   . PHE A 1 177 ? 20.466 30.396 49.520 1.00 23.31 ? 161  PHE A O   1 
ATOM   1161 C  CB  . PHE A 1 177 ? 20.649 31.756 52.209 1.00 21.48 ? 161  PHE A CB  1 
ATOM   1162 C  CG  . PHE A 1 177 ? 21.307 32.466 53.340 1.00 21.21 ? 161  PHE A CG  1 
ATOM   1163 C  CD1 . PHE A 1 177 ? 21.140 32.009 54.648 1.00 21.78 ? 161  PHE A CD1 1 
ATOM   1164 C  CD2 . PHE A 1 177 ? 22.163 33.558 53.104 1.00 20.45 ? 161  PHE A CD2 1 
ATOM   1165 C  CE1 . PHE A 1 177 ? 21.828 32.653 55.715 1.00 20.61 ? 161  PHE A CE1 1 
ATOM   1166 C  CE2 . PHE A 1 177 ? 22.816 34.199 54.154 1.00 21.03 ? 161  PHE A CE2 1 
ATOM   1167 C  CZ  . PHE A 1 177 ? 22.652 33.723 55.459 1.00 22.08 ? 161  PHE A CZ  1 
ATOM   1168 N  N   . THR A 1 178 ? 20.660 28.510 50.759 1.00 22.84 ? 162  THR A N   1 
ATOM   1169 C  CA  . THR A 1 178 ? 20.245 27.627 49.662 1.00 22.46 ? 162  THR A CA  1 
ATOM   1170 C  C   . THR A 1 178 ? 18.802 27.122 49.810 1.00 22.21 ? 162  THR A C   1 
ATOM   1171 O  O   . THR A 1 178 ? 18.333 26.349 48.976 1.00 22.15 ? 162  THR A O   1 
ATOM   1172 C  CB  . THR A 1 178 ? 21.181 26.390 49.591 1.00 21.99 ? 162  THR A CB  1 
ATOM   1173 O  OG1 . THR A 1 178 ? 21.196 25.741 50.875 1.00 23.10 ? 162  THR A OG1 1 
ATOM   1174 C  CG2 . THR A 1 178 ? 22.620 26.820 49.216 1.00 21.31 ? 162  THR A CG2 1 
ATOM   1175 N  N   . GLY A 1 179 ? 18.122 27.500 50.890 1.00 22.11 ? 163  GLY A N   1 
ATOM   1176 C  CA  . GLY A 1 179 ? 16.728 27.075 51.088 1.00 22.40 ? 163  GLY A CA  1 
ATOM   1177 C  C   . GLY A 1 179 ? 16.584 25.574 50.961 1.00 21.52 ? 163  GLY A C   1 
ATOM   1178 O  O   . GLY A 1 179 ? 17.363 24.797 51.564 1.00 22.76 ? 163  GLY A O   1 
ATOM   1179 N  N   . ASP A 1 180 ? 15.608 25.160 50.146 1.00 21.66 ? 164  ASP A N   1 
ATOM   1180 C  CA  . ASP A 1 180 ? 15.327 23.752 49.960 1.00 22.71 ? 164  ASP A CA  1 
ATOM   1181 C  C   . ASP A 1 180 ? 15.857 23.254 48.629 1.00 22.31 ? 164  ASP A C   1 
ATOM   1182 O  O   . ASP A 1 180 ? 15.406 22.231 48.116 1.00 24.21 ? 164  ASP A O   1 
ATOM   1183 C  CB  . ASP A 1 180 ? 13.837 23.458 50.155 1.00 21.21 ? 164  ASP A CB  1 
ATOM   1184 C  CG  . ASP A 1 180 ? 13.411 23.592 51.592 1.00 24.22 ? 164  ASP A CG  1 
ATOM   1185 O  OD1 . ASP A 1 180 ? 14.218 23.990 52.441 1.00 23.85 ? 164  ASP A OD1 1 
ATOM   1186 O  OD2 . ASP A 1 180 ? 12.241 23.346 51.838 1.00 25.65 ? 164  ASP A OD2 1 
ATOM   1187 N  N   . THR A 1 181 ? 16.816 23.987 48.059 1.00 22.68 ? 165  THR A N   1 
ATOM   1188 C  CA  . THR A 1 181 ? 17.466 23.532 46.818 1.00 22.84 ? 165  THR A CA  1 
ATOM   1189 C  C   . THR A 1 181 ? 18.590 22.571 47.130 1.00 23.05 ? 165  THR A C   1 
ATOM   1190 O  O   . THR A 1 181 ? 18.692 21.504 46.519 1.00 23.57 ? 165  THR A O   1 
ATOM   1191 C  CB  . THR A 1 181 ? 17.968 24.746 45.975 1.00 23.28 ? 165  THR A CB  1 
ATOM   1192 O  OG1 . THR A 1 181 ? 16.825 25.531 45.577 1.00 24.47 ? 165  THR A OG1 1 
ATOM   1193 C  CG2 . THR A 1 181 ? 18.735 24.288 44.739 1.00 22.79 ? 165  THR A CG2 1 
ATOM   1194 N  N   . MET A 1 182 ? 19.420 22.935 48.106 1.00 23.22 ? 166  MET A N   1 
ATOM   1195 C  CA  . MET A 1 182 ? 20.558 22.122 48.451 1.00 23.12 ? 166  MET A CA  1 
ATOM   1196 C  C   . MET A 1 182 ? 20.639 22.081 49.963 1.00 23.01 ? 166  MET A C   1 
ATOM   1197 O  O   . MET A 1 182 ? 20.434 23.098 50.631 1.00 23.64 ? 166  MET A O   1 
ATOM   1198 C  CB  . MET A 1 182 ? 21.856 22.715 47.869 1.00 22.05 ? 166  MET A CB  1 
ATOM   1199 C  CG  . MET A 1 182 ? 23.040 21.706 47.862 1.00 23.92 ? 166  MET A CG  1 
ATOM   1200 S  SD  . MET A 1 182 ? 24.559 22.403 47.117 1.00 28.28 ? 166  MET A SD  1 
ATOM   1201 C  CE  . MET A 1 182 ? 24.974 23.431 48.462 1.00 26.31 ? 166  MET A CE  1 
ATOM   1202 N  N   . PHE A 1 183 ? 20.877 20.885 50.492 1.00 23.50 ? 167  PHE A N   1 
ATOM   1203 C  CA  . PHE A 1 183 ? 21.104 20.684 51.918 1.00 22.91 ? 167  PHE A CA  1 
ATOM   1204 C  C   . PHE A 1 183 ? 22.522 20.196 52.061 1.00 22.67 ? 167  PHE A C   1 
ATOM   1205 O  O   . PHE A 1 183 ? 23.210 19.977 51.048 1.00 23.07 ? 167  PHE A O   1 
ATOM   1206 C  CB  . PHE A 1 183 ? 20.128 19.593 52.445 1.00 23.39 ? 167  PHE A CB  1 
ATOM   1207 C  CG  . PHE A 1 183 ? 18.676 19.952 52.253 1.00 22.76 ? 167  PHE A CG  1 
ATOM   1208 C  CD1 . PHE A 1 183 ? 18.049 20.866 53.115 1.00 24.44 ? 167  PHE A CD1 1 
ATOM   1209 C  CD2 . PHE A 1 183 ? 17.942 19.406 51.205 1.00 25.60 ? 167  PHE A CD2 1 
ATOM   1210 C  CE1 . PHE A 1 183 ? 16.703 21.227 52.924 1.00 25.25 ? 167  PHE A CE1 1 
ATOM   1211 C  CE2 . PHE A 1 183 ? 16.605 19.749 51.028 1.00 25.71 ? 167  PHE A CE2 1 
ATOM   1212 C  CZ  . PHE A 1 183 ? 15.999 20.698 51.893 1.00 26.19 ? 167  PHE A CZ  1 
ATOM   1213 N  N   . ILE A 1 184 ? 22.975 19.961 53.297 1.00 22.41 ? 168  ILE A N   1 
ATOM   1214 C  CA  . ILE A 1 184 ? 24.256 19.292 53.434 1.00 21.87 ? 168  ILE A CA  1 
ATOM   1215 C  C   . ILE A 1 184 ? 24.123 17.864 52.859 1.00 21.73 ? 168  ILE A C   1 
ATOM   1216 O  O   . ILE A 1 184 ? 23.273 17.080 53.306 1.00 22.27 ? 168  ILE A O   1 
ATOM   1217 C  CB  . ILE A 1 184 ? 24.768 19.271 54.890 1.00 22.69 ? 168  ILE A CB  1 
ATOM   1218 C  CG1 . ILE A 1 184 ? 24.956 20.708 55.394 1.00 25.29 ? 168  ILE A CG1 1 
ATOM   1219 C  CG2 . ILE A 1 184 ? 26.086 18.407 55.005 1.00 21.57 ? 168  ILE A CG2 1 
ATOM   1220 C  CD1 . ILE A 1 184 ? 25.665 20.788 56.741 1.00 27.68 ? 168  ILE A CD1 1 
ATOM   1221 N  N   . ALA A 1 185 ? 24.936 17.579 51.838 1.00 21.24 ? 169  ALA A N   1 
ATOM   1222 C  CA  . ALA A 1 185 ? 24.954 16.305 51.117 1.00 21.68 ? 169  ALA A CA  1 
ATOM   1223 C  C   . ALA A 1 185 ? 23.634 15.963 50.411 1.00 22.12 ? 169  ALA A C   1 
ATOM   1224 O  O   . ALA A 1 185 ? 23.439 14.805 49.977 1.00 21.24 ? 169  ALA A O   1 
ATOM   1225 C  CB  . ALA A 1 185 ? 25.368 15.165 52.051 1.00 21.46 ? 169  ALA A CB  1 
ATOM   1226 N  N   . GLY A 1 186 ? 22.757 16.959 50.263 1.00 22.84 ? 170  GLY A N   1 
ATOM   1227 C  CA  . GLY A 1 186 ? 21.454 16.691 49.695 1.00 23.00 ? 170  GLY A CA  1 
ATOM   1228 C  C   . GLY A 1 186 ? 20.853 17.792 48.835 1.00 24.02 ? 170  GLY A C   1 
ATOM   1229 O  O   . GLY A 1 186 ? 21.481 18.854 48.586 1.00 22.86 ? 170  GLY A O   1 
ATOM   1230 N  N   . ILE A 1 187 ? 19.658 17.484 48.330 1.00 23.12 ? 171  ILE A N   1 
ATOM   1231 C  CA  . ILE A 1 187 ? 18.859 18.390 47.484 1.00 22.55 ? 171  ILE A CA  1 
ATOM   1232 C  C   . ILE A 1 187 ? 17.403 18.273 47.880 1.00 23.44 ? 171  ILE A C   1 
ATOM   1233 O  O   . ILE A 1 187 ? 16.996 17.305 48.542 1.00 23.06 ? 171  ILE A O   1 
ATOM   1234 C  CB  . ILE A 1 187 ? 18.981 18.079 45.939 1.00 22.59 ? 171  ILE A CB  1 
ATOM   1235 C  CG1 . ILE A 1 187 ? 18.706 16.581 45.656 1.00 23.33 ? 171  ILE A CG1 1 
ATOM   1236 C  CG2 . ILE A 1 187 ? 20.365 18.471 45.442 1.00 20.94 ? 171  ILE A CG2 1 
ATOM   1237 C  CD1 . ILE A 1 187 ? 18.416 16.256 44.165 1.00 26.16 ? 171  ILE A CD1 1 
ATOM   1238 N  N   . GLY A 1 188 ? 16.612 19.271 47.491 1.00 23.45 ? 172  GLY A N   1 
ATOM   1239 C  CA  . GLY A 1 188 ? 15.182 19.270 47.813 1.00 23.32 ? 172  GLY A CA  1 
ATOM   1240 C  C   . GLY A 1 188 ? 14.392 18.450 46.818 1.00 23.04 ? 172  GLY A C   1 
ATOM   1241 O  O   . GLY A 1 188 ? 14.871 18.140 45.718 1.00 22.61 ? 172  GLY A O   1 
ATOM   1242 N  N   . ALA A 1 189 ? 13.179 18.105 47.210 1.00 22.69 ? 173  ALA A N   1 
ATOM   1243 C  CA  . ALA A 1 189 ? 12.266 17.397 46.290 1.00 22.98 ? 173  ALA A CA  1 
ATOM   1244 C  C   . ALA A 1 189 ? 11.883 18.331 45.117 1.00 22.49 ? 173  ALA A C   1 
ATOM   1245 O  O   . ALA A 1 189 ? 11.759 19.574 45.301 1.00 21.74 ? 173  ALA A O   1 
ATOM   1246 C  CB  . ALA A 1 189 ? 11.043 16.927 47.051 1.00 22.50 ? 173  ALA A CB  1 
ATOM   1247 N  N   . PHE A 1 190 ? 11.700 17.741 43.935 1.00 21.81 ? 174  PHE A N   1 
ATOM   1248 C  CA  . PHE A 1 190 ? 11.473 18.511 42.716 1.00 22.00 ? 174  PHE A CA  1 
ATOM   1249 C  C   . PHE A 1 190 ? 9.995  18.845 42.547 1.00 21.80 ? 174  PHE A C   1 
ATOM   1250 O  O   . PHE A 1 190 ? 9.409  18.462 41.536 1.00 21.28 ? 174  PHE A O   1 
ATOM   1251 C  CB  . PHE A 1 190 ? 11.927 17.738 41.456 1.00 22.76 ? 174  PHE A CB  1 
ATOM   1252 C  CG  . PHE A 1 190 ? 13.372 17.267 41.477 1.00 23.40 ? 174  PHE A CG  1 
ATOM   1253 C  CD1 . PHE A 1 190 ? 13.790 16.287 40.555 1.00 23.64 ? 174  PHE A CD1 1 
ATOM   1254 C  CD2 . PHE A 1 190 ? 14.316 17.815 42.361 1.00 24.73 ? 174  PHE A CD2 1 
ATOM   1255 C  CE1 . PHE A 1 190 ? 15.134 15.843 40.518 1.00 25.64 ? 174  PHE A CE1 1 
ATOM   1256 C  CE2 . PHE A 1 190 ? 15.653 17.384 42.324 1.00 24.78 ? 174  PHE A CE2 1 
ATOM   1257 C  CZ  . PHE A 1 190 ? 16.059 16.395 41.412 1.00 24.11 ? 174  PHE A CZ  1 
ATOM   1258 N  N   . PHE A 1 191 ? 9.398  19.555 43.508 1.00 22.03 ? 175  PHE A N   1 
ATOM   1259 C  CA  . PHE A 1 191 ? 7.936  19.765 43.488 1.00 21.94 ? 175  PHE A CA  1 
ATOM   1260 C  C   . PHE A 1 191 ? 7.437  20.461 42.238 1.00 22.35 ? 175  PHE A C   1 
ATOM   1261 O  O   . PHE A 1 191 ? 6.330  20.190 41.767 1.00 21.06 ? 175  PHE A O   1 
ATOM   1262 C  CB  . PHE A 1 191 ? 7.458  20.579 44.697 1.00 23.00 ? 175  PHE A CB  1 
ATOM   1263 C  CG  . PHE A 1 191 ? 7.561  19.848 46.027 1.00 23.17 ? 175  PHE A CG  1 
ATOM   1264 C  CD1 . PHE A 1 191 ? 7.591  20.574 47.210 1.00 30.82 ? 175  PHE A CD1 1 
ATOM   1265 C  CD2 . PHE A 1 191 ? 7.610  18.459 46.104 1.00 24.95 ? 175  PHE A CD2 1 
ATOM   1266 C  CE1 . PHE A 1 191 ? 7.677  19.919 48.461 1.00 30.19 ? 175  PHE A CE1 1 
ATOM   1267 C  CE2 . PHE A 1 191 ? 7.674  17.801 47.322 1.00 27.58 ? 175  PHE A CE2 1 
ATOM   1268 C  CZ  . PHE A 1 191 ? 7.720  18.518 48.498 1.00 29.57 ? 175  PHE A CZ  1 
ATOM   1269 N  N   . GLU A 1 192 ? 8.226  21.413 41.747 1.00 21.91 ? 176  GLU A N   1 
ATOM   1270 C  CA  . GLU A 1 192 ? 7.779  22.246 40.640 1.00 22.57 ? 176  GLU A CA  1 
ATOM   1271 C  C   . GLU A 1 192 ? 8.824  22.276 39.518 1.00 23.42 ? 176  GLU A C   1 
ATOM   1272 O  O   . GLU A 1 192 ? 9.049  23.313 38.863 1.00 24.55 ? 176  GLU A O   1 
ATOM   1273 C  CB  . GLU A 1 192 ? 7.449  23.658 41.145 1.00 22.08 ? 176  GLU A CB  1 
ATOM   1274 C  CG  . GLU A 1 192 ? 6.319  23.700 42.217 1.00 21.40 ? 176  GLU A CG  1 
ATOM   1275 C  CD  . GLU A 1 192 ? 5.948  25.117 42.692 1.00 23.95 ? 176  GLU A CD  1 
ATOM   1276 O  OE1 . GLU A 1 192 ? 6.541  26.125 42.237 1.00 23.06 ? 176  GLU A OE1 1 
ATOM   1277 O  OE2 . GLU A 1 192 ? 5.033  25.222 43.535 1.00 23.66 ? 176  GLU A OE2 1 
ATOM   1278 N  N   . GLY A 1 193 ? 9.460  21.143 39.281 1.00 23.71 ? 177  GLY A N   1 
ATOM   1279 C  CA  . GLY A 1 193 ? 10.509 21.100 38.280 1.00 23.44 ? 177  GLY A CA  1 
ATOM   1280 C  C   . GLY A 1 193 ? 11.049 19.699 38.132 1.00 23.19 ? 177  GLY A C   1 
ATOM   1281 O  O   . GLY A 1 193 ? 10.375 18.738 38.517 1.00 24.21 ? 177  GLY A O   1 
ATOM   1282 N  N   . ASP A 1 194 ? 12.263 19.572 37.594 1.00 22.48 ? 178  ASP A N   1 
ATOM   1283 C  CA  . ASP A 1 194 ? 12.770 18.231 37.251 1.00 22.55 ? 178  ASP A CA  1 
ATOM   1284 C  C   . ASP A 1 194 ? 14.282 18.139 37.404 1.00 22.79 ? 178  ASP A C   1 
ATOM   1285 O  O   . ASP A 1 194 ? 14.923 19.073 37.928 1.00 22.34 ? 178  ASP A O   1 
ATOM   1286 C  CB  . ASP A 1 194 ? 12.316 17.803 35.846 1.00 22.39 ? 178  ASP A CB  1 
ATOM   1287 C  CG  . ASP A 1 194 ? 12.965 18.624 34.736 1.00 23.32 ? 178  ASP A CG  1 
ATOM   1288 O  OD1 . ASP A 1 194 ? 13.903 19.423 34.984 1.00 22.13 ? 178  ASP A OD1 1 
ATOM   1289 O  OD2 . ASP A 1 194 ? 12.492 18.487 33.592 1.00 27.44 ? 178  ASP A OD2 1 
ATOM   1290 N  N   . GLU A 1 195 ? 14.850 17.016 36.960 1.00 21.81 ? 179  GLU A N   1 
ATOM   1291 C  CA  . GLU A 1 195 ? 16.269 16.755 37.220 1.00 22.38 ? 179  GLU A CA  1 
ATOM   1292 C  C   . GLU A 1 195 ? 17.161 17.727 36.437 1.00 22.61 ? 179  GLU A C   1 
ATOM   1293 O  O   . GLU A 1 195 ? 18.277 18.052 36.884 1.00 22.55 ? 179  GLU A O   1 
ATOM   1294 C  CB  . GLU A 1 195 ? 16.621 15.301 36.877 1.00 22.67 ? 179  GLU A CB  1 
ATOM   1295 C  CG  . GLU A 1 195 ? 16.730 15.021 35.381 1.00 24.16 ? 179  GLU A CG  1 
ATOM   1296 C  CD  . GLU A 1 195 ? 15.397 14.857 34.679 1.00 28.45 ? 179  GLU A CD  1 
ATOM   1297 O  OE1 . GLU A 1 195 ? 15.431 14.444 33.496 1.00 32.86 ? 179  GLU A OE1 1 
ATOM   1298 O  OE2 . GLU A 1 195 ? 14.320 15.120 35.277 1.00 29.48 ? 179  GLU A OE2 1 
ATOM   1299 N  N   . LYS A 1 196 ? 16.667 18.184 35.276 1.00 22.00 ? 180  LYS A N   1 
ATOM   1300 C  CA  . LYS A 1 196 ? 17.422 19.169 34.482 1.00 21.89 ? 180  LYS A CA  1 
ATOM   1301 C  C   . LYS A 1 196 ? 17.537 20.463 35.253 1.00 22.07 ? 180  LYS A C   1 
ATOM   1302 O  O   . LYS A 1 196 ? 18.618 21.068 35.294 1.00 21.51 ? 180  LYS A O   1 
ATOM   1303 C  CB  . LYS A 1 196 ? 16.779 19.433 33.114 1.00 21.42 ? 180  LYS A CB  1 
ATOM   1304 C  CG  . LYS A 1 196 ? 16.595 18.225 32.268 1.00 22.74 ? 180  LYS A CG  1 
ATOM   1305 C  CD  . LYS A 1 196 ? 16.312 18.662 30.831 1.00 21.55 ? 180  LYS A CD  1 
ATOM   1306 C  CE  . LYS A 1 196 ? 15.092 19.610 30.739 1.00 22.97 ? 180  LYS A CE  1 
ATOM   1307 N  NZ  . LYS A 1 196 ? 13.743 19.001 31.170 1.00 23.86 ? 180  LYS A NZ  1 
ATOM   1308 N  N   . ASP A 1 197 ? 16.423 20.889 35.875 1.00 21.32 ? 181  ASP A N   1 
ATOM   1309 C  CA  . ASP A 1 197 ? 16.430 22.072 36.708 1.00 21.31 ? 181  ASP A CA  1 
ATOM   1310 C  C   . ASP A 1 197 ? 17.464 21.908 37.826 1.00 21.25 ? 181  ASP A C   1 
ATOM   1311 O  O   . ASP A 1 197 ? 18.239 22.844 38.102 1.00 21.24 ? 181  ASP A O   1 
ATOM   1312 C  CB  . ASP A 1 197 ? 15.035 22.338 37.304 1.00 21.22 ? 181  ASP A CB  1 
ATOM   1313 C  CG  . ASP A 1 197 ? 14.012 22.696 36.268 1.00 22.32 ? 181  ASP A CG  1 
ATOM   1314 O  OD1 . ASP A 1 197 ? 14.336 23.338 35.232 1.00 21.13 ? 181  ASP A OD1 1 
ATOM   1315 O  OD2 . ASP A 1 197 ? 12.822 22.348 36.474 1.00 21.82 ? 181  ASP A OD2 1 
ATOM   1316 N  N   . MET A 1 198 ? 17.477 20.738 38.476 1.00 20.91 ? 182  MET A N   1 
ATOM   1317 C  CA  . MET A 1 198 ? 18.401 20.550 39.575 1.00 21.47 ? 182  MET A CA  1 
ATOM   1318 C  C   . MET A 1 198 ? 19.849 20.517 39.106 1.00 22.11 ? 182  MET A C   1 
ATOM   1319 O  O   . MET A 1 198 ? 20.729 21.066 39.773 1.00 23.29 ? 182  MET A O   1 
ATOM   1320 C  CB  . MET A 1 198 ? 18.034 19.343 40.443 1.00 21.31 ? 182  MET A CB  1 
ATOM   1321 C  CG  . MET A 1 198 ? 18.840 19.266 41.762 1.00 21.10 ? 182  MET A CG  1 
ATOM   1322 S  SD  . MET A 1 198 ? 18.696 20.742 42.811 1.00 23.65 ? 182  MET A SD  1 
ATOM   1323 C  CE  . MET A 1 198 ? 17.053 20.556 43.485 1.00 20.87 ? 182  MET A CE  1 
ATOM   1324 N  N   . CYS A 1 199 ? 20.102 19.887 37.961 1.00 21.69 ? 183  CYS A N   1 
ATOM   1325 C  CA  . CYS A 1 199 ? 21.462 19.877 37.394 1.00 22.18 ? 183  CYS A CA  1 
ATOM   1326 C  C   . CYS A 1 199 ? 21.949 21.309 37.203 1.00 22.48 ? 183  CYS A C   1 
ATOM   1327 O  O   . CYS A 1 199 ? 23.085 21.629 37.539 1.00 21.84 ? 183  CYS A O   1 
ATOM   1328 C  CB  . CYS A 1 199 ? 21.501 19.118 36.077 1.00 22.30 ? 183  CYS A CB  1 
ATOM   1329 S  SG  . CYS A 1 199 ? 21.443 17.322 36.255 1.00 23.29 ? 183  CYS A SG  1 
ATOM   1330 N  N   . ARG A 1 200 ? 21.070 22.163 36.689 1.00 21.05 ? 184  ARG A N   1 
ATOM   1331 C  CA  . ARG A 1 200 ? 21.407 23.555 36.419 1.00 21.93 ? 184  ARG A CA  1 
ATOM   1332 C  C   . ARG A 1 200 ? 21.720 24.290 37.719 1.00 21.50 ? 184  ARG A C   1 
ATOM   1333 O  O   . ARG A 1 200 ? 22.694 25.062 37.778 1.00 21.41 ? 184  ARG A O   1 
ATOM   1334 C  CB  . ARG A 1 200 ? 20.289 24.284 35.638 1.00 21.89 ? 184  ARG A CB  1 
ATOM   1335 C  CG  . ARG A 1 200 ? 20.600 25.759 35.304 1.00 24.45 ? 184  ARG A CG  1 
ATOM   1336 C  CD  . ARG A 1 200 ? 19.484 26.378 34.393 1.00 33.83 ? 184  ARG A CD  1 
ATOM   1337 N  NE  . ARG A 1 200 ? 19.603 27.846 34.301 1.00 39.96 ? 184  ARG A NE  1 
ATOM   1338 C  CZ  . ARG A 1 200 ? 20.166 28.512 33.289 1.00 42.40 ? 184  ARG A CZ  1 
ATOM   1339 N  NH1 . ARG A 1 200 ? 20.661 27.862 32.239 1.00 45.08 ? 184  ARG A NH1 1 
ATOM   1340 N  NH2 . ARG A 1 200 ? 20.226 29.842 33.316 1.00 42.55 ? 184  ARG A NH2 1 
ATOM   1341 N  N   . ALA A 1 201 ? 20.916 24.041 38.754 1.00 21.67 ? 185  ALA A N   1 
ATOM   1342 C  CA  . ALA A 1 201 ? 21.173 24.638 40.052 1.00 21.93 ? 185  ALA A CA  1 
ATOM   1343 C  C   . ALA A 1 201 ? 22.510 24.187 40.617 1.00 22.76 ? 185  ALA A C   1 
ATOM   1344 O  O   . ALA A 1 201 ? 23.258 25.004 41.171 1.00 23.29 ? 185  ALA A O   1 
ATOM   1345 C  CB  . ALA A 1 201 ? 20.007 24.324 41.046 1.00 22.17 ? 185  ALA A CB  1 
ATOM   1346 N  N   . MET A 1 202 ? 22.816 22.894 40.500 1.00 22.70 ? 186  MET A N   1 
