data_2P1N
# 
_entry.id   2P1N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P1N         
RCSB  RCSB041854   
WWPDB D_1000041854 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2P1M . unspecified 
PDB 2P1O . unspecified 
PDB 2P1P . unspecified 
PDB 2P1Q . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2P1N 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tan, X.'                     1 
'Calderon-Villalobos, L.I.A.' 2 
'Sharon, M.'                  3 
'Robinson, C.V.'              4 
'Estelle, M.'                 5 
'Zheng, C.'                   6 
'Zheng, N.'                   7 
# 
_citation.id                        primary 
_citation.title                     'Mechanism of auxin perception by the TIR1 ubiquitin ligase' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            446 
_citation.page_first                640 
_citation.page_last                 645 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17410169 
_citation.pdbx_database_id_DOI      10.1038/nature05731 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tan, X.'                     1 ? 
primary 'Calderon-Villalobos, L.I.A.' 2 ? 
primary 'Sharon, M.'                  3 ? 
primary 'Zheng, C.'                   4 ? 
primary 'Robinson, C.V.'              5 ? 
primary 'Estelle, M.'                 6 ? 
primary 'Zheng, N.'                   7 ? 
# 
_cell.entry_id           2P1N 
_cell.length_a           102.665 
_cell.length_b           82.745 
_cell.length_c           125.791 
_cell.angle_alpha        90.00 
_cell.angle_beta         100.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P1N 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SKP1-like protein 1A'                   17876.043 2   ? ? ? ? 
2 polymer     man 'TRANSPORT INHIBITOR RESPONSE 1 protein' 66875.438 2   ? ? ? ? 
3 polymer     syn 'Auxin-responsive protein IAA7'          1601.872  2   ? ? ? ? 
4 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE'              660.035   2   ? ? ? ? 
5 non-polymer syn '(2,4-DICHLOROPHENOXY)ACETIC ACID'       221.037   2   ? ? ? ? 
6 water       nat water                                    18.015    524 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SKP1-like 1, UFO-binding protein 1'                     
2 'F-box/LRR-repeat protein 1'                             
3 'Indoleacetic acid-induced protein 7, Auxin resistant 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE
;
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE
;
A,D ? 
2 'polypeptide(L)' no no 
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
B,E ? 
3 'polypeptide(L)' no no QVVGWPPVRNYRK QVVGWPPVRNYRK C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   LYS n 
1 6   ILE n 
1 7   VAL n 
1 8   LEU n 
1 9   LYS n 
1 10  SER n 
1 11  SER n 
1 12  ASP n 
1 13  GLY n 
1 14  GLU n 
1 15  SER n 
1 16  PHE n 
1 17  GLU n 
1 18  VAL n 
1 19  GLU n 
1 20  GLU n 
1 21  ALA n 
1 22  VAL n 
1 23  ALA n 
1 24  LEU n 
1 25  GLU n 
1 26  SER n 
1 27  GLN n 
1 28  THR n 
1 29  ILE n 
1 30  ALA n 
1 31  HIS n 
1 32  MET n 
1 33  VAL n 
1 34  GLU n 
1 35  ASP n 
1 36  ASP n 
1 37  CYS n 
1 38  VAL n 
1 39  ASP n 
1 40  ASN n 
1 41  GLY n 
1 42  VAL n 
1 43  PRO n 
1 44  LEU n 
1 45  PRO n 
1 46  ASN n 
1 47  VAL n 
1 48  THR n 
1 49  SER n 
1 50  LYS n 
1 51  ILE n 
1 52  LEU n 
1 53  ALA n 
1 54  LYS n 
1 55  VAL n 
1 56  ILE n 
1 57  GLU n 
1 58  TYR n 
1 59  CYS n 
1 60  LYS n 
1 61  ARG n 
1 62  HIS n 
1 63  VAL n 
1 64  GLU n 
1 65  ALA n 
1 66  ALA n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  ALA n 
1 71  GLU n 
1 72  ALA n 
1 73  VAL n 
1 74  GLU n 
1 75  GLY n 
1 76  ALA n 
1 77  ALA n 
1 78  THR n 
1 79  SER n 
1 80  ASP n 
1 81  ASP n 
1 82  ASP n 
1 83  LEU n 
1 84  LYS n 
1 85  ALA n 
1 86  TRP n 
1 87  ASP n 
1 88  ALA n 
1 89  ASP n 
1 90  PHE n 
1 91  MET n 
1 92  LYS n 
1 93  ILE n 
1 94  ASP n 
1 95  GLN n 
1 96  ALA n 
1 97  THR n 
1 98  LEU n 
1 99  PHE n 
1 100 GLU n 
1 101 LEU n 
1 102 ILE n 
1 103 LEU n 
1 104 ALA n 
1 105 ALA n 
1 106 ASN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASN n 
1 110 ILE n 
1 111 LYS n 
1 112 ASN n 
1 113 LEU n 
1 114 LEU n 
1 115 ASP n 
1 116 LEU n 
1 117 THR n 
1 118 CYS n 
1 119 GLN n 
1 120 THR n 
1 121 VAL n 
1 122 ALA n 
1 123 ASP n 
1 124 MET n 
1 125 ILE n 
1 126 LYS n 
1 127 GLY n 
1 128 LYS n 
1 129 THR n 
1 130 PRO n 
1 131 GLU n 
1 132 GLU n 
1 133 ILE n 
1 134 ARG n 
1 135 THR n 
1 136 THR n 
1 137 PHE n 
1 138 ASN n 
1 139 ILE n 
1 140 LYS n 
1 141 ASN n 
1 142 ASP n 
1 143 PHE n 
1 144 THR n 
1 145 PRO n 
1 146 GLU n 
1 147 GLU n 
1 148 GLU n 
1 149 GLU n 
1 150 GLU n 
1 151 VAL n 
1 152 ARG n 
1 153 ARG n 
1 154 GLU n 
1 155 ASN n 
1 156 GLN n 
1 157 TRP n 
1 158 ALA n 
1 159 PHE n 
1 160 GLU n 
2 1   MET n 
2 2   GLN n 
2 3   LYS n 
2 4   ARG n 
2 5   ILE n 
2 6   ALA n 
2 7   LEU n 
2 8   SER n 
2 9   PHE n 
2 10  PRO n 
2 11  GLU n 
2 12  GLU n 
2 13  VAL n 
2 14  LEU n 
2 15  GLU n 
2 16  HIS n 
2 17  VAL n 
2 18  PHE n 
2 19  SER n 
2 20  PHE n 
2 21  ILE n 
2 22  GLN n 
2 23  LEU n 
2 24  ASP n 
2 25  LYS n 
2 26  ASP n 
2 27  ARG n 
2 28  ASN n 
2 29  SER n 
2 30  VAL n 
2 31  SER n 
2 32  LEU n 
2 33  VAL n 
2 34  CYS n 
2 35  LYS n 
2 36  SER n 
2 37  TRP n 
2 38  TYR n 
2 39  GLU n 
2 40  ILE n 
2 41  GLU n 
2 42  ARG n 
2 43  TRP n 
2 44  CYS n 
2 45  ARG n 
2 46  ARG n 
2 47  LYS n 
2 48  VAL n 
2 49  PHE n 
2 50  ILE n 
2 51  GLY n 
2 52  ASN n 
2 53  CYS n 
2 54  TYR n 
2 55  ALA n 
2 56  VAL n 
2 57  SER n 
2 58  PRO n 
2 59  ALA n 
2 60  THR n 
2 61  VAL n 
2 62  ILE n 
2 63  ARG n 
2 64  ARG n 
2 65  PHE n 
2 66  PRO n 
2 67  LYS n 
2 68  VAL n 
2 69  ARG n 
2 70  SER n 
2 71  VAL n 
2 72  GLU n 
2 73  LEU n 
2 74  LYS n 
2 75  GLY n 
2 76  LYS n 
2 77  PRO n 
2 78  HIS n 
2 79  PHE n 
2 80  ALA n 
2 81  ASP n 
2 82  PHE n 
2 83  ASN n 
2 84  LEU n 
2 85  VAL n 
2 86  PRO n 
2 87  ASP n 
2 88  GLY n 
2 89  TRP n 
2 90  GLY n 
2 91  GLY n 
2 92  TYR n 
2 93  VAL n 
2 94  TYR n 
2 95  PRO n 
2 96  TRP n 
2 97  ILE n 
2 98  GLU n 
2 99  ALA n 
2 100 MET n 
2 101 SER n 
2 102 SER n 
2 103 SER n 
2 104 TYR n 
2 105 THR n 
2 106 TRP n 
2 107 LEU n 
2 108 GLU n 
2 109 GLU n 
2 110 ILE n 
2 111 ARG n 
2 112 LEU n 
2 113 LYS n 
2 114 ARG n 
2 115 MET n 
2 116 VAL n 
2 117 VAL n 
2 118 THR n 
2 119 ASP n 
2 120 ASP n 
2 121 CYS n 
2 122 LEU n 
2 123 GLU n 
2 124 LEU n 
2 125 ILE n 
2 126 ALA n 
2 127 LYS n 
2 128 SER n 
2 129 PHE n 
2 130 LYS n 
2 131 ASN n 
2 132 PHE n 
2 133 LYS n 
2 134 VAL n 
2 135 LEU n 
2 136 VAL n 
2 137 LEU n 
2 138 SER n 
2 139 SER n 
2 140 CYS n 
2 141 GLU n 
2 142 GLY n 
2 143 PHE n 
2 144 SER n 
2 145 THR n 
2 146 ASP n 
2 147 GLY n 
2 148 LEU n 
2 149 ALA n 
2 150 ALA n 
2 151 ILE n 
2 152 ALA n 
2 153 ALA n 
2 154 THR n 
2 155 CYS n 
2 156 ARG n 
2 157 ASN n 
2 158 LEU n 
2 159 LYS n 
2 160 GLU n 
2 161 LEU n 
2 162 ASP n 
2 163 LEU n 
2 164 ARG n 
2 165 GLU n 
2 166 SER n 
2 167 ASP n 
2 168 VAL n 
2 169 ASP n 
2 170 ASP n 
2 171 VAL n 
2 172 SER n 
2 173 GLY n 
2 174 HIS n 
2 175 TRP n 
2 176 LEU n 
2 177 SER n 
2 178 HIS n 
2 179 PHE n 
2 180 PRO n 
2 181 ASP n 
2 182 THR n 
2 183 TYR n 
2 184 THR n 
2 185 SER n 
2 186 LEU n 
2 187 VAL n 
2 188 SER n 
2 189 LEU n 
2 190 ASN n 
2 191 ILE n 
2 192 SER n 
2 193 CYS n 
2 194 LEU n 
2 195 ALA n 
2 196 SER n 
2 197 GLU n 
2 198 VAL n 
2 199 SER n 
2 200 PHE n 
2 201 SER n 
2 202 ALA n 
2 203 LEU n 
2 204 GLU n 
2 205 ARG n 
2 206 LEU n 
2 207 VAL n 
2 208 THR n 
2 209 ARG n 
2 210 CYS n 
2 211 PRO n 
2 212 ASN n 
2 213 LEU n 
2 214 LYS n 
2 215 SER n 
2 216 LEU n 
2 217 LYS n 
2 218 LEU n 
2 219 ASN n 
2 220 ARG n 
2 221 ALA n 
2 222 VAL n 
2 223 PRO n 
2 224 LEU n 
2 225 GLU n 
2 226 LYS n 
2 227 LEU n 
2 228 ALA n 
2 229 THR n 
2 230 LEU n 
2 231 LEU n 
2 232 GLN n 
2 233 ARG n 
2 234 ALA n 
2 235 PRO n 
2 236 GLN n 
2 237 LEU n 
2 238 GLU n 
2 239 GLU n 
2 240 LEU n 
2 241 GLY n 
2 242 THR n 
2 243 GLY n 
2 244 GLY n 
2 245 TYR n 
2 246 THR n 
2 247 ALA n 
2 248 GLU n 
2 249 VAL n 
2 250 ARG n 
2 251 PRO n 
2 252 ASP n 
2 253 VAL n 
2 254 TYR n 
2 255 SER n 
2 256 GLY n 
2 257 LEU n 
2 258 SER n 
2 259 VAL n 
2 260 ALA n 
2 261 LEU n 
2 262 SER n 
2 263 GLY n 
2 264 CYS n 
2 265 LYS n 
2 266 GLU n 
2 267 LEU n 
2 268 ARG n 
2 269 CYS n 
2 270 LEU n 
2 271 SER n 
2 272 GLY n 
2 273 PHE n 
2 274 TRP n 
2 275 ASP n 
2 276 ALA n 
2 277 VAL n 
2 278 PRO n 
2 279 ALA n 
2 280 TYR n 
2 281 LEU n 
2 282 PRO n 
2 283 ALA n 
2 284 VAL n 
2 285 TYR n 
2 286 SER n 
2 287 VAL n 
2 288 CYS n 
2 289 SER n 
2 290 ARG n 
2 291 LEU n 
2 292 THR n 
2 293 THR n 
2 294 LEU n 
2 295 ASN n 
2 296 LEU n 
2 297 SER n 
2 298 TYR n 
2 299 ALA n 
2 300 THR n 
2 301 VAL n 
2 302 GLN n 
2 303 SER n 
2 304 TYR n 
2 305 ASP n 
2 306 LEU n 
2 307 VAL n 
2 308 LYS n 
2 309 LEU n 
2 310 LEU n 
2 311 CYS n 
2 312 GLN n 
2 313 CYS n 
2 314 PRO n 
2 315 LYS n 
2 316 LEU n 
2 317 GLN n 
2 318 ARG n 
2 319 LEU n 
2 320 TRP n 
2 321 VAL n 
2 322 LEU n 
2 323 ASP n 
2 324 TYR n 
2 325 ILE n 
2 326 GLU n 
2 327 ASP n 
2 328 ALA n 
2 329 GLY n 
2 330 LEU n 
2 331 GLU n 
2 332 VAL n 
2 333 LEU n 
2 334 ALA n 
2 335 SER n 
2 336 THR n 
2 337 CYS n 
2 338 LYS n 
2 339 ASP n 
2 340 LEU n 
2 341 ARG n 
2 342 GLU n 
2 343 LEU n 
2 344 ARG n 
2 345 VAL n 
2 346 PHE n 
2 347 PRO n 
2 348 SER n 
2 349 GLU n 
2 350 PRO n 
2 351 PHE n 
2 352 VAL n 
2 353 MET n 
2 354 GLU n 
2 355 PRO n 
2 356 ASN n 
2 357 VAL n 
2 358 ALA n 
2 359 LEU n 
2 360 THR n 
2 361 GLU n 
2 362 GLN n 
2 363 GLY n 
2 364 LEU n 
2 365 VAL n 
2 366 SER n 
2 367 VAL n 
2 368 SER n 
2 369 MET n 
2 370 GLY n 
2 371 CYS n 
2 372 PRO n 
2 373 LYS n 
2 374 LEU n 
2 375 GLU n 
2 376 SER n 
2 377 VAL n 
2 378 LEU n 
2 379 TYR n 
2 380 PHE n 
2 381 CYS n 
2 382 ARG n 
2 383 GLN n 
2 384 MET n 
2 385 THR n 
2 386 ASN n 
2 387 ALA n 
2 388 ALA n 
2 389 LEU n 
2 390 ILE n 
2 391 THR n 
2 392 ILE n 
2 393 ALA n 
2 394 ARG n 
2 395 ASN n 
2 396 ARG n 
2 397 PRO n 
2 398 ASN n 
2 399 MET n 
2 400 THR n 
2 401 ARG n 
2 402 PHE n 
2 403 ARG n 
2 404 LEU n 
2 405 CYS n 
2 406 ILE n 
2 407 ILE n 
2 408 GLU n 
2 409 PRO n 
2 410 LYS n 
2 411 ALA n 
2 412 PRO n 
2 413 ASP n 
2 414 TYR n 
2 415 LEU n 
2 416 THR n 
2 417 LEU n 
2 418 GLU n 
2 419 PRO n 
2 420 LEU n 
2 421 ASP n 
2 422 ILE n 
2 423 GLY n 
2 424 PHE n 
2 425 GLY n 
2 426 ALA n 
2 427 ILE n 
2 428 VAL n 
2 429 GLU n 
2 430 HIS n 
2 431 CYS n 
2 432 LYS n 
2 433 ASP n 
2 434 LEU n 
2 435 ARG n 
2 436 ARG n 
2 437 LEU n 
2 438 SER n 
2 439 LEU n 
2 440 SER n 
2 441 GLY n 
2 442 LEU n 
2 443 LEU n 
2 444 THR n 
2 445 ASP n 
2 446 LYS n 
2 447 VAL n 
2 448 PHE n 
2 449 GLU n 
2 450 TYR n 
2 451 ILE n 
2 452 GLY n 
2 453 THR n 
2 454 TYR n 
2 455 ALA n 
2 456 LYS n 
2 457 LYS n 
2 458 MET n 
2 459 GLU n 
2 460 MET n 
2 461 LEU n 
2 462 SER n 
2 463 VAL n 
2 464 ALA n 
2 465 PHE n 
2 466 ALA n 
2 467 GLY n 
2 468 ASP n 
2 469 SER n 
2 470 ASP n 
2 471 LEU n 
2 472 GLY n 
2 473 MET n 
2 474 HIS n 
2 475 HIS n 
2 476 VAL n 
2 477 LEU n 
2 478 SER n 
2 479 GLY n 
2 480 CYS n 
2 481 ASP n 
2 482 SER n 
2 483 LEU n 
2 484 ARG n 
2 485 LYS n 
2 486 LEU n 
2 487 GLU n 
2 488 ILE n 
2 489 ARG n 
2 490 ASP n 
2 491 CYS n 
2 492 PRO n 
2 493 PHE n 
2 494 GLY n 
2 495 ASP n 
2 496 LYS n 
2 497 ALA n 
2 498 LEU n 
2 499 LEU n 
2 500 ALA n 
2 501 ASN n 
2 502 ALA n 
2 503 SER n 
2 504 LYS n 
2 505 LEU n 
2 506 GLU n 
2 507 THR n 
2 508 MET n 
2 509 ARG n 
2 510 SER n 
2 511 LEU n 
2 512 TRP n 
2 513 MET n 
2 514 SER n 
2 515 SER n 
2 516 CYS n 
2 517 SER n 
2 518 VAL n 
2 519 SER n 
2 520 PHE n 
2 521 GLY n 
2 522 ALA n 
2 523 CYS n 
2 524 LYS n 
2 525 LEU n 
2 526 LEU n 
2 527 GLY n 
2 528 GLN n 
2 529 LYS n 
2 530 MET n 
2 531 PRO n 
2 532 LYS n 
2 533 LEU n 
2 534 ASN n 
2 535 VAL n 
2 536 GLU n 
2 537 VAL n 
2 538 ILE n 
2 539 ASP n 
2 540 GLU n 
2 541 ARG n 
2 542 GLY n 
2 543 ALA n 
2 544 PRO n 
2 545 ASP n 
2 546 SER n 
2 547 ARG n 
2 548 PRO n 
2 549 GLU n 
2 550 SER n 
2 551 CYS n 
2 552 PRO n 
2 553 VAL n 
2 554 GLU n 
2 555 ARG n 
2 556 VAL n 
2 557 PHE n 
2 558 ILE n 
2 559 TYR n 
2 560 ARG n 
2 561 THR n 
2 562 VAL n 
2 563 ALA n 
2 564 GLY n 
2 565 PRO n 
2 566 ARG n 
2 567 PHE n 
2 568 ASP n 
2 569 MET n 
2 570 PRO n 
2 571 GLY n 
2 572 PHE n 
2 573 VAL n 
2 574 TRP n 
2 575 ASN n 
2 576 MET n 
2 577 ASP n 
2 578 GLN n 
2 579 ASP n 
2 580 SER n 
2 581 THR n 
2 582 MET n 
2 583 ARG n 
2 584 PHE n 
2 585 SER n 
2 586 ARG n 
2 587 GLN n 
2 588 ILE n 
2 589 ILE n 
2 590 THR n 
2 591 THR n 
2 592 ASN n 
2 593 GLY n 
2 594 LEU n 
3 1   GLN n 
3 2   VAL n 
3 3   VAL n 
3 4   GLY n 
3 5   TRP n 
3 6   PRO n 
3 7   PRO n 
3 8   VAL n 
3 9   ARG n 
3 10  ASN n 
3 11  TYR n 
3 12  ARG n 
3 13  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'thale cress' Arabidopsis 'SKP1A, ASK1, SKP1, UIP1' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
2 1 sample ? ? ? 'thale cress' Arabidopsis 'TIR1, FBL1, WEI1'        ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'IAA7 peptide is synthesized from commercial source. It naturally occurs in Arabidopsis thaliana' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SKP1A_ARATH Q39255 1 
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE

;
1  ? 
2 UNP TIR1_ARATH  Q570C0 2 
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
1  ? 
3 UNP IAA7_ARATH  Q38825 3 QVVGWPPVRNYRK 82 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P1N A 1 ? 160 ? Q39255 1  ? 160 ? 1 160 
2 1 2P1N D 1 ? 160 ? Q39255 1  ? 160 ? 1 160 
3 2 2P1N B 1 ? 594 ? Q570C0 1  ? 594 ? 1 594 
4 2 2P1N E 1 ? 594 ? Q570C0 1  ? 594 ? 1 594 
5 3 2P1N C 1 ? 13  ? Q38825 82 ? 94  ? 1 13  
6 3 2P1N F 1 ? 13  ? Q38825 82 ? 94  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'     133.103 
CFA non-polymer         . '(2,4-DICHLOROPHENOXY)ACETIC ACID' '2,4-DICHLOROPHENOXYACETIC ACID' 'C8 H6 Cl2 O3'   221.037 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                              ? 'H2 O'           18.015  
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE'        
'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 'C6 H18 O24 P6'  660.035 
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2P1N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.04 
_exptl_crystal.density_percent_sol   59.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    
'100 mM BTP, 10% 14% PEG 20,000, 200 mM NaCl, and 5 mM DTT, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-02-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2P1N 
_reflns.observed_criterion_sigma_F   2 
_reflns.observed_criterion_sigma_I   2 
_reflns.d_resolution_high            2.5 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   61845 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        15.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   98.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.405 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2P1N 
_refine.ls_number_reflns_obs                     61845 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    90.51 
_refine.ls_R_factor_obs                          0.19863 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19458 
_refine.ls_R_factor_R_free                       0.27405 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3302 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               7.709 
_refine.aniso_B[1][1]                            0.82 
_refine.aniso_B[2][2]                            1.19 
_refine.aniso_B[3][3]                            -1.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.49 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2P1M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.469 
_refine.pdbx_overall_ESU_R_Free                  0.316 
_refine.overall_SU_ML                            0.210 
_refine.overall_SU_B                             18.042 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11250 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         98 
_refine_hist.number_atoms_solvent             524 
_refine_hist.number_atoms_total               11872 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.029  0.022  ? 11603 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.793  1.987  ? 15743 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       12.245 5.000  ? 1413  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.506 23.629 ? 496   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       24.518 15.000 ? 2040  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       24.877 15.000 ? 84    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.719  0.200  ? 1795  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 8596  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.309  0.200  ? 6066  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.359  0.200  ? 7693  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.219  0.200  ? 768   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.305  0.200  ? 68    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.189  0.200  ? 11    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  5.213  1.500  ? 7337  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.968  2.000  ? 11523 'X-RAY DIFFRACTION' ? 
r_scbond_it                  11.017 3.000  ? 4918  'X-RAY DIFFRACTION' ? 
r_scangle_it                 11.919 4.500  ? 4220  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1023 0.54 0.50 'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 B 4496 0.27 0.50 'medium positional' 2 'X-RAY DIFFRACTION' 2 ? ? ? 
1 C 114  0.40 0.50 'medium positional' 3 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1023 3.52 2.00 'medium thermal'    1 'X-RAY DIFFRACTION' 4 ? ? ? 
1 B 4496 3.31 2.00 'medium thermal'    2 'X-RAY DIFFRACTION' 5 ? ? ? 
1 C 114  3.87 2.00 'medium thermal'    3 'X-RAY DIFFRACTION' 6 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.565 
_refine_ls_shell.number_reflns_R_work             4049 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.percent_reflns_obs               80.07 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             186 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 D 
2 1 B 
2 2 E 
3 1 C 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 5 A 160 1 4 A LYS 5 ? A GLU 160 ? 1 ? 
2 D 5 D 160 1 4 D LYS 5 ? D GLU 160 ? 1 ? 
1 B 8 B 578 1 4 B SER 8 ? B GLN 578 ? 2 ? 
2 E 8 E 578 1 4 E SER 8 ? E GLN 578 ? 2 ? 
1 C 1 C 13  1 4 C GLN 1 ? C LYS 13  ? 3 ? 
2 F 1 F 13  1 4 F GLN 1 ? F LYS 13  ? 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  2P1N 
_struct.title                     'Mechanism of Auxin Perception by the TIR1 Ubiqutin Ligase' 
_struct.pdbx_descriptor           'SKP1-like protein 1A, TRANSPORT INHIBITOR RESPONSE 1 protein, Auxin-responsive protein IAA7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P1N 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'F-box, leucine rich repeat, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 19  ? GLU A 25  ? GLU A 19  GLU A 25  1 ? 7  
HELX_P HELX_P2  2  SER A 26  ? HIS A 31  ? SER A 26  HIS A 31  1 ? 6  
HELX_P HELX_P3  3  THR A 48  ? HIS A 62  ? THR A 48  HIS A 62  1 ? 15 
HELX_P HELX_P4  4  ASP A 94  ? LEU A 108 ? ASP A 94  LEU A 108 1 ? 15 
HELX_P HELX_P5  5  ILE A 110 ? LYS A 126 ? ILE A 110 LYS A 126 1 ? 17 
HELX_P HELX_P6  6  THR A 129 ? PHE A 137 ? THR A 129 PHE A 137 1 ? 9  
HELX_P HELX_P7  7  THR A 144 ? GLU A 160 ? THR A 144 GLU A 160 1 ? 17 
HELX_P HELX_P8  8  GLU B 12  ? SER B 19  ? GLU B 12  SER B 19  1 ? 8  
HELX_P HELX_P9  9  LEU B 23  ? SER B 31  ? LEU B 23  SER B 31  1 ? 9  
HELX_P HELX_P10 10 CYS B 34  ? ARG B 45  ? CYS B 34  ARG B 45  1 ? 12 
HELX_P HELX_P11 11 ASN B 52  ? VAL B 56  ? ASN B 52  VAL B 56  5 ? 5  
HELX_P HELX_P12 12 SER B 57  ? PHE B 65  ? SER B 57  PHE B 65  1 ? 9  
HELX_P HELX_P13 13 PRO B 77  ? ASN B 83  ? PRO B 77  ASN B 83  5 ? 7  
HELX_P HELX_P14 14 VAL B 93  ? TYR B 104 ? VAL B 93  TYR B 104 1 ? 12 
HELX_P HELX_P15 15 THR B 118 ? PHE B 129 ? THR B 118 PHE B 129 1 ? 12 
HELX_P HELX_P16 16 THR B 145 ? CYS B 155 ? THR B 145 CYS B 155 1 ? 11 
HELX_P HELX_P17 17 SER B 172 ? PHE B 179 ? SER B 172 PHE B 179 5 ? 8  
HELX_P HELX_P18 18 SER B 199 ? ARG B 209 ? SER B 199 ARG B 209 1 ? 11 
HELX_P HELX_P19 19 PRO B 223 ? GLU B 225 ? PRO B 223 GLU B 225 5 ? 3  
HELX_P HELX_P20 20 LYS B 226 ? ALA B 234 ? LYS B 226 ALA B 234 1 ? 9  
HELX_P HELX_P21 21 ARG B 250 ? GLY B 263 ? ARG B 250 GLY B 263 1 ? 14 
HELX_P HELX_P22 22 VAL B 277 ? LEU B 291 ? VAL B 277 LEU B 291 5 ? 15 
HELX_P HELX_P23 23 GLN B 302 ? CYS B 311 ? GLN B 302 CYS B 311 1 ? 10 
HELX_P HELX_P24 24 ILE B 325 ? CYS B 337 ? ILE B 325 CYS B 337 1 ? 13 
HELX_P HELX_P25 25 THR B 360 ? CYS B 371 ? THR B 360 CYS B 371 1 ? 12 
HELX_P HELX_P26 26 THR B 385 ? ARG B 396 ? THR B 385 ARG B 396 1 ? 12 
HELX_P HELX_P27 27 LEU B 420 ? CYS B 431 ? LEU B 420 CYS B 431 1 ? 12 
HELX_P HELX_P28 28 THR B 444 ? ALA B 455 ? THR B 444 ALA B 455 1 ? 12 
HELX_P HELX_P29 29 SER B 469 ? CYS B 480 ? SER B 469 CYS B 480 1 ? 12 
HELX_P HELX_P30 30 GLY B 494 ? ASN B 501 ? GLY B 494 ASN B 501 1 ? 8  
HELX_P HELX_P31 31 ALA B 502 ? MET B 508 ? ALA B 502 MET B 508 5 ? 7  
HELX_P HELX_P32 32 SER B 519 ? MET B 530 ? SER B 519 MET B 530 1 ? 12 
HELX_P HELX_P33 33 ALA B 543 ? ARG B 547 ? ALA B 543 ARG B 547 5 ? 5  
HELX_P HELX_P34 34 GLU D 19  ? GLU D 25  ? GLU D 19  GLU D 25  1 ? 7  
HELX_P HELX_P35 35 SER D 26  ? VAL D 33  ? SER D 26  VAL D 33  1 ? 8  
HELX_P HELX_P36 36 THR D 48  ? HIS D 62  ? THR D 48  HIS D 62  1 ? 15 
HELX_P HELX_P37 37 ASP D 94  ? ASN D 109 ? ASP D 94  ASN D 109 1 ? 16 
HELX_P HELX_P38 38 ILE D 110 ? LYS D 126 ? ILE D 110 LYS D 126 1 ? 17 
HELX_P HELX_P39 39 THR D 129 ? PHE D 137 ? THR D 129 PHE D 137 1 ? 9  
HELX_P HELX_P40 40 THR D 144 ? GLU D 160 ? THR D 144 GLU D 160 1 ? 17 
HELX_P HELX_P41 41 PRO E 10  ? SER E 19  ? PRO E 10  SER E 19  1 ? 10 
HELX_P HELX_P42 42 LEU E 23  ? SER E 31  ? LEU E 23  SER E 31  1 ? 9  
HELX_P HELX_P43 43 CYS E 34  ? ARG E 45  ? CYS E 34  ARG E 45  1 ? 12 
HELX_P HELX_P44 44 SER E 57  ? PHE E 65  ? SER E 57  PHE E 65  1 ? 9  
HELX_P HELX_P45 45 PRO E 77  ? ASN E 83  ? PRO E 77  ASN E 83  5 ? 7  
HELX_P HELX_P46 46 VAL E 93  ? TYR E 104 ? VAL E 93  TYR E 104 1 ? 12 
HELX_P HELX_P47 47 THR E 118 ? PHE E 129 ? THR E 118 PHE E 129 1 ? 12 
HELX_P HELX_P48 48 THR E 145 ? CYS E 155 ? THR E 145 CYS E 155 1 ? 11 
HELX_P HELX_P49 49 SER E 172 ? PHE E 179 ? SER E 172 PHE E 179 5 ? 8  
HELX_P HELX_P50 50 SER E 199 ? ARG E 209 ? SER E 199 ARG E 209 1 ? 11 
HELX_P HELX_P51 51 PRO E 223 ? ARG E 233 ? PRO E 223 ARG E 233 1 ? 11 
HELX_P HELX_P52 52 ARG E 250 ? GLY E 263 ? ARG E 250 GLY E 263 1 ? 14 
HELX_P HELX_P53 53 VAL E 277 ? ARG E 290 ? VAL E 277 ARG E 290 5 ? 14 
HELX_P HELX_P54 54 GLN E 302 ? CYS E 311 ? GLN E 302 CYS E 311 1 ? 10 
HELX_P HELX_P55 55 GLU E 326 ? CYS E 337 ? GLU E 326 CYS E 337 1 ? 12 
HELX_P HELX_P56 56 THR E 360 ? CYS E 371 ? THR E 360 CYS E 371 1 ? 12 
HELX_P HELX_P57 57 THR E 385 ? ARG E 396 ? THR E 385 ARG E 396 1 ? 12 
HELX_P HELX_P58 58 LEU E 420 ? CYS E 431 ? LEU E 420 CYS E 431 1 ? 12 
HELX_P HELX_P59 59 THR E 444 ? ALA E 455 ? THR E 444 ALA E 455 1 ? 12 
HELX_P HELX_P60 60 SER E 469 ? CYS E 480 ? SER E 469 CYS E 480 1 ? 12 
HELX_P HELX_P61 61 GLY E 494 ? ASN E 501 ? GLY E 494 ASN E 501 1 ? 8  
HELX_P HELX_P62 62 ALA E 502 ? MET E 508 ? ALA E 502 MET E 508 5 ? 7  
HELX_P HELX_P63 63 SER E 519 ? MET E 530 ? SER E 519 MET E 530 1 ? 12 
HELX_P HELX_P64 64 ALA E 543 ? ARG E 547 ? ALA E 543 ARG E 547 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 5 C . ? TRP 5 C PRO 6 C ? PRO 6 C 1 -1.04 
2 TRP 5 F . ? TRP 5 F PRO 6 F ? PRO 6 F 1 9.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 21 ? 
C ? 2  ? 
D ? 3  ? 
E ? 21 ? 
F ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? parallel      
B 2  3  ? parallel      
B 3  4  ? parallel      
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? parallel      
B 11 12 ? parallel      
B 12 13 ? parallel      
B 13 14 ? parallel      
B 14 15 ? parallel      
B 15 16 ? parallel      
B 16 17 ? parallel      
B 17 18 ? parallel      
B 18 19 ? anti-parallel 
B 19 20 ? anti-parallel 
B 20 21 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? anti-parallel 
D 2  3  ? parallel      
E 1  2  ? parallel      
E 2  3  ? parallel      
E 3  4  ? parallel      
E 4  5  ? parallel      
E 5  6  ? parallel      
E 6  7  ? parallel      
E 7  8  ? parallel      
E 8  9  ? parallel      
E 9  10 ? parallel      
E 10 11 ? parallel      
E 11 12 ? parallel      
E 12 13 ? parallel      
E 13 14 ? parallel      
E 14 15 ? parallel      
E 15 16 ? parallel      
E 16 17 ? parallel      
E 17 18 ? parallel      
E 18 19 ? anti-parallel 
E 19 20 ? anti-parallel 
E 20 21 ? anti-parallel 
F 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  SER A 15  ? VAL A 18  ? SER A 15  VAL A 18  
A 2  ILE A 6   ? LYS A 9   ? ILE A 6   LYS A 9   
A 3  VAL A 42  ? PRO A 43  ? VAL A 42  PRO A 43  
B 1  LYS B 47  ? ILE B 50  ? LYS B 47  ILE B 50  
B 2  SER B 70  ? LYS B 74  ? SER B 70  LYS B 74  
B 3  GLU B 109 ? LYS B 113 ? GLU B 109 LYS B 113 
B 4  VAL B 134 ? SER B 138 ? VAL B 134 SER B 138 
B 5  GLU B 160 ? ASP B 162 ? GLU B 160 ASP B 162 
B 6  SER B 188 ? ASN B 190 ? SER B 188 ASN B 190 
B 7  SER B 215 ? LYS B 217 ? SER B 215 LYS B 217 
B 8  GLU B 239 ? GLY B 241 ? GLU B 239 GLY B 241 
B 9  CYS B 269 ? SER B 271 ? CYS B 269 SER B 271 
B 10 THR B 293 ? LEU B 296 ? THR B 293 LEU B 296 
B 11 ARG B 318 ? LEU B 322 ? ARG B 318 LEU B 322 
B 12 GLU B 342 ? PHE B 346 ? GLU B 342 PHE B 346 
B 13 SER B 376 ? CYS B 381 ? SER B 376 CYS B 381 
B 14 ARG B 401 ? ILE B 406 ? ARG B 401 ILE B 406 
B 15 ARG B 436 ? SER B 438 ? ARG B 436 SER B 438 
B 16 MET B 460 ? ALA B 464 ? MET B 460 ALA B 464 
B 17 LYS B 485 ? ARG B 489 ? LYS B 485 ARG B 489 
B 18 SER B 510 ? SER B 514 ? SER B 510 SER B 514 
B 19 ARG B 555 ? ARG B 560 ? ARG B 555 ARG B 560 
B 20 LEU B 533 ? ILE B 538 ? LEU B 533 ILE B 538 
B 21 VAL B 573 ? ASN B 575 ? VAL B 573 ASN B 575 
C 1  GLU B 141 ? SER B 144 ? GLU B 141 SER B 144 
C 2  ASP B 167 ? ASP B 169 ? ASP B 167 ASP B 169 
D 1  SER D 15  ? VAL D 18  ? SER D 15  VAL D 18  
D 2  ILE D 6   ? LYS D 9   ? ILE D 6   LYS D 9   
D 3  VAL D 42  ? PRO D 43  ? VAL D 42  PRO D 43  
E 1  LYS E 47  ? ILE E 50  ? LYS E 47  ILE E 50  
E 2  SER E 70  ? LYS E 74  ? SER E 70  LYS E 74  
E 3  GLU E 109 ? LYS E 113 ? GLU E 109 LYS E 113 
E 4  VAL E 134 ? SER E 138 ? VAL E 134 SER E 138 
E 5  GLU E 160 ? ASP E 162 ? GLU E 160 ASP E 162 
E 6  SER E 188 ? ASN E 190 ? SER E 188 ASN E 190 
E 7  SER E 215 ? LYS E 217 ? SER E 215 LYS E 217 
E 8  GLU E 239 ? GLY E 241 ? GLU E 239 GLY E 241 
E 9  CYS E 269 ? SER E 271 ? CYS E 269 SER E 271 
E 10 THR E 293 ? ASN E 295 ? THR E 293 ASN E 295 
E 11 ARG E 318 ? LEU E 322 ? ARG E 318 LEU E 322 
E 12 GLU E 342 ? PHE E 346 ? GLU E 342 PHE E 346 
E 13 SER E 376 ? CYS E 381 ? SER E 376 CYS E 381 
E 14 ARG E 401 ? ILE E 406 ? ARG E 401 ILE E 406 
E 15 ARG E 436 ? SER E 438 ? ARG E 436 SER E 438 
E 16 MET E 460 ? ALA E 464 ? MET E 460 ALA E 464 
E 17 LYS E 485 ? ARG E 489 ? LYS E 485 ARG E 489 
E 18 SER E 510 ? SER E 514 ? SER E 510 SER E 514 
E 19 ARG E 555 ? ARG E 560 ? ARG E 555 ARG E 560 
E 20 LEU E 533 ? ILE E 538 ? LEU E 533 ILE E 538 
E 21 VAL E 573 ? ASN E 575 ? VAL E 573 ASN E 575 
F 1  GLU E 141 ? SER E 144 ? GLU E 141 SER E 144 
F 2  ASP E 167 ? ASP E 169 ? ASP E 167 ASP E 169 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O PHE A 16  ? O PHE A 16  N LEU A 8   ? N LEU A 8   
A 2  3  N LYS A 9   ? N LYS A 9   O VAL A 42  ? O VAL A 42  
B 1  2  N ILE B 50  ? N ILE B 50  O GLU B 72  ? O GLU B 72  
B 2  3  N VAL B 71  ? N VAL B 71  O GLU B 109 ? O GLU B 109 
B 3  4  N LEU B 112 ? N LEU B 112 O VAL B 136 ? O VAL B 136 
B 4  5  N LEU B 137 ? N LEU B 137 O ASP B 162 ? O ASP B 162 
B 5  6  N LEU B 161 ? N LEU B 161 O SER B 188 ? O SER B 188 
B 6  7  N LEU B 189 ? N LEU B 189 O LYS B 217 ? O LYS B 217 
B 7  8  N LEU B 216 ? N LEU B 216 O GLY B 241 ? O GLY B 241 
B 8  9  N LEU B 240 ? N LEU B 240 O CYS B 269 ? O CYS B 269 
B 9  10 N LEU B 270 ? N LEU B 270 O ASN B 295 ? O ASN B 295 
B 10 11 N LEU B 296 ? N LEU B 296 O TRP B 320 ? O TRP B 320 
B 11 12 N LEU B 319 ? N LEU B 319 O ARG B 344 ? O ARG B 344 
B 12 13 N VAL B 345 ? N VAL B 345 O LEU B 378 ? O LEU B 378 
B 13 14 N VAL B 377 ? N VAL B 377 O ARG B 401 ? O ARG B 401 
B 14 15 N PHE B 402 ? N PHE B 402 O ARG B 436 ? O ARG B 436 
B 15 16 N LEU B 437 ? N LEU B 437 O MET B 460 ? O MET B 460 
B 16 17 N VAL B 463 ? N VAL B 463 O GLU B 487 ? O GLU B 487 
B 17 18 N ILE B 488 ? N ILE B 488 O TRP B 512 ? O TRP B 512 
B 18 19 N LEU B 511 ? N LEU B 511 O ILE B 558 ? O ILE B 558 
B 19 20 O ARG B 555 ? O ARG B 555 N ILE B 538 ? N ILE B 538 
B 20 21 N VAL B 537 ? N VAL B 537 O TRP B 574 ? O TRP B 574 
C 1  2  N PHE B 143 ? N PHE B 143 O ASP B 169 ? O ASP B 169 
D 1  2  O PHE D 16  ? O PHE D 16  N LEU D 8   ? N LEU D 8   
D 2  3  N LYS D 9   ? N LYS D 9   O VAL D 42  ? O VAL D 42  
E 1  2  N VAL E 48  ? N VAL E 48  O SER E 70  ? O SER E 70  
E 2  3  N LEU E 73  ? N LEU E 73  O ARG E 111 ? O ARG E 111 
E 3  4  N ILE E 110 ? N ILE E 110 O VAL E 134 ? O VAL E 134 
E 4  5  N LEU E 137 ? N LEU E 137 O ASP E 162 ? O ASP E 162 
E 5  6  N LEU E 161 ? N LEU E 161 O ASN E 190 ? O ASN E 190 
E 6  7  N LEU E 189 ? N LEU E 189 O SER E 215 ? O SER E 215 
E 7  8  N LEU E 216 ? N LEU E 216 O GLY E 241 ? O GLY E 241 
E 8  9  N LEU E 240 ? N LEU E 240 O CYS E 269 ? O CYS E 269 
E 9  10 N LEU E 270 ? N LEU E 270 O ASN E 295 ? O ASN E 295 
E 10 11 N LEU E 294 ? N LEU E 294 O ARG E 318 ? O ARG E 318 
E 11 12 N LEU E 319 ? N LEU E 319 O ARG E 344 ? O ARG E 344 
E 12 13 N LEU E 343 ? N LEU E 343 O LEU E 378 ? O LEU E 378 
E 13 14 N VAL E 377 ? N VAL E 377 O ARG E 403 ? O ARG E 403 
E 14 15 N PHE E 402 ? N PHE E 402 O ARG E 436 ? O ARG E 436 
E 15 16 N LEU E 437 ? N LEU E 437 O SER E 462 ? O SER E 462 
E 16 17 N VAL E 463 ? N VAL E 463 O GLU E 487 ? O GLU E 487 
E 17 18 N LEU E 486 ? N LEU E 486 O TRP E 512 ? O TRP E 512 
E 18 19 N MET E 513 ? N MET E 513 O VAL E 556 ? O VAL E 556 
E 19 20 O PHE E 557 ? O PHE E 557 N GLU E 536 ? N GLU E 536 
E 20 21 N VAL E 537 ? N VAL E 537 O TRP E 574 ? O TRP E 574 
F 1  2  N PHE E 143 ? N PHE E 143 O ASP E 169 ? O ASP E 169 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B IHP 601 ? 14 'BINDING SITE FOR RESIDUE IHP B 601' 
AC2 Software E IHP 601 ? 16 'BINDING SITE FOR RESIDUE IHP E 601' 
AC3 Software B CFA 602 ? 11 'BINDING SITE FOR RESIDUE CFA B 602' 
AC4 Software E CFA 602 ? 11 'BINDING SITE FOR RESIDUE CFA E 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LYS B 74  ? LYS B 74  . ? 1_555 ? 