ATOM   1347 C  CA  . MET A 1 202 ? 24.082 22.373 41.019 1.00 23.10 ? 186  MET A CA  1 
ATOM   1348 C  C   . MET A 1 202 ? 25.282 22.951 40.281 1.00 23.41 ? 186  MET A C   1 
ATOM   1349 O  O   . MET A 1 202 ? 26.314 23.266 40.890 1.00 23.33 ? 186  MET A O   1 
ATOM   1350 C  CB  . MET A 1 202 ? 24.105 20.840 40.977 1.00 23.42 ? 186  MET A CB  1 
ATOM   1351 C  CG  . MET A 1 202 ? 23.057 20.217 41.974 1.00 25.24 ? 186  MET A CG  1 
ATOM   1352 S  SD  . MET A 1 202 ? 23.342 20.692 43.713 1.00 25.13 ? 186  MET A SD  1 
ATOM   1353 C  CE  . MET A 1 202 ? 22.179 22.034 43.930 1.00 23.99 ? 186  MET A CE  1 
ATOM   1354 N  N   . GLU A 1 203 ? 25.140 23.125 38.975 1.00 22.42 ? 187  GLU A N   1 
ATOM   1355 C  CA  . GLU A 1 203 ? 26.201 23.784 38.180 1.00 22.63 ? 187  GLU A CA  1 
ATOM   1356 C  C   . GLU A 1 203 ? 26.452 25.237 38.633 1.00 22.28 ? 187  GLU A C   1 
ATOM   1357 O  O   . GLU A 1 203 ? 27.621 25.666 38.748 1.00 22.26 ? 187  GLU A O   1 
ATOM   1358 C  CB  . GLU A 1 203 ? 25.851 23.728 36.708 1.00 23.22 ? 187  GLU A CB  1 
ATOM   1359 C  CG  . GLU A 1 203 ? 26.146 22.364 36.133 1.00 26.75 ? 187  GLU A CG  1 
ATOM   1360 C  CD  . GLU A 1 203 ? 25.757 22.247 34.698 1.00 35.37 ? 187  GLU A CD  1 
ATOM   1361 O  OE1 . GLU A 1 203 ? 25.306 23.269 34.121 1.00 37.83 ? 187  GLU A OE1 1 
ATOM   1362 O  OE2 . GLU A 1 203 ? 25.917 21.135 34.140 1.00 37.72 ? 187  GLU A OE2 1 
ATOM   1363 N  N   . LYS A 1 204 ? 25.375 25.964 38.920 1.00 21.68 ? 188  LYS A N   1 
ATOM   1364 C  CA  . LYS A 1 204 ? 25.492 27.353 39.383 1.00 22.55 ? 188  LYS A CA  1 
ATOM   1365 C  C   . LYS A 1 204 ? 26.225 27.403 40.721 1.00 22.18 ? 188  LYS A C   1 
ATOM   1366 O  O   . LYS A 1 204 ? 27.122 28.234 40.909 1.00 23.31 ? 188  LYS A O   1 
ATOM   1367 C  CB  . LYS A 1 204 ? 24.128 28.059 39.491 1.00 22.01 ? 188  LYS A CB  1 
ATOM   1368 C  CG  . LYS A 1 204 ? 23.497 28.373 38.122 1.00 22.93 ? 188  LYS A CG  1 
ATOM   1369 C  CD  . LYS A 1 204 ? 22.175 29.110 38.289 1.00 24.29 ? 188  LYS A CD  1 
ATOM   1370 C  CE  . LYS A 1 204 ? 21.517 29.386 36.943 1.00 24.81 ? 188  LYS A CE  1 
ATOM   1371 N  NZ  . LYS A 1 204 ? 20.320 30.268 36.998 1.00 25.95 ? 188  LYS A NZ  1 
ATOM   1372 N  N   . VAL A 1 205 ? 25.840 26.522 41.636 1.00 22.05 ? 189  VAL A N   1 
ATOM   1373 C  CA  . VAL A 1 205 ? 26.480 26.484 42.957 1.00 22.41 ? 189  VAL A CA  1 
ATOM   1374 C  C   . VAL A 1 205 ? 27.962 26.070 42.821 1.00 21.95 ? 189  VAL A C   1 
ATOM   1375 O  O   . VAL A 1 205 ? 28.852 26.703 43.390 1.00 22.53 ? 189  VAL A O   1 
ATOM   1376 C  CB  . VAL A 1 205 ? 25.741 25.516 43.884 1.00 22.29 ? 189  VAL A CB  1 
ATOM   1377 C  CG1 . VAL A 1 205 ? 26.508 25.347 45.194 1.00 21.86 ? 189  VAL A CG1 1 
ATOM   1378 C  CG2 . VAL A 1 205 ? 24.360 26.053 44.211 1.00 21.97 ? 189  VAL A CG2 1 
ATOM   1379 N  N   . TYR A 1 206 ? 28.214 25.013 42.051 1.00 21.55 ? 190  TYR A N   1 
ATOM   1380 C  CA  . TYR A 1 206 ? 29.566 24.480 41.881 1.00 21.50 ? 190  TYR A CA  1 
ATOM   1381 C  C   . TYR A 1 206 ? 30.530 25.572 41.391 1.00 22.46 ? 190  TYR A C   1 
ATOM   1382 O  O   . TYR A 1 206 ? 31.674 25.630 41.848 1.00 21.91 ? 190  TYR A O   1 
ATOM   1383 C  CB  . TYR A 1 206 ? 29.531 23.376 40.835 1.00 22.47 ? 190  TYR A CB  1 
ATOM   1384 C  CG  . TYR A 1 206 ? 30.745 22.455 40.867 1.00 21.62 ? 190  TYR A CG  1 
ATOM   1385 C  CD1 . TYR A 1 206 ? 30.713 21.269 41.612 1.00 21.69 ? 190  TYR A CD1 1 
ATOM   1386 C  CD2 . TYR A 1 206 ? 31.916 22.779 40.171 1.00 22.27 ? 190  TYR A CD2 1 
ATOM   1387 C  CE1 . TYR A 1 206 ? 31.806 20.420 41.639 1.00 21.41 ? 190  TYR A CE1 1 
ATOM   1388 C  CE2 . TYR A 1 206 ? 33.011 21.912 40.177 1.00 24.88 ? 190  TYR A CE2 1 
ATOM   1389 C  CZ  . TYR A 1 206 ? 32.939 20.743 40.914 1.00 24.61 ? 190  TYR A CZ  1 
ATOM   1390 O  OH  . TYR A 1 206 ? 34.010 19.874 40.953 1.00 28.04 ? 190  TYR A OH  1 
ATOM   1391 N  N   . HIS A 1 207 ? 30.056 26.439 40.480 1.00 22.05 ? 191  HIS A N   1 
ATOM   1392 C  CA  . HIS A 1 207 ? 30.951 27.368 39.771 1.00 22.53 ? 191  HIS A CA  1 
ATOM   1393 C  C   . HIS A 1 207 ? 30.832 28.824 40.265 1.00 22.62 ? 191  HIS A C   1 
ATOM   1394 O  O   . HIS A 1 207 ? 31.332 29.767 39.604 1.00 22.55 ? 191  HIS A O   1 
ATOM   1395 C  CB  . HIS A 1 207 ? 30.719 27.283 38.257 1.00 23.22 ? 191  HIS A CB  1 
ATOM   1396 C  CG  . HIS A 1 207 ? 31.069 25.948 37.663 1.00 25.60 ? 191  HIS A CG  1 
ATOM   1397 N  ND1 . HIS A 1 207 ? 32.353 25.433 37.684 1.00 27.54 ? 191  HIS A ND1 1 
ATOM   1398 C  CD2 . HIS A 1 207 ? 30.312 25.035 37.009 1.00 26.11 ? 191  HIS A CD2 1 
ATOM   1399 C  CE1 . HIS A 1 207 ? 32.367 24.260 37.076 1.00 24.74 ? 191  HIS A CE1 1 
ATOM   1400 N  NE2 . HIS A 1 207 ? 31.141 23.998 36.655 1.00 25.75 ? 191  HIS A NE2 1 
ATOM   1401 N  N   . ILE A 1 208 ? 30.183 29.009 41.417 1.00 22.72 ? 192  ILE A N   1 
ATOM   1402 C  CA  . ILE A 1 208 ? 30.097 30.345 42.033 1.00 23.77 ? 192  ILE A CA  1 
ATOM   1403 C  C   . ILE A 1 208 ? 31.442 31.094 41.983 1.00 23.39 ? 192  ILE A C   1 
ATOM   1404 O  O   . ILE A 1 208 ? 31.508 32.292 41.648 1.00 22.89 ? 192  ILE A O   1 
ATOM   1405 C  CB  . ILE A 1 208 ? 29.598 30.251 43.501 1.00 24.15 ? 192  ILE A CB  1 
ATOM   1406 C  CG1 . ILE A 1 208 ? 28.069 30.134 43.527 1.00 25.02 ? 192  ILE A CG1 1 
ATOM   1407 C  CG2 . ILE A 1 208 ? 30.031 31.477 44.300 1.00 26.68 ? 192  ILE A CG2 1 
ATOM   1408 C  CD1 . ILE A 1 208 ? 27.512 29.800 44.940 1.00 25.01 ? 192  ILE A CD1 1 
ATOM   1409 N  N   . HIS A 1 209 ? 32.515 30.393 42.333 1.00 22.07 ? 193  HIS A N   1 
ATOM   1410 C  CA  . HIS A 1 209 ? 33.823 31.034 42.481 1.00 22.39 ? 193  HIS A CA  1 
ATOM   1411 C  C   . HIS A 1 209 ? 34.800 30.717 41.363 1.00 22.30 ? 193  HIS A C   1 
ATOM   1412 O  O   . HIS A 1 209 ? 36.028 30.793 41.544 1.00 22.45 ? 193  HIS A O   1 
ATOM   1413 C  CB  . HIS A 1 209 ? 34.431 30.668 43.841 1.00 21.59 ? 193  HIS A CB  1 
ATOM   1414 C  CG  . HIS A 1 209 ? 33.710 31.293 44.983 1.00 23.08 ? 193  HIS A CG  1 
ATOM   1415 N  ND1 . HIS A 1 209 ? 33.434 32.652 45.034 1.00 23.22 ? 193  HIS A ND1 1 
ATOM   1416 C  CD2 . HIS A 1 209 ? 33.211 30.753 46.122 1.00 23.06 ? 193  HIS A CD2 1 
ATOM   1417 C  CE1 . HIS A 1 209 ? 32.796 32.911 46.161 1.00 25.09 ? 193  HIS A CE1 1 
ATOM   1418 N  NE2 . HIS A 1 209 ? 32.628 31.776 46.827 1.00 25.37 ? 193  HIS A NE2 1 
ATOM   1419 N  N   . LYS A 1 210 ? 34.255 30.344 40.209 1.00 21.94 ? 194  LYS A N   1 
ATOM   1420 C  CA  . LYS A 1 210 ? 35.104 30.095 39.036 1.00 23.12 ? 194  LYS A CA  1 
ATOM   1421 C  C   . LYS A 1 210 ? 36.014 31.297 38.713 1.00 22.15 ? 194  LYS A C   1 
ATOM   1422 O  O   . LYS A 1 210 ? 37.184 31.125 38.306 1.00 21.52 ? 194  LYS A O   1 
ATOM   1423 C  CB  . LYS A 1 210 ? 34.258 29.716 37.821 1.00 23.38 ? 194  LYS A CB  1 
ATOM   1424 C  CG  . LYS A 1 210 ? 35.097 29.455 36.570 1.00 27.25 ? 194  LYS A CG  1 
ATOM   1425 C  CD  . LYS A 1 210 ? 34.221 28.903 35.462 1.00 31.49 ? 194  LYS A CD  1 
ATOM   1426 C  CE  . LYS A 1 210 ? 34.987 28.867 34.148 1.00 35.92 ? 194  LYS A CE  1 
ATOM   1427 N  NZ  . LYS A 1 210 ? 34.049 28.545 33.039 1.00 37.76 ? 194  LYS A NZ  1 
ATOM   1428 N  N   . GLY A 1 211 ? 35.479 32.501 38.938 1.00 22.99 ? 195  GLY A N   1 
ATOM   1429 C  CA  . GLY A 1 211 ? 36.194 33.751 38.700 1.00 23.82 ? 195  GLY A CA  1 
ATOM   1430 C  C   . GLY A 1 211 ? 37.436 33.955 39.544 1.00 23.04 ? 195  GLY A C   1 
ATOM   1431 O  O   . GLY A 1 211 ? 38.329 34.697 39.141 1.00 23.93 ? 195  GLY A O   1 
ATOM   1432 N  N   . ASN A 1 212 ? 37.492 33.321 40.715 1.00 21.81 ? 196  ASN A N   1 
ATOM   1433 C  CA  . ASN A 1 212 ? 38.671 33.401 41.578 1.00 21.88 ? 196  ASN A CA  1 
ATOM   1434 C  C   . ASN A 1 212 ? 39.388 32.049 41.709 1.00 21.86 ? 196  ASN A C   1 
ATOM   1435 O  O   . ASN A 1 212 ? 40.080 31.782 42.706 1.00 21.50 ? 196  ASN A O   1 
ATOM   1436 C  CB  . ASN A 1 212 ? 38.331 34.003 42.961 1.00 22.36 ? 196  ASN A CB  1 
ATOM   1437 C  CG  . ASN A 1 212 ? 37.207 33.285 43.663 1.00 23.84 ? 196  ASN A CG  1 
ATOM   1438 O  OD1 . ASN A 1 212 ? 37.412 32.241 44.296 1.00 25.29 ? 196  ASN A OD1 1 
ATOM   1439 N  ND2 . ASN A 1 212 ? 35.999 33.848 43.576 1.00 22.85 ? 196  ASN A ND2 1 
ATOM   1440 N  N   . ASP A 1 213 ? 39.238 31.224 40.676 1.00 21.03 ? 197  ASP A N   1 
ATOM   1441 C  CA  . ASP A 1 213 ? 39.827 29.870 40.652 1.00 21.41 ? 197  ASP A CA  1 
ATOM   1442 C  C   . ASP A 1 213 ? 39.458 29.078 41.912 1.00 20.32 ? 197  ASP A C   1 
ATOM   1443 O  O   . ASP A 1 213 ? 40.287 28.322 42.440 1.00 20.48 ? 197  ASP A O   1 
ATOM   1444 C  CB  . ASP A 1 213 ? 41.370 29.905 40.442 1.00 20.24 ? 197  ASP A CB  1 
ATOM   1445 C  CG  . ASP A 1 213 ? 41.766 30.462 39.075 1.00 22.34 ? 197  ASP A CG  1 
ATOM   1446 O  OD1 . ASP A 1 213 ? 40.990 30.328 38.106 1.00 24.59 ? 197  ASP A OD1 1 
ATOM   1447 O  OD2 . ASP A 1 213 ? 42.864 31.014 38.961 1.00 24.27 ? 197  ASP A OD2 1 
ATOM   1448 N  N   . TYR A 1 214 ? 38.198 29.240 42.344 1.00 21.09 ? 198  TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 214 ? 37.603 28.535 43.482 1.00 21.59 ? 198  TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 214 ? 38.369 28.755 44.790 1.00 21.66 ? 198  TYR A C   1 
ATOM   1451 O  O   . TYR A 1 214 ? 38.201 27.980 45.713 1.00 22.32 ? 198  TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 214 ? 37.517 27.024 43.182 1.00 21.59 ? 198  TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 214 ? 36.847 26.769 41.880 1.00 22.36 ? 198  TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 214 ? 37.600 26.506 40.730 1.00 25.35 ? 198  TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 214 ? 35.458 26.875 41.764 1.00 22.95 ? 198  TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 214 ? 36.977 26.319 39.510 1.00 25.87 ? 198  TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 214 ? 34.820 26.651 40.547 1.00 24.18 ? 198  TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 214 ? 35.581 26.387 39.432 1.00 24.74 ? 198  TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 214 ? 34.971 26.180 38.209 1.00 25.63 ? 198  TYR A OH  1 
ATOM   1460 N  N   . ALA A 1 215 ? 39.188 29.803 44.877 1.00 21.35 ? 199  ALA A N   1 
ATOM   1461 C  CA  . ALA A 1 215 ? 39.857 30.143 46.158 1.00 21.28 ? 199  ALA A CA  1 
ATOM   1462 C  C   . ALA A 1 215 ? 38.878 30.360 47.330 1.00 22.05 ? 199  ALA A C   1 
ATOM   1463 O  O   . ALA A 1 215 ? 39.187 30.053 48.479 1.00 22.23 ? 199  ALA A O   1 
ATOM   1464 C  CB  . ALA A 1 215 ? 40.753 31.367 45.997 1.00 21.13 ? 199  ALA A CB  1 
ATOM   1465 N  N   . LEU A 1 216 ? 37.716 30.926 47.035 1.00 21.93 ? 200  LEU A N   1 
ATOM   1466 C  CA  . LEU A 1 216 ? 36.750 31.241 48.090 1.00 22.16 ? 200  LEU A CA  1 
ATOM   1467 C  C   . LEU A 1 216 ? 35.839 30.066 48.471 1.00 22.95 ? 200  LEU A C   1 
ATOM   1468 O  O   . LEU A 1 216 ? 35.040 30.169 49.434 1.00 23.82 ? 200  LEU A O   1 
ATOM   1469 C  CB  . LEU A 1 216 ? 35.934 32.499 47.710 1.00 22.52 ? 200  LEU A CB  1 
ATOM   1470 C  CG  . LEU A 1 216 ? 36.720 33.822 47.617 1.00 24.60 ? 200  LEU A CG  1 
ATOM   1471 C  CD1 . LEU A 1 216 ? 35.811 34.972 47.214 1.00 22.06 ? 200  LEU A CD1 1 
ATOM   1472 C  CD2 . LEU A 1 216 ? 37.411 34.137 48.942 1.00 25.63 ? 200  LEU A CD2 1 
ATOM   1473 N  N   . ASP A 1 217 ? 35.968 28.941 47.765 1.00 22.42 ? 201  ASP A N   1 
ATOM   1474 C  CA  . ASP A 1 217 ? 35.167 27.746 48.105 1.00 23.26 ? 201  ASP A CA  1 
ATOM   1475 C  C   . ASP A 1 217 ? 35.329 27.393 49.589 1.00 24.16 ? 201  ASP A C   1 
ATOM   1476 O  O   . ASP A 1 217 ? 34.350 27.078 50.281 1.00 24.18 ? 201  ASP A O   1 
ATOM   1477 C  CB  . ASP A 1 217 ? 35.537 26.532 47.242 1.00 23.18 ? 201  ASP A CB  1 
ATOM   1478 C  CG  . ASP A 1 217 ? 34.827 26.512 45.901 1.00 23.51 ? 201  ASP A CG  1 
ATOM   1479 O  OD1 . ASP A 1 217 ? 34.096 27.478 45.592 1.00 23.52 ? 201  ASP A OD1 1 
ATOM   1480 O  OD2 . ASP A 1 217 ? 35.049 25.523 45.157 1.00 24.03 ? 201  ASP A OD2 1 
ATOM   1481 N  N   . LYS A 1 218 ? 36.559 27.471 50.085 1.00 23.46 ? 202  LYS A N   1 
ATOM   1482 C  CA  . LYS A 1 218 ? 36.842 27.053 51.474 1.00 24.43 ? 202  LYS A CA  1 
ATOM   1483 C  C   . LYS A 1 218 ? 36.299 27.983 52.547 1.00 23.65 ? 202  LYS A C   1 
ATOM   1484 O  O   . LYS A 1 218 ? 36.204 27.604 53.714 1.00 25.84 ? 202  LYS A O   1 
ATOM   1485 C  CB  . LYS A 1 218 ? 38.340 26.814 51.684 1.00 24.17 ? 202  LYS A CB  1 
ATOM   1486 C  CG  . LYS A 1 218 ? 39.263 27.983 51.270 1.00 25.88 ? 202  LYS A CG  1 
ATOM   1487 C  CD  . LYS A 1 218 ? 40.763 27.640 51.398 1.00 29.52 ? 202  LYS A CD  1 
ATOM   1488 C  CE  . LYS A 1 218 ? 41.303 26.746 50.235 1.00 32.20 ? 202  LYS A CE  1 
ATOM   1489 N  NZ  . LYS A 1 218 ? 41.457 27.394 48.883 1.00 29.48 ? 202  LYS A NZ  1 
ATOM   1490 N  N   . VAL A 1 219 ? 35.959 29.209 52.162 1.00 23.52 ? 203  VAL A N   1 
ATOM   1491 C  CA  . VAL A 1 219 ? 35.301 30.174 53.062 1.00 22.90 ? 203  VAL A CA  1 
ATOM   1492 C  C   . VAL A 1 219 ? 33.856 30.558 52.623 1.00 22.96 ? 203  VAL A C   1 
ATOM   1493 O  O   . VAL A 1 219 ? 33.327 31.600 52.989 1.00 23.08 ? 203  VAL A O   1 
ATOM   1494 C  CB  . VAL A 1 219 ? 36.202 31.423 53.286 1.00 22.49 ? 203  VAL A CB  1 
ATOM   1495 C  CG1 . VAL A 1 219 ? 37.473 31.035 54.124 1.00 22.72 ? 203  VAL A CG1 1 
ATOM   1496 C  CG2 . VAL A 1 219 ? 36.543 32.103 51.946 1.00 21.47 ? 203  VAL A CG2 1 
ATOM   1497 N  N   . THR A 1 220 ? 33.228 29.694 51.833 1.00 21.86 ? 204  THR A N   1 
ATOM   1498 C  CA  . THR A 1 220 ? 31.841 29.864 51.466 1.00 23.02 ? 204  THR A CA  1 
ATOM   1499 C  C   . THR A 1 220 ? 31.068 28.834 52.271 1.00 22.99 ? 204  THR A C   1 
ATOM   1500 O  O   . THR A 1 220 ? 31.324 27.620 52.151 1.00 23.41 ? 204  THR A O   1 
ATOM   1501 C  CB  . THR A 1 220 ? 31.676 29.621 49.959 1.00 22.11 ? 204  THR A CB  1 
ATOM   1502 O  OG1 . THR A 1 220 ? 32.434 30.631 49.290 1.00 24.09 ? 204  THR A OG1 1 
ATOM   1503 C  CG2 . THR A 1 220 ? 30.194 29.682 49.513 1.00 23.68 ? 204  THR A CG2 1 
ATOM   1504 N  N   . PHE A 1 221 ? 30.105 29.305 53.047 1.00 22.77 ? 205  PHE A N   1 
ATOM   1505 C  CA  . PHE A 1 221 ? 29.381 28.437 53.974 1.00 23.52 ? 205  PHE A CA  1 
ATOM   1506 C  C   . PHE A 1 221 ? 27.928 28.297 53.587 1.00 23.15 ? 205  PHE A C   1 
ATOM   1507 O  O   . PHE A 1 221 ? 27.272 29.269 53.233 1.00 23.14 ? 205  PHE A O   1 
ATOM   1508 C  CB  . PHE A 1 221 ? 29.591 28.887 55.429 1.00 22.53 ? 205  PHE A CB  1 
ATOM   1509 C  CG  . PHE A 1 221 ? 31.015 28.681 55.891 1.00 24.06 ? 205  PHE A CG  1 
ATOM   1510 C  CD1 . PHE A 1 221 ? 31.432 27.442 56.398 1.00 24.15 ? 205  PHE A CD1 1 
ATOM   1511 C  CD2 . PHE A 1 221 ? 31.951 29.700 55.742 1.00 24.99 ? 205  PHE A CD2 1 
ATOM   1512 C  CE1 . PHE A 1 221 ? 32.763 27.244 56.775 1.00 26.01 ? 205  PHE A CE1 1 
ATOM   1513 C  CE2 . PHE A 1 221 ? 33.317 29.514 56.134 1.00 25.70 ? 205  PHE A CE2 1 
ATOM   1514 C  CZ  . PHE A 1 221 ? 33.698 28.281 56.650 1.00 26.08 ? 205  PHE A CZ  1 
ATOM   1515 N  N   . ILE A 1 222 ? 27.443 27.065 53.667 1.00 22.62 ? 206  ILE A N   1 
ATOM   1516 C  CA  . ILE A 1 222 ? 26.144 26.670 53.109 1.00 22.99 ? 206  ILE A CA  1 
ATOM   1517 C  C   . ILE A 1 222 ? 25.103 26.649 54.255 1.00 22.21 ? 206  ILE A C   1 
ATOM   1518 O  O   . ILE A 1 222 ? 25.295 25.943 55.222 1.00 21.97 ? 206  ILE A O   1 
ATOM   1519 C  CB  . ILE A 1 222 ? 26.230 25.239 52.502 1.00 23.51 ? 206  ILE A CB  1 
ATOM   1520 C  CG1 . ILE A 1 222 ? 27.274 25.159 51.350 1.00 26.00 ? 206  ILE A CG1 1 
ATOM   1521 C  CG2 . ILE A 1 222 ? 24.836 24.767 52.022 1.00 23.99 ? 206  ILE A CG2 1 
ATOM   1522 C  CD1 . ILE A 1 222 ? 27.048 26.149 50.268 1.00 28.66 ? 206  ILE A CD1 1 
ATOM   1523 N  N   . PHE A 1 223 ? 24.050 27.458 54.127 1.00 21.16 ? 207  PHE A N   1 
ATOM   1524 C  CA  . PHE A 1 223 ? 22.997 27.608 55.151 1.00 22.52 ? 207  PHE A CA  1 
ATOM   1525 C  C   . PHE A 1 223 ? 21.694 27.196 54.495 1.00 22.02 ? 207  PHE A C   1 
ATOM   1526 O  O   . PHE A 1 223 ? 21.072 27.986 53.802 1.00 23.03 ? 207  PHE A O   1 
ATOM   1527 C  CB  . PHE A 1 223 ? 22.930 29.074 55.625 1.00 22.51 ? 207  PHE A CB  1 
ATOM   1528 C  CG  . PHE A 1 223 ? 24.185 29.531 56.314 1.00 21.99 ? 207  PHE A CG  1 
ATOM   1529 C  CD1 . PHE A 1 223 ? 25.177 30.225 55.619 1.00 23.43 ? 207  PHE A CD1 1 
ATOM   1530 C  CD2 . PHE A 1 223 ? 24.377 29.252 57.667 1.00 22.60 ? 207  PHE A CD2 1 
ATOM   1531 C  CE1 . PHE A 1 223 ? 26.360 30.640 56.277 1.00 24.34 ? 207  PHE A CE1 1 
ATOM   1532 C  CE2 . PHE A 1 223 ? 25.536 29.666 58.336 1.00 23.70 ? 207  PHE A CE2 1 
ATOM   1533 C  CZ  . PHE A 1 223 ? 26.533 30.366 57.647 1.00 26.19 ? 207  PHE A CZ  1 
ATOM   1534 N  N   . PRO A 1 224 ? 21.307 25.923 54.657 1.00 22.10 ? 208  PRO A N   1 
ATOM   1535 C  CA  . PRO A 1 224 ? 20.150 25.376 53.962 1.00 21.72 ? 208  PRO A CA  1 
ATOM   1536 C  C   . PRO A 1 224 ? 18.848 25.456 54.794 1.00 21.59 ? 208  PRO A C   1 
ATOM   1537 O  O   . PRO A 1 224 ? 18.864 25.898 55.958 1.00 21.41 ? 208  PRO A O   1 
ATOM   1538 C  CB  . PRO A 1 224 ? 20.566 23.920 53.742 1.00 21.63 ? 208  PRO A CB  1 
ATOM   1539 C  CG  . PRO A 1 224 ? 21.275 23.597 55.069 1.00 22.62 ? 208  PRO A CG  1 
ATOM   1540 C  CD  . PRO A 1 224 ? 22.003 24.901 55.458 1.00 22.51 ? 208  PRO A CD  1 
ATOM   1541 N  N   . GLY A 1 225 ? 17.753 24.977 54.222 1.00 21.49 ? 209  GLY A N   1 
ATOM   1542 C  CA  . GLY A 1 225 ? 16.440 25.176 54.820 1.00 20.74 ? 209  GLY A CA  1 
ATOM   1543 C  C   . GLY A 1 225 ? 16.099 24.283 55.992 1.00 21.15 ? 209  GLY A C   1 
ATOM   1544 O  O   . GLY A 1 225 ? 15.268 24.667 56.834 1.00 21.45 ? 209  GLY A O   1 
ATOM   1545 N  N   . HIS A 1 226 ? 16.708 23.094 56.043 1.00 21.56 ? 210  HIS A N   1 
ATOM   1546 C  CA  . HIS A 1 226 ? 16.314 22.064 57.022 1.00 21.60 ? 210  HIS A CA  1 
ATOM   1547 C  C   . HIS A 1 226 ? 17.494 21.251 57.562 1.00 22.35 ? 210  HIS A C   1 
ATOM   1548 O  O   . HIS A 1 226 ? 18.533 21.096 56.906 1.00 21.99 ? 210  HIS A O   1 
ATOM   1549 C  CB  . HIS A 1 226 ? 15.314 21.052 56.431 1.00 21.81 ? 210  HIS A CB  1 
ATOM   1550 C  CG  . HIS A 1 226 ? 14.019 21.647 55.983 1.00 22.28 ? 210  HIS A CG  1 
ATOM   1551 N  ND1 . HIS A 1 226 ? 12.890 21.669 56.772 1.00 23.71 ? 210  HIS A ND1 1 
ATOM   1552 C  CD2 . HIS A 1 226 ? 13.681 22.254 54.822 1.00 21.79 ? 210  HIS A CD2 1 
ATOM   1553 C  CE1 . HIS A 1 226 ? 11.903 22.244 56.104 1.00 22.62 ? 210  HIS A CE1 1 
ATOM   1554 N  NE2 . HIS A 1 226 ? 12.356 22.612 54.917 1.00 22.66 ? 210  HIS A NE2 1 
ATOM   1555 N  N   . GLU A 1 227 ? 17.276 20.682 58.736 1.00 21.44 ? 211  GLU A N   1 
ATOM   1556 C  CA  . GLU A 1 227 ? 18.182 19.713 59.346 1.00 21.81 ? 211  GLU A CA  1 
ATOM   1557 C  C   . GLU A 1 227 ? 17.921 18.327 58.757 1.00 21.94 ? 211  GLU A C   1 
ATOM   1558 O  O   . GLU A 1 227 ? 17.307 17.469 59.419 1.00 22.28 ? 211  GLU A O   1 
ATOM   1559 C  CB  . GLU A 1 227 ? 17.924 19.709 60.861 1.00 21.42 ? 211  GLU A CB  1 
ATOM   1560 C  CG  . GLU A 1 227 ? 18.850 18.808 61.690 1.00 21.21 ? 211  GLU A CG  1 
ATOM   1561 C  CD  . GLU A 1 227 ? 20.304 19.140 61.465 1.00 22.37 ? 211  GLU A CD  1 
ATOM   1562 O  OE1 . GLU A 1 227 ? 20.823 19.983 62.226 1.00 22.76 ? 211  GLU A OE1 1 
ATOM   1563 O  OE2 . GLU A 1 227 ? 20.910 18.564 60.520 1.00 22.60 ? 211  GLU A OE2 1 
ATOM   1564 N  N   . TYR A 1 228 ? 18.371 18.113 57.517 1.00 22.07 ? 212  TYR A N   1 
ATOM   1565 C  CA  . TYR A 1 228 ? 18.244 16.821 56.822 1.00 23.69 ? 212  TYR A CA  1 
ATOM   1566 C  C   . TYR A 1 228 ? 19.617 16.132 56.643 1.00 23.94 ? 212  TYR A C   1 
ATOM   1567 O  O   . TYR A 1 228 ? 19.726 15.104 55.960 1.00 24.09 ? 212  TYR A O   1 
ATOM   1568 C  CB  . TYR A 1 228 ? 17.613 16.991 55.431 1.00 24.10 ? 212  TYR A CB  1 
ATOM   1569 C  CG  . TYR A 1 228 ? 16.181 17.484 55.364 1.00 25.06 ? 212  TYR A CG  1 
ATOM   1570 C  CD1 . TYR A 1 228 ? 15.279 17.333 56.425 1.00 25.86 ? 212  TYR A CD1 1 
ATOM   1571 C  CD2 . TYR A 1 228 ? 15.718 18.070 54.185 1.00 25.73 ? 212  TYR A CD2 1 
ATOM   1572 C  CE1 . TYR A 1 228 ? 13.936 17.800 56.301 1.00 26.62 ? 212  TYR A CE1 1 
ATOM   1573 C  CE2 . TYR A 1 228 ? 14.413 18.506 54.049 1.00 26.78 ? 212  TYR A CE2 1 
ATOM   1574 C  CZ  . TYR A 1 228 ? 13.536 18.389 55.090 1.00 28.18 ? 212  TYR A CZ  1 
ATOM   1575 O  OH  . TYR A 1 228 ? 12.265 18.876 54.861 1.00 29.49 ? 212  TYR A OH  1 
ATOM   1576 N  N   . THR A 1 229 ? 20.642 16.698 57.275 1.00 23.96 ? 213  THR A N   1 
ATOM   1577 C  CA  . THR A 1 229 ? 22.020 16.265 57.095 1.00 24.57 ? 213  THR A CA  1 
ATOM   1578 C  C   . THR A 1 229 ? 22.233 14.764 57.365 1.00 25.04 ? 213  THR A C   1 
ATOM   1579 O  O   . THR A 1 229 ? 22.870 14.085 56.551 1.00 24.94 ? 213  THR A O   1 
ATOM   1580 C  CB  . THR A 1 229 ? 22.967 17.105 57.966 1.00 25.03 ? 213  THR A CB  1 
ATOM   1581 O  OG1 . THR A 1 229 ? 22.782 18.486 57.640 1.00 24.21 ? 213  THR A OG1 1 
ATOM   1582 C  CG2 . THR A 1 229 ? 24.416 16.727 57.761 1.00 23.80 ? 213  THR A CG2 1 
ATOM   1583 N  N   . SER A 1 230 ? 21.732 14.262 58.500 1.00 24.91 ? 214  SER A N   1 
ATOM   1584 C  CA  . SER A 1 230 ? 21.875 12.843 58.864 1.00 26.04 ? 214  SER A CA  1 
ATOM   1585 C  C   . SER A 1 230 ? 21.524 11.890 57.730 1.00 25.50 ? 214  SER A C   1 
ATOM   1586 O  O   . SER A 1 230 ? 22.326 11.005 57.371 1.00 26.02 ? 214  SER A O   1 
ATOM   1587 C  CB  . SER A 1 230 ? 20.974 12.511 60.059 1.00 25.26 ? 214  SER A CB  1 
ATOM   1588 O  OG  . SER A 1 230 ? 21.045 11.128 60.354 1.00 31.60 ? 214  SER A OG  1 
ATOM   1589 N  N   . GLY A 1 231 ? 20.321 12.060 57.185 1.00 24.73 ? 215  GLY A N   1 
ATOM   1590 C  CA  . GLY A 1 231 ? 19.798 11.130 56.200 1.00 24.80 ? 215  GLY A CA  1 
ATOM   1591 C  C   . GLY A 1 231 ? 20.595 11.205 54.911 1.00 24.39 ? 215  GLY A C   1 
ATOM   1592 O  O   . GLY A 1 231 ? 20.891 10.180 54.296 1.00 24.78 ? 215  GLY A O   1 
ATOM   1593 N  N   . PHE A 1 232 ? 20.956 12.421 54.509 1.00 23.60 ? 216  PHE A N   1 
ATOM   1594 C  CA  . PHE A 1 232 ? 21.744 12.597 53.289 1.00 23.13 ? 216  PHE A CA  1 
ATOM   1595 C  C   . PHE A 1 232 ? 23.180 12.077 53.425 1.00 23.14 ? 216  PHE A C   1 
ATOM   1596 O  O   . PHE A 1 232 ? 23.746 11.546 52.472 1.00 22.30 ? 216  PHE A O   1 
ATOM   1597 C  CB  . PHE A 1 232 ? 21.726 14.054 52.854 1.00 23.17 ? 216  PHE A CB  1 
ATOM   1598 C  CG  . PHE A 1 232 ? 20.450 14.454 52.160 1.00 23.42 ? 216  PHE A CG  1 
ATOM   1599 C  CD1 . PHE A 1 232 ? 19.658 15.467 52.660 1.00 23.26 ? 216  PHE A CD1 1 
ATOM   1600 C  CD2 . PHE A 1 232 ? 20.041 13.809 51.003 1.00 23.65 ? 216  PHE A CD2 1 
ATOM   1601 C  CE1 . PHE A 1 232 ? 18.449 15.842 52.001 1.00 24.44 ? 216  PHE A CE1 1 
ATOM   1602 C  CE2 . PHE A 1 232 ? 18.859 14.190 50.330 1.00 24.08 ? 216  PHE A CE2 1 
ATOM   1603 C  CZ  . PHE A 1 232 ? 18.074 15.208 50.832 1.00 25.05 ? 216  PHE A CZ  1 
ATOM   1604 N  N   . MET A 1 233 ? 23.774 12.238 54.602 1.00 22.02 ? 217  MET A N   1 
ATOM   1605 C  CA  . MET A 1 233 ? 25.146 11.782 54.806 1.00 22.70 ? 217  MET A CA  1 
ATOM   1606 C  C   . MET A 1 233 ? 25.220 10.240 54.825 1.00 22.91 ? 217  MET A C   1 
ATOM   1607 O  O   . MET A 1 233 ? 26.199 9.644  54.353 1.00 23.34 ? 217  MET A O   1 
ATOM   1608 C  CB  . MET A 1 233 ? 25.750 12.417 56.068 1.00 23.04 ? 217  MET A CB  1 
ATOM   1609 C  CG  . MET A 1 233 ? 26.082 13.919 55.898 1.00 21.49 ? 217  MET A CG  1 
ATOM   1610 S  SD  . MET A 1 233 ? 27.357 14.270 54.676 1.00 25.48 ? 217  MET A SD  1 
ATOM   1611 C  CE  . MET A 1 233 ? 28.800 13.613 55.556 1.00 21.14 ? 217  MET A CE  1 
ATOM   1612 N  N   . THR A 1 234 ? 24.167 9.600  55.323 1.00 22.93 ? 218  THR A N   1 
ATOM   1613 C  CA  . THR A 1 234 ? 24.068 8.142  55.262 1.00 23.12 ? 218  THR A CA  1 
ATOM   1614 C  C   . THR A 1 234 ? 24.003 7.709  53.796 1.00 22.97 ? 218  THR A C   1 
ATOM   1615 O  O   . THR A 1 234 ? 24.707 6.777  53.393 1.00 23.46 ? 218  THR A O   1 
ATOM   1616 C  CB  . THR A 1 234 ? 22.855 7.624  56.058 1.00 23.55 ? 218  THR A CB  1 
ATOM   1617 O  OG1 . THR A 1 234 ? 23.039 7.946  57.448 1.00 25.11 ? 218  THR A OG1 1 
ATOM   1618 C  CG2 . THR A 1 234 ? 22.720 6.100  55.932 1.00 23.61 ? 218  THR A CG2 1 
ATOM   1619 N  N   . PHE A 1 235 ? 23.167 8.407  53.021 1.00 22.05 ? 219  PHE A N   1 
ATOM   1620 C  CA  . PHE A 1 235 ? 23.083 8.244  51.572 1.00 22.14 ? 219  PHE A CA  1 
ATOM   1621 C  C   . PHE A 1 235 ? 24.448 8.366  50.874 1.00 21.05 ? 219  PHE A C   1 
ATOM   1622 O  O   . PHE A 1 235 ? 24.818 7.474  50.104 1.00 20.95 ? 219  PHE A O   1 
ATOM   1623 C  CB  . PHE A 1 235 ? 22.064 9.224  50.963 1.00 22.79 ? 219  PHE A CB  1 
ATOM   1624 C  CG  . PHE A 1 235 ? 22.007 9.167  49.472 1.00 24.66 ? 219  PHE A CG  1 
ATOM   1625 C  CD1 . PHE A 1 235 ? 21.417 8.071  48.818 1.00 26.88 ? 219  PHE A CD1 1 
ATOM   1626 C  CD2 . PHE A 1 235 ? 22.569 10.177 48.713 1.00 25.77 ? 219  PHE A CD2 1 
ATOM   1627 C  CE1 . PHE A 1 235 ? 21.379 8.008  47.413 1.00 27.27 ? 219  PHE A CE1 1 
ATOM   1628 C  CE2 . PHE A 1 235 ? 22.534 10.122 47.299 1.00 26.13 ? 219  PHE A CE2 1 
ATOM   1629 C  CZ  . PHE A 1 235 ? 21.941 9.045  46.659 1.00 26.46 ? 219  PHE A CZ  1 
ATOM   1630 N  N   . SER A 1 236 ? 25.190 9.458  51.138 1.00 20.83 ? 220  SER A N   1 
ATOM   1631 C  CA  . SER A 1 236 ? 26.543 9.655  50.553 1.00 20.69 ? 220  SER A CA  1 
ATOM   1632 C  C   . SER A 1 236 ? 27.489 8.503  50.910 1.00 20.60 ? 220  SER A C   1 
ATOM   1633 O  O   . SER A 1 236 ? 28.211 8.003  50.065 1.00 19.95 ? 220  SER A O   1 
ATOM   1634 C  CB  . SER A 1 236 ? 27.196 10.953 51.044 1.00 20.64 ? 220  SER A CB  1 
ATOM   1635 O  OG  . SER A 1 236 ? 26.534 12.091 50.542 1.00 23.54 ? 220  SER A OG  1 
ATOM   1636 N  N   . GLU A 1 237 ? 27.481 8.093  52.182 1.00 19.97 ? 221  GLU A N   1 
ATOM   1637 C  CA  . GLU A 1 237 ? 28.355 7.001  52.644 1.00 21.60 ? 221  GLU A CA  1 
ATOM   1638 C  C   . GLU A 1 237 ? 28.060 5.694  51.898 1.00 21.65 ? 221  GLU A C   1 
ATOM   1639 O  O   . GLU A 1 237 ? 28.992 5.008  51.452 1.00 22.46 ? 221  GLU A O   1 
ATOM   1640 C  CB  . GLU A 1 237 ? 28.208 6.834  54.165 1.00 21.50 ? 221  GLU A CB  1 
ATOM   1641 C  CG  . GLU A 1 237 ? 29.340 6.077  54.882 1.00 24.66 ? 221  GLU A CG  1 
ATOM   1642 C  CD  . GLU A 1 237 ? 29.178 4.579  54.889 1.00 29.51 ? 221  GLU A CD  1 
ATOM   1643 O  OE1 . GLU A 1 237 ? 30.156 3.904  55.261 1.00 30.57 ? 221  GLU A OE1 1 
ATOM   1644 O  OE2 . GLU A 1 237 ? 28.089 4.072  54.525 1.00 32.46 ? 221  GLU A OE2 1 
ATOM   1645 N  N   . LYS A 1 238 ? 26.774 5.373  51.734 1.00 22.28 ? 222  LYS A N   1 
ATOM   1646 C  CA  . LYS A 1 238 ? 26.356 4.134  51.038 1.00 23.00 ? 222  LYS A CA  1 
ATOM   1647 C  C   . LYS A 1 238 ? 26.618 4.164  49.531 1.00 23.30 ? 222  LYS A C   1 
ATOM   1648 O  O   . LYS A 1 238 ? 26.939 3.126  48.928 1.00 23.91 ? 222  LYS A O   1 
ATOM   1649 C  CB  . LYS A 1 238 ? 24.861 3.853  51.260 1.00 23.74 ? 222  LYS A CB  1 
ATOM   1650 N  N   . THR A 1 239 ? 26.485 5.343  48.932 1.00 22.64 ? 223  THR A N   1 
ATOM   1651 C  CA  . THR A 1 239 ? 26.395 5.465  47.485 1.00 23.41 ? 223  THR A CA  1 
ATOM   1652 C  C   . THR A 1 239 ? 27.719 5.862  46.839 1.00 23.10 ? 223  THR A C   1 
ATOM   1653 O  O   . THR A 1 239 ? 27.904 5.686  45.633 1.00 23.12 ? 223  THR A O   1 
ATOM   1654 C  CB  . THR A 1 239 ? 25.294 6.497  47.109 1.00 23.22 ? 223  THR A CB  1 
ATOM   1655 O  OG1 . THR A 1 239 ? 24.087 6.169  47.812 1.00 24.25 ? 223  THR A OG1 1 
ATOM   1656 C  CG2 . THR A 1 239 ? 25.029 6.525  45.580 1.00 24.29 ? 223  THR A CG2 1 
ATOM   1657 N  N   . PHE A 1 240 ? 28.637 6.420  47.617 1.00 23.47 ? 224  PHE A N   1 
ATOM   1658 C  CA  . PHE A 1 240 ? 29.898 6.878  47.012 1.00 23.22 ? 224  PHE A CA  1 
ATOM   1659 C  C   . PHE A 1 240 ? 30.553 5.708  46.214 1.00 24.17 ? 224  PHE A C   1 
ATOM   1660 O  O   . PHE A 1 240 ? 30.741 4.616  46.746 1.00 23.69 ? 224  PHE A O   1 
ATOM   1661 C  CB  . PHE A 1 240 ? 30.852 7.478  48.053 1.00 22.95 ? 224  PHE A CB  1 
ATOM   1662 C  CG  . PHE A 1 240 ? 32.002 8.197  47.435 1.00 23.01 ? 224  PHE A CG  1 
ATOM   1663 C  CD1 . PHE A 1 240 ? 31.836 9.491  46.964 1.00 25.19 ? 224  PHE A CD1 1 
ATOM   1664 C  CD2 . PHE A 1 240 ? 33.237 7.558  47.257 1.00 22.58 ? 224  PHE A CD2 1 
ATOM   1665 C  CE1 . PHE A 1 240 ? 32.875 10.161 46.339 1.00 24.54 ? 224  PHE A CE1 1 
ATOM   1666 C  CE2 . PHE A 1 240 ? 34.287 8.216  46.622 1.00 21.20 ? 224  PHE A CE2 1 
ATOM   1667 C  CZ  . PHE A 1 240 ? 34.102 9.522  46.165 1.00 22.94 ? 224  PHE A CZ  1 
ATOM   1668 N  N   . PRO A 1 241 ? 30.854 5.931  44.916 1.00 25.03 ? 225  PRO A N   1 
ATOM   1669 C  CA  . PRO A 1 241 ? 31.191 4.835  44.016 1.00 26.30 ? 225  PRO A CA  1 
ATOM   1670 C  C   . PRO A 1 241 ? 32.613 4.289  44.173 1.00 26.32 ? 225  PRO A C   1 
ATOM   1671 O  O   . PRO A 1 241 ? 32.888 3.175  43.739 1.00 27.13 ? 225  PRO A O   1 
ATOM   1672 C  CB  . PRO A 1 241 ? 31.020 5.476  42.634 1.00 26.51 ? 225  PRO A CB  1 
ATOM   1673 C  CG  . PRO A 1 241 ? 31.429 6.876  42.852 1.00 26.40 ? 225  PRO A CG  1 
ATOM   1674 C  CD  . PRO A 1 241 ? 30.883 7.231  44.220 1.00 25.94 ? 225  PRO A CD  1 
ATOM   1675 N  N   . ASP A 1 242 ? 33.497 5.062  44.793 1.00 26.29 ? 226  ASP A N   1 
ATOM   1676 C  CA  . ASP A 1 242 ? 34.924 4.764  44.753 1.00 26.60 ? 226  ASP A CA  1 
ATOM   1677 C  C   . ASP A 1 242 ? 35.483 4.511  46.145 1.00 25.73 ? 226  ASP A C   1 
ATOM   1678 O  O   . ASP A 1 242 ? 35.864 5.448  46.860 1.00 25.90 ? 226  ASP A O   1 
ATOM   1679 C  CB  . ASP A 1 242 ? 35.654 5.918  44.076 1.00 27.11 ? 226  ASP A CB  1 
ATOM   1680 C  CG  . ASP A 1 242 ? 37.101 5.623  43.799 1.00 28.49 ? 226  ASP A CG  1 
ATOM   1681 O  OD1 . ASP A 1 242 ? 37.619 4.514  44.104 1.00 31.44 ? 226  ASP A OD1 1 
ATOM   1682 O  OD2 . ASP A 1 242 ? 37.741 6.542  43.262 1.00 33.83 ? 226  ASP A OD2 1 
ATOM   1683 N  N   . ARG A 1 243 ? 35.533 3.236  46.513 1.00 24.70 ? 227  ARG A N   1 
ATOM   1684 C  CA  . ARG A 1 243 ? 35.896 2.859  47.872 1.00 24.56 ? 227  ARG A CA  1 
ATOM   1685 C  C   . ARG A 1 243 ? 37.408 2.993  48.136 1.00 23.65 ? 227  ARG A C   1 
ATOM   1686 O  O   . ARG A 1 243 ? 37.849 2.904  49.285 0.50 23.05 ? 227  ARG A O   1 
ATOM   1687 C  CB  . ARG A 1 243 ? 35.355 1.460  48.228 1.00 25.10 ? 227  ARG A CB  1 
ATOM   1688 C  CG  . ARG A 1 243 ? 33.891 1.130  47.746 1.00 26.86 ? 227  ARG A CG  1 
ATOM   1689 C  CD  . ARG A 1 243 ? 32.805 2.130  48.200 1.00 28.35 ? 227  ARG A CD  1 
ATOM   1690 N  NE  . ARG A 1 243 ? 32.358 1.946  49.588 1.00 30.49 ? 227  ARG A NE  1 
ATOM   1691 C  CZ  . ARG A 1 243 ? 31.417 2.683  50.191 1.00 31.36 ? 227  ARG A CZ  1 
ATOM   1692 N  NH1 . ARG A 1 243 ? 30.791 3.671  49.547 1.00 31.31 ? 227  ARG A NH1 1 
ATOM   1693 N  NH2 . ARG A 1 243 ? 31.095 2.444  51.455 1.00 30.54 ? 227  ARG A NH2 1 
ATOM   1694 N  N   . ALA A 1 244 ? 38.191 3.231  47.074 1.00 22.94 ? 228  ALA A N   1 
ATOM   1695 C  CA  . ALA A 1 244 ? 39.643 3.484  47.220 1.00 23.21 ? 228  ALA A CA  1 
ATOM   1696 C  C   . ALA A 1 244 ? 39.973 4.948  47.554 1.00 22.51 ? 228  ALA A C   1 
ATOM   1697 O  O   . ALA A 1 244 ? 41.080 5.241  48.019 1.00 22.86 ? 228  ALA A O   1 
ATOM   1698 C  CB  . ALA A 1 244 ? 40.420 3.030  45.970 1.00 23.28 ? 228  ALA A CB  1 
ATOM   1699 N  N   . SER A 1 245 ? 39.009 5.856  47.376 1.00 22.56 ? 229  SER A N   1 
ATOM   1700 C  CA  . SER A 1 245 ? 39.280 7.282  47.587 1.00 21.73 ? 229  SER A CA  1 
ATOM   1701 C  C   . SER A 1 245 ? 39.161 7.673  49.055 1.00 21.82 ? 229  SER A C   1 
ATOM   1702 O  O   . SER A 1 245 ? 38.295 7.154  49.764 1.00 22.09 ? 229  SER A O   1 
ATOM   1703 C  CB  . SER A 1 245 ? 38.329 8.132  46.736 1.00 22.59 ? 229  SER A CB  1 
ATOM   1704 O  OG  . SER A 1 245 ? 38.416 9.504  47.104 1.00 23.96 ? 229  SER A OG  1 
ATOM   1705 N  N   . ASP A 1 246 ? 39.983 8.617  49.516 1.00 21.46 ? 230  ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 246 ? 39.799 9.143  50.879 1.00 22.17 ? 230  ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 246 ? 38.540 9.999  51.055 1.00 22.04 ? 230  ASP A C   1 
ATOM   1708 O  O   . ASP A 1 246 ? 38.205 10.377 52.177 1.00 21.40 ? 230  ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 246 ? 41.051 9.838  51.443 1.00 24.52 ? 230  ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 246 ? 41.450 11.067 50.677 1.00 26.00 ? 230  ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 246 ? 40.606 11.645 49.954 1.00 29.78 ? 230  ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 246 ? 42.655 11.427 50.781 1.00 31.05 ? 230  ASP A OD2 1 
ATOM   1713 N  N   . ASP A 1 247 ? 37.846 10.306 49.949 1.00 21.79 ? 231  ASP A N   1 
ATOM   1714 C  CA  . ASP A 1 247 ? 36.513 10.945 50.053 1.00 22.95 ? 231  ASP A CA  1 
ATOM   1715 C  C   . ASP A 1 247 ? 35.527 10.084 50.844 1.00 23.13 ? 231  ASP A C   1 
ATOM   1716 O  O   . ASP A 1 247 ? 34.648 10.622 51.550 1.00 23.35 ? 231  ASP A O   1 
ATOM   1717 C  CB  . ASP A 1 247 ? 35.939 11.317 48.677 1.00 22.24 ? 231  ASP A CB  1 