2  AC1 14 HIS B 78  ? HIS B 78  . ? 1_555 ? 
3  AC1 14 LYS B 113 ? LYS B 113 . ? 1_555 ? 
4  AC1 14 ARG B 114 ? ARG B 114 . ? 1_555 ? 
5  AC1 14 ARG B 344 ? ARG B 344 . ? 1_555 ? 
6  AC1 14 ARG B 401 ? ARG B 401 . ? 1_555 ? 
7  AC1 14 ARG B 403 ? ARG B 403 . ? 1_555 ? 
8  AC1 14 ARG B 436 ? ARG B 436 . ? 1_555 ? 
9  AC1 14 MET B 460 ? MET B 460 . ? 1_555 ? 
10 AC1 14 ARG B 484 ? ARG B 484 . ? 1_555 ? 
11 AC1 14 LYS B 485 ? LYS B 485 . ? 1_555 ? 
12 AC1 14 ARG B 509 ? ARG B 509 . ? 1_555 ? 
13 AC1 14 HOH L .   ? HOH B 634 . ? 1_555 ? 
14 AC1 14 HOH L .   ? HOH B 638 . ? 1_555 ? 
15 AC2 16 PHE E 49  ? PHE E 49  . ? 1_555 ? 
16 AC2 16 LYS E 74  ? LYS E 74  . ? 1_555 ? 
17 AC2 16 HIS E 78  ? HIS E 78  . ? 1_555 ? 
18 AC2 16 LYS E 113 ? LYS E 113 . ? 1_555 ? 
19 AC2 16 ARG E 114 ? ARG E 114 . ? 1_555 ? 
20 AC2 16 ARG E 344 ? ARG E 344 . ? 1_555 ? 
21 AC2 16 ARG E 401 ? ARG E 401 . ? 1_555 ? 
22 AC2 16 ARG E 403 ? ARG E 403 . ? 1_555 ? 
23 AC2 16 ARG E 435 ? ARG E 435 . ? 1_555 ? 
24 AC2 16 ARG E 436 ? ARG E 436 . ? 1_555 ? 
25 AC2 16 ARG E 484 ? ARG E 484 . ? 1_555 ? 
26 AC2 16 LYS E 485 ? LYS E 485 . ? 1_555 ? 
27 AC2 16 ARG E 509 ? ARG E 509 . ? 1_555 ? 
28 AC2 16 HOH O .   ? HOH E 791 . ? 1_555 ? 
29 AC2 16 HOH O .   ? HOH E 811 . ? 1_555 ? 
30 AC2 16 HOH O .   ? HOH E 818 . ? 1_555 ? 
31 AC3 11 PHE B 79  ? PHE B 79  . ? 1_555 ? 
32 AC3 11 LEU B 378 ? LEU B 378 . ? 1_555 ? 
33 AC3 11 ARG B 403 ? ARG B 403 . ? 1_555 ? 
34 AC3 11 LEU B 404 ? LEU B 404 . ? 1_555 ? 
35 AC3 11 CYS B 405 ? CYS B 405 . ? 1_555 ? 
36 AC3 11 SER B 438 ? SER B 438 . ? 1_555 ? 
37 AC3 11 LEU B 439 ? LEU B 439 . ? 1_555 ? 
38 AC3 11 VAL B 463 ? VAL B 463 . ? 1_555 ? 
39 AC3 11 HOH L .   ? HOH B 603 . ? 1_555 ? 
40 AC3 11 HOH L .   ? HOH B 659 . ? 1_555 ? 
41 AC3 11 PRO C 7   ? PRO C 7   . ? 1_555 ? 
42 AC4 11 PHE E 79  ? PHE E 79  . ? 1_555 ? 
43 AC4 11 LEU E 378 ? LEU E 378 . ? 1_555 ? 
44 AC4 11 ARG E 403 ? ARG E 403 . ? 1_555 ? 
45 AC4 11 LEU E 404 ? LEU E 404 . ? 1_555 ? 
46 AC4 11 CYS E 405 ? CYS E 405 . ? 1_555 ? 
47 AC4 11 SER E 438 ? SER E 438 . ? 1_555 ? 
48 AC4 11 LEU E 439 ? LEU E 439 . ? 1_555 ? 
49 AC4 11 VAL E 463 ? VAL E 463 . ? 1_555 ? 
50 AC4 11 HOH O .   ? HOH E 617 . ? 1_555 ? 
51 AC4 11 HOH O .   ? HOH E 633 . ? 1_555 ? 
52 AC4 11 PRO F 7   ? PRO F 7   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2P1N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2P1N 
_atom_sites.fract_transf_matrix[1][1]   0.009740 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001788 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012085 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008083 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1 5   ? -42.024 -56.435 -23.328  1.00 2.00  ? 5   LYS A N     1 
ATOM   2     C  CA    . LYS A 1 5   ? -41.160 -56.389 -24.497  1.00 6.84  ? 5   LYS A CA    1 
ATOM   3     C  C     . LYS A 1 5   ? -41.942 -56.421 -25.799  1.00 16.72 ? 5   LYS A C     1 
ATOM   4     O  O     . LYS A 1 5   ? -42.897 -57.178 -25.936  1.00 16.85 ? 5   LYS A O     1 
ATOM   5     C  CB    . LYS A 1 5   ? -40.160 -57.532 -24.465  1.00 4.90  ? 5   LYS A CB    1 
ATOM   6     C  CG    . LYS A 1 5   ? -39.566 -57.779 -23.114  1.00 19.26 ? 5   LYS A CG    1 
ATOM   7     C  CD    . LYS A 1 5   ? -38.213 -57.142 -22.992  1.00 18.88 ? 5   LYS A CD    1 
ATOM   8     C  CE    . LYS A 1 5   ? -37.724 -57.217 -21.570  1.00 26.23 ? 5   LYS A CE    1 
ATOM   9     N  NZ    . LYS A 1 5   ? -38.590 -58.112 -20.767  1.00 7.61  ? 5   LYS A NZ    1 
ATOM   10    N  N     . ILE A 1 6   ? -41.530 -55.591 -26.752  1.00 17.51 ? 6   ILE A N     1 
ATOM   11    C  CA    . ILE A 1 6   ? -41.848 -55.805 -28.156  1.00 8.37  ? 6   ILE A CA    1 
ATOM   12    C  C     . ILE A 1 6   ? -40.602 -56.302 -28.867  1.00 6.83  ? 6   ILE A C     1 
ATOM   13    O  O     . ILE A 1 6   ? -39.493 -55.992 -28.455  1.00 5.65  ? 6   ILE A O     1 
ATOM   14    C  CB    . ILE A 1 6   ? -42.343 -54.489 -28.795  1.00 2.00  ? 6   ILE A CB    1 
ATOM   15    C  CG1   . ILE A 1 6   ? -43.751 -54.153 -28.315  1.00 2.00  ? 6   ILE A CG1   1 
ATOM   16    C  CG2   . ILE A 1 6   ? -42.327 -54.574 -30.301  1.00 2.00  ? 6   ILE A CG2   1 
ATOM   17    C  CD1   . ILE A 1 6   ? -43.817 -52.981 -27.385  1.00 2.00  ? 6   ILE A CD1   1 
ATOM   18    N  N     . VAL A 1 7   ? -40.776 -57.077 -29.930  1.00 2.46  ? 7   VAL A N     1 
ATOM   19    C  CA    . VAL A 1 7   ? -39.671 -57.304 -30.844  1.00 3.62  ? 7   VAL A CA    1 
ATOM   20    C  C     . VAL A 1 7   ? -39.791 -56.591 -32.173  1.00 9.71  ? 7   VAL A C     1 
ATOM   21    O  O     . VAL A 1 7   ? -40.876 -56.435 -32.716  1.00 10.09 ? 7   VAL A O     1 
ATOM   22    C  CB    . VAL A 1 7   ? -39.328 -58.798 -31.062  1.00 15.14 ? 7   VAL A CB    1 
ATOM   23    C  CG1   . VAL A 1 7   ? -39.526 -59.603 -29.797  1.00 2.00  ? 7   VAL A CG1   1 
ATOM   24    C  CG2   . VAL A 1 7   ? -40.110 -59.377 -32.220  1.00 8.78  ? 7   VAL A CG2   1 
ATOM   25    N  N     . LEU A 1 8   ? -38.647 -56.166 -32.687  1.00 2.00  ? 8   LEU A N     1 
ATOM   26    C  CA    . LEU A 1 8   ? -38.599 -55.365 -33.847  1.00 4.27  ? 8   LEU A CA    1 
ATOM   27    C  C     . LEU A 1 8   ? -37.709 -56.054 -34.866  1.00 8.86  ? 8   LEU A C     1 
ATOM   28    O  O     . LEU A 1 8   ? -36.592 -56.496 -34.550  1.00 2.00  ? 8   LEU A O     1 
ATOM   29    C  CB    . LEU A 1 8   ? -38.096 -53.943 -33.508  1.00 11.63 ? 8   LEU A CB    1 
ATOM   30    C  CG    . LEU A 1 8   ? -38.882 -53.092 -32.472  1.00 9.73  ? 8   LEU A CG    1 
ATOM   31    C  CD1   . LEU A 1 8   ? -38.160 -51.785 -32.116  1.00 2.00  ? 8   LEU A CD1   1 
ATOM   32    C  CD2   . LEU A 1 8   ? -40.328 -52.844 -32.879  1.00 2.00  ? 8   LEU A CD2   1 
ATOM   33    N  N     . LYS A 1 9   ? -38.227 -56.122 -36.086  1.00 4.40  ? 9   LYS A N     1 
ATOM   34    C  CA    . LYS A 1 9   ? -37.601 -56.832 -37.182  1.00 9.36  ? 9   LYS A CA    1 
ATOM   35    C  C     . LYS A 1 9   ? -36.992 -55.852 -38.178  1.00 2.14  ? 9   LYS A C     1 
ATOM   36    O  O     . LYS A 1 9   ? -37.693 -55.227 -38.955  1.00 2.00  ? 9   LYS A O     1 
ATOM   37    C  CB    . LYS A 1 9   ? -38.629 -57.725 -37.873  1.00 3.55  ? 9   LYS A CB    1 
ATOM   38    C  CG    . LYS A 1 9   ? -38.190 -59.167 -38.065  1.00 23.63 ? 9   LYS A CG    1 
ATOM   39    C  CD    . LYS A 1 9   ? -39.055 -59.881 -39.104  1.00 19.15 ? 9   LYS A CD    1 
ATOM   40    C  CE    . LYS A 1 9   ? -39.474 -61.272 -38.645  1.00 22.31 ? 9   LYS A CE    1 
ATOM   41    N  NZ    . LYS A 1 9   ? -39.865 -61.315 -37.214  1.00 2.00  ? 9   LYS A NZ    1 
ATOM   42    N  N     . SER A 1 10  ? -35.673 -55.734 -38.144  1.00 2.00  ? 10  SER A N     1 
ATOM   43    C  CA    . SER A 1 10  ? -34.942 -54.934 -39.107  1.00 2.00  ? 10  SER A CA    1 
ATOM   44    C  C     . SER A 1 10  ? -35.434 -55.165 -40.523  1.00 2.00  ? 10  SER A C     1 
ATOM   45    O  O     . SER A 1 10  ? -36.370 -55.913 -40.742  1.00 3.10  ? 10  SER A O     1 
ATOM   46    C  CB    . SER A 1 10  ? -33.446 -55.205 -38.996  1.00 2.00  ? 10  SER A CB    1 
ATOM   47    O  OG    . SER A 1 10  ? -33.053 -56.288 -39.807  1.00 2.00  ? 10  SER A OG    1 
ATOM   48    N  N     . SER A 1 11  ? -34.809 -54.498 -41.481  1.00 3.65  ? 11  SER A N     1 
ATOM   49    C  CA    . SER A 1 11  ? -35.071 -54.757 -42.889  1.00 2.78  ? 11  SER A CA    1 
ATOM   50    C  C     . SER A 1 11  ? -34.253 -55.950 -43.327  1.00 3.22  ? 11  SER A C     1 
ATOM   51    O  O     . SER A 1 11  ? -34.391 -56.448 -44.435  1.00 2.00  ? 11  SER A O     1 
ATOM   52    C  CB    . SER A 1 11  ? -34.715 -53.536 -43.732  1.00 2.00  ? 11  SER A CB    1 
ATOM   53    O  OG    . SER A 1 11  ? -33.326 -53.465 -43.976  1.00 3.17  ? 11  SER A OG    1 
ATOM   54    N  N     . ASP A 1 12  ? -33.393 -56.393 -42.426  1.00 2.00  ? 12  ASP A N     1 
ATOM   55    C  CA    . ASP A 1 12  ? -32.335 -57.365 -42.740  1.00 2.00  ? 12  ASP A CA    1 
ATOM   56    C  C     . ASP A 1 12  ? -32.851 -58.732 -42.212  1.00 2.68  ? 12  ASP A C     1 
ATOM   57    O  O     . ASP A 1 12  ? -32.336 -59.782 -42.525  1.00 2.00  ? 12  ASP A O     1 
ATOM   58    C  CB    . ASP A 1 12  ? -31.042 -57.008 -41.966  1.00 5.33  ? 12  ASP A CB    1 
ATOM   59    C  CG    . ASP A 1 12  ? -30.222 -55.855 -42.602  1.00 2.00  ? 12  ASP A CG    1 
ATOM   60    O  OD1   . ASP A 1 12  ? -30.027 -55.877 -43.826  1.00 2.00  ? 12  ASP A OD1   1 
ATOM   61    O  OD2   . ASP A 1 12  ? -29.740 -54.936 -41.869  1.00 4.86  ? 12  ASP A OD2   1 
ATOM   62    N  N     . GLY A 1 13  ? -33.892 -58.689 -41.398  1.00 4.60  ? 13  GLY A N     1 
ATOM   63    C  CA    . GLY A 1 13  ? -34.682 -59.857 -41.116  1.00 2.00  ? 13  GLY A CA    1 
ATOM   64    C  C     . GLY A 1 13  ? -34.354 -60.329 -39.713  1.00 9.00  ? 13  GLY A C     1 
ATOM   65    O  O     . GLY A 1 13  ? -34.887 -61.371 -39.279  1.00 7.99  ? 13  GLY A O     1 
ATOM   66    N  N     . GLU A 1 14  ? -33.477 -59.575 -39.013  1.00 7.74  ? 14  GLU A N     1 
ATOM   67    C  CA    . GLU A 1 14  ? -33.042 -59.909 -37.629  1.00 6.41  ? 14  GLU A CA    1 
ATOM   68    C  C     . GLU A 1 14  ? -33.806 -59.203 -36.565  1.00 2.38  ? 14  GLU A C     1 
ATOM   69    O  O     . GLU A 1 14  ? -34.470 -58.216 -36.821  1.00 5.65  ? 14  GLU A O     1 
ATOM   70    C  CB    . GLU A 1 14  ? -31.590 -59.586 -37.375  1.00 2.00  ? 14  GLU A CB    1 
ATOM   71    C  CG    . GLU A 1 14  ? -30.754 -59.650 -38.581  1.00 2.00  ? 14  GLU A CG    1 
ATOM   72    C  CD    . GLU A 1 14  ? -29.340 -59.357 -38.201  1.00 3.37  ? 14  GLU A CD    1 
ATOM   73    O  OE1   . GLU A 1 14  ? -28.557 -60.307 -37.919  1.00 5.20  ? 14  GLU A OE1   1 
ATOM   74    O  OE2   . GLU A 1 14  ? -29.009 -58.157 -38.150  1.00 5.38  ? 14  GLU A OE2   1 
ATOM   75    N  N     . SER A 1 15  ? -33.696 -59.711 -35.358  1.00 2.00  ? 15  SER A N     1 
ATOM   76    C  CA    . SER A 1 15  ? -34.733 -59.463 -34.404  1.00 2.00  ? 15  SER A CA    1 
ATOM   77    C  C     . SER A 1 15  ? -34.219 -58.837 -33.138  1.00 2.00  ? 15  SER A C     1 
ATOM   78    O  O     . SER A 1 15  ? -33.242 -59.329 -32.524  1.00 6.57  ? 15  SER A O     1 
ATOM   79    C  CB    . SER A 1 15  ? -35.522 -60.723 -34.050  1.00 2.00  ? 15  SER A CB    1 
ATOM   80    O  OG    . SER A 1 15  ? -36.813 -60.716 -34.642  1.00 3.58  ? 15  SER A OG    1 
ATOM   81    N  N     . PHE A 1 16  ? -34.948 -57.783 -32.738  1.00 2.37  ? 16  PHE A N     1 
ATOM   82    C  CA    . PHE A 1 16  ? -34.607 -56.870 -31.665  1.00 2.22  ? 16  PHE A CA    1 
ATOM   83    C  C     . PHE A 1 16  ? -35.696 -56.952 -30.651  1.00 5.59  ? 16  PHE A C     1 
ATOM   84    O  O     . PHE A 1 16  ? -36.871 -56.697 -30.974  1.00 6.95  ? 16  PHE A O     1 
ATOM   85    C  CB    . PHE A 1 16  ? -34.496 -55.461 -32.228  1.00 2.00  ? 16  PHE A CB    1 
ATOM   86    C  CG    . PHE A 1 16  ? -33.258 -55.248 -33.111  1.00 4.47  ? 16  PHE A CG    1 
ATOM   87    C  CD1   . PHE A 1 16  ? -33.256 -55.660 -34.447  1.00 2.00  ? 16  PHE A CD1   1 
ATOM   88    C  CD2   . PHE A 1 16  ? -32.109 -54.646 -32.593  1.00 2.00  ? 16  PHE A CD2   1 
ATOM   89    C  CE1   . PHE A 1 16  ? -32.130 -55.447 -35.244  1.00 2.00  ? 16  PHE A CE1   1 
ATOM   90    C  CE2   . PHE A 1 16  ? -30.991 -54.425 -33.384  1.00 2.00  ? 16  PHE A CE2   1 
ATOM   91    C  CZ    . PHE A 1 16  ? -30.997 -54.831 -34.710  1.00 2.00  ? 16  PHE A CZ    1 
ATOM   92    N  N     . GLU A 1 17  ? -35.326 -57.368 -29.446  1.00 2.00  ? 17  GLU A N     1 
ATOM   93    C  CA    . GLU A 1 17  ? -36.239 -57.250 -28.296  1.00 7.38  ? 17  GLU A CA    1 
ATOM   94    C  C     . GLU A 1 17  ? -35.903 -56.085 -27.362  1.00 13.39 ? 17  GLU A C     1 
ATOM   95    O  O     . GLU A 1 17  ? -34.767 -56.020 -26.770  1.00 12.33 ? 17  GLU A O     1 
ATOM   96    C  CB    . GLU A 1 17  ? -36.256 -58.548 -27.474  1.00 7.42  ? 17  GLU A CB    1 
ATOM   97    C  CG    . GLU A 1 17  ? -37.551 -58.868 -26.739  1.00 2.00  ? 17  GLU A CG    1 
ATOM   98    C  CD    . GLU A 1 17  ? -37.385 -60.053 -25.760  1.00 19.10 ? 17  GLU A CD    1 
ATOM   99    O  OE1   . GLU A 1 17  ? -36.209 -60.390 -25.437  1.00 3.19  ? 17  GLU A OE1   1 
ATOM   100   O  OE2   . GLU A 1 17  ? -38.419 -60.651 -25.316  1.00 11.75 ? 17  GLU A OE2   1 
ATOM   101   N  N     . VAL A 1 18  ? -36.897 -55.193 -27.199  1.00 7.13  ? 18  VAL A N     1 
ATOM   102   C  CA    . VAL A 1 18  ? -36.733 -53.915 -26.416  1.00 3.04  ? 18  VAL A CA    1 
ATOM   103   C  C     . VAL A 1 18  ? -37.853 -53.908 -25.452  1.00 2.00  ? 18  VAL A C     1 
ATOM   104   O  O     . VAL A 1 18  ? -38.908 -54.322 -25.813  1.00 2.00  ? 18  VAL A O     1 
ATOM   105   C  CB    . VAL A 1 18  ? -36.941 -52.646 -27.283  1.00 2.00  ? 18  VAL A CB    1 
ATOM   106   C  CG1   . VAL A 1 18  ? -35.699 -52.388 -28.121  1.00 2.00  ? 18  VAL A CG1   1 
ATOM   107   C  CG2   . VAL A 1 18  ? -38.115 -52.815 -28.166  1.00 2.00  ? 18  VAL A CG2   1 
ATOM   108   N  N     . GLU A 1 19  ? -37.673 -53.426 -24.233  1.00 7.46  ? 19  GLU A N     1 
ATOM   109   C  CA    . GLU A 1 19  ? -38.869 -53.317 -23.424  1.00 11.86 ? 19  GLU A CA    1 
ATOM   110   C  C     . GLU A 1 19  ? -39.910 -52.265 -23.836  1.00 11.26 ? 19  GLU A C     1 
ATOM   111   O  O     . GLU A 1 19  ? -39.635 -51.381 -24.651  1.00 6.71  ? 19  GLU A O     1 
ATOM   112   C  CB    . GLU A 1 19  ? -38.611 -53.378 -21.929  1.00 18.82 ? 19  GLU A CB    1 
ATOM   113   C  CG    . GLU A 1 19  ? -37.178 -53.296 -21.569  1.00 16.61 ? 19  GLU A CG    1 
ATOM   114   C  CD    . GLU A 1 19  ? -36.926 -52.046 -20.779  1.00 23.35 ? 19  GLU A CD    1 
ATOM   115   O  OE1   . GLU A 1 19  ? -37.688 -51.798 -19.818  1.00 13.48 ? 19  GLU A OE1   1 
ATOM   116   O  OE2   . GLU A 1 19  ? -35.993 -51.299 -21.134  1.00 23.23 ? 19  GLU A OE2   1 
ATOM   117   N  N     . GLU A 1 20  ? -41.112 -52.415 -23.277  1.00 12.35 ? 20  GLU A N     1 
ATOM   118   C  CA    . GLU A 1 20  ? -42.370 -51.831 -23.783  1.00 16.53 ? 20  GLU A CA    1 
ATOM   119   C  C     . GLU A 1 20  ? -42.299 -50.282 -24.114  1.00 9.34  ? 20  GLU A C     1 
ATOM   120   O  O     . GLU A 1 20  ? -42.759 -49.846 -25.177  1.00 2.00  ? 20  GLU A O     1 
ATOM   121   C  CB    . GLU A 1 20  ? -43.558 -52.301 -22.866  1.00 17.64 ? 20  GLU A CB    1 
ATOM   122   C  CG    . GLU A 1 20  ? -43.990 -53.894 -23.025  1.00 37.68 ? 20  GLU A CG    1 
ATOM   123   C  CD    . GLU A 1 20  ? -43.301 -55.041 -22.105  1.00 36.81 ? 20  GLU A CD    1 
ATOM   124   O  OE1   . GLU A 1 20  ? -42.109 -55.429 -22.331  1.00 8.08  ? 20  GLU A OE1   1 
ATOM   125   O  OE2   . GLU A 1 20  ? -44.006 -55.625 -21.219  1.00 2.00  ? 20  GLU A OE2   1 
ATOM   126   N  N     . ALA A 1 21  ? -41.643 -49.483 -23.252  1.00 15.56 ? 21  ALA A N     1 
ATOM   127   C  CA    . ALA A 1 21  ? -41.574 -47.997 -23.393  1.00 9.75  ? 21  ALA A CA    1 
ATOM   128   C  C     . ALA A 1 21  ? -40.561 -47.544 -24.430  1.00 7.68  ? 21  ALA A C     1 
ATOM   129   O  O     . ALA A 1 21  ? -40.779 -46.560 -25.173  1.00 5.92  ? 21  ALA A O     1 
ATOM   130   C  CB    . ALA A 1 21  ? -41.301 -47.297 -22.028  1.00 2.60  ? 21  ALA A CB    1 
ATOM   131   N  N     . VAL A 1 22  ? -39.446 -48.260 -24.499  1.00 4.19  ? 22  VAL A N     1 
ATOM   132   C  CA    . VAL A 1 22  ? -38.502 -48.052 -25.588  1.00 2.00  ? 22  VAL A CA    1 
ATOM   133   C  C     . VAL A 1 22  ? -39.187 -48.175 -26.986  1.00 2.67  ? 22  VAL A C     1 
ATOM   134   O  O     . VAL A 1 22  ? -39.015 -47.341 -27.859  1.00 4.93  ? 22  VAL A O     1 
ATOM   135   C  CB    . VAL A 1 22  ? -37.295 -48.976 -25.397  1.00 2.00  ? 22  VAL A CB    1 
ATOM   136   C  CG1   . VAL A 1 22  ? -36.303 -48.867 -26.518  1.00 2.00  ? 22  VAL A CG1   1 
ATOM   137   C  CG2   . VAL A 1 22  ? -36.656 -48.647 -24.091  1.00 2.00  ? 22  VAL A CG2   1 
ATOM   138   N  N     . ALA A 1 23  ? -39.978 -49.196 -27.244  1.00 2.20  ? 23  ALA A N     1 
ATOM   139   C  CA    . ALA A 1 23  ? -40.430 -49.311 -28.624  1.00 10.34 ? 23  ALA A CA    1 
ATOM   140   C  C     . ALA A 1 23  ? -41.392 -48.149 -28.969  1.00 10.19 ? 23  ALA A C     1 
ATOM   141   O  O     . ALA A 1 23  ? -41.609 -47.818 -30.161  1.00 5.97  ? 23  ALA A O     1 
ATOM   142   C  CB    . ALA A 1 23  ? -41.070 -50.716 -28.900  1.00 6.08  ? 23  ALA A CB    1 
ATOM   143   N  N     . LEU A 1 24  ? -41.961 -47.558 -27.918  1.00 2.00  ? 24  LEU A N     1 
ATOM   144   C  CA    . LEU A 1 24  ? -43.136 -46.716 -28.040  1.00 8.63  ? 24  LEU A CA    1 
ATOM   145   C  C     . LEU A 1 24  ? -42.768 -45.244 -28.197  1.00 9.52  ? 24  LEU A C     1 
ATOM   146   O  O     . LEU A 1 24  ? -43.599 -44.449 -28.652  1.00 2.45  ? 24  LEU A O     1 
ATOM   147   C  CB    . LEU A 1 24  ? -44.076 -46.906 -26.831  1.00 2.80  ? 24  LEU A CB    1 
ATOM   148   C  CG    . LEU A 1 24  ? -45.215 -47.876 -27.112  1.00 2.00  ? 24  LEU A CG    1 
ATOM   149   C  CD1   . LEU A 1 24  ? -46.534 -47.324 -26.606  1.00 11.47 ? 24  LEU A CD1   1 
ATOM   150   C  CD2   . LEU A 1 24  ? -45.260 -48.103 -28.641  1.00 5.81  ? 24  LEU A CD2   1 
ATOM   151   N  N     . GLU A 1 25  ? -41.534 -44.901 -27.813  1.00 5.91  ? 25  GLU A N     1 
ATOM   152   C  CA    . GLU A 1 25  ? -40.812 -43.730 -28.334  1.00 4.12  ? 25  GLU A CA    1 
ATOM   153   C  C     . GLU A 1 25  ? -41.027 -43.365 -29.785  1.00 2.00  ? 25  GLU A C     1 
ATOM   154   O  O     . GLU A 1 25  ? -40.977 -42.183 -30.117  1.00 5.86  ? 25  GLU A O     1 
ATOM   155   C  CB    . GLU A 1 25  ? -39.312 -43.832 -28.068  1.00 2.00  ? 25  GLU A CB    1 
ATOM   156   C  CG    . GLU A 1 25  ? -38.978 -43.694 -26.592  1.00 7.22  ? 25  GLU A CG    1 
ATOM   157   C  CD    . GLU A 1 25  ? -39.574 -42.437 -25.985  1.00 2.00  ? 25  GLU A CD    1 
ATOM   158   O  OE1   . GLU A 1 25  ? -40.278 -42.502 -24.951  1.00 2.00  ? 25  GLU A OE1   1 
ATOM   159   O  OE2   . GLU A 1 25  ? -39.321 -41.358 -26.542  1.00 6.49  ? 25  GLU A OE2   1 
ATOM   160   N  N     . SER A 1 26  ? -41.251 -44.366 -30.640  1.00 5.66  ? 26  SER A N     1 
ATOM   161   C  CA    . SER A 1 26  ? -41.512 -44.179 -32.098  1.00 5.11  ? 26  SER A CA    1 
ATOM   162   C  C     . SER A 1 26  ? -43.023 -44.125 -32.178  1.00 2.00  ? 26  SER A C     1 
ATOM   163   O  O     . SER A 1 26  ? -43.691 -45.023 -31.685  1.00 2.01  ? 26  SER A O     1 
ATOM   164   C  CB    . SER A 1 26  ? -41.033 -45.399 -32.928  1.00 2.00  ? 26  SER A CB    1 
ATOM   165   O  OG    . SER A 1 26  ? -41.537 -45.405 -34.266  1.00 2.00  ? 26  SER A OG    1 
ATOM   166   N  N     . GLN A 1 27  ? -43.562 -43.060 -32.754  1.00 2.17  ? 27  GLN A N     1 
ATOM   167   C  CA    . GLN A 1 27  ? -45.005 -42.998 -32.956  1.00 7.17  ? 27  GLN A CA    1 
ATOM   168   C  C     . GLN A 1 27  ? -45.279 -43.995 -34.041  1.00 2.00  ? 27  GLN A C     1 
ATOM   169   O  O     . GLN A 1 27  ? -46.343 -44.585 -34.045  1.00 2.00  ? 27  GLN A O     1 
ATOM   170   C  CB    . GLN A 1 27  ? -45.541 -41.592 -33.335  1.00 2.00  ? 27  GLN A CB    1 
ATOM   171   C  CG    . GLN A 1 27  ? -45.721 -40.663 -32.146  1.00 17.84 ? 27  GLN A CG    1 
ATOM   172   C  CD    . GLN A 1 27  ? -44.879 -39.367 -32.255  1.00 37.66 ? 27  GLN A CD    1 
ATOM   173   O  OE1   . GLN A 1 27  ? -45.399 -38.321 -32.645  1.00 30.26 ? 27  GLN A OE1   1 
ATOM   174   N  NE2   . GLN A 1 27  ? -43.580 -39.439 -31.899  1.00 28.59 ? 27  GLN A NE2   1 
ATOM   175   N  N     . THR A 1 28  ? -44.327 -44.194 -34.955  1.00 2.00  ? 28  THR A N     1 
ATOM   176   C  CA    . THR A 1 28  ? -44.591 -45.092 -36.098  1.00 10.97 ? 28  THR A CA    1 
ATOM   177   C  C     . THR A 1 28  ? -44.859 -46.563 -35.638  1.00 15.09 ? 28  THR A C     1 
ATOM   178   O  O     . THR A 1 28  ? -45.811 -47.251 -36.108  1.00 2.45  ? 28  THR A O     1 
ATOM   179   C  CB    . THR A 1 28  ? -43.486 -45.044 -37.169  1.00 13.55 ? 28  THR A CB    1 
ATOM   180   O  OG1   . THR A 1 28  ? -43.452 -43.743 -37.795  1.00 2.00  ? 28  THR A OG1   1 
ATOM   181   C  CG2   . THR A 1 28  ? -43.778 -46.090 -38.215  1.00 2.00  ? 28  THR A CG2   1 
ATOM   182   N  N     . ILE A 1 29  ? -44.058 -46.996 -34.663  1.00 9.50  ? 29  ILE A N     1 
ATOM   183   C  CA    . ILE A 1 29  ? -44.324 -48.231 -33.921  1.00 5.87  ? 29  ILE A CA    1 
ATOM   184   C  C     . ILE A 1 29  ? -45.583 -48.324 -33.079  1.00 2.00  ? 29  ILE A C     1 
ATOM   185   O  O     . ILE A 1 29  ? -46.367 -49.260 -33.234  1.00 7.76  ? 29  ILE A O     1 
ATOM   186   C  CB    . ILE A 1 29  ? -43.068 -48.833 -33.253  1.00 2.00  ? 29  ILE A CB    1 
ATOM   187   C  CG1   . ILE A 1 29  ? -42.090 -49.263 -34.374  1.00 2.00  ? 29  ILE A CG1   1 
ATOM   188   C  CG2   . ILE A 1 29  ? -43.460 -50.006 -32.454  1.00 2.00  ? 29  ILE A CG2   1 
ATOM   189   C  CD1   . ILE A 1 29  ? -40.546 -49.039 -34.155  1.00 2.00  ? 29  ILE A CD1   1 
ATOM   190   N  N     . ALA A 1 30  ? -45.766 -47.359 -32.193  1.00 3.56  ? 30  ALA A N     1 
ATOM   191   C  CA    . ALA A 1 30  ? -47.005 -47.180 -31.423  1.00 4.62  ? 30  ALA A CA    1 
ATOM   192   C  C     . ALA A 1 30  ? -48.297 -47.539 -32.171  1.00 4.62  ? 30  ALA A C     1 
ATOM   193   O  O     . ALA A 1 30  ? -49.239 -48.138 -31.593  1.00 4.08  ? 30  ALA A O     1 
ATOM   194   C  CB    . ALA A 1 30  ? -47.083 -45.728 -30.884  1.00 2.00  ? 30  ALA A CB    1 
ATOM   195   N  N     . HIS A 1 31  ? -48.330 -47.155 -33.448  1.00 2.00  ? 31  HIS A N     1 
ATOM   196   C  CA    . HIS A 1 31  ? -49.567 -47.033 -34.221  1.00 4.01  ? 31  HIS A CA    1 
ATOM   197   C  C     . HIS A 1 31  ? -49.681 -48.212 -35.205  1.00 7.58  ? 31  HIS A C     1 
ATOM   198   O  O     . HIS A 1 31  ? -50.654 -48.320 -35.949  1.00 7.60  ? 31  HIS A O     1 
ATOM   199   C  CB    . HIS A 1 31  ? -49.582 -45.678 -34.954  1.00 2.00  ? 31  HIS A CB    1 
ATOM   200   C  CG    . HIS A 1 31  ? -50.843 -45.394 -35.708  1.00 2.00  ? 31  HIS A CG    1 
ATOM   201   N  ND1   . HIS A 1 31  ? -51.912 -44.725 -35.144  1.00 2.00  ? 31  HIS A ND1   1 
ATOM   202   C  CD2   . HIS A 1 31  ? -51.200 -45.667 -36.988  1.00 2.00  ? 31  HIS A CD2   1 
ATOM   203   C  CE1   . HIS A 1 31  ? -52.876 -44.605 -36.040  1.00 2.00  ? 31  HIS A CE1   1 
ATOM   204   N  NE2   . HIS A 1 31  ? -52.469 -45.169 -37.168  1.00 2.00  ? 31  HIS A NE2   1 
ATOM   205   N  N     . MET A 1 32  ? -48.682 -49.093 -35.190  1.00 5.78  ? 32  MET A N     1 
ATOM   206   C  CA    . MET A 1 32  ? -48.849 -50.479 -35.613  1.00 9.40  ? 32  MET A CA    1 
ATOM   207   C  C     . MET A 1 32  ? -49.124 -51.391 -34.391  1.00 11.58 ? 32  MET A C     1 
ATOM   208   O  O     . MET A 1 32  ? -48.220 -51.683 -33.597  1.00 9.88  ? 32  MET A O     1 
ATOM   209   C  CB    . MET A 1 32  ? -47.596 -50.926 -36.395  1.00 12.65 ? 32  MET A CB    1 
ATOM   210   C  CG    . MET A 1 32  ? -47.177 -49.959 -37.510  1.00 2.00  ? 32  MET A CG    1 
ATOM   211   S  SD    . MET A 1 32  ? -45.527 -50.262 -38.209  1.00 7.00  ? 32  MET A SD    1 
ATOM   212   C  CE    . MET A 1 32  ? -45.524 -49.190 -39.695  1.00 5.26  ? 32  MET A CE    1 
ATOM   213   N  N     . VAL A 1 33  ? -50.383 -51.800 -34.215  1.00 13.99 ? 33  VAL A N     1 
ATOM   214   C  CA    . VAL A 1 33  ? -50.888 -52.266 -32.906  1.00 9.29  ? 33  VAL A CA    1 
ATOM   215   C  C     . VAL A 1 33  ? -52.392 -52.107 -32.989  1.00 4.66  ? 33  VAL A C     1 
ATOM   216   O  O     . VAL A 1 33  ? -52.895 -51.840 -34.072  1.00 2.00  ? 33  VAL A O     1 
ATOM   217   C  CB    . VAL A 1 33  ? -50.342 -51.405 -31.706  1.00 17.74 ? 33  VAL A CB    1 
ATOM   218   C  CG1   . VAL A 1 33  ? -51.394 -51.353 -30.540  1.00 2.00  ? 33  VAL A CG1   1 
ATOM   219   C  CG2   . VAL A 1 33  ? -48.833 -51.827 -31.268  1.00 2.00  ? 33  VAL A CG2   1 
ATOM   220   N  N     . ASN A 1 40  ? -46.105 -62.140 -35.903  1.00 2.00  ? 40  ASN A N     1 
ATOM   221   C  CA    . ASN A 1 40  ? -45.851 -61.558 -34.589  1.00 8.58  ? 40  ASN A CA    1 
ATOM   222   C  C     . ASN A 1 40  ? -44.479 -60.872 -34.471  1.00 15.75 ? 40  ASN A C     1 
ATOM   223   O  O     . ASN A 1 40  ? -43.436 -61.494 -34.681  1.00 20.48 ? 40  ASN A O     1 
ATOM   224   C  CB    . ASN A 1 40  ? -45.999 -62.614 -33.500  1.00 2.75  ? 40  ASN A CB    1 
ATOM   225   C  CG    . ASN A 1 40  ? -46.452 -62.027 -32.181  1.00 7.13  ? 40  ASN A CG    1 
ATOM   226   O  OD1   . ASN A 1 40  ? -46.741 -60.837 -32.084  1.00 2.00  ? 40  ASN A OD1   1 
ATOM   227   N  ND2   . ASN A 1 40  ? -46.524 -62.863 -31.157  1.00 2.00  ? 40  ASN A ND2   1 
ATOM   228   N  N     . GLY A 1 41  ? -44.483 -59.592 -34.113  1.00 17.16 ? 41  GLY A N     1 
ATOM   229   C  CA    . GLY A 1 41  ? -43.240 -58.826 -34.008  1.00 20.14 ? 41  GLY A CA    1 
ATOM   230   C  C     . GLY A 1 41  ? -43.120 -57.831 -35.165  1.00 22.83 ? 41  GLY A C     1 
ATOM   231   O  O     . GLY A 1 41  ? -43.445 -58.161 -36.313  1.00 28.72 ? 41  GLY A O     1 
ATOM   232   N  N     . VAL A 1 42  ? -42.670 -56.611 -34.882  1.00 5.98  ? 42  VAL A N     1 
ATOM   233   C  CA    . VAL A 1 42  ? -43.015 -55.496 -35.742  1.00 13.91 ? 42  VAL A CA    1 
ATOM   234   C  C     . VAL A 1 42  ? -42.002 -55.324 -36.884  1.00 14.49 ? 42  VAL A C     1 
ATOM   235   O  O     . VAL A 1 42  ? -40.834 -55.016 -36.589  1.00 8.50  ? 42  VAL A O     1 
ATOM   236   C  CB    . VAL A 1 42  ? -43.095 -54.189 -34.926  1.00 18.01 ? 42  VAL A CB    1 
ATOM   237   C  CG1   . VAL A 1 42  ? -43.007 -52.972 -35.862  1.00 21.97 ? 42  VAL A CG1   1 
ATOM   238   C  CG2   . VAL A 1 42  ? -44.394 -54.151 -34.105  1.00 3.95  ? 42  VAL A CG2   1 
ATOM   239   N  N     . PRO A 1 43  ? -42.426 -55.548 -38.180  1.00 15.62 ? 43  PRO A N     1 
ATOM   240   C  CA    . PRO A 1 43  ? -41.405 -55.488 -39.261  1.00 8.20  ? 43  PRO A CA    1 
ATOM   241   C  C     . PRO A 1 43  ? -41.072 -54.010 -39.657  1.00 5.31  ? 43  PRO A C     1 
ATOM   242   O  O     . PRO A 1 43  ? -41.899 -53.119 -39.496  1.00 9.39  ? 43  PRO A O     1 
ATOM   243   C  CB    . PRO A 1 43  ? -42.026 -56.338 -40.417  1.00 2.00  ? 43  PRO A CB    1 
ATOM   244   C  CG    . PRO A 1 43  ? -43.499 -56.521 -40.090  1.00 2.00  ? 43  PRO A CG    1 
ATOM   245   C  CD    . PRO A 1 43  ? -43.776 -55.854 -38.724  1.00 12.22 ? 43  PRO A CD    1 
ATOM   246   N  N     . LEU A 1 44  ? -39.859 -53.738 -40.107  1.00 6.24  ? 44  LEU A N     1 
ATOM   247   C  CA    . LEU A 1 44  ? -39.405 -52.348 -40.264  1.00 2.19  ? 44  LEU A CA    1 
ATOM   248   C  C     . LEU A 1 44  ? -38.644 -52.258 -41.604  1.00 4.04  ? 44  LEU A C     1 
ATOM   249   O  O     . LEU A 1 44  ? -37.403 -52.155 -41.577  1.00 2.00  ? 44  LEU A O     1 
ATOM   250   C  CB    . LEU A 1 44  ? -38.555 -51.865 -39.035  1.00 2.00  ? 44  LEU A CB    1 
ATOM   251   C  CG    . LEU A 1 44  ? -39.294 -51.709 -37.676  1.00 2.00  ? 44  LEU A CG    1 
ATOM   252   C  CD1   . LEU A 1 44  ? -38.528 -51.505 -36.332  1.00 2.00  ? 44  LEU A CD1   1 
ATOM   253   C  CD2   . LEU A 1 44  ? -40.561 -50.851 -37.747  1.00 2.00  ? 44  LEU A CD2   1 
ATOM   254   N  N     . PRO A 1 45  ? -39.388 -52.327 -42.760  1.00 2.00  ? 45  PRO A N     1 
ATOM   255   C  CA    . PRO A 1 45  ? -38.837 -52.488 -44.108  1.00 2.00  ? 45  PRO A CA    1 
ATOM   256   C  C     . PRO A 1 45  ? -37.821 -51.427 -44.486  1.00 2.74  ? 45  PRO A C     1 
ATOM   257   O  O     . PRO A 1 45  ? -37.005 -51.642 -45.424  1.00 6.57  ? 45  PRO A O     1 
ATOM   258   C  CB    . PRO A 1 45  ? -40.070 -52.410 -45.049  1.00 2.00  ? 45  PRO A CB    1 
ATOM   259   C  CG    . PRO A 1 45  ? -41.264 -52.100 -44.228  1.00 2.00  ? 45  PRO A CG    1 
ATOM   260   C  CD    . PRO A 1 45  ? -40.867 -52.338 -42.764  1.00 2.00  ? 45  PRO A CD    1 
ATOM   261   N  N     . ASN A 1 46  ? -37.836 -50.292 -43.788  1.00 2.00  ? 46  ASN A N     1 
ATOM   262   C  CA    . ASN A 1 46  ? -36.983 -49.161 -44.212  1.00 14.58 ? 46  ASN A CA    1 
ATOM   263   C  C     . ASN A 1 46  ? -35.836 -48.717 -43.302  1.00 13.85 ? 46  ASN A C     1 
ATOM   264   O  O     . ASN A 1 46  ? -35.287 -47.625 -43.500  1.00 10.21 ? 46  ASN A O     1 
ATOM   265   C  CB    . ASN A 1 46  ? -37.815 -47.990 -44.741  1.00 2.65  ? 46  ASN A CB    1 
ATOM   266   C  CG    . ASN A 1 46  ? -38.923 -48.479 -45.644  1.00 26.10 ? 46  ASN A CG    1 
ATOM   267   O  OD1   . ASN A 1 46  ? -38.658 -49.002 -46.736  1.00 31.00 ? 46  ASN A OD1   1 
ATOM   268   N  ND2   . ASN A 1 46  ? -40.166 -48.390 -45.169  1.00 5.33  ? 46  ASN A ND2   1 
ATOM   269   N  N     . VAL A 1 47  ? -35.527 -49.582 -42.337  1.00 5.95  ? 47  VAL A N     1 
ATOM   270   C  CA    . VAL A 1 47  ? -34.432 -49.442 -41.387  1.00 5.46  ? 47  VAL A CA    1 
ATOM   271   C  C     . VAL A 1 47  ? -33.594 -50.720 -41.379  1.00 3.33  ? 47  VAL A C     1 
ATOM   272   O  O     . VAL A 1 47  ? -34.125 -51.806 -41.221  1.00 8.41  ? 47  VAL A O     1 
ATOM   273   C  CB    . VAL A 1 47  ? -34.976 -49.298 -39.965  1.00 6.78  ? 47  VAL A CB    1 
ATOM   274   C  CG1   . VAL A 1 47  ? -34.064 -48.471 -39.117  1.00 8.70  ? 47  VAL A CG1   1 
ATOM   275   C  CG2   . VAL A 1 47  ? -36.367 -48.749 -39.979  1.00 13.51 ? 47  VAL A CG2   1 
ATOM   276   N  N     . THR A 1 48  ? -32.285 -50.583 -41.523  1.00 2.00  ? 48  THR A N     1 
ATOM   277   C  CA    . THR A 1 48  ? -31.376 -51.706 -41.349  1.00 4.29  ? 48  THR A CA    1 
ATOM   278   C  C     . THR A 1 48  ? -31.284 -52.186 -39.906  1.00 2.61  ? 48  THR A C     1 
ATOM   279   O  O     . THR A 1 48  ? -31.962 -51.665 -39.043  1.00 17.15 ? 48  THR A O     1 
ATOM   280   C  CB    . THR A 1 48  ? -30.003 -51.359 -41.878  1.00 2.00  ? 48  THR A CB    1 
ATOM   281   O  OG1   . THR A 1 48  ? -29.413 -50.358 -41.055  1.00 3.40  ? 48  THR A OG1   1 
ATOM   282   C  CG2   . THR A 1 48  ? -30.120 -50.686 -43.188  1.00 2.00  ? 48  THR A CG2   1 
ATOM   283   N  N     . SER A 1 49  ? -30.451 -53.185 -39.643  1.00 4.33  ? 49  SER A N     1 
ATOM   284   C  CA    . SER A 1 49  ? -30.188 -53.559 -38.256  1.00 2.03  ? 49  SER A CA    1 
ATOM   285   C  C     . SER A 1 49  ? -29.169 -52.579 -37.667  1.00 2.00  ? 49  SER A C     1 
ATOM   286   O  O     . SER A 1 49  ? -29.311 -52.100 -36.502  1.00 2.00  ? 49  SER A O     1 
ATOM   287   C  CB    . SER A 1 49  ? -29.607 -55.011 -38.173  1.00 2.00  ? 49  SER A CB    1 
ATOM   288   O  OG    . SER A 1 49  ? -30.377 -55.945 -38.871  1.00 2.00  ? 49  SER A OG    1 
ATOM   289   N  N     . LYS A 1 50  ? -28.126 -52.312 -38.469  1.00 2.00  ? 50  LYS A N     1 
ATOM   290   C  CA    . LYS A 1 50  ? -27.055 -51.383 -38.083  1.00 2.00  ? 50  LYS A CA    1 
ATOM   291   C  C     . LYS A 1 50  ? -27.740 -50.177 -37.410  1.00 3.46  ? 50  LYS A C     1 
ATOM   292   O  O     . LYS A 1 50  ? -27.613 -49.929 -36.184  1.00 2.00  ? 50  LYS A O     1 
ATOM   293   C  CB    . LYS A 1 50  ? -26.267 -50.961 -39.345  1.00 2.61  ? 50  LYS A CB    1 
ATOM   294   C  CG    . LYS A 1 50  ? -25.246 -49.809 -39.150  1.00 2.77  ? 50  LYS A CG    1 
ATOM   295   C  CD    . LYS A 1 50  ? -23.806 -50.273 -39.261  1.00 2.00  ? 50  LYS A CD    1 
ATOM   296   C  CE    . LYS A 1 50  ? -23.245 -50.721 -37.894  1.00 22.40 ? 50  LYS A CE    1 
ATOM   297   N  NZ    . LYS A 1 50  ? -21.780 -50.460 -37.733  1.00 2.00  ? 50  LYS A NZ    1 
ATOM   298   N  N     . ILE A 1 51  ? -28.550 -49.513 -38.244  1.00 2.72  ? 51  ILE A N     1 
ATOM   299   C  CA    . ILE A 1 51  ? -29.306 -48.344 -37.903  1.00 2.31  ? 51  ILE A CA    1 
ATOM   300   C  C     . ILE A 1 51  ? -30.318 -48.584 -36.834  1.00 2.00  ? 51  ILE A C     1 
ATOM   301   O  O     . ILE A 1 51  ? -30.370 -47.844 -35.858  1.00 8.39  ? 51  ILE A O     1 
ATOM   302   C  CB    . ILE A 1 51  ? -29.889 -47.638 -39.166  1.00 2.70  ? 51  ILE A CB    1 
ATOM   303   C  CG1   . ILE A 1 51  ? -28.764 -47.074 -40.021  1.00 7.59  ? 51  ILE A CG1   1 
ATOM   304   C  CG2   . ILE A 1 51  ? -30.788 -46.537 -38.755  1.00 6.02  ? 51  ILE A CG2   1 
ATOM   305   C  CD1   . ILE A 1 51  ? -27.685 -46.364 -39.208  1.00 4.00  ? 51  ILE A CD1   1 
ATOM   306   N  N     . LEU A 1 52  ? -31.132 -49.609 -36.970  1.00 2.00  ? 52  LEU A N     1 
ATOM   307   C  CA    . LEU A 1 52  ? -32.058 -49.928 -35.864  1.00 2.00  ? 52  LEU A CA    1 
ATOM   308   C  C     . LEU A 1 52  ? -31.309 -50.166 -34.529  1.00 7.71  ? 52  LEU A C     1 
ATOM   309   O  O     . LEU A 1 52  ? -31.844 -49.782 -33.447  1.00 2.04  ? 52  LEU A O     1 
ATOM   310   C  CB    . LEU A 1 52  ? -33.066 -51.044 -36.242  1.00 2.00  ? 52  LEU A CB    1 
ATOM   311   C  CG    . LEU A 1 52  ? -34.394 -51.318 -35.482  1.00 7.20  ? 52  LEU A CG    1 
ATOM   312   C  CD1   . LEU A 1 52  ? -35.209 -52.564 -36.059  1.00 2.00  ? 52  LEU A CD1   1 
ATOM   313   C  CD2   . LEU A 1 52  ? -34.049 -51.639 -34.059  1.00 5.62  ? 52  LEU A CD2   1 
ATOM   314   N  N     . ALA A 1 53  ? -30.083 -50.742 -34.578  1.00 2.00  ? 53  ALA A N     1 
ATOM   315   C  CA    . ALA A 1 53  ? -29.247 -50.783 -33.360  1.00 2.00  ? 53  ALA A CA    1 
ATOM   316   C  C     . ALA A 1 53  ? -29.163 -49.413 -32.641  1.00 6.16  ? 53  ALA A C     1 
ATOM   317   O  O     . ALA A 1 53  ? -29.597 -49.293 -31.478  1.00 2.00  ? 53  ALA A O     1 
ATOM   318   C  CB    . ALA A 1 53  ? -27.866 -51.315 -33.662  1.00 2.00  ? 53  ALA A CB    1 
ATOM   319   N  N     . LYS A 1 54  ? -28.627 -48.394 -33.373  1.00 9.18  ? 54  LYS A N     1 
ATOM   320   C  CA    . LYS A 1 54  ? -28.272 -47.037 -32.860  1.00 2.00  ? 54  LYS A CA    1 
ATOM   321   C  C     . LYS A 1 54  ? -29.512 -46.371 -32.307  1.00 2.00  ? 54  LYS A C     1 
ATOM   322   O  O     . LYS A 1 54  ? -29.536 -45.841 -31.173  1.00 2.00  ? 54  LYS A O     1 
ATOM   323   C  CB    . LYS A 1 54  ? -27.720 -46.194 -33.978  1.00 2.00  ? 54  LYS A CB    1 
ATOM   324   C  CG    . LYS A 1 54  ? -26.300 -46.549 -34.320  1.00 18.64 ? 54  LYS A CG    1 
ATOM   325   C  CD    . LYS A 1 54  ? -25.306 -45.352 -34.180  1.00 26.00 ? 54  LYS A CD    1 
ATOM   326   C  CE    . LYS A 1 54  ? -24.947 -45.008 -32.718  1.00 11.96 ? 54  LYS A CE    1 
ATOM   327   N  NZ    . LYS A 1 54  ? -23.617 -44.310 -32.607  1.00 12.84 ? 54  LYS A NZ    1 
ATOM   328   N  N     . VAL A 1 55  ? -30.580 -46.480 -33.094  1.00 2.00  ? 55  VAL A N     1 
ATOM   329   C  CA    . VAL A 1 55  ? -31.885 -45.963 -32.703  1.00 2.00  ? 55  VAL A CA    1 
ATOM   330   C  C     . VAL A 1 55  ? -32.195 -46.470 -31.327  1.00 2.00  ? 55  VAL A C     1 
ATOM   331   O  O     . VAL A 1 55  ? -32.763 -45.734 -30.503  1.00 2.39  ? 55  VAL A O     1 
ATOM   332   C  CB    . VAL A 1 55  ? -33.042 -46.339 -33.748  1.00 8.15  ? 55  VAL A CB    1 
ATOM   333   C  CG1   . VAL A 1 55  ? -34.407 -46.296 -33.100  1.00 2.00  ? 55  VAL A CG1   1 
ATOM   334   C  CG2   . VAL A 1 55  ? -33.030 -45.407 -35.033  1.00 2.00  ? 55  VAL A CG2   1 
ATOM   335   N  N     . ILE A 1 56  ? -31.804 -47.730 -31.047  1.00 7.91  ? 56  ILE A N     1 
ATOM   336   C  CA    . ILE A 1 56  ? -32.252 -48.408 -29.811  1.00 2.14  ? 56  ILE A CA    1 
ATOM   337   C  C     . ILE A 1 56  ? -31.407 -47.916 -28.641  1.00 10.39 ? 56  ILE A C     1 