ATOM   1718 C  CG  . ASP A 1 247 ? 36.586 12.560 48.092 1.00 23.98 ? 231  ASP A CG  1 
ATOM   1719 O  OD1 . ASP A 1 247 ? 37.410 13.245 48.764 1.00 23.00 ? 231  ASP A OD1 1 
ATOM   1720 O  OD2 . ASP A 1 247 ? 36.263 12.876 46.938 1.00 25.62 ? 231  ASP A OD2 1 
ATOM   1721 N  N   . LEU A 1 248 ? 35.649 8.761  50.722 1.00 23.07 ? 232  LEU A N   1 
ATOM   1722 C  CA  . LEU A 1 248 ? 34.826 7.871  51.543 1.00 23.69 ? 232  LEU A CA  1 
ATOM   1723 C  C   . LEU A 1 248 ? 35.138 8.055  53.045 1.00 23.93 ? 232  LEU A C   1 
ATOM   1724 O  O   . LEU A 1 248 ? 34.230 8.280  53.847 1.00 24.12 ? 232  LEU A O   1 
ATOM   1725 C  CB  . LEU A 1 248 ? 35.006 6.398  51.137 1.00 23.84 ? 232  LEU A CB  1 
ATOM   1726 C  CG  . LEU A 1 248 ? 34.186 5.396  51.955 1.00 23.34 ? 232  LEU A CG  1 
ATOM   1727 C  CD1 . LEU A 1 248 ? 32.674 5.705  51.891 1.00 25.38 ? 232  LEU A CD1 1 
ATOM   1728 C  CD2 . LEU A 1 248 ? 34.487 3.996  51.465 1.00 23.84 ? 232  LEU A CD2 1 
ATOM   1729 N  N   . ALA A 1 249 ? 36.418 7.958  53.417 1.00 24.50 ? 233  ALA A N   1 
ATOM   1730 C  CA  . ALA A 1 249 ? 36.845 8.211  54.804 1.00 24.00 ? 233  ALA A CA  1 
ATOM   1731 C  C   . ALA A 1 249 ? 36.378 9.597  55.288 1.00 24.28 ? 233  ALA A C   1 
ATOM   1732 O  O   . ALA A 1 249 ? 35.985 9.763  56.445 1.00 24.28 ? 233  ALA A O   1 
ATOM   1733 C  CB  . ALA A 1 249 ? 38.352 8.099  54.917 1.00 24.93 ? 233  ALA A CB  1 
ATOM   1734 N  N   . PHE A 1 250 ? 36.432 10.581 54.395 1.00 23.96 ? 234  PHE A N   1 
ATOM   1735 C  CA  . PHE A 1 250 ? 35.986 11.943 54.699 1.00 23.94 ? 234  PHE A CA  1 
ATOM   1736 C  C   . PHE A 1 250 ? 34.474 12.012 54.999 1.00 24.36 ? 234  PHE A C   1 
ATOM   1737 O  O   . PHE A 1 250 ? 34.055 12.553 56.036 1.00 24.53 ? 234  PHE A O   1 
ATOM   1738 C  CB  . PHE A 1 250 ? 36.389 12.892 53.568 1.00 22.89 ? 234  PHE A CB  1 
ATOM   1739 C  CG  . PHE A 1 250 ? 35.897 14.297 53.755 1.00 23.39 ? 234  PHE A CG  1 
ATOM   1740 C  CD1 . PHE A 1 250 ? 36.475 15.115 54.715 1.00 23.29 ? 234  PHE A CD1 1 
ATOM   1741 C  CD2 . PHE A 1 250 ? 34.840 14.789 52.988 1.00 22.76 ? 234  PHE A CD2 1 
ATOM   1742 C  CE1 . PHE A 1 250 ? 36.027 16.446 54.906 1.00 23.32 ? 234  PHE A CE1 1 
ATOM   1743 C  CE2 . PHE A 1 250 ? 34.372 16.096 53.176 1.00 23.08 ? 234  PHE A CE2 1 
ATOM   1744 C  CZ  . PHE A 1 250 ? 34.977 16.927 54.139 1.00 22.90 ? 234  PHE A CZ  1 
ATOM   1745 N  N   . ILE A 1 251 ? 33.671 11.416 54.123 1.00 23.53 ? 235  ILE A N   1 
ATOM   1746 C  CA  . ILE A 1 251 ? 32.230 11.320 54.310 1.00 23.31 ? 235  ILE A CA  1 
ATOM   1747 C  C   . ILE A 1 251 ? 31.919 10.655 55.657 1.00 23.23 ? 235  ILE A C   1 
ATOM   1748 O  O   . ILE A 1 251 ? 31.060 11.142 56.392 1.00 23.39 ? 235  ILE A O   1 
ATOM   1749 C  CB  . ILE A 1 251 ? 31.554 10.581 53.131 1.00 22.81 ? 235  ILE A CB  1 
ATOM   1750 C  CG1 . ILE A 1 251 ? 31.604 11.463 51.867 1.00 23.02 ? 235  ILE A CG1 1 
ATOM   1751 C  CG2 . ILE A 1 251 ? 30.098 10.220 53.451 1.00 22.12 ? 235  ILE A CG2 1 
ATOM   1752 C  CD1 . ILE A 1 251 ? 31.284 10.757 50.547 1.00 20.14 ? 235  ILE A CD1 1 
ATOM   1753 N  N   . GLN A 1 252 ? 32.638 9.578  55.986 1.00 22.81 ? 236  GLN A N   1 
ATOM   1754 C  CA  . GLN A 1 252 ? 32.391 8.849  57.251 1.00 22.49 ? 236  GLN A CA  1 
ATOM   1755 C  C   . GLN A 1 252 ? 32.690 9.700  58.480 1.00 23.03 ? 236  GLN A C   1 
ATOM   1756 O  O   . GLN A 1 252 ? 31.890 9.724  59.420 1.00 23.92 ? 236  GLN A O   1 
ATOM   1757 C  CB  . GLN A 1 252 ? 33.163 7.525  57.292 1.00 22.23 ? 236  GLN A CB  1 
ATOM   1758 C  CG  . GLN A 1 252 ? 32.724 6.519  56.210 1.00 21.50 ? 236  GLN A CG  1 
ATOM   1759 C  CD  . GLN A 1 252 ? 33.688 5.350  56.034 1.00 23.53 ? 236  GLN A CD  1 
ATOM   1760 O  OE1 . GLN A 1 252 ? 34.899 5.508  56.174 1.00 22.43 ? 236  GLN A OE1 1 
ATOM   1761 N  NE2 . GLN A 1 252 ? 33.149 4.170  55.717 1.00 21.80 ? 236  GLN A NE2 1 
ATOM   1762 N  N   . ALA A 1 253 ? 33.818 10.407 58.451 1.00 22.30 ? 237  ALA A N   1 
ATOM   1763 C  CA  . ALA A 1 253 ? 34.219 11.332 59.518 1.00 22.97 ? 237  ALA A CA  1 
ATOM   1764 C  C   . ALA A 1 253 ? 33.229 12.495 59.668 1.00 22.77 ? 237  ALA A C   1 
ATOM   1765 O  O   . ALA A 1 253 ? 32.895 12.901 60.795 1.00 20.79 ? 237  ALA A O   1 
ATOM   1766 C  CB  . ALA A 1 253 ? 35.598 11.881 59.222 1.00 23.11 ? 237  ALA A CB  1 
ATOM   1767 N  N   . GLN A 1 254 ? 32.781 13.029 58.526 1.00 22.70 ? 238  GLN A N   1 
ATOM   1768 C  CA  . GLN A 1 254 ? 31.867 14.169 58.495 1.00 22.72 ? 238  GLN A CA  1 
ATOM   1769 C  C   . GLN A 1 254 ? 30.514 13.753 59.063 1.00 23.34 ? 238  GLN A C   1 
ATOM   1770 O  O   . GLN A 1 254 ? 29.882 14.497 59.833 1.00 23.04 ? 238  GLN A O   1 
ATOM   1771 C  CB  . GLN A 1 254 ? 31.692 14.683 57.058 1.00 23.11 ? 238  GLN A CB  1 
ATOM   1772 C  CG  . GLN A 1 254 ? 32.867 15.458 56.503 1.00 22.75 ? 238  GLN A CG  1 
ATOM   1773 C  CD  . GLN A 1 254 ? 32.911 16.877 56.988 1.00 25.43 ? 238  GLN A CD  1 
ATOM   1774 O  OE1 . GLN A 1 254 ? 32.239 17.781 56.440 1.00 23.84 ? 238  GLN A OE1 1 
ATOM   1775 N  NE2 . GLN A 1 254 ? 33.734 17.105 58.001 1.00 22.06 ? 238  GLN A NE2 1 
ATOM   1776 N  N   . ARG A 1 255 ? 30.085 12.553 58.682 1.00 23.53 ? 239  ARG A N   1 
ATOM   1777 C  CA  . ARG A 1 255 ? 28.813 12.008 59.133 1.00 23.62 ? 239  ARG A CA  1 
ATOM   1778 C  C   . ARG A 1 255 ? 28.781 11.913 60.658 1.00 23.69 ? 239  ARG A C   1 
ATOM   1779 O  O   . ARG A 1 255 ? 27.822 12.379 61.294 1.00 23.60 ? 239  ARG A O   1 
ATOM   1780 C  CB  . ARG A 1 255 ? 28.567 10.653 58.487 1.00 23.41 ? 239  ARG A CB  1 
ATOM   1781 C  CG  . ARG A 1 255 ? 27.166 10.083 58.665 1.00 24.43 ? 239  ARG A CG  1 
ATOM   1782 C  CD  . ARG A 1 255 ? 27.223 8.657  58.153 1.00 24.64 ? 239  ARG A CD  1 
ATOM   1783 N  NE  . ARG A 1 255 ? 26.051 7.880  58.480 1.00 28.90 ? 239  ARG A NE  1 
ATOM   1784 C  CZ  . ARG A 1 255 ? 26.070 6.563  58.635 1.00 29.66 ? 239  ARG A CZ  1 
ATOM   1785 N  NH1 . ARG A 1 255 ? 24.952 5.907  58.913 1.00 30.74 ? 239  ARG A NH1 1 
ATOM   1786 N  NH2 . ARG A 1 255 ? 27.215 5.907  58.507 1.00 29.47 ? 239  ARG A NH2 1 
ATOM   1787 N  N   . ALA A 1 256 ? 29.849 11.357 61.239 1.00 23.91 ? 240  ALA A N   1 
ATOM   1788 C  CA  . ALA A 1 256 ? 29.965 11.219 62.675 1.00 24.19 ? 240  ALA A CA  1 
ATOM   1789 C  C   . ALA A 1 256 ? 29.974 12.597 63.336 1.00 24.66 ? 240  ALA A C   1 
ATOM   1790 O  O   . ALA A 1 256 ? 29.359 12.781 64.383 1.00 23.85 ? 240  ALA A O   1 
ATOM   1791 C  CB  . ALA A 1 256 ? 31.218 10.434 63.037 1.00 24.03 ? 240  ALA A CB  1 
ATOM   1792 N  N   . LYS A 1 257 ? 30.659 13.555 62.704 1.00 24.60 ? 241  LYS A N   1 
ATOM   1793 C  CA  . LYS A 1 257 ? 30.774 14.913 63.243 1.00 25.23 ? 241  LYS A CA  1 
ATOM   1794 C  C   . LYS A 1 257 ? 29.412 15.597 63.274 1.00 24.10 ? 241  LYS A C   1 
ATOM   1795 O  O   . LYS A 1 257 ? 29.019 16.169 64.281 1.00 24.25 ? 241  LYS A O   1 
ATOM   1796 C  CB  . LYS A 1 257 ? 31.779 15.738 62.435 1.00 24.98 ? 241  LYS A CB  1 
ATOM   1797 C  CG  . LYS A 1 257 ? 31.698 17.249 62.643 1.00 27.49 ? 241  LYS A CG  1 
ATOM   1798 C  CD  . LYS A 1 257 ? 32.815 17.997 61.906 1.00 29.00 ? 241  LYS A CD  1 
ATOM   1799 C  CE  . LYS A 1 257 ? 32.366 18.513 60.550 1.00 30.94 ? 241  LYS A CE  1 
ATOM   1800 N  NZ  . LYS A 1 257 ? 33.487 19.225 59.818 1.00 33.96 ? 241  LYS A NZ  1 
ATOM   1801 N  N   . TYR A 1 258 ? 28.677 15.518 62.179 1.00 23.65 ? 242  TYR A N   1 
ATOM   1802 C  CA  . TYR A 1 258 ? 27.346 16.090 62.132 1.00 23.45 ? 242  TYR A CA  1 
ATOM   1803 C  C   . TYR A 1 258 ? 26.401 15.390 63.124 1.00 24.51 ? 242  TYR A C   1 
ATOM   1804 O  O   . TYR A 1 258 ? 25.602 16.062 63.807 1.00 24.98 ? 242  TYR A O   1 
ATOM   1805 C  CB  . TYR A 1 258 ? 26.797 16.005 60.705 1.00 23.42 ? 242  TYR A CB  1 
ATOM   1806 C  CG  . TYR A 1 258 ? 27.548 16.832 59.674 1.00 22.03 ? 242  TYR A CG  1 
ATOM   1807 C  CD1 . TYR A 1 258 ? 27.965 18.147 59.945 1.00 20.70 ? 242  TYR A CD1 1 
ATOM   1808 C  CD2 . TYR A 1 258 ? 27.815 16.305 58.412 1.00 21.94 ? 242  TYR A CD2 1 
ATOM   1809 C  CE1 . TYR A 1 258 ? 28.603 18.930 58.945 1.00 20.23 ? 242  TYR A CE1 1 
ATOM   1810 C  CE2 . TYR A 1 258 ? 28.457 17.066 57.413 1.00 21.76 ? 242  TYR A CE2 1 
ATOM   1811 C  CZ  . TYR A 1 258 ? 28.862 18.370 57.695 1.00 20.19 ? 242  TYR A CZ  1 
ATOM   1812 O  OH  . TYR A 1 258 ? 29.523 19.102 56.736 1.00 21.30 ? 242  TYR A OH  1 
ATOM   1813 N  N   . ALA A 1 259 ? 26.501 14.059 63.230 1.00 24.25 ? 243  ALA A N   1 
ATOM   1814 C  CA  . ALA A 1 259 ? 25.669 13.323 64.189 1.00 24.43 ? 243  ALA A CA  1 
ATOM   1815 C  C   . ALA A 1 259 ? 25.929 13.751 65.618 1.00 24.36 ? 243  ALA A C   1 
ATOM   1816 O  O   . ALA A 1 259 ? 24.988 13.888 66.390 1.00 25.01 ? 243  ALA A O   1 
ATOM   1817 C  CB  . ALA A 1 259 ? 25.854 11.826 64.051 1.00 24.98 ? 243  ALA A CB  1 
ATOM   1818 N  N   . ALA A 1 260 ? 27.198 13.958 65.967 1.00 24.27 ? 244  ALA A N   1 
ATOM   1819 C  CA  . ALA A 1 260 ? 27.573 14.408 67.301 1.00 24.03 ? 244  ALA A CA  1 
ATOM   1820 C  C   . ALA A 1 260 ? 27.002 15.787 67.575 1.00 24.02 ? 244  ALA A C   1 
ATOM   1821 O  O   . ALA A 1 260 ? 26.467 16.017 68.655 1.00 23.53 ? 244  ALA A O   1 
ATOM   1822 C  CB  . ALA A 1 260 ? 29.084 14.416 67.471 1.00 24.71 ? 244  ALA A CB  1 
ATOM   1823 N  N   . ALA A 1 261 ? 27.097 16.690 66.588 1.00 23.20 ? 245  ALA A N   1 
ATOM   1824 C  CA  . ALA A 1 261 ? 26.500 18.030 66.708 1.00 23.40 ? 245  ALA A CA  1 
ATOM   1825 C  C   . ALA A 1 261 ? 25.024 17.896 67.052 1.00 23.39 ? 245  ALA A C   1 
ATOM   1826 O  O   . ALA A 1 261 ? 24.565 18.444 68.068 1.00 23.72 ? 245  ALA A O   1 
ATOM   1827 C  CB  . ALA A 1 261 ? 26.675 18.853 65.413 1.00 22.56 ? 245  ALA A CB  1 
ATOM   1828 N  N   . VAL A 1 262 ? 24.305 17.143 66.211 1.00 23.19 ? 246  VAL A N   1 
ATOM   1829 C  CA  . VAL A 1 262 ? 22.861 16.948 66.349 1.00 23.48 ? 246  VAL A CA  1 
ATOM   1830 C  C   . VAL A 1 262 ? 22.518 16.321 67.699 1.00 23.34 ? 246  VAL A C   1 
ATOM   1831 O  O   . VAL A 1 262 ? 21.539 16.709 68.356 1.00 23.94 ? 246  VAL A O   1 
ATOM   1832 C  CB  . VAL A 1 262 ? 22.274 16.148 65.152 1.00 23.39 ? 246  VAL A CB  1 
ATOM   1833 C  CG1 . VAL A 1 262 ? 20.818 15.725 65.399 1.00 24.14 ? 246  VAL A CG1 1 
ATOM   1834 C  CG2 . VAL A 1 262 ? 22.377 16.987 63.830 1.00 23.11 ? 246  VAL A CG2 1 
ATOM   1835 N  N   . LYS A 1 263 ? 23.346 15.378 68.136 1.00 23.40 ? 247  LYS A N   1 
ATOM   1836 C  CA  . LYS A 1 263 ? 23.182 14.776 69.472 1.00 23.02 ? 247  LYS A CA  1 
ATOM   1837 C  C   . LYS A 1 263 ? 23.151 15.769 70.643 1.00 23.60 ? 247  LYS A C   1 
ATOM   1838 O  O   . LYS A 1 263 ? 22.423 15.550 71.601 1.00 22.82 ? 247  LYS A O   1 
ATOM   1839 C  CB  . LYS A 1 263 ? 24.244 13.708 69.728 1.00 23.06 ? 247  LYS A CB  1 
ATOM   1840 N  N   . THR A 1 264 ? 23.941 16.845 70.577 1.00 23.56 ? 248  THR A N   1 
ATOM   1841 C  CA  . THR A 1 264 ? 23.958 17.813 71.684 1.00 23.98 ? 248  THR A CA  1 
ATOM   1842 C  C   . THR A 1 264 ? 22.986 18.975 71.437 1.00 23.22 ? 248  THR A C   1 
ATOM   1843 O  O   . THR A 1 264 ? 22.894 19.907 72.238 1.00 23.38 ? 248  THR A O   1 
ATOM   1844 C  CB  . THR A 1 264 ? 25.384 18.312 72.053 1.00 24.24 ? 248  THR A CB  1 
ATOM   1845 O  OG1 . THR A 1 264 ? 25.948 19.055 70.976 1.00 25.94 ? 248  THR A OG1 1 
ATOM   1846 C  CG2 . THR A 1 264 ? 26.315 17.138 72.425 1.00 26.80 ? 248  THR A CG2 1 
ATOM   1847 N  N   . GLY A 1 265 ? 22.205 18.866 70.367 1.00 22.28 ? 249  GLY A N   1 
ATOM   1848 C  CA  . GLY A 1 265 ? 21.238 19.899 69.998 1.00 21.14 ? 249  GLY A CA  1 
ATOM   1849 C  C   . GLY A 1 265 ? 21.791 20.927 69.027 1.00 20.79 ? 249  GLY A C   1 
ATOM   1850 O  O   . GLY A 1 265 ? 21.061 21.812 68.568 1.00 20.26 ? 249  GLY A O   1 
ATOM   1851 N  N   . ASP A 1 266 ? 23.072 20.814 68.687 1.00 21.04 ? 250  ASP A N   1 
ATOM   1852 C  CA  . ASP A 1 266 ? 23.706 21.789 67.793 1.00 21.49 ? 250  ASP A CA  1 
ATOM   1853 C  C   . ASP A 1 266 ? 23.292 21.557 66.341 1.00 22.31 ? 250  ASP A C   1 
ATOM   1854 O  O   . ASP A 1 266 ? 23.082 20.407 65.931 1.00 22.71 ? 250  ASP A O   1 
ATOM   1855 C  CB  . ASP A 1 266 ? 25.243 21.762 67.899 1.00 21.48 ? 250  ASP A CB  1 
ATOM   1856 C  CG  . ASP A 1 266 ? 25.760 22.329 69.222 1.00 23.67 ? 250  ASP A CG  1 
ATOM   1857 O  OD1 . ASP A 1 266 ? 26.887 21.960 69.617 1.00 26.02 ? 250  ASP A OD1 1 
ATOM   1858 O  OD2 . ASP A 1 266 ? 25.042 23.124 69.870 1.00 22.08 ? 250  ASP A OD2 1 
ATOM   1859 N  N   . PRO A 1 267 ? 23.177 22.645 65.559 1.00 22.17 ? 251  PRO A N   1 
ATOM   1860 C  CA  . PRO A 1 267 ? 22.895 22.447 64.154 1.00 21.97 ? 251  PRO A CA  1 
ATOM   1861 C  C   . PRO A 1 267 ? 24.073 21.713 63.492 1.00 21.88 ? 251  PRO A C   1 
ATOM   1862 O  O   . PRO A 1 267 ? 25.229 21.889 63.891 1.00 21.69 ? 251  PRO A O   1 
ATOM   1863 C  CB  . PRO A 1 267 ? 22.802 23.892 63.603 1.00 22.96 ? 251  PRO A CB  1 
ATOM   1864 C  CG  . PRO A 1 267 ? 22.464 24.743 64.833 1.00 21.85 ? 251  PRO A CG  1 
ATOM   1865 C  CD  . PRO A 1 267 ? 23.244 24.077 65.921 1.00 22.80 ? 251  PRO A CD  1 
ATOM   1866 N  N   . SER A 1 268 ? 23.765 20.869 62.521 1.00 22.24 ? 252  SER A N   1 
ATOM   1867 C  CA  . SER A 1 268 ? 24.789 20.305 61.660 1.00 23.29 ? 252  SER A CA  1 
ATOM   1868 C  C   . SER A 1 268 ? 25.391 21.367 60.742 1.00 23.51 ? 252  SER A C   1 
ATOM   1869 O  O   . SER A 1 268 ? 26.504 21.206 60.247 1.00 24.86 ? 252  SER A O   1 
ATOM   1870 C  CB  . SER A 1 268 ? 24.186 19.156 60.833 1.00 22.53 ? 252  SER A CB  1 
ATOM   1871 O  OG  . SER A 1 268 ? 23.238 19.636 59.874 1.00 23.48 ? 252  SER A OG  1 
ATOM   1872 N  N   . VAL A 1 269 ? 24.677 22.468 60.544 1.00 23.10 ? 253  VAL A N   1 
ATOM   1873 C  CA  . VAL A 1 269 ? 25.060 23.486 59.542 1.00 23.30 ? 253  VAL A CA  1 
ATOM   1874 C  C   . VAL A 1 269 ? 25.880 24.619 60.202 1.00 22.78 ? 253  VAL A C   1 
ATOM   1875 O  O   . VAL A 1 269 ? 25.720 24.863 61.418 1.00 22.74 ? 253  VAL A O   1 
ATOM   1876 C  CB  . VAL A 1 269 ? 23.791 24.057 58.807 1.00 23.17 ? 253  VAL A CB  1 
ATOM   1877 C  CG1 . VAL A 1 269 ? 22.936 22.910 58.247 1.00 24.33 ? 253  VAL A CG1 1 
ATOM   1878 C  CG2 . VAL A 1 269 ? 22.931 24.879 59.738 1.00 25.16 ? 253  VAL A CG2 1 
ATOM   1879 N  N   . PRO A 1 270 ? 26.729 25.325 59.418 1.00 22.61 ? 254  PRO A N   1 
ATOM   1880 C  CA  . PRO A 1 270 ? 26.999 25.204 57.986 1.00 22.31 ? 254  PRO A CA  1 
ATOM   1881 C  C   . PRO A 1 270 ? 28.150 24.260 57.642 1.00 23.01 ? 254  PRO A C   1 
ATOM   1882 O  O   . PRO A 1 270 ? 29.058 24.072 58.453 1.00 23.97 ? 254  PRO A O   1 
ATOM   1883 C  CB  . PRO A 1 270 ? 27.430 26.640 57.606 1.00 21.91 ? 254  PRO A CB  1 
ATOM   1884 C  CG  . PRO A 1 270 ? 28.116 27.137 58.791 1.00 23.27 ? 254  PRO A CG  1 
ATOM   1885 C  CD  . PRO A 1 270 ? 27.477 26.463 60.003 1.00 22.21 ? 254  PRO A CD  1 
ATOM   1886 N  N   . SER A 1 271 ? 28.138 23.728 56.429 1.00 22.64 ? 255  SER A N   1 
ATOM   1887 C  CA  . SER A 1 271 ? 29.328 23.124 55.839 1.00 22.79 ? 255  SER A CA  1 
ATOM   1888 C  C   . SER A 1 271 ? 29.921 24.186 54.887 1.00 22.86 ? 255  SER A C   1 
ATOM   1889 O  O   . SER A 1 271 ? 29.280 25.187 54.596 1.00 22.54 ? 255  SER A O   1 
ATOM   1890 C  CB  . SER A 1 271 ? 28.956 21.866 55.036 1.00 22.62 ? 255  SER A CB  1 
ATOM   1891 O  OG  . SER A 1 271 ? 28.095 22.230 53.973 1.00 23.77 ? 255  SER A OG  1 
ATOM   1892 N  N   . SER A 1 272 ? 31.145 23.974 54.421 1.00 22.34 ? 256  SER A N   1 
ATOM   1893 C  CA  . SER A 1 272 ? 31.736 24.858 53.399 1.00 22.25 ? 256  SER A CA  1 
ATOM   1894 C  C   . SER A 1 272 ? 31.438 24.286 52.014 1.00 22.35 ? 256  SER A C   1 
ATOM   1895 O  O   . SER A 1 272 ? 31.141 23.091 51.882 1.00 22.23 ? 256  SER A O   1 
ATOM   1896 C  CB  . SER A 1 272 ? 33.240 25.033 53.630 1.00 22.27 ? 256  SER A CB  1 
ATOM   1897 O  OG  . SER A 1 272 ? 34.001 23.942 53.150 1.00 22.65 ? 256  SER A OG  1 
ATOM   1898 N  N   . LEU A 1 273 ? 31.538 25.121 50.983 1.00 21.91 ? 257  LEU A N   1 
ATOM   1899 C  CA  . LEU A 1 273 ? 31.330 24.648 49.613 1.00 22.34 ? 257  LEU A CA  1 
ATOM   1900 C  C   . LEU A 1 273 ? 32.437 23.632 49.216 1.00 22.55 ? 257  LEU A C   1 
ATOM   1901 O  O   . LEU A 1 273 ? 32.143 22.617 48.559 1.00 22.67 ? 257  LEU A O   1 
ATOM   1902 C  CB  . LEU A 1 273 ? 31.295 25.839 48.656 1.00 21.93 ? 257  LEU A CB  1 
ATOM   1903 C  CG  . LEU A 1 273 ? 30.989 25.564 47.199 1.00 22.89 ? 257  LEU A CG  1 
ATOM   1904 C  CD1 . LEU A 1 273 ? 29.726 24.696 47.030 1.00 22.04 ? 257  LEU A CD1 1 
ATOM   1905 C  CD2 . LEU A 1 273 ? 30.877 26.916 46.448 1.00 21.59 ? 257  LEU A CD2 1 
ATOM   1906 N  N   . ALA A 1 274 ? 33.661 23.891 49.695 1.00 21.66 ? 258  ALA A N   1 
ATOM   1907 C  CA  . ALA A 1 274 ? 34.796 22.941 49.564 1.00 22.25 ? 258  ALA A CA  1 
ATOM   1908 C  C   . ALA A 1 274 ? 34.422 21.535 50.079 1.00 22.58 ? 258  ALA A C   1 
ATOM   1909 O  O   . ALA A 1 274 ? 34.659 20.504 49.411 1.00 22.13 ? 258  ALA A O   1 
ATOM   1910 C  CB  . ALA A 1 274 ? 36.029 23.478 50.288 1.00 22.27 ? 258  ALA A CB  1 
ATOM   1911 N  N   . GLU A 1 275 ? 33.798 21.499 51.245 1.00 21.70 ? 259  GLU A N   1 
ATOM   1912 C  CA  . GLU A 1 275 ? 33.303 20.246 51.815 1.00 22.23 ? 259  GLU A CA  1 
ATOM   1913 C  C   . GLU A 1 275 ? 32.182 19.605 51.008 1.00 22.01 ? 259  GLU A C   1 
ATOM   1914 O  O   . GLU A 1 275 ? 32.184 18.386 50.793 1.00 22.43 ? 259  GLU A O   1 
ATOM   1915 C  CB  . GLU A 1 275 ? 32.849 20.474 53.252 1.00 21.94 ? 259  GLU A CB  1 
ATOM   1916 C  CG  . GLU A 1 275 ? 34.041 20.816 54.182 1.00 22.29 ? 259  GLU A CG  1 
ATOM   1917 C  CD  . GLU A 1 275 ? 33.632 21.133 55.609 1.00 26.65 ? 259  GLU A CD  1 
ATOM   1918 O  OE1 . GLU A 1 275 ? 34.359 20.705 56.532 1.00 29.68 ? 259  GLU A OE1 1 
ATOM   1919 O  OE2 . GLU A 1 275 ? 32.624 21.825 55.835 1.00 25.25 ? 259  GLU A OE2 1 
ATOM   1920 N  N   . GLU A 1 276 ? 31.217 20.409 50.589 1.00 22.73 ? 260  GLU A N   1 
ATOM   1921 C  CA  . GLU A 1 276 ? 30.082 19.888 49.798 1.00 23.13 ? 260  GLU A CA  1 
ATOM   1922 C  C   . GLU A 1 276 ? 30.572 19.259 48.499 1.00 23.26 ? 260  GLU A C   1 
ATOM   1923 O  O   . GLU A 1 276 ? 30.000 18.288 48.003 1.00 22.66 ? 260  GLU A O   1 
ATOM   1924 C  CB  . GLU A 1 276 ? 29.108 21.012 49.477 1.00 23.50 ? 260  GLU A CB  1 
ATOM   1925 C  CG  . GLU A 1 276 ? 28.265 21.468 50.657 1.00 25.91 ? 260  GLU A CG  1 
ATOM   1926 C  CD  . GLU A 1 276 ? 27.515 20.321 51.312 1.00 27.76 ? 260  GLU A CD  1 
ATOM   1927 O  OE1 . GLU A 1 276 ? 26.801 19.590 50.600 1.00 28.28 ? 260  GLU A OE1 1 
ATOM   1928 O  OE2 . GLU A 1 276 ? 27.621 20.163 52.546 1.00 25.93 ? 260  GLU A OE2 1 
ATOM   1929 N  N   . LYS A 1 277 ? 31.616 19.848 47.919 1.00 23.30 ? 261  LYS A N   1 
ATOM   1930 C  CA  . LYS A 1 277 ? 32.192 19.306 46.683 1.00 24.04 ? 261  LYS A CA  1 
ATOM   1931 C  C   . LYS A 1 277 ? 32.777 17.913 46.849 1.00 24.06 ? 261  LYS A C   1 
ATOM   1932 O  O   . LYS A 1 277 ? 33.053 17.215 45.860 1.00 24.15 ? 261  LYS A O   1 
ATOM   1933 C  CB  . LYS A 1 277 ? 33.221 20.289 46.086 1.00 23.73 ? 261  LYS A CB  1 
ATOM   1934 C  CG  . LYS A 1 277 ? 32.518 21.480 45.405 1.00 24.12 ? 261  LYS A CG  1 
ATOM   1935 C  CD  . LYS A 1 277 ? 33.548 22.373 44.676 1.00 22.66 ? 261  LYS A CD  1 
ATOM   1936 C  CE  . LYS A 1 277 ? 32.830 23.315 43.744 1.00 23.69 ? 261  LYS A CE  1 
ATOM   1937 N  NZ  . LYS A 1 277 ? 33.777 24.310 43.192 1.00 19.05 ? 261  LYS A NZ  1 
ATOM   1938 N  N   . ARG A 1 278 ? 33.003 17.506 48.100 1.00 23.12 ? 262  ARG A N   1 
ATOM   1939 C  CA  . ARG A 1 278 ? 33.403 16.152 48.364 1.00 22.79 ? 262  ARG A CA  1 
ATOM   1940 C  C   . ARG A 1 278 ? 32.239 15.281 48.780 1.00 22.80 ? 262  ARG A C   1 
ATOM   1941 O  O   . ARG A 1 278 ? 32.144 14.147 48.326 1.00 23.06 ? 262  ARG A O   1 
ATOM   1942 C  CB  . ARG A 1 278 ? 34.460 16.083 49.481 1.00 21.12 ? 262  ARG A CB  1 
ATOM   1943 C  CG  . ARG A 1 278 ? 35.689 17.004 49.229 1.00 23.94 ? 262  ARG A CG  1 
ATOM   1944 C  CD  . ARG A 1 278 ? 36.768 16.829 50.277 1.00 24.77 ? 262  ARG A CD  1 
ATOM   1945 N  NE  . ARG A 1 278 ? 37.409 15.505 50.309 1.00 24.98 ? 262  ARG A NE  1 
ATOM   1946 C  CZ  . ARG A 1 278 ? 38.271 15.097 51.251 1.00 25.29 ? 262  ARG A CZ  1 
ATOM   1947 N  NH1 . ARG A 1 278 ? 38.619 15.893 52.261 1.00 26.02 ? 262  ARG A NH1 1 
ATOM   1948 N  NH2 . ARG A 1 278 ? 38.800 13.883 51.204 1.00 23.88 ? 262  ARG A NH2 1 
ATOM   1949 N  N   . GLN A 1 279 ? 31.406 15.785 49.697 1.00 22.49 ? 263  GLN A N   1 
ATOM   1950 C  CA  . GLN A 1 279 ? 30.403 14.919 50.373 1.00 22.35 ? 263  GLN A CA  1 
ATOM   1951 C  C   . GLN A 1 279 ? 29.013 14.927 49.727 1.00 21.67 ? 263  GLN A C   1 
ATOM   1952 O  O   . GLN A 1 279 ? 28.205 14.048 50.024 1.00 22.82 ? 263  GLN A O   1 
ATOM   1953 C  CB  . GLN A 1 279 ? 30.283 15.271 51.858 1.00 20.89 ? 263  GLN A CB  1 
ATOM   1954 C  CG  . GLN A 1 279 ? 29.673 16.631 52.138 1.00 22.34 ? 263  GLN A CG  1 
ATOM   1955 C  CD  . GLN A 1 279 ? 29.929 17.130 53.572 1.00 23.63 ? 263  GLN A CD  1 
ATOM   1956 O  OE1 . GLN A 1 279 ? 30.671 16.512 54.334 1.00 25.75 ? 263  GLN A OE1 1 
ATOM   1957 N  NE2 . GLN A 1 279 ? 29.336 18.268 53.920 1.00 23.21 ? 263  GLN A NE2 1 
ATOM   1958 N  N   . ASN A 1 280 ? 28.759 15.874 48.830 1.00 22.23 ? 264  ASN A N   1 
ATOM   1959 C  CA  . ASN A 1 280 ? 27.432 16.019 48.238 1.00 21.54 ? 264  ASN A CA  1 
ATOM   1960 C  C   . ASN A 1 280 ? 27.411 15.465 46.832 1.00 22.40 ? 264  ASN A C   1 
ATOM   1961 O  O   . ASN A 1 280 ? 27.896 16.119 45.887 1.00 21.44 ? 264  ASN A O   1 
ATOM   1962 C  CB  . ASN A 1 280 ? 26.989 17.481 48.271 1.00 22.69 ? 264  ASN A CB  1 
ATOM   1963 C  CG  . ASN A 1 280 ? 25.521 17.669 47.875 1.00 23.73 ? 264  ASN A CG  1 
ATOM   1964 O  OD1 . ASN A 1 280 ? 25.002 16.921 47.039 1.00 23.31 ? 264  ASN A OD1 1 
ATOM   1965 N  ND2 . ASN A 1 280 ? 24.837 18.665 48.490 1.00 23.73 ? 264  ASN A ND2 1 
ATOM   1966 N  N   . LEU A 1 281 ? 26.869 14.248 46.701 1.00 21.21 ? 265  LEU A N   1 
ATOM   1967 C  CA  . LEU A 1 281 ? 26.906 13.547 45.431 1.00 21.94 ? 265  LEU A CA  1 
ATOM   1968 C  C   . LEU A 1 281 ? 26.069 14.262 44.383 1.00 21.46 ? 265  LEU A C   1 
ATOM   1969 O  O   . LEU A 1 281 ? 26.363 14.170 43.201 1.00 22.38 ? 265  LEU A O   1 
ATOM   1970 C  CB  . LEU A 1 281 ? 26.443 12.087 45.583 1.00 20.48 ? 265  LEU A CB  1 
ATOM   1971 C  CG  . LEU A 1 281 ? 27.221 11.208 46.601 1.00 21.56 ? 265  LEU A CG  1 
ATOM   1972 C  CD1 . LEU A 1 281 ? 26.941 9.725  46.377 1.00 23.28 ? 265  LEU A CD1 1 
ATOM   1973 C  CD2 . LEU A 1 281 ? 28.747 11.465 46.637 1.00 22.51 ? 265  LEU A CD2 1 
ATOM   1974 N  N   . PHE A 1 282 ? 25.013 14.949 44.812 1.00 21.78 ? 266  PHE A N   1 
ATOM   1975 C  CA  . PHE A 1 282 ? 24.160 15.685 43.851 1.00 21.55 ? 266  PHE A CA  1 
ATOM   1976 C  C   . PHE A 1 282 ? 24.909 16.881 43.287 1.00 21.96 ? 266  PHE A C   1 
ATOM   1977 O  O   . PHE A 1 282 ? 24.842 17.144 42.090 1.00 22.01 ? 266  PHE A O   1 
ATOM   1978 C  CB  . PHE A 1 282 ? 22.867 16.166 44.506 1.00 21.48 ? 266  PHE A CB  1 
ATOM   1979 C  CG  . PHE A 1 282 ? 22.105 15.075 45.201 1.00 21.29 ? 266  PHE A CG  1 
ATOM   1980 C  CD1 . PHE A 1 282 ? 22.347 14.791 46.570 1.00 21.45 ? 266  PHE A CD1 1 
ATOM   1981 C  CD2 . PHE A 1 282 ? 21.169 14.305 44.488 1.00 21.19 ? 266  PHE A CD2 1 
ATOM   1982 C  CE1 . PHE A 1 282 ? 21.627 13.783 47.204 1.00 21.59 ? 266  PHE A CE1 1 
ATOM   1983 C  CE2 . PHE A 1 282 ? 20.456 13.293 45.114 1.00 22.21 ? 266  PHE A CE2 1 
ATOM   1984 C  CZ  . PHE A 1 282 ? 20.705 13.018 46.481 1.00 20.67 ? 266  PHE A CZ  1 
ATOM   1985 N  N   . LEU A 1 283 ? 25.615 17.607 44.150 1.00 22.20 ? 267  LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 283 ? 26.436 18.742 43.705 1.00 22.23 ? 267  LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 283 ? 27.534 18.243 42.745 1.00 21.60 ? 267  LEU A C   1 
ATOM   1988 O  O   . LEU A 1 283 ? 27.852 18.921 41.752 1.00 22.22 ? 267  LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 283 ? 27.070 19.418 44.906 1.00 21.72 ? 267  LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 283 ? 28.003 20.594 44.559 1.00 21.04 ? 267  LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 283 ? 27.291 21.727 43.814 1.00 20.94 ? 267  LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 283 ? 28.663 21.130 45.842 1.00 23.94 ? 267  LEU A CD2 1 
ATOM   1993 N  N   . ARG A 1 284 ? 28.069 17.048 43.024 1.00 22.33 ? 268  ARG A N   1 
ATOM   1994 C  CA  . ARG A 1 284 ? 29.170 16.522 42.213 1.00 22.76 ? 268  ARG A CA  1 
ATOM   1995 C  C   . ARG A 1 284 ? 28.725 16.131 40.795 1.00 22.31 ? 268  ARG A C   1 
ATOM   1996 O  O   . ARG A 1 284 ? 29.576 15.917 39.930 1.00 21.43 ? 268  ARG A O   1 
ATOM   1997 C  CB  . ARG A 1 284 ? 29.860 15.370 42.912 1.00 23.15 ? 268  ARG A CB  1 
ATOM   1998 C  CG  . ARG A 1 284 ? 30.639 15.851 44.145 1.00 23.17 ? 268  ARG A CG  1 
ATOM   1999 C  CD  . ARG A 1 284 ? 31.379 14.678 44.776 1.00 23.25 ? 268  ARG A CD  1 
ATOM   2000 N  NE  . ARG A 1 284 ? 32.595 14.295 44.055 1.00 22.86 ? 268  ARG A NE  1 
ATOM   2001 C  CZ  . ARG A 1 284 ? 33.616 13.654 44.629 1.00 24.64 ? 268  ARG A CZ  1 
ATOM   2002 N  NH1 . ARG A 1 284 ? 33.572 13.362 45.932 1.00 23.40 ? 268  ARG A NH1 1 
ATOM   2003 N  NH2 . ARG A 1 284 ? 34.704 13.334 43.921 1.00 24.04 ? 268  ARG A NH2 1 
ATOM   2004 N  N   . VAL A 1 285 ? 27.410 16.063 40.548 1.00 21.81 ? 269  VAL A N   1 
ATOM   2005 C  CA  . VAL A 1 285 ? 26.927 15.896 39.161 1.00 21.69 ? 269  VAL A CA  1 
ATOM   2006 C  C   . VAL A 1 285 ? 27.489 17.011 38.246 1.00 21.75 ? 269  VAL A C   1 
ATOM   2007 O  O   . VAL A 1 285 ? 27.594 16.837 37.036 1.00 22.10 ? 269  VAL A O   1 
ATOM   2008 C  CB  . VAL A 1 285 ? 25.380 15.779 39.093 1.00 21.31 ? 269  VAL A CB  1 
ATOM   2009 C  CG1 . VAL A 1 285 ? 24.878 15.696 37.666 1.00 23.56 ? 269  VAL A CG1 1 
ATOM   2010 C  CG2 . VAL A 1 285 ? 24.909 14.559 39.905 1.00 22.37 ? 269  VAL A CG2 1 
ATOM   2011 N  N   . ALA A 1 286 ? 27.867 18.149 38.826 1.00 22.64 ? 270  ALA A N   1 
ATOM   2012 C  CA  . ALA A 1 286 ? 28.442 19.256 38.059 1.00 23.73 ? 270  ALA A CA  1 
ATOM   2013 C  C   . ALA A 1 286 ? 29.922 19.020 37.674 1.00 24.80 ? 270  ALA A C   1 
ATOM   2014 O  O   . ALA A 1 286 ? 30.521 19.800 36.909 1.00 25.83 ? 270  ALA A O   1 
ATOM   2015 C  CB  . ALA A 1 286 ? 28.281 20.571 38.823 1.00 24.64 ? 270  ALA A CB  1 
ATOM   2016 N  N   . ASP A 1 287 ? 30.488 17.914 38.161 1.00 23.96 ? 271  ASP A N   1 
ATOM   2017 C  CA  . ASP A 1 287 ? 31.860 17.535 37.819 1.00 24.10 ? 271  ASP A CA  1 
ATOM   2018 C  C   . ASP A 1 287 ? 31.827 16.416 36.776 1.00 23.56 ? 271  ASP A C   1 
ATOM   2019 O  O   . ASP A 1 287 ? 31.454 15.292 37.104 1.00 24.00 ? 271  ASP A O   1 
ATOM   2020 C  CB  . ASP A 1 287 ? 32.561 17.059 39.085 1.00 23.45 ? 271  ASP A CB  1 
ATOM   2021 C  CG  . ASP A 1 287 ? 33.998 16.617 38.843 1.00 24.50 ? 271  ASP A CG  1 
ATOM   2022 O  OD1 . ASP A 1 287 ? 34.424 16.511 37.677 1.00 26.44 ? 271  ASP A OD1 1 
ATOM   2023 O  OD2 . ASP A 1 287 ? 34.693 16.372 39.846 1.00 27.55 ? 271  ASP A OD2 1 
ATOM   2024 N  N   . PRO A 1 288 ? 32.222 16.713 35.527 1.00 23.76 ? 272  PRO A N   1 
ATOM   2025 C  CA  . PRO A 1 288 ? 32.144 15.698 34.458 1.00 23.39 ? 272  PRO A CA  1 
ATOM   2026 C  C   . PRO A 1 288 ? 32.887 14.395 34.793 1.00 23.13 ? 272  PRO A C   1 
ATOM   2027 O  O   . PRO A 1 288 ? 32.472 13.310 34.362 1.00 22.40 ? 272  PRO A O   1 
ATOM   2028 C  CB  . PRO A 1 288 ? 32.803 16.403 33.268 1.00 24.91 ? 272  PRO A CB  1 
ATOM   2029 C  CG  . PRO A 1 288 ? 32.574 17.845 33.539 1.00 26.38 ? 272  PRO A CG  1 
ATOM   2030 C  CD  . PRO A 1 288 ? 32.727 18.001 35.016 1.00 23.55 ? 272  PRO A CD  1 
ATOM   2031 N  N   . ALA A 1 289 ? 33.992 14.505 35.529 1.00 22.42 ? 273  ALA A N   1 
ATOM   2032 C  CA  . ALA A 1 289 ? 34.759 13.326 35.946 1.00 21.91 ? 273  ALA A CA  1 
ATOM   2033 C  C   . ALA A 1 289 ? 34.000 12.453 36.917 1.00 21.64 ? 273  ALA A C   1 
ATOM   2034 O  O   . ALA A 1 289 ? 34.134 11.232 36.893 1.00 22.36 ? 273  ALA A O   1 
ATOM   2035 C  CB  . ALA A 1 289 ? 36.124 13.723 36.555 1.00 21.29 ? 273  ALA A CB  1 
ATOM   2036 N  N   . PHE A 1 290 ? 33.213 13.078 37.781 1.00 21.71 ? 274  PHE A N   1 
ATOM   2037 C  CA  . PHE A 1 290 ? 32.381 12.327 38.701 1.00 22.28 ? 274  PHE A CA  1 
ATOM   2038 C  C   . PHE A 1 290 ? 31.218 11.651 37.946 1.00 22.15 ? 274  PHE A C   1 
ATOM   2039 O  O   . PHE A 1 290 ? 30.832 10.524 38.279 1.00 22.56 ? 274  PHE A O   1 
ATOM   2040 C  CB  . PHE A 1 290 ? 31.811 13.242 39.779 1.00 22.19 ? 274  PHE A CB  1 
ATOM   2041 C  CG  . PHE A 1 290 ? 30.969 12.521 40.804 1.00 23.79 ? 274  PHE A CG  1 
ATOM   2042 C  CD1 . PHE A 1 290 ? 31.582 11.747 41.804 1.00 26.51 ? 274  PHE A CD1 1 
ATOM   2043 C  CD2 . PHE A 1 290 ? 29.572 12.590 40.756 1.00 25.33 ? 274  PHE A CD2 1 
ATOM   2044 C  CE1 . PHE A 1 290 ? 30.794 11.061 42.773 1.00 27.28 ? 274  PHE A CE1 1 
ATOM   2045 C  CE2 . PHE A 1 290 ? 28.780 11.926 41.722 1.00 28.25 ? 274  PHE A CE2 1 
ATOM   2046 C  CZ  . PHE A 1 290 ? 29.406 11.150 42.717 1.00 28.22 ? 274  PHE A CZ  1 
ATOM   2047 N  N   . VAL A 1 291 ? 30.641 12.360 36.974 1.00 21.86 ? 275  VAL A N   1 
ATOM   2048 C  CA  . VAL A 1 291 ? 29.564 11.782 36.154 1.00 21.76 ? 275  VAL A CA  1 
ATOM   2049 C  C   . VAL A 1 291 ? 30.101 10.509 35.486 1.00 22.54 ? 275  VAL A C   1 
ATOM   2050 O  O   . VAL A 1 291 ? 29.470 9.442  35.558 1.00 22.94 ? 275  VAL A O   1 
ATOM   2051 C  CB  . VAL A 1 291 ? 28.989 12.791 35.119 1.00 21.44 ? 275  VAL A CB  1 
ATOM   2052 C  CG1 . VAL A 1 291 ? 28.002 12.115 34.170 1.00 20.45 ? 275  VAL A CG1 1 
ATOM   2053 C  CG2 . VAL A 1 291 ? 28.308 13.968 35.845 1.00 21.49 ? 275  VAL A CG2 1 
ATOM   2054 N  N   . ALA A 1 292 ? 31.277 10.610 34.864 1.00 21.20 ? 276  ALA A N   1 
ATOM   2055 C  CA  . ALA A 1 292 ? 31.912 9.445  34.237 1.00 22.56 ? 276  ALA A CA  1 
ATOM   2056 C  C   . ALA A 1 292 ? 32.131 8.295  35.218 1.00 22.52 ? 276  ALA A C   1 
ATOM   2057 O  O   . ALA A 1 292 ? 31.839 7.144  34.900 1.00 22.98 ? 276  ALA A O   1 
ATOM   2058 C  CB  . ALA A 1 292 ? 33.216 9.842  33.601 1.00 21.23 ? 276  ALA A CB  1 
ATOM   2059 N  N   . LYS A 1 293 ? 32.639 8.615  36.403 1.00 23.55 ? 277  LYS A N   1 
ATOM   2060 C  CA  . LYS A 1 293 ? 32.937 7.622  37.450 1.00 24.08 ? 277  LYS A CA  1 
ATOM   2061 C  C   . LYS A 1 293 ? 31.702 6.840  37.928 1.00 24.17 ? 277  LYS A C   1 
ATOM   2062 O  O   . LYS A 1 293 ? 31.758 5.621  38.136 1.00 23.63 ? 277  LYS A O   1 
ATOM   2063 C  CB  . LYS A 1 293 ? 33.601 8.311  38.661 1.00 23.63 ? 277  LYS A CB  1 
ATOM   2064 C  CG  . LYS A 1 293 ? 34.212 7.325  39.650 1.00 25.10 ? 277  LYS A CG  1 
ATOM   2065 C  CD  . LYS A 1 293 ? 35.460 6.707  39.037 1.00 27.35 ? 277  LYS A CD  1 
ATOM   2066 C  CE  . LYS A 1 293 ? 36.181 5.789  39.998 1.00 29.88 ? 277  LYS A CE  1 
ATOM   2067 N  NZ  . LYS A 1 293 ? 37.460 5.300  39.393 1.00 31.31 ? 277  LYS A NZ  1 
ATOM   2068 N  N   . MET A 1 294 ? 30.597 7.555  38.124 1.00 24.68 ? 278  MET A N   1 
ATOM   2069 C  CA  . MET A 1 294 ? 29.338 6.950  38.555 1.00 24.88 ? 278  MET A CA  1 
ATOM   2070 C  C   . MET A 1 294 ? 28.789 5.956  37.541 1.00 24.97 ? 278  MET A C   1 
ATOM   2071 O  O   . MET A 1 294 ? 28.147 4.976  37.932 1.00 24.44 ? 278  MET A O   1 
ATOM   2072 C  CB  . MET A 1 294 ? 28.294 8.020  38.811 1.00 25.75 ? 278  MET A CB  1 
ATOM   2073 C  CG  . MET A 1 294 ? 28.437 8.796  40.134 1.00 26.95 ? 278  MET A CG  1 
ATOM   2074 S  SD  . MET A 1 294 ? 28.396 7.755  41.618 1.00 31.62 ? 278  MET A SD  1 
ATOM   2075 C  CE  . MET A 1 294 ? 26.819 6.904  41.472 1.00 29.51 ? 278  MET A CE  1 
ATOM   2076 N  N   . ASN A 1 295 ? 29.064 6.204  36.259 1.00 24.80 ? 279  ASN A N   1 
ATOM   2077 C  CA  . ASN A 1 295 ? 28.690 5.289  35.159 1.00 25.77 ? 279  ASN A CA  1 
ATOM   2078 C  C   . ASN A 1 295 ? 27.192 4.976  35.145 1.00 25.56 ? 279  ASN A C   1 
ATOM   2079 O  O   . ASN A 1 295 ? 26.777 3.835  34.933 1.00 25.22 ? 279  ASN A O   1 
ATOM   2080 C  CB  . ASN A 1 295 ? 29.528 3.995  35.207 1.00 25.79 ? 279  ASN A CB  1 
ATOM   2081 C  CG  . ASN A 1 295 ? 29.442 3.186  33.928 1.00 28.45 ? 279  ASN A CG  1 
ATOM   2082 O  OD1 . ASN A 1 295 ? 29.206 1.978  33.970 1.00 31.34 ? 279  ASN A OD1 1 
ATOM   2083 N  ND2 . ASN A 1 295 ? 29.647 3.839  32.783 1.00 29.75 ? 279  ASN A ND2 1 
ATOM   2084 N  N   . GLN A 1 296 ? 26.382 6.000  35.395 1.00 25.57 ? 280  GLN A N   1 
ATOM   2085 C  CA  . GLN A 1 296 ? 24.937 5.840  35.353 1.00 26.72 ? 280  GLN A CA  1 
ATOM   2086 C  C   . GLN A 1 296 ? 24.312 6.652  34.223 1.00 26.57 ? 280  GLN A C   1 
ATOM   2087 O  O   . GLN A 1 296 ? 23.159 7.051  34.310 1.00 28.12 ? 280  GLN A O   1 
ATOM   2088 C  CB  . GLN A 1 296 ? 24.299 6.176  36.708 1.00 26.19 ? 280  GLN A CB  1 
ATOM   2089 C  CG  . GLN A 1 296 ? 24.746 5.258  37.859 1.00 28.22 ? 280  GLN A CG  1 