ATOM   338   O  O     . ILE A 1 56  ? -31.989 -47.522 -27.579  1.00 2.00  ? 56  ILE A O     1 
ATOM   339   C  CB    . ILE A 1 56  ? -32.352 -49.960 -29.967  1.00 13.64 ? 56  ILE A CB    1 
ATOM   340   C  CG1   . ILE A 1 56  ? -33.533 -50.288 -30.875  1.00 14.10 ? 56  ILE A CG1   1 
ATOM   341   C  CG2   . ILE A 1 56  ? -32.509 -50.658 -28.652  1.00 2.00  ? 56  ILE A CG2   1 
ATOM   342   C  CD1   . ILE A 1 56  ? -33.876 -51.771 -30.960  1.00 2.00  ? 56  ILE A CD1   1 
ATOM   343   N  N     . GLU A 1 57  ? -30.073 -47.800 -28.847  1.00 2.00  ? 57  GLU A N     1 
ATOM   344   C  CA    . GLU A 1 57  ? -29.324 -47.113 -27.775  1.00 6.48  ? 57  GLU A CA    1 
ATOM   345   C  C     . GLU A 1 57  ? -29.994 -45.820 -27.397  1.00 2.00  ? 57  GLU A C     1 
ATOM   346   O  O     . GLU A 1 57  ? -30.252 -45.605 -26.226  1.00 2.00  ? 57  GLU A O     1 
ATOM   347   C  CB    . GLU A 1 57  ? -27.876 -46.872 -28.056  1.00 2.00  ? 57  GLU A CB    1 
ATOM   348   C  CG    . GLU A 1 57  ? -27.413 -47.772 -29.086  1.00 14.66 ? 57  GLU A CG    1 
ATOM   349   C  CD    . GLU A 1 57  ? -25.997 -47.497 -29.416  1.00 21.39 ? 57  GLU A CD    1 
ATOM   350   O  OE1   . GLU A 1 57  ? -25.379 -46.677 -28.684  1.00 11.20 ? 57  GLU A OE1   1 
ATOM   351   O  OE2   . GLU A 1 57  ? -25.517 -48.109 -30.396  1.00 23.39 ? 57  GLU A OE2   1 
ATOM   352   N  N     . TYR A 1 58  ? -30.309 -45.002 -28.395  1.00 2.00  ? 58  TYR A N     1 
ATOM   353   C  CA    . TYR A 1 58  ? -30.885 -43.679 -28.109  1.00 4.42  ? 58  TYR A CA    1 
ATOM   354   C  C     . TYR A 1 58  ? -32.141 -43.908 -27.405  1.00 2.00  ? 58  TYR A C     1 
ATOM   355   O  O     . TYR A 1 58  ? -32.382 -43.343 -26.346  1.00 2.00  ? 58  TYR A O     1 
ATOM   356   C  CB    . TYR A 1 58  ? -31.248 -42.865 -29.366  1.00 8.30  ? 58  TYR A CB    1 
ATOM   357   C  CG    . TYR A 1 58  ? -31.825 -41.431 -29.148  1.00 2.09  ? 58  TYR A CG    1 
ATOM   358   C  CD1   . TYR A 1 58  ? -30.984 -40.295 -29.161  1.00 20.06 ? 58  TYR A CD1   1 
ATOM   359   C  CD2   . TYR A 1 58  ? -33.198 -41.195 -28.989  1.00 2.94  ? 58  TYR A CD2   1 
ATOM   360   C  CE1   . TYR A 1 58  ? -31.477 -38.989 -28.986  1.00 2.00  ? 58  TYR A CE1   1 
ATOM   361   C  CE2   . TYR A 1 58  ? -33.700 -39.851 -28.817  1.00 5.49  ? 58  TYR A CE2   1 
ATOM   362   C  CZ    . TYR A 1 58  ? -32.830 -38.769 -28.817  1.00 2.00  ? 58  TYR A CZ    1 
ATOM   363   O  OH    . TYR A 1 58  ? -33.298 -37.466 -28.634  1.00 6.30  ? 58  TYR A OH    1 
ATOM   364   N  N     . CYS A 1 59  ? -32.999 -44.707 -27.979  1.00 2.00  ? 59  CYS A N     1 
ATOM   365   C  CA    . CYS A 1 59  ? -34.236 -44.717 -27.302  1.00 2.00  ? 59  CYS A CA    1 
ATOM   366   C  C     . CYS A 1 59  ? -34.096 -45.249 -25.856  1.00 14.88 ? 59  CYS A C     1 
ATOM   367   O  O     . CYS A 1 59  ? -34.934 -44.933 -24.988  1.00 15.18 ? 59  CYS A O     1 
ATOM   368   C  CB    . CYS A 1 59  ? -35.353 -45.321 -28.135  1.00 5.24  ? 59  CYS A CB    1 
ATOM   369   S  SG    . CYS A 1 59  ? -35.788 -44.373 -29.681  1.00 2.06  ? 59  CYS A SG    1 
ATOM   370   N  N     . LYS A 1 60  ? -33.051 -46.016 -25.587  1.00 10.00 ? 60  LYS A N     1 
ATOM   371   C  CA    . LYS A 1 60  ? -32.833 -46.525 -24.247  1.00 9.75  ? 60  LYS A CA    1 
ATOM   372   C  C     . LYS A 1 60  ? -32.358 -45.432 -23.304  1.00 4.41  ? 60  LYS A C     1 
ATOM   373   O  O     . LYS A 1 60  ? -32.929 -45.219 -22.244  1.00 2.00  ? 60  LYS A O     1 
ATOM   374   C  CB    . LYS A 1 60  ? -31.838 -47.684 -24.274  1.00 9.11  ? 60  LYS A CB    1 
ATOM   375   C  CG    . LYS A 1 60  ? -32.468 -49.031 -24.524  1.00 2.00  ? 60  LYS A CG    1 
ATOM   376   C  CD    . LYS A 1 60  ? -31.454 -50.140 -24.365  1.00 6.81  ? 60  LYS A CD    1 
ATOM   377   C  CE    . LYS A 1 60  ? -31.375 -51.019 -25.590  1.00 2.00  ? 60  LYS A CE    1 
ATOM   378   N  NZ    . LYS A 1 60  ? -29.983 -51.159 -26.083  1.00 2.00  ? 60  LYS A NZ    1 
ATOM   379   N  N     . ARG A 1 61  ? -31.302 -44.740 -23.705  1.00 9.70  ? 61  ARG A N     1 
ATOM   380   C  CA    . ARG A 1 61  ? -30.711 -43.688 -22.896  1.00 14.59 ? 61  ARG A CA    1 
ATOM   381   C  C     . ARG A 1 61  ? -31.752 -42.707 -22.395  1.00 13.94 ? 61  ARG A C     1 
ATOM   382   O  O     . ARG A 1 61  ? -31.647 -42.200 -21.286  1.00 12.53 ? 61  ARG A O     1 
ATOM   383   C  CB    . ARG A 1 61  ? -29.655 -42.942 -23.703  1.00 11.57 ? 61  ARG A CB    1 
ATOM   384   C  CG    . ARG A 1 61  ? -28.556 -42.333 -22.873  1.00 6.97  ? 61  ARG A CG    1 
ATOM   385   C  CD    . ARG A 1 61  ? -28.513 -42.834 -21.451  1.00 8.09  ? 61  ARG A CD    1 
ATOM   386   N  NE    . ARG A 1 61  ? -28.569 -41.744 -20.482  1.00 40.13 ? 61  ARG A NE    1 
ATOM   387   C  CZ    . ARG A 1 61  ? -27.530 -40.995 -20.146  1.00 29.53 ? 61  ARG A CZ    1 
ATOM   388   N  NH1   . ARG A 1 61  ? -26.351 -41.218 -20.699  1.00 2.00  ? 61  ARG A NH1   1 
ATOM   389   N  NH2   . ARG A 1 61  ? -27.663 -40.022 -19.262  1.00 2.00  ? 61  ARG A NH2   1 
ATOM   390   N  N     . HIS A 1 62  ? -32.753 -42.436 -23.223  1.00 5.44  ? 62  HIS A N     1 
ATOM   391   C  CA    . HIS A 1 62  ? -33.561 -41.237 -23.086  1.00 9.25  ? 62  HIS A CA    1 
ATOM   392   C  C     . HIS A 1 62  ? -34.859 -41.536 -22.350  1.00 8.32  ? 62  HIS A C     1 
ATOM   393   O  O     . HIS A 1 62  ? -35.272 -42.684 -22.237  1.00 6.35  ? 62  HIS A O     1 
ATOM   394   C  CB    . HIS A 1 62  ? -33.860 -40.628 -24.458  1.00 9.61  ? 62  HIS A CB    1 
ATOM   395   C  CG    . HIS A 1 62  ? -32.936 -39.515 -24.844  1.00 22.26 ? 62  HIS A CG    1 
ATOM   396   N  ND1   . HIS A 1 62  ? -31.638 -39.731 -25.247  1.00 6.26  ? 62  HIS A ND1   1 
ATOM   397   C  CD2   . HIS A 1 62  ? -33.122 -38.177 -24.880  1.00 16.00 ? 62  HIS A CD2   1 
ATOM   398   C  CE1   . HIS A 1 62  ? -31.064 -38.574 -25.514  1.00 2.00  ? 62  HIS A CE1   1 
ATOM   399   N  NE2   . HIS A 1 62  ? -31.943 -37.615 -25.299  1.00 2.00  ? 62  HIS A NE2   1 
ATOM   400   N  N     . ASP A 1 87  ? -25.899 -37.441 -25.073  1.00 8.75  ? 87  ASP A N     1 
ATOM   401   C  CA    . ASP A 1 87  ? -26.054 -37.735 -26.488  1.00 4.07  ? 87  ASP A CA    1 
ATOM   402   C  C     . ASP A 1 87  ? -25.564 -36.611 -27.370  1.00 3.02  ? 87  ASP A C     1 
ATOM   403   O  O     . ASP A 1 87  ? -26.184 -35.566 -27.452  1.00 2.00  ? 87  ASP A O     1 
ATOM   404   C  CB    . ASP A 1 87  ? -27.503 -38.105 -26.837  1.00 6.45  ? 87  ASP A CB    1 
ATOM   405   C  CG    . ASP A 1 87  ? -28.507 -37.004 -26.504  1.00 12.50 ? 87  ASP A CG    1 
ATOM   406   O  OD1   . ASP A 1 87  ? -29.523 -37.317 -25.852  1.00 2.00  ? 87  ASP A OD1   1 
ATOM   407   O  OD2   . ASP A 1 87  ? -28.391 -35.818 -26.864  1.00 11.18 ? 87  ASP A OD2   1 
ATOM   408   N  N     . ALA A 1 88  ? -24.434 -36.824 -28.020  1.00 8.36  ? 88  ALA A N     1 
ATOM   409   C  CA    . ALA A 1 88  ? -23.316 -35.910 -27.876  1.00 10.76 ? 88  ALA A CA    1 
ATOM   410   C  C     . ALA A 1 88  ? -22.098 -36.470 -28.576  1.00 10.24 ? 88  ALA A C     1 
ATOM   411   O  O     . ALA A 1 88  ? -21.671 -35.948 -29.596  1.00 12.86 ? 88  ALA A O     1 
ATOM   412   C  CB    . ALA A 1 88  ? -23.024 -35.659 -26.411  1.00 10.22 ? 88  ALA A CB    1 
ATOM   413   N  N     . ASP A 1 89  ? -21.551 -37.547 -28.033  1.00 2.92  ? 89  ASP A N     1 
ATOM   414   C  CA    . ASP A 1 89  ? -20.604 -38.350 -28.783  1.00 12.17 ? 89  ASP A CA    1 
ATOM   415   C  C     . ASP A 1 89  ? -21.259 -39.560 -29.425  1.00 10.08 ? 89  ASP A C     1 
ATOM   416   O  O     . ASP A 1 89  ? -20.676 -40.206 -30.286  1.00 2.00  ? 89  ASP A O     1 
ATOM   417   C  CB    . ASP A 1 89  ? -19.403 -38.743 -27.918  1.00 18.27 ? 89  ASP A CB    1 
ATOM   418   C  CG    . ASP A 1 89  ? -19.742 -39.770 -26.867  1.00 18.09 ? 89  ASP A CG    1 
ATOM   419   O  OD1   . ASP A 1 89  ? -19.503 -40.971 -27.109  1.00 2.00  ? 89  ASP A OD1   1 
ATOM   420   O  OD2   . ASP A 1 89  ? -20.233 -39.473 -25.763  1.00 17.34 ? 89  ASP A OD2   1 
ATOM   421   N  N     . PHE A 1 90  ? -22.483 -39.846 -28.996  1.00 3.85  ? 90  PHE A N     1 
ATOM   422   C  CA    . PHE A 1 90  ? -23.462 -40.537 -29.820  1.00 3.91  ? 90  PHE A CA    1 
ATOM   423   C  C     . PHE A 1 90  ? -23.423 -40.058 -31.245  1.00 2.00  ? 90  PHE A C     1 
ATOM   424   O  O     . PHE A 1 90  ? -23.488 -40.854 -32.169  1.00 3.83  ? 90  PHE A O     1 
ATOM   425   C  CB    . PHE A 1 90  ? -24.872 -40.347 -29.263  1.00 8.11  ? 90  PHE A CB    1 
ATOM   426   C  CG    . PHE A 1 90  ? -25.946 -41.016 -30.077  1.00 7.16  ? 90  PHE A CG    1 
ATOM   427   C  CD1   . PHE A 1 90  ? -26.400 -42.274 -29.749  1.00 21.58 ? 90  PHE A CD1   1 
ATOM   428   C  CD2   . PHE A 1 90  ? -26.509 -40.382 -31.159  1.00 2.00  ? 90  PHE A CD2   1 
ATOM   429   C  CE1   . PHE A 1 90  ? -27.381 -42.882 -30.488  1.00 2.00  ? 90  PHE A CE1   1 
ATOM   430   C  CE2   . PHE A 1 90  ? -27.490 -40.991 -31.894  1.00 5.44  ? 90  PHE A CE2   1 
ATOM   431   C  CZ    . PHE A 1 90  ? -27.925 -42.240 -31.557  1.00 2.00  ? 90  PHE A CZ    1 
ATOM   432   N  N     . MET A 1 91  ? -23.318 -38.758 -31.442  1.00 2.00  ? 91  MET A N     1 
ATOM   433   C  CA    . MET A 1 91  ? -23.397 -38.227 -32.788  1.00 2.00  ? 91  MET A CA    1 
ATOM   434   C  C     . MET A 1 91  ? -22.025 -38.125 -33.423  1.00 2.00  ? 91  MET A C     1 
ATOM   435   O  O     . MET A 1 91  ? -21.893 -37.954 -34.624  1.00 2.00  ? 91  MET A O     1 
ATOM   436   C  CB    . MET A 1 91  ? -24.114 -36.886 -32.787  1.00 4.79  ? 91  MET A CB    1 
ATOM   437   C  CG    . MET A 1 91  ? -25.602 -37.018 -32.907  1.00 2.00  ? 91  MET A CG    1 
ATOM   438   S  SD    . MET A 1 91  ? -26.063 -37.379 -34.588  1.00 3.84  ? 91  MET A SD    1 
ATOM   439   C  CE    . MET A 1 91  ? -27.543 -38.297 -34.298  1.00 3.53  ? 91  MET A CE    1 
ATOM   440   N  N     . LYS A 1 92  ? -21.006 -38.247 -32.592  1.00 2.00  ? 92  LYS A N     1 
ATOM   441   C  CA    . LYS A 1 92  ? -19.724 -38.780 -33.006  1.00 2.48  ? 92  LYS A CA    1 
ATOM   442   C  C     . LYS A 1 92  ? -19.847 -39.975 -33.928  1.00 3.55  ? 92  LYS A C     1 
ATOM   443   O  O     . LYS A 1 92  ? -19.274 -41.025 -33.670  1.00 2.00  ? 92  LYS A O     1 
ATOM   444   C  CB    . LYS A 1 92  ? -18.910 -39.152 -31.780  1.00 5.14  ? 92  LYS A CB    1 
ATOM   445   C  CG    . LYS A 1 92  ? -18.892 -38.075 -30.722  1.00 20.12 ? 92  LYS A CG    1 
ATOM   446   C  CD    . LYS A 1 92  ? -17.690 -37.168 -30.885  1.00 2.43  ? 92  LYS A CD    1 
ATOM   447   C  CE    . LYS A 1 92  ? -17.874 -35.876 -30.115  1.00 2.00  ? 92  LYS A CE    1 
ATOM   448   N  NZ    . LYS A 1 92  ? -17.588 -34.690 -30.963  1.00 9.69  ? 92  LYS A NZ    1 
ATOM   449   N  N     . ILE A 1 93  ? -20.594 -39.811 -35.008  1.00 2.00  ? 93  ILE A N     1 
ATOM   450   C  CA    . ILE A 1 93  ? -20.628 -40.810 -36.056  1.00 2.00  ? 93  ILE A CA    1 
ATOM   451   C  C     . ILE A 1 93  ? -20.265 -40.177 -37.365  1.00 2.00  ? 93  ILE A C     1 
ATOM   452   O  O     . ILE A 1 93  ? -19.973 -38.992 -37.432  1.00 2.00  ? 93  ILE A O     1 
ATOM   453   C  CB    . ILE A 1 93  ? -22.020 -41.444 -36.183  1.00 7.77  ? 93  ILE A CB    1 
ATOM   454   C  CG1   . ILE A 1 93  ? -22.935 -40.556 -37.015  1.00 2.00  ? 93  ILE A CG1   1 
ATOM   455   C  CG2   . ILE A 1 93  ? -22.610 -41.725 -34.837  1.00 2.00  ? 93  ILE A CG2   1 
ATOM   456   C  CD1   . ILE A 1 93  ? -24.369 -40.635 -36.608  1.00 28.16 ? 93  ILE A CD1   1 
ATOM   457   N  N     . ASP A 1 94  ? -20.299 -40.972 -38.418  1.00 2.00  ? 94  ASP A N     1 
ATOM   458   C  CA    . ASP A 1 94  ? -19.906 -40.477 -39.712  1.00 4.84  ? 94  ASP A CA    1 
ATOM   459   C  C     . ASP A 1 94  ? -21.083 -40.219 -40.622  1.00 6.78  ? 94  ASP A C     1 
ATOM   460   O  O     . ASP A 1 94  ? -22.213 -40.583 -40.326  1.00 13.90 ? 94  ASP A O     1 
ATOM   461   C  CB    . ASP A 1 94  ? -18.903 -41.408 -40.378  1.00 2.00  ? 94  ASP A CB    1 
ATOM   462   C  CG    . ASP A 1 94  ? -19.478 -42.765 -40.683  1.00 10.82 ? 94  ASP A CG    1 
ATOM   463   O  OD1   . ASP A 1 94  ? -19.517 -43.608 -39.765  1.00 30.95 ? 94  ASP A OD1   1 
ATOM   464   O  OD2   . ASP A 1 94  ? -19.892 -43.088 -41.811  1.00 5.31  ? 94  ASP A OD2   1 
ATOM   465   N  N     . GLN A 1 95  ? -20.792 -39.581 -41.740  1.00 3.62  ? 95  GLN A N     1 
ATOM   466   C  CA    . GLN A 1 95  ? -21.769 -38.835 -42.500  1.00 6.23  ? 95  GLN A CA    1 
ATOM   467   C  C     . GLN A 1 95  ? -22.857 -39.777 -43.057  1.00 8.40  ? 95  GLN A C     1 
ATOM   468   O  O     . GLN A 1 95  ? -24.067 -39.562 -42.824  1.00 2.43  ? 95  GLN A O     1 
ATOM   469   C  CB    . GLN A 1 95  ? -21.084 -38.027 -43.622  1.00 5.47  ? 95  GLN A CB    1 
ATOM   470   C  CG    . GLN A 1 95  ? -22.050 -37.458 -44.684  1.00 5.22  ? 95  GLN A CG    1 
ATOM   471   C  CD    . GLN A 1 95  ? -21.559 -36.183 -45.350  1.00 2.00  ? 95  GLN A CD    1 
ATOM   472   O  OE1   . GLN A 1 95  ? -21.932 -35.880 -46.485  1.00 2.00  ? 95  GLN A OE1   1 
ATOM   473   N  NE2   . GLN A 1 95  ? -20.724 -35.435 -44.649  1.00 2.00  ? 95  GLN A NE2   1 
ATOM   474   N  N     . ALA A 1 96  ? -22.439 -40.811 -43.797  1.00 8.16  ? 96  ALA A N     1 
ATOM   475   C  CA    . ALA A 1 96  ? -23.404 -41.694 -44.469  1.00 2.80  ? 96  ALA A CA    1 
ATOM   476   C  C     . ALA A 1 96  ? -24.319 -42.298 -43.405  1.00 5.13  ? 96  ALA A C     1 
ATOM   477   O  O     . ALA A 1 96  ? -25.361 -42.881 -43.720  1.00 2.08  ? 96  ALA A O     1 
ATOM   478   C  CB    . ALA A 1 96  ? -22.699 -42.782 -45.261  1.00 2.00  ? 96  ALA A CB    1 
ATOM   479   N  N     . THR A 1 97  ? -23.933 -42.116 -42.144  1.00 2.00  ? 97  THR A N     1 
ATOM   480   C  CA    . THR A 1 97  ? -24.533 -42.849 -41.063  1.00 2.00  ? 97  THR A CA    1 
ATOM   481   C  C     . THR A 1 97  ? -25.581 -42.048 -40.249  1.00 2.00  ? 97  THR A C     1 
ATOM   482   O  O     . THR A 1 97  ? -26.715 -42.524 -40.077  1.00 2.00  ? 97  THR A O     1 
ATOM   483   C  CB    . THR A 1 97  ? -23.451 -43.708 -40.242  1.00 6.99  ? 97  THR A CB    1 
ATOM   484   O  OG1   . THR A 1 97  ? -23.130 -44.909 -40.969  1.00 2.00  ? 97  THR A OG1   1 
ATOM   485   C  CG2   . THR A 1 97  ? -23.927 -44.095 -38.806  1.00 2.00  ? 97  THR A CG2   1 
ATOM   486   N  N     . LEU A 1 98  ? -25.221 -40.852 -39.798  1.00 4.48  ? 98  LEU A N     1 
ATOM   487   C  CA    . LEU A 1 98  ? -26.137 -39.712 -39.758  1.00 2.00  ? 98  LEU A CA    1 
ATOM   488   C  C     . LEU A 1 98  ? -27.150 -39.698 -40.895  1.00 2.00  ? 98  LEU A C     1 
ATOM   489   O  O     . LEU A 1 98  ? -28.348 -39.691 -40.669  1.00 2.00  ? 98  LEU A O     1 
ATOM   490   C  CB    . LEU A 1 98  ? -25.345 -38.410 -39.766  1.00 2.83  ? 98  LEU A CB    1 
ATOM   491   C  CG    . LEU A 1 98  ? -26.032 -37.146 -39.257  1.00 2.00  ? 98  LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1 98  ? -26.296 -37.272 -37.780  1.00 2.26  ? 98  LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1 98  ? -25.201 -35.911 -39.556  1.00 2.00  ? 98  LEU A CD2   1 
ATOM   494   N  N     . PHE A 1 99  ? -26.650 -39.684 -42.120  1.00 2.00  ? 99  PHE A N     1 
ATOM   495   C  CA    . PHE A 1 99  ? -27.489 -39.803 -43.296  1.00 2.00  ? 99  PHE A CA    1 
ATOM   496   C  C     . PHE A 1 99  ? -28.678 -40.700 -43.062  1.00 2.00  ? 99  PHE A C     1 
ATOM   497   O  O     . PHE A 1 99  ? -29.808 -40.322 -43.330  1.00 3.57  ? 99  PHE A O     1 
ATOM   498   C  CB    . PHE A 1 99  ? -27.965 -38.438 -43.753  1.00 13.54 ? 99  PHE A CB    1 
ATOM   499   C  CG    . PHE A 1 99  ? -26.924 -37.645 -44.483  1.00 21.57 ? 99  PHE A CG    1 
ATOM   500   C  CD1   . PHE A 1 99  ? -26.806 -37.737 -45.853  1.00 22.38 ? 99  PHE A CD1   1 
ATOM   501   C  CD2   . PHE A 1 99  ? -26.075 -36.799 -43.801  1.00 2.00  ? 99  PHE A CD2   1 
ATOM   502   C  CE1   . PHE A 1 99  ? -25.862 -37.012 -46.521  1.00 29.25 ? 99  PHE A CE1   1 
ATOM   503   C  CE2   . PHE A 1 99  ? -25.136 -36.072 -44.469  1.00 2.00  ? 99  PHE A CE2   1 
ATOM   504   C  CZ    . PHE A 1 99  ? -25.028 -36.179 -45.828  1.00 12.57 ? 99  PHE A CZ    1 
ATOM   505   N  N     . GLU A 1 100 ? -28.409 -41.904 -42.574  1.00 6.78  ? 100 GLU A N     1 
ATOM   506   C  CA    . GLU A 1 100 ? -29.416 -42.945 -42.477  1.00 2.00  ? 100 GLU A CA    1 
ATOM   507   C  C     . GLU A 1 100 ? -30.208 -42.785 -41.188  1.00 2.00  ? 100 GLU A C     1 
ATOM   508   O  O     . GLU A 1 100 ? -31.356 -43.181 -41.099  1.00 2.00  ? 100 GLU A O     1 
ATOM   509   C  CB    . GLU A 1 100 ? -28.746 -44.314 -42.525  1.00 2.00  ? 100 GLU A CB    1 
ATOM   510   C  CG    . GLU A 1 100 ? -28.878 -45.025 -43.857  1.00 2.00  ? 100 GLU A CG    1 
ATOM   511   C  CD    . GLU A 1 100 ? -27.942 -46.206 -43.978  1.00 20.06 ? 100 GLU A CD    1 
ATOM   512   O  OE1   . GLU A 1 100 ? -26.777 -45.998 -44.369  1.00 13.83 ? 100 GLU A OE1   1 
ATOM   513   O  OE2   . GLU A 1 100 ? -28.367 -47.343 -43.686  1.00 17.04 ? 100 GLU A OE2   1 
ATOM   514   N  N     . LEU A 1 101 ? -29.572 -42.174 -40.201  1.00 2.00  ? 101 LEU A N     1 
ATOM   515   C  CA    . LEU A 1 101 ? -30.152 -41.973 -38.880  1.00 4.60  ? 101 LEU A CA    1 
ATOM   516   C  C     . LEU A 1 101 ? -31.351 -40.982 -38.936  1.00 2.10  ? 101 LEU A C     1 
ATOM   517   O  O     . LEU A 1 101 ? -32.466 -41.266 -38.450  1.00 7.69  ? 101 LEU A O     1 
ATOM   518   C  CB    . LEU A 1 101 ? -29.041 -41.461 -37.952  1.00 2.00  ? 101 LEU A CB    1 
ATOM   519   C  CG    . LEU A 1 101 ? -28.789 -42.076 -36.597  1.00 2.00  ? 101 LEU A CG    1 
ATOM   520   C  CD1   . LEU A 1 101 ? -28.320 -40.997 -35.712  1.00 2.00  ? 101 LEU A CD1   1 
ATOM   521   C  CD2   . LEU A 1 101 ? -29.995 -42.756 -35.982  1.00 2.00  ? 101 LEU A CD2   1 
ATOM   522   N  N     . ILE A 1 102 ? -31.095 -39.812 -39.523  1.00 5.53  ? 102 ILE A N     1 
ATOM   523   C  CA    . ILE A 1 102 ? -32.143 -38.894 -39.939  1.00 4.84  ? 102 ILE A CA    1 
ATOM   524   C  C     . ILE A 1 102 ? -33.317 -39.680 -40.526  1.00 2.62  ? 102 ILE A C     1 
ATOM   525   O  O     . ILE A 1 102 ? -34.430 -39.656 -39.958  1.00 2.00  ? 102 ILE A O     1 
ATOM   526   C  CB    . ILE A 1 102 ? -31.674 -37.856 -41.078  1.00 16.19 ? 102 ILE A CB    1 
ATOM   527   C  CG1   . ILE A 1 102 ? -30.499 -36.971 -40.649  1.00 2.00  ? 102 ILE A CG1   1 
ATOM   528   C  CG2   . ILE A 1 102 ? -32.857 -36.940 -41.468  1.00 2.00  ? 102 ILE A CG2   1 
ATOM   529   C  CD1   . ILE A 1 102 ? -30.702 -35.519 -41.026  1.00 13.77 ? 102 ILE A CD1   1 
ATOM   530   N  N     . LEU A 1 103 ? -33.070 -40.331 -41.684  1.00 3.76  ? 103 LEU A N     1 
ATOM   531   C  CA    . LEU A 1 103 ? -34.165 -40.933 -42.470  1.00 2.02  ? 103 LEU A CA    1 
ATOM   532   C  C     . LEU A 1 103 ? -35.052 -41.854 -41.586  1.00 10.20 ? 103 LEU A C     1 
ATOM   533   O  O     . LEU A 1 103 ? -36.297 -41.786 -41.615  1.00 11.97 ? 103 LEU A O     1 
ATOM   534   C  CB    . LEU A 1 103 ? -33.633 -41.610 -43.726  1.00 2.00  ? 103 LEU A CB    1 
ATOM   535   C  CG    . LEU A 1 103 ? -33.167 -40.852 -44.992  1.00 9.68  ? 103 LEU A CG    1 
ATOM   536   C  CD1   . LEU A 1 103 ? -32.955 -41.819 -46.203  1.00 2.00  ? 103 LEU A CD1   1 
ATOM   537   C  CD2   . LEU A 1 103 ? -34.056 -39.663 -45.434  1.00 2.00  ? 103 LEU A CD2   1 
ATOM   538   N  N     . ALA A 1 104 ? -34.400 -42.640 -40.728  1.00 11.31 ? 104 ALA A N     1 
ATOM   539   C  CA    . ALA A 1 104 ? -35.090 -43.527 -39.805  1.00 2.56  ? 104 ALA A CA    1 
ATOM   540   C  C     . ALA A 1 104 ? -35.705 -42.762 -38.705  1.00 4.15  ? 104 ALA A C     1 
ATOM   541   O  O     . ALA A 1 104 ? -36.772 -43.136 -38.238  1.00 6.86  ? 104 ALA A O     1 
ATOM   542   C  CB    . ALA A 1 104 ? -34.123 -44.574 -39.226  1.00 10.63 ? 104 ALA A CB    1 
ATOM   543   N  N     . ALA A 1 105 ? -35.074 -41.692 -38.229  1.00 2.60  ? 105 ALA A N     1 
ATOM   544   C  CA    . ALA A 1 105 ? -35.801 -40.970 -37.178  1.00 5.20  ? 105 ALA A CA    1 
ATOM   545   C  C     . ALA A 1 105 ? -37.096 -40.369 -37.723  1.00 2.15  ? 105 ALA A C     1 
ATOM   546   O  O     . ALA A 1 105 ? -38.141 -40.317 -37.032  1.00 6.21  ? 105 ALA A O     1 
ATOM   547   C  CB    . ALA A 1 105 ? -34.962 -39.969 -36.470  1.00 2.00  ? 105 ALA A CB    1 
ATOM   548   N  N     . ASN A 1 106 ? -37.047 -39.982 -38.990  1.00 8.52  ? 106 ASN A N     1 
ATOM   549   C  CA    . ASN A 1 106 ? -38.256 -39.611 -39.732  1.00 5.63  ? 106 ASN A CA    1 
ATOM   550   C  C     . ASN A 1 106 ? -39.285 -40.728 -39.937  1.00 6.48  ? 106 ASN A C     1 
ATOM   551   O  O     . ASN A 1 106 ? -40.443 -40.581 -39.483  1.00 7.10  ? 106 ASN A O     1 
ATOM   552   C  CB    . ASN A 1 106 ? -37.906 -38.979 -41.080  1.00 8.22  ? 106 ASN A CB    1 
ATOM   553   C  CG    . ASN A 1 106 ? -39.044 -38.144 -41.628  1.00 13.23 ? 106 ASN A CG    1 
ATOM   554   O  OD1   . ASN A 1 106 ? -39.640 -37.354 -40.886  1.00 20.03 ? 106 ASN A OD1   1 
ATOM   555   N  ND2   . ASN A 1 106 ? -39.364 -38.318 -42.915  1.00 2.00  ? 106 ASN A ND2   1 
ATOM   556   N  N     . TYR A 1 107 ? -38.865 -41.806 -40.618  1.00 2.00  ? 107 TYR A N     1 
ATOM   557   C  CA    . TYR A 1 107 ? -39.674 -43.017 -40.778  1.00 2.00  ? 107 TYR A CA    1 
ATOM   558   C  C     . TYR A 1 107 ? -40.336 -43.589 -39.480  1.00 2.00  ? 107 TYR A C     1 
ATOM   559   O  O     . TYR A 1 107 ? -41.505 -44.029 -39.512  1.00 2.00  ? 107 TYR A O     1 
ATOM   560   C  CB    . TYR A 1 107 ? -38.868 -44.081 -41.517  1.00 2.28  ? 107 TYR A CB    1 
ATOM   561   C  CG    . TYR A 1 107 ? -39.554 -45.392 -41.607  1.00 12.59 ? 107 TYR A CG    1 
ATOM   562   C  CD1   . TYR A 1 107 ? -40.673 -45.566 -42.446  1.00 19.04 ? 107 TYR A CD1   1 
ATOM   563   C  CD2   . TYR A 1 107 ? -39.115 -46.473 -40.831  1.00 12.82 ? 107 TYR A CD2   1 
ATOM   564   C  CE1   . TYR A 1 107 ? -41.337 -46.791 -42.521  1.00 2.00  ? 107 TYR A CE1   1 
ATOM   565   C  CE2   . TYR A 1 107 ? -39.744 -47.706 -40.913  1.00 5.14  ? 107 TYR A CE2   1 
ATOM   566   C  CZ    . TYR A 1 107 ? -40.854 -47.874 -41.757  1.00 26.58 ? 107 TYR A CZ    1 
ATOM   567   O  OH    . TYR A 1 107 ? -41.475 -49.133 -41.812  1.00 13.33 ? 107 TYR A OH    1 
ATOM   568   N  N     . LEU A 1 108 ? -39.605 -43.542 -38.359  1.00 2.00  ? 108 LEU A N     1 
ATOM   569   C  CA    . LEU A 1 108 ? -40.094 -44.029 -37.063  1.00 2.00  ? 108 LEU A CA    1 
ATOM   570   C  C     . LEU A 1 108 ? -40.835 -42.981 -36.257  1.00 3.06  ? 108 LEU A C     1 
ATOM   571   O  O     . LEU A 1 108 ? -41.265 -43.291 -35.129  1.00 2.00  ? 108 LEU A O     1 
ATOM   572   C  CB    . LEU A 1 108 ? -38.960 -44.551 -36.205  1.00 2.00  ? 108 LEU A CB    1 
ATOM   573   C  CG    . LEU A 1 108 ? -38.352 -45.818 -36.800  1.00 3.67  ? 108 LEU A CG    1 
ATOM   574   C  CD1   . LEU A 1 108 ? -37.633 -46.559 -35.717  1.00 11.36 ? 108 LEU A CD1   1 
ATOM   575   C  CD2   . LEU A 1 108 ? -39.477 -46.690 -37.304  1.00 2.00  ? 108 LEU A CD2   1 
ATOM   576   N  N     . ASN A 1 109 ? -40.951 -41.748 -36.812  1.00 2.00  ? 109 ASN A N     1 
ATOM   577   C  CA    . ASN A 1 109 ? -41.416 -40.594 -36.058  1.00 2.00  ? 109 ASN A CA    1 
ATOM   578   C  C     . ASN A 1 109 ? -40.882 -40.530 -34.643  1.00 3.72  ? 109 ASN A C     1 
ATOM   579   O  O     . ASN A 1 109 ? -41.643 -40.589 -33.671  1.00 2.00  ? 109 ASN A O     1 
ATOM   580   C  CB    . ASN A 1 109 ? -42.921 -40.660 -35.908  1.00 3.28  ? 109 ASN A CB    1 
ATOM   581   C  CG    . ASN A 1 109 ? -43.624 -39.888 -36.953  1.00 30.01 ? 109 ASN A CG    1 
ATOM   582   O  OD1   . ASN A 1 109 ? -43.758 -38.664 -36.829  1.00 13.93 ? 109 ASN A OD1   1 
ATOM   583   N  ND2   . ASN A 1 109 ? -44.074 -40.581 -38.020  1.00 28.55 ? 109 ASN A ND2   1 
ATOM   584   N  N     . ILE A 1 110 ? -39.580 -40.409 -34.490  1.00 3.23  ? 110 ILE A N     1 
ATOM   585   C  CA    . ILE A 1 110 ? -39.139 -40.236 -33.139  1.00 9.03  ? 110 ILE A CA    1 
ATOM   586   C  C     . ILE A 1 110 ? -38.674 -38.815 -32.935  1.00 6.12  ? 110 ILE A C     1 
ATOM   587   O  O     . ILE A 1 110 ? -37.535 -38.468 -33.282  1.00 5.11  ? 110 ILE A O     1 
ATOM   588   C  CB    . ILE A 1 110 ? -38.034 -41.204 -32.796  1.00 14.37 ? 110 ILE A CB    1 
ATOM   589   C  CG1   . ILE A 1 110 ? -38.492 -42.646 -33.090  1.00 10.71 ? 110 ILE A CG1   1 
ATOM   590   C  CG2   . ILE A 1 110 ? -37.588 -40.939 -31.348  1.00 2.00  ? 110 ILE A CG2   1 
ATOM   591   C  CD1   . ILE A 1 110 ? -37.325 -43.581 -33.393  1.00 6.73  ? 110 ILE A CD1   1 
ATOM   592   N  N     . LYS A 1 111 ? -39.565 -37.990 -32.410  1.00 2.14  ? 111 LYS A N     1 
ATOM   593   C  CA    . LYS A 1 111 ? -39.388 -36.532 -32.477  1.00 9.61  ? 111 LYS A CA    1 
ATOM   594   C  C     . LYS A 1 111 ? -38.046 -36.036 -31.847  1.00 8.03  ? 111 LYS A C     1 
ATOM   595   O  O     . LYS A 1 111 ? -37.254 -35.412 -32.555  1.00 2.00  ? 111 LYS A O     1 
ATOM   596   C  CB    . LYS A 1 111 ? -40.611 -35.809 -31.888  1.00 2.00  ? 111 LYS A CB    1 
ATOM   597   C  CG    . LYS A 1 111 ? -40.952 -34.446 -32.529  1.00 36.71 ? 111 LYS A CG    1 
ATOM   598   C  CD    . LYS A 1 111 ? -41.799 -33.518 -31.567  1.00 23.60 ? 111 LYS A CD    1 
ATOM   599   C  CE    . LYS A 1 111 ? -40.919 -32.499 -30.851  1.00 8.88  ? 111 LYS A CE    1 
ATOM   600   N  NZ    . LYS A 1 111 ? -41.182 -32.503 -29.401  1.00 2.00  ? 111 LYS A NZ    1 
ATOM   601   N  N     . ASN A 1 112 ? -37.751 -36.335 -30.565  1.00 2.00  ? 112 ASN A N     1 
ATOM   602   C  CA    . ASN A 1 112 ? -36.413 -36.029 -30.091  1.00 2.00  ? 112 ASN A CA    1 
ATOM   603   C  C     . ASN A 1 112 ? -35.136 -36.249 -30.881  1.00 2.19  ? 112 ASN A C     1 
ATOM   604   O  O     . ASN A 1 112 ? -34.154 -35.501 -30.738  1.00 2.00  ? 112 ASN A O     1 
ATOM   605   C  CB    . ASN A 1 112 ? -36.251 -35.745 -28.622  1.00 6.75  ? 112 ASN A CB    1 
ATOM   606   C  CG    . ASN A 1 112 ? -36.850 -36.813 -27.745  1.00 29.19 ? 112 ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1 112 ? -37.802 -36.543 -26.982  1.00 12.67 ? 112 ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1 112 ? -36.268 -38.030 -27.796  1.00 4.16  ? 112 ASN A ND2   1 
ATOM   609   N  N     . LEU A 1 113 ? -35.174 -37.285 -31.728  1.00 7.31  ? 113 LEU A N     1 
ATOM   610   C  CA    . LEU A 1 113 ? -33.995 -37.845 -32.405  1.00 2.07  ? 113 LEU A CA    1 
ATOM   611   C  C     . LEU A 1 113 ? -33.895 -37.126 -33.763  1.00 6.66  ? 113 LEU A C     1 
ATOM   612   O  O     . LEU A 1 113 ? -32.798 -36.724 -34.236  1.00 9.49  ? 113 LEU A O     1 
ATOM   613   C  CB    . LEU A 1 113 ? -34.096 -39.401 -32.572  1.00 2.00  ? 113 LEU A CB    1 
ATOM   614   C  CG    . LEU A 1 113 ? -33.102 -40.113 -33.532  1.00 2.00  ? 113 LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1 113 ? -31.733 -40.249 -32.966  1.00 2.00  ? 113 LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1 113 ? -33.531 -41.404 -34.191  1.00 7.85  ? 113 LEU A CD2   1 
ATOM   617   N  N     . LEU A 1 114 ? -35.065 -36.925 -34.362  1.00 3.95  ? 114 LEU A N     1 
ATOM   618   C  CA    . LEU A 1 114 ? -35.195 -36.074 -35.555  1.00 10.74 ? 114 LEU A CA    1 
ATOM   619   C  C     . LEU A 1 114 ? -34.595 -34.650 -35.345  1.00 7.45  ? 114 LEU A C     1 
ATOM   620   O  O     . LEU A 1 114 ? -33.839 -34.137 -36.211  1.00 2.00  ? 114 LEU A O     1 
ATOM   621   C  CB    . LEU A 1 114 ? -36.671 -36.022 -35.982  1.00 3.62  ? 114 LEU A CB    1 
ATOM   622   C  CG    . LEU A 1 114 ? -36.958 -35.633 -37.420  1.00 17.25 ? 114 LEU A CG    1 
ATOM   623   C  CD1   . LEU A 1 114 ? -36.672 -36.817 -38.321  1.00 2.00  ? 114 LEU A CD1   1 
ATOM   624   C  CD2   . LEU A 1 114 ? -38.432 -35.118 -37.522  1.00 8.91  ? 114 LEU A CD2   1 
ATOM   625   N  N     . ASP A 1 115 ? -34.945 -34.067 -34.181  1.00 3.30  ? 115 ASP A N     1 
ATOM   626   C  CA    . ASP A 1 115 ? -34.396 -32.811 -33.657  1.00 2.30  ? 115 ASP A CA    1 
ATOM   627   C  C     . ASP A 1 115 ? -32.920 -32.941 -33.545  1.00 2.00  ? 115 ASP A C     1 
ATOM   628   O  O     . ASP A 1 115 ? -32.205 -32.235 -34.205  1.00 2.00  ? 115 ASP A O     1 
ATOM   629   C  CB    . ASP A 1 115 ? -34.974 -32.449 -32.271  1.00 2.17  ? 115 ASP A CB    1 
ATOM   630   C  CG    . ASP A 1 115 ? -36.307 -31.751 -32.362  1.00 2.00  ? 115 ASP A CG    1 
ATOM   631   O  OD1   . ASP A 1 115 ? -36.553 -31.107 -33.409  1.00 16.83 ? 115 ASP A OD1   1 
ATOM   632   O  OD2   . ASP A 1 115 ? -37.104 -31.841 -31.397  1.00 2.00  ? 115 ASP A OD2   1 
ATOM   633   N  N     . LEU A 1 116 ? -32.461 -33.863 -32.722  1.00 2.13  ? 116 LEU A N     1 
ATOM   634   C  CA    . LEU A 1 116 ? -31.050 -33.949 -32.464  1.00 2.00  ? 116 LEU A CA    1 
ATOM   635   C  C     . LEU A 1 116 ? -30.232 -34.199 -33.713  1.00 7.87  ? 116 LEU A C     1 
ATOM   636   O  O     . LEU A 1 116 ? -29.139 -33.638 -33.850  1.00 2.00  ? 116 LEU A O     1 
ATOM   637   C  CB    . LEU A 1 116 ? -30.774 -35.063 -31.509  1.00 3.93  ? 116 LEU A CB    1 
ATOM   638   C  CG    . LEU A 1 116 ? -29.305 -34.926 -31.193  1.00 4.27  ? 116 LEU A CG    1 
ATOM   639   C  CD1   . LEU A 1 116 ? -29.286 -34.319 -29.786  1.00 21.57 ? 116 LEU A CD1   1 
ATOM   640   C  CD2   . LEU A 1 116 ? -28.725 -36.329 -31.174  1.00 2.00  ? 116 LEU A CD2   1 
ATOM   641   N  N     . THR A 1 117 ? -30.725 -35.050 -34.623  1.00 2.00  ? 117 THR A N     1 
ATOM   642   C  CA    . THR A 1 117 ? -29.963 -35.293 -35.850  1.00 2.00  ? 117 THR A CA    1 
ATOM   643   C  C     . THR A 1 117 ? -30.165 -34.150 -36.854  1.00 3.98  ? 117 THR A C     1 
ATOM   644   O  O     . THR A 1 117 ? -29.283 -33.860 -37.713  1.00 2.00  ? 117 THR A O     1 
ATOM   645   C  CB    . THR A 1 117 ? -30.396 -36.575 -36.541  1.00 2.00  ? 117 THR A CB    1 
ATOM   646   O  OG1   . THR A 1 117 ? -31.810 -36.511 -36.722  1.00 2.00  ? 117 THR A OG1   1 
ATOM   647   C  CG2   . THR A 1 117 ? -30.065 -37.770 -35.678  1.00 6.13  ? 117 THR A CG2   1 
ATOM   648   N  N     . CYS A 1 118 ? -31.330 -33.508 -36.766  1.00 2.00  ? 118 CYS A N     1 
ATOM   649   C  CA    . CYS A 1 118 ? -31.507 -32.235 -37.454  1.00 6.50  ? 118 CYS A CA    1 
ATOM   650   C  C     . CYS A 1 118 ? -30.646 -31.026 -37.053  1.00 2.00  ? 118 CYS A C     1 
ATOM   651   O  O     . CYS A 1 118 ? -30.014 -30.456 -37.948  1.00 2.00  ? 118 CYS A O     1 
ATOM   652   C  CB    . CYS A 1 118 ? -32.971 -31.906 -37.726  1.00 17.14 ? 118 CYS A CB    1 
ATOM   653   S  SG    . CYS A 1 118 ? -33.622 -32.957 -39.047  1.00 10.00 ? 118 CYS A SG    1 
ATOM   654   N  N     . GLN A 1 119 ? -30.570 -30.688 -35.748  1.00 2.00  ? 119 GLN A N     1 
ATOM   655   C  CA    . GLN A 1 119 ? -29.559 -29.730 -35.258  1.00 2.00  ? 119 GLN A CA    1 
ATOM   656   C  C     . GLN A 1 119 ? -28.245 -30.040 -35.896  1.00 2.00  ? 119 GLN A C     1 
ATOM   657   O  O     . GLN A 1 119 ? -27.508 -29.152 -36.300  1.00 2.02  ? 119 GLN A O     1 
ATOM   658   C  CB    . GLN A 1 119 ? -29.393 -29.715 -33.743  1.00 2.00  ? 119 GLN A CB    1 
ATOM   659   C  CG    . GLN A 1 119 ? -30.708 -29.584 -33.033  1.00 7.28  ? 119 GLN A CG    1 
ATOM   660   C  CD    . GLN A 1 119 ? -30.611 -29.801 -31.539  1.00 29.37 ? 119 GLN A CD    1 
ATOM   661   O  OE1   . GLN A 1 119 ? -30.683 -30.949 -31.040  1.00 9.76  ? 119 GLN A OE1   1 
ATOM   662   N  NE2   . GLN A 1 119 ? -30.459 -28.691 -30.799  1.00 13.22 ? 119 GLN A NE2   1 
ATOM   663   N  N     . THR A 1 120 ? -27.962 -31.318 -36.021  1.00 2.00  ? 120 THR A N     1 
ATOM   664   C  CA    . THR A 1 120 ? -26.597 -31.732 -36.192  1.00 2.00  ? 120 THR A CA    1 
ATOM   665   C  C     . THR A 1 120 ? -26.166 -31.512 -37.620  1.00 2.00  ? 120 THR A C     1 
ATOM   666   O  O     . THR A 1 120 ? -25.047 -31.052 -37.893  1.00 2.00  ? 120 THR A O     1 
ATOM   667   C  CB    . THR A 1 120 ? -26.423 -33.199 -35.839  1.00 4.05  ? 120 THR A CB    1 
ATOM   668   O  OG1   . THR A 1 120 ? -26.571 -33.356 -34.420  1.00 2.00  ? 120 THR A OG1   1 
ATOM   669   C  CG2   . THR A 1 120 ? -25.027 -33.687 -36.290  1.00 2.00  ? 120 THR A CG2   1 
ATOM   670   N  N     . VAL A 1 121 ? -27.070 -31.827 -38.535  1.00 2.00  ? 121 VAL A N     1 
ATOM   671   C  CA    . VAL A 1 121 ? -26.912 -31.385 -39.930  1.00 2.00  ? 121 VAL A CA    1 
ATOM   672   C  C     . VAL A 1 121 ? -26.903 -29.871 -40.120  1.00 6.55  ? 121 VAL A C     1 
ATOM   673   O  O     . VAL A 1 121 ? -26.100 -29.342 -40.902  1.00 14.50 ? 121 VAL A O     1 
ATOM   674   C  CB    . VAL A 1 121 ? -27.953 -32.006 -40.864  1.00 2.00  ? 121 VAL A CB    1 
ATOM   675   C  CG1   . VAL A 1 121 ? -27.680 -31.554 -42.285  1.00 2.00  ? 121 VAL A CG1   1 
ATOM   676   C  CG2   . VAL A 1 121 ? -27.884 -33.571 -40.756  1.00 2.00  ? 121 VAL A CG2   1 
ATOM   677   N  N     . ALA A 1 122 ? -27.775 -29.165 -39.408  1.00 5.55  ? 122 ALA A N     1 
ATOM   678   C  CA    . ALA A 1 122 ? -27.712 -27.721 -39.408  1.00 2.00  ? 122 ALA A CA    1 
ATOM   679   C  C     . ALA A 1 122 ? -26.295 -27.259 -39.101  1.00 8.19  ? 122 ALA A C     1 
ATOM   680   O  O     . ALA A 1 122 ? -25.742 -26.464 -39.882  1.00 5.56  ? 122 ALA A O     1 
ATOM   681   C  CB    . ALA A 1 122 ? -28.680 -27.149 -38.421  1.00 2.88  ? 122 ALA A CB    1 
ATOM   682   N  N     . ASP A 1 123 ? -25.703 -27.729 -37.994  1.00 2.00  ? 123 ASP A N     1 
ATOM   683   C  CA    . ASP A 1 123 ? -24.470 -27.096 -37.517  1.00 2.00  ? 123 ASP A CA    1 
ATOM   684   C  C     . ASP A 1 123 ? -23.358 -27.284 -38.564  1.00 2.77  ? 123 ASP A C     1 
ATOM   685   O  O     . ASP A 1 123 ? -22.373 -26.551 -38.575  1.00 2.00  ? 123 ASP A O     1 
ATOM   686   C  CB    . ASP A 1 123 ? -24.046 -27.562 -36.117  1.00 2.00  ? 123 ASP A CB    1 
ATOM   687   C  CG    . ASP A 1 123 ? -25.076 -27.224 -35.058  1.00 2.00  ? 123 ASP A CG    1 
ATOM   688   O  OD1   . ASP A 1 123 ? -26.096 -26.629 -35.387  1.00 7.04  ? 123 ASP A OD1   1 
ATOM   689   O  OD2   . ASP A 1 123 ? -24.927 -27.563 -33.894  1.00 2.50  ? 123 ASP A OD2   1 
ATOM   690   N  N     . MET A 1 124 ? -23.559 -28.228 -39.483  1.00 2.00  ? 124 MET A N     1 
ATOM   691   C  CA    . MET A 1 124 ? -22.681 -28.394 -40.663  1.00 7.33  ? 124 MET A CA    1 
ATOM   692   C  C     . MET A 1 124 ? -22.977 -27.413 -41.823  1.00 8.54  ? 124 MET A C     1 
ATOM   693   O  O     . MET A 1 124 ? -22.117 -27.169 -42.685  1.00 2.00  ? 124 MET A O     1 
ATOM   694   C  CB    . MET A 1 124 ? -22.778 -29.830 -41.223  1.00 13.49 ? 124 MET A CB    1 
ATOM   695   C  CG    . MET A 1 124 ? -22.876 -30.979 -40.187  1.00 20.58 ? 124 MET A CG    1 
ATOM   696   S  SD    . MET A 1 124 ? -22.877 -32.616 -40.995  1.00 10.35 ? 124 MET A SD    1 
ATOM   697   C  CE    . MET A 1 124 ? -21.611 -33.566 -40.054  1.00 23.86 ? 124 MET A CE    1 
ATOM   698   N  N     . ILE A 1 125 ? -24.209 -26.907 -41.870  1.00 2.00  ? 125 ILE A N     1 
ATOM   699   C  CA    . ILE A 1 125 ? -24.515 -25.835 -42.780  1.00 12.87 ? 125 ILE A CA    1 
ATOM   700   C  C     . ILE A 1 125 ? -23.852 -24.512 -42.422  1.00 7.15  ? 125 ILE A C     1 
ATOM   701   O  O     . ILE A 1 125 ? -23.338 -23.857 -43.314  1.00 7.97  ? 125 ILE A O     1 
ATOM   702   C  CB    . ILE A 1 125 ? -26.029 -25.658 -43.032  1.00 25.20 ? 125 ILE A CB    1 