ATOM   2090 C  CD  . GLN A 1 296 ? 24.069 3.880  37.860 1.00 32.23 ? 280  GLN A CD  1 
ATOM   2091 O  OE1 . GLN A 1 296 ? 23.219 3.571  37.012 1.00 31.71 ? 280  GLN A OE1 1 
ATOM   2092 N  NE2 . GLN A 1 296 ? 24.461 3.037  38.821 1.00 33.81 ? 280  GLN A NE2 1 
ATOM   2093 N  N   . GLY A 1 297 ? 25.065 6.845  33.144 1.00 26.43 ? 281  GLY A N   1 
ATOM   2094 C  CA  . GLY A 1 297 ? 24.617 7.664  32.020 1.00 25.45 ? 281  GLY A CA  1 
ATOM   2095 C  C   . GLY A 1 297 ? 25.142 9.079  32.112 1.00 25.29 ? 281  GLY A C   1 
ATOM   2096 O  O   . GLY A 1 297 ? 26.123 9.343  32.839 1.00 25.82 ? 281  GLY A O   1 
ATOM   2097 N  N   . ASN A 1 298 ? 24.506 9.998  31.387 1.00 24.15 ? 282  ASN A N   1 
ATOM   2098 C  CA  . ASN A 1 298 ? 24.944 11.397 31.421 1.00 24.22 ? 282  ASN A CA  1 
ATOM   2099 C  C   . ASN A 1 298 ? 24.476 12.104 32.707 1.00 23.43 ? 282  ASN A C   1 
ATOM   2100 O  O   . ASN A 1 298 ? 23.863 11.463 33.562 1.00 23.92 ? 282  ASN A O   1 
ATOM   2101 C  CB  . ASN A 1 298 ? 24.518 12.136 30.147 1.00 23.91 ? 282  ASN A CB  1 
ATOM   2102 C  CG  . ASN A 1 298 ? 23.007 12.306 30.021 1.00 24.26 ? 282  ASN A CG  1 
ATOM   2103 O  OD1 . ASN A 1 298 ? 22.230 12.000 30.934 1.00 24.04 ? 282  ASN A OD1 1 
ATOM   2104 N  ND2 . ASN A 1 298 ? 22.587 12.819 28.873 1.00 25.67 ? 282  ASN A ND2 1 
ATOM   2105 N  N   . ALA A 1 299 ? 24.778 13.393 32.864 1.00 22.69 ? 283  ALA A N   1 
ATOM   2106 C  CA  . ALA A 1 299 ? 24.486 14.102 34.117 1.00 22.80 ? 283  ALA A CA  1 
ATOM   2107 C  C   . ALA A 1 299 ? 23.003 14.052 34.476 1.00 23.10 ? 283  ALA A C   1 
ATOM   2108 O  O   . ALA A 1 299 ? 22.664 13.854 35.624 1.00 21.54 ? 283  ALA A O   1 
ATOM   2109 C  CB  . ALA A 1 299 ? 24.981 15.536 34.055 1.00 22.32 ? 283  ALA A CB  1 
ATOM   2110 N  N   . HIS A 1 300 ? 22.125 14.222 33.482 1.00 22.83 ? 284  HIS A N   1 
ATOM   2111 C  CA  . HIS A 1 300 ? 20.684 14.143 33.731 1.00 23.62 ? 284  HIS A CA  1 
ATOM   2112 C  C   . HIS A 1 300 ? 20.284 12.761 34.256 1.00 23.21 ? 284  HIS A C   1 
ATOM   2113 O  O   . HIS A 1 300 ? 19.569 12.663 35.247 1.00 22.78 ? 284  HIS A O   1 
ATOM   2114 C  CB  . HIS A 1 300 ? 19.892 14.459 32.464 1.00 24.05 ? 284  HIS A CB  1 
ATOM   2115 C  CG  . HIS A 1 300 ? 20.011 15.880 32.017 1.00 26.66 ? 284  HIS A CG  1 
ATOM   2116 N  ND1 . HIS A 1 300 ? 19.715 16.276 30.727 1.00 29.86 ? 284  HIS A ND1 1 
ATOM   2117 C  CD2 . HIS A 1 300 ? 20.392 16.999 32.680 1.00 27.38 ? 284  HIS A CD2 1 
ATOM   2118 C  CE1 . HIS A 1 300 ? 19.919 17.578 30.614 1.00 30.51 ? 284  HIS A CE1 1 
ATOM   2119 N  NE2 . HIS A 1 300 ? 20.331 18.040 31.784 1.00 26.88 ? 284  HIS A NE2 1 
ATOM   2120 N  N   . ALA A 1 301 ? 20.785 11.717 33.595 1.00 22.76 ? 285  ALA A N   1 
ATOM   2121 C  CA  . ALA A 1 301 ? 20.528 10.326 33.969 1.00 22.77 ? 285  ALA A CA  1 
ATOM   2122 C  C   . ALA A 1 301 ? 21.041 10.075 35.382 1.00 22.98 ? 285  ALA A C   1 
ATOM   2123 O  O   . ALA A 1 301 ? 20.339 9.466  36.203 1.00 22.30 ? 285  ALA A O   1 
ATOM   2124 C  CB  . ALA A 1 301 ? 21.174 9.379  32.982 1.00 22.87 ? 285  ALA A CB  1 
ATOM   2125 N  N   . LEU A 1 302 ? 22.234 10.605 35.677 1.00 22.29 ? 286  LEU A N   1 
ATOM   2126 C  CA  . LEU A 1 302 ? 22.825 10.454 36.982 1.00 22.55 ? 286  LEU A CA  1 
ATOM   2127 C  C   . LEU A 1 302 ? 22.010 11.137 38.069 1.00 22.65 ? 286  LEU A C   1 
ATOM   2128 O  O   . LEU A 1 302 ? 21.826 10.570 39.162 1.00 22.43 ? 286  LEU A O   1 
ATOM   2129 C  CB  . LEU A 1 302 ? 24.266 10.963 36.991 1.00 22.61 ? 286  LEU A CB  1 
ATOM   2130 C  CG  . LEU A 1 302 ? 24.975 10.902 38.357 1.00 23.31 ? 286  LEU A CG  1 
ATOM   2131 C  CD1 . LEU A 1 302 ? 25.034 9.476  38.902 1.00 24.43 ? 286  LEU A CD1 1 
ATOM   2132 C  CD2 . LEU A 1 302 ? 26.396 11.496 38.268 1.00 24.12 ? 286  LEU A CD2 1 
ATOM   2133 N  N   . MET A 1 303 ? 21.543 12.354 37.786 1.00 21.60 ? 287  MET A N   1 
ATOM   2134 C  CA  . MET A 1 303 ? 20.726 13.066 38.756 1.00 22.30 ? 287  MET A CA  1 
ATOM   2135 C  C   . MET A 1 303 ? 19.464 12.249 39.050 1.00 22.36 ? 287  MET A C   1 
ATOM   2136 O  O   . MET A 1 303 ? 19.059 12.139 40.213 1.00 21.80 ? 287  MET A O   1 
ATOM   2137 C  CB  . MET A 1 303 ? 20.388 14.482 38.275 1.00 22.29 ? 287  MET A CB  1 
ATOM   2138 C  CG  . MET A 1 303 ? 19.585 15.331 39.281 1.00 23.03 ? 287  MET A CG  1 
ATOM   2139 S  SD  . MET A 1 303 ? 20.535 15.726 40.791 1.00 25.23 ? 287  MET A SD  1 
ATOM   2140 C  CE  . MET A 1 303 ? 21.695 16.975 40.199 1.00 22.06 ? 287  MET A CE  1 
ATOM   2141 N  N   . MET A 1 304 ? 18.885 11.662 38.005 1.00 21.58 ? 288  MET A N   1 
ATOM   2142 C  CA  . MET A 1 304 ? 17.668 10.852 38.127 1.00 23.67 ? 288  MET A CA  1 
ATOM   2143 C  C   . MET A 1 304 ? 17.979 9.623  38.983 1.00 23.22 ? 288  MET A C   1 
ATOM   2144 O  O   . MET A 1 304 ? 17.212 9.275  39.890 1.00 23.19 ? 288  MET A O   1 
ATOM   2145 C  CB  . MET A 1 304 ? 17.163 10.408 36.766 1.00 23.47 ? 288  MET A CB  1 
ATOM   2146 C  CG  . MET A 1 304 ? 16.447 11.490 35.923 1.00 28.46 ? 288  MET A CG  1 
ATOM   2147 S  SD  . MET A 1 304 ? 15.597 10.900 34.411 1.00 37.61 ? 288  MET A SD  1 
ATOM   2148 C  CE  . MET A 1 304 ? 16.819 9.921  33.536 1.00 35.93 ? 288  MET A CE  1 
ATOM   2149 N  N   . TYR A 1 305 ? 19.107 8.978  38.689 1.00 22.47 ? 289  TYR A N   1 
ATOM   2150 C  CA  . TYR A 1 305 ? 19.550 7.830  39.472 1.00 22.84 ? 289  TYR A CA  1 
ATOM   2151 C  C   . TYR A 1 305 ? 19.699 8.184  40.957 1.00 22.07 ? 289  TYR A C   1 
ATOM   2152 O  O   . TYR A 1 305 ? 19.270 7.415  41.820 1.00 21.20 ? 289  TYR A O   1 
ATOM   2153 C  CB  . TYR A 1 305 ? 20.875 7.275  38.931 1.00 22.10 ? 289  TYR A CB  1 
ATOM   2154 C  CG  . TYR A 1 305 ? 21.498 6.203  39.796 1.00 22.99 ? 289  TYR A CG  1 
ATOM   2155 C  CD1 . TYR A 1 305 ? 21.144 4.867  39.633 1.00 24.44 ? 289  TYR A CD1 1 
ATOM   2156 C  CD2 . TYR A 1 305 ? 22.455 6.526  40.776 1.00 23.16 ? 289  TYR A CD2 1 
ATOM   2157 C  CE1 . TYR A 1 305 ? 21.719 3.873  40.421 1.00 25.22 ? 289  TYR A CE1 1 
ATOM   2158 C  CE2 . TYR A 1 305 ? 23.047 5.531  41.568 1.00 24.64 ? 289  TYR A CE2 1 
ATOM   2159 C  CZ  . TYR A 1 305 ? 22.668 4.212  41.389 1.00 24.32 ? 289  TYR A CZ  1 
ATOM   2160 O  OH  . TYR A 1 305 ? 23.236 3.211  42.156 1.00 24.64 ? 289  TYR A OH  1 
ATOM   2161 N  N   . LEU A 1 306 ? 20.322 9.324  41.250 1.00 22.13 ? 290  LEU A N   1 
ATOM   2162 C  CA  . LEU A 1 306 ? 20.587 9.672  42.646 1.00 22.08 ? 290  LEU A CA  1 
ATOM   2163 C  C   . LEU A 1 306 ? 19.295 10.065 43.360 1.00 22.62 ? 290  LEU A C   1 
ATOM   2164 O  O   . LEU A 1 306 ? 19.102 9.750  44.544 1.00 22.63 ? 290  LEU A O   1 
ATOM   2165 C  CB  . LEU A 1 306 ? 21.598 10.819 42.727 1.00 22.34 ? 290  LEU A CB  1 
ATOM   2166 C  CG  . LEU A 1 306 ? 23.047 10.529 42.325 1.00 21.53 ? 290  LEU A CG  1 
ATOM   2167 C  CD1 . LEU A 1 306 ? 23.788 11.873 42.268 1.00 24.12 ? 290  LEU A CD1 1 
ATOM   2168 C  CD2 . LEU A 1 306 ? 23.746 9.517  43.245 1.00 23.76 ? 290  LEU A CD2 1 
ATOM   2169 N  N   . TYR A 1 307 ? 18.432 10.771 42.640 1.00 22.77 ? 291  TYR A N   1 
ATOM   2170 C  CA  . TYR A 1 307 ? 17.142 11.208 43.167 1.00 24.18 ? 291  TYR A CA  1 
ATOM   2171 C  C   . TYR A 1 307 ? 16.262 9.998  43.567 1.00 25.23 ? 291  TYR A C   1 
ATOM   2172 O  O   . TYR A 1 307 ? 15.552 10.061 44.563 1.00 24.85 ? 291  TYR A O   1 
ATOM   2173 C  CB  . TYR A 1 307 ? 16.432 12.089 42.141 1.00 23.78 ? 291  TYR A CB  1 
ATOM   2174 C  CG  . TYR A 1 307 ? 15.194 12.810 42.623 1.00 23.25 ? 291  TYR A CG  1 
ATOM   2175 C  CD1 . TYR A 1 307 ? 15.285 13.867 43.535 1.00 21.86 ? 291  TYR A CD1 1 
ATOM   2176 C  CD2 . TYR A 1 307 ? 13.930 12.481 42.113 1.00 22.01 ? 291  TYR A CD2 1 
ATOM   2177 C  CE1 . TYR A 1 307 ? 14.152 14.556 43.947 1.00 22.22 ? 291  TYR A CE1 1 
ATOM   2178 C  CE2 . TYR A 1 307 ? 12.779 13.161 42.530 1.00 22.22 ? 291  TYR A CE2 1 
ATOM   2179 C  CZ  . TYR A 1 307 ? 12.897 14.199 43.465 1.00 22.43 ? 291  TYR A CZ  1 
ATOM   2180 O  OH  . TYR A 1 307 ? 11.767 14.895 43.889 1.00 18.60 ? 291  TYR A OH  1 
ATOM   2181 N  N   . ASN A 1 308 ? 16.377 8.891  42.839 1.00 27.59 ? 292  ASN A N   1 
ATOM   2182 C  CA  . ASN A 1 308 ? 15.382 7.791  42.894 1.00 30.19 ? 292  ASN A CA  1 
ATOM   2183 C  C   . ASN A 1 308 ? 15.257 6.558  43.860 1.00 31.95 ? 292  ASN A C   1 
ATOM   2184 O  O   . ASN A 1 308 ? 14.127 6.088  43.965 1.00 33.28 ? 292  ASN A O   1 
ATOM   2185 C  CB  . ASN A 1 308 ? 15.095 7.307  41.459 1.00 30.29 ? 292  ASN A CB  1 
ATOM   2186 C  CG  . ASN A 1 308 ? 14.038 8.163  40.761 1.00 32.05 ? 292  ASN A CG  1 
ATOM   2187 O  OD1 . ASN A 1 308 ? 13.174 8.779  41.409 1.00 32.25 ? 292  ASN A OD1 1 
ATOM   2188 N  ND2 . ASN A 1 308 ? 14.104 8.206  39.437 1.00 34.18 ? 292  ASN A ND2 1 
ATOM   2189 N  N   . ALA A 1 309 ? 16.247 5.965  44.554 1.00 33.91 ? 293  ALA A N   1 
ATOM   2190 C  CA  . ALA A 1 309 ? 17.618 6.388  44.919 1.00 34.43 ? 293  ALA A CA  1 
ATOM   2191 C  C   . ALA A 1 309 ? 17.692 7.274  46.163 1.00 34.98 ? 293  ALA A C   1 
ATOM   2192 O  O   . ALA A 1 309 ? 17.476 6.771  47.278 1.00 35.70 ? 293  ALA A O   1 
ATOM   2193 C  CB  . ALA A 1 309 ? 18.348 6.949  43.804 1.00 34.94 ? 293  ALA A CB  1 
HETATM 2194 ZN ZN  . ZN  B 2 .   ? 11.175 23.718 53.615 1.00 19.14 ? 301  ZN  A ZN  1 
HETATM 2195 ZN ZN  . ZN  C 2 .   ? 10.209 23.989 50.459 1.00 17.58 ? 302  ZN  A ZN  1 
HETATM 2196 N  N1  . SPD D 3 .   ? 13.190 15.354 52.658 1.00 36.64 ? 304  SPD A N1  1 
HETATM 2197 C  C2  . SPD D 3 .   ? 14.114 15.779 51.616 1.00 36.59 ? 304  SPD A C2  1 
HETATM 2198 C  C3  . SPD D 3 .   ? 14.209 14.724 50.522 1.00 36.04 ? 304  SPD A C3  1 
HETATM 2199 C  C4  . SPD D 3 .   ? 14.053 15.323 49.127 1.00 38.02 ? 304  SPD A C4  1 
HETATM 2200 C  C5  . SPD D 3 .   ? 15.205 15.002 48.175 1.00 38.12 ? 304  SPD A C5  1 
HETATM 2201 N  N6  . SPD D 3 .   ? 15.225 13.636 47.695 1.00 38.24 ? 304  SPD A N6  1 
HETATM 2202 C  C7  . SPD D 3 .   ? 16.442 13.035 47.162 1.00 37.62 ? 304  SPD A C7  1 
HETATM 2203 C  C8  . SPD D 3 .   ? 17.032 12.092 48.206 1.00 35.74 ? 304  SPD A C8  1 
HETATM 2204 C  C9  . SPD D 3 .   ? 17.785 10.912 47.633 1.00 35.04 ? 304  SPD A C9  1 
HETATM 2205 N  N10 . SPD D 3 .   ? 18.273 10.218 48.798 1.00 35.77 ? 304  SPD A N10 1 
HETATM 2206 C  C   . ACY E 4 .   ? 9.494  21.132 52.258 1.00 34.74 ? 1022 ACY A C   1 
HETATM 2207 O  O   . ACY E 4 .   ? 10.059 21.665 53.254 1.00 34.68 ? 1022 ACY A O   1 
HETATM 2208 O  OXT . ACY E 4 .   ? 9.276  21.751 51.201 1.00 33.96 ? 1022 ACY A OXT 1 
HETATM 2209 C  CH3 . ACY E 4 .   ? 9.055  19.692 52.323 1.00 34.58 ? 1022 ACY A CH3 1 
HETATM 2210 O  O   . HOH F 5 .   ? 9.662  24.019 52.333 1.00 21.60 ? 1023 HOH A O   1 
HETATM 2211 O  O   . HOH F 5 .   ? 16.501 28.560 55.243 1.00 13.10 ? 1024 HOH A O   1 
HETATM 2212 O  O   . HOH F 5 .   ? 18.541 28.998 53.326 1.00 16.06 ? 1025 HOH A O   1 
HETATM 2213 O  O   . HOH F 5 .   ? 3.376  26.002 51.545 1.00 16.93 ? 1026 HOH A O   1 
HETATM 2214 O  O   . HOH F 5 .   ? 24.944 13.180 48.496 1.00 18.15 ? 1027 HOH A O   1 
HETATM 2215 O  O   . HOH F 5 .   ? 12.919 27.913 57.526 1.00 20.01 ? 1028 HOH A O   1 
HETATM 2216 O  O   . HOH F 5 .   ? 11.144 31.765 61.535 1.00 22.74 ? 1029 HOH A O   1 
HETATM 2217 O  O   . HOH F 5 .   ? 20.951 20.014 55.714 1.00 18.01 ? 1030 HOH A O   1 
HETATM 2218 O  O   . HOH F 5 .   ? 32.494 27.837 43.409 1.00 15.85 ? 1031 HOH A O   1 
HETATM 2219 O  O   . HOH F 5 .   ? 12.064 32.980 45.961 1.00 16.74 ? 1032 HOH A O   1 
HETATM 2220 O  O   . HOH F 5 .   ? 18.215 44.481 42.934 0.50 16.86 ? 1033 HOH A O   1 
HETATM 2221 O  O   . HOH F 5 .   ? 12.244 18.694 49.850 1.00 21.85 ? 1034 HOH A O   1 
HETATM 2222 O  O   . HOH F 5 .   ? 17.551 25.528 38.382 1.00 16.60 ? 1035 HOH A O   1 
HETATM 2223 O  O   . HOH F 5 .   ? 14.949 24.690 43.689 1.00 13.78 ? 1036 HOH A O   1 
HETATM 2224 O  O   . HOH F 5 .   ? 36.624 17.863 37.109 1.00 20.89 ? 1037 HOH A O   1 
HETATM 2225 O  O   . HOH F 5 .   ? 14.246 31.378 40.390 1.00 15.88 ? 1038 HOH A O   1 
HETATM 2226 O  O   . HOH F 5 .   ? 5.259  28.724 58.938 1.00 31.08 ? 1039 HOH A O   1 
HETATM 2227 O  O   . HOH F 5 .   ? 20.849 27.698 72.289 1.00 31.15 ? 1040 HOH A O   1 
HETATM 2228 O  O   . HOH F 5 .   ? 37.059 22.919 39.576 1.00 29.30 ? 1041 HOH A O   1 
HETATM 2229 O  O   . HOH F 5 .   ? 12.393 31.512 38.434 1.00 24.85 ? 1042 HOH A O   1 
HETATM 2230 O  O   . HOH F 5 .   ? 9.289  28.930 69.577 1.00 31.46 ? 1043 HOH A O   1 
HETATM 2231 O  O   . HOH F 5 .   ? 39.029 24.437 47.942 1.00 22.56 ? 1044 HOH A O   1 
HETATM 2232 O  O   . HOH F 5 .   ? 10.938 22.259 34.663 1.00 24.25 ? 1045 HOH A O   1 
HETATM 2233 O  O   . HOH F 5 .   ? 11.184 34.600 55.030 1.00 22.59 ? 1046 HOH A O   1 
HETATM 2234 O  O   . HOH F 5 .   ? 31.224 20.673 57.826 1.00 20.90 ? 1047 HOH A O   1 
HETATM 2235 O  O   . HOH F 5 .   ? 33.129 33.555 39.903 1.00 28.28 ? 1048 HOH A O   1 
HETATM 2236 O  O   . HOH F 5 .   ? 27.549 38.874 47.616 1.00 25.82 ? 1049 HOH A O   1 
HETATM 2237 O  O   . HOH F 5 .   ? 20.694 15.886 60.645 1.00 20.87 ? 1050 HOH A O   1 
HETATM 2238 O  O   . HOH F 5 .   ? 11.260 24.565 37.879 1.00 20.64 ? 1051 HOH A O   1 
HETATM 2239 O  O   . HOH F 5 .   ? 2.606  24.126 42.838 1.00 27.62 ? 1052 HOH A O   1 
HETATM 2240 O  O   . HOH F 5 .   ? 9.864  21.781 60.557 1.00 22.72 ? 1053 HOH A O   1 
HETATM 2241 O  O   . HOH F 5 .   ? 36.436 24.523 54.091 1.00 28.56 ? 1054 HOH A O   1 
HETATM 2242 O  O   . HOH F 5 .   ? 37.196 23.694 44.433 1.00 30.65 ? 1055 HOH A O   1 
HETATM 2243 O  O   . HOH F 5 .   ? 28.883 15.403 32.488 1.00 23.17 ? 1056 HOH A O   1 
HETATM 2244 O  O   . HOH F 5 .   ? 26.777 8.645  35.643 1.00 24.30 ? 1057 HOH A O   1 
HETATM 2245 O  O   . HOH F 5 .   ? 11.703 33.683 41.204 1.00 14.82 ? 1058 HOH A O   1 
HETATM 2246 O  O   . HOH F 5 .   ? 19.558 13.834 28.729 1.00 25.48 ? 1059 HOH A O   1 
HETATM 2247 O  O   . HOH F 5 .   ? 12.276 20.600 51.902 1.00 21.53 ? 1060 HOH A O   1 
HETATM 2248 O  O   . HOH F 5 .   ? 5.348  23.646 45.810 1.00 18.67 ? 1061 HOH A O   1 
HETATM 2249 O  O   . HOH F 5 .   ? 18.796 21.712 64.302 1.00 31.66 ? 1062 HOH A O   1 
HETATM 2250 O  O   . HOH F 5 .   ? 19.603 41.352 37.401 1.00 24.74 ? 1063 HOH A O   1 
HETATM 2251 O  O   . HOH F 5 .   ? 3.922  36.031 55.704 1.00 23.60 ? 1064 HOH A O   1 
HETATM 2252 O  O   . HOH F 5 .   ? 9.605  15.987 39.647 1.00 30.35 ? 1065 HOH A O   1 
HETATM 2253 O  O   . HOH F 5 .   ? 32.936 38.853 53.042 1.00 24.82 ? 1066 HOH A O   1 
HETATM 2254 O  O   . HOH F 5 .   ? 42.666 29.409 43.654 1.00 26.03 ? 1067 HOH A O   1 
HETATM 2255 O  O   . HOH F 5 .   ? 17.677 45.429 51.147 1.00 25.82 ? 1068 HOH A O   1 
HETATM 2256 O  O   . HOH F 5 .   ? 38.570 23.194 52.674 1.00 36.79 ? 1069 HOH A O   1 
HETATM 2257 O  O   . HOH F 5 .   ? 4.021  33.580 40.848 1.00 23.23 ? 1070 HOH A O   1 
HETATM 2258 O  O   . HOH F 5 .   ? 40.705 26.037 46.430 1.00 29.02 ? 1071 HOH A O   1 
HETATM 2259 O  O   . HOH F 5 .   ? 1.496  36.648 54.611 1.00 25.74 ? 1072 HOH A O   1 
HETATM 2260 O  O   . HOH F 5 .   ? 36.984 19.712 56.270 1.00 29.73 ? 1073 HOH A O   1 
HETATM 2261 O  O   . HOH F 5 .   ? 30.852 13.271 32.148 1.00 28.61 ? 1074 HOH A O   1 
HETATM 2262 O  O   . HOH F 5 .   ? 8.316  22.452 57.712 1.00 23.88 ? 1075 HOH A O   1 
HETATM 2263 O  O   . HOH F 5 .   ? 26.825 14.715 31.009 1.00 28.24 ? 1076 HOH A O   1 
HETATM 2264 O  O   . HOH F 5 .   ? 3.105  36.240 58.554 1.00 30.75 ? 1077 HOH A O   1 
HETATM 2265 O  O   . HOH F 5 .   ? 1.374  39.254 50.367 1.00 38.14 ? 1078 HOH A O   1 
HETATM 2266 O  O   . HOH F 5 .   ? 35.239 36.179 41.491 1.00 36.13 ? 1079 HOH A O   1 
HETATM 2267 O  O   . HOH F 5 .   ? 8.128  37.028 45.339 1.00 24.32 ? 1080 HOH A O   1 
HETATM 2268 O  O   . HOH F 5 .   ? 16.445 30.157 35.968 1.00 34.79 ? 1081 HOH A O   1 
HETATM 2269 O  O   . HOH F 5 .   ? 5.946  28.768 42.647 1.00 22.26 ? 1082 HOH A O   1 
HETATM 2270 O  O   . HOH F 5 .   ? 20.171 21.405 73.723 1.00 37.04 ? 1083 HOH A O   1 
HETATM 2271 O  O   . HOH F 5 .   ? 40.046 23.242 50.407 1.00 32.04 ? 1084 HOH A O   1 
HETATM 2272 O  O   . HOH F 5 .   ? 19.991 23.296 66.397 1.00 28.72 ? 1085 HOH A O   1 
HETATM 2273 O  O   . HOH F 5 .   ? 14.459 12.548 38.020 1.00 40.96 ? 1086 HOH A O   1 
HETATM 2274 O  O   . HOH F 5 .   ? 33.541 15.867 42.034 1.00 36.43 ? 1087 HOH A O   1 
HETATM 2275 O  O   . HOH F 5 .   ? 9.924  37.496 36.399 1.00 26.11 ? 1088 HOH A O   1 
HETATM 2276 O  O   . HOH F 5 .   ? 17.192 32.998 35.416 1.00 27.50 ? 1089 HOH A O   1 
HETATM 2277 O  O   . HOH F 5 .   ? 27.685 30.041 39.233 1.00 29.51 ? 1090 HOH A O   1 
HETATM 2278 O  O   . HOH F 5 .   ? 15.075 49.468 54.542 1.00 46.47 ? 1091 HOH A O   1 
HETATM 2279 O  O   . HOH F 5 .   ? 13.777 21.299 33.135 1.00 26.79 ? 1092 HOH A O   1 
HETATM 2280 O  O   . HOH F 5 .   ? 16.524 31.922 70.229 1.00 37.77 ? 1093 HOH A O   1 
HETATM 2281 O  O   . HOH F 5 .   ? 25.157 12.637 60.173 1.00 23.82 ? 1094 HOH A O   1 
HETATM 2282 O  O   . HOH F 5 .   ? 30.549 17.682 65.973 1.00 33.04 ? 1095 HOH A O   1 
HETATM 2283 O  O   . HOH F 5 .   ? 35.464 20.320 38.410 1.00 30.72 ? 1096 HOH A O   1 
HETATM 2284 O  O   . HOH F 5 .   ? 20.110 47.835 54.684 1.00 28.78 ? 1097 HOH A O   1 
HETATM 2285 O  O   . HOH F 5 .   ? 18.000 4.820  41.050 1.00 35.29 ? 1098 HOH A O   1 
HETATM 2286 O  O   . HOH F 5 .   ? 40.079 5.744  43.176 1.00 32.54 ? 1099 HOH A O   1 
HETATM 2287 O  O   . HOH F 5 .   ? 27.848 29.368 36.426 1.00 36.90 ? 1100 HOH A O   1 
HETATM 2288 O  O   . HOH F 5 .   ? 18.499 14.702 62.068 1.00 29.86 ? 1101 HOH A O   1 
HETATM 2289 O  O   . HOH F 5 .   ? 38.772 27.010 48.180 1.00 22.69 ? 1102 HOH A O   1 
HETATM 2290 O  O   . HOH F 5 .   ? 5.092  43.782 52.707 1.00 26.01 ? 1103 HOH A O   1 
HETATM 2291 O  O   . HOH F 5 .   ? 35.908 22.812 42.102 1.00 24.08 ? 1104 HOH A O   1 
HETATM 2292 O  O   . HOH F 5 .   ? 13.644 35.127 40.022 1.00 20.44 ? 1105 HOH A O   1 
HETATM 2293 O  O   . HOH F 5 .   ? 33.740 23.491 57.730 1.00 32.19 ? 1106 HOH A O   1 
HETATM 2294 O  O   . HOH F 5 .   ? 27.020 33.724 41.876 1.00 32.26 ? 1107 HOH A O   1 
HETATM 2295 O  O   . HOH F 5 .   ? 3.180  43.133 57.482 1.00 27.61 ? 1108 HOH A O   1 
HETATM 2296 O  O   . HOH F 5 .   ? 24.234 36.930 63.342 1.00 30.40 ? 1109 HOH A O   1 
HETATM 2297 O  O   . HOH F 5 .   ? 31.287 21.672 60.230 1.00 38.51 ? 1110 HOH A O   1 
HETATM 2298 O  O   . HOH F 5 .   ? 15.993 16.239 61.697 1.00 41.92 ? 1111 HOH A O   1 
HETATM 2299 O  O   . HOH F 5 .   ? 36.633 8.536  58.850 1.00 34.36 ? 1112 HOH A O   1 
HETATM 2300 O  O   . HOH F 5 .   ? 17.953 13.654 58.428 1.00 31.30 ? 1113 HOH A O   1 
HETATM 2301 O  O   . HOH F 5 .   ? 24.826 38.344 65.610 1.00 36.00 ? 1114 HOH A O   1 
HETATM 2302 O  O   . HOH F 5 .   ? 27.016 43.995 64.680 1.00 43.30 ? 1115 HOH A O   1 
HETATM 2303 O  O   . HOH F 5 .   ? 7.499  31.470 67.594 1.00 33.07 ? 1116 HOH A O   1 
HETATM 2304 O  O   . HOH F 5 .   ? 10.721 35.860 72.524 1.00 34.11 ? 1117 HOH A O   1 
HETATM 2305 O  O   . HOH F 5 .   ? 3.109  32.199 46.394 1.00 35.62 ? 1118 HOH A O   1 
HETATM 2306 O  O   . HOH F 5 .   ? 10.187 16.838 50.928 1.00 30.86 ? 1119 HOH A O   1 
HETATM 2307 O  O   . HOH F 5 .   ? 15.662 12.613 56.957 1.00 46.63 ? 1120 HOH A O   1 
HETATM 2308 O  O   . HOH F 5 .   ? 17.400 12.727 54.524 1.00 41.67 ? 1121 HOH A O   1 
HETATM 2309 O  O   . HOH F 5 .   ? 35.115 13.747 41.176 1.00 24.97 ? 1122 HOH A O   1 
HETATM 2310 O  O   . HOH F 5 .   ? 32.954 21.193 36.540 1.00 31.65 ? 1123 HOH A O   1 
HETATM 2311 O  O   . HOH F 5 .   ? 30.148 21.985 35.376 1.00 28.42 ? 1124 HOH A O   1 
HETATM 2312 O  O   . HOH F 5 .   ? 28.960 17.226 34.585 1.00 27.16 ? 1125 HOH A O   1 
HETATM 2313 O  O   . HOH F 5 .   ? 25.801 18.625 35.206 1.00 32.65 ? 1126 HOH A O   1 
HETATM 2314 O  O   . HOH F 5 .   ? 23.111 15.832 30.877 1.00 28.51 ? 1127 HOH A O   1 
HETATM 2315 O  O   . HOH F 5 .   ? 10.489 47.577 50.695 1.00 38.97 ? 1128 HOH A O   1 
HETATM 2316 O  O   . HOH F 5 .   ? 9.267  20.271 35.025 1.00 35.49 ? 1129 HOH A O   1 
HETATM 2317 O  O   . HOH F 5 .   ? 16.291 49.373 51.001 1.00 31.99 ? 1130 HOH A O   1 
HETATM 2318 O  O   . HOH F 5 .   ? 36.704 20.586 47.726 1.00 32.98 ? 1131 HOH A O   1 
HETATM 2319 O  O   . HOH F 5 .   ? 20.718 20.987 32.795 1.00 39.70 ? 1132 HOH A O   1 
HETATM 2320 O  O   . HOH F 5 .   ? 39.404 40.746 52.013 1.00 32.80 ? 1133 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -15 ?   ?   ?   A . n 
A 1 2   HIS 2   -14 ?   ?   ?   A . n 
A 1 3   HIS 3   -13 ?   ?   ?   A . n 
A 1 4   HIS 4   -12 ?   ?   ?   A . n 
A 1 5   HIS 5   -11 ?   ?   ?   A . n 
A 1 6   HIS 6   -10 ?   ?   ?   A . n 
A 1 7   SER 7   -9  ?   ?   ?   A . n 
A 1 8   SER 8   -8  ?   ?   ?   A . n 
A 1 9   GLY 9   -7  ?   ?   ?   A . n 
A 1 10  LEU 10  -6  ?   ?   ?   A . n 
A 1 11  VAL 11  -5  ?   ?   ?   A . n 
A 1 12  PRO 12  -4  ?   ?   ?   A . n 
A 1 13  ARG 13  -3  ?   ?   ?   A . n 
A 1 14  GLY 14  -2  ?   ?   ?   A . n 
A 1 15  SER 15  -1  ?   ?   ?   A . n 
A 1 16  HIS 16  0   ?   ?   ?   A . n 
A 1 17  MET 17  1   1   MET MET A . n 
A 1 18  ARG 18  2   2   ARG ARG A . n 
A 1 19  ASN 19  3   3   ASN ASN A . n 
A 1 20  TYR 20  4   4   TYR TYR A . n 
A 1 21  CYS 21  5   5   CYS CYS A . n 
A 1 22  THR 22  6   6   THR THR A . n 
A 1 23  LYS 23  7   7   LYS LYS A . n 
A 1 24  THR 24  8   8   THR THR A . n 
A 1 25  PHE 25  9   9   PHE PHE A . n 
A 1 26  GLY 26  10  10  GLY GLY A . n 
A 1 27  SER 27  11  11  SER SER A . n 
A 1 28  ALA 28  12  12  ALA ALA A . n 
A 1 29  PHE 29  13  13  PHE PHE A . n 
A 1 30  SER 30  14  14  SER SER A . n 
A 1 31  VAL 31  15  15  VAL VAL A . n 
A 1 32  THR 32  16  16  THR THR A . n 
A 1 33  VAL 33  17  17  VAL VAL A . n 
A 1 34  VAL 34  18  18  VAL VAL A . n 
A 1 35  PRO 35  19  19  PRO PRO A . n 
A 1 36  THR 36  20  20  THR THR A . n 
A 1 37  LEU 37  21  21  LEU LEU A . n 
A 1 38  LYS 38  22  22  LYS LYS A . n 
A 1 39  ASP 39  23  23  ASP ASP A . n 
A 1 40  ASN 40  24  24  ASN ASN A . n 
A 1 41  PHE 41  25  25  PHE PHE A . n 
A 1 42  SER 42  26  26  SER SER A . n 
A 1 43  TYR 43  27  27  TYR TYR A . n 
A 1 44  LEU 44  28  28  LEU LEU A . n 
A 1 45  ILE 45  29  29  ILE ILE A . n 
A 1 46  ASN 46  30  30  ASN ASN A . n 
A 1 47  ASP 47  31  31  ASP ASP A . n 
A 1 48  HIS 48  32  32  HIS HIS A . n 
A 1 49  THR 49  33  33  THR THR A . n 
A 1 50  THR 50  34  34  THR THR A . n 
A 1 51  HIS 51  35  35  HIS HIS A . n 
A 1 52  THR 52  36  36  THR THR A . n 
A 1 53  LEU 53  37  37  LEU LEU A . n 
A 1 54  ALA 54  38  38  ALA ALA A . n 
A 1 55  ALA 55  39  39  ALA ALA A . n 
A 1 56  VAL 56  40  40  VAL VAL A . n 
A 1 57  ASP 57  41  41  ASP ASP A . n 
A 1 58  VAL 58  42  42  VAL VAL A . n 
A 1 59  ASN 59  43  43  ASN ASN A . n 
A 1 60  ALA 60  44  44  ALA ALA A . n 
A 1 61  ASP 61  45  45  ASP ASP A . n 
A 1 62  TYR 62  46  46  TYR TYR A . n 
A 1 63  LYS 63  47  47  LYS LYS A . n 
A 1 64  PRO 64  48  48  PRO PRO A . n 
A 1 65  ILE 65  49  49  ILE ILE A . n 
A 1 66  LEU 66  50  50  LEU LEU A . n 
A 1 67  THR 67  51  51  THR THR A . n 
A 1 68  TYR 68  52  52  TYR TYR A . n 
A 1 69  ILE 69  53  53  ILE ILE A . n 
A 1 70  GLU 70  54  54  GLU GLU A . n 
A 1 71  GLU 71  55  55  GLU GLU A . n 
A 1 72  HIS 72  56  56  HIS HIS A . n 
A 1 73  LEU 73  57  57  LEU LEU A . n 
A 1 74  LYS 74  58  ?   ?   ?   A . n 
A 1 75  GLN 75  59  ?   ?   ?   A . n 
A 1 76  GLN 76  60  ?   ?   ?   A . n 
A 1 77  GLY 77  61  ?   ?   ?   A . n 
A 1 78  ASN 78  62  ?   ?   ?   A . n 
A 1 79  ALA 79  63  ?   ?   ?   A . n 
A 1 80  ASP 80  64  ?   ?   ?   A . n 
A 1 81  VAL 81  65  ?   ?   ?   A . n 
A 1 82  THR 82  66  66  THR THR A . n 
A 1 83  TYR 83  67  67  TYR TYR A . n 
A 1 84  THR 84  68  68  THR THR A . n 
A 1 85  PHE 85  69  69  PHE PHE A . n 
A 1 86  SER 86  70  70  SER SER A . n 
A 1 87  THR 87  71  71  THR THR A . n 
A 1 88  ILE 88  72  72  ILE ILE A . n 
A 1 89  LEU 89  73  73  LEU LEU A . n 
A 1 90  SER 90  74  74  SER SER A . n 
A 1 91  THR 91  75  75  THR THR A . n 
A 1 92  HIS 92  76  76  HIS HIS A . n 
A 1 93  LYS 93  77  77  LYS LYS A . n 
A 1 94  HIS 94  78  78  HIS HIS A . n 
A 1 95  TRP 95  79  79  TRP TRP A . n 
A 1 96  ASP 96  80  80  ASP ASP A . n 
A 1 97  HIS 97  81  81  HIS HIS A . n 
A 1 98  SER 98  82  82  SER SER A . n 
A 1 99  GLY 99  83  83  GLY GLY A . n 
A 1 100 GLY 100 84  84  GLY GLY A . n 
A 1 101 ASN 101 85  85  ASN ASN A . n 
A 1 102 ALA 102 86  86  ALA ALA A . n 
A 1 103 LYS 103 87  87  LYS LYS A . n 
A 1 104 LEU 104 88  88  LEU LEU A . n 
A 1 105 LYS 105 89  89  LYS LYS A . n 
A 1 106 ALA 106 90  90  ALA ALA A . n 
A 1 107 GLU 107 91  91  GLU GLU A . n 
A 1 108 LEU 108 92  92  LEU LEU A . n 
A 1 109 GLU 109 93  93  GLU GLU A . n 
A 1 110 ALA 110 94  94  ALA ALA A . n 
A 1 111 MET 111 95  95  MET MET A . n 
A 1 112 ASN 112 96  96  ASN ASN A . n 
A 1 113 SER 113 97  ?   ?   ?   A . n 
A 1 114 THR 114 98  ?   ?   ?   A . n 
A 1 115 VAL 115 99  99  VAL VAL A . n 
A 1 116 PRO 116 100 100 PRO PRO A . n 
A 1 117 VAL 117 101 101 VAL VAL A . n 
A 1 118 VAL 118 102 102 VAL VAL A . n 
A 1 119 VAL 119 103 103 VAL VAL A . n 
A 1 120 VAL 120 104 104 VAL VAL A . n 
A 1 121 GLY 121 105 105 GLY GLY A . n 
A 1 122 GLY 122 106 106 GLY GLY A . n 
A 1 123 ALA 123 107 107 ALA ALA A . n 
A 1 124 ASN 124 108 108 ASN ASN A . n 
A 1 125 ASP 125 109 109 ASP ASP A . n 
A 1 126 SER 126 110 110 SER SER A . n 
A 1 127 ILE 127 111 111 ILE ILE A . n 
A 1 128 PRO 128 112 112 PRO PRO A . n 
A 1 129 ALA 129 113 113 ALA ALA A . n 
A 1 130 VAL 130 114 114 VAL VAL A . n 
A 1 131 THR 131 115 115 THR THR A . n 
A 1 132 LYS 132 116 116 LYS LYS A . n 
A 1 133 PRO 133 117 117 PRO PRO A . n 
A 1 134 VAL 134 118 118 VAL VAL A . n 
A 1 135 ARG 135 119 119 ARG ARG A . n 
A 1 136 GLU 136 120 120 GLU GLU A . n 
A 1 137 GLY 137 121 121 GLY GLY A . n 
A 1 138 ASP 138 122 122 ASP ASP A . n 
A 1 139 ARG 139 123 123 ARG ARG A . n 
A 1 140 VAL 140 124 124 VAL VAL A . n 
A 1 141 GLN 141 125 125 GLN GLN A . n 
A 1 142 VAL 142 126 126 VAL VAL A . n 
A 1 143 GLY 143 127 127 GLY GLY A . n 
A 1 144 ASP 144 128 128 ASP ASP A . n 
A 1 145 LEU 145 129 129 LEU LEU A . n 
A 1 146 SER 146 130 130 SER SER A . n 
A 1 147 VAL 147 131 131 VAL VAL A . n 
A 1 148 GLU 148 132 132 GLU GLU A . n 
A 1 149 VAL 149 133 133 VAL VAL A . n 
A 1 150 ILE 150 134 134 ILE ILE A . n 
A 1 151 ASP 151 135 135 ASP ASP A . n 
A 1 152 ALA 152 136 136 ALA ALA A . n 
A 1 153 PRO 153 137 137 PRO PRO A . n 
A 1 154 CYS 154 138 138 CYS CYS A . n 
A 1 155 HIS 155 139 139 HIS HIS A . n 
A 1 156 THR 156 140 140 THR THR A . n 
A 1 157 ARG 157 141 141 ARG ARG A . n 
A 1 158 GLY 158 142 142 GLY GLY A . n 
A 1 159 HIS 159 143 143 HIS HIS A . n 
A 1 160 VAL 160 144 144 VAL VAL A . n 
A 1 161 LEU 161 145 145 LEU LEU A . n 
A 1 162 TYR 162 146 146 TYR TYR A . n 
A 1 163 LYS 163 147 147 LYS LYS A . n 
A 1 164 VAL 164 148 148 VAL VAL A . n 
A 1 165 GLN 165 149 149 GLN GLN A . n 
A 1 166 HIS 166 150 150 HIS HIS A . n 
A 1 167 PRO 167 151 151 PRO PRO A . n 
A 1 168 GLN 168 152 152 GLN GLN A . n 
A 1 169 HIS 169 153 153 HIS HIS A . n 
A 1 170 PRO 170 154 154 PRO PRO A . n 
A 1 171 ASN 171 155 155 ASN ASN A . n 
A 1 172 ASP 172 156 156 ASP ASP A . n 
A 1 173 GLY 173 157 157 GLY GLY A . n 
A 1 174 VAL 174 158 158 VAL VAL A . n 
A 1 175 ALA 175 159 159 ALA ALA A . n 
A 1 176 LEU 176 160 160 LEU LEU A . n 
A 1 177 PHE 177 161 161 PHE PHE A . n 
A 1 178 THR 178 162 162 THR THR A . n 
A 1 179 GLY 179 163 163 GLY GLY A . n 
A 1 180 ASP 180 164 164 ASP ASP A . n 
A 1 181 THR 181 165 165 THR THR A . n 
A 1 182 MET 182 166 166 MET MET A . n 
A 1 183 PHE 183 167 167 PHE PHE A . n 
A 1 184 ILE 184 168 168 ILE ILE A . n 
A 1 185 ALA 185 169 169 ALA ALA A . n 
A 1 186 GLY 186 170 170 GLY GLY A . n 
A 1 187 ILE 187 171 171 ILE ILE A . n 
A 1 188 GLY 188 172 172 GLY GLY A . n 
A 1 189 ALA 189 173 173 ALA ALA A . n 
A 1 190 PHE 190 174 174 PHE PHE A . n 
A 1 191 PHE 191 175 175 PHE PHE A . n 
A 1 192 GLU 192 176 176 GLU GLU A . n 
A 1 193 GLY 193 177 177 GLY GLY A . n 
A 1 194 ASP 194 178 178 ASP ASP A . n 
A 1 195 GLU 195 179 179 GLU GLU A . n 
A 1 196 LYS 196 180 180 LYS LYS A . n 
A 1 197 ASP 197 181 181 ASP ASP A . n 
A 1 198 MET 198 182 182 MET MET A . n 
A 1 199 CYS 199 183 183 CYS CYS A . n 
A 1 200 ARG 200 184 184 ARG ARG A . n 
A 1 201 ALA 201 185 185 ALA ALA A . n 
A 1 202 MET 202 186 186 MET MET A . n 
A 1 203 GLU 203 187 187 GLU GLU A . n 
A 1 204 LYS 204 188 188 LYS LYS A . n 
A 1 205 VAL 205 189 189 VAL VAL A . n 
A 1 206 TYR 206 190 190 TYR TYR A . n 
A 1 207 HIS 207 191 191 HIS HIS A . n 
A 1 208 ILE 208 192 192 ILE ILE A . n 
A 1 209 HIS 209 193 193 HIS HIS A . n 
A 1 210 LYS 210 194 194 LYS LYS A . n 
A 1 211 GLY 211 195 195 GLY GLY A . n 
A 1 212 ASN 212 196 196 ASN ASN A . n 
A 1 213 ASP 213 197 197 ASP ASP A . n 
A 1 214 TYR 214 198 198 TYR TYR A . n 
A 1 215 ALA 215 199 199 ALA ALA A . n 
A 1 216 LEU 216 200 200 LEU LEU A . n 
A 1 217 ASP 217 201 201 ASP ASP A . n 
A 1 218 LYS 218 202 202 LYS LYS A . n 
A 1 219 VAL 219 203 203 VAL VAL A . n 
A 1 220 THR 220 204 204 THR THR A . n 
A 1 221 PHE 221 205 205 PHE PHE A . n 
A 1 222 ILE 222 206 206 ILE ILE A . n 
A 1 223 PHE 223 207 207 PHE PHE A . n 
A 1 224 PRO 224 208 208 PRO PRO A . n 
A 1 225 GLY 225 209 209 GLY GLY A . n 
A 1 226 HIS 226 210 210 HIS HIS A . n 
A 1 227 GLU 227 211 211 GLU GLU A . n 
A 1 228 TYR 228 212 212 TYR TYR A . n 
A 1 229 THR 229 213 213 THR THR A . n 
A 1 230 SER 230 214 214 SER SER A . n 
A 1 231 GLY 231 215 215 GLY GLY A . n 
A 1 232 PHE 232 216 216 PHE PHE A . n 
A 1 233 MET 233 217 217 MET MET A . n 
A 1 234 THR 234 218 218 THR THR A . n 
A 1 235 PHE 235 219 219 PHE PHE A . n 
A 1 236 SER 236 220 220 SER SER A . n 
A 1 237 GLU 237 221 221 GLU GLU A . n 
A 1 238 LYS 238 222 222 LYS LYS A . n 
A 1 239 THR 239 223 223 THR THR A . n 
A 1 240 PHE 240 224 224 PHE PHE A . n 
A 1 241 PRO 241 225 225 PRO PRO A . n 
A 1 242 ASP 242 226 226 ASP ASP A . n 
A 1 243 ARG 243 227 227 ARG ARG A . n 
A 1 244 ALA 244 228 228 ALA ALA A . n 
A 1 245 SER 245 229 229 SER SER A . n 
A 1 246 ASP 246 230 230 ASP ASP A . n 
A 1 247 ASP 247 231 231 ASP ASP A . n 
A 1 248 LEU 248 232 232 LEU LEU A . n 
A 1 249 ALA 249 233 233 ALA ALA A . n 
A 1 250 PHE 250 234 234 PHE PHE A . n 
A 1 251 ILE 251 235 235 ILE ILE A . n 
A 1 252 GLN 252 236 236 GLN GLN A . n 
A 1 253 ALA 253 237 237 ALA ALA A . n 
A 1 254 GLN 254 238 238 GLN GLN A . n 
A 1 255 ARG 255 239 239 ARG ARG A . n 
A 1 256 ALA 256 240 240 ALA ALA A . n 
A 1 257 LYS 257 241 241 LYS LYS A . n 
A 1 258 TYR 258 242 242 TYR TYR A . n 
A 1 259 ALA 259 243 243 ALA ALA A . n 
A 1 260 ALA 260 244 244 ALA ALA A . n 
A 1 261 ALA 261 245 245 ALA ALA A . n 
A 1 262 VAL 262 246 246 VAL VAL A . n 
A 1 263 LYS 263 247 247 LYS LYS A . n 
A 1 264 THR 264 248 248 THR THR A . n 
A 1 265 GLY 265 249 249 GLY GLY A . n 
A 1 266 ASP 266 250 250 ASP ASP A . n 
A 1 267 PRO 267 251 251 PRO PRO A . n 
A 1 268 SER 268 252 252 SER SER A . n 
A 1 269 VAL 269 253 253 VAL VAL A . n 
A 1 270 PRO 270 254 254 PRO PRO A . n 
A 1 271 SER 271 255 255 SER SER A . n 
A 1 272 SER 272 256 256 SER SER A . n 
A 1 273 LEU 273 257 257 LEU LEU A . n 
A 1 274 ALA 274 258 258 ALA ALA A . n 
A 1 275 GLU 275 259 259 GLU GLU A . n 
A 1 276 GLU 276 260 260 GLU GLU A . n 
A 1 277 LYS 277 261 261 LYS LYS A . n 
A 1 278 ARG 278 262 262 ARG ARG A . n 
A 1 279 GLN 279 263 263 GLN GLN A . n 
A 1 280 ASN 280 264 264 ASN ASN A . n 
A 1 281 LEU 281 265 265 LEU LEU A . n 
A 1 282 PHE 282 266 266 PHE PHE A . n 
A 1 283 LEU 283 267 267 LEU LEU A . n 
A 1 284 ARG 284 268 268 ARG ARG A . n 
A 1 285 VAL 285 269 269 VAL VAL A . n 
A 1 286 ALA 286 270 270 ALA ALA A . n 
A 1 287 ASP 287 271 271 ASP ASP A . n 
A 1 288 PRO 288 272 272 PRO PRO A . n 
A 1 289 ALA 289 273 273 ALA ALA A . n 
A 1 290 PHE 290 274 274 PHE PHE A . n 
A 1 291 VAL 291 275 275 VAL VAL A . n 
A 1 292 ALA 292 276 276 ALA ALA A . n 
A 1 293 LYS 293 277 277 LYS LYS A . n 
A 1 294 MET 294 278 278 MET MET A . n 
A 1 295 ASN 295 279 279 ASN ASN A . n 
A 1 296 GLN 296 280 280 GLN GLN A . n 
A 1 297 GLY 297 281 281 GLY GLY A . n 
A 1 298 ASN 298 282 282 ASN ASN A . n 
A 1 299 ALA 299 283 283 ALA ALA A . n 
A 1 300 HIS 300 284 284 HIS HIS A . n 
A 1 301 ALA 301 285 285 ALA ALA A . n 
A 1 302 LEU 302 286 286 LEU LEU A . n 
A 1 303 MET 303 287 287 MET MET A . n 
A 1 304 MET 304 288 288 MET MET A . n 
A 1 305 TYR 305 289 289 TYR TYR A . n 
A 1 306 LEU 306 290 290 LEU LEU A . n 
A 1 307 TYR 307 291 291 TYR TYR A . n 
A 1 308 ASN 308 292 292 ASN ASN A . n 
A 1 309 ALA 309 293 293 ALA ALA A . n 
A 1 310 CYS 310 294 ?   ?   ?   A . n 
A 1 311 ASP 311 295 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1033 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 92  ? A HIS 76   ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 ND1 ? A HIS 94  ? A HIS 78   ? 1_555 95.2  ? 