ATOM   703   C  CG1   . ILE A 1 125 ? -26.654 -27.028 -43.363  1.00 8.24  ? 125 ILE A CG1   1 
ATOM   704   C  CG2   . ILE A 1 125 ? -26.264 -24.624 -44.167  1.00 2.00  ? 125 ILE A CG2   1 
ATOM   705   C  CD1   . ILE A 1 125 ? -25.733 -27.869 -44.122  1.00 21.18 ? 125 ILE A CD1   1 
ATOM   706   N  N     . LYS A 1 126 ? -23.806 -24.182 -41.132  1.00 2.00  ? 126 LYS A N     1 
ATOM   707   C  CA    . LYS A 1 126 ? -23.754 -22.799 -40.659  1.00 2.00  ? 126 LYS A CA    1 
ATOM   708   C  C     . LYS A 1 126 ? -22.358 -22.304 -40.903  1.00 2.00  ? 126 LYS A C     1 
ATOM   709   O  O     . LYS A 1 126 ? -21.445 -23.104 -40.950  1.00 2.00  ? 126 LYS A O     1 
ATOM   710   C  CB    . LYS A 1 126 ? -24.064 -22.690 -39.140  1.00 2.04  ? 126 LYS A CB    1 
ATOM   711   C  CG    . LYS A 1 126 ? -25.268 -23.534 -38.626  1.00 18.58 ? 126 LYS A CG    1 
ATOM   712   C  CD    . LYS A 1 126 ? -26.032 -22.896 -37.464  1.00 2.00  ? 126 LYS A CD    1 
ATOM   713   C  CE    . LYS A 1 126 ? -25.363 -23.167 -36.099  1.00 25.32 ? 126 LYS A CE    1 
ATOM   714   N  NZ    . LYS A 1 126 ? -26.315 -23.219 -34.926  1.00 2.00  ? 126 LYS A NZ    1 
ATOM   715   N  N     . GLY A 1 127 ? -22.196 -20.994 -41.080  1.00 2.00  ? 127 GLY A N     1 
ATOM   716   C  CA    . GLY A 1 127 ? -20.907 -20.430 -41.440  1.00 2.00  ? 127 GLY A CA    1 
ATOM   717   C  C     . GLY A 1 127 ? -20.422 -20.772 -42.832  1.00 2.00  ? 127 GLY A C     1 
ATOM   718   O  O     . GLY A 1 127 ? -19.388 -20.309 -43.245  1.00 2.00  ? 127 GLY A O     1 
ATOM   719   N  N     . LYS A 1 128 ? -21.116 -21.626 -43.564  1.00 2.00  ? 128 LYS A N     1 
ATOM   720   C  CA    . LYS A 1 128 ? -20.478 -22.273 -44.708  1.00 2.00  ? 128 LYS A CA    1 
ATOM   721   C  C     . LYS A 1 128 ? -21.085 -21.639 -45.918  1.00 2.00  ? 128 LYS A C     1 
ATOM   722   O  O     . LYS A 1 128 ? -22.235 -21.166 -45.858  1.00 2.00  ? 128 LYS A O     1 
ATOM   723   C  CB    . LYS A 1 128 ? -20.756 -23.791 -44.734  1.00 2.00  ? 128 LYS A CB    1 
ATOM   724   C  CG    . LYS A 1 128 ? -19.605 -24.673 -44.143  1.00 2.30  ? 128 LYS A CG    1 
ATOM   725   C  CD    . LYS A 1 128 ? -19.685 -26.104 -44.630  1.00 2.00  ? 128 LYS A CD    1 
ATOM   726   C  CE    . LYS A 1 128 ? -19.340 -27.095 -43.487  1.00 22.86 ? 128 LYS A CE    1 
ATOM   727   N  NZ    . LYS A 1 128 ? -19.394 -28.563 -43.897  1.00 15.92 ? 128 LYS A NZ    1 
ATOM   728   N  N     . THR A 1 129 ? -20.330 -21.661 -47.016  1.00 2.00  ? 129 THR A N     1 
ATOM   729   C  CA    . THR A 1 129 ? -20.785 -21.208 -48.333  1.00 2.00  ? 129 THR A CA    1 
ATOM   730   C  C     . THR A 1 129 ? -21.521 -22.274 -49.146  1.00 4.35  ? 129 THR A C     1 
ATOM   731   O  O     . THR A 1 129 ? -21.376 -23.469 -48.891  1.00 16.80 ? 129 THR A O     1 
ATOM   732   C  CB    . THR A 1 129 ? -19.574 -20.803 -49.167  1.00 2.00  ? 129 THR A CB    1 
ATOM   733   O  OG1   . THR A 1 129 ? -19.103 -21.950 -49.879  1.00 7.42  ? 129 THR A OG1   1 
ATOM   734   C  CG2   . THR A 1 129 ? -18.442 -20.259 -48.262  1.00 2.00  ? 129 THR A CG2   1 
ATOM   735   N  N     . PRO A 1 130 ? -22.257 -21.855 -50.184  1.00 8.29  ? 130 PRO A N     1 
ATOM   736   C  CA    . PRO A 1 130 ? -22.954 -22.761 -51.115  1.00 7.30  ? 130 PRO A CA    1 
ATOM   737   C  C     . PRO A 1 130 ? -22.057 -23.906 -51.656  1.00 12.39 ? 130 PRO A C     1 
ATOM   738   O  O     . PRO A 1 130 ? -22.343 -25.080 -51.392  1.00 19.04 ? 130 PRO A O     1 
ATOM   739   C  CB    . PRO A 1 130 ? -23.341 -21.837 -52.272  1.00 9.22  ? 130 PRO A CB    1 
ATOM   740   C  CG    . PRO A 1 130 ? -23.411 -20.476 -51.652  1.00 5.99  ? 130 PRO A CG    1 
ATOM   741   C  CD    . PRO A 1 130 ? -22.389 -20.441 -50.566  1.00 2.00  ? 130 PRO A CD    1 
ATOM   742   N  N     . GLU A 1 131 ? -21.000 -23.558 -52.408  1.00 8.23  ? 131 GLU A N     1 
ATOM   743   C  CA    . GLU A 1 131 ? -19.986 -24.515 -52.935  1.00 10.65 ? 131 GLU A CA    1 
ATOM   744   C  C     . GLU A 1 131 ? -19.303 -25.418 -51.905  1.00 4.50  ? 131 GLU A C     1 
ATOM   745   O  O     . GLU A 1 131 ? -18.785 -26.436 -52.288  1.00 14.62 ? 131 GLU A O     1 
ATOM   746   C  CB    . GLU A 1 131 ? -18.872 -23.813 -53.754  1.00 9.11  ? 131 GLU A CB    1 
ATOM   747   C  CG    . GLU A 1 131 ? -19.339 -23.123 -55.041  1.00 24.00 ? 131 GLU A CG    1 
ATOM   748   C  CD    . GLU A 1 131 ? -19.844 -21.648 -54.853  1.00 30.42 ? 131 GLU A CD    1 
ATOM   749   O  OE1   . GLU A 1 131 ? -19.985 -21.147 -53.701  1.00 2.00  ? 131 GLU A OE1   1 
ATOM   750   O  OE2   . GLU A 1 131 ? -20.113 -20.986 -55.892  1.00 2.00  ? 131 GLU A OE2   1 
ATOM   751   N  N     . GLU A 1 132 ? -19.256 -25.028 -50.633  1.00 2.00  ? 132 GLU A N     1 
ATOM   752   C  CA    . GLU A 1 132 ? -18.750 -25.879 -49.584  1.00 2.00  ? 132 GLU A CA    1 
ATOM   753   C  C     . GLU A 1 132 ? -19.838 -26.761 -49.013  1.00 4.35  ? 132 GLU A C     1 
ATOM   754   O  O     . GLU A 1 132 ? -19.589 -27.938 -48.719  1.00 3.10  ? 132 GLU A O     1 
ATOM   755   C  CB    . GLU A 1 132 ? -18.133 -25.081 -48.446  1.00 2.00  ? 132 GLU A CB    1 
ATOM   756   C  CG    . GLU A 1 132 ? -17.509 -23.802 -48.851  1.00 2.00  ? 132 GLU A CG    1 
ATOM   757   C  CD    . GLU A 1 132 ? -17.144 -22.950 -47.653  1.00 16.49 ? 132 GLU A CD    1 
ATOM   758   O  OE1   . GLU A 1 132 ? -17.900 -22.000 -47.305  1.00 13.72 ? 132 GLU A OE1   1 
ATOM   759   O  OE2   . GLU A 1 132 ? -16.095 -23.236 -47.049  1.00 2.00  ? 132 GLU A OE2   1 
ATOM   760   N  N     . ILE A 1 133 ? -21.026 -26.184 -48.822  1.00 5.86  ? 133 ILE A N     1 
ATOM   761   C  CA    . ILE A 1 133 ? -22.225 -26.969 -48.521  1.00 6.13  ? 133 ILE A CA    1 
ATOM   762   C  C     . ILE A 1 133 ? -22.416 -28.008 -49.620  1.00 7.49  ? 133 ILE A C     1 
ATOM   763   O  O     . ILE A 1 133 ? -22.554 -29.201 -49.356  1.00 12.89 ? 133 ILE A O     1 
ATOM   764   C  CB    . ILE A 1 133 ? -23.467 -26.087 -48.408  1.00 3.65  ? 133 ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1 133 ? -23.408 -25.228 -47.133  1.00 9.72  ? 133 ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1 133 ? -24.756 -26.906 -48.470  1.00 2.00  ? 133 ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1 133 ? -24.474 -24.062 -47.119  1.00 2.00  ? 133 ILE A CD1   1 
ATOM   768   N  N     . ARG A 1 134 ? -22.372 -27.571 -50.864  1.00 7.73  ? 134 ARG A N     1 
ATOM   769   C  CA    . ARG A 1 134 ? -22.505 -28.514 -51.955  1.00 5.61  ? 134 ARG A CA    1 
ATOM   770   C  C     . ARG A 1 134 ? -21.231 -29.342 -52.274  1.00 15.31 ? 134 ARG A C     1 
ATOM   771   O  O     . ARG A 1 134 ? -21.219 -30.220 -53.174  1.00 14.14 ? 134 ARG A O     1 
ATOM   772   C  CB    . ARG A 1 134 ? -23.287 -27.917 -53.159  1.00 2.00  ? 134 ARG A CB    1 
ATOM   773   C  CG    . ARG A 1 134 ? -22.489 -27.244 -54.206  1.00 2.00  ? 134 ARG A CG    1 
ATOM   774   C  CD    . ARG A 1 134 ? -23.404 -26.637 -55.275  1.00 2.00  ? 134 ARG A CD    1 
ATOM   775   N  NE    . ARG A 1 134 ? -22.793 -25.429 -55.813  1.00 2.00  ? 134 ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1 134 ? -23.214 -24.186 -55.581  1.00 2.00  ? 134 ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1 134 ? -24.285 -23.967 -54.840  1.00 21.67 ? 134 ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1 134 ? -22.578 -23.150 -56.114  1.00 2.05  ? 134 ARG A NH2   1 
ATOM   779   N  N     . THR A 1 135 ? -20.171 -29.129 -51.492  1.00 11.98 ? 135 THR A N     1 
ATOM   780   C  CA    . THR A 1 135 ? -19.186 -30.184 -51.357  1.00 4.01  ? 135 THR A CA    1 
ATOM   781   C  C     . THR A 1 135 ? -19.696 -31.079 -50.285  1.00 3.26  ? 135 THR A C     1 
ATOM   782   O  O     . THR A 1 135 ? -19.965 -32.239 -50.544  1.00 2.66  ? 135 THR A O     1 
ATOM   783   C  CB    . THR A 1 135 ? -17.753 -29.699 -50.983  1.00 13.95 ? 135 THR A CB    1 
ATOM   784   O  OG1   . THR A 1 135 ? -16.952 -29.619 -52.173  1.00 2.00  ? 135 THR A OG1   1 
ATOM   785   C  CG2   . THR A 1 135 ? -17.053 -30.719 -50.010  1.00 7.65  ? 135 THR A CG2   1 
ATOM   786   N  N     . THR A 1 136 ? -19.841 -30.526 -49.080  1.00 6.11  ? 136 THR A N     1 
ATOM   787   C  CA    . THR A 1 136 ? -19.883 -31.342 -47.867  1.00 2.00  ? 136 THR A CA    1 
ATOM   788   C  C     . THR A 1 136 ? -20.976 -32.402 -48.064  1.00 2.00  ? 136 THR A C     1 
ATOM   789   O  O     . THR A 1 136 ? -21.026 -33.366 -47.342  1.00 2.00  ? 136 THR A O     1 
ATOM   790   C  CB    . THR A 1 136 ? -20.043 -30.495 -46.529  1.00 3.82  ? 136 THR A CB    1 
ATOM   791   O  OG1   . THR A 1 136 ? -20.282 -29.109 -46.831  1.00 2.12  ? 136 THR A OG1   1 
ATOM   792   C  CG2   . THR A 1 136 ? -18.770 -30.579 -45.645  1.00 2.00  ? 136 THR A CG2   1 
ATOM   793   N  N     . PHE A 1 137 ? -21.794 -32.242 -49.107  1.00 2.00  ? 137 PHE A N     1 
ATOM   794   C  CA    . PHE A 1 137 ? -23.140 -32.844 -49.191  1.00 2.00  ? 137 PHE A CA    1 
ATOM   795   C  C     . PHE A 1 137 ? -23.457 -33.687 -50.436  1.00 3.43  ? 137 PHE A C     1 
ATOM   796   O  O     . PHE A 1 137 ? -24.532 -34.290 -50.527  1.00 2.00  ? 137 PHE A O     1 
ATOM   797   C  CB    . PHE A 1 137 ? -24.198 -31.754 -49.113  1.00 2.00  ? 137 PHE A CB    1 
ATOM   798   C  CG    . PHE A 1 137 ? -24.839 -31.658 -47.785  1.00 3.06  ? 137 PHE A CG    1 
ATOM   799   C  CD1   . PHE A 1 137 ? -26.160 -32.014 -47.619  1.00 11.39 ? 137 PHE A CD1   1 
ATOM   800   C  CD2   . PHE A 1 137 ? -24.110 -31.240 -46.686  1.00 2.00  ? 137 PHE A CD2   1 
ATOM   801   C  CE1   . PHE A 1 137 ? -26.747 -31.944 -46.376  1.00 19.11 ? 137 PHE A CE1   1 
ATOM   802   C  CE2   . PHE A 1 137 ? -24.689 -31.166 -45.438  1.00 6.84  ? 137 PHE A CE2   1 
ATOM   803   C  CZ    . PHE A 1 137 ? -26.007 -31.518 -45.281  1.00 9.21  ? 137 PHE A CZ    1 
ATOM   804   N  N     . ASN A 1 138 ? -22.507 -33.703 -51.363  1.00 11.80 ? 138 ASN A N     1 
ATOM   805   C  CA    . ASN A 1 138 ? -22.713 -34.191 -52.716  1.00 12.58 ? 138 ASN A CA    1 
ATOM   806   C  C     . ASN A 1 138 ? -23.925 -33.614 -53.410  1.00 14.79 ? 138 ASN A C     1 
ATOM   807   O  O     . ASN A 1 138 ? -24.785 -34.348 -53.876  1.00 7.16  ? 138 ASN A O     1 
ATOM   808   C  CB    . ASN A 1 138 ? -22.798 -35.704 -52.730  1.00 2.09  ? 138 ASN A CB    1 
ATOM   809   C  CG    . ASN A 1 138 ? -21.449 -36.354 -52.708  1.00 17.88 ? 138 ASN A CG    1 
ATOM   810   O  OD1   . ASN A 1 138 ? -20.468 -35.784 -53.181  1.00 18.27 ? 138 ASN A OD1   1 
ATOM   811   N  ND2   . ASN A 1 138 ? -21.384 -37.560 -52.160  1.00 19.10 ? 138 ASN A ND2   1 
ATOM   812   N  N     . ILE A 1 139 ? -23.993 -32.298 -53.500  1.00 5.37  ? 139 ILE A N     1 
ATOM   813   C  CA    . ILE A 1 139 ? -25.000 -31.699 -54.343  1.00 6.85  ? 139 ILE A CA    1 
ATOM   814   C  C     . ILE A 1 139 ? -24.385 -31.153 -55.606  1.00 7.52  ? 139 ILE A C     1 
ATOM   815   O  O     . ILE A 1 139 ? -23.332 -30.534 -55.580  1.00 2.00  ? 139 ILE A O     1 
ATOM   816   C  CB    . ILE A 1 139 ? -25.774 -30.622 -53.591  1.00 6.15  ? 139 ILE A CB    1 
ATOM   817   C  CG1   . ILE A 1 139 ? -26.103 -31.098 -52.184  1.00 4.86  ? 139 ILE A CG1   1 
ATOM   818   C  CG2   . ILE A 1 139 ? -27.055 -30.306 -54.309  1.00 3.24  ? 139 ILE A CG2   1 
ATOM   819   C  CD1   . ILE A 1 139 ? -27.520 -30.828 -51.789  1.00 2.00  ? 139 ILE A CD1   1 
ATOM   820   N  N     . LYS A 1 140 ? -25.042 -31.412 -56.722  1.00 6.45  ? 140 LYS A N     1 
ATOM   821   C  CA    . LYS A 1 140 ? -24.665 -30.798 -57.975  1.00 4.83  ? 140 LYS A CA    1 
ATOM   822   C  C     . LYS A 1 140 ? -25.364 -29.466 -58.122  1.00 4.92  ? 140 LYS A C     1 
ATOM   823   O  O     . LYS A 1 140 ? -26.567 -29.356 -57.915  1.00 2.00  ? 140 LYS A O     1 
ATOM   824   C  CB    . LYS A 1 140 ? -25.030 -31.707 -59.148  1.00 2.00  ? 140 LYS A CB    1 
ATOM   825   C  CG    . LYS A 1 140 ? -24.277 -31.407 -60.425  1.00 2.00  ? 140 LYS A CG    1 
ATOM   826   C  CD    . LYS A 1 140 ? -25.227 -31.194 -61.590  1.00 2.00  ? 140 LYS A CD    1 
ATOM   827   C  CE    . LYS A 1 140 ? -24.794 -31.999 -62.817  1.00 2.00  ? 140 LYS A CE    1 
ATOM   828   N  NZ    . LYS A 1 140 ? -24.635 -31.155 -64.033  1.00 2.00  ? 140 LYS A NZ    1 
ATOM   829   N  N     . ASN A 1 141 ? -24.605 -28.450 -58.501  1.00 2.00  ? 141 ASN A N     1 
ATOM   830   C  CA    . ASN A 1 141 ? -25.214 -27.194 -58.801  1.00 2.03  ? 141 ASN A CA    1 
ATOM   831   C  C     . ASN A 1 141 ? -26.020 -27.175 -60.099  1.00 3.94  ? 141 ASN A C     1 
ATOM   832   O  O     . ASN A 1 141 ? -25.462 -27.350 -61.183  1.00 2.58  ? 141 ASN A O     1 
ATOM   833   C  CB    . ASN A 1 141 ? -24.172 -26.094 -58.826  1.00 5.63  ? 141 ASN A CB    1 
ATOM   834   C  CG    . ASN A 1 141 ? -24.800 -24.755 -59.018  1.00 2.00  ? 141 ASN A CG    1 
ATOM   835   O  OD1   . ASN A 1 141 ? -26.015 -24.664 -59.174  1.00 2.00  ? 141 ASN A OD1   1 
ATOM   836   N  ND2   . ASN A 1 141 ? -23.995 -23.704 -58.985  1.00 3.45  ? 141 ASN A ND2   1 
ATOM   837   N  N     . ASP A 1 142 ? -27.328 -26.939 -59.988  1.00 2.00  ? 142 ASP A N     1 
ATOM   838   C  CA    . ASP A 1 142 ? -28.204 -26.850 -61.161  1.00 2.00  ? 142 ASP A CA    1 
ATOM   839   C  C     . ASP A 1 142 ? -28.752 -25.447 -61.311  1.00 11.89 ? 142 ASP A C     1 
ATOM   840   O  O     . ASP A 1 142 ? -29.932 -25.259 -61.666  1.00 11.23 ? 142 ASP A O     1 
ATOM   841   C  CB    . ASP A 1 142 ? -29.392 -27.734 -60.938  1.00 2.00  ? 142 ASP A CB    1 
ATOM   842   C  CG    . ASP A 1 142 ? -30.095 -27.433 -59.634  1.00 3.21  ? 142 ASP A CG    1 
ATOM   843   O  OD1   . ASP A 1 142 ? -29.496 -26.829 -58.699  1.00 2.00  ? 142 ASP A OD1   1 
ATOM   844   O  OD2   . ASP A 1 142 ? -31.272 -27.810 -59.553  1.00 2.00  ? 142 ASP A OD2   1 
ATOM   845   N  N     . PHE A 1 143 ? -27.903 -24.467 -60.998  1.00 13.42 ? 143 PHE A N     1 
ATOM   846   C  CA    . PHE A 1 143 ? -28.077 -23.105 -61.482  1.00 11.05 ? 143 PHE A CA    1 
ATOM   847   C  C     . PHE A 1 143 ? -27.236 -22.874 -62.716  1.00 2.72  ? 143 PHE A C     1 
ATOM   848   O  O     . PHE A 1 143 ? -26.064 -23.302 -62.821  1.00 2.00  ? 143 PHE A O     1 
ATOM   849   C  CB    . PHE A 1 143 ? -27.753 -22.047 -60.395  1.00 10.04 ? 143 PHE A CB    1 
ATOM   850   C  CG    . PHE A 1 143 ? -28.773 -21.982 -59.238  1.00 7.25  ? 143 PHE A CG    1 
ATOM   851   C  CD1   . PHE A 1 143 ? -28.400 -22.396 -57.930  1.00 2.00  ? 143 PHE A CD1   1 
ATOM   852   C  CD2   . PHE A 1 143 ? -30.074 -21.469 -59.450  1.00 2.00  ? 143 PHE A CD2   1 
ATOM   853   C  CE1   . PHE A 1 143 ? -29.298 -22.296 -56.852  1.00 2.00  ? 143 PHE A CE1   1 
ATOM   854   C  CE2   . PHE A 1 143 ? -31.005 -21.374 -58.374  1.00 4.04  ? 143 PHE A CE2   1 
ATOM   855   C  CZ    . PHE A 1 143 ? -30.623 -21.789 -57.064  1.00 2.00  ? 143 PHE A CZ    1 
ATOM   856   N  N     . THR A 1 144 ? -27.851 -22.183 -63.662  1.00 2.95  ? 144 THR A N     1 
ATOM   857   C  CA    . THR A 1 144 ? -27.058 -21.451 -64.611  1.00 7.03  ? 144 THR A CA    1 
ATOM   858   C  C     . THR A 1 144 ? -26.268 -20.319 -63.940  1.00 10.24 ? 144 THR A C     1 
ATOM   859   O  O     . THR A 1 144 ? -26.715 -19.707 -62.930  1.00 9.04  ? 144 THR A O     1 
ATOM   860   C  CB    . THR A 1 144 ? -27.818 -21.103 -65.927  1.00 9.14  ? 144 THR A CB    1 
ATOM   861   O  OG1   . THR A 1 144 ? -28.726 -20.011 -65.742  1.00 2.00  ? 144 THR A OG1   1 
ATOM   862   C  CG2   . THR A 1 144 ? -28.601 -22.355 -66.415  1.00 7.13  ? 144 THR A CG2   1 
ATOM   863   N  N     . PRO A 1 145 ? -25.063 -20.073 -64.468  1.00 7.81  ? 145 PRO A N     1 
ATOM   864   C  CA    . PRO A 1 145 ? -24.379 -18.798 -64.343  1.00 2.76  ? 145 PRO A CA    1 
ATOM   865   C  C     . PRO A 1 145 ? -25.394 -17.725 -63.943  1.00 4.10  ? 145 PRO A C     1 
ATOM   866   O  O     . PRO A 1 145 ? -25.288 -17.100 -62.877  1.00 8.55  ? 145 PRO A O     1 
ATOM   867   C  CB    . PRO A 1 145 ? -23.876 -18.579 -65.778  1.00 2.00  ? 145 PRO A CB    1 
ATOM   868   C  CG    . PRO A 1 145 ? -23.922 -19.990 -66.414  1.00 2.00  ? 145 PRO A CG    1 
ATOM   869   C  CD    . PRO A 1 145 ? -24.312 -20.965 -65.348  1.00 2.00  ? 145 PRO A CD    1 
ATOM   870   N  N     . GLU A 1 146 ? -26.409 -17.570 -64.782  1.00 3.02  ? 146 GLU A N     1 
ATOM   871   C  CA    . GLU A 1 146 ? -27.214 -16.365 -64.827  1.00 3.07  ? 146 GLU A CA    1 
ATOM   872   C  C     . GLU A 1 146 ? -28.184 -16.347 -63.657  1.00 4.88  ? 146 GLU A C     1 
ATOM   873   O  O     . GLU A 1 146 ? -28.344 -15.329 -62.975  1.00 2.04  ? 146 GLU A O     1 
ATOM   874   C  CB    . GLU A 1 146 ? -27.963 -16.304 -66.155  1.00 7.49  ? 146 GLU A CB    1 
ATOM   875   C  CG    . GLU A 1 146 ? -29.261 -15.528 -66.164  1.00 7.70  ? 146 GLU A CG    1 
ATOM   876   C  CD    . GLU A 1 146 ? -29.648 -15.153 -67.588  1.00 33.11 ? 146 GLU A CD    1 
ATOM   877   O  OE1   . GLU A 1 146 ? -29.418 -15.994 -68.509  1.00 19.52 ? 146 GLU A OE1   1 
ATOM   878   O  OE2   . GLU A 1 146 ? -30.161 -14.021 -67.784  1.00 17.29 ? 146 GLU A OE2   1 
ATOM   879   N  N     . GLU A 1 147 ? -28.818 -17.476 -63.399  1.00 5.20  ? 147 GLU A N     1 
ATOM   880   C  CA    . GLU A 1 147 ? -29.736 -17.518 -62.284  1.00 4.04  ? 147 GLU A CA    1 
ATOM   881   C  C     . GLU A 1 147 ? -29.079 -17.394 -60.932  1.00 2.00  ? 147 GLU A C     1 
ATOM   882   O  O     . GLU A 1 147 ? -29.727 -16.977 -59.994  1.00 2.00  ? 147 GLU A O     1 
ATOM   883   C  CB    . GLU A 1 147 ? -30.581 -18.757 -62.346  1.00 2.02  ? 147 GLU A CB    1 
ATOM   884   C  CG    . GLU A 1 147 ? -30.555 -19.423 -63.692  1.00 19.29 ? 147 GLU A CG    1 
ATOM   885   C  CD    . GLU A 1 147 ? -31.247 -20.763 -63.643  1.00 18.10 ? 147 GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1 147 ? -30.574 -21.779 -63.335  1.00 2.00  ? 147 GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1 147 ? -32.466 -20.772 -63.878  1.00 2.00  ? 147 GLU A OE2   1 
ATOM   888   N  N     . GLU A 1 148 ? -27.837 -17.840 -60.835  1.00 2.00  ? 148 GLU A N     1 
ATOM   889   C  CA    . GLU A 1 148 ? -27.183 -17.966 -59.553  1.00 2.00  ? 148 GLU A CA    1 
ATOM   890   C  C     . GLU A 1 148 ? -26.826 -16.558 -59.126  1.00 2.00  ? 148 GLU A C     1 
ATOM   891   O  O     . GLU A 1 148 ? -26.790 -16.239 -57.948  1.00 2.00  ? 148 GLU A O     1 
ATOM   892   C  CB    . GLU A 1 148 ? -25.930 -18.815 -59.677  1.00 2.00  ? 148 GLU A CB    1 
ATOM   893   C  CG    . GLU A 1 148 ? -25.251 -19.090 -58.356  1.00 12.39 ? 148 GLU A CG    1 
ATOM   894   C  CD    . GLU A 1 148 ? -23.932 -19.820 -58.499  1.00 20.65 ? 148 GLU A CD    1 
ATOM   895   O  OE1   . GLU A 1 148 ? -23.299 -20.093 -57.462  1.00 15.77 ? 148 GLU A OE1   1 
ATOM   896   O  OE2   . GLU A 1 148 ? -23.533 -20.122 -59.641  1.00 5.38  ? 148 GLU A OE2   1 
ATOM   897   N  N     . GLU A 1 149 ? -26.584 -15.713 -60.114  1.00 2.00  ? 149 GLU A N     1 
ATOM   898   C  CA    . GLU A 1 149 ? -26.163 -14.348 -59.879  1.00 2.30  ? 149 GLU A CA    1 
ATOM   899   C  C     . GLU A 1 149 ? -27.345 -13.459 -59.550  1.00 4.15  ? 149 GLU A C     1 
ATOM   900   O  O     . GLU A 1 149 ? -27.250 -12.603 -58.694  1.00 9.44  ? 149 GLU A O     1 
ATOM   901   C  CB    . GLU A 1 149 ? -25.421 -13.800 -61.094  1.00 2.00  ? 149 GLU A CB    1 
ATOM   902   C  CG    . GLU A 1 149 ? -26.173 -12.698 -61.814  1.00 4.39  ? 149 GLU A CG    1 
ATOM   903   C  CD    . GLU A 1 149 ? -25.294 -11.904 -62.753  1.00 16.08 ? 149 GLU A CD    1 
ATOM   904   O  OE1   . GLU A 1 149 ? -25.730 -10.830 -63.209  1.00 13.62 ? 149 GLU A OE1   1 
ATOM   905   O  OE2   . GLU A 1 149 ? -24.169 -12.357 -63.039  1.00 17.25 ? 149 GLU A OE2   1 
ATOM   906   N  N     . GLU A 1 150 ? -28.460 -13.670 -60.229  1.00 2.00  ? 150 GLU A N     1 
ATOM   907   C  CA    . GLU A 1 150 ? -29.702 -13.018 -59.858  1.00 2.75  ? 150 GLU A CA    1 
ATOM   908   C  C     . GLU A 1 150 ? -30.082 -13.220 -58.401  1.00 2.00  ? 150 GLU A C     1 
ATOM   909   O  O     . GLU A 1 150 ? -30.587 -12.312 -57.763  1.00 2.00  ? 150 GLU A O     1 
ATOM   910   C  CB    . GLU A 1 150 ? -30.840 -13.485 -60.748  1.00 2.00  ? 150 GLU A CB    1 
ATOM   911   C  CG    . GLU A 1 150 ? -30.693 -13.063 -62.186  1.00 26.73 ? 150 GLU A CG    1 
ATOM   912   C  CD    . GLU A 1 150 ? -31.639 -11.950 -62.545  1.00 31.56 ? 150 GLU A CD    1 
ATOM   913   O  OE1   . GLU A 1 150 ? -31.845 -11.705 -63.751  1.00 2.00  ? 150 GLU A OE1   1 
ATOM   914   O  OE2   . GLU A 1 150 ? -32.172 -11.320 -61.613  1.00 7.92  ? 150 GLU A OE2   1 
ATOM   915   N  N     . VAL A 1 151 ? -29.851 -14.422 -57.892  1.00 2.00  ? 151 VAL A N     1 
ATOM   916   C  CA    . VAL A 1 151 ? -30.263 -14.784 -56.514  1.00 2.00  ? 151 VAL A CA    1 
ATOM   917   C  C     . VAL A 1 151 ? -29.274 -14.180 -55.496  1.00 2.00  ? 151 VAL A C     1 
ATOM   918   O  O     . VAL A 1 151 ? -29.682 -13.535 -54.493  1.00 2.00  ? 151 VAL A O     1 
ATOM   919   C  CB    . VAL A 1 151 ? -30.468 -16.369 -56.337  1.00 2.00  ? 151 VAL A CB    1 
ATOM   920   C  CG1   . VAL A 1 151 ? -30.304 -16.827 -54.965  1.00 2.00  ? 151 VAL A CG1   1 
ATOM   921   C  CG2   . VAL A 1 151 ? -31.808 -16.802 -56.835  1.00 2.00  ? 151 VAL A CG2   1 
ATOM   922   N  N     . ARG A 1 152 ? -27.985 -14.384 -55.746  1.00 2.00  ? 152 ARG A N     1 
ATOM   923   C  CA    . ARG A 1 152 ? -26.943 -13.864 -54.869  1.00 2.00  ? 152 ARG A CA    1 
ATOM   924   C  C     . ARG A 1 152 ? -27.163 -12.386 -54.565  1.00 2.24  ? 152 ARG A C     1 
ATOM   925   O  O     . ARG A 1 152 ? -27.613 -12.026 -53.478  1.00 7.63  ? 152 ARG A O     1 
ATOM   926   C  CB    . ARG A 1 152 ? -25.562 -14.073 -55.495  1.00 2.00  ? 152 ARG A CB    1 
ATOM   927   C  CG    . ARG A 1 152 ? -24.406 -13.886 -54.526  1.00 8.80  ? 152 ARG A CG    1 
ATOM   928   C  CD    . ARG A 1 152 ? -23.088 -14.464 -55.013  1.00 7.05  ? 152 ARG A CD    1 
ATOM   929   N  NE    . ARG A 1 152 ? -22.860 -15.813 -54.505  1.00 24.72 ? 152 ARG A NE    1 
ATOM   930   C  CZ    . ARG A 1 152 ? -22.762 -16.891 -55.271  1.00 36.76 ? 152 ARG A CZ    1 
ATOM   931   N  NH1   . ARG A 1 152 ? -22.871 -16.784 -56.588  1.00 18.12 ? 152 ARG A NH1   1 
ATOM   932   N  NH2   . ARG A 1 152 ? -22.555 -18.080 -54.722  1.00 21.04 ? 152 ARG A NH2   1 
ATOM   933   N  N     . ARG A 1 153 ? -26.842 -11.534 -55.534  1.00 2.00  ? 153 ARG A N     1 
ATOM   934   C  CA    . ARG A 1 153 ? -27.860 -10.820 -56.294  1.00 2.00  ? 153 ARG A CA    1 
ATOM   935   C  C     . ARG A 1 153 ? -28.890 -10.470 -55.224  1.00 4.53  ? 153 ARG A C     1 
ATOM   936   O  O     . ARG A 1 153 ? -28.554 -9.889  -54.192  1.00 5.56  ? 153 ARG A O     1 
ATOM   937   C  CB    . ARG A 1 153 ? -27.230 -9.672  -57.086  1.00 2.88  ? 153 ARG A CB    1 
ATOM   938   C  CG    . ARG A 1 153 ? -28.116 -8.443  -57.209  1.00 15.68 ? 153 ARG A CG    1 
ATOM   939   C  CD    . ARG A 1 153 ? -27.878 -7.630  -58.471  1.00 2.00  ? 153 ARG A CD    1 
ATOM   940   N  NE    . ARG A 1 153 ? -28.540 -8.218  -59.632  1.00 19.40 ? 153 ARG A NE    1 
ATOM   941   C  CZ    . ARG A 1 153 ? -27.919 -8.551  -60.755  1.00 30.26 ? 153 ARG A CZ    1 
ATOM   942   N  NH1   . ARG A 1 153 ? -26.613 -8.356  -60.876  1.00 26.26 ? 153 ARG A NH1   1 
ATOM   943   N  NH2   . ARG A 1 153 ? -28.601 -9.080  -61.761  1.00 2.00  ? 153 ARG A NH2   1 
ATOM   944   N  N     . GLU A 1 154 ? -30.144 -10.829 -55.478  1.00 2.00  ? 154 GLU A N     1 
ATOM   945   C  CA    . GLU A 1 154 ? -31.222 -10.568 -54.532  1.00 2.62  ? 154 GLU A CA    1 
ATOM   946   C  C     . GLU A 1 154 ? -30.855 -10.636 -53.053  1.00 5.34  ? 154 GLU A C     1 
ATOM   947   O  O     . GLU A 1 154 ? -31.290 -9.806  -52.256  1.00 2.11  ? 154 GLU A O     1 
ATOM   948   C  CB    . GLU A 1 154 ? -32.440 -11.450 -54.813  1.00 13.80 ? 154 GLU A CB    1 
ATOM   949   C  CG    . GLU A 1 154 ? -33.736 -10.679 -54.996  1.00 9.76  ? 154 GLU A CG    1 
ATOM   950   C  CD    . GLU A 1 154 ? -34.885 -11.565 -55.435  1.00 3.03  ? 154 GLU A CD    1 
ATOM   951   O  OE1   . GLU A 1 154 ? -35.427 -11.336 -56.537  1.00 2.00  ? 154 GLU A OE1   1 
ATOM   952   O  OE2   . GLU A 1 154 ? -35.246 -12.491 -54.679  1.00 2.00  ? 154 GLU A OE2   1 
ATOM   953   N  N     . ASN A 1 155 ? -30.051 -11.632 -52.694  1.00 3.65  ? 155 ASN A N     1 
ATOM   954   C  CA    . ASN A 1 155 ? -29.941 -12.077 -51.275  1.00 2.58  ? 155 ASN A CA    1 
ATOM   955   C  C     . ASN A 1 155 ? -29.171 -10.929 -50.612  1.00 5.89  ? 155 ASN A C     1 
ATOM   956   O  O     . ASN A 1 155 ? -29.618 -10.340 -49.648  1.00 2.71  ? 155 ASN A O     1 
ATOM   957   C  CB    . ASN A 1 155 ? -29.013 -13.259 -51.181  1.00 2.00  ? 155 ASN A CB    1 
ATOM   958   C  CG    . ASN A 1 155 ? -29.681 -14.565 -51.529  1.00 14.10 ? 155 ASN A CG    1 
ATOM   959   O  OD1   . ASN A 1 155 ? -30.864 -14.657 -51.858  1.00 2.58  ? 155 ASN A OD1   1 
ATOM   960   N  ND2   . ASN A 1 155 ? -28.901 -15.601 -51.454  1.00 17.37 ? 155 ASN A ND2   1 
ATOM   961   N  N     . GLN A 1 156 ? -28.016 -10.636 -51.198  1.00 2.00  ? 156 GLN A N     1 
ATOM   962   C  CA    . GLN A 1 156 ? -27.087 -9.628  -50.748  1.00 2.00  ? 156 GLN A CA    1 
ATOM   963   C  C     . GLN A 1 156 ? -27.667 -8.219  -50.855  1.00 3.42  ? 156 GLN A C     1 
ATOM   964   O  O     . GLN A 1 156 ? -27.683 -7.561  -49.888  1.00 2.00  ? 156 GLN A O     1 
ATOM   965   C  CB    . GLN A 1 156 ? -25.811 -9.684  -51.577  1.00 2.00  ? 156 GLN A CB    1 
ATOM   966   C  CG    . GLN A 1 156 ? -24.860 -10.752 -51.153  1.00 2.57  ? 156 GLN A CG    1 
ATOM   967   C  CD    . GLN A 1 156 ? -23.788 -11.013 -52.159  1.00 8.58  ? 156 GLN A CD    1 
ATOM   968   O  OE1   . GLN A 1 156 ? -23.436 -10.136 -52.938  1.00 37.15 ? 156 GLN A OE1   1 
ATOM   969   N  NE2   . GLN A 1 156 ? -23.239 -12.221 -52.146  1.00 27.70 ? 156 GLN A NE2   1 
ATOM   970   N  N     . TRP A 1 157 ? -28.190 -7.779  -52.006  1.00 2.00  ? 157 TRP A N     1 
ATOM   971   C  CA    . TRP A 1 157 ? -28.655 -6.427  -52.091  1.00 2.00  ? 157 TRP A CA    1 
ATOM   972   C  C     . TRP A 1 157 ? -29.863 -6.204  -51.250  1.00 5.29  ? 157 TRP A C     1 
ATOM   973   O  O     . TRP A 1 157 ? -30.080 -5.092  -50.802  1.00 3.08  ? 157 TRP A O     1 
ATOM   974   C  CB    . TRP A 1 157 ? -28.919 -5.965  -53.517  1.00 2.00  ? 157 TRP A CB    1 
ATOM   975   C  CG    . TRP A 1 157 ? -27.723 -5.978  -54.303  1.00 2.00  ? 157 TRP A CG    1 
ATOM   976   C  CD1   . TRP A 1 157 ? -26.596 -6.584  -53.975  1.00 2.00  ? 157 TRP A CD1   1 
ATOM   977   C  CD2   . TRP A 1 157 ? -27.509 -5.306  -55.504  1.00 2.00  ? 157 TRP A CD2   1 
ATOM   978   N  NE1   . TRP A 1 157 ? -25.687 -6.373  -54.908  1.00 2.00  ? 157 TRP A NE1   1 
ATOM   979   C  CE2   . TRP A 1 157 ? -26.202 -5.577  -55.877  1.00 2.00  ? 157 TRP A CE2   1 
ATOM   980   C  CE3   . TRP A 1 157 ? -28.295 -4.497  -56.313  1.00 2.00  ? 157 TRP A CE3   1 
ATOM   981   C  CZ2   . TRP A 1 157 ? -25.626 -5.101  -57.065  1.00 2.00  ? 157 TRP A CZ2   1 
ATOM   982   C  CZ3   . TRP A 1 157 ? -27.753 -4.030  -57.494  1.00 2.00  ? 157 TRP A CZ3   1 
ATOM   983   C  CH2   . TRP A 1 157 ? -26.414 -4.326  -57.861  1.00 2.00  ? 157 TRP A CH2   1 
ATOM   984   N  N     . ALA A 1 158 ? -30.700 -7.206  -51.038  1.00 4.87  ? 158 ALA A N     1 
ATOM   985   C  CA    . ALA A 1 158 ? -32.013 -6.878  -50.444  1.00 2.11  ? 158 ALA A CA    1 
ATOM   986   C  C     . ALA A 1 158 ? -32.180 -7.651  -49.130  1.00 2.00  ? 158 ALA A C     1 
ATOM   987   O  O     . ALA A 1 158 ? -33.030 -7.307  -48.343  1.00 7.81  ? 158 ALA A O     1 
ATOM   988   C  CB    . ALA A 1 158 ? -33.192 -7.209  -51.430  1.00 12.43 ? 158 ALA A CB    1 
ATOM   989   N  N     . PHE A 1 159 ? -31.396 -8.694  -48.863  1.00 2.43  ? 159 PHE A N     1 
ATOM   990   C  CA    . PHE A 1 159 ? -31.761 -9.541  -47.710  1.00 6.87  ? 159 PHE A CA    1 
ATOM   991   C  C     . PHE A 1 159 ? -30.753 -9.750  -46.665  1.00 2.00  ? 159 PHE A C     1 
ATOM   992   O  O     . PHE A 1 159 ? -30.973 -10.498 -45.724  1.00 5.69  ? 159 PHE A O     1 
ATOM   993   C  CB    . PHE A 1 159 ? -32.410 -10.856 -48.086  1.00 2.00  ? 159 PHE A CB    1 
ATOM   994   C  CG    . PHE A 1 159 ? -33.634 -10.711 -48.976  1.00 3.13  ? 159 PHE A CG    1 
ATOM   995   C  CD1   . PHE A 1 159 ? -33.645 -11.222 -50.281  1.00 14.95 ? 159 PHE A CD1   1 
ATOM   996   C  CD2   . PHE A 1 159 ? -34.777 -10.136 -48.526  1.00 2.00  ? 159 PHE A CD2   1 
ATOM   997   C  CE1   . PHE A 1 159 ? -34.781 -11.151 -51.111  1.00 2.00  ? 159 PHE A CE1   1 
ATOM   998   C  CE2   . PHE A 1 159 ? -35.937 -10.053 -49.390  1.00 3.85  ? 159 PHE A CE2   1 
ATOM   999   C  CZ    . PHE A 1 159 ? -35.904 -10.541 -50.673  1.00 2.00  ? 159 PHE A CZ    1 
ATOM   1000  N  N     . GLU A 1 160 ? -29.626 -9.100  -46.799  1.00 4.66  ? 160 GLU A N     1 
ATOM   1001  C  CA    . GLU A 1 160 ? -28.702 -9.100  -45.665  1.00 12.63 ? 160 GLU A CA    1 
ATOM   1002  C  C     . GLU A 1 160 ? -28.339 -7.673  -45.377  1.00 2.04  ? 160 GLU A C     1 
ATOM   1003  O  O     . GLU A 1 160 ? -27.803 -7.412  -44.326  1.00 17.22 ? 160 GLU A O     1 
ATOM   1004  C  CB    . GLU A 1 160 ? -27.381 -9.778  -46.032  1.00 2.00  ? 160 GLU A CB    1 
ATOM   1005  C  CG    . GLU A 1 160 ? -27.375 -11.270 -46.061  1.00 38.13 ? 160 GLU A CG    1 
ATOM   1006  C  CD    . GLU A 1 160 ? -26.208 -11.826 -46.899  1.00 31.28 ? 160 GLU A CD    1 
ATOM   1007  O  OE1   . GLU A 1 160 ? -25.142 -11.138 -46.948  1.00 26.02 ? 160 GLU A OE1   1 
ATOM   1008  O  OE2   . GLU A 1 160 ? -26.376 -12.948 -47.481  1.00 18.82 ? 160 GLU A OE2   1 
ATOM   1009  O  OXT   . GLU A 1 160 ? -28.429 -6.804  -46.214  1.00 2.00  ? 160 GLU A OXT   1 
ATOM   1010  N  N     . SER B 2 8   ? -29.810 -35.660 -49.043  1.00 28.09 ? 8   SER B N     1 
ATOM   1011  C  CA    . SER B 2 8   ? -30.428 -36.155 -50.338  1.00 28.89 ? 8   SER B CA    1 
ATOM   1012  C  C     . SER B 2 8   ? -31.868 -36.697 -50.157  1.00 25.31 ? 8   SER B C     1 
ATOM   1013  O  O     . SER B 2 8   ? -32.382 -37.511 -50.954  1.00 21.62 ? 8   SER B O     1 
ATOM   1014  C  CB    . SER B 2 8   ? -29.469 -37.099 -51.138  1.00 35.06 ? 8   SER B CB    1 
ATOM   1015  O  OG    . SER B 2 8   ? -29.828 -38.494 -51.175  1.00 8.63  ? 8   SER B OG    1 
ATOM   1016  N  N     . PHE B 2 9   ? -32.512 -36.188 -49.109  1.00 18.12 ? 9   PHE B N     1 
ATOM   1017  C  CA    . PHE B 2 9   ? -33.660 -36.839 -48.464  1.00 22.28 ? 9   PHE B CA    1 
ATOM   1018  C  C     . PHE B 2 9   ? -34.747 -35.765 -48.184  1.00 11.59 ? 9   PHE B C     1 
ATOM   1019  O  O     . PHE B 2 9   ? -34.447 -34.573 -48.223  1.00 4.73  ? 9   PHE B O     1 
ATOM   1020  C  CB    . PHE B 2 9   ? -33.177 -37.344 -47.115  1.00 29.10 ? 9   PHE B CB    1 
ATOM   1021  C  CG    . PHE B 2 9   ? -32.254 -36.389 -46.463  1.00 25.75 ? 9   PHE B CG    1 
ATOM   1022  C  CD1   . PHE B 2 9   ? -32.257 -35.057 -46.872  1.00 10.66 ? 9   PHE B CD1   1 
ATOM   1023  C  CD2   . PHE B 2 9   ? -31.371 -36.803 -45.488  1.00 11.65 ? 9   PHE B CD2   1 
ATOM   1024  C  CE1   . PHE B 2 9   ? -31.397 -34.159 -46.314  1.00 29.90 ? 9   PHE B CE1   1 
ATOM   1025  C  CE2   . PHE B 2 9   ? -30.510 -35.905 -44.914  1.00 32.93 ? 9   PHE B CE2   1 
ATOM   1026  C  CZ    . PHE B 2 9   ? -30.522 -34.578 -45.325  1.00 40.58 ? 9   PHE B CZ    1 
ATOM   1027  N  N     . PRO B 2 10  ? -35.986 -36.197 -47.848  1.00 2.00  ? 10  PRO B N     1 
ATOM   1028  C  CA    . PRO B 2 10  ? -37.158 -35.456 -48.274  1.00 8.35  ? 10  PRO B CA    1 
ATOM   1029  C  C     . PRO B 2 10  ? -37.402 -34.231 -47.403  1.00 5.37  ? 10  PRO B C     1 
ATOM   1030  O  O     . PRO B 2 10  ? -36.520 -33.737 -46.694  1.00 2.00  ? 10  PRO B O     1 
ATOM   1031  C  CB    . PRO B 2 10  ? -38.298 -36.427 -47.974  1.00 2.92  ? 10  PRO B CB    1 
ATOM   1032  C  CG    . PRO B 2 10  ? -37.841 -37.155 -46.730  1.00 2.00  ? 10  PRO B CG    1 
ATOM   1033  C  CD    . PRO B 2 10  ? -36.359 -37.356 -47.005  1.00 4.69  ? 10  PRO B CD    1 
ATOM   1034  N  N     . GLU B 2 11  ? -38.627 -33.736 -47.477  1.00 10.04 ? 11  GLU B N     1 
ATOM   1035  C  CA    . GLU B 2 11  ? -38.884 -32.369 -47.899  1.00 24.50 ? 11  GLU B CA    1 
ATOM   1036  C  C     . GLU B 2 11  ? -39.634 -31.675 -46.792  1.00 20.16 ? 11  GLU B C     1 
ATOM   1037  O  O     . GLU B 2 11  ? -40.779 -31.281 -46.968  1.00 11.49 ? 11  GLU B O     1 
ATOM   1038  C  CB    . GLU B 2 11  ? -39.750 -32.345 -49.158  1.00 18.54 ? 11  GLU B CB    1 
ATOM   1039  C  CG    . GLU B 2 11  ? -39.295 -31.357 -50.219  1.00 40.68 ? 11  GLU B CG    1 
ATOM   1040  C  CD    . GLU B 2 11  ? -40.400 -30.425 -50.665  1.00 45.66 ? 11  GLU B CD    1 
ATOM   1041  O  OE1   . GLU B 2 11  ? -41.261 -30.088 -49.826  1.00 25.05 ? 11  GLU B OE1   1 
ATOM   1042  O  OE2   . GLU B 2 11  ? -40.407 -30.031 -51.849  1.00 4.90  ? 11  GLU B OE2   1 
ATOM   1043  N  N     . GLU B 2 12  ? -39.007 -31.564 -45.636  1.00 13.46 ? 12  GLU B N     1 
ATOM   1044  C  CA    . GLU B 2 12  ? -39.654 -31.960 -44.400  1.00 8.42  ? 12  GLU B CA    1 
ATOM   1045  C  C     . GLU B 2 12  ? -38.600 -32.331 -43.406  1.00 7.64  ? 12  GLU B C     1 
ATOM   1046  O  O     . GLU B 2 12  ? -38.651 -31.917 -42.265  1.00 2.00  ? 12  GLU B O     1 
ATOM   1047  C  CB    . GLU B 2 12  ? -40.576 -33.146 -44.630  1.00 19.85 ? 12  GLU B CB    1 
ATOM   1048  C  CG    . GLU B 2 12  ? -40.641 -33.610 -46.069  1.00 27.66 ? 12  GLU B CG    1 
ATOM   1049  C  CD    . GLU B 2 12  ? -41.476 -34.864 -46.231  1.00 45.85 ? 12  GLU B CD    1 
ATOM   1050  O  OE1   . GLU B 2 12  ? -41.678 -35.575 -45.224  1.00 17.24 ? 12  GLU B OE1   1 
ATOM   1051  O  OE2   . GLU B 2 12  ? -41.931 -35.138 -47.359  1.00 16.12 ? 12  GLU B OE2   1 
ATOM   1052  N  N     . VAL B 2 13  ? -37.635 -33.114 -43.856  1.00 4.99  ? 13  VAL B N     1 
ATOM   1053  C  CA    . VAL B 2 13  ? -36.367 -33.223 -43.168  1.00 3.71  ? 13  VAL B CA    1 
ATOM   1054  C  C     . VAL B 2 13  ? -35.482 -32.028 -43.460  1.00 2.00  ? 13  VAL B C     1 
ATOM   1055  O  O     . VAL B 2 13  ? -34.925 -31.422 -42.557  1.00 5.82  ? 13  VAL B O     1 
ATOM   1056  C  CB    . VAL B 2 13  ? -35.640 -34.501 -43.564  1.00 2.05  ? 13  VAL B CB    1 
ATOM   1057  C  CG1   . VAL B 2 13  ? -34.332 -34.599 -42.849  1.00 2.00  ? 13  VAL B CG1   1 
ATOM   1058  C  CG2   . VAL B 2 13  ? -36.504 -35.693 -43.270  1.00 2.63  ? 13  VAL B CG2   1 
ATOM   1059  N  N     . LEU B 2 14  ? -35.354 -31.686 -44.730  1.00 2.00  ? 14  LEU B N     1 
ATOM   1060  C  CA    . LEU B 2 14  ? -34.725 -30.386 -45.089  1.00 12.02 ? 14  LEU B CA    1 
ATOM   1061  C  C     . LEU B 2 14  ? -35.350 -29.174 -44.379  1.00 4.14  ? 14  LEU B C     1 
ATOM   1062  O  O     . LEU B 2 14  ? -34.647 -28.383 -43.820  1.00 9.31  ? 14  LEU B O     1 
ATOM   1063  C  CB    . LEU B 2 14  ? -34.826 -30.141 -46.591  1.00 11.13 ? 14  LEU B CB    1 
ATOM   1064  C  CG    . LEU B 2 14  ? -33.793 -30.673 -47.572  1.00 17.94 ? 14  LEU B CG    1 
ATOM   1065  C  CD1   . LEU B 2 14  ? -33.808 -29.602 -48.658  1.00 24.22 ? 14  LEU B CD1   1 
ATOM   1066  C  CD2   . LEU B 2 14  ? -32.382 -30.868 -46.926  1.00 6.65  ? 14  LEU B CD2   1 
ATOM   1067  N  N     . GLU B 2 15  ? -36.673 -29.039 -44.460  1.00 4.76  ? 15  GLU B N     1 
ATOM   1068  C  CA    . GLU B 2 15  ? -37.411 -28.054 -43.755  1.00 4.27  ? 15  GLU B CA    1 
ATOM   1069  C  C     . GLU B 2 15  ? -37.073 -28.095 -42.274  1.00 9.58  ? 15  GLU B C     1 
ATOM   1070  O  O     . GLU B 2 15  ? -36.640 -27.090 -41.719  1.00 4.45  ? 15  GLU B O     1 
ATOM   1071  C  CB    . GLU B 2 15  ? -38.903 -28.249 -43.941  1.00 7.64  ? 15  GLU B CB    1 
ATOM   1072  C  CG    . GLU B 2 15  ? -39.692 -27.201 -43.096  1.00 15.84 ? 15  GLU B CG    1 
ATOM   1073  C  CD    . GLU B 2 15  ? -41.129 -26.902 -43.558  1.00 2.00  ? 15  GLU B CD    1 
ATOM   1074  O  OE1   . GLU B 2 15  ? -41.842 -26.194 -42.835  1.00 8.10  ? 15  GLU B OE1   1 
ATOM   1075  O  OE2   . GLU B 2 15  ? -41.593 -27.435 -44.577  1.00 30.65 ? 15  GLU B OE2   1 
ATOM   1076  N  N     . HIS B 2 16  ? -37.230 -29.245 -41.634  1.00 2.61  ? 16  HIS B N     1 
ATOM   1077  C  CA    . HIS B 2 16  ? -36.860 -29.327 -40.230  1.00 2.17  ? 16  HIS B CA    1 
ATOM   1078  C  C     . HIS B 2 16  ? -35.392 -29.029 -39.977  1.00 2.00  ? 16  HIS B C     1 
ATOM   1079  O  O     . HIS B 2 16  ? -35.041 -28.487 -38.945  1.00 4.03  ? 16  HIS B O     1 
ATOM   1080  C  CB    . HIS B 2 16  ? -37.170 -30.690 -39.668  1.00 2.77  ? 16  HIS B CB    1 
ATOM   1081  C  CG    . HIS B 2 16  ? -37.135 -30.738 -38.177  1.00 5.01  ? 16  HIS B CG    1 
ATOM   1082  N  ND1   . HIS B 2 16  ? -38.187 -30.314 -37.397  1.00 8.68  ? 16  HIS B ND1   1 
ATOM   1083  C  CD2   . HIS B 2 16  ? -36.176 -31.151 -37.317  1.00 23.05 ? 16  HIS B CD2   1 
ATOM   1084  C  CE1   . HIS B 2 16  ? -37.888 -30.474 -36.121  1.00 9.37  ? 16  HIS B CE1   1 
ATOM   1085  N  NE2   . HIS B 2 16  ? -36.668 -30.974 -36.042  1.00 21.43 ? 16  HIS B NE2   1 
ATOM   1086  N  N     . VAL B 2 17  ? -34.517 -29.373 -40.905  1.00 2.00  ? 17  VAL B N     1 
ATOM   1087  C  CA    . VAL B 2 17  ? -33.120 -28.938 -40.757  1.00 3.66  ? 17  VAL B CA    1 
ATOM   1088  C  C     . VAL B 2 17  ? -32.888 -27.343 -40.737  1.00 9.85  ? 17  VAL B C     1 
ATOM   1089  O  O     . VAL B 2 17  ? -32.373 -26.750 -39.776  1.00 2.00  ? 17  VAL B O     1 
ATOM   1090  C  CB    . VAL B 2 17  ? -32.305 -29.547 -41.897  1.00 11.78 ? 17  VAL B CB    1 
ATOM   1091  C  CG1   . VAL B 2 17  ? -30.844 -28.935 -41.991  1.00 2.00  ? 17  VAL B CG1   1 
ATOM   1092  C  CG2   . VAL B 2 17  ? -32.436 -31.123 -41.936  1.00 2.00  ? 17  VAL B CG2   1 
ATOM   1093  N  N     . PHE B 2 18  ? -33.240 -26.709 -41.848  1.00 2.00  ? 18  PHE B N     1 
ATOM   1094  C  CA    . PHE B 2 18  ? -33.553 -25.328 -41.949  1.00 3.22  ? 18  PHE B CA    1 
ATOM   1095  C  C     . PHE B 2 18  ? -34.132 -24.671 -40.699  1.00 6.46  ? 18  PHE B C     1 
ATOM   1096  O  O     . PHE B 2 18  ? -33.592 -23.676 -40.232  1.00 2.00  ? 18  PHE B O     1 
ATOM   1097  C  CB    . PHE B 2 18  ? -34.367 -25.037 -43.220  1.00 2.00  ? 18  PHE B CB    1 
ATOM   1098  C  CG    . PHE B 2 18  ? -33.670 -25.462 -44.499  1.00 2.00  ? 18  PHE B CG    1 
ATOM   1099  C  CD1   . PHE B 2 18  ? -34.320 -25.333 -45.741  1.00 7.17  ? 18  PHE B CD1   1 
ATOM   1100  C  CD2   . PHE B 2 18  ? -32.445 -26.054 -44.451  1.00 2.00  ? 18  PHE B CD2   1 
ATOM   1101  C  CE1   . PHE B 2 18  ? -33.746 -25.719 -46.888  1.00 2.00  ? 18  PHE B CE1   1 
ATOM   1102  C  CE2   . PHE B 2 18  ? -31.865 -26.461 -45.589  1.00 2.47  ? 18  PHE B CE2   1 
ATOM   1103  C  CZ    . PHE B 2 18  ? -32.517 -26.262 -46.832  1.00 5.30  ? 18  PHE B CZ    1 
ATOM   1104  N  N     . SER B 2 19  ? -35.157 -25.242 -40.093  1.00 2.00  ? 19  SER B N     1 
ATOM   1105  C  CA    . SER B 2 19  ? -35.628 -24.621 -38.879  1.00 2.00  ? 19  SER B CA    1 
ATOM   1106  C  C     . SER B 2 19  ? -34.546 -24.373 -37.788  1.00 2.00  ? 19  SER B C     1 
ATOM   1107  O  O     . SER B 2 19  ? -34.801 -23.753 -36.783  1.00 2.01  ? 19  SER B O     1 
ATOM   1108  C  CB    . SER B 2 19  ? -36.800 -25.381 -38.309  1.00 2.00  ? 19  SER B CB    1 
ATOM   1109  O  OG    . SER B 2 19  ? -36.308 -26.334 -37.382  1.00 4.98  ? 19  SER B OG    1 
ATOM   1110  N  N     . PHE B 2 20  ? -33.350 -24.886 -37.917  1.00 2.00  ? 20  PHE B N     1 
ATOM   1111  C  CA    . PHE B 2 20  ? -32.438 -24.627 -36.846  1.00 2.00  ? 20  PHE B CA    1 
ATOM   1112  C  C     . PHE B 2 20  ? -31.480 -23.571 -37.391  1.00 10.00 ? 20  PHE B C     1 
ATOM   1113  O  O     . PHE B 2 20  ? -30.584 -23.150 -36.657  1.00 2.00  ? 20  PHE B O     1 
ATOM   1114  C  CB    . PHE B 2 20  ? -31.663 -25.891 -36.430  1.00 2.00  ? 20  PHE B CB    1 
ATOM   1115  C  CG    . PHE B 2 20  ? -32.490 -26.885 -35.718  1.00 5.51  ? 20  PHE B CG    1 
ATOM   1116  C  CD1   . PHE B 2 20  ? -33.065 -27.949 -36.424  1.00 2.00  ? 20  PHE B CD1   1 
ATOM   1117  C  CD2   . PHE B 2 20  ? -32.699 -26.770 -34.338  1.00 2.00  ? 20  PHE B CD2   1 
ATOM   1118  C  CE1   . PHE B 2 20  ? -33.850 -28.869 -35.761  1.00 2.26  ? 20  PHE B CE1   1 
ATOM   1119  C  CE2   . PHE B 2 20  ? -33.509 -27.675 -33.653  1.00 2.00  ? 20  PHE B CE2   1 
ATOM   1120  C  CZ    . PHE B 2 20  ? -34.093 -28.736 -34.352  1.00 4.04  ? 20  PHE B CZ    1 
ATOM   1121  N  N     . ILE B 2 21  ? -31.648 -23.186 -38.676  1.00 3.61  ? 21  ILE B N     1 
ATOM   1122  C  CA    . ILE B 2 21  ? -30.867 -22.072 -39.311  1.00 6.84  ? 21  ILE B CA    1 
ATOM   1123  C  C     . ILE B 2 21  ? -31.598 -20.701 -39.308  1.00 12.53 ? 21  ILE B C     1 
ATOM   1124  O  O     . ILE B 2 21  ? -32.588 -20.534 -40.042  1.00 8.21  ? 21  ILE B O     1 
ATOM   1125  C  CB    . ILE B 2 21  ? -30.592 -22.320 -40.793  1.00 5.16  ? 21  ILE B CB    1 
ATOM   1126  C  CG1   . ILE B 2 21  ? -30.083 -23.729 -41.053  1.00 7.40  ? 21  ILE B CG1   1 
ATOM   1127  C  CG2   . ILE B 2 21  ? -29.660 -21.278 -41.332  1.00 2.00  ? 21  ILE B CG2   1 
ATOM   1128  C  CD1   . ILE B 2 21  ? -28.788 -23.977 -40.447  1.00 16.33 ? 21  ILE B CD1   1 
ATOM   1129  N  N     . GLN B 2 22  ? -31.095 -19.720 -38.528  1.00 15.22 ? 22  GLN B N     1 
ATOM   1130  C  CA    . GLN B 2 22  ? -31.777 -18.427 -38.382  1.00 8.28  ? 22  GLN B CA    1 
ATOM   1131  C  C     . GLN B 2 22  ? -31.039 -17.138 -38.856  1.00 8.39  ? 22  GLN B C     1 
ATOM   1132  O  O     . GLN B 2 22  ? -31.693 -16.112 -39.151  1.00 2.00  ? 22  GLN B O     1 
ATOM   1133  C  CB    . GLN B 2 22  ? -32.462 -18.289 -37.023  1.00 2.00  ? 22  GLN B CB    1 
ATOM   1134  C  CG    . GLN B 2 22  ? -33.325 -19.512 -36.643  1.00 11.42 ? 22  GLN B CG    1 
ATOM   1135  C  CD    . GLN B 2 22  ? -34.727 -19.510 -37.297  1.00 30.58 ? 22  GLN B CD    1 
ATOM   1136  O  OE1   . GLN B 2 22  ? -35.011 -20.248 -38.274  1.00 12.59 ? 22  GLN B OE1   1 
ATOM   1137  N  NE2   . GLN B 2 22  ? -35.612 -18.676 -36.752  1.00 46.45 ? 22  GLN B NE2   1 
ATOM   1138  N  N     . LEU B 2 23  ? -29.712 -17.191 -38.986  1.00 2.00  ? 23  LEU B N     1 
ATOM   1139  C  CA    . LEU B 2 23  ? -28.980 -16.015 -39.504  1.00 5.99  ? 23  LEU B CA    1 
ATOM   1140  C  C     . LEU B 2 23  ? -29.277 -15.764 -40.977  1.00 2.00  ? 23  LEU B C     1 
ATOM   1141  O  O     . LEU B 2 23  ? -29.288 -16.700 -41.800  1.00 3.00  ? 23  LEU B O     1 
ATOM   1142  C  CB    . LEU B 2 23  ? -27.481 -16.175 -39.363  1.00 2.00  ? 23  LEU B CB    1 
ATOM   1143  C  CG    . LEU B 2 23  ? -26.867 -15.565 -38.131  1.00 15.89 ? 23  LEU B CG    1 
ATOM   1144  C  CD1   . LEU B 2 23  ? -27.867 -15.535 -36.953  1.00 2.45  ? 23  LEU B CD1   1 
ATOM   1145  C  CD2   . LEU B 2 23  ? -25.651 -16.413 -37.838  1.00 2.00  ? 23  LEU B CD2   1 
ATOM   1146  N  N     . ASP B 2 24  ? -29.502 -14.498 -41.295  1.00 2.00  ? 24  ASP B N     1 
ATOM   1147  C  CA    . ASP B 2 24  ? -29.855 -14.082 -42.621  1.00 2.00  ? 24  ASP B CA    1 
ATOM   1148  C  C     . ASP B 2 24  ? -28.875 -14.640 -43.625  1.00 2.00  ? 24  ASP B C     1 
ATOM   1149  O  O     . ASP B 2 24  ? -29.313 -15.074 -44.703  1.00 2.00  ? 24  ASP B O     1 
ATOM   1150  C  CB    . ASP B 2 24  ? -29.802 -12.561 -42.729  1.00 2.00  ? 24  ASP B CB    1 
ATOM   1151  C  CG    . ASP B 2 24  ? -30.889 -11.858 -41.912  1.00 6.86  ? 24  ASP B CG    1 
ATOM   1152  O  OD1   . ASP B 2 24  ? -32.010 -12.376 -41.818  1.00 10.23 ? 24  ASP B OD1   1 
ATOM   1153  O  OD2   . ASP B 2 24  ? -30.632 -10.758 -41.354  1.00 28.61 ? 24  ASP B OD2   1 
ATOM   1154  N  N     . LYS B 2 25  ? -27.568 -14.592 -43.279  1.00 2.00  ? 25  LYS B N     1 
ATOM   1155  C  CA    . LYS B 2 25  ? -26.413 -15.063 -44.138  1.00 7.99  ? 25  LYS B CA    1 
ATOM   1156  C  C     . LYS B 2 25  ? -26.506 -16.534 -44.394  1.00 2.98  ? 25  LYS B C     1 
ATOM   1157  O  O     . LYS B 2 25  ? -26.123 -16.991 -45.478  1.00 2.00  ? 25  LYS B O     1 
ATOM   1158  C  CB    . LYS B 2 25  ? -24.989 -14.870 -43.521  1.00 3.40  ? 25  LYS B CB    1 
ATOM   1159  C  CG    . LYS B 2 25  ? -24.630 -13.425 -43.033  1.00 27.09 ? 25  LYS B CG    1 
ATOM   1160  C  CD    . LYS B 2 25  ? -23.931 -12.501 -44.102  1.00 21.22 ? 25  LYS B CD    1 
ATOM   1161  C  CE    . LYS B 2 25  ? -23.656 -11.035 -43.568  1.00 19.36 ? 25  LYS B CE    1 
ATOM   1162  N  NZ    . LYS B 2 25  ? -23.889 -10.021 -44.656  1.00 20.24 ? 25  LYS B NZ    1 
ATOM   1163  N  N     . ASP B 2 26  ? -26.963 -17.263 -43.368  1.00 2.00  ? 26  ASP B N     1 
ATOM   1164  C  CA    . ASP B 2 26  ? -26.913 -18.682 -43.415  1.00 3.13  ? 26  ASP B CA    1 
ATOM   1165  C  C     . ASP B 2 26  ? -28.042 -19.049 -44.392  1.00 2.00  ? 26  ASP B C     1 
ATOM   1166  O  O     . ASP B 2 26  ? -27.798 -19.782 -45.331  1.00 6.53  ? 26  ASP B O     1 
ATOM   1167  C  CB    . ASP B 2 26  ? -26.943 -19.295 -42.005  1.00 2.00  ? 26  ASP B CB    1 
ATOM   1168  C  CG    . ASP B 2 26  ? -25.552 -19.287 -41.327  1.00 2.00  ? 26  ASP B CG    1 
ATOM   1169  O  OD1   . ASP B 2 26  ? -24.555 -19.167 -42.046  1.00 2.00  ? 26  ASP B OD1   1 
ATOM   1170  O  OD2   . ASP B 2 26  ? -25.422 -19.397 -40.090  1.00 2.00  ? 26  ASP B OD2   1 
ATOM   1171  N  N     . ARG B 2 27  ? -29.216 -18.439 -44.250  1.00 2.00  ? 27  ARG B N     1 
ATOM   1172  C  CA    . ARG B 2 27  ? -30.405 -18.738 -45.096  1.00 2.00  ? 27  ARG B CA    1 
ATOM   1173  C  C     . ARG B 2 27  ? -30.126 -18.424 -46.578  1.00 6.31  ? 27  ARG B C     1 
ATOM   1174  O  O     . ARG B 2 27  ? -30.581 -19.129 -47.512  1.00 4.83  ? 27  ARG B O     1 
ATOM   1175  C  CB    . ARG B 2 27  ? -31.580 -17.895 -44.600  1.00 2.25  ? 27  ARG B CB    1 
ATOM   1176  C  CG    . ARG B 2 27  ? -32.205 -18.351 -43.217  1.00 2.00  ? 27  ARG B CG    1 
ATOM   1177  C  CD    . ARG B 2 27  ? -33.399 -19.202 -43.580  1.00 2.00  ? 27  ARG B CD    1 
ATOM   1178  N  NE    . ARG B 2 27  ? -34.014 -20.026 -42.536  1.00 8.66  ? 27  ARG B NE    1 
ATOM   1179  C  CZ    . ARG B 2 27  ? -34.966 -20.910 -42.805  1.00 2.00  ? 27  ARG B CZ    1 
ATOM   1180  N  NH1   . ARG B 2 27  ? -35.373 -21.048 -44.078  1.00 5.60  ? 27  ARG B NH1   1 
ATOM   1181  N  NH2   . ARG B 2 27  ? -35.543 -21.613 -41.826  1.00 25.28 ? 27  ARG B NH2   1 
ATOM   1182  N  N     . ASN B 2 28  ? -29.326 -17.382 -46.799  1.00 5.92  ? 28  ASN B N     1 
ATOM   1183  C  CA    . ASN B 2 28  ? -29.012 -16.922 -48.167  1.00 15.40 ? 28  ASN B CA    1 
ATOM   1184  C  C     . ASN B 2 28  ? -28.115 -17.915 -48.800  1.00 6.63  ? 28  ASN B C     1 
ATOM   1185  O  O     . ASN B 2 28  ? -28.174 -18.164 -50.015  1.00 3.49  ? 28  ASN B O     1 
ATOM   1186  C  CB    . ASN B 2 28  ? -28.365 -15.508 -48.213  1.00 5.54  ? 28  ASN B CB    1 
ATOM   1187  C  CG    . ASN B 2 28  ? -29.392 -14.415 -48.024  1.00 12.48 ? 28  ASN B CG    1 
ATOM   1188  O  OD1   . ASN B 2 28  ? -30.535 -14.702 -47.689  1.00 8.89  ? 28  ASN B OD1   1 
ATOM   1189  N  ND2   . ASN B 2 28  ? -29.008 -13.173 -48.230  1.00 3.36  ? 28  ASN B ND2   1 
ATOM   1190  N  N     . SER B 2 29  ? -27.264 -18.461 -47.962  1.00 2.00  ? 29  SER B N     1 
ATOM   1191  C  CA    . SER B 2 29  ? -26.346 -19.443 -48.440  1.00 12.15 ? 29  SER B CA    1 
ATOM   1192  C  C     . SER B 2 29  ? -27.018 -20.805 -48.815  1.00 10.82 ? 29  SER B C     1 
ATOM   1193  O  O     . SER B 2 29  ? -26.884 -21.342 -49.949  1.00 2.00  ? 29  SER B O     1 
ATOM   1194  C  CB    . SER B 2 29  ? -25.257 -19.624 -47.408  1.00 6.56  ? 29  SER B CB    1 
ATOM   1195  O  OG    . SER B 2 29  ? -24.105 -19.991 -48.090  1.00 10.06 ? 29  SER B OG    1 
ATOM   1196  N  N     . VAL B 2 30  ? -27.766 -21.345 -47.875  1.00 2.00  ? 30  VAL B N     1 
ATOM   1197  C  CA    . VAL B 2 30  ? -28.539 -22.480 -48.217  1.00 4.56  ? 30  VAL B CA    1 
ATOM   1198  C  C     . VAL B 2 30  ? -29.447 -22.192 -49.406  1.00 2.12  ? 30  VAL B C     1 
ATOM   1199  O  O     . VAL B 2 30  ? -29.712 -23.048 -50.222  1.00 6.49  ? 30  VAL B O     1 
ATOM   1200  C  CB    . VAL B 2 30  ? -29.298 -23.025 -47.031  1.00 11.19 ? 30  VAL B CB    1 
ATOM   1201  C  CG1   . VAL B 2 30  ? -28.769 -22.518 -45.721  1.00 2.00  ? 30  VAL B CG1   1 
ATOM   1202  C  CG2   . VAL B 2 30  ? -30.709 -22.769 -47.192  1.00 6.98  ? 30  VAL B CG2   1 
ATOM   1203  N  N     . SER B 2 31  ? -29.926 -20.980 -49.562  1.00 2.99  ? 31  SER B N     1 
ATOM   1204  C  CA    . SER B 2 31  ? -30.787 -20.777 -50.735  1.00 2.00  ? 31  SER B CA    1 
ATOM   1205  C  C     . SER B 2 31  ? -30.045 -20.964 -52.051  1.00 2.00  ? 31  SER B C     1 
ATOM   1206  O  O     . SER B 2 31  ? -30.665 -21.079 -53.080  1.00 2.00  ? 31  SER B O     1 
ATOM   1207  C  CB    . SER B 2 31  ? -31.541 -19.429 -50.689  1.00 4.87  ? 31  SER B CB    1 
ATOM   1208  O  OG    . SER B 2 31  ? -30.679 -18.387 -51.080  1.00 2.00  ? 31  SER B OG    1 
ATOM   1209  N  N     . LEU B 2 32  ? -28.715 -20.978 -52.024  1.00 2.17  ? 32  LEU B N     1 
ATOM   1210  C  CA    . LEU B 2 32  ? -27.909 -20.964 -53.266  1.00 2.00  ? 32  LEU B CA    1 
ATOM   1211  C  C     . LEU B 2 32  ? -27.211 -22.343 -53.559  1.00 3.10  ? 32  LEU B C     1 
ATOM   1212  O  O     . LEU B 2 32  ? -26.553 -22.554 -54.586  1.00 2.00  ? 32  LEU B O     1 
ATOM   1213  C  CB    . LEU B 2 32  ? -26.855 -19.821 -53.219  1.00 4.05  ? 32  LEU B CB    1 
ATOM   1214  C  CG    . LEU B 2 32  ? -27.085 -18.305 -53.567  1.00 14.12 ? 32  LEU B CG    1 
ATOM   1215  C  CD1   . LEU B 2 32  ? -25.903 -17.351 -53.215  1.00 2.00  ? 32  LEU B CD1   1 
ATOM   1216  C  CD2   . LEU B 2 32  ? -27.531 -18.066 -54.976  1.00 2.00  ? 32  LEU B CD2   1 
ATOM   1217  N  N     . VAL B 2 33  ? -27.347 -23.281 -52.627  1.00 17.34 ? 33  VAL B N     1 
ATOM   1218  C  CA    . VAL B 2 33  ? -26.941 -24.662 -52.859  1.00 3.03  ? 33  VAL B CA    1 
ATOM   1219  C  C     . VAL B 2 33  ? -27.422 -25.281 -54.188  1.00 2.00  ? 33  VAL B C     1 
ATOM   1220  O  O     . VAL B 2 33  ? -26.576 -25.719 -54.940  1.00 2.00  ? 33  VAL B O     1 
ATOM   1221  C  CB    . VAL B 2 33  ? -27.335 -25.545 -51.690  1.00 7.84  ? 33  VAL B CB    1 
ATOM   1222  C  CG1   . VAL B 2 33  ? -26.955 -26.978 -51.987  1.00 14.55 ? 33  VAL B CG1   1 
ATOM   1223  C  CG2   . VAL B 2 33  ? -26.709 -25.015 -50.404  1.00 2.00  ? 33  VAL B CG2   1 
ATOM   1224  N  N     . CYS B 2 34  ? -28.731 -25.318 -54.473  1.00 2.00  ? 34  CYS B N     1 
ATOM   1225  C  CA    . CYS B 2 34  ? -29.286 -25.976 -55.680  1.00 2.00  ? 34  CYS B CA    1 
ATOM   1226  C  C     . CYS B 2 34  ? -30.702 -25.549 -55.768  1.00 2.00  ? 34  CYS B C     1 
ATOM   1227  O  O     . CYS B 2 34  ? -31.224 -25.180 -54.746  1.00 2.00  ? 34  CYS B O     1 
ATOM   1228  C  CB    . CYS B 2 34  ? -29.329 -27.516 -55.521  1.00 2.00  ? 34  CYS B CB    1 
ATOM   1229  S  SG    . CYS B 2 34  ? -30.502 -28.084 -54.241  1.00 3.38  ? 34  CYS B SG    1 
ATOM   1230  N  N     . LYS B 2 35  ? -31.351 -25.657 -56.934  1.00 2.00  ? 35  LYS B N     1 
ATOM   1231  C  CA    . LYS B 2 35  ? -32.755 -25.203 -57.047  1.00 2.00  ? 35  LYS B CA    1 
ATOM   1232  C  C     . LYS B 2 35  ? -33.698 -25.733 -55.926  1.00 4.07  ? 35  LYS B C     1 
ATOM   1233  O  O     . LYS B 2 35  ? -34.603 -25.007 -55.429  1.00 4.39  ? 35  LYS B O     1 
ATOM   1234  C  CB    . LYS B 2 35  ? -33.360 -25.310 -58.478  1.00 2.00  ? 35  LYS B CB    1 
ATOM   1235  C  CG    . LYS B 2 35  ? -33.053 -24.065 -59.456  1.00 27.39 ? 35  LYS B CG    1 
ATOM   1236  C  CD    . LYS B 2 35  ? -34.186 -23.551 -60.509  1.00 2.00  ? 35  LYS B CD    1 
ATOM   1237  C  CE    . LYS B 2 35  ? -35.401 -22.796 -59.885  1.00 31.40 ? 35  LYS B CE    1 
ATOM   1238  N  NZ    . LYS B 2 35  ? -35.110 -21.510 -59.109  1.00 2.00  ? 35  LYS B NZ    1 
ATOM   1239  N  N     . SER B 2 36  ? -33.441 -26.967 -55.481  1.00 6.27  ? 36  SER B N     1 
ATOM   1240  C  CA    . SER B 2 36  ? -34.301 -27.656 -54.525  1.00 2.00  ? 36  SER B CA    1 
ATOM   1241  C  C     . SER B 2 36  ? -34.261 -26.873 -53.237  1.00 2.00  ? 36  SER B C     1 
ATOM   1242  O  O     . SER B 2 36  ? -35.298 -26.640 -52.579  1.00 2.00  ? 36  SER B O     1 
ATOM   1243  C  CB    . SER B 2 36  ? -33.826 -29.145 -54.323  1.00 15.48 ? 36  SER B CB    1 
ATOM   1244  O  OG    . SER B 2 36  ? -34.685 -29.951 -53.477  1.00 2.00  ? 36  SER B OG    1 
ATOM   1245  N  N     . TRP B 2 37  ? -33.063 -26.443 -52.864  1.00 2.00  ? 37  TRP B N     1 
ATOM   1246  C  CA    . TRP B 2 37  ? -32.950 -25.762 -51.558  1.00 8.85  ? 37  TRP B CA    1 
ATOM   1247  C  C     . TRP B 2 37  ? -33.495 -24.341 -51.597  1.00 2.00  ? 37  TRP B C     1 
ATOM   1248  O  O     . TRP B 2 37  ? -34.195 -23.912 -50.736  1.00 2.00  ? 37  TRP B O     1 
ATOM   1249  C  CB    . TRP B 2 37  ? -31.515 -25.727 -51.094  1.00 12.16 ? 37  TRP B CB    1 
ATOM   1250  C  CG    . TRP B 2 37  ? -31.048 -26.990 -50.630  1.00 3.01  ? 37  TRP B CG    1 
ATOM   1251  C  CD1   . TRP B 2 37  ? -31.422 -28.204 -51.100  1.00 5.62  ? 37  TRP B CD1   1 
ATOM   1252  C  CD2   . TRP B 2 37  ? -30.102 -27.224 -49.583  1.00 10.14 ? 37  TRP B CD2   1 
ATOM   1253  N  NE1   . TRP B 2 37  ? -30.778 -29.186 -50.413  1.00 2.00  ? 37  TRP B NE1   1 
ATOM   1254  C  CE2   . TRP B 2 37  ? -29.948 -28.625 -49.479  1.00 14.03 ? 37  TRP B CE2   1 
ATOM   1255  C  CE3   . TRP B 2 37  ? -29.359 -26.393 -48.736  1.00 3.98  ? 37  TRP B CE3   1 
ATOM   1256  C  CZ2   . TRP B 2 37  ? -29.063 -29.230 -48.564  1.00 7.58  ? 37  TRP B CZ2   1 
ATOM   1257  C  CZ3   . TRP B 2 37  ? -28.494 -26.988 -47.808  1.00 23.54 ? 37  TRP B CZ3   1 
ATOM   1258  C  CH2   . TRP B 2 37  ? -28.353 -28.402 -47.735  1.00 17.27 ? 37  TRP B CH2   1 
ATOM   1259  N  N     . TYR B 2 38  ? -33.170 -23.635 -52.646  1.00 2.00  ? 38  TYR B N     1 
ATOM   1260  C  CA    . TYR B 2 38  ? -33.880 -22.426 -52.952  1.00 3.38  ? 38  TYR B CA    1 
ATOM   1261  C  C     . TYR B 2 38  ? -35.365 -22.500 -52.729  1.00 2.00  ? 38  TYR B C     1 
ATOM   1262  O  O     . TYR B 2 38  ? -35.890 -21.676 -51.993  1.00 9.13  ? 38  TYR B O     1 
ATOM   1263  C  CB    . TYR B 2 38  ? -33.596 -21.939 -54.339  1.00 2.00  ? 38  TYR B CB    1 
ATOM   1264  C  CG    . TYR B 2 38  ? -34.359 -20.706 -54.654  1.00 8.39  ? 38  TYR B CG    1 
ATOM   1265  C  CD1   . TYR B 2 38  ? -35.681 -20.790 -55.063  1.00 2.00  ? 38  TYR B CD1   1 
ATOM   1266  C  CD2   . TYR B 2 38  ? -33.772 -19.429 -54.523  1.00 8.49  ? 38  TYR B CD2   1 
ATOM   1267  C  CE1   . TYR B 2 38  ? -36.419 -19.640 -55.346  1.00 15.35 ? 38  TYR B CE1   1 
ATOM   1268  C  CE2   . TYR B 2 38  ? -34.490 -18.283 -54.828  1.00 2.24  ? 38  TYR B CE2   1 
ATOM   1269  C  CZ    . TYR B 2 38  ? -35.819 -18.401 -55.236  1.00 15.55 ? 38  TYR B CZ    1 
ATOM   1270  O  OH    . TYR B 2 38  ? -36.594 -17.295 -55.505  1.00 4.45  ? 38  TYR B OH    1 
ATOM   1271  N  N     . GLU B 2 39  ? -36.061 -23.482 -53.304  1.00 10.95 ? 39  GLU B N     1 
ATOM   1272  C  CA    . GLU B 2 39  ? -37.507 -23.697 -52.956  1.00 3.40  ? 39  GLU B CA    1 
ATOM   1273  C  C     . GLU B 2 39  ? -37.884 -24.012 -51.477  1.00 2.95  ? 39  GLU B C     1 
ATOM   1274  O  O     . GLU B 2 39  ? -38.846 -23.444 -50.927  1.00 2.00  ? 39  GLU B O     1 
ATOM   1275  C  CB    . GLU B 2 39  ? -38.187 -24.618 -53.962  1.00 2.00  ? 39  GLU B CB    1 
ATOM   1276  C  CG    . GLU B 2 39  ? -37.940 -24.128 -55.412  1.00 3.93  ? 39  GLU B CG    1 
ATOM   1277  C  CD    . GLU B 2 39  ? -38.774 -22.831 -55.872  1.00 13.23 ? 39  GLU B CD    1 
ATOM   1278  O  OE1   . GLU B 2 39  ? -38.519 -22.310 -57.005  1.00 11.22 ? 39  GLU B OE1   1 
ATOM   1279  O  OE2   . GLU B 2 39  ? -39.675 -22.348 -55.144  1.00 2.00  ? 39  GLU B OE2   1 
ATOM   1280  N  N     . ILE B 2 40  ? -37.147 -24.907 -50.827  1.00 2.00  ? 40  ILE B N     1 
ATOM   1281  C  CA    . ILE B 2 40  ? -37.522 -25.282 -49.460  1.00 6.40  ? 40  ILE B CA    1 
ATOM   1282  C  C     . ILE B 2 40  ? -37.285 -24.099 -48.521  1.00 12.55 ? 40  ILE B C     1 
ATOM   1283  O  O     . ILE B 2 40  ? -37.969 -23.994 -47.484  1.00 8.54  ? 40  ILE B O     1 
ATOM   1284  C  CB    . ILE B 2 40  ? -36.663 -26.528 -48.914  1.00 10.35 ? 40  ILE B CB    1 
ATOM   1285  C  CG1   . ILE B 2 40  ? -36.622 -27.707 -49.910  1.00 12.81 ? 40  ILE B CG1   1 
ATOM   1286  C  CG2   . ILE B 2 40  ? -37.224 -27.055 -47.640  1.00 2.00  ? 40  ILE B CG2   1 
ATOM   1287  C  CD1   . ILE B 2 40  ? -37.993 -28.205 -50.312  1.00 11.68 ? 40  ILE B CD1   1 
ATOM   1288  N  N     . GLU B 2 41  ? -36.321 -23.233 -48.802  1.00 7.74  ? 41  GLU B N     1 
ATOM   1289  C  CA    . GLU B 2 41  ? -36.074 -22.162 -47.857  1.00 2.91  ? 41  GLU B CA    1 
ATOM   1290  C  C     . GLU B 2 41  ? -36.910 -20.902 -47.926  1.00 2.00  ? 41  GLU B C     1 
ATOM   1291  O  O     . GLU B 2 41  ? -37.483 -20.500 -46.934  1.00 2.00  ? 41  GLU B O     1 
ATOM   1292  C  CB    . GLU B 2 41  ? -34.614 -21.990 -47.445  1.00 2.00  ? 41  GLU B CB    1 
ATOM   1293  C  CG    . GLU B 2 41  ? -33.825 -20.893 -48.149  1.00 25.13 ? 41  GLU B CG    1 
ATOM   1294  C  CD    . GLU B 2 41  ? -34.332 -19.483 -47.891  1.00 2.00  ? 41  GLU B CD    1 
ATOM   1295  O  OE1   . GLU B 2 41  ? -34.546 -18.767 -48.874  1.00 2.00  ? 41  GLU B OE1   1 
ATOM   1296  O  OE2   . GLU B 2 41  ? -34.499 -19.096 -46.727  1.00 2.00  ? 41  GLU B OE2   1 
ATOM   1297  N  N     . ARG B 2 42  ? -37.010 -20.313 -49.109  1.00 5.34  ? 42  ARG B N     1 
ATOM   1298  C  CA    . ARG B 2 42  ? -38.257 -19.741 -49.598  1.00 2.36  ? 42  ARG B CA    1 
ATOM   1299  C  C     . ARG B 2 42  ? -39.373 -19.905 -48.590  1.00 7.20  ? 42  ARG B C     1 
ATOM   1300  O  O     . ARG B 2 42  ? -39.882 -18.939 -48.046  1.00 2.72  ? 42  ARG B O     1 
ATOM   1301  C  CB    . ARG B 2 42  ? -38.683 -20.416 -50.896  1.00 2.99  ? 42  ARG B CB    1 
ATOM   1302  C  CG    . ARG B 2 42  ? -38.190 -19.757 -52.162  1.00 33.56 ? 42  ARG B CG    1 
ATOM   1303  C  CD    . ARG B 2 42  ? -39.059 -20.015 -53.363  1.00 2.00  ? 42  ARG B CD    1 
ATOM   1304  N  NE    . ARG B 2 42  ? -40.371 -19.423 -53.183  1.00 29.86 ? 42  ARG B NE    1 
ATOM   1305  C  CZ    . ARG B 2 42  ? -41.363 -19.525 -54.038  1.00 4.86  ? 42  ARG B CZ    1 
ATOM   1306  N  NH1   . ARG B 2 42  ? -41.216 -20.216 -55.147  1.00 2.00  ? 42  ARG B NH1   1 
ATOM   1307  N  NH2   . ARG B 2 42  ? -42.508 -18.935 -53.779  1.00 20.45 ? 42  ARG B NH2   1 
ATOM   1308  N  N     . TRP B 2 43  ? -39.773 -21.146 -48.373  1.00 2.00  ? 43  TRP B N     1 
ATOM   1309  C  CA    . TRP B 2 43  ? -41.110 -21.437 -47.910  1.00 3.08  ? 43  TRP B CA    1 
ATOM   1310  C  C     . TRP B 2 43  ? -41.112 -21.577 -46.410  1.00 2.00  ? 43  TRP B C     1 
ATOM   1311  O  O     . TRP B 2 43  ? -42.147 -21.472 -45.779  1.00 2.00  ? 43  TRP B O     1 
ATOM   1312  C  CB    . TRP B 2 43  ? -41.649 -22.706 -48.567  1.00 2.00  ? 43  TRP B CB    1 
ATOM   1313  C  CG    . TRP B 2 43  ? -42.294 -22.453 -49.875  1.00 2.00  ? 43  TRP B CG    1 
ATOM   1314  C  CD1   . TRP B 2 43  ? -41.748 -22.637 -51.098  1.00 2.00  ? 43  TRP B CD1   1 
ATOM   1315  C  CD2   . TRP B 2 43  ? -43.607 -21.948 -50.095  1.00 2.00  ? 43  TRP B CD2   1 
ATOM   1316  N  NE1   . TRP B 2 43  ? -42.642 -22.281 -52.074  1.00 2.00  ? 43  TRP B NE1   1 
ATOM   1317  C  CE2   . TRP B 2 43  ? -43.793 -21.849 -51.477  1.00 2.00  ? 43  TRP B CE2   1 
ATOM   1318  C  CE3   . TRP B 2 43  ? -44.650 -21.564 -49.258  1.00 2.00  ? 43  TRP B CE3   1 
ATOM   1319  C  CZ2   . TRP B 2 43  ? -44.968 -21.395 -52.035  1.00 2.00  ? 43  TRP B CZ2   1 
ATOM   1320  C  CZ3   . TRP B 2 43  ? -45.803 -21.115 -49.812  1.00 2.00  ? 43  TRP B CZ3   1 
ATOM   1321  C  CH2   . TRP B 2 43  ? -45.960 -21.031 -51.184  1.00 2.00  ? 43  TRP B CH2   1 
ATOM   1322  N  N     . CYS B 2 44  ? -39.939 -21.807 -45.841  1.00 2.00  ? 44  CYS B N     1 
ATOM   1323  C  CA    . CYS B 2 44  ? -39.812 -21.760 -44.380  1.00 12.02 ? 44  CYS B CA    1 
ATOM   1324  C  C     . CYS B 2 44  ? -38.967 -20.568 -43.734  1.00 8.47  ? 44  CYS B C     1 
ATOM   1325  O  O     . CYS B 2 44  ? -38.570 -20.645 -42.543  1.00 2.00  ? 44  CYS B O     1 
ATOM   1326  C  CB    . CYS B 2 44  ? -39.391 -23.127 -43.835  1.00 2.00  ? 44  CYS B CB    1 
ATOM   1327  S  SG    . CYS B 2 44  ? -37.801 -23.604 -44.405  1.00 2.00  ? 44  CYS B SG    1 
ATOM   1328  N  N     . ARG B 2 45  ? -38.715 -19.525 -44.537  1.00 2.00  ? 45  ARG B N     1 
ATOM   1329  C  CA    . ARG B 2 45  ? -38.038 -18.302 -44.052  1.00 8.58  ? 45  ARG B CA    1 
ATOM   1330  C  C     . ARG B 2 45  ? -38.910 -17.444 -43.116  1.00 2.00  ? 45  ARG B C     1 
ATOM   1331  O  O     . ARG B 2 45  ? -39.960 -16.951 -43.534  1.00 11.25 ? 45  ARG B O     1 
ATOM   1332  C  CB    . ARG B 2 45  ? -37.450 -17.440 -45.192  1.00 5.72  ? 45  ARG B CB    1 
ATOM   1333  C  CG    . ARG B 2 45  ? -36.611 -16.288 -44.584  1.00 2.00  ? 45  ARG B CG    1 
ATOM   1334  C  CD    . ARG B 2 45  ? -35.816 -15.495 -45.620  1.00 2.00  ? 45  ARG B CD    1 
ATOM   1335  N  NE    . ARG B 2 45  ? -34.781 -16.248 -46.251  1.00 2.00  ? 45  ARG B NE    1 
ATOM   1336  C  CZ    . ARG B 2 45  ? -33.714 -15.707 -46.807  1.00 11.48 ? 45  ARG B CZ    1 
ATOM   1337  N  NH1   . ARG B 2 45  ? -33.551 -14.398 -46.698  1.00 3.23  ? 45  ARG B NH1   1 
ATOM   1338  N  NH2   . ARG B 2 45  ? -32.834 -16.445 -47.478  1.00 2.00  ? 45  ARG B NH2   1 
ATOM   1339  N  N     . ARG B 2 46  ? -38.540 -17.362 -41.836  1.00 3.81  ? 46  ARG B N     1 
ATOM   1340  C  CA    . ARG B 2 46  ? -39.461 -16.905 -40.792  1.00 2.00  ? 46  ARG B CA    1 
ATOM   1341  C  C     . ARG B 2 46  ? -39.340 -15.389 -40.732  1.00 4.18  ? 46  ARG B C     1 
ATOM   1342  O  O     . ARG B 2 46  ? -40.284 -14.740 -40.318  1.00 6.86  ? 46  ARG B O     1 
ATOM   1343  C  CB    . ARG B 2 46  ? -39.091 -17.469 -39.424  1.00 5.82  ? 46  ARG B CB    1 
ATOM   1344  C  CG    . ARG B 2 46  ? -39.287 -19.014 -39.290  1.00 18.32 ? 46  ARG B CG    1 
ATOM   1345  C  CD    . ARG B 2 46  ? -38.823 -19.324 -37.834  1.00 57.99 ? 46  ARG B CD    1 
ATOM   1346  N  NE    . ARG B 2 46  ? -38.868 -20.728 -37.403  1.00 38.68 ? 46  ARG B NE    1 
ATOM   1347  C  CZ    . ARG B 2 46  ? -38.427 -21.113 -36.207  1.00 29.68 ? 46  ARG B CZ    1 
ATOM   1348  N  NH1   . ARG B 2 46  ? -37.937 -20.201 -35.371  1.00 59.13 ? 46  ARG B NH1   1 
ATOM   1349  N  NH2   . ARG B 2 46  ? -38.467 -22.376 -35.827  1.00 4.56  ? 46  ARG B NH2   1 
ATOM   1350  N  N     . LYS B 2 47  ? -38.180 -14.837 -41.119  1.00 2.00  ? 47  LYS B N     1 
ATOM   1351  C  CA    . LYS B 2 47  ? -37.924 -13.391 -41.019  1.00 6.07  ? 47  LYS B CA    1 
ATOM   1352  C  C     . LYS B 2 47  ? -37.078 -12.839 -42.088  1.00 5.60  ? 47  LYS B C     1 
ATOM   1353  O  O     . LYS B 2 47  ? -36.231 -13.506 -42.723  1.00 4.86  ? 47  LYS B O     1 
ATOM   1354  C  CB    . LYS B 2 47  ? -37.341 -12.943 -39.682  1.00 3.76  ? 47  LYS B CB    1 
ATOM   1355  C  CG    . LYS B 2 47  ? -35.954 -13.436 -39.486  1.00 25.81 ? 47  LYS B CG    1 
ATOM   1356  C  CD    . LYS B 2 47  ? -34.954 -12.436 -40.062  1.00 51.23 ? 47  LYS B CD    1 
ATOM   1357  C  CE    . LYS B 2 47  ? -33.821 -12.163 -39.059  1.00 39.94 ? 47  LYS B CE    1 
ATOM   1358  N  NZ    . LYS B 2 47  ? -33.717 -13.294 -38.070  1.00 25.92 ? 47  LYS B NZ    1 
ATOM   1359  N  N     . VAL B 2 48  ? -37.303 -11.576 -42.311  1.00 2.89  ? 48  VAL B N     1 
ATOM   1360  C  CA    . VAL B 2 48  ? -36.593 -10.974 -43.423  1.00 13.60 ? 48  VAL B CA    1 
ATOM   1361  C  C     . VAL B 2 48  ? -36.011 -9.632  -42.915  1.00 9.88  ? 48  VAL B C     1 
ATOM   1362  O  O     . VAL B 2 48  ? -36.658 -8.920  -42.138  1.00 2.00  ? 48  VAL B O     1 
ATOM   1363  C  CB    . VAL B 2 48  ? -37.647 -10.783 -44.514  1.00 8.37  ? 48  VAL B CB    1 
ATOM   1364  C  CG1   . VAL B 2 48  ? -37.903 -9.383  -44.815  1.00 11.08 ? 48  VAL B CG1   1 
ATOM   1365  C  CG2   . VAL B 2 48  ? -37.403 -11.643 -45.668  1.00 2.00  ? 48  VAL B CG2   1 
ATOM   1366  N  N     . PHE B 2 49  ? -34.823 -9.270  -43.360  1.00 9.62  ? 49  PHE B N     1 
ATOM   1367  C  CA    . PHE B 2 49  ? -34.201 -8.007  -42.894  1.00 5.64  ? 49  PHE B CA    1 
ATOM   1368  C  C     . PHE B 2 49  ? -33.916 -7.165  -44.133  1.00 6.17  ? 49  PHE B C     1 
ATOM   1369  O  O     . PHE B 2 49  ? -33.206 -7.622  -45.047  1.00 2.00  ? 49  PHE B O     1 
ATOM   1370  C  CB    . PHE B 2 49  ? -32.851 -8.292  -42.247  1.00 2.00  ? 49  PHE B CB    1 
ATOM   1371  C  CG    . PHE B 2 49  ? -32.050 -7.049  -41.927  1.00 11.27 ? 49  PHE B CG    1 
ATOM   1372  C  CD1   . PHE B 2 49  ? -32.366 -6.264  -40.831  1.00 16.82 ? 49  PHE B CD1   1 
ATOM   1373  C  CD2   . PHE B 2 49  ? -30.940 -6.687  -42.692  1.00 10.20 ? 49  PHE B CD2   1 
ATOM   1374  C  CE1   . PHE B 2 49  ? -31.560 -5.130  -40.497  1.00 16.20 ? 49  PHE B CE1   1 
ATOM   1375  C  CE2   . PHE B 2 49  ? -30.128 -5.564  -42.345  1.00 10.41 ? 49  PHE B CE2   1 
ATOM   1376  C  CZ    . PHE B 2 49  ? -30.482 -4.767  -41.284  1.00 2.00  ? 49  PHE B CZ    1 
ATOM   1377  N  N     . ILE B 2 50  ? -34.520 -5.963  -44.204  1.00 5.06  ? 50  ILE B N     1 
ATOM   1378  C  CA    . ILE B 2 50  ? -34.372 -5.108  -45.401  1.00 7.52  ? 50  ILE B CA    1 
ATOM   1379  C  C     . ILE B 2 50  ? -33.726 -3.784  -44.985  1.00 11.82 ? 50  ILE B C     1 
ATOM   1380  O  O     . ILE B 2 50  ? -34.424 -2.835  -44.480  1.00 12.39 ? 50  ILE B O     1 
ATOM   1381  C  CB    . ILE B 2 50  ? -35.720 -4.889  -46.123  1.00 2.77  ? 50  ILE B CB    1 
ATOM   1382  C  CG1   . ILE B 2 50  ? -36.400 -6.229  -46.407  1.00 3.35  ? 50  ILE B CG1   1 
ATOM   1383  C  CG2   . ILE B 2 50  ? -35.437 -4.156  -47.429  1.00 3.07  ? 50  ILE B CG2   1 
ATOM   1384  C  CD1   . ILE B 2 50  ? -37.788 -6.164  -46.909  1.00 13.91 ? 50  ILE B CD1   1 
ATOM   1385  N  N     . GLY B 2 51  ? -32.398 -3.758  -45.087  1.00 2.00  ? 51  GLY B N     1 
ATOM   1386  C  CA    . GLY B 2 51  ? -31.642 -2.612  -44.614  1.00 3.72  ? 51  GLY B CA    1 
ATOM   1387  C  C     . GLY B 2 51  ? -31.921 -1.299  -45.352  1.00 2.00  ? 51  GLY B C     1 
ATOM   1388  O  O     . GLY B 2 51  ? -31.642 -0.287  -44.877  1.00 10.73 ? 51  GLY B O     1 
ATOM   1389  N  N     . ASN B 2 52  ? -32.511 -1.350  -46.513  1.00 6.58  ? 52  ASN B N     1 
ATOM   1390  C  CA    . ASN B 2 52  ? -32.775 -0.183  -47.365  1.00 3.99  ? 52  ASN B CA    1 
ATOM   1391  C  C     . ASN B 2 52  ? -34.050 -0.593  -48.047  1.00 4.43  ? 52  ASN B C     1 
ATOM   1392  O  O     . ASN B 2 52  ? -33.985 -1.328  -49.091  1.00 4.09  ? 52  ASN B O     1 
ATOM   1393  C  CB    . ASN B 2 52  ? -31.696 -0.097  -48.501  1.00 2.00  ? 52  ASN B CB    1 
ATOM   1394  C  CG    . ASN B 2 52  ? -32.006 0.973   -49.474  1.00 2.00  ? 52  ASN B CG    1 
ATOM   1395  O  OD1   . ASN B 2 52  ? -31.245 1.260   -50.422  1.00 2.00  ? 52  ASN B OD1   1 
ATOM   1396  N  ND2   . ASN B 2 52  ? -33.118 1.572   -49.270  1.00 2.00  ? 52  ASN B ND2   1 
ATOM   1397  N  N     . CYS B 2 53  ? -35.171 -0.179  -47.453  1.00 2.47  ? 53  CYS B N     1 
ATOM   1398  C  CA    . CYS B 2 53  ? -36.519 -0.259  -48.071  1.00 2.00  ? 53  CYS B CA    1 
ATOM   1399  C  C     . CYS B 2 53  ? -36.564 -0.044  -49.590  1.00 7.20  ? 53  CYS B C     1 
ATOM   1400  O  O     . CYS B 2 53  ? -37.337 -0.760  -50.230  1.00 2.53  ? 53  CYS B O     1 
ATOM   1401  C  CB    . CYS B 2 53  ? -37.595 0.537   -47.341  1.00 3.52  ? 53  CYS B CB    1 
ATOM   1402  S  SG    . CYS B 2 53  ? -37.374 2.381   -47.731  1.00 7.54  ? 53  CYS B SG    1 
ATOM   1403  N  N     . TYR B 2 54  ? -35.702 0.790   -50.216  1.00 5.54  ? 54  TYR B N     1 
ATOM   1404  C  CA    . TYR B 2 54  ? -35.807 1.007   -51.752  1.00 3.77  ? 54  TYR B CA    1 
ATOM   1405  C  C     . TYR B 2 54  ? -34.971 0.063   -52.559  1.00 2.00  ? 54  TYR B C     1 
ATOM   1406  O  O     . TYR B 2 54  ? -34.837 0.134   -53.846  1.00 3.20  ? 54  TYR B O     1 
ATOM   1407  C  CB    . TYR B 2 54  ? -35.553 2.481   -52.160  1.00 2.00  ? 54  TYR B CB    1 
ATOM   1408  C  CG    . TYR B 2 54  ? -36.613 3.419   -51.639  1.00 4.58  ? 54  TYR B CG    1 
ATOM   1409  C  CD1   . TYR B 2 54  ? -36.324 4.400   -50.673  1.00 2.00  ? 54  TYR B CD1   1 
ATOM   1410  C  CD2   . TYR B 2 54  ? -37.905 3.305   -52.066  1.00 2.00  ? 54  TYR B CD2   1 
ATOM   1411  C  CE1   . TYR B 2 54  ? -37.300 5.274   -50.179  1.00 2.00  ? 54  TYR B CE1   1 
ATOM   1412  C  CE2   . TYR B 2 54  ? -38.882 4.128   -51.557  1.00 3.81  ? 54  TYR B CE2   1 
ATOM   1413  C  CZ    . TYR B 2 54  ? -38.579 5.124   -50.632  1.00 8.35  ? 54  TYR B CZ    1 
ATOM   1414  O  OH    . TYR B 2 54  ? -39.605 5.925   -50.163  1.00 4.50  ? 54  TYR B OH    1 
ATOM   1415  N  N     . ALA B 2 55  ? -34.296 -0.768  -51.795  1.00 2.00  ? 55  ALA B N     1 
ATOM   1416  C  CA    . ALA B 2 55  ? -33.397 -1.767  -52.422  1.00 2.42  ? 55  ALA B CA    1 
ATOM   1417  C  C     . ALA B 2 55  ? -34.218 -2.829  -53.101  1.00 2.00  ? 55  ALA B C     1 
ATOM   1418  O  O     . ALA B 2 55  ? -33.711 -3.534  -53.958  1.00 4.53  ? 55  ALA B O     1 
ATOM   1419  C  CB    . ALA B 2 55  ? -32.405 -2.418  -51.356  1.00 2.00  ? 55  ALA B CB    1 
ATOM   1420  N  N     . VAL B 2 56  ? -35.483 -2.966  -52.741  1.00 2.00  ? 56  VAL B N     1 
ATOM   1421  C  CA    . VAL B 2 56  ? -36.269 -4.050  -53.358  1.00 7.80  ? 56  VAL B CA    1 
ATOM   1422  C  C     . VAL B 2 56  ? -37.711 -3.696  -53.130  1.00 4.08  ? 56  VAL B C     1 
ATOM   1423  O  O     . VAL B 2 56  ? -37.989 -2.976  -52.178  1.00 13.85 ? 56  VAL B O     1 
ATOM   1424  C  CB    . VAL B 2 56  ? -36.007 -5.514  -52.624  1.00 6.90  ? 56  VAL B CB    1 
ATOM   1425  C  CG1   . VAL B 2 56  ? -36.449 -5.526  -51.158  1.00 3.79  ? 56  VAL B CG1   1 
ATOM   1426  C  CG2   . VAL B 2 56  ? -36.848 -6.618  -53.268  1.00 4.44  ? 56  VAL B CG2   1 
ATOM   1427  N  N     . SER B 2 57  ? -38.633 -4.280  -53.893  1.00 7.76  ? 57  SER B N     1 
ATOM   1428  C  CA    . SER B 2 57  ? -40.070 -3.956  -53.766  1.00 5.00  ? 57  SER B CA    1 
ATOM   1429  C  C     . SER B 2 57  ? -40.878 -4.918  -52.887  1.00 8.04  ? 57  SER B C     1 
ATOM   1430  O  O     . SER B 2 57  ? -40.478 -6.059  -52.669  1.00 3.28  ? 57  SER B O     1 
ATOM   1431  C  CB    . SER B 2 57  ? -40.681 -3.862  -55.178  1.00 16.39 ? 57  SER B CB    1 