2  NE2 ? A HIS 92  ? A HIS 76   ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 155 ? A HIS 139  ? 1_555 101.4 ? 
3  ND1 ? A HIS 94  ? A HIS 78   ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 155 ? A HIS 139  ? 1_555 91.0  ? 
4  NE2 ? A HIS 92  ? A HIS 76   ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 103.4 ? 
5  ND1 ? A HIS 94  ? A HIS 78   ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 100.7 ? 
6  NE2 ? A HIS 155 ? A HIS 139  ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 151.3 ? 
7  OD2 ? A ASP 96  ? A ASP 80   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 97  ? A HIS 81   ? 1_555 85.9  ? 
8  OD2 ? A ASP 96  ? A ASP 80   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 180 ? A ASP 164  ? 1_555 169.7 ? 
9  NE2 ? A HIS 97  ? A HIS 81   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 180 ? A ASP 164  ? 1_555 94.6  ? 
10 OD2 ? A ASP 96  ? A ASP 80   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 226 ? A HIS 210  ? 1_555 91.0  ? 
11 NE2 ? A HIS 97  ? A HIS 81   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 226 ? A HIS 210  ? 1_555 109.2 ? 
12 OD2 ? A ASP 180 ? A ASP 164  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 226 ? A HIS 210  ? 1_555 98.5  ? 
13 OD2 ? A ASP 96  ? A ASP 80   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? E ACY .   ? A ACY 1022 ? 1_555 89.5  ? 
14 NE2 ? A HIS 97  ? A HIS 81   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? E ACY .   ? A ACY 1022 ? 1_555 165.7 ? 
15 OD2 ? A ASP 180 ? A ASP 164  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? E ACY .   ? A ACY 1022 ? 1_555 87.5  ? 
16 NE2 ? A HIS 226 ? A HIS 210  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? E ACY .   ? A ACY 1022 ? 1_555 84.4  ? 
17 OD2 ? A ASP 96  ? A ASP 80   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 87.2  ? 
18 NE2 ? A HIS 97  ? A HIS 81   ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 95.1  ? 
19 OD2 ? A ASP 180 ? A ASP 164  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 82.5  ? 
20 NE2 ? A HIS 226 ? A HIS 210  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 155.4 ? 
21 O   ? E ACY .   ? A ACY 1022 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O   ? F HOH .   ? A HOH 1023 ? 1_555 71.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-01-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 21.0760 33.7410 61.5950 -0.0143 0.0175  -0.1039 -0.0107 0.0090  -0.0655 4.2283  2.9543  1.8364  1.0952  1.0751  
-0.3371 -0.0334 -0.1064 0.1398  -0.5959 0.2483  -0.1091 0.5208  -0.0940 -0.0014 'X-RAY DIFFRACTION' 
2  ? refined 16.1690 37.4230 69.3500 0.1609  0.3084  0.0156  0.0023  0.1281  -0.2213 20.6570 13.8456 8.7224  9.5332  9.0370  
4.6020  0.0688  -0.1972 0.1284  -1.7598 0.9294  -0.1009 0.6675  -0.5422 -0.2691 'X-RAY DIFFRACTION' 
3  ? refined 10.6730 36.8140 56.5620 -0.0482 -0.0145 0.0225  0.0321  0.0301  -0.1003 4.1394  4.0378  2.8800  -0.7099 0.0858  
0.5761  -0.0918 0.0235  0.0683  -0.6398 0.7521  0.1279  0.4309  -0.2968 -0.2292 'X-RAY DIFFRACTION' 
4  ? refined 9.7460  47.5200 60.3790 0.4720  0.3371  0.4715  0.1453  -0.0786 -0.3445 11.2301 6.4694  23.2801 -3.8784 -5.1528 
-0.7970 -0.1246 0.4403  -0.3157 -1.9877 1.6029  -1.1069 1.3234  -2.8536 -0.6232 'X-RAY DIFFRACTION' 
5  ? refined 19.0800 33.4540 47.1240 -0.1315 -0.1215 -0.0915 -0.0033 0.0299  -0.0077 1.9109  2.7096  1.3775  -0.1557 0.1191  
-0.1857 0.0859  -0.0610 -0.0249 -0.0469 0.3256  -0.0910 0.0430  -0.1043 0.0349  'X-RAY DIFFRACTION' 
6  ? refined 20.2690 22.2410 37.7130 -0.0665 -0.0498 -0.1730 0.0629  -0.0114 0.0024  18.2321 6.4714  4.0097  6.5848  3.9225  
1.8219  0.0129  0.0778  -0.0907 0.8293  -0.0397 0.0819  -0.5498 -0.0467 -0.0435 'X-RAY DIFFRACTION' 
7  ? refined 28.7170 20.7510 49.3420 -0.1184 -0.0885 -0.1363 0.0156  -0.0280 0.0216  2.9391  2.8268  1.2030  0.1463  -0.4049 
0.3433  0.0475  -0.0390 -0.0085 -0.0743 -0.2098 -0.2317 0.0754  0.1147  0.0762  'X-RAY DIFFRACTION' 
8  ? refined 31.9190 11.5490 57.1320 0.0236  0.0054  -0.0611 0.0330  -0.0937 0.0986  9.1725  7.9300  11.3985 -5.8029 -8.4258 
7.0391  -0.2248 0.0646  0.1603  -0.3517 -0.3701 -0.2275 0.8242  0.5493  0.2850  'X-RAY DIFFRACTION' 
9  ? refined 28.4750 16.1870 45.9950 -0.1189 -0.1137 -0.0964 0.0185  -0.0381 0.0108  3.9987  1.9754  4.1472  -0.3481 -0.3367 
1.0663  0.0996  0.0446  -0.1442 0.2015  -0.3884 -0.0702 0.0805  0.1779  0.2420  'X-RAY DIFFRACTION' 
10 ? refined 19.0590 9.8940  40.4890 -0.0211 -0.0546 0.0369  0.0018  -0.0670 -0.0478 18.0340 7.5054  9.1922  0.2333  -7.0581 
4.7886  0.1063  -0.3045 0.1982  0.4526  -1.4294 0.5928  0.4391  0.6171  -0.3672 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 17  A 61  ALL A 1   A 45  'X-RAY DIFFRACTION' ? 
2  2  A 62  A 73  ALL A 46  A 57  'X-RAY DIFFRACTION' ? 
3  3  A 82  A 106 ALL A 66  A 90  'X-RAY DIFFRACTION' ? 
4  4  A 107 A 119 ALL A 91  A 103 'X-RAY DIFFRACTION' ? 
5  5  A 120 A 193 ALL A 104 A 177 'X-RAY DIFFRACTION' ? 
6  6  A 194 A 205 ALL A 178 A 189 'X-RAY DIFFRACTION' ? 
7  7  A 206 A 242 ALL A 190 A 226 'X-RAY DIFFRACTION' ? 
8  8  A 243 A 263 ALL A 227 A 247 'X-RAY DIFFRACTION' ? 
9  9  A 264 A 300 ALL A 248 A 284 'X-RAY DIFFRACTION' ? 
10 10 A 301 A 309 ALL A 285 A 293 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     2P18 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.700 
_pdbx_phasing_MR.d_res_low_rotation           25.890 
_pdbx_phasing_MR.d_res_high_translation       2.700 
_pdbx_phasing_MR.d_res_low_translation        25.890 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       .     ?                other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
PHASER      .     ?                other   'R. J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 2 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html             Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/            C++        ? 4 
MxCuBE      .     ?                ?       ?                 ?                           'data collection' ? ?          ? 5 
MOSFLM      .     ?                ?       ?                 ?                           'data reduction'  ? ?          ? 6 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A GLU 54 ? ? N  A GLU 55 ? ? 1.484 1.336 0.148 0.023 Y 
2 1 N A GLU 55 ? ? CA A GLU 55 ? ? 1.670 1.459 0.211 0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A GLU 54  ? ? N  A GLU 55  ? ? CA A GLU 55  ? ? 105.28 121.70 -16.42 2.50 Y 
2 1 N A LEU 92  ? ? CA A LEU 92  ? ? C  A LEU 92  ? ? 89.83  111.00 -21.17 2.70 N 
3 1 N A ASN 292 ? ? CA A ASN 292 ? ? C  A ASN 292 ? ? 131.12 111.00 20.12  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 21  ? ? 54.12   -135.22 
2 1 ASP A 23  ? ? -140.52 16.43   
3 1 ASN A 43  ? ? -108.43 -166.62 
4 1 LEU A 92  ? ? -155.66 -45.65  
5 1 CYS A 138 ? ? 177.05  -65.73  
6 1 TYR A 198 ? ? 57.82   19.41   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 54 ? ? GLU A 55 ? ? 137.46 
2 1 GLU A 91 ? ? LEU A 92 ? ? -94.75 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLU 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              54 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -11.46 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 1   ? CG  ? A MET 17  CG  
2  1 Y 1 A MET 1   ? SD  ? A MET 17  SD  
3  1 Y 1 A MET 1   ? CE  ? A MET 17  CE  
4  1 Y 1 A LYS 22  ? CG  ? A LYS 38  CG  
5  1 Y 1 A LYS 22  ? CD  ? A LYS 38  CD  
6  1 Y 1 A LYS 22  ? CE  ? A LYS 38  CE  
7  1 Y 1 A LYS 22  ? NZ  ? A LYS 38  NZ  
8  1 Y 1 A GLU 54  ? CG  ? A GLU 70  CG  
9  1 Y 1 A GLU 54  ? CD  ? A GLU 70  CD  
10 1 Y 1 A GLU 54  ? OE1 ? A GLU 70  OE1 
11 1 Y 1 A GLU 54  ? OE2 ? A GLU 70  OE2 
12 1 Y 1 A GLU 55  ? CG  ? A GLU 71  CG  
13 1 Y 1 A GLU 55  ? CD  ? A GLU 71  CD  
14 1 Y 1 A GLU 55  ? OE1 ? A GLU 71  OE1 
15 1 Y 1 A GLU 55  ? OE2 ? A GLU 71  OE2 
16 1 Y 1 A THR 66  ? OG1 ? A THR 82  OG1 
17 1 Y 1 A THR 66  ? CG2 ? A THR 82  CG2 
18 1 Y 1 A ASN 96  ? CG  ? A ASN 112 CG  
19 1 Y 1 A ASN 96  ? OD1 ? A ASN 112 OD1 
20 1 Y 1 A ASN 96  ? ND2 ? A ASN 112 ND2 
21 1 Y 1 A VAL 99  ? CG1 ? A VAL 115 CG1 
22 1 Y 1 A VAL 99  ? CG2 ? A VAL 115 CG2 
23 1 Y 1 A LYS 222 ? CG  ? A LYS 238 CG  
24 1 Y 1 A LYS 222 ? CD  ? A LYS 238 CD  
25 1 Y 1 A LYS 222 ? CE  ? A LYS 238 CE  
26 1 Y 1 A LYS 222 ? NZ  ? A LYS 238 NZ  
27 1 Y 1 A LYS 247 ? CG  ? A LYS 263 CG  
28 1 Y 1 A LYS 247 ? CD  ? A LYS 263 CD  
29 1 Y 1 A LYS 247 ? CE  ? A LYS 263 CE  
30 1 Y 1 A LYS 247 ? NZ  ? A LYS 263 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -15 ? A HIS 1   
2  1 Y 1 A HIS -14 ? A HIS 2   
3  1 Y 1 A HIS -13 ? A HIS 3   
4  1 Y 1 A HIS -12 ? A HIS 4   
5  1 Y 1 A HIS -11 ? A HIS 5   
6  1 Y 1 A HIS -10 ? A HIS 6   
7  1 Y 1 A SER -9  ? A SER 7   
8  1 Y 1 A SER -8  ? A SER 8   
9  1 Y 1 A GLY -7  ? A GLY 9   
10 1 Y 1 A LEU -6  ? A LEU 10  
11 1 Y 1 A VAL -5  ? A VAL 11  
12 1 Y 1 A PRO -4  ? A PRO 12  
13 1 Y 1 A ARG -3  ? A ARG 13  
14 1 Y 1 A GLY -2  ? A GLY 14  
15 1 Y 1 A SER -1  ? A SER 15  
16 1 Y 1 A HIS 0   ? A HIS 16  
17 1 Y 1 A LYS 58  ? A LYS 74  
18 1 Y 1 A GLN 59  ? A GLN 75  
19 1 Y 1 A GLN 60  ? A GLN 76  
20 1 Y 1 A GLY 61  ? A GLY 77  
21 1 Y 1 A ASN 62  ? A ASN 78  
22 1 Y 1 A ALA 63  ? A ALA 79  
23 1 Y 1 A ASP 64  ? A ASP 80  
24 1 Y 1 A VAL 65  ? A VAL 81  
25 1 Y 1 A SER 97  ? A SER 113 
26 1 Y 1 A THR 98  ? A THR 114 
27 1 Y 1 A CYS 294 ? A CYS 310 
28 1 Y 1 A ASP 295 ? A ASP 311 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 SPERMIDINE    SPD 
4 'ACETIC ACID' ACY 
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   301  301  ZN  ZN  A . 
C 2 ZN  1   302  302  ZN  ZN  A . 
D 3 SPD 1   304  304  SPD SPD A . 
E 4 ACY 1   1022 1022 ACY ACY A . 
F 5 HOH 1   1023 303  HOH HOH A . 
F 5 HOH 2   1024 1    HOH HOH A . 
F 5 HOH 3   1025 2    HOH HOH A . 
F 5 HOH 4   1026 3    HOH HOH A . 
F 5 HOH 5   1027 4    HOH HOH A . 
F 5 HOH 6   1028 5    HOH HOH A . 
F 5 HOH 7   1029 6    HOH HOH A . 
F 5 HOH 8   1030 7    HOH HOH A . 
F 5 HOH 9   1031 8    HOH HOH A . 
F 5 HOH 10  1032 9    HOH HOH A . 
F 5 HOH 11  1033 10   HOH HOH A . 
F 5 HOH 12  1034 11   HOH HOH A . 
F 5 HOH 13  1035 12   HOH HOH A . 
F 5 HOH 14  1036 13   HOH HOH A . 
F 5 HOH 15  1037 14   HOH HOH A . 
F 5 HOH 16  1038 15   HOH HOH A . 
F 5 HOH 17  1039 16   HOH HOH A . 
F 5 HOH 18  1040 17   HOH HOH A . 
F 5 HOH 19  1041 18   HOH HOH A . 
F 5 HOH 20  1042 19   HOH HOH A . 
F 5 HOH 21  1043 20   HOH HOH A . 
F 5 HOH 22  1044 21   HOH HOH A . 
F 5 HOH 23  1045 22   HOH HOH A . 
F 5 HOH 24  1046 24   HOH HOH A . 
F 5 HOH 25  1047 26   HOH HOH A . 
F 5 HOH 26  1048 27   HOH HOH A . 
F 5 HOH 27  1049 28   HOH HOH A . 
F 5 HOH 28  1050 29   HOH HOH A . 
F 5 HOH 29  1051 30   HOH HOH A . 
F 5 HOH 30  1052 31   HOH HOH A . 
F 5 HOH 31  1053 32   HOH HOH A . 
F 5 HOH 32  1054 33   HOH HOH A . 
F 5 HOH 33  1055 34   HOH HOH A . 
F 5 HOH 34  1056 35   HOH HOH A . 
F 5 HOH 35  1057 36   HOH HOH A . 
F 5 HOH 36  1058 37   HOH HOH A . 
F 5 HOH 37  1059 38   HOH HOH A . 
F 5 HOH 38  1060 39   HOH HOH A . 
F 5 HOH 39  1061 40   HOH HOH A . 
F 5 HOH 40  1062 41   HOH HOH A . 
F 5 HOH 41  1063 42   HOH HOH A . 
F 5 HOH 42  1064 44   HOH HOH A . 
F 5 HOH 43  1065 47   HOH HOH A . 
F 5 HOH 44  1066 49   HOH HOH A . 
F 5 HOH 45  1067 51   HOH HOH A . 
F 5 HOH 46  1068 52   HOH HOH A . 
F 5 HOH 47  1069 53   HOH HOH A . 
F 5 HOH 48  1070 55   HOH HOH A . 
F 5 HOH 49  1071 57   HOH HOH A . 
F 5 HOH 50  1072 60   HOH HOH A . 
F 5 HOH 51  1073 62   HOH HOH A . 
F 5 HOH 52  1074 63   HOH HOH A . 
F 5 HOH 53  1075 68   HOH HOH A . 
F 5 HOH 54  1076 71   HOH HOH A . 
F 5 HOH 55  1077 72   HOH HOH A . 
F 5 HOH 56  1078 76   HOH HOH A . 
F 5 HOH 57  1079 77   HOH HOH A . 
F 5 HOH 58  1080 78   HOH HOH A . 
F 5 HOH 59  1081 83   HOH HOH A . 
F 5 HOH 60  1082 84   HOH HOH A . 
F 5 HOH 61  1083 85   HOH HOH A . 
F 5 HOH 62  1084 87   HOH HOH A . 
F 5 HOH 63  1085 88   HOH HOH A . 
F 5 HOH 64  1086 90   HOH HOH A . 
F 5 HOH 65  1087 92   HOH HOH A . 
F 5 HOH 66  1088 99   HOH HOH A . 
F 5 HOH 67  1089 100  HOH HOH A . 
F 5 HOH 68  1090 104  HOH HOH A . 
F 5 HOH 69  1091 106  HOH HOH A . 
F 5 HOH 70  1092 110  HOH HOH A . 
F 5 HOH 71  1093 118  HOH HOH A . 
F 5 HOH 72  1094 121  HOH HOH A . 
F 5 HOH 73  1095 131  HOH HOH A . 
F 5 HOH 74  1096 133  HOH HOH A . 
F 5 HOH 75  1097 134  HOH HOH A . 
F 5 HOH 76  1098 147  HOH HOH A . 
F 5 HOH 77  1099 164  HOH HOH A . 
F 5 HOH 78  1100 165  HOH HOH A . 
F 5 HOH 79  1101 166  HOH HOH A . 
F 5 HOH 80  1102 167  HOH HOH A . 
F 5 HOH 81  1103 168  HOH HOH A . 
F 5 HOH 82  1104 169  HOH HOH A . 
F 5 HOH 83  1105 170  HOH HOH A . 
F 5 HOH 84  1106 171  HOH HOH A . 
F 5 HOH 85  1107 172  HOH HOH A . 
F 5 HOH 86  1108 173  HOH HOH A . 
F 5 HOH 87  1109 175  HOH HOH A . 
F 5 HOH 88  1110 176  HOH HOH A . 
F 5 HOH 89  1111 177  HOH HOH A . 
F 5 HOH 90  1112 178  HOH HOH A . 
F 5 HOH 91  1113 180  HOH HOH A . 
F 5 HOH 92  1114 182  HOH HOH A . 
F 5 HOH 93  1115 184  HOH HOH A . 
F 5 HOH 94  1116 185  HOH HOH A . 
F 5 HOH 95  1117 186  HOH HOH A . 
F 5 HOH 96  1118 187  HOH HOH A . 
F 5 HOH 97  1119 188  HOH HOH A . 
F 5 HOH 98  1120 189  HOH HOH A . 
F 5 HOH 99  1121 190  HOH HOH A . 
F 5 HOH 100 1122 191  HOH HOH A . 
F 5 HOH 101 1123 192  HOH HOH A . 
F 5 HOH 102 1124 193  HOH HOH A . 
F 5 HOH 103 1125 194  HOH HOH A . 
F 5 HOH 104 1126 195  HOH HOH A . 
F 5 HOH 105 1127 196  HOH HOH A . 
F 5 HOH 106 1128 197  HOH HOH A . 
F 5 HOH 107 1129 198  HOH HOH A . 
F 5 HOH 108 1130 199  HOH HOH A . 
F 5 HOH 109 1131 200  HOH HOH A . 
F 5 HOH 110 1132 201  HOH HOH A . 
F 5 HOH 111 1133 202  HOH HOH A . 
#