ATOM   1432  O  OG    . SER B 2 57  ? -41.086 -5.137  -55.603  1.00 2.79  ? 57  SER B OG    1 
ATOM   1433  N  N     . PRO B 2 58  ? -41.998 -4.456  -52.312  1.00 4.19  ? 58  PRO B N     1 
ATOM   1434  C  CA    . PRO B 2 58  ? -42.713 -5.484  -51.532  1.00 2.09  ? 58  PRO B CA    1 
ATOM   1435  C  C     . PRO B 2 58  ? -43.140 -6.696  -52.379  1.00 8.65  ? 58  PRO B C     1 
ATOM   1436  O  O     . PRO B 2 58  ? -42.822 -7.834  -52.006  1.00 14.80 ? 58  PRO B O     1 
ATOM   1437  C  CB    . PRO B 2 58  ? -43.929 -4.765  -50.991  1.00 2.00  ? 58  PRO B CB    1 
ATOM   1438  C  CG    . PRO B 2 58  ? -43.629 -3.305  -51.136  1.00 4.21  ? 58  PRO B CG    1 
ATOM   1439  C  CD    . PRO B 2 58  ? -42.651 -3.144  -52.280  1.00 2.00  ? 58  PRO B CD    1 
ATOM   1440  N  N     . ALA B 2 59  ? -43.826 -6.473  -53.493  1.00 2.00  ? 59  ALA B N     1 
ATOM   1441  C  CA    . ALA B 2 59  ? -44.242 -7.590  -54.330  1.00 4.42  ? 59  ALA B CA    1 
ATOM   1442  C  C     . ALA B 2 59  ? -43.060 -8.551  -54.364  1.00 11.19 ? 59  ALA B C     1 
ATOM   1443  O  O     . ALA B 2 59  ? -43.230 -9.757  -54.162  1.00 8.07  ? 59  ALA B O     1 
ATOM   1444  C  CB    . ALA B 2 59  ? -44.601 -7.155  -55.736  1.00 2.00  ? 59  ALA B CB    1 
ATOM   1445  N  N     . THR B 2 60  ? -41.853 -8.049  -54.595  1.00 3.89  ? 60  THR B N     1 
ATOM   1446  C  CA    . THR B 2 60  ? -40.769 -8.968  -54.558  1.00 2.00  ? 60  THR B CA    1 
ATOM   1447  C  C     . THR B 2 60  ? -40.557 -9.816  -53.289  1.00 11.88 ? 60  THR B C     1 
ATOM   1448  O  O     . THR B 2 60  ? -40.296 -11.049 -53.339  1.00 7.13  ? 60  THR B O     1 
ATOM   1449  C  CB    . THR B 2 60  ? -39.659 -8.886  -55.697  1.00 14.08 ? 60  THR B CB    1 
ATOM   1450  O  OG1   . THR B 2 60  ? -38.356 -9.105  -55.135  1.00 9.74  ? 60  THR B OG1   1 
ATOM   1451  C  CG2   . THR B 2 60  ? -39.644 -7.553  -56.465  1.00 2.00  ? 60  THR B CG2   1 
ATOM   1452  N  N     . VAL B 2 61  ? -40.699 -9.183  -52.134  1.00 2.00  ? 61  VAL B N     1 
ATOM   1453  C  CA    . VAL B 2 61  ? -40.333 -9.866  -50.918  1.00 3.77  ? 61  VAL B CA    1 
ATOM   1454  C  C     . VAL B 2 61  ? -41.503 -10.860 -50.706  1.00 13.92 ? 61  VAL B C     1 
ATOM   1455  O  O     . VAL B 2 61  ? -41.341 -11.993 -50.242  1.00 3.19  ? 61  VAL B O     1 
ATOM   1456  C  CB    . VAL B 2 61  ? -40.314 -8.874  -49.754  1.00 6.12  ? 61  VAL B CB    1 
ATOM   1457  C  CG1   . VAL B 2 61  ? -40.278 -9.554  -48.364  1.00 2.00  ? 61  VAL B CG1   1 
ATOM   1458  C  CG2   . VAL B 2 61  ? -39.225 -7.798  -50.008  1.00 5.54  ? 61  VAL B CG2   1 
ATOM   1459  N  N     . ILE B 2 62  ? -42.712 -10.409 -50.985  1.00 6.08  ? 62  ILE B N     1 
ATOM   1460  C  CA    . ILE B 2 62  ? -43.809 -11.161 -50.516  1.00 2.00  ? 62  ILE B CA    1 
ATOM   1461  C  C     . ILE B 2 62  ? -43.966 -12.421 -51.392  1.00 12.57 ? 62  ILE B C     1 
ATOM   1462  O  O     . ILE B 2 62  ? -44.285 -13.506 -50.906  1.00 6.23  ? 62  ILE B O     1 
ATOM   1463  C  CB    . ILE B 2 62  ? -45.051 -10.351 -50.531  1.00 9.22  ? 62  ILE B CB    1 
ATOM   1464  C  CG1   . ILE B 2 62  ? -45.135 -9.468  -49.290  1.00 2.00  ? 62  ILE B CG1   1 
ATOM   1465  C  CG2   . ILE B 2 62  ? -46.291 -11.286 -50.659  1.00 8.64  ? 62  ILE B CG2   1 
ATOM   1466  C  CD1   . ILE B 2 62  ? -46.082 -8.291  -49.545  1.00 7.95  ? 62  ILE B CD1   1 
ATOM   1467  N  N     . ARG B 2 63  ? -43.684 -12.319 -52.676  1.00 3.82  ? 63  ARG B N     1 
ATOM   1468  C  CA    . ARG B 2 63  ? -43.819 -13.500 -53.520  1.00 9.32  ? 63  ARG B CA    1 
ATOM   1469  C  C     . ARG B 2 63  ? -42.752 -14.583 -53.263  1.00 2.40  ? 63  ARG B C     1 
ATOM   1470  O  O     . ARG B 2 63  ? -42.974 -15.782 -53.506  1.00 2.00  ? 63  ARG B O     1 
ATOM   1471  C  CB    . ARG B 2 63  ? -43.892 -13.067 -54.991  1.00 5.95  ? 63  ARG B CB    1 
ATOM   1472  C  CG    . ARG B 2 63  ? -43.879 -14.188 -56.056  1.00 25.15 ? 63  ARG B CG    1 
ATOM   1473  C  CD    . ARG B 2 63  ? -43.798 -13.500 -57.446  1.00 24.67 ? 63  ARG B CD    1 
ATOM   1474  N  NE    . ARG B 2 63  ? -44.227 -12.107 -57.262  1.00 39.76 ? 63  ARG B NE    1 
ATOM   1475  C  CZ    . ARG B 2 63  ? -45.404 -11.629 -57.671  1.00 52.38 ? 63  ARG B CZ    1 
ATOM   1476  N  NH1   . ARG B 2 63  ? -46.253 -12.415 -58.346  1.00 39.92 ? 63  ARG B NH1   1 
ATOM   1477  N  NH2   . ARG B 2 63  ? -45.727 -10.363 -57.424  1.00 20.01 ? 63  ARG B NH2   1 
ATOM   1478  N  N     . ARG B 2 64  ? -41.589 -14.166 -52.787  1.00 2.00  ? 64  ARG B N     1 
ATOM   1479  C  CA    . ARG B 2 64  ? -40.498 -15.097 -52.598  1.00 3.57  ? 64  ARG B CA    1 
ATOM   1480  C  C     . ARG B 2 64  ? -40.483 -15.805 -51.218  1.00 8.15  ? 64  ARG B C     1 
ATOM   1481  O  O     . ARG B 2 64  ? -40.150 -16.985 -51.131  1.00 2.00  ? 64  ARG B O     1 
ATOM   1482  C  CB    . ARG B 2 64  ? -39.187 -14.381 -52.804  1.00 2.00  ? 64  ARG B CB    1 
ATOM   1483  C  CG    . ARG B 2 64  ? -38.015 -15.107 -52.156  1.00 16.10 ? 64  ARG B CG    1 
ATOM   1484  C  CD    . ARG B 2 64  ? -36.730 -14.973 -52.968  1.00 2.10  ? 64  ARG B CD    1 
ATOM   1485  N  NE    . ARG B 2 64  ? -35.667 -15.894 -52.519  1.00 10.24 ? 64  ARG B NE    1 
ATOM   1486  C  CZ    . ARG B 2 64  ? -34.379 -15.548 -52.367  1.00 10.86 ? 64  ARG B CZ    1 
ATOM   1487  N  NH1   . ARG B 2 64  ? -33.986 -14.299 -52.623  1.00 8.93  ? 64  ARG B NH1   1 
ATOM   1488  N  NH2   . ARG B 2 64  ? -33.469 -16.446 -51.987  1.00 2.25  ? 64  ARG B NH2   1 
ATOM   1489  N  N     . PHE B 2 65  ? -40.781 -15.062 -50.145  1.00 2.27  ? 65  PHE B N     1 
ATOM   1490  C  CA    . PHE B 2 65  ? -40.863 -15.627 -48.798  1.00 9.55  ? 65  PHE B CA    1 
ATOM   1491  C  C     . PHE B 2 65  ? -42.291 -15.528 -48.299  1.00 7.00  ? 65  PHE B C     1 
ATOM   1492  O  O     . PHE B 2 65  ? -42.643 -14.565 -47.656  1.00 21.67 ? 65  PHE B O     1 
ATOM   1493  C  CB    . PHE B 2 65  ? -39.900 -14.935 -47.844  1.00 2.00  ? 65  PHE B CB    1 
ATOM   1494  C  CG    . PHE B 2 65  ? -38.485 -14.905 -48.356  1.00 16.02 ? 65  PHE B CG    1 
ATOM   1495  C  CD1   . PHE B 2 65  ? -37.897 -13.718 -48.770  1.00 3.09  ? 65  PHE B CD1   1 
ATOM   1496  C  CD2   . PHE B 2 65  ? -37.737 -16.063 -48.446  1.00 6.97  ? 65  PHE B CD2   1 
ATOM   1497  C  CE1   . PHE B 2 65  ? -36.586 -13.696 -49.253  1.00 12.13 ? 65  PHE B CE1   1 
ATOM   1498  C  CE2   . PHE B 2 65  ? -36.435 -16.064 -48.967  1.00 2.00  ? 65  PHE B CE2   1 
ATOM   1499  C  CZ    . PHE B 2 65  ? -35.859 -14.897 -49.372  1.00 25.11 ? 65  PHE B CZ    1 
ATOM   1500  N  N     . PRO B 2 66  ? -43.147 -16.487 -48.682  1.00 12.17 ? 66  PRO B N     1 
ATOM   1501  C  CA    . PRO B 2 66  ? -44.548 -16.190 -48.424  1.00 4.43  ? 66  PRO B CA    1 
ATOM   1502  C  C     . PRO B 2 66  ? -44.944 -16.582 -47.053  1.00 4.56  ? 66  PRO B C     1 
ATOM   1503  O  O     . PRO B 2 66  ? -46.102 -16.385 -46.703  1.00 3.44  ? 66  PRO B O     1 
ATOM   1504  C  CB    . PRO B 2 66  ? -45.308 -17.041 -49.437  1.00 2.00  ? 66  PRO B CB    1 
ATOM   1505  C  CG    . PRO B 2 66  ? -44.273 -17.751 -50.183  1.00 2.00  ? 66  PRO B CG    1 
ATOM   1506  C  CD    . PRO B 2 66  ? -42.994 -17.737 -49.428  1.00 2.00  ? 66  PRO B CD    1 
ATOM   1507  N  N     . LYS B 2 67  ? -44.004 -17.099 -46.262  1.00 6.18  ? 67  LYS B N     1 
ATOM   1508  C  CA    . LYS B 2 67  ? -44.353 -17.520 -44.903  1.00 2.88  ? 67  LYS B CA    1 
ATOM   1509  C  C     . LYS B 2 67  ? -43.811 -16.657 -43.734  1.00 2.07  ? 67  LYS B C     1 
ATOM   1510  O  O     . LYS B 2 67  ? -43.930 -17.017 -42.566  1.00 2.00  ? 67  LYS B O     1 
ATOM   1511  C  CB    . LYS B 2 67  ? -44.068 -18.998 -44.734  1.00 2.00  ? 67  LYS B CB    1 
ATOM   1512  C  CG    . LYS B 2 67  ? -45.216 -19.915 -45.257  1.00 2.00  ? 67  LYS B CG    1 
ATOM   1513  C  CD    . LYS B 2 67  ? -45.532 -21.027 -44.274  1.00 26.00 ? 67  LYS B CD    1 
ATOM   1514  C  CE    . LYS B 2 67  ? -45.216 -22.436 -44.844  1.00 50.73 ? 67  LYS B CE    1 
ATOM   1515  N  NZ    . LYS B 2 67  ? -46.210 -23.539 -44.453  1.00 10.31 ? 67  LYS B NZ    1 
ATOM   1516  N  N     . VAL B 2 68  ? -43.256 -15.493 -44.072  1.00 4.74  ? 68  VAL B N     1 
ATOM   1517  C  CA    . VAL B 2 68  ? -42.527 -14.650 -43.110  1.00 2.00  ? 68  VAL B CA    1 
ATOM   1518  C  C     . VAL B 2 68  ? -43.390 -14.275 -41.978  1.00 2.00  ? 68  VAL B C     1 
ATOM   1519  O  O     . VAL B 2 68  ? -44.525 -13.975 -42.184  1.00 3.26  ? 68  VAL B O     1 
ATOM   1520  C  CB    . VAL B 2 68  ? -42.038 -13.386 -43.808  1.00 7.84  ? 68  VAL B CB    1 
ATOM   1521  C  CG1   . VAL B 2 68  ? -41.747 -12.289 -42.795  1.00 4.70  ? 68  VAL B CG1   1 
ATOM   1522  C  CG2   . VAL B 2 68  ? -40.812 -13.738 -44.653  1.00 2.00  ? 68  VAL B CG2   1 
ATOM   1523  N  N     . ARG B 2 69  ? -42.860 -14.314 -40.761  1.00 7.11  ? 69  ARG B N     1 
ATOM   1524  C  CA    . ARG B 2 69  ? -43.617 -13.933 -39.580  1.00 5.11  ? 69  ARG B CA    1 
ATOM   1525  C  C     . ARG B 2 69  ? -43.142 -12.603 -38.978  1.00 3.19  ? 69  ARG B C     1 
ATOM   1526  O  O     . ARG B 2 69  ? -43.729 -12.034 -38.036  1.00 2.00  ? 69  ARG B O     1 
ATOM   1527  C  CB    . ARG B 2 69  ? -43.547 -15.051 -38.563  1.00 2.53  ? 69  ARG B CB    1 
ATOM   1528  C  CG    . ARG B 2 69  ? -44.721 -15.980 -38.671  1.00 2.00  ? 69  ARG B CG    1 
ATOM   1529  C  CD    . ARG B 2 69  ? -44.303 -17.455 -38.973  1.00 37.88 ? 69  ARG B CD    1 
ATOM   1530  N  NE    . ARG B 2 69  ? -45.453 -18.365 -38.898  1.00 21.92 ? 69  ARG B NE    1 
ATOM   1531  C  CZ    . ARG B 2 69  ? -46.095 -18.651 -37.761  1.00 36.82 ? 69  ARG B CZ    1 
ATOM   1532  N  NH1   . ARG B 2 69  ? -45.692 -18.118 -36.602  1.00 32.60 ? 69  ARG B NH1   1 
ATOM   1533  N  NH2   . ARG B 2 69  ? -47.140 -19.470 -37.761  1.00 3.63  ? 69  ARG B NH2   1 
ATOM   1534  N  N     . SER B 2 70  ? -42.020 -12.141 -39.506  1.00 6.70  ? 70  SER B N     1 
ATOM   1535  C  CA    . SER B 2 70  ? -41.285 -11.078 -38.845  1.00 2.00  ? 70  SER B CA    1 
ATOM   1536  C  C     . SER B 2 70  ? -40.510 -10.265 -39.880  1.00 6.16  ? 70  SER B C     1 
ATOM   1537  O  O     . SER B 2 70  ? -39.732 -10.806 -40.713  1.00 3.44  ? 70  SER B O     1 
ATOM   1538  C  CB    . SER B 2 70  ? -40.360 -11.603 -37.785  1.00 9.35  ? 70  SER B CB    1 
ATOM   1539  O  OG    . SER B 2 70  ? -39.210 -10.715 -37.643  1.00 4.98  ? 70  SER B OG    1 
ATOM   1540  N  N     . VAL B 2 71  ? -40.794 -8.963  -39.882  1.00 2.61  ? 71  VAL B N     1 
ATOM   1541  C  CA    . VAL B 2 71  ? -40.231 -8.066  -40.883  1.00 2.00  ? 71  VAL B CA    1 
ATOM   1542  C  C     . VAL B 2 71  ? -39.468 -6.857  -40.286  1.00 2.00  ? 71  VAL B C     1 
ATOM   1543  O  O     . VAL B 2 71  ? -39.935 -6.207  -39.352  1.00 2.00  ? 71  VAL B O     1 
ATOM   1544  C  CB    . VAL B 2 71  ? -41.276 -7.646  -41.866  1.00 2.00  ? 71  VAL B CB    1 
ATOM   1545  C  CG1   . VAL B 2 71  ? -40.639 -6.800  -42.933  1.00 10.25 ? 71  VAL B CG1   1 
ATOM   1546  C  CG2   . VAL B 2 71  ? -41.768 -8.896  -42.576  1.00 25.36 ? 71  VAL B CG2   1 
ATOM   1547  N  N     . GLU B 2 72  ? -38.255 -6.637  -40.792  1.00 2.00  ? 72  GLU B N     1 
ATOM   1548  C  CA    . GLU B 2 72  ? -37.552 -5.451  -40.474  1.00 5.79  ? 72  GLU B CA    1 
ATOM   1549  C  C     . GLU B 2 72  ? -37.180 -4.574  -41.645  1.00 2.17  ? 72  GLU B C     1 
ATOM   1550  O  O     . GLU B 2 72  ? -36.516 -5.056  -42.594  1.00 2.67  ? 72  GLU B O     1 
ATOM   1551  C  CB    . GLU B 2 72  ? -36.368 -5.727  -39.571  1.00 3.66  ? 72  GLU B CB    1 
ATOM   1552  C  CG    . GLU B 2 72  ? -35.324 -4.551  -39.481  1.00 3.69  ? 72  GLU B CG    1 
ATOM   1553  C  CD    . GLU B 2 72  ? -34.395 -4.673  -38.202  1.00 14.96 ? 72  GLU B CD    1 
ATOM   1554  O  OE1   . GLU B 2 72  ? -33.939 -5.789  -37.796  1.00 7.93  ? 72  GLU B OE1   1 
ATOM   1555  O  OE2   . GLU B 2 72  ? -34.112 -3.621  -37.593  1.00 11.21 ? 72  GLU B OE2   1 
ATOM   1556  N  N     . LEU B 2 73  ? -37.553 -3.266  -41.544  1.00 7.18  ? 73  LEU B N     1 
ATOM   1557  C  CA    . LEU B 2 73  ? -37.256 -2.199  -42.615  1.00 5.33  ? 73  LEU B CA    1 
ATOM   1558  C  C     . LEU B 2 73  ? -36.594 -0.868  -42.145  1.00 3.90  ? 73  LEU B C     1 
ATOM   1559  O  O     . LEU B 2 73  ? -36.972 -0.253  -41.087  1.00 9.29  ? 73  LEU B O     1 
ATOM   1560  C  CB    . LEU B 2 73  ? -38.590 -1.779  -43.208  1.00 2.00  ? 73  LEU B CB    1 
ATOM   1561  C  CG    . LEU B 2 73  ? -39.204 -2.749  -44.162  1.00 4.13  ? 73  LEU B CG    1 
ATOM   1562  C  CD1   . LEU B 2 73  ? -40.693 -2.873  -43.865  1.00 4.72  ? 73  LEU B CD1   1 
ATOM   1563  C  CD2   . LEU B 2 73  ? -38.818 -2.505  -45.662  1.00 2.00  ? 73  LEU B CD2   1 
ATOM   1564  N  N     . LYS B 2 74  ? -35.716 -0.342  -42.978  1.00 14.15 ? 74  LYS B N     1 
ATOM   1565  C  CA    . LYS B 2 74  ? -34.936 0.856   -42.644  1.00 4.65  ? 74  LYS B CA    1 
ATOM   1566  C  C     . LYS B 2 74  ? -35.110 1.813   -43.808  1.00 8.62  ? 74  LYS B C     1 
ATOM   1567  O  O     . LYS B 2 74  ? -35.080 1.383   -44.976  1.00 5.64  ? 74  LYS B O     1 
ATOM   1568  C  CB    . LYS B 2 74  ? -33.487 0.469   -42.464  1.00 2.00  ? 74  LYS B CB    1 
ATOM   1569  C  CG    . LYS B 2 74  ? -33.422 -0.096  -41.090  1.00 3.82  ? 74  LYS B CG    1 
ATOM   1570  C  CD    . LYS B 2 74  ? -32.144 -0.881  -40.817  1.00 6.41  ? 74  LYS B CD    1 
ATOM   1571  C  CE    . LYS B 2 74  ? -31.794 -0.813  -39.357  1.00 2.00  ? 74  LYS B CE    1 
ATOM   1572  N  NZ    . LYS B 2 74  ? -30.378 -1.145  -39.084  1.00 7.80  ? 74  LYS B NZ    1 
ATOM   1573  N  N     . GLY B 2 75  ? -35.346 3.093   -43.511  1.00 2.25  ? 75  GLY B N     1 
ATOM   1574  C  CA    . GLY B 2 75  ? -35.713 4.031   -44.588  1.00 2.00  ? 75  GLY B CA    1 
ATOM   1575  C  C     . GLY B 2 75  ? -34.643 5.056   -44.877  1.00 2.00  ? 75  GLY B C     1 
ATOM   1576  O  O     . GLY B 2 75  ? -33.649 4.771   -45.582  1.00 5.64  ? 75  GLY B O     1 
ATOM   1577  N  N     . LYS B 2 76  ? -34.804 6.258   -44.348  1.00 7.86  ? 76  LYS B N     1 
ATOM   1578  C  CA    . LYS B 2 76  ? -33.844 7.363   -44.644  1.00 2.24  ? 76  LYS B CA    1 
ATOM   1579  C  C     . LYS B 2 76  ? -32.387 6.953   -44.216  1.00 9.91  ? 76  LYS B C     1 
ATOM   1580  O  O     . LYS B 2 76  ? -32.215 6.135   -43.258  1.00 7.89  ? 76  LYS B O     1 
ATOM   1581  C  CB    . LYS B 2 76  ? -34.283 8.575   -43.855  1.00 2.78  ? 76  LYS B CB    1 
ATOM   1582  C  CG    . LYS B 2 76  ? -35.813 8.821   -43.924  1.00 5.30  ? 76  LYS B CG    1 
ATOM   1583  C  CD    . LYS B 2 76  ? -36.131 10.091  -43.138  1.00 9.00  ? 76  LYS B CD    1 
ATOM   1584  C  CE    . LYS B 2 76  ? -37.609 10.440  -43.171  1.00 22.07 ? 76  LYS B CE    1 
ATOM   1585  N  NZ    . LYS B 2 76  ? -37.901 11.873  -42.741  1.00 24.46 ? 76  LYS B NZ    1 
ATOM   1586  N  N     . PRO B 2 77  ? -31.361 7.520   -44.906  1.00 2.00  ? 77  PRO B N     1 
ATOM   1587  C  CA    . PRO B 2 77  ? -29.937 7.418   -44.610  1.00 2.00  ? 77  PRO B CA    1 
ATOM   1588  C  C     . PRO B 2 77  ? -29.684 7.980   -43.236  1.00 2.50  ? 77  PRO B C     1 
ATOM   1589  O  O     . PRO B 2 77  ? -30.512 8.772   -42.680  1.00 2.96  ? 77  PRO B O     1 
ATOM   1590  C  CB    . PRO B 2 77  ? -29.300 8.399   -45.610  1.00 5.66  ? 77  PRO B CB    1 
ATOM   1591  C  CG    . PRO B 2 77  ? -30.321 8.534   -46.749  1.00 2.00  ? 77  PRO B CG    1 
ATOM   1592  C  CD    . PRO B 2 77  ? -31.660 8.408   -46.069  1.00 2.00  ? 77  PRO B CD    1 
ATOM   1593  N  N     . HIS B 2 78  ? -28.538 7.641   -42.670  1.00 3.09  ? 78  HIS B N     1 
ATOM   1594  C  CA    . HIS B 2 78  ? -28.298 7.915   -41.199  1.00 2.00  ? 78  HIS B CA    1 
ATOM   1595  C  C     . HIS B 2 78  ? -28.383 9.438   -40.922  1.00 5.99  ? 78  HIS B C     1 
ATOM   1596  O  O     . HIS B 2 78  ? -28.882 9.849   -39.858  1.00 3.24  ? 78  HIS B O     1 
ATOM   1597  C  CB    . HIS B 2 78  ? -26.933 7.313   -40.846  1.00 2.00  ? 78  HIS B CB    1 
ATOM   1598  C  CG    . HIS B 2 78  ? -26.350 7.781   -39.565  1.00 2.00  ? 78  HIS B CG    1 
ATOM   1599  N  ND1   . HIS B 2 78  ? -25.005 8.013   -39.423  1.00 2.00  ? 78  HIS B ND1   1 
ATOM   1600  C  CD2   . HIS B 2 78  ? -26.898 7.982   -38.356  1.00 2.02  ? 78  HIS B CD2   1 
ATOM   1601  C  CE1   . HIS B 2 78  ? -24.777 8.439   -38.196  1.00 6.60  ? 78  HIS B CE1   1 
ATOM   1602  N  NE2   . HIS B 2 78  ? -25.910 8.441   -37.535  1.00 2.00  ? 78  HIS B NE2   1 
ATOM   1603  N  N     . PHE B 2 79  ? -27.963 10.241  -41.930  1.00 2.90  ? 79  PHE B N     1 
ATOM   1604  C  CA    . PHE B 2 79  ? -27.724 11.707  -41.829  1.00 7.64  ? 79  PHE B CA    1 
ATOM   1605  C  C     . PHE B 2 79  ? -29.009 12.475  -41.714  1.00 9.76  ? 79  PHE B C     1 
ATOM   1606  O  O     . PHE B 2 79  ? -28.970 13.685  -41.361  1.00 5.18  ? 79  PHE B O     1 
ATOM   1607  C  CB    . PHE B 2 79  ? -26.935 12.285  -43.016  1.00 2.00  ? 79  PHE B CB    1 
ATOM   1608  C  CG    . PHE B 2 79  ? -25.412 12.256  -42.827  1.00 5.56  ? 79  PHE B CG    1 
ATOM   1609  C  CD1   . PHE B 2 79  ? -24.803 11.561  -41.728  1.00 2.15  ? 79  PHE B CD1   1 
ATOM   1610  C  CD2   . PHE B 2 79  ? -24.577 12.897  -43.714  1.00 2.00  ? 79  PHE B CD2   1 
ATOM   1611  C  CE1   . PHE B 2 79  ? -23.399 11.523  -41.566  1.00 2.00  ? 79  PHE B CE1   1 
ATOM   1612  C  CE2   . PHE B 2 79  ? -23.169 12.824  -43.516  1.00 7.99  ? 79  PHE B CE2   1 
ATOM   1613  C  CZ    . PHE B 2 79  ? -22.615 12.134  -42.428  1.00 2.00  ? 79  PHE B CZ    1 
ATOM   1614  N  N     . ALA B 2 80  ? -30.141 11.785  -41.968  1.00 4.76  ? 80  ALA B N     1 
ATOM   1615  C  CA    . ALA B 2 80  ? -31.483 12.299  -41.550  1.00 6.20  ? 80  ALA B CA    1 
ATOM   1616  C  C     . ALA B 2 80  ? -31.490 12.788  -40.125  1.00 8.83  ? 80  ALA B C     1 
ATOM   1617  O  O     . ALA B 2 80  ? -32.182 13.747  -39.794  1.00 7.10  ? 80  ALA B O     1 
ATOM   1618  C  CB    . ALA B 2 80  ? -32.535 11.271  -41.701  1.00 11.75 ? 80  ALA B CB    1 
ATOM   1619  N  N     . ASP B 2 81  ? -30.719 12.132  -39.275  1.00 2.44  ? 81  ASP B N     1 
ATOM   1620  C  CA    . ASP B 2 81  ? -30.675 12.566  -37.898  1.00 7.92  ? 81  ASP B CA    1 
ATOM   1621  C  C     . ASP B 2 81  ? -30.136 13.947  -37.727  1.00 8.52  ? 81  ASP B C     1 
ATOM   1622  O  O     . ASP B 2 81  ? -30.385 14.528  -36.700  1.00 5.71  ? 81  ASP B O     1 
ATOM   1623  C  CB    . ASP B 2 81  ? -29.846 11.611  -37.013  1.00 20.66 ? 81  ASP B CB    1 
ATOM   1624  C  CG    . ASP B 2 81  ? -30.462 10.202  -36.894  1.00 20.66 ? 81  ASP B CG    1 
ATOM   1625  O  OD1   . ASP B 2 81  ? -31.612 10.023  -37.370  1.00 8.07  ? 81  ASP B OD1   1 
ATOM   1626  O  OD2   . ASP B 2 81  ? -29.760 9.287   -36.376  1.00 18.79 ? 81  ASP B OD2   1 
ATOM   1627  N  N     . PHE B 2 82  ? -29.411 14.459  -38.716  1.00 5.55  ? 82  PHE B N     1 
ATOM   1628  C  CA    . PHE B 2 82  ? -28.672 15.706  -38.558  1.00 7.34  ? 82  PHE B CA    1 
ATOM   1629  C  C     . PHE B 2 82  ? -29.247 16.804  -39.447  1.00 2.00  ? 82  PHE B C     1 
ATOM   1630  O  O     . PHE B 2 82  ? -28.521 17.443  -40.209  1.00 5.11  ? 82  PHE B O     1 
ATOM   1631  C  CB    . PHE B 2 82  ? -27.191 15.495  -38.875  1.00 2.39  ? 82  PHE B CB    1 
ATOM   1632  C  CG    . PHE B 2 82  ? -26.559 14.373  -38.101  1.00 2.00  ? 82  PHE B CG    1 
ATOM   1633  C  CD1   . PHE B 2 82  ? -26.901 14.148  -36.779  1.00 2.00  ? 82  PHE B CD1   1 
ATOM   1634  C  CD2   . PHE B 2 82  ? -25.623 13.544  -38.696  1.00 8.19  ? 82  PHE B CD2   1 
ATOM   1635  C  CE1   . PHE B 2 82  ? -26.322 13.117  -36.064  1.00 4.69  ? 82  PHE B CE1   1 
ATOM   1636  C  CE2   . PHE B 2 82  ? -25.040 12.511  -37.987  1.00 3.52  ? 82  PHE B CE2   1 
ATOM   1637  C  CZ    . PHE B 2 82  ? -25.390 12.297  -36.669  1.00 2.00  ? 82  PHE B CZ    1 
ATOM   1638  N  N     . ASN B 2 83  ? -30.555 17.018  -39.343  1.00 6.10  ? 83  ASN B N     1 
ATOM   1639  C  CA    . ASN B 2 83  ? -31.443 16.902  -40.494  1.00 2.70  ? 83  ASN B CA    1 
ATOM   1640  C  C     . ASN B 2 83  ? -30.795 17.412  -41.776  1.00 7.88  ? 83  ASN B C     1 
ATOM   1641  O  O     . ASN B 2 83  ? -30.885 18.596  -42.101  1.00 6.18  ? 83  ASN B O     1 
ATOM   1642  C  CB    . ASN B 2 83  ? -32.754 17.648  -40.235  1.00 29.89 ? 83  ASN B CB    1 
ATOM   1643  C  CG    . ASN B 2 83  ? -32.707 18.489  -38.974  1.00 39.56 ? 83  ASN B CG    1 
ATOM   1644  O  OD1   . ASN B 2 83  ? -31.906 19.417  -38.863  1.00 21.93 ? 83  ASN B OD1   1 
ATOM   1645  N  ND2   . ASN B 2 83  ? -33.568 18.167  -38.016  1.00 7.46  ? 83  ASN B ND2   1 
ATOM   1646  N  N     . LEU B 2 84  ? -30.141 16.510  -42.501  1.00 6.98  ? 84  LEU B N     1 
ATOM   1647  C  CA    . LEU B 2 84  ? -29.529 16.853  -43.780  1.00 2.00  ? 84  LEU B CA    1 
ATOM   1648  C  C     . LEU B 2 84  ? -30.346 16.309  -44.946  1.00 2.06  ? 84  LEU B C     1 
ATOM   1649  O  O     . LEU B 2 84  ? -30.005 16.523  -46.109  1.00 3.13  ? 84  LEU B O     1 
ATOM   1650  C  CB    . LEU B 2 84  ? -28.096 16.320  -43.848  1.00 2.74  ? 84  LEU B CB    1 
ATOM   1651  C  CG    . LEU B 2 84  ? -27.088 16.963  -42.892  1.00 9.79  ? 84  LEU B CG    1 
ATOM   1652  C  CD1   . LEU B 2 84  ? -25.724 16.304  -43.028  1.00 3.52  ? 84  LEU B CD1   1 
ATOM   1653  C  CD2   . LEU B 2 84  ? -26.992 18.460  -43.140  1.00 2.00  ? 84  LEU B CD2   1 
ATOM   1654  N  N     . VAL B 2 85  ? -31.427 15.604  -44.627  1.00 2.00  ? 85  VAL B N     1 
ATOM   1655  C  CA    . VAL B 2 85  ? -32.435 15.240  -45.631  1.00 2.00  ? 85  VAL B CA    1 
ATOM   1656  C  C     . VAL B 2 85  ? -33.822 16.028  -45.578  1.00 10.25 ? 85  VAL B C     1 
ATOM   1657  O  O     . VAL B 2 85  ? -34.579 15.969  -44.581  1.00 11.57 ? 85  VAL B O     1 
ATOM   1658  C  CB    . VAL B 2 85  ? -32.489 13.658  -45.986  1.00 13.53 ? 85  VAL B CB    1 
ATOM   1659  C  CG1   . VAL B 2 85  ? -31.700 12.752  -44.998  1.00 2.93  ? 85  VAL B CG1   1 
ATOM   1660  C  CG2   . VAL B 2 85  ? -33.893 13.113  -46.158  1.00 2.25  ? 85  VAL B CG2   1 
ATOM   1661  N  N     . PRO B 2 86  ? -34.136 16.828  -46.623  1.00 3.79  ? 86  PRO B N     1 
ATOM   1662  C  CA    . PRO B 2 86  ? -35.346 17.675  -46.457  1.00 6.72  ? 86  PRO B CA    1 
ATOM   1663  C  C     . PRO B 2 86  ? -36.539 16.736  -46.171  1.00 9.22  ? 86  PRO B C     1 
ATOM   1664  O  O     . PRO B 2 86  ? -36.520 15.577  -46.641  1.00 5.92  ? 86  PRO B O     1 
ATOM   1665  C  CB    . PRO B 2 86  ? -35.521 18.294  -47.858  1.00 2.19  ? 86  PRO B CB    1 
ATOM   1666  C  CG    . PRO B 2 86  ? -34.221 18.180  -48.485  1.00 2.00  ? 86  PRO B CG    1 
ATOM   1667  C  CD    . PRO B 2 86  ? -33.478 17.044  -47.924  1.00 2.00  ? 86  PRO B CD    1 
ATOM   1668  N  N     . ASP B 2 87  ? -37.529 17.214  -45.400  1.00 4.86  ? 87  ASP B N     1 
ATOM   1669  C  CA    . ASP B 2 87  ? -38.844 16.583  -45.244  1.00 2.01  ? 87  ASP B CA    1 
ATOM   1670  C  C     . ASP B 2 87  ? -39.431 16.165  -46.613  1.00 2.00  ? 87  ASP B C     1 
ATOM   1671  O  O     . ASP B 2 87  ? -39.285 16.844  -47.655  1.00 6.23  ? 87  ASP B O     1 
ATOM   1672  C  CB    . ASP B 2 87  ? -39.803 17.581  -44.528  1.00 9.42  ? 87  ASP B CB    1 
ATOM   1673  C  CG    . ASP B 2 87  ? -39.395 17.847  -43.087  1.00 14.37 ? 87  ASP B CG    1 
ATOM   1674  O  OD1   . ASP B 2 87  ? -39.601 18.952  -42.548  1.00 34.75 ? 87  ASP B OD1   1 
ATOM   1675  O  OD2   . ASP B 2 87  ? -38.843 16.940  -42.472  1.00 19.99 ? 87  ASP B OD2   1 
ATOM   1676  N  N     . GLY B 2 88  ? -40.127 15.054  -46.619  1.00 3.74  ? 88  GLY B N     1 
ATOM   1677  C  CA    . GLY B 2 88  ? -40.828 14.621  -47.810  1.00 2.00  ? 88  GLY B CA    1 
ATOM   1678  C  C     . GLY B 2 88  ? -39.974 13.727  -48.726  1.00 6.16  ? 88  GLY B C     1 
ATOM   1679  O  O     . GLY B 2 88  ? -40.440 13.264  -49.777  1.00 2.00  ? 88  GLY B O     1 
ATOM   1680  N  N     . TRP B 2 89  ? -38.717 13.513  -48.366  1.00 2.00  ? 89  TRP B N     1 
ATOM   1681  C  CA    . TRP B 2 89  ? -37.830 12.791  -49.278  1.00 4.45  ? 89  TRP B CA    1 
ATOM   1682  C  C     . TRP B 2 89  ? -38.295 11.322  -49.599  1.00 9.26  ? 89  TRP B C     1 
ATOM   1683  O  O     . TRP B 2 89  ? -38.087 10.823  -50.714  1.00 2.00  ? 89  TRP B O     1 
ATOM   1684  C  CB    . TRP B 2 89  ? -36.454 12.681  -48.578  1.00 4.05  ? 89  TRP B CB    1 
ATOM   1685  C  CG    . TRP B 2 89  ? -35.506 11.666  -49.230  1.00 6.34  ? 89  TRP B CG    1 
ATOM   1686  C  CD1   . TRP B 2 89  ? -34.657 11.903  -50.267  1.00 2.00  ? 89  TRP B CD1   1 
ATOM   1687  C  CD2   . TRP B 2 89  ? -35.359 10.247  -48.880  1.00 2.00  ? 89  TRP B CD2   1 
ATOM   1688  N  NE1   . TRP B 2 89  ? -33.996 10.731  -50.584  1.00 6.51  ? 89  TRP B NE1   1 
ATOM   1689  C  CE2   . TRP B 2 89  ? -34.377 9.720   -49.717  1.00 2.66  ? 89  TRP B CE2   1 
ATOM   1690  C  CE3   . TRP B 2 89  ? -35.943 9.407   -47.906  1.00 4.82  ? 89  TRP B CE3   1 
ATOM   1691  C  CZ2   . TRP B 2 89  ? -33.994 8.360   -49.668  1.00 3.26  ? 89  TRP B CZ2   1 
ATOM   1692  C  CZ3   . TRP B 2 89  ? -35.526 8.079   -47.816  1.00 2.87  ? 89  TRP B CZ3   1 
ATOM   1693  C  CH2   . TRP B 2 89  ? -34.564 7.570   -48.714  1.00 2.00  ? 89  TRP B CH2   1 
ATOM   1694  N  N     . GLY B 2 90  ? -38.826 10.627  -48.580  1.00 2.00  ? 90  GLY B N     1 
ATOM   1695  C  CA    . GLY B 2 90  ? -39.407 9.333   -48.742  1.00 3.04  ? 90  GLY B CA    1 
ATOM   1696  C  C     . GLY B 2 90  ? -39.325 8.480   -47.477  1.00 3.64  ? 90  GLY B C     1 
ATOM   1697  O  O     . GLY B 2 90  ? -39.265 9.004   -46.384  1.00 2.00  ? 90  GLY B O     1 
ATOM   1698  N  N     . GLY B 2 91  ? -39.348 7.158   -47.628  1.00 9.18  ? 91  GLY B N     1 
ATOM   1699  C  CA    . GLY B 2 91  ? -39.259 6.240   -46.432  1.00 2.00  ? 91  GLY B CA    1 
ATOM   1700  C  C     . GLY B 2 91  ? -40.610 5.787   -45.956  1.00 2.00  ? 91  GLY B C     1 
ATOM   1701  O  O     . GLY B 2 91  ? -40.777 5.429   -44.786  1.00 11.04 ? 91  GLY B O     1 
ATOM   1702  N  N     . TYR B 2 92  ? -41.609 5.810   -46.835  1.00 3.57  ? 92  TYR B N     1 
ATOM   1703  C  CA    . TYR B 2 92  ? -43.014 5.614   -46.382  1.00 2.51  ? 92  TYR B CA    1 
ATOM   1704  C  C     . TYR B 2 92  ? -43.199 4.122   -46.259  1.00 12.13 ? 92  TYR B C     1 
ATOM   1705  O  O     . TYR B 2 92  ? -42.827 3.381   -47.151  1.00 2.00  ? 92  TYR B O     1 
ATOM   1706  C  CB    . TYR B 2 92  ? -44.008 6.152   -47.445  1.00 11.86 ? 92  TYR B CB    1 
ATOM   1707  C  CG    . TYR B 2 92  ? -43.880 7.660   -47.725  1.00 2.32  ? 92  TYR B CG    1 
ATOM   1708  C  CD1   . TYR B 2 92  ? -43.072 8.126   -48.779  1.00 12.21 ? 92  TYR B CD1   1 
ATOM   1709  C  CD2   . TYR B 2 92  ? -44.574 8.614   -46.935  1.00 11.65 ? 92  TYR B CD2   1 
ATOM   1710  C  CE1   . TYR B 2 92  ? -42.945 9.513   -49.044  1.00 15.07 ? 92  TYR B CE1   1 
ATOM   1711  C  CE2   . TYR B 2 92  ? -44.455 10.024  -47.171  1.00 4.98  ? 92  TYR B CE2   1 
ATOM   1712  C  CZ    . TYR B 2 92  ? -43.637 10.451  -48.238  1.00 13.18 ? 92  TYR B CZ    1 
ATOM   1713  O  OH    . TYR B 2 92  ? -43.484 11.794  -48.497  1.00 18.97 ? 92  TYR B OH    1 
ATOM   1714  N  N     . VAL B 2 93  ? -43.757 3.662   -45.140  1.00 10.39 ? 93  VAL B N     1 
ATOM   1715  C  CA    . VAL B 2 93  ? -43.937 2.259   -44.957  1.00 2.00  ? 93  VAL B CA    1 
ATOM   1716  C  C     . VAL B 2 93  ? -45.281 1.811   -45.492  1.00 9.81  ? 93  VAL B C     1 
ATOM   1717  O  O     . VAL B 2 93  ? -45.523 0.619   -45.603  1.00 11.14 ? 93  VAL B O     1 
ATOM   1718  C  CB    . VAL B 2 93  ? -43.833 1.868   -43.489  1.00 2.00  ? 93  VAL B CB    1 
ATOM   1719  C  CG1   . VAL B 2 93  ? -45.079 2.231   -42.750  1.00 2.00  ? 93  VAL B CG1   1 
ATOM   1720  C  CG2   . VAL B 2 93  ? -43.447 0.361   -43.375  1.00 2.00  ? 93  VAL B CG2   1 
ATOM   1721  N  N     . TYR B 2 94  ? -46.188 2.736   -45.792  1.00 9.29  ? 94  TYR B N     1 
ATOM   1722  C  CA    . TYR B 2 94  ? -47.502 2.270   -46.166  1.00 9.47  ? 94  TYR B CA    1 
ATOM   1723  C  C     . TYR B 2 94  ? -47.520 1.223   -47.278  1.00 2.00  ? 94  TYR B C     1 
ATOM   1724  O  O     . TYR B 2 94  ? -48.156 0.208   -47.136  1.00 3.30  ? 94  TYR B O     1 
ATOM   1725  C  CB    . TYR B 2 94  ? -48.389 3.398   -46.582  1.00 6.81  ? 94  TYR B CB    1 
ATOM   1726  C  CG    . TYR B 2 94  ? -49.801 2.933   -46.767  1.00 3.80  ? 94  TYR B CG    1 
ATOM   1727  C  CD1   . TYR B 2 94  ? -50.602 2.653   -45.651  1.00 12.86 ? 94  TYR B CD1   1 
ATOM   1728  C  CD2   . TYR B 2 94  ? -50.364 2.770   -48.065  1.00 2.03  ? 94  TYR B CD2   1 
ATOM   1729  C  CE1   . TYR B 2 94  ? -51.945 2.240   -45.812  1.00 2.00  ? 94  TYR B CE1   1 
ATOM   1730  C  CE2   . TYR B 2 94  ? -51.660 2.349   -48.226  1.00 2.00  ? 94  TYR B CE2   1 
ATOM   1731  C  CZ    . TYR B 2 94  ? -52.443 2.100   -47.102  1.00 4.69  ? 94  TYR B CZ    1 
ATOM   1732  O  OH    . TYR B 2 94  ? -53.722 1.685   -47.228  1.00 14.09 ? 94  TYR B OH    1 
ATOM   1733  N  N     . PRO B 2 95  ? -46.903 1.502   -48.417  1.00 2.00  ? 95  PRO B N     1 
ATOM   1734  C  CA    . PRO B 2 95  ? -47.008 0.470   -49.427  1.00 2.00  ? 95  PRO B CA    1 
ATOM   1735  C  C     . PRO B 2 95  ? -46.659 -0.976  -48.891  1.00 5.92  ? 95  PRO B C     1 
ATOM   1736  O  O     . PRO B 2 95  ? -47.031 -1.977  -49.521  1.00 9.91  ? 95  PRO B O     1 
ATOM   1737  C  CB    . PRO B 2 95  ? -46.000 0.953   -50.533  1.00 2.00  ? 95  PRO B CB    1 
ATOM   1738  C  CG    . PRO B 2 95  ? -45.912 2.427   -50.418  1.00 2.00  ? 95  PRO B CG    1 
ATOM   1739  C  CD    . PRO B 2 95  ? -46.124 2.675   -48.886  1.00 3.72  ? 95  PRO B CD    1 
ATOM   1740  N  N     . TRP B 2 96  ? -45.942 -1.090  -47.767  1.00 5.58  ? 96  TRP B N     1 
ATOM   1741  C  CA    . TRP B 2 96  ? -45.360 -2.392  -47.326  1.00 7.93  ? 96  TRP B CA    1 
ATOM   1742  C  C     . TRP B 2 96  ? -46.488 -3.063  -46.623  1.00 2.00  ? 96  TRP B C     1 
ATOM   1743  O  O     . TRP B 2 96  ? -46.847 -4.200  -46.885  1.00 12.64 ? 96  TRP B O     1 
ATOM   1744  C  CB    . TRP B 2 96  ? -44.086 -2.240  -46.405  1.00 3.80  ? 96  TRP B CB    1 
ATOM   1745  C  CG    . TRP B 2 96  ? -42.782 -2.008  -47.269  1.00 3.01  ? 96  TRP B CG    1 
ATOM   1746  C  CD1   . TRP B 2 96  ? -42.246 -0.788  -47.673  1.00 2.00  ? 96  TRP B CD1   1 
ATOM   1747  C  CD2   . TRP B 2 96  ? -41.896 -3.011  -47.810  1.00 9.96  ? 96  TRP B CD2   1 
ATOM   1748  N  NE1   . TRP B 2 96  ? -41.117 -0.981  -48.460  1.00 2.00  ? 96  TRP B NE1   1 
ATOM   1749  C  CE2   . TRP B 2 96  ? -40.890 -2.329  -48.570  1.00 8.92  ? 96  TRP B CE2   1 
ATOM   1750  C  CE3   . TRP B 2 96  ? -41.873 -4.420  -47.776  1.00 4.77  ? 96  TRP B CE3   1 
ATOM   1751  C  CZ2   . TRP B 2 96  ? -39.878 -3.020  -49.253  1.00 2.53  ? 96  TRP B CZ2   1 
ATOM   1752  C  CZ3   . TRP B 2 96  ? -40.874 -5.105  -48.495  1.00 2.00  ? 96  TRP B CZ3   1 
ATOM   1753  C  CH2   . TRP B 2 96  ? -39.898 -4.406  -49.210  1.00 16.31 ? 96  TRP B CH2   1 
ATOM   1754  N  N     . ILE B 2 97  ? -47.100 -2.287  -45.771  1.00 2.00  ? 97  ILE B N     1 
ATOM   1755  C  CA    . ILE B 2 97  ? -48.173 -2.742  -44.959  1.00 3.47  ? 97  ILE B CA    1 
ATOM   1756  C  C     . ILE B 2 97  ? -49.295 -3.084  -45.903  1.00 10.76 ? 97  ILE B C     1 
ATOM   1757  O  O     . ILE B 2 97  ? -49.920 -4.120  -45.773  1.00 6.17  ? 97  ILE B O     1 
ATOM   1758  C  CB    . ILE B 2 97  ? -48.465 -1.686  -43.851  1.00 3.15  ? 97  ILE B CB    1 
ATOM   1759  C  CG1   . ILE B 2 97  ? -47.296 -1.832  -42.827  1.00 5.48  ? 97  ILE B CG1   1 
ATOM   1760  C  CG2   . ILE B 2 97  ? -49.739 -2.029  -43.156  1.00 2.00  ? 97  ILE B CG2   1 
ATOM   1761  C  CD1   . ILE B 2 97  ? -46.774 -0.681  -42.243  1.00 11.35 ? 97  ILE B CD1   1 
ATOM   1762  N  N     . GLU B 2 98  ? -49.509 -2.276  -46.930  1.00 11.13 ? 98  GLU B N     1 
ATOM   1763  C  CA    . GLU B 2 98  ? -50.655 -2.580  -47.732  1.00 12.19 ? 98  GLU B CA    1 
ATOM   1764  C  C     . GLU B 2 98  ? -50.438 -3.956  -48.352  1.00 13.42 ? 98  GLU B C     1 
ATOM   1765  O  O     . GLU B 2 98  ? -51.325 -4.781  -48.279  1.00 2.00  ? 98  GLU B O     1 
ATOM   1766  C  CB    . GLU B 2 98  ? -50.877 -1.555  -48.821  1.00 10.13 ? 98  GLU B CB    1 
ATOM   1767  C  CG    . GLU B 2 98  ? -51.939 -2.083  -49.799  1.00 26.23 ? 98  GLU B CG    1 
ATOM   1768  C  CD    . GLU B 2 98  ? -52.545 -1.022  -50.705  1.00 23.59 ? 98  GLU B CD    1 
ATOM   1769  O  OE1   . GLU B 2 98  ? -53.721 -0.634  -50.513  1.00 40.04 ? 98  GLU B OE1   1 
ATOM   1770  O  OE2   . GLU B 2 98  ? -51.845 -0.596  -51.634  1.00 39.90 ? 98  GLU B OE2   1 
ATOM   1771  N  N     . ALA B 2 99  ? -49.237 -4.184  -48.914  1.00 3.44  ? 99  ALA B N     1 
ATOM   1772  C  CA    . ALA B 2 99  ? -48.886 -5.423  -49.620  1.00 2.00  ? 99  ALA B CA    1 
ATOM   1773  C  C     . ALA B 2 99  ? -48.905 -6.592  -48.632  1.00 4.33  ? 99  ALA B C     1 
ATOM   1774  O  O     . ALA B 2 99  ? -49.496 -7.595  -48.886  1.00 5.27  ? 99  ALA B O     1 
ATOM   1775  C  CB    . ALA B 2 99  ? -47.505 -5.303  -50.233  1.00 2.00  ? 99  ALA B CB    1 
ATOM   1776  N  N     . MET B 2 100 ? -48.284 -6.442  -47.471  1.00 7.02  ? 100 MET B N     1 
ATOM   1777  C  CA    . MET B 2 100 ? -48.310 -7.524  -46.472  1.00 9.68  ? 100 MET B CA    1 
ATOM   1778  C  C     . MET B 2 100 ? -49.686 -7.906  -45.895  1.00 6.61  ? 100 MET B C     1 
ATOM   1779  O  O     . MET B 2 100 ? -49.878 -9.035  -45.405  1.00 5.44  ? 100 MET B O     1 
ATOM   1780  C  CB    . MET B 2 100 ? -47.334 -7.203  -45.321  1.00 3.15  ? 100 MET B CB    1 
ATOM   1781  C  CG    . MET B 2 100 ? -45.911 -7.297  -45.734  1.00 2.00  ? 100 MET B CG    1 
ATOM   1782  S  SD    . MET B 2 100 ? -44.871 -7.024  -44.309  1.00 8.21  ? 100 MET B SD    1 
ATOM   1783  C  CE    . MET B 2 100 ? -45.357 -5.445  -43.522  1.00 2.00  ? 100 MET B CE    1 
ATOM   1784  N  N     . SER B 2 101 ? -50.619 -6.956  -45.911  1.00 2.28  ? 101 SER B N     1 
ATOM   1785  C  CA    . SER B 2 101 ? -51.808 -7.065  -45.065  1.00 5.51  ? 101 SER B CA    1 
ATOM   1786  C  C     . SER B 2 101 ? -52.660 -8.183  -45.645  1.00 6.63  ? 101 SER B C     1 
ATOM   1787  O  O     . SER B 2 101 ? -53.421 -8.800  -44.942  1.00 2.00  ? 101 SER B O     1 
ATOM   1788  C  CB    . SER B 2 101 ? -52.666 -5.783  -45.139  1.00 3.38  ? 101 SER B CB    1 
ATOM   1789  O  OG    . SER B 2 101 ? -53.071 -5.566  -46.498  1.00 2.55  ? 101 SER B OG    1 
ATOM   1790  N  N     . SER B 2 102 ? -52.570 -8.396  -46.946  1.00 2.00  ? 102 SER B N     1 
ATOM   1791  C  CA    . SER B 2 102 ? -53.291 -9.537  -47.502  1.00 19.83 ? 102 SER B CA    1 
ATOM   1792  C  C     . SER B 2 102 ? -52.459 -10.807 -47.686  1.00 12.45 ? 102 SER B C     1 
ATOM   1793  O  O     . SER B 2 102 ? -53.021 -11.885 -47.840  1.00 16.57 ? 102 SER B O     1 
ATOM   1794  C  CB    . SER B 2 102 ? -53.928 -9.203  -48.844  1.00 11.81 ? 102 SER B CB    1 
ATOM   1795  O  OG    . SER B 2 102 ? -52.876 -9.188  -49.782  1.00 3.78  ? 102 SER B OG    1 
ATOM   1796  N  N     . SER B 2 103 ? -51.145 -10.701 -47.711  1.00 4.10  ? 103 SER B N     1 
ATOM   1797  C  CA    . SER B 2 103 ? -50.347 -11.918 -47.792  1.00 4.62  ? 103 SER B CA    1 
ATOM   1798  C  C     . SER B 2 103 ? -49.882 -12.450 -46.463  1.00 5.54  ? 103 SER B C     1 
ATOM   1799  O  O     . SER B 2 103 ? -50.035 -13.624 -46.163  1.00 10.00 ? 103 SER B O     1 
ATOM   1800  C  CB    . SER B 2 103 ? -49.222 -11.789 -48.780  1.00 4.36  ? 103 SER B CB    1 
ATOM   1801  O  OG    . SER B 2 103 ? -49.776 -11.578 -50.070  1.00 12.42 ? 103 SER B OG    1 
ATOM   1802  N  N     . TYR B 2 104 ? -49.397 -11.599 -45.587  1.00 5.33  ? 104 TYR B N     1 
ATOM   1803  C  CA    . TYR B 2 104 ? -48.818 -12.189 -44.415  1.00 2.00  ? 104 TYR B CA    1 
ATOM   1804  C  C     . TYR B 2 104 ? -49.777 -12.317 -43.274  1.00 2.10  ? 104 TYR B C     1 
ATOM   1805  O  O     . TYR B 2 104 ? -49.661 -11.594 -42.292  1.00 4.26  ? 104 TYR B O     1 
ATOM   1806  C  CB    . TYR B 2 104 ? -47.591 -11.426 -44.035  1.00 2.00  ? 104 TYR B CB    1 
ATOM   1807  C  CG    . TYR B 2 104 ? -46.383 -11.612 -44.969  1.00 6.92  ? 104 TYR B CG    1 
ATOM   1808  C  CD1   . TYR B 2 104 ? -45.296 -10.737 -44.867  1.00 2.00  ? 104 TYR B CD1   1 
ATOM   1809  C  CD2   . TYR B 2 104 ? -46.313 -12.649 -45.943  1.00 2.00  ? 104 TYR B CD2   1 
ATOM   1810  C  CE1   . TYR B 2 104 ? -44.182 -10.857 -45.656  1.00 2.00  ? 104 TYR B CE1   1 
ATOM   1811  C  CE2   . TYR B 2 104 ? -45.169 -12.763 -46.760  1.00 2.00  ? 104 TYR B CE2   1 
ATOM   1812  C  CZ    . TYR B 2 104 ? -44.100 -11.841 -46.566  1.00 2.00  ? 104 TYR B CZ    1 
ATOM   1813  O  OH    . TYR B 2 104 ? -42.934 -11.852 -47.244  1.00 2.00  ? 104 TYR B OH    1 
ATOM   1814  N  N     . THR B 2 105 ? -50.757 -13.203 -43.387  1.00 2.00  ? 105 THR B N     1 
ATOM   1815  C  CA    . THR B 2 105 ? -51.837 -13.160 -42.362  1.00 9.19  ? 105 THR B CA    1 
ATOM   1816  C  C     . THR B 2 105 ? -51.247 -13.492 -40.989  1.00 2.00  ? 105 THR B C     1 
ATOM   1817  O  O     . THR B 2 105 ? -51.754 -13.120 -39.969  1.00 2.00  ? 105 THR B O     1 
ATOM   1818  C  CB    . THR B 2 105 ? -53.097 -14.133 -42.649  1.00 2.00  ? 105 THR B CB    1 
ATOM   1819  O  OG1   . THR B 2 105 ? -52.879 -14.815 -43.857  1.00 7.29  ? 105 THR B OG1   1 
ATOM   1820  C  CG2   . THR B 2 105 ? -54.362 -13.338 -42.867  1.00 26.02 ? 105 THR B CG2   1 
ATOM   1821  N  N     . TRP B 2 106 ? -50.184 -14.255 -40.946  1.00 4.47  ? 106 TRP B N     1 
ATOM   1822  C  CA    . TRP B 2 106 ? -49.826 -14.739 -39.651  1.00 7.77  ? 106 TRP B CA    1 
ATOM   1823  C  C     . TRP B 2 106 ? -48.726 -13.846 -39.091  1.00 7.24  ? 106 TRP B C     1 
ATOM   1824  O  O     . TRP B 2 106 ? -48.087 -14.245 -38.148  1.00 3.86  ? 106 TRP B O     1 
ATOM   1825  C  CB    . TRP B 2 106 ? -49.313 -16.181 -39.739  1.00 14.28 ? 106 TRP B CB    1 
ATOM   1826  C  CG    . TRP B 2 106 ? -50.352 -17.285 -40.130  1.00 39.14 ? 106 TRP B CG    1 
ATOM   1827  C  CD1   . TRP B 2 106 ? -50.682 -17.691 -41.416  1.00 36.52 ? 106 TRP B CD1   1 
ATOM   1828  C  CD2   . TRP B 2 106 ? -51.126 -18.133 -39.240  1.00 48.05 ? 106 TRP B CD2   1 
ATOM   1829  N  NE1   . TRP B 2 106 ? -51.628 -18.690 -41.374  1.00 27.50 ? 106 TRP B NE1   1 
ATOM   1830  C  CE2   . TRP B 2 106 ? -51.909 -19.006 -40.063  1.00 65.97 ? 106 TRP B CE2   1 
ATOM   1831  C  CE3   . TRP B 2 106 ? -51.235 -18.244 -37.835  1.00 44.29 ? 106 TRP B CE3   1 
ATOM   1832  C  CZ2   . TRP B 2 106 ? -52.785 -20.007 -39.513  1.00 27.37 ? 106 TRP B CZ2   1 
ATOM   1833  C  CZ3   . TRP B 2 106 ? -52.113 -19.197 -37.292  1.00 15.36 ? 106 TRP B CZ3   1 
ATOM   1834  C  CH2   . TRP B 2 106 ? -52.868 -20.074 -38.143  1.00 37.40 ? 106 TRP B CH2   1 
ATOM   1835  N  N     . LEU B 2 107 ? -48.481 -12.672 -39.693  1.00 2.00  ? 107 LEU B N     1 
ATOM   1836  C  CA    . LEU B 2 107 ? -47.357 -11.821 -39.279  1.00 2.00  ? 107 LEU B CA    1 
ATOM   1837  C  C     . LEU B 2 107 ? -47.434 -11.431 -37.819  1.00 2.00  ? 107 LEU B C     1 
ATOM   1838  O  O     . LEU B 2 107 ? -48.504 -11.145 -37.276  1.00 2.00  ? 107 LEU B O     1 
ATOM   1839  C  CB    . LEU B 2 107 ? -47.274 -10.552 -40.109  1.00 4.84  ? 107 LEU B CB    1 
ATOM   1840  C  CG    . LEU B 2 107 ? -46.064 -9.633  -39.977  1.00 5.66  ? 107 LEU B CG    1 
ATOM   1841  C  CD1   . LEU B 2 107 ? -44.885 -10.284 -40.646  1.00 11.01 ? 107 LEU B CD1   1 
ATOM   1842  C  CD2   . LEU B 2 107 ? -46.342 -8.231  -40.653  1.00 2.00  ? 107 LEU B CD2   1 
ATOM   1843  N  N     . GLU B 2 108 ? -46.248 -11.453 -37.222  1.00 2.00  ? 108 GLU B N     1 
ATOM   1844  C  CA    . GLU B 2 108 ? -46.061 -11.301 -35.797  1.00 2.00  ? 108 GLU B CA    1 
ATOM   1845  C  C     . GLU B 2 108 ? -45.273 -10.053 -35.299  1.00 2.93  ? 108 GLU B C     1 
ATOM   1846  O  O     . GLU B 2 108 ? -45.573 -9.504  -34.240  1.00 2.00  ? 108 GLU B O     1 
ATOM   1847  C  CB    . GLU B 2 108 ? -45.449 -12.570 -35.281  1.00 3.61  ? 108 GLU B CB    1 
ATOM   1848  C  CG    . GLU B 2 108 ? -46.592 -13.639 -34.942  1.00 6.14  ? 108 GLU B CG    1 
ATOM   1849  C  CD    . GLU B 2 108 ? -45.999 -14.950 -34.397  1.00 2.00  ? 108 GLU B CD    1 
ATOM   1850  O  OE1   . GLU B 2 108 ? -44.814 -14.962 -33.981  1.00 7.39  ? 108 GLU B OE1   1 
ATOM   1851  O  OE2   . GLU B 2 108 ? -46.699 -15.959 -34.344  1.00 9.86  ? 108 GLU B OE2   1 
ATOM   1852  N  N     . GLU B 2 109 ? -44.275 -9.666  -36.088  1.00 2.00  ? 109 GLU B N     1 
ATOM   1853  C  CA    . GLU B 2 109 ? -43.280 -8.738  -35.754  1.00 2.00  ? 109 GLU B CA    1 
ATOM   1854  C  C     . GLU B 2 109 ? -42.985 -7.732  -36.888  1.00 3.66  ? 109 GLU B C     1 
ATOM   1855  O  O     . GLU B 2 109 ? -42.648 -8.082  -38.060  1.00 2.03  ? 109 GLU B O     1 
ATOM   1856  C  CB    . GLU B 2 109 ? -42.013 -9.456  -35.375  1.00 2.22  ? 109 GLU B CB    1 
ATOM   1857  C  CG    . GLU B 2 109 ? -42.252 -10.341 -34.200  1.00 3.83  ? 109 GLU B CG    1 
ATOM   1858  C  CD    . GLU B 2 109 ? -40.964 -10.979 -33.695  1.00 15.45 ? 109 GLU B CD    1 
ATOM   1859  O  OE1   . GLU B 2 109 ? -39.876 -10.486 -34.080  1.00 8.56  ? 109 GLU B OE1   1 
ATOM   1860  O  OE2   . GLU B 2 109 ? -41.053 -11.974 -32.925  1.00 7.05  ? 109 GLU B OE2   1 
ATOM   1861  N  N     . ILE B 2 110 ? -43.085 -6.455  -36.531  1.00 5.63  ? 110 ILE B N     1 
ATOM   1862  C  CA    . ILE B 2 110 ? -42.645 -5.368  -37.470  1.00 8.99  ? 110 ILE B CA    1 
ATOM   1863  C  C     . ILE B 2 110 ? -41.617 -4.472  -36.807  1.00 2.00  ? 110 ILE B C     1 
ATOM   1864  O  O     . ILE B 2 110 ? -41.892 -3.910  -35.731  1.00 7.37  ? 110 ILE B O     1 
ATOM   1865  C  CB    . ILE B 2 110 ? -43.860 -4.518  -37.869  1.00 2.98  ? 110 ILE B CB    1 
ATOM   1866  C  CG1   . ILE B 2 110 ? -44.804 -5.376  -38.753  1.00 3.28  ? 110 ILE B CG1   1 
ATOM   1867  C  CG2   . ILE B 2 110 ? -43.399 -3.324  -38.567  1.00 3.06  ? 110 ILE B CG2   1 
ATOM   1868  C  CD1   . ILE B 2 110 ? -46.060 -4.644  -39.230  1.00 2.00  ? 110 ILE B CD1   1 
ATOM   1869  N  N     . ARG B 2 111 ? -40.424 -4.353  -37.376  1.00 3.72  ? 111 ARG B N     1 
ATOM   1870  C  CA    . ARG B 2 111 ? -39.457 -3.390  -36.802  1.00 7.40  ? 111 ARG B CA    1 
ATOM   1871  C  C     . ARG B 2 111 ? -39.050 -2.411  -37.834  1.00 4.18  ? 111 ARG B C     1 
ATOM   1872  O  O     . ARG B 2 111 ? -38.489 -2.789  -38.913  1.00 5.74  ? 111 ARG B O     1 
ATOM   1873  C  CB    . ARG B 2 111 ? -38.146 -4.052  -36.302  1.00 2.32  ? 111 ARG B CB    1 
ATOM   1874  C  CG    . ARG B 2 111 ? -38.391 -5.221  -35.433  1.00 8.65  ? 111 ARG B CG    1 
ATOM   1875  C  CD    . ARG B 2 111 ? -37.198 -5.846  -34.558  1.00 3.13  ? 111 ARG B CD    1 
ATOM   1876  N  NE    . ARG B 2 111 ? -37.774 -7.134  -34.189  1.00 18.10 ? 111 ARG B NE    1 
ATOM   1877  C  CZ    . ARG B 2 111 ? -37.968 -7.524  -32.958  1.00 4.83  ? 111 ARG B CZ    1 
ATOM   1878  N  NH1   . ARG B 2 111 ? -37.569 -6.746  -31.966  1.00 25.45 ? 111 ARG B NH1   1 
ATOM   1879  N  NH2   . ARG B 2 111 ? -38.508 -8.705  -32.730  1.00 26.04 ? 111 ARG B NH2   1 
ATOM   1880  N  N     . LEU B 2 112 ? -39.231 -1.151  -37.495  1.00 3.21  ? 112 LEU B N     1 
ATOM   1881  C  CA    . LEU B 2 112 ? -39.053 -0.076  -38.510  1.00 5.61  ? 112 LEU B CA    1 
ATOM   1882  C  C     . LEU B 2 112 ? -38.043 0.985   -37.982  1.00 7.62  ? 112 LEU B C     1 
ATOM   1883  O  O     . LEU B 2 112 ? -38.033 1.400   -36.800  1.00 2.00  ? 112 LEU B O     1 
ATOM   1884  C  CB    . LEU B 2 112 ? -40.400 0.610   -38.793  1.00 2.00  ? 112 LEU B CB    1 
ATOM   1885  C  CG    . LEU B 2 112 ? -41.580 -0.179  -39.421  1.00 2.00  ? 112 LEU B CG    1 
ATOM   1886  C  CD1   . LEU B 2 112 ? -42.791 0.826   -39.579  1.00 3.26  ? 112 LEU B CD1   1 
ATOM   1887  C  CD2   . LEU B 2 112 ? -41.214 -0.753  -40.830  1.00 2.00  ? 112 LEU B CD2   1 
ATOM   1888  N  N     . LYS B 2 113 ? -37.180 1.385   -38.886  1.00 2.19  ? 113 LYS B N     1 
ATOM   1889  C  CA    . LYS B 2 113 ? -36.272 2.475   -38.638  1.00 11.25 ? 113 LYS B CA    1 
ATOM   1890  C  C     . LYS B 2 113 ? -36.237 3.566   -39.662  1.00 2.00  ? 113 LYS B C     1 
ATOM   1891  O  O     . LYS B 2 113 ? -36.121 3.347   -40.911  1.00 2.00  ? 113 LYS B O     1 
ATOM   1892  C  CB    . LYS B 2 113 ? -34.883 1.980   -38.456  1.00 2.71  ? 113 LYS B CB    1 
ATOM   1893  C  CG    . LYS B 2 113 ? -34.185 2.762   -37.445  1.00 8.59  ? 113 LYS B CG    1 
ATOM   1894  C  CD    . LYS B 2 113 ? -32.705 2.208   -37.327  1.00 8.85  ? 113 LYS B CD    1 
ATOM   1895  C  CE    . LYS B 2 113 ? -31.872 3.011   -36.302  1.00 2.00  ? 113 LYS B CE    1 
ATOM   1896  N  NZ    . LYS B 2 113 ? -30.477 2.856   -36.596  1.00 8.63  ? 113 LYS B NZ    1 
ATOM   1897  N  N     . ARG B 2 114 ? -36.300 4.753   -39.097  1.00 5.99  ? 114 ARG B N     1 
ATOM   1898  C  CA    . ARG B 2 114 ? -36.317 5.976   -39.895  1.00 2.00  ? 114 ARG B CA    1 
ATOM   1899  C  C     . ARG B 2 114 ? -37.223 5.812   -41.090  1.00 2.14  ? 114 ARG B C     1 
ATOM   1900  O  O     . ARG B 2 114 ? -36.775 6.040   -42.282  1.00 2.20  ? 114 ARG B O     1 
ATOM   1901  C  CB    . ARG B 2 114 ? -34.920 6.268   -40.404  1.00 4.09  ? 114 ARG B CB    1 
ATOM   1902  C  CG    . ARG B 2 114 ? -33.985 6.717   -39.350  1.00 2.00  ? 114 ARG B CG    1 
ATOM   1903  C  CD    . ARG B 2 114 ? -32.632 6.880   -40.031  1.00 2.80  ? 114 ARG B CD    1 
ATOM   1904  N  NE    . ARG B 2 114 ? -31.730 7.179   -38.939  1.00 16.81 ? 114 ARG B NE    1 
ATOM   1905  C  CZ    . ARG B 2 114 ? -30.691 6.415   -38.632  1.00 11.45 ? 114 ARG B CZ    1 
ATOM   1906  N  NH1   . ARG B 2 114 ? -30.358 5.368   -39.420  1.00 4.60  ? 114 ARG B NH1   1 
ATOM   1907  N  NH2   . ARG B 2 114 ? -29.937 6.772   -37.613  1.00 13.34 ? 114 ARG B NH2   1 
ATOM   1908  N  N     . MET B 2 115 ? -38.484 5.456   -40.793  1.00 2.00  ? 115 MET B N     1 
ATOM   1909  C  CA    . MET B 2 115 ? -39.555 5.555   -41.813  1.00 6.52  ? 115 MET B CA    1 
ATOM   1910  C  C     . MET B 2 115 ? -40.708 6.406   -41.423  1.00 5.73  ? 115 MET B C     1 
ATOM   1911  O  O     . MET B 2 115 ? -40.959 6.707   -40.233  1.00 5.46  ? 115 MET B O     1 
ATOM   1912  C  CB    . MET B 2 115 ? -40.192 4.216   -42.120  1.00 4.31  ? 115 MET B CB    1 
ATOM   1913  C  CG    . MET B 2 115 ? -39.248 3.024   -41.990  1.00 13.69 ? 115 MET B CG    1 
ATOM   1914  S  SD    . MET B 2 115 ? -39.150 1.969   -43.443  1.00 12.00 ? 115 MET B SD    1 
ATOM   1915  C  CE    . MET B 2 115 ? -40.268 2.498   -44.799  1.00 2.00  ? 115 MET B CE    1 
ATOM   1916  N  N     . VAL B 2 116 ? -41.446 6.767   -42.453  1.00 3.11  ? 116 VAL B N     1 
ATOM   1917  C  CA    . VAL B 2 116 ? -42.563 7.630   -42.231  1.00 5.07  ? 116 VAL B CA    1 
ATOM   1918  C  C     . VAL B 2 116 ? -43.721 6.720   -42.080  1.00 2.01  ? 116 VAL B C     1 
ATOM   1919  O  O     . VAL B 2 116 ? -44.021 5.977   -42.988  1.00 2.87  ? 116 VAL B O     1 
ATOM   1920  C  CB    . VAL B 2 116 ? -42.760 8.513   -43.464  1.00 8.30  ? 116 VAL B CB    1 
ATOM   1921  C  CG1   . VAL B 2 116 ? -43.992 9.430   -43.296  1.00 2.00  ? 116 VAL B CG1   1 
ATOM   1922  C  CG2   . VAL B 2 116 ? -41.513 9.273   -43.677  1.00 2.00  ? 116 VAL B CG2   1 
ATOM   1923  N  N     . VAL B 2 117 ? -44.375 6.780   -40.943  1.00 2.00  ? 117 VAL B N     1 
ATOM   1924  C  CA    . VAL B 2 117 ? -45.352 5.772   -40.578  1.00 2.00  ? 117 VAL B CA    1 
ATOM   1925  C  C     . VAL B 2 117 ? -46.535 6.543   -40.059  1.00 9.30  ? 117 VAL B C     1 
ATOM   1926  O  O     . VAL B 2 117 ? -46.418 7.344   -39.092  1.00 7.04  ? 117 VAL B O     1 
ATOM   1927  C  CB    . VAL B 2 117 ? -44.831 4.862   -39.327  1.00 14.79 ? 117 VAL B CB    1 
ATOM   1928  C  CG1   . VAL B 2 117 ? -45.867 3.775   -38.883  1.00 2.00  ? 117 VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B 2 117 ? -43.368 4.277   -39.559  1.00 2.00  ? 117 VAL B CG2   1 
ATOM   1930  N  N     . THR B 2 118 ? -47.672 6.143   -40.586  1.00 2.00  ? 118 THR B N     1 
ATOM   1931  C  CA    . THR B 2 118 ? -48.889 6.920   -40.621  1.00 3.62  ? 118 THR B CA    1 
ATOM   1932  C  C     . THR B 2 118 ? -49.984 6.254   -39.827  1.00 3.31  ? 118 THR B C     1 
ATOM   1933  O  O     . THR B 2 118 ? -49.989 5.025   -39.624  1.00 8.19  ? 118 THR B O     1 
ATOM   1934  C  CB    . THR B 2 118 ? -49.302 6.814   -42.046  1.00 4.64  ? 118 THR B CB    1 
ATOM   1935  O  OG1   . THR B 2 118 ? -49.011 8.036   -42.682  1.00 5.10  ? 118 THR B OG1   1 
ATOM   1936  C  CG2   . THR B 2 118 ? -50.629 6.386   -42.217  1.00 2.00  ? 118 THR B CG2   1 
ATOM   1937  N  N     . ASP B 2 119 ? -50.939 7.030   -39.360  1.00 10.33 ? 119 ASP B N     1 
ATOM   1938  C  CA    . ASP B 2 119 ? -51.994 6.424   -38.546  1.00 6.55  ? 119 ASP B CA    1 
ATOM   1939  C  C     . ASP B 2 119 ? -52.711 5.393   -39.412  1.00 8.34  ? 119 ASP B C     1 
ATOM   1940  O  O     . ASP B 2 119 ? -53.150 4.347   -38.955  1.00 2.17  ? 119 ASP B O     1 
ATOM   1941  C  CB    . ASP B 2 119 ? -52.983 7.477   -38.019  1.00 2.66  ? 119 ASP B CB    1 
ATOM   1942  C  CG    . ASP B 2 119 ? -52.483 8.187   -36.721  1.00 21.88 ? 119 ASP B CG    1 
ATOM   1943  O  OD1   . ASP B 2 119 ? -51.510 7.699   -36.094  1.00 9.32  ? 119 ASP B OD1   1 
ATOM   1944  O  OD2   . ASP B 2 119 ? -53.051 9.239   -36.331  1.00 19.61 ? 119 ASP B OD2   1 
ATOM   1945  N  N     . ASP B 2 120 ? -52.836 5.684   -40.682  1.00 2.00  ? 120 ASP B N     1 
ATOM   1946  C  CA    . ASP B 2 120 ? -53.393 4.676   -41.531  1.00 2.99  ? 120 ASP B CA    1 
ATOM   1947  C  C     . ASP B 2 120 ? -52.642 3.342   -41.512  1.00 8.65  ? 120 ASP B C     1 
ATOM   1948  O  O     . ASP B 2 120 ? -53.290 2.275   -41.520  1.00 2.30  ? 120 ASP B O     1 
ATOM   1949  C  CB    . ASP B 2 120 ? -53.530 5.168   -42.953  1.00 2.00  ? 120 ASP B CB    1 
ATOM   1950  C  CG    . ASP B 2 120 ? -54.797 5.975   -43.161  1.00 10.47 ? 120 ASP B CG    1 
ATOM   1951  O  OD1   . ASP B 2 120 ? -55.579 6.170   -42.185  1.00 19.09 ? 120 ASP B OD1   1 
ATOM   1952  O  OD2   . ASP B 2 120 ? -55.010 6.425   -44.318  1.00 9.47  ? 120 ASP B OD2   1 
ATOM   1953  N  N     . CYS B 2 121 ? -51.301 3.403   -41.559  1.00 2.39  ? 121 CYS B N     1 
ATOM   1954  C  CA    . CYS B 2 121 ? -50.446 2.228   -41.389  1.00 2.00  ? 121 CYS B CA    1 
ATOM   1955  C  C     . CYS B 2 121 ? -50.853 1.559   -40.097  1.00 3.44  ? 121 CYS B C     1 
ATOM   1956  O  O     . CYS B 2 121 ? -51.024 0.324   -40.065  1.00 3.58  ? 121 CYS B O     1 
ATOM   1957  C  CB    . CYS B 2 121 ? -48.930 2.610   -41.286  1.00 5.68  ? 121 CYS B CB    1 
ATOM   1958  S  SG    . CYS B 2 121 ? -48.315 3.635   -42.677  1.00 8.56  ? 121 CYS B SG    1 
ATOM   1959  N  N     . LEU B 2 122 ? -51.015 2.327   -39.020  1.00 2.00  ? 122 LEU B N     1 
ATOM   1960  C  CA    . LEU B 2 122 ? -51.145 1.630   -37.778  1.00 2.00  ? 122 LEU B CA    1 
ATOM   1961  C  C     . LEU B 2 122 ? -52.479 0.850   -37.665  1.00 2.66  ? 122 LEU B C     1 
ATOM   1962  O  O     . LEU B 2 122 ? -52.526 -0.253  -37.187  1.00 8.00  ? 122 LEU B O     1 
ATOM   1963  C  CB    . LEU B 2 122 ? -50.809 2.515   -36.575  1.00 2.00  ? 122 LEU B CB    1 
ATOM   1964  C  CG    . LEU B 2 122 ? -49.437 3.138   -36.525  1.00 2.00  ? 122 LEU B CG    1 
ATOM   1965  C  CD1   . LEU B 2 122 ? -49.306 3.998   -35.331  1.00 3.02  ? 122 LEU B CD1   1 
ATOM   1966  C  CD2   . LEU B 2 122 ? -48.580 1.970   -36.342  1.00 5.72  ? 122 LEU B CD2   1 
ATOM   1967  N  N     . GLU B 2 123 ? -53.556 1.418   -38.177  1.00 11.15 ? 123 GLU B N     1 
ATOM   1968  C  CA    . GLU B 2 123 ? -54.844 0.778   -38.225  1.00 7.65  ? 123 GLU B CA    1 
ATOM   1969  C  C     . GLU B 2 123 ? -54.782 -0.450  -39.098  1.00 8.46  ? 123 GLU B C     1 
ATOM   1970  O  O     . GLU B 2 123 ? -55.425 -1.496  -38.796  1.00 6.30  ? 123 GLU B O     1 
ATOM   1971  C  CB    . GLU B 2 123 ? -55.871 1.777   -38.804  1.00 15.82 ? 123 GLU B CB    1 
ATOM   1972  C  CG    . GLU B 2 123 ? -55.611 3.198   -38.264  1.00 15.03 ? 123 GLU B CG    1 
ATOM   1973  C  CD    . GLU B 2 123 ? -56.882 3.882   -37.889  1.00 23.30 ? 123 GLU B CD    1 
ATOM   1974  O  OE1   . GLU B 2 123 ? -57.713 4.045   -38.800  1.00 50.99 ? 123 GLU B OE1   1 
ATOM   1975  O  OE2   . GLU B 2 123 ? -57.066 4.236   -36.704  1.00 23.24 ? 123 GLU B OE2   1 
ATOM   1976  N  N     . LEU B 2 124 ? -54.046 -0.338  -40.201  1.00 2.58  ? 124 LEU B N     1 
ATOM   1977  C  CA    . LEU B 2 124 ? -54.078 -1.445  -41.179  1.00 5.68  ? 124 LEU B CA    1 
ATOM   1978  C  C     . LEU B 2 124 ? -53.415 -2.634  -40.416  1.00 10.16 ? 124 LEU B C     1 
ATOM   1979  O  O     . LEU B 2 124 ? -53.874 -3.748  -40.512  1.00 4.28  ? 124 LEU B O     1 
ATOM   1980  C  CB    . LEU B 2 124 ? -53.360 -1.089  -42.483  1.00 2.00  ? 124 LEU B CB    1 
ATOM   1981  C  CG    . LEU B 2 124 ? -53.890 -1.634  -43.812  1.00 2.00  ? 124 LEU B CG    1 
ATOM   1982  C  CD1   . LEU B 2 124 ? -52.915 -1.937  -44.912  1.00 2.00  ? 124 LEU B CD1   1 
ATOM   1983  C  CD2   . LEU B 2 124 ? -55.049 -2.579  -43.725  1.00 2.00  ? 124 LEU B CD2   1 
ATOM   1984  N  N     . ILE B 2 125 ? -52.392 -2.362  -39.598  1.00 4.37  ? 125 ILE B N     1 
ATOM   1985  C  CA    . ILE B 2 125 ? -51.593 -3.434  -39.028  1.00 4.58  ? 125 ILE B CA    1 
ATOM   1986  C  C     . ILE B 2 125 ? -52.583 -4.013  -38.053  1.00 7.89  ? 125 ILE B C     1 
ATOM   1987  O  O     . ILE B 2 125 ? -52.741 -5.234  -37.884  1.00 7.25  ? 125 ILE B O     1 
ATOM   1988  C  CB    . ILE B 2 125 ? -50.273 -2.827  -38.306  1.00 2.80  ? 125 ILE B CB    1 
ATOM   1989  C  CG1   . ILE B 2 125 ? -49.134 -2.615  -39.296  1.00 2.00  ? 125 ILE B CG1   1 
ATOM   1990  C  CG2   . ILE B 2 125 ? -49.828 -3.492  -37.009  1.00 2.00  ? 125 ILE B CG2   1 
ATOM   1991  C  CD1   . ILE B 2 125 ? -48.065 -1.699  -38.707  1.00 7.14  ? 125 ILE B CD1   1 
ATOM   1992  N  N     . ALA B 2 126 ? -53.266 -3.121  -37.371  1.00 7.10  ? 126 ALA B N     1 
ATOM   1993  C  CA    . ALA B 2 126 ? -53.998 -3.553  -36.162  1.00 4.44  ? 126 ALA B CA    1 
ATOM   1994  C  C     . ALA B 2 126 ? -55.015 -4.594  -36.574  1.00 3.05  ? 126 ALA B C     1 
ATOM   1995  O  O     . ALA B 2 126 ? -55.339 -5.511  -35.806  1.00 2.25  ? 126 ALA B O     1 
ATOM   1996  C  CB    . ALA B 2 126 ? -54.673 -2.358  -35.543  1.00 2.00  ? 126 ALA B CB    1 
ATOM   1997  N  N     . LYS B 2 127 ? -55.506 -4.415  -37.801  1.00 2.21  ? 127 LYS B N     1 
ATOM   1998  C  CA    . LYS B 2 127 ? -56.727 -4.991  -38.221  1.00 11.51 ? 127 LYS B CA    1 
ATOM   1999  C  C     . LYS B 2 127 ? -56.485 -6.051  -39.329  1.00 5.47  ? 127 LYS B C     1 
ATOM   2000  O  O     . LYS B 2 127 ? -57.361 -6.785  -39.702  1.00 2.00  ? 127 LYS B O     1 
ATOM   2001  C  CB    . LYS B 2 127 ? -57.694 -3.864  -38.583  1.00 15.67 ? 127 LYS B CB    1 
ATOM   2002  C  CG    . LYS B 2 127 ? -58.203 -3.823  -40.041  1.00 24.55 ? 127 LYS B CG    1 
ATOM   2003  C  CD    . LYS B 2 127 ? -59.540 -3.014  -40.140  1.00 31.71 ? 127 LYS B CD    1 
ATOM   2004  C  CE    . LYS B 2 127 ? -60.704 -3.844  -40.770  1.00 46.64 ? 127 LYS B CE    1 
ATOM   2005  N  NZ    . LYS B 2 127 ? -60.509 -4.107  -42.262  1.00 25.32 ? 127 LYS B NZ    1 
ATOM   2006  N  N     . SER B 2 128 ? -55.264 -6.193  -39.765  1.00 2.00  ? 128 SER B N     1 
ATOM   2007  C  CA    . SER B 2 128 ? -54.886 -7.326  -40.601  1.00 6.16  ? 128 SER B CA    1 
ATOM   2008  C  C     . SER B 2 128 ? -54.128 -8.437  -39.903  1.00 12.50 ? 128 SER B C     1 
ATOM   2009  O  O     . SER B 2 128 ? -54.088 -9.526  -40.461  1.00 4.69  ? 128 SER B O     1 
ATOM   2010  C  CB    . SER B 2 128 ? -53.934 -6.921  -41.745  1.00 2.00  ? 128 SER B CB    1 
ATOM   2011  O  OG    . SER B 2 128 ? -54.316 -5.722  -42.368  1.00 3.57  ? 128 SER B OG    1 
ATOM   2012  N  N     . PHE B 2 129 ? -53.407 -8.164  -38.801  1.00 2.86  ? 129 PHE B N     1 
ATOM   2013  C  CA    . PHE B 2 129 ? -52.544 -9.214  -38.243  1.00 2.00  ? 129 PHE B CA    1 
ATOM   2014  C  C     . PHE B 2 129 ? -52.993 -9.679  -36.892  1.00 4.17  ? 129 PHE B C     1 
ATOM   2015  O  O     . PHE B 2 129 ? -52.838 -8.976  -35.927  1.00 7.18  ? 129 PHE B O     1 
ATOM   2016  C  CB    . PHE B 2 129 ? -51.105 -8.843  -38.288  1.00 2.00  ? 129 PHE B CB    1 
ATOM   2017  C  CG    . PHE B 2 129 ? -50.703 -8.218  -39.569  1.00 2.00  ? 129 PHE B CG    1 
ATOM   2018  C  CD1   . PHE B 2 129 ? -50.219 -6.905  -39.606  1.00 3.75  ? 129 PHE B CD1   1 
ATOM   2019  C  CD2   . PHE B 2 129 ? -50.788 -8.944  -40.748  1.00 2.44  ? 129 PHE B CD2   1 
ATOM   2020  C  CE1   . PHE B 2 129 ? -49.821 -6.288  -40.807  1.00 2.00  ? 129 PHE B CE1   1 
ATOM   2021  C  CE2   . PHE B 2 129 ? -50.387 -8.390  -41.956  1.00 2.00  ? 129 PHE B CE2   1 
ATOM   2022  C  CZ    . PHE B 2 129 ? -49.907 -7.024  -41.984  1.00 13.43 ? 129 PHE B CZ    1 
ATOM   2023  N  N     . LYS B 2 130 ? -53.662 -10.823 -36.826  1.00 5.06  ? 130 LYS B N     1 
ATOM   2024  C  CA    . LYS B 2 130 ? -54.368 -11.158 -35.627  1.00 2.00  ? 130 LYS B CA    1 
ATOM   2025  C  C     . LYS B 2 130 ? -53.283 -11.646 -34.626  1.00 6.84  ? 130 LYS B C     1 
ATOM   2026  O  O     . LYS B 2 130 ? -53.484 -11.660 -33.425  1.00 2.00  ? 130 LYS B O     1 
ATOM   2027  C  CB    . LYS B 2 130 ? -55.281 -12.329 -35.973  1.00 2.00  ? 130 LYS B CB    1 
ATOM   2028  C  CG    . LYS B 2 130 ? -56.696 -12.273 -35.400  1.00 6.85  ? 130 LYS B CG    1 
ATOM   2029  C  CD    . LYS B 2 130 ? -57.709 -11.628 -36.385  1.00 56.78 ? 130 LYS B CD    1 
ATOM   2030  C  CE    . LYS B 2 130 ? -58.686 -10.650 -35.657  1.00 63.92 ? 130 LYS B CE    1 
ATOM   2031  N  NZ    . LYS B 2 130 ? -58.175 -9.205  -35.461  1.00 16.13 ? 130 LYS B NZ    1 
ATOM   2032  N  N     . ASN B 2 131 ? -52.150 -12.145 -35.116  1.00 2.00  ? 131 ASN B N     1 
ATOM   2033  C  CA    . ASN B 2 131 ? -51.223 -12.698 -34.162  1.00 2.00  ? 131 ASN B CA    1 
ATOM   2034  C  C     . ASN B 2 131 ? -50.138 -11.641 -33.809  1.00 16.26 ? 131 ASN B C     1 
ATOM   2035  O  O     . ASN B 2 131 ? -49.059 -11.988 -33.258  1.00 2.00  ? 131 ASN B O     1 
ATOM   2036  C  CB    . ASN B 2 131 ? -50.559 -13.943 -34.708  1.00 2.00  ? 131 ASN B CB    1 
ATOM   2037  C  CG    . ASN B 2 131 ? -51.470 -15.214 -34.612  1.00 31.53 ? 131 ASN B CG    1 
ATOM   2038  O  OD1   . ASN B 2 131 ? -52.568 -15.255 -33.975  1.00 2.00  ? 131 ASN B OD1   1 
ATOM   2039  N  ND2   . ASN B 2 131 ? -51.002 -16.265 -35.269  1.00 2.14  ? 131 ASN B ND2   1 
ATOM   2040  N  N     . PHE B 2 132 ? -50.414 -10.373 -34.169  1.00 2.60  ? 132 PHE B N     1 
ATOM   2041  C  CA    . PHE B 2 132 ? -49.462 -9.279  -33.963  1.00 7.76  ? 132 PHE B CA    1 
ATOM   2042  C  C     . PHE B 2 132 ? -48.882 -9.135  -32.545  1.00 2.08  ? 132 PHE B C     1 
ATOM   2043  O  O     . PHE B 2 132 ? -49.602 -8.967  -31.522  1.00 2.00  ? 132 PHE B O     1 
ATOM   2044  C  CB    . PHE B 2 132 ? -50.039 -7.949  -34.407  1.00 2.00  ? 132 PHE B CB    1 
ATOM   2045  C  CG    . PHE B 2 132 ? -49.017 -6.946  -34.653  1.00 2.00  ? 132 PHE B CG    1 
ATOM   2046  C  CD1   . PHE B 2 132 ? -47.995 -7.203  -35.568  1.00 10.19 ? 132 PHE B CD1   1 
ATOM   2047  C  CD2   . PHE B 2 132 ? -49.019 -5.745  -33.958  1.00 9.23  ? 132 PHE B CD2   1 
ATOM   2048  C  CE1   . PHE B 2 132 ? -46.991 -6.279  -35.819  1.00 2.00  ? 132 PHE B CE1   1 
ATOM   2049  C  CE2   . PHE B 2 132 ? -47.995 -4.817  -34.207  1.00 4.12  ? 132 PHE B CE2   1 
ATOM   2050  C  CZ    . PHE B 2 132 ? -46.982 -5.114  -35.127  1.00 9.04  ? 132 PHE B CZ    1 
ATOM   2051  N  N     . LYS B 2 133 ? -47.574 -9.236  -32.489  1.00 2.00  ? 133 LYS B N     1 
ATOM   2052  C  CA    . LYS B 2 133 ? -46.940 -9.410  -31.211  1.00 2.00  ? 133 LYS B CA    1 
ATOM   2053  C  C     . LYS B 2 133 ? -45.927 -8.319  -30.860  1.00 2.00  ? 133 LYS B C     1 
ATOM   2054  O  O     . LYS B 2 133 ? -45.804 -7.947  -29.690  1.00 4.13  ? 133 LYS B O     1 
ATOM   2055  C  CB    . LYS B 2 133 ? -46.299 -10.776 -31.112  1.00 2.00  ? 133 LYS B CB    1 
ATOM   2056  C  CG    . LYS B 2 133 ? -47.250 -11.803 -30.629  1.00 2.00  ? 133 LYS B CG    1 
ATOM   2057  C  CD    . LYS B 2 133 ? -46.494 -13.075 -30.454  1.00 12.40 ? 133 LYS B CD    1 
ATOM   2058  C  CE    . LYS B 2 133 ? -47.371 -14.333 -30.654  1.00 11.65 ? 133 LYS B CE    1 
ATOM   2059  N  NZ    . LYS B 2 133 ? -46.911 -15.366 -29.756  1.00 9.84  ? 133 LYS B NZ    1 
ATOM   2060  N  N     . VAL B 2 134 ? -45.236 -7.800  -31.870  1.00 2.39  ? 134 VAL B N     1 
ATOM   2061  C  CA    . VAL B 2 134 ? -44.093 -6.946  -31.641  1.00 2.00  ? 134 VAL B CA    1 
ATOM   2062  C  C     . VAL B 2 134 ? -44.083 -5.742  -32.570  1.00 9.60  ? 134 VAL B C     1 
ATOM   2063  O  O     . VAL B 2 134 ? -43.974 -5.877  -33.830  1.00 2.00  ? 134 VAL B O     1 
ATOM   2064  C  CB    . VAL B 2 134 ? -42.766 -7.693  -31.774  1.00 10.70 ? 134 VAL B CB    1 
ATOM   2065  C  CG1   . VAL B 2 134 ? -41.722 -6.637  -31.974  1.00 2.00  ? 134 VAL B CG1   1 
ATOM   2066  C  CG2   . VAL B 2 134 ? -42.508 -8.678  -30.520  1.00 2.00  ? 134 VAL B CG2   1 
ATOM   2067  N  N     . LEU B 2 135 ? -44.205 -4.546  -31.975  1.00 2.98  ? 135 LEU B N     1 
ATOM   2068  C  CA    . LEU B 2 135 ? -44.065 -3.301  -32.843  1.00 6.22  ? 135 LEU B CA    1 
ATOM   2069  C  C     . LEU B 2 135 ? -42.950 -2.413  -32.301  1.00 3.12  ? 135 LEU B C     1 
ATOM   2070  O  O     . LEU B 2 135 ? -43.072 -1.865  -31.198  1.00 3.21  ? 135 LEU B O     1 
ATOM   2071  C  CB    . LEU B 2 135 ? -45.364 -2.467  -32.845  1.00 4.56  ? 135 LEU B CB    1 
ATOM   2072  C  CG    . LEU B 2 135 ? -45.375 -1.109  -33.621  1.00 9.02  ? 135 LEU B CG    1 
ATOM   2073  C  CD1   . LEU B 2 135 ? -45.274 -1.367  -35.100  1.00 2.00  ? 135 LEU B CD1   1 
ATOM   2074  C  CD2   . LEU B 2 135 ? -46.647 -0.292  -33.366  1.00 2.00  ? 135 LEU B CD2   1 
ATOM   2075  N  N     . VAL B 2 136 ? -41.878 -2.324  -33.049  1.00 2.00  ? 136 VAL B N     1 
ATOM   2076  C  CA    . VAL B 2 136 ? -40.787 -1.442  -32.741  1.00 8.89  ? 136 VAL B CA    1 
ATOM   2077  C  C     . VAL B 2 136 ? -40.716 -0.300  -33.751  1.00 8.95  ? 136 VAL B C     1 
ATOM   2078  O  O     . VAL B 2 136 ? -40.466 -0.514  -34.990  1.00 8.30  ? 136 VAL B O     1 
ATOM   2079  C  CB    . VAL B 2 136 ? -39.386 -2.185  -32.670  1.00 5.58  ? 136 VAL B CB    1 
ATOM   2080  C  CG1   . VAL B 2 136 ? -38.319 -1.176  -32.511  1.00 2.00  ? 136 VAL B CG1   1 
ATOM   2081  C  CG2   . VAL B 2 136 ? -39.431 -3.094  -31.523  1.00 2.00  ? 136 VAL B CG2   1 
ATOM   2082  N  N     . LEU B 2 137 ? -40.881 0.918   -33.241  1.00 3.23  ? 137 LEU B N     1 
ATOM   2083  C  CA    . LEU B 2 137 ? -40.838 2.100   -34.148  1.00 2.28  ? 137 LEU B CA    1 
ATOM   2084  C  C     . LEU B 2 137 ? -39.687 3.038   -33.751  1.00 2.00  ? 137 LEU B C     1 
ATOM   2085  O  O     . LEU B 2 137 ? -39.753 3.778   -32.754  1.00 2.00  ? 137 LEU B O     1 
ATOM   2086  C  CB    . LEU B 2 137 ? -42.178 2.830   -34.204  1.00 2.00  ? 137 LEU B CB    1 
ATOM   2087  C  CG    . LEU B 2 137 ? -43.391 2.125   -34.838  1.00 6.18  ? 137 LEU B CG    1 
ATOM   2088  C  CD1   . LEU B 2 137 ? -44.635 2.908   -34.441  1.00 2.00  ? 137 LEU B CD1   1 
ATOM   2089  C  CD2   . LEU B 2 137 ? -43.310 2.017   -36.412  1.00 2.00  ? 137 LEU B CD2   1 
ATOM   2090  N  N     . SER B 2 138 ? -38.621 3.011   -34.530  1.00 2.00  ? 138 SER B N     1 
ATOM   2091  C  CA    . SER B 2 138 ? -37.354 3.505   -34.028  1.00 7.78  ? 138 SER B CA    1 
ATOM   2092  C  C     . SER B 2 138 ? -36.943 4.746   -34.877  1.00 2.79  ? 138 SER B C     1 
ATOM   2093  O  O     . SER B 2 138 ? -36.632 4.602   -36.050  1.00 2.33  ? 138 SER B O     1 
ATOM   2094  C  CB    . SER B 2 138 ? -36.335 2.365   -34.096  1.00 2.00  ? 138 SER B CB    1 
ATOM   2095  O  OG    . SER B 2 138 ? -35.059 2.839   -33.773  1.00 5.48  ? 138 SER B OG    1 
ATOM   2096  N  N     . SER B 2 139 ? -36.996 5.942   -34.287  1.00 2.00  ? 139 SER B N     1 
ATOM   2097  C  CA    . SER B 2 139 ? -36.883 7.156   -35.041  1.00 2.00  ? 139 SER B CA    1 
ATOM   2098  C  C     . SER B 2 139 ? -37.794 7.111   -36.197  1.00 2.00  ? 139 SER B C     1 
ATOM   2099  O  O     . SER B 2 139 ? -37.323 7.294   -37.329  1.00 2.00  ? 139 SER B O     1 
ATOM   2100  C  CB    . SER B 2 139 ? -35.552 7.266   -35.692  1.00 2.00  ? 139 SER B CB    1 
ATOM   2101  O  OG    . SER B 2 139 ? -34.549 7.440   -34.749  1.00 8.56  ? 139 SER B OG    1 
ATOM   2102  N  N     . CYS B 2 140 ? -39.073 6.858   -35.971  1.00 2.00  ? 140 CYS B N     1 
ATOM   2103  C  CA    . CYS B 2 140 ? -39.963 7.112   -37.084  1.00 5.54  ? 140 CYS B CA    1 
ATOM   2104  C  C     . CYS B 2 140 ? -40.776 8.404   -36.871  1.00 4.21  ? 140 CYS B C     1 
ATOM   2105  O  O     . CYS B 2 140 ? -40.804 8.972   -35.769  1.00 4.89  ? 140 CYS B O     1 
ATOM   2106  C  CB    . CYS B 2 140 ? -40.871 5.912   -37.246  1.00 4.30  ? 140 CYS B CB    1 
ATOM   2107  S  SG    . CYS B 2 140 ? -40.035 4.400   -37.730  1.00 5.67  ? 140 CYS B SG    1 
ATOM   2108  N  N     . GLU B 2 141 ? -41.440 8.872   -37.909  1.00 3.89  ? 141 GLU B N     1 
ATOM   2109  C  CA    . GLU B 2 141 ? -42.359 10.008  -37.795  1.00 2.15  ? 141 GLU B CA    1 
ATOM   2110  C  C     . GLU B 2 141 ? -43.617 9.744   -38.629  1.00 3.09  ? 141 GLU B C     1 
ATOM   2111  O  O     . GLU B 2 141 ? -43.581 8.921   -39.595  1.00 7.43  ? 141 GLU B O     1 
ATOM   2112  C  CB    . GLU B 2 141 ? -41.647 11.246  -38.363  1.00 7.67  ? 141 GLU B CB    1 
ATOM   2113  C  CG    . GLU B 2 141 ? -41.073 10.984  -39.730  1.00 10.30 ? 141 GLU B CG    1 
ATOM   2114  C  CD    . GLU B 2 141 ? -40.285 12.160  -40.370  1.00 20.59 ? 141 GLU B CD    1 
ATOM   2115  O  OE1   . GLU B 2 141 ? -40.561 13.358  -40.039  1.00 21.39 ? 141 GLU B OE1   1 
ATOM   2116  O  OE2   . GLU B 2 141 ? -39.386 11.844  -41.235  1.00 15.91 ? 141 GLU B OE2   1 
ATOM   2117  N  N     . GLY B 2 142 ? -44.712 10.446  -38.321  1.00 6.31  ? 142 GLY B N     1 
ATOM   2118  C  CA    . GLY B 2 142 ? -45.840 10.553  -39.287  1.00 2.00  ? 142 GLY B CA    1 
ATOM   2119  C  C     . GLY B 2 142 ? -47.120 10.112  -38.651  1.00 2.00  ? 142 GLY B C     1 
ATOM   2120  O  O     . GLY B 2 142 ? -48.160 10.094  -39.281  1.00 2.00  ? 142 GLY B O     1 
ATOM   2121  N  N     . PHE B 2 143 ? -47.046 9.735   -37.375  1.00 2.00  ? 143 PHE B N     1 
ATOM   2122  C  CA    . PHE B 2 143 ? -48.208 9.153   -36.732  1.00 2.00  ? 143 PHE B CA    1 
ATOM   2123  C  C     . PHE B 2 143 ? -48.509 9.895   -35.449  1.00 2.42  ? 143 PHE B C     1 
ATOM   2124  O  O     . PHE B 2 143 ? -47.788 10.804  -35.094  1.00 6.04  ? 143 PHE B O     1 
ATOM   2125  C  CB    . PHE B 2 143 ? -48.035 7.661   -36.471  1.00 2.00  ? 143 PHE B CB    1 
ATOM   2126  C  CG    . PHE B 2 143 ? -46.798 7.309   -35.612  1.00 4.51  ? 143 PHE B CG    1 
ATOM   2127  C  CD1   . PHE B 2 143 ? -46.927 7.000   -34.272  1.00 2.00  ? 143 PHE B CD1   1 
ATOM   2128  C  CD2   . PHE B 2 143 ? -45.509 7.339   -36.154  1.00 8.78  ? 143 PHE B CD2   1 
ATOM   2129  C  CE1   . PHE B 2 143 ? -45.814 6.696   -33.484  1.00 2.00  ? 143 PHE B CE1   1 
ATOM   2130  C  CE2   . PHE B 2 143 ? -44.404 7.039   -35.372  1.00 2.00  ? 143 PHE B CE2   1 
ATOM   2131  C  CZ    . PHE B 2 143 ? -44.574 6.696   -34.052  1.00 2.00  ? 143 PHE B CZ    1 
ATOM   2132  N  N     . SER B 2 144 ? -49.578 9.512   -34.756  1.00 8.08  ? 144 SER B N     1 
ATOM   2133  C  CA    . SER B 2 144 ? -50.149 10.285  -33.717  1.00 2.00  ? 144 SER B CA    1 
ATOM   2134  C  C     . SER B 2 144 ? -50.646 9.286   -32.694  1.00 2.00  ? 144 SER B C     1 
ATOM   2135  O  O     . SER B 2 144 ? -50.758 8.087   -32.965  1.00 3.89  ? 144 SER B O     1 
ATOM   2136  C  CB    . SER B 2 144 ? -51.297 11.054  -34.300  1.00 2.00  ? 144 SER B CB    1 
ATOM   2137  O  OG    . SER B 2 144 ? -52.507 10.317  -34.162  1.00 10.16 ? 144 SER B OG    1 
ATOM   2138  N  N     . THR B 2 145 ? -50.947 9.772   -31.504  1.00 2.00  ? 145 THR B N     1 
ATOM   2139  C  CA    . THR B 2 145 ? -51.536 8.966   -30.496  1.00 2.00  ? 145 THR B CA    1 
ATOM   2140  C  C     . THR B 2 145 ? -52.856 8.290   -30.912  1.00 7.02  ? 145 THR B C     1 
ATOM   2141  O  O     . THR B 2 145 ? -53.448 7.412   -30.174  1.00 3.01  ? 145 THR B O     1 
ATOM   2142  C  CB    . THR B 2 145 ? -51.811 9.823   -29.205  1.00 9.78  ? 145 THR B CB    1 
ATOM   2143  O  OG1   . THR B 2 145 ? -52.545 11.015  -29.527  1.00 13.84 ? 145 THR B OG1   1 
ATOM   2144  C  CG2   . THR B 2 145 ? -50.483 10.186  -28.472  1.00 6.09  ? 145 THR B CG2   1 
ATOM   2145  N  N     . ASP B 2 146 ? -53.391 8.725   -32.041  1.00 3.18  ? 146 ASP B N     1 
ATOM   2146  C  CA    . ASP B 2 146 ? -54.692 8.189   -32.444  1.00 6.08  ? 146 ASP B CA    1 
ATOM   2147  C  C     . ASP B 2 146 ? -54.330 6.825   -33.003  1.00 12.23 ? 146 ASP B C     1 
ATOM   2148  O  O     . ASP B 2 146 ? -55.122 5.911   -32.820  1.00 5.74  ? 146 ASP B O     1 
ATOM   2149  C  CB    . ASP B 2 146 ? -55.352 9.054   -33.539  1.00 7.67  ? 146 ASP B CB    1 
ATOM   2150  C  CG    . ASP B 2 146 ? -56.108 10.257  -32.973  1.00 23.95 ? 146 ASP B CG    1 
ATOM   2151  O  OD1   . ASP B 2 146 ? -56.398 10.234  -31.743  1.00 10.13 ? 146 ASP B OD1   1 
ATOM   2152  O  OD2   . ASP B 2 146 ? -56.410 11.207  -33.761  1.00 18.93 ? 146 ASP B OD2   1 
ATOM   2153  N  N     . GLY B 2 147 ? -53.153 6.720   -33.675  1.00 2.00  ? 147 GLY B N     1 
ATOM   2154  C  CA    . GLY B 2 147 ? -52.747 5.492   -34.362  1.00 2.83  ? 147 GLY B CA    1 
ATOM   2155  C  C     . GLY B 2 147 ? -52.486 4.424   -33.296  1.00 14.68 ? 147 GLY B C     1 
ATOM   2156  O  O     . GLY B 2 147 ? -52.963 3.265   -33.381  1.00 2.02  ? 147 GLY B O     1 
ATOM   2157  N  N     . LEU B 2 148 ? -51.794 4.857   -32.239  1.00 2.96  ? 148 LEU B N     1 
ATOM   2158  C  CA    . LEU B 2 148 ? -51.468 3.969   -31.190  1.00 2.00  ? 148 LEU B CA    1 
ATOM   2159  C  C     . LEU B 2 148 ? -52.729 3.517   -30.502  1.00 3.76  ? 148 LEU B C     1 
ATOM   2160  O  O     . LEU B 2 148 ? -52.854 2.349   -30.182  1.00 10.43 ? 148 LEU B O     1 
ATOM   2161  C  CB    . LEU B 2 148 ? -50.606 4.651   -30.158  1.00 2.00  ? 148 LEU B CB    1 
ATOM   2162  C  CG    . LEU B 2 148 ? -49.285 5.274   -30.583  1.00 2.70  ? 148 LEU B CG    1 
ATOM   2163  C  CD1   . LEU B 2 148 ? -48.815 6.106   -29.426  1.00 2.00  ? 148 LEU B CD1   1 
ATOM   2164  C  CD2   . LEU B 2 148 ? -48.275 4.324   -30.933  1.00 2.00  ? 148 LEU B CD2   1 
ATOM   2165  N  N     . ALA B 2 149 ? -53.661 4.432   -30.229  1.00 10.40 ? 149 ALA B N     1 
ATOM   2166  C  CA    . ALA B 2 149 ? -54.975 4.006   -29.684  1.00 6.97  ? 149 ALA B CA    1 
ATOM   2167  C  C     . ALA B 2 149 ? -55.467 2.790   -30.530  1.00 12.24 ? 149 ALA B C     1 
ATOM   2168  O  O     . ALA B 2 149 ? -56.021 1.835   -29.971  1.00 4.54  ? 149 ALA B O     1 
ATOM   2169  C  CB    . ALA B 2 149 ? -55.996 5.121   -29.705  1.00 2.00  ? 149 ALA B CB    1 
ATOM   2170  N  N     . ALA B 2 150 ? -55.259 2.810   -31.852  1.00 2.00  ? 150 ALA B N     1 
ATOM   2171  C  CA    . ALA B 2 150 ? -55.739 1.696   -32.685  1.00 2.13  ? 150 ALA B CA    1 
ATOM   2172  C  C     . ALA B 2 150 ? -55.094 0.379   -32.307  1.00 2.00  ? 150 ALA B C     1 
ATOM   2173  O  O     . ALA B 2 150 ? -55.742 -0.644  -32.008  1.00 4.91  ? 150 ALA B O     1 
ATOM   2174  C  CB    . ALA B 2 150 ? -55.450 1.994   -34.123  1.00 13.33 ? 150 ALA B CB    1 
ATOM   2175  N  N     . ILE B 2 151 ? -53.780 0.427   -32.264  1.00 3.94  ? 151 ILE B N     1 
ATOM   2176  C  CA    . ILE B 2 151 ? -52.975 -0.700  -31.817  1.00 2.97  ? 151 ILE B CA    1 
ATOM   2177  C  C     . ILE B 2 151 ? -53.455 -1.222  -30.469  1.00 6.67  ? 151 ILE B C     1 
ATOM   2178  O  O     . ILE B 2 151 ? -53.776 -2.409  -30.340  1.00 5.83  ? 151 ILE B O     1 
ATOM   2179  C  CB    . ILE B 2 151 ? -51.505 -0.326  -31.866  1.00 3.39  ? 151 ILE B CB    1 
ATOM   2180  C  CG1   . ILE B 2 151 ? -51.186 -0.001  -33.335  1.00 2.00  ? 151 ILE B CG1   1 
ATOM   2181  C  CG2   . ILE B 2 151 ? -50.550 -1.419  -31.280  1.00 2.00  ? 151 ILE B CG2   1 
ATOM   2182  C  CD1   . ILE B 2 151 ? -50.728 -1.088  -34.102  1.00 2.00  ? 151 ILE B CD1   1 
ATOM   2183  N  N     . ALA B 2 152 ? -53.579 -0.341  -29.490  1.00 2.00  ? 152 ALA B N     1 
ATOM   2184  C  CA    . ALA B 2 152 ? -53.903 -0.805  -28.155  1.00 4.56  ? 152 ALA B CA    1 
ATOM   2185  C  C     . ALA B 2 152 ? -55.294 -1.430  -28.086  1.00 2.00  ? 152 ALA B C     1 
ATOM   2186  O  O     . ALA B 2 152 ? -55.601 -2.263  -27.210  1.00 2.90  ? 152 ALA B O     1 
ATOM   2187  C  CB    . ALA B 2 152 ? -53.756 0.330   -27.130  1.00 2.00  ? 152 ALA B CB    1 
ATOM   2188  N  N     . ALA B 2 153 ? -56.196 -0.966  -28.940  1.00 5.81  ? 153 ALA B N     1 
ATOM   2189  C  CA    . ALA B 2 153 ? -57.618 -1.338  -28.726  1.00 7.36  ? 153 ALA B CA    1 
ATOM   2190  C  C     . ALA B 2 153 ? -57.780 -2.720  -29.360  1.00 12.08 ? 153 ALA B C     1 
ATOM   2191  O  O     . ALA B 2 153 ? -58.507 -3.546  -28.844  1.00 4.65  ? 153 ALA B O     1 
ATOM   2192  C  CB    . ALA B 2 153 ? -58.545 -0.376  -29.383  1.00 2.00  ? 153 ALA B CB    1 
ATOM   2193  N  N     . THR B 2 154 ? -57.036 -2.957  -30.441  1.00 5.44  ? 154 THR B N     1 
ATOM   2194  C  CA    . THR B 2 154 ? -57.281 -4.061  -31.319  1.00 3.61  ? 154 THR B CA    1 
ATOM   2195  C  C     . THR B 2 154 ? -56.286 -5.219  -31.164  1.00 4.44  ? 154 THR B C     1 
ATOM   2196  O  O     . THR B 2 154 ? -56.684 -6.352  -31.307  1.00 9.82  ? 154 THR B O     1 
ATOM   2197  C  CB    . THR B 2 154 ? -57.309 -3.564  -32.737  1.00 2.05  ? 154 THR B CB    1 
ATOM   2198  O  OG1   . THR B 2 154 ? -58.283 -2.509  -32.785  1.00 5.09  ? 154 THR B OG1   1 
ATOM   2199  C  CG2   . THR B 2 154 ? -57.733 -4.683  -33.645  1.00 2.00  ? 154 THR B CG2   1 
ATOM   2200  N  N     . CYS B 2 155 ? -55.024 -4.946  -30.837  1.00 3.65  ? 155 CYS B N     1 
ATOM   2201  C  CA    . CYS B 2 155 ? -53.965 -5.961  -30.887  1.00 2.00  ? 155 CYS B CA    1 
ATOM   2202  C  C     . CYS B 2 155 ? -53.905 -6.794  -29.633  1.00 7.73  ? 155 CYS B C     1 
ATOM   2203  O  O     . CYS B 2 155 ? -53.265 -6.438  -28.639  1.00 2.13  ? 155 CYS B O     1 
ATOM   2204  C  CB    . CYS B 2 155 ? -52.617 -5.341  -31.132  1.00 2.00  ? 155 CYS B CB    1 
ATOM   2205  S  SG    . CYS B 2 155 ? -52.547 -4.663  -32.790  1.00 2.17  ? 155 CYS B SG    1 
ATOM   2206  N  N     . ARG B 2 156 ? -54.623 -7.914  -29.671  1.00 8.50  ? 156 ARG B N     1 
ATOM   2207  C  CA    . ARG B 2 156 ? -55.021 -8.514  -28.437  1.00 6.89  ? 156 ARG B CA    1 
ATOM   2208  C  C     . ARG B 2 156 ? -53.869 -9.333  -27.901  1.00 2.00  ? 156 ARG B C     1 
ATOM   2209  O  O     . ARG B 2 156 ? -53.854 -9.651  -26.772  1.00 5.41  ? 156 ARG B O     1 
ATOM   2210  C  CB    . ARG B 2 156 ? -56.413 -9.209  -28.485  1.00 2.00  ? 156 ARG B CB    1 
ATOM   2211  C  CG    . ARG B 2 156 ? -56.564 -10.453 -29.369  1.00 13.53 ? 156 ARG B CG    1 
ATOM   2212  C  CD    . ARG B 2 156 ? -56.823 -11.699 -28.525  1.00 14.35 ? 156 ARG B CD    1 
ATOM   2213  N  NE    . ARG B 2 156 ? -58.020 -12.460 -28.913  1.00 25.71 ? 156 ARG B NE    1 
ATOM   2214  C  CZ    . ARG B 2 156 ? -59.100 -11.936 -29.496  1.00 39.08 ? 156 ARG B CZ    1 
ATOM   2215  N  NH1   . ARG B 2 156 ? -59.122 -10.634 -29.774  1.00 30.83 ? 156 ARG B NH1   1 
ATOM   2216  N  NH2   . ARG B 2 156 ? -60.154 -12.711 -29.807  1.00 5.02  ? 156 ARG B NH2   1 
ATOM   2217  N  N     . ASN B 2 157 ? -52.878 -9.620  -28.725  1.00 3.90  ? 157 ASN B N     1 
ATOM   2218  C  CA    . ASN B 2 157 ? -51.826 -10.554 -28.374  1.00 2.00  ? 157 ASN B CA    1 
ATOM   2219  C  C     . ASN B 2 157 ? -50.506 -9.795  -28.194  1.00 8.23  ? 157 ASN B C     1 
ATOM   2220  O  O     . ASN B 2 157 ? -49.474 -10.425 -27.898  1.00 4.20  ? 157 ASN B O     1 
ATOM   2221  C  CB    . ASN B 2 157 ? -51.659 -11.527 -29.561  1.00 2.00  ? 157 ASN B CB    1 
ATOM   2222  C  CG    . ASN B 2 157 ? -52.824 -12.556 -29.641  1.00 6.57  ? 157 ASN B CG    1 
ATOM   2223  O  OD1   . ASN B 2 157 ? -53.194 -13.117 -28.619  1.00 2.00  ? 157 ASN B OD1   1 
ATOM   2224  N  ND2   . ASN B 2 157 ? -53.384 -12.782 -30.820  1.00 2.00  ? 157 ASN B ND2   1 
ATOM   2225  N  N     . LEU B 2 158 ? -50.526 -8.467  -28.453  1.00 6.61  ? 158 LEU B N     1 
ATOM   2226  C  CA    . LEU B 2 158 ? -49.331 -7.605  -28.311  1.00 4.51  ? 158 LEU B CA    1 
ATOM   2227  C  C     . LEU B 2 158 ? -48.423 -7.852  -27.063  1.00 5.77  ? 158 LEU B C     1 
ATOM   2228  O  O     . LEU B 2 158 ? -48.900 -7.928  -25.946  1.00 2.00  ? 158 LEU B O     1 
ATOM   2229  C  CB    . LEU B 2 158 ? -49.697 -6.139  -28.409  1.00 2.00  ? 158 LEU B CB    1 
ATOM   2230  C  CG    . LEU B 2 158 ? -48.472 -5.234  -28.811  1.00 8.44  ? 158 LEU B CG    1 
ATOM   2231  C  CD1   . LEU B 2 158 ? -48.213 -5.129  -30.282  1.00 3.36  ? 158 LEU B CD1   1 
ATOM   2232  C  CD2   . LEU B 2 158 ? -48.754 -3.872  -28.356  1.00 9.51  ? 158 LEU B CD2   1 
ATOM   2233  N  N     . LYS B 2 159 ? -47.127 -8.001  -27.314  1.00 2.00  ? 159 LYS B N     1 
ATOM   2234  C  CA    . LYS B 2 159 ? -46.162 -8.231  -26.280  1.00 2.00  ? 159 LYS B CA    1 
ATOM   2235  C  C     . LYS B 2 159 ? -45.209 -7.025  -26.120  1.00 10.17 ? 159 LYS B C     1 
ATOM   2236  O  O     . LYS B 2 159 ? -44.722 -6.750  -25.000  1.00 2.23  ? 159 LYS B O     1 
ATOM   2237  C  CB    . LYS B 2 159 ? -45.381 -9.468  -26.687  1.00 8.40  ? 159 LYS B CB    1 
ATOM   2238  C  CG    . LYS B 2 159 ? -45.963 -10.814 -26.099  1.00 10.61 ? 159 LYS B CG    1 
ATOM   2239  C  CD    . LYS B 2 159 ? -45.785 -11.886 -27.106  1.00 10.81 ? 159 LYS B CD    1 
ATOM   2240  C  CE    . LYS B 2 159 ? -44.992 -13.046 -26.540  1.00 26.62 ? 159 LYS B CE    1 
ATOM   2241  N  NZ    . LYS B 2 159 ? -43.621 -12.560 -26.306  1.00 3.66  ? 159 LYS B NZ    1 
ATOM   2242  N  N     . GLU B 2 160 ? -44.939 -6.309  -27.236  1.00 2.00  ? 160 GLU B N     1 
ATOM   2243  C  CA    . GLU B 2 160 ? -43.914 -5.266  -27.250  1.00 4.71  ? 160 GLU B CA    1 
ATOM   2244  C  C     . GLU B 2 160 ? -44.429 -4.018  -27.960  1.00 11.33 ? 160 GLU B C     1 
ATOM   2245  O  O     . GLU B 2 160 ? -44.788 -4.102  -29.152  1.00 2.71  ? 160 GLU B O     1 
ATOM   2246  C  CB    . GLU B 2 160 ? -42.667 -5.727  -27.990  1.00 2.93  ? 160 GLU B CB    1 
ATOM   2247  C  CG    . GLU B 2 160 ? -41.670 -6.261  -27.058  1.00 6.47  ? 160 GLU B CG    1 
ATOM   2248  C  CD    . GLU B 2 160 ? -40.521 -6.981  -27.735  1.00 9.27  ? 160 GLU B CD    1 
ATOM   2249  O  OE1   . GLU B 2 160 ? -40.490 -8.224  -27.590  1.00 5.13  ? 160 GLU B OE1   1 
ATOM   2250  O  OE2   . GLU B 2 160 ? -39.646 -6.315  -28.352  1.00 2.40  ? 160 GLU B OE2   1 
ATOM   2251  N  N     . LEU B 2 161 ? -44.448 -2.863  -27.268  1.00 5.29  ? 161 LEU B N     1 
ATOM   2252  C  CA    . LEU B 2 161 ? -44.601 -1.551  -27.995  1.00 10.60 ? 161 LEU B CA    1 
ATOM   2253  C  C     . LEU B 2 161 ? -43.467 -0.623  -27.635  1.00 7.56  ? 161 LEU B C     1 
ATOM   2254  O  O     . LEU B 2 161 ? -43.322 -0.144  -26.499  1.00 3.16  ? 161 LEU B O     1 
ATOM   2255  C  CB    . LEU B 2 161 ? -45.931 -0.848  -27.673  1.00 15.36 ? 161 LEU B CB    1 
ATOM   2256  C  CG    . LEU B 2 161 ? -46.266 0.528   -28.299  1.00 2.34  ? 161 LEU B CG    1 
ATOM   2257  C  CD1   . LEU B 2 161 ? -46.341 0.497   -29.794  1.00 2.00  ? 161 LEU B CD1   1 
ATOM   2258  C  CD2   . LEU B 2 161 ? -47.615 0.929   -27.812  1.00 2.00  ? 161 LEU B CD2   1 
ATOM   2259  N  N     . ASP B 2 162 ? -42.626 -0.428  -28.604  1.00 2.00  ? 162 ASP B N     1 
ATOM   2260  C  CA    . ASP B 2 162 ? -41.396 0.227   -28.333  1.00 5.70  ? 162 ASP B CA    1 
ATOM   2261  C  C     . ASP B 2 162 ? -41.300 1.458   -29.275  1.00 3.23  ? 162 ASP B C     1 
ATOM   2262  O  O     . ASP B 2 162 ? -41.206 1.295   -30.484  1.00 2.00  ? 162 ASP B O     1 
ATOM   2263  C  CB    . ASP B 2 162 ? -40.255 -0.743  -28.613  1.00 2.00  ? 162 ASP B CB    1 
ATOM   2264  C  CG    . ASP B 2 162 ? -38.960 -0.220  -28.147  1.00 6.92  ? 162 ASP B CG    1 
ATOM   2265  O  OD1   . ASP B 2 162 ? -38.807 0.998   -28.225  1.00 12.98 ? 162 ASP B OD1   1 
ATOM   2266  O  OD2   . ASP B 2 162 ? -38.091 -0.983  -27.680  1.00 11.17 ? 162 ASP B OD2   1 
ATOM   2267  N  N     . LEU B 2 163 ? -41.326 2.655   -28.699  1.00 6.89  ? 163 LEU B N     1 
ATOM   2268  C  CA    . LEU B 2 163 ? -41.523 3.874   -29.474  1.00 2.75  ? 163 LEU B CA    1 
ATOM   2269  C  C     . LEU B 2 163 ? -40.214 4.638   -29.645  1.00 3.50  ? 163 LEU B C     1 
ATOM   2270  O  O     . LEU B 2 163 ? -40.210 5.797   -30.058  1.00 10.31 ? 163 LEU B O     1 
ATOM   2271  C  CB    . LEU B 2 163 ? -42.570 4.769   -28.808  1.00 2.00  ? 163 LEU B CB    1 
ATOM   2272  C  CG    . LEU B 2 163 ? -44.032 4.360   -28.999  1.00 9.56  ? 163 LEU B CG    1 
ATOM   2273  C  CD1   . LEU B 2 163 ? -44.964 5.498   -28.610  1.00 2.00  ? 163 LEU B CD1   1 
ATOM   2274  C  CD2   . LEU B 2 163 ? -44.285 3.922   -30.433  1.00 2.00  ? 163 LEU B CD2   1 
ATOM   2275  N  N     . ARG B 2 164 ? -39.105 3.980   -29.326  1.00 2.00  ? 164 ARG B N     1 
ATOM   2276  C  CA    . ARG B 2 164 ? -37.880 4.678   -28.954  1.00 2.00  ? 164 ARG B CA    1 
ATOM   2277  C  C     . ARG B 2 164 ? -37.512 5.735   -29.989  1.00 2.00  ? 164 ARG B C     1 
ATOM   2278  O  O     . ARG B 2 164 ? -37.386 5.438   -31.177  1.00 2.00  ? 164 ARG B O     1 
ATOM   2279  C  CB    . ARG B 2 164 ? -36.728 3.685   -28.784  1.00 2.00  ? 164 ARG B CB    1 
ATOM   2280  C  CG    . ARG B 2 164 ? -36.377 2.919   -30.049  1.00 2.00  ? 164 ARG B CG    1 
ATOM   2281  C  CD    . ARG B 2 164 ? -34.927 2.468   -30.119  1.00 3.84  ? 164 ARG B CD    1 
ATOM   2282  N  NE    . ARG B 2 164 ? -34.809 1.064   -30.500  1.00 42.94 ? 164 ARG B NE    1 
ATOM   2283  C  CZ    . ARG B 2 164 ? -35.406 0.066   -29.863  1.00 45.01 ? 164 ARG B CZ    1 
ATOM   2284  N  NH1   . ARG B 2 164 ? -36.170 0.313   -28.808  1.00 7.15  ? 164 ARG B NH1   1 
ATOM   2285  N  NH2   . ARG B 2 164 ? -35.242 -1.182  -30.279  1.00 10.06 ? 164 ARG B NH2   1 
ATOM   2286  N  N     . GLU B 2 165 ? -37.342 6.971   -29.531  1.00 2.00  ? 165 GLU B N     1 
ATOM   2287  C  CA    . GLU B 2 165 ? -36.710 8.008   -30.338  1.00 2.00  ? 165 GLU B CA    1 
ATOM   2288  C  C     . GLU B 2 165 ? -37.534 8.314   -31.585  1.00 2.00  ? 165 GLU B C     1 
ATOM   2289  O  O     . GLU B 2 165 ? -36.989 8.689   -32.624  1.00 2.00  ? 165 GLU B O     1 
ATOM   2290  C  CB    . GLU B 2 165 ? -35.293 7.590   -30.734  1.00 2.04  ? 165 GLU B CB    1 
ATOM   2291  C  CG    . GLU B 2 165 ? -34.703 6.493   -29.862  1.00 22.46 ? 165 GLU B CG    1 
ATOM   2292  C  CD    . GLU B 2 165 ? -34.084 7.032   -28.587  1.00 20.66 ? 165 GLU B CD    1 
ATOM   2293  O  OE1   . GLU B 2 165 ? -34.324 6.442   -27.513  1.00 56.76 ? 165 GLU B OE1   1 
ATOM   2294  O  OE2   . GLU B 2 165 ? -33.358 8.045   -28.659  1.00 46.60 ? 165 GLU B OE2   1 
ATOM   2295  N  N     . SER B 2 166 ? -38.848 8.151   -31.475  1.00 2.00  ? 166 SER B N     1 
ATOM   2296  C  CA    . SER B 2 166 ? -39.733 8.589   -32.475  1.00 2.00  ? 166 SER B CA    1 
ATOM   2297  C  C     . SER B 2 166 ? -40.356 9.969   -32.179  1.00 5.86  ? 166 SER B C     1 
ATOM   2298  O  O     . SER B 2 166 ? -40.369 10.449  -31.059  1.00 3.82  ? 166 SER B O     1 
ATOM   2299  C  CB    . SER B 2 166 ? -40.751 7.541   -32.723  1.00 2.00  ? 166 SER B CB    1 
ATOM   2300  O  OG    . SER B 2 166 ? -40.193 6.620   -33.629  1.00 2.00  ? 166 SER B OG    1 
ATOM   2301  N  N     . ASP B 2 167 ? -40.854 10.590  -33.223  1.00 2.79  ? 167 ASP B N     1 
ATOM   2302  C  CA    . ASP B 2 167 ? -41.505 11.857  -33.151  1.00 5.23  ? 167 ASP B CA    1 
ATOM   2303  C  C     . ASP B 2 167 ? -43.035 11.596  -33.341  1.00 2.00  ? 167 ASP B C     1 
ATOM   2304  O  O     . ASP B 2 167 ? -43.446 11.320  -34.432  1.00 3.24  ? 167 ASP B O     1 
ATOM   2305  C  CB    . ASP B 2 167 ? -40.929 12.674  -34.319  1.00 2.00  ? 167 ASP B CB    1 
ATOM   2306  C  CG    . ASP B 2 167 ? -41.522 14.066  -34.423  1.00 12.72 ? 167 ASP B CG    1 
ATOM   2307  O  OD1   . ASP B 2 167 ? -42.200 14.550  -33.458  1.00 18.56 ? 167 ASP B OD1   1 
ATOM   2308  O  OD2   . ASP B 2 167 ? -41.296 14.694  -35.490  1.00 21.34 ? 167 ASP B OD2   1 
ATOM   2309  N  N     . VAL B 2 168 ? -43.840 11.625  -32.293  1.00 2.00  ? 168 VAL B N     1 
ATOM   2310  C  CA    . VAL B 2 168 ? -45.243 11.306  -32.394  1.00 2.00  ? 168 VAL B CA    1 
ATOM   2311  C  C     . VAL B 2 168 ? -46.050 12.579  -32.310  1.00 5.64  ? 168 VAL B C     1 
ATOM   2312  O  O     . VAL B 2 168 ? -45.827 13.424  -31.444  1.00 12.11 ? 168 VAL B O     1 
ATOM   2313  C  CB    . VAL B 2 168 ? -45.671 10.412  -31.236  1.00 6.02  ? 168 VAL B CB    1 
ATOM   2314  C  CG1   . VAL B 2 168 ? -47.118 9.836   -31.410  1.00 2.00  ? 168 VAL B CG1   1 
ATOM   2315  C  CG2   . VAL B 2 168 ? -44.683 9.308   -31.131  1.00 10.53 ? 168 VAL B CG2   1 
ATOM   2316  N  N     . ASP B 2 169 ? -46.961 12.751  -33.248  1.00 4.05  ? 169 ASP B N     1 
ATOM   2317  C  CA    . ASP B 2 169 ? -47.853 13.848  -33.159  1.00 8.05  ? 169 ASP B CA    1 
ATOM   2318  C  C     . ASP B 2 169 ? -48.776 13.663  -31.896  1.00 11.08 ? 169 ASP B C     1 
ATOM   2319  O  O     . ASP B 2 169 ? -49.617 12.746  -31.821  1.00 4.42  ? 169 ASP B O     1 
ATOM   2320  C  CB    . ASP B 2 169 ? -48.536 14.089  -34.510  1.00 2.00  ? 169 ASP B CB    1 
ATOM   2321  C  CG    . ASP B 2 169 ? -49.827 14.848  -34.370  1.00 20.31 ? 169 ASP B CG    1 
ATOM   2322  O  OD1   . ASP B 2 169 ? -50.897 14.369  -34.823  1.00 41.85 ? 169 ASP B OD1   1 
ATOM   2323  O  OD2   . ASP B 2 169 ? -49.779 15.953  -33.804  1.00 36.15 ? 169 ASP B OD2   1 
ATOM   2324  N  N     . ASP B 2 170 ? -48.578 14.505  -30.888  1.00 13.04 ? 170 ASP B N     1 
ATOM   2325  C  CA    . ASP B 2 170 ? -48.938 14.160  -29.513  1.00 16.12 ? 170 ASP B CA    1 
ATOM   2326  C  C     . ASP B 2 170 ? -50.255 14.808  -29.102  1.00 10.69 ? 170 ASP B C     1 
ATOM   2327  O  O     . ASP B 2 170 ? -50.304 15.527  -28.115  1.00 10.85 ? 170 ASP B O     1 
ATOM   2328  C  CB    . ASP B 2 170 ? -47.845 14.605  -28.538  1.00 12.53 ? 170 ASP B CB    1 
ATOM   2329  C  CG    . ASP B 2 170 ? -47.065 13.442  -27.946  1.00 34.08 ? 170 ASP B CG    1 
ATOM   2330  O  OD1   . ASP B 2 170 ? -47.664 12.626  -27.221  1.00 16.95 ? 170 ASP B OD1   1 
ATOM   2331  O  OD2   . ASP B 2 170 ? -45.844 13.277  -28.133  1.00 3.74  ? 170 ASP B OD2   1 
ATOM   2332  N  N     . VAL B 2 171 ? -51.312 14.557  -29.867  1.00 5.87  ? 171 VAL B N     1 
ATOM   2333  C  CA    . VAL B 2 171 ? -52.645 14.364  -29.315  1.00 3.25  ? 171 VAL B CA    1 
ATOM   2334  C  C     . VAL B 2 171 ? -52.641 13.298  -28.223  1.00 7.81  ? 171 VAL B C     1 
ATOM   2335  O  O     . VAL B 2 171 ? -52.231 12.162  -28.469  1.00 2.00  ? 171 VAL B O     1 
ATOM   2336  C  CB    . VAL B 2 171 ? -53.610 13.897  -30.397  1.00 9.16  ? 171 VAL B CB    1 
ATOM   2337  C  CG1   . VAL B 2 171 ? -54.980 14.459  -30.171  1.00 2.00  ? 171 VAL B CG1   1 
ATOM   2338  C  CG2   . VAL B 2 171 ? -53.082 14.219  -31.773  1.00 2.00  ? 171 VAL B CG2   1 
ATOM   2339  N  N     . SER B 2 172 ? -53.099 13.661  -27.028  1.00 11.18 ? 172 SER B N     1 
ATOM   2340  C  CA    . SER B 2 172 ? -53.843 12.757  -26.146  1.00 5.81  ? 172 SER B CA    1 
ATOM   2341  C  C     . SER B 2 172 ? -53.083 11.593  -25.513  1.00 5.71  ? 172 SER B C     1 
ATOM   2342  O  O     . SER B 2 172 ? -52.622 10.690  -26.189  1.00 2.00  ? 172 SER B O     1 
ATOM   2343  C  CB    . SER B 2 172 ? -55.140 12.284  -26.786  1.00 2.00  ? 172 SER B CB    1 
ATOM   2344  O  OG    . SER B 2 172 ? -56.035 11.810  -25.805  1.00 2.00  ? 172 SER B OG    1 
ATOM   2345  N  N     . GLY B 2 173 ? -52.975 11.616  -24.195  1.00 10.12 ? 173 GLY B N     1 
ATOM   2346  C  CA    . GLY B 2 173 ? -52.538 10.451  -23.455  1.00 19.98 ? 173 GLY B CA    1 
ATOM   2347  C  C     . GLY B 2 173 ? -53.641 9.434   -23.236  1.00 20.72 ? 173 GLY B C     1 
ATOM   2348  O  O     . GLY B 2 173 ? -53.435 8.405   -22.598  1.00 15.10 ? 173 GLY B O     1 
ATOM   2349  N  N     . HIS B 2 174 ? -54.814 9.717   -23.787  1.00 10.25 ? 174 HIS B N     1 
ATOM   2350  C  CA    . HIS B 2 174 ? -55.949 8.828   -23.627  1.00 7.11  ? 174 HIS B CA    1 
ATOM   2351  C  C     . HIS B 2 174 ? -55.785 7.463   -24.293  1.00 8.14  ? 174 HIS B C     1 
ATOM   2352  O  O     . HIS B 2 174 ? -56.405 6.492   -23.887  1.00 2.00  ? 174 HIS B O     1 
ATOM   2353  C  CB    . HIS B 2 174 ? -57.223 9.505   -24.100  1.00 2.00  ? 174 HIS B CB    1 
ATOM   2354  C  CG    . HIS B 2 174 ? -58.464 8.774   -23.710  1.00 24.48 ? 174 HIS B CG    1 
ATOM   2355  N  ND1   . HIS B 2 174 ? -59.061 8.926   -22.480  1.00 12.35 ? 174 HIS B ND1   1 
ATOM   2356  C  CD2   . HIS B 2 174 ? -59.213 7.871   -24.383  1.00 28.41 ? 174 HIS B CD2   1 
ATOM   2357  C  CE1   . HIS B 2 174 ? -60.130 8.155   -22.413  1.00 7.28  ? 174 HIS B CE1   1 
ATOM   2358  N  NE2   . HIS B 2 174 ? -60.245 7.503   -23.555  1.00 47.49 ? 174 HIS B NE2   1 
ATOM   2359  N  N     . TRP B 2 175 ? -54.938 7.406   -25.309  1.00 2.00  ? 175 TRP B N     1 
ATOM   2360  C  CA    . TRP B 2 175 ? -54.818 6.272   -26.187  1.00 2.00  ? 175 TRP B CA    1 
ATOM   2361  C  C     . TRP B 2 175 ? -54.452 5.037   -25.348  1.00 12.17 ? 175 TRP B C     1 
ATOM   2362  O  O     . TRP B 2 175 ? -54.847 3.886   -25.677  1.00 2.00  ? 175 TRP B O     1 
ATOM   2363  C  CB    . TRP B 2 175 ? -53.727 6.519   -27.240  1.00 2.00  ? 175 TRP B CB    1 
ATOM   2364  C  CG    . TRP B 2 175 ? -52.344 6.627   -26.640  1.00 19.35 ? 175 TRP B CG    1 
ATOM   2365  C  CD1   . TRP B 2 175 ? -51.693 7.785   -26.224  1.00 15.60 ? 175 TRP B CD1   1 
ATOM   2366  C  CD2   . TRP B 2 175 ? -51.451 5.548   -26.344  1.00 4.09  ? 175 TRP B CD2   1 
ATOM   2367  N  NE1   . TRP B 2 175 ? -50.459 7.483   -25.705  1.00 2.00  ? 175 TRP B NE1   1 
ATOM   2368  C  CE2   . TRP B 2 175 ? -50.278 6.122   -25.758  1.00 9.45  ? 175 TRP B CE2   1 
ATOM   2369  C  CE3   . TRP B 2 175 ? -51.524 4.167   -26.499  1.00 9.35  ? 175 TRP B CE3   1 
ATOM   2370  C  CZ2   . TRP B 2 175 ? -49.172 5.345   -25.355  1.00 3.43  ? 175 TRP B CZ2   1 
ATOM   2371  C  CZ3   . TRP B 2 175 ? -50.394 3.371   -26.104  1.00 11.21 ? 175 TRP B CZ3   1 
ATOM   2372  C  CH2   . TRP B 2 175 ? -49.247 3.973   -25.547  1.00 9.99  ? 175 TRP B CH2   1 
ATOM   2373  N  N     . LEU B 2 176 ? -53.681 5.252   -24.272  1.00 5.90  ? 176 LEU B N     1 
ATOM   2374  C  CA    . LEU B 2 176 ? -53.253 4.079   -23.543  1.00 7.87  ? 176 LEU B CA    1 
ATOM   2375  C  C     . LEU B 2 176 ? -54.438 3.366   -22.822  1.00 2.00  ? 176 LEU B C     1 
ATOM   2376  O  O     . LEU B 2 176 ? -54.419 2.184   -22.674  1.00 10.43 ? 176 LEU B O     1 
ATOM   2377  C  CB    . LEU B 2 176 ? -52.011 4.325   -22.669  1.00 9.86  ? 176 LEU B CB    1 
ATOM   2378  C  CG    . LEU B 2 176 ? -51.511 3.242   -21.652  1.00 5.61  ? 176 LEU B CG    1 
ATOM   2379  C  CD1   . LEU B 2 176 ? -50.056 3.435   -21.331  1.00 4.91  ? 176 LEU B CD1   1 
ATOM   2380  C  CD2   . LEU B 2 176 ? -52.253 3.238   -20.322  1.00 15.43 ? 176 LEU B CD2   1 
ATOM   2381  N  N     . SER B 2 177 ? -55.470 4.060   -22.397  1.00 2.00  ? 177 SER B N     1 
ATOM   2382  C  CA    . SER B 2 177 ? -56.557 3.383   -21.719  1.00 2.00  ? 177 SER B CA    1 
ATOM   2383  C  C     . SER B 2 177 ? -57.371 2.637   -22.726  1.00 9.76  ? 177 SER B C     1 
ATOM   2384  O  O     . SER B 2 177 ? -58.438 2.176   -22.399  1.00 2.00  ? 177 SER B O     1 
ATOM   2385  C  CB    . SER B 2 177 ? -57.553 4.395   -21.173  1.00 6.16  ? 177 SER B CB    1 
ATOM   2386  O  OG    . SER B 2 177 ? -56.934 5.652   -20.965  1.00 22.06 ? 177 SER B OG    1 
ATOM   2387  N  N     . HIS B 2 178 ? -56.930 2.566   -23.974  1.00 6.30  ? 178 HIS B N     1 
ATOM   2388  C  CA    . HIS B 2 178 ? -57.682 1.728   -24.949  1.00 14.07 ? 178 HIS B CA    1 
ATOM   2389  C  C     . HIS B 2 178 ? -57.374 0.177   -24.919  1.00 7.71  ? 178 HIS B C     1 
ATOM   2390  O  O     . HIS B 2 178 ? -58.066 -0.629  -25.535  1.00 5.43  ? 178 HIS B O     1 
ATOM   2391  C  CB    . HIS B 2 178 ? -57.547 2.306   -26.370  1.00 4.00  ? 178 HIS B CB    1 
ATOM   2392  C  CG    . HIS B 2 178 ? -58.357 3.550   -26.610  1.00 13.22 ? 178 HIS B CG    1 
ATOM   2393  N  ND1   . HIS B 2 178 ? -59.396 3.599   -27.516  1.00 9.06  ? 178 HIS B ND1   1 
ATOM   2394  C  CD2   . HIS B 2 178 ? -58.252 4.802   -26.091  1.00 8.23  ? 178 HIS B CD2   1 
ATOM   2395  C  CE1   . HIS B 2 178 ? -59.909 4.819   -27.534  1.00 5.48  ? 178 HIS B CE1   1 
ATOM   2396  N  NE2   . HIS B 2 178 ? -59.234 5.571   -26.678  1.00 24.65 ? 178 HIS B NE2   1 
ATOM   2397  N  N     . PHE B 2 179 ? -56.295 -0.195  -24.250  1.00 6.01  ? 179 PHE B N     1 
ATOM   2398  C  CA    . PHE B 2 179 ? -56.018 -1.548  -23.827  1.00 3.92  ? 179 PHE B CA    1 
ATOM   2399  C  C     . PHE B 2 179 ? -57.179 -2.019  -22.977  1.00 4.91  ? 179 PHE B C     1 
ATOM   2400  O  O     . PHE B 2 179 ? -57.427 -1.466  -21.893  1.00 3.05  ? 179 PHE B O     1 
ATOM   2401  C  CB    . PHE B 2 179 ? -54.704 -1.558  -23.005  1.00 2.00  ? 179 PHE B CB    1 
ATOM   2402  C  CG    . PHE B 2 179 ? -53.416 -1.446  -23.856  1.00 2.00  ? 179 PHE B CG    1 
ATOM   2403  C  CD1   . PHE B 2 179 ? -52.544 -0.444  -23.660  1.00 2.00  ? 179 PHE B CD1   1 
ATOM   2404  C  CD2   . PHE B 2 179 ? -53.090 -2.430  -24.792  1.00 2.00  ? 179 PHE B CD2   1 
ATOM   2405  C  CE1   . PHE B 2 179 ? -51.366 -0.374  -24.350  1.00 2.00  ? 179 PHE B CE1   1 
ATOM   2406  C  CE2   . PHE B 2 179 ? -51.947 -2.396  -25.517  1.00 2.00  ? 179 PHE B CE2   1 
ATOM   2407  C  CZ    . PHE B 2 179 ? -51.042 -1.307  -25.308  1.00 9.05  ? 179 PHE B CZ    1 
ATOM   2408  N  N     . PRO B 2 180 ? -57.888 -3.059  -23.462  1.00 3.72  ? 180 PRO B N     1 
ATOM   2409  C  CA    . PRO B 2 180 ? -59.037 -3.640  -22.744  1.00 2.09  ? 180 PRO B CA    1 
ATOM   2410  C  C     . PRO B 2 180 ? -58.559 -4.317  -21.470  1.00 2.00  ? 180 PRO B C     1 
ATOM   2411  O  O     . PRO B 2 180 ? -57.402 -4.649  -21.389  1.00 6.57  ? 180 PRO B O     1 
ATOM   2412  C  CB    . PRO B 2 180 ? -59.649 -4.674  -23.728  1.00 2.00  ? 180 PRO B CB    1 
ATOM   2413  C  CG    . PRO B 2 180 ? -59.049 -4.347  -25.069  1.00 9.99  ? 180 PRO B CG    1 
ATOM   2414  C  CD    . PRO B 2 180 ? -57.661 -3.695  -24.770  1.00 2.00  ? 180 PRO B CD    1 
ATOM   2415  N  N     . ASP B 2 181 ? -59.448 -4.496  -20.493  1.00 2.00  ? 181 ASP B N     1 
ATOM   2416  C  CA    . ASP B 2 181 ? -59.151 -5.198  -19.288  1.00 4.12  ? 181 ASP B CA    1 
ATOM   2417  C  C     . ASP B 2 181 ? -58.752 -6.628  -19.565  1.00 2.20  ? 181 ASP B C     1 
ATOM   2418  O  O     . ASP B 2 181 ? -58.264 -7.282  -18.654  1.00 6.86  ? 181 ASP B O     1 
ATOM   2419  C  CB    . ASP B 2 181 ? -60.403 -5.274  -18.418  1.00 6.14  ? 181 ASP B CB    1 
ATOM   2420  C  CG    . ASP B 2 181 ? -60.705 -3.974  -17.722  1.00 33.27 ? 181 ASP B CG    1 
ATOM   2421  O  OD1   . ASP B 2 181 ? -59.877 -3.026  -17.839  1.00 33.10 ? 181 ASP B OD1   1 
ATOM   2422  O  OD2   . ASP B 2 181 ? -61.785 -3.916  -17.066  1.00 30.54 ? 181 ASP B OD2   1 
ATOM   2423  N  N     . THR B 2 182 ? -59.081 -7.162  -20.728  1.00 2.00  ? 182 THR B N     1 
ATOM   2424  C  CA    . THR B 2 182 ? -58.806 -8.569  -20.904  1.00 5.32  ? 182 THR B CA    1 
ATOM   2425  C  C     . THR B 2 182 ? -57.411 -8.681  -21.485  1.00 10.88 ? 182 THR B C     1 
ATOM   2426  O  O     . THR B 2 182 ? -56.881 -9.770  -21.556  1.00 9.23  ? 182 THR B O     1 
ATOM   2427  C  CB    . THR B 2 182 ? -59.869 -9.409  -21.802  1.00 3.95  ? 182 THR B CB    1 
ATOM   2428  O  OG1   . THR B 2 182 ? -60.122 -8.777  -23.059  1.00 6.54  ? 182 THR B OG1   1 
ATOM   2429  C  CG2   . THR B 2 182 ? -61.189 -9.585  -21.088  1.00 5.18  ? 182 THR B CG2   1 
ATOM   2430  N  N     . TYR B 2 183 ? -56.806 -7.562  -21.862  1.00 2.00  ? 183 TYR B N     1 
ATOM   2431  C  CA    . TYR B 2 183 ? -55.407 -7.543  -22.272  1.00 3.35  ? 183 TYR B CA    1 
ATOM   2432  C  C     . TYR B 2 183 ? -54.416 -7.716  -21.126  1.00 2.00  ? 183 TYR B C     1 
ATOM   2433  O  O     . TYR B 2 183 ? -54.554 -7.093  -20.092  1.00 3.63  ? 183 TYR B O     1 
ATOM   2434  C  CB    . TYR B 2 183 ? -55.101 -6.261  -23.039  1.00 2.00  ? 183 TYR B CB    1 
ATOM   2435  C  CG    . TYR B 2 183 ? -53.658 -6.116  -23.437  1.00 10.10 ? 183 TYR B CG    1 
ATOM   2436  C  CD1   . TYR B 2 183 ? -53.152 -6.800  -24.518  1.00 2.00  ? 183 TYR B CD1   1 
ATOM   2437  C  CD2   . TYR B 2 183 ? -52.801 -5.301  -22.726  1.00 2.00  ? 183 TYR B CD2   1 
ATOM   2438  C  CE1   . TYR B 2 183 ? -51.851 -6.680  -24.876  1.00 4.19  ? 183 TYR B CE1   1 
ATOM   2439  C  CE2   . TYR B 2 183 ? -51.490 -5.183  -23.080  1.00 2.00  ? 183 TYR B CE2   1 
ATOM   2440  C  CZ    . TYR B 2 183 ? -51.021 -5.868  -24.161  1.00 2.00  ? 183 TYR B CZ    1 
ATOM   2441  O  OH    . TYR B 2 183 ? -49.714 -5.756  -24.529  1.00 2.63  ? 183 TYR B OH    1 
ATOM   2442  N  N     . THR B 2 184 ? -53.412 -8.559  -21.333  1.00 2.00  ? 184 THR B N     1 
ATOM   2443  C  CA    . THR B 2 184 ? -52.517 -8.983  -20.264  1.00 2.00  ? 184 THR B CA    1 
ATOM   2444  C  C     . THR B 2 184 ? -51.114 -9.375  -20.690  1.00 4.01  ? 184 THR B C     1 
ATOM   2445  O  O     . THR B 2 184 ? -50.338 -9.847  -19.880  1.00 3.87  ? 184 THR B O     1 
ATOM   2446  C  CB    . THR B 2 184 ? -53.118 -10.125 -19.404  1.00 5.58  ? 184 THR B CB    1 
ATOM   2447  O  OG1   . THR B 2 184 ? -53.168 -11.340 -20.147  1.00 2.00  ? 184 THR B OG1   1 
ATOM   2448  C  CG2   . THR B 2 184 ? -54.537 -9.863  -19.054  1.00 2.00  ? 184 THR B CG2   1 
ATOM   2449  N  N     . SER B 2 185 ? -50.791 -9.212  -21.961  1.00 2.00  ? 185 SER B N     1 
ATOM   2450  C  CA    . SER B 2 185 ? -49.714 -9.994  -22.543  1.00 7.96  ? 185 SER B CA    1 
ATOM   2451  C  C     . SER B 2 185 ? -48.415 -9.222  -22.647  1.00 6.82  ? 185 SER B C     1 
ATOM   2452  O  O     . SER B 2 185 ? -47.433 -9.725  -23.161  1.00 10.02 ? 185 SER B O     1 
ATOM   2453  C  CB    . SER B 2 185 ? -50.103 -10.558 -23.898  1.00 2.00  ? 185 SER B CB    1 
ATOM   2454  O  OG    . SER B 2 185 ? -51.004 -9.708  -24.551  1.00 2.00  ? 185 SER B OG    1 
ATOM   2455  N  N     . LEU B 2 186 ? -48.415 -8.005  -22.136  1.00 3.56  ? 186 LEU B N     1 
ATOM   2456  C  CA    . LEU B 2 186 ? -47.361 -7.060  -22.473  1.00 4.26  ? 186 LEU B CA    1 
ATOM   2457  C  C     . LEU B 2 186 ? -46.054 -7.472  -21.862  1.00 6.57  ? 186 LEU B C     1 
ATOM   2458  O  O     . LEU B 2 186 ? -45.963 -7.651  -20.659  1.00 2.49  ? 186 LEU B O     1 
ATOM   2459  C  CB    . LEU B 2 186 ? -47.716 -5.701  -21.843  1.00 12.41 ? 186 LEU B CB    1 
ATOM   2460  C  CG    . LEU B 2 186 ? -46.871 -4.446  -22.163  1.00 4.45  ? 186 LEU B CG    1 
ATOM   2461  C  CD1   . LEU B 2 186 ? -47.000 -4.127  -23.578  1.00 2.00  ? 186 LEU B CD1   1 
ATOM   2462  C  CD2   . LEU B 2 186 ? -47.379 -3.220  -21.329  1.00 2.00  ? 186 LEU B CD2   1 
ATOM   2463  N  N     . VAL B 2 187 ? -45.013 -7.525  -22.673  1.00 3.42  ? 187 VAL B N     1 
ATOM   2464  C  CA    . VAL B 2 187 ? -43.651 -7.762  -22.139  1.00 7.86  ? 187 VAL B CA    1 
ATOM   2465  C  C     . VAL B 2 187 ? -42.824 -6.461  -21.937  1.00 6.96  ? 187 VAL B C     1 
ATOM   2466  O  O     . VAL B 2 187 ? -41.901 -6.398  -21.082  1.00 2.00  ? 187 VAL B O     1 
ATOM   2467  C  CB    . VAL B 2 187 ? -42.854 -8.715  -23.089  1.00 4.25  ? 187 VAL B CB    1 
ATOM   2468  C  CG1   . VAL B 2 187 ? -41.437 -8.876  -22.650  1.00 2.92  ? 187 VAL B CG1   1 
ATOM   2469  C  CG2   . VAL B 2 187 ? -43.530 -10.071 -23.111  1.00 11.28 ? 187 VAL B CG2   1 
ATOM   2470  N  N     . SER B 2 188 ? -43.182 -5.443  -22.720  1.00 3.84  ? 188 SER B N     1 
ATOM   2471  C  CA    . SER B 2 188 ? -42.262 -4.363  -23.113  1.00 2.00  ? 188 SER B CA    1 
ATOM   2472  C  C     . SER B 2 188 ? -42.939 -3.094  -23.749  1.00 2.77  ? 188 SER B C     1 
ATOM   2473  O  O     . SER B 2 188 ? -43.383 -3.132  -24.907  1.00 4.06  ? 188 SER B O     1 
ATOM   2474  C  CB    . SER B 2 188 ? -41.277 -4.987  -24.068  1.00 4.51  ? 188 SER B CB    1 
ATOM   2475  O  OG    . SER B 2 188 ? -40.311 -4.090  -24.522  1.00 2.44  ? 188 SER B OG    1 
ATOM   2476  N  N     . LEU B 2 189 ? -42.982 -2.004  -22.960  1.00 3.96  ? 189 LEU B N     1 
ATOM   2477  C  CA    . LEU B 2 189 ? -43.527 -0.666  -23.272  1.00 2.66  ? 189 LEU B CA    1 
ATOM   2478  C  C     . LEU B 2 189 ? -42.397 0.335   -23.186  1.00 5.11  ? 189 LEU B C     1 
ATOM   2479  O  O     . LEU B 2 189 ? -41.874 0.597   -22.085  1.00 2.00  ? 189 LEU B O     1 
ATOM   2480  C  CB    . LEU B 2 189 ? -44.471 -0.268  -22.149  1.00 2.00  ? 189 LEU B CB    1 
ATOM   2481  C  CG    . LEU B 2 189 ? -45.472 0.815   -22.557  1.00 2.00  ? 189 LEU B CG    1 
ATOM   2482  C  CD1   . LEU B 2 189 ? -46.029 0.657   -23.987  1.00 2.00  ? 189 LEU B CD1   1 
ATOM   2483  C  CD2   . LEU B 2 189 ? -46.564 0.941   -21.606  1.00 2.00  ? 189 LEU B CD2   1 
ATOM   2484  N  N     . ASN B 2 190 ? -42.002 0.905   -24.322  1.00 2.79  ? 190 ASN B N     1 
ATOM   2485  C  CA    . ASN B 2 190 ? -41.009 1.990   -24.292  1.00 2.00  ? 190 ASN B CA    1 
ATOM   2486  C  C     . ASN B 2 190 ? -41.664 3.245   -24.737  1.00 2.00  ? 190 ASN B C     1 
ATOM   2487  O  O     . ASN B 2 190 ? -41.910 3.435   -25.920  1.00 2.00  ? 190 ASN B O     1 
ATOM   2488  C  CB    . ASN B 2 190 ? -39.814 1.781   -25.148  1.00 2.00  ? 190 ASN B CB    1 
ATOM   2489  C  CG    . ASN B 2 190 ? -38.920 3.050   -25.186  1.00 6.66  ? 190 ASN B CG    1 
ATOM   2490  O  OD1   . ASN B 2 190 ? -39.312 4.118   -24.630  1.00 2.01  ? 190 ASN B OD1   1 
ATOM   2491  N  ND2   . ASN B 2 190 ? -37.759 2.980   -25.853  1.00 2.00  ? 190 ASN B ND2   1 
ATOM   2492  N  N     . ILE B 2 191 ? -41.880 4.117   -23.778  1.00 3.54  ? 191 ILE B N     1 
ATOM   2493  C  CA    . ILE B 2 191 ? -42.925 5.191   -23.775  1.00 5.86  ? 191 ILE B CA    1 
ATOM   2494  C  C     . ILE B 2 191 ? -42.312 6.563   -23.911  1.00 14.75 ? 191 ILE B C     1 
ATOM   2495  O  O     . ILE B 2 191 ? -43.004 7.608   -23.858  1.00 15.52 ? 191 ILE B O     1 
ATOM   2496  C  CB    . ILE B 2 191 ? -44.244 4.943   -22.841  1.00 9.48  ? 191 ILE B CB    1 
ATOM   2497  C  CG1   . ILE B 2 191 ? -45.266 5.006   -23.846  1.00 2.00  ? 191 ILE B CG1   1 
ATOM   2498  C  CG2   . ILE B 2 191 ? -44.682 5.882   -21.766  1.00 2.00  ? 191 ILE B CG2   1 
ATOM   2499  C  CD1   . ILE B 2 191 ? -44.472 5.111   -24.915  1.00 3.11  ? 191 ILE B CD1   1 
ATOM   2500  N  N     . SER B 2 192 ? -40.997 6.539   -24.123  1.00 2.00  ? 192 SER B N     1 
ATOM   2501  C  CA    . SER B 2 192 ? -40.202 7.549   -23.542  1.00 3.79  ? 192 SER B CA    1 
ATOM   2502  C  C     . SER B 2 192 ? -40.050 8.880   -24.375  1.00 3.31  ? 192 SER B C     1 
ATOM   2503  O  O     . SER B 2 192 ? -39.808 9.915   -23.797  1.00 7.66  ? 192 SER B O     1 
ATOM   2504  C  CB    . SER B 2 192 ? -38.904 6.948   -23.129  1.00 2.00  ? 192 SER B CB    1 
ATOM   2505  O  OG    . SER B 2 192 ? -38.187 6.727   -24.280  1.00 2.88  ? 192 SER B OG    1 
ATOM   2506  N  N     . CYS B 2 193 ? -40.231 8.831   -25.692  1.00 2.00  ? 193 CYS B N     1 
ATOM   2507  C  CA    . CYS B 2 193 ? -40.433 9.953   -26.538  1.00 2.00  ? 193 CYS B CA    1 
ATOM   2508  C  C     . CYS B 2 193 ? -41.755 10.703  -26.490  1.00 2.71  ? 193 CYS B C     1 
ATOM   2509  O  O     . CYS B 2 193 ? -41.917 11.688  -27.170  1.00 4.43  ? 193 CYS B O     1 
ATOM   2510  C  CB    . CYS B 2 193 ? -40.284 9.492   -27.975  1.00 2.00  ? 193 CYS B CB    1 
ATOM   2511  S  SG    . CYS B 2 193 ? -41.573 8.183   -28.503  1.00 8.50  ? 193 CYS B SG    1 
ATOM   2512  N  N     . LEU B 2 194 ? -42.760 10.248  -25.785  1.00 2.00  ? 194 LEU B N     1 
ATOM   2513  C  CA    . LEU B 2 194 ? -44.007 10.955  -25.904  1.00 2.00  ? 194 LEU B CA    1 
ATOM   2514  C  C     . LEU B 2 194 ? -43.966 12.210  -25.017  1.00 4.73  ? 194 LEU B C     1 
ATOM   2515  O  O     . LEU B 2 194 ? -43.541 12.109  -23.860  1.00 3.27  ? 194 LEU B O     1 
ATOM   2516  C  CB    . LEU B 2 194 ? -45.113 10.025  -25.410  1.00 2.00  ? 194 LEU B CB    1 
ATOM   2517  C  CG    . LEU B 2 194 ? -45.461 8.884   -26.354  1.00 2.10  ? 194 LEU B CG    1 
ATOM   2518  C  CD1   . LEU B 2 194 ? -46.530 8.068   -25.796  1.00 3.32  ? 194 LEU B CD1   1 
ATOM   2519  C  CD2   . LEU B 2 194 ? -45.676 9.210   -27.815  1.00 2.00  ? 194 LEU B CD2   1 
ATOM   2520  N  N     . ALA B 2 195 ? -44.415 13.384  -25.498  1.00 6.38  ? 195 ALA B N     1 
ATOM   2521  C  CA    . ALA B 2 195 ? -44.649 14.521  -24.573  1.00 6.86  ? 195 ALA B CA    1 
ATOM   2522  C  C     . ALA B 2 195 ? -45.972 14.334  -23.786  1.00 12.69 ? 195 ALA B C     1 
ATOM   2523  O  O     . ALA B 2 195 ? -46.088 14.642  -22.625  1.00 3.48  ? 195 ALA B O     1 
ATOM   2524  C  CB    . ALA B 2 195 ? -44.680 15.784  -25.291  1.00 2.00  ? 195 ALA B CB    1 
ATOM   2525  N  N     . SER B 2 196 ? -47.002 13.820  -24.402  1.00 4.24  ? 196 SER B N     1 
ATOM   2526  C  CA    . SER B 2 196 ? -48.264 14.024  -23.729  1.00 15.24 ? 196 SER B CA    1 
ATOM   2527  C  C     . SER B 2 196 ? -48.244 13.027  -22.587  1.00 7.98  ? 196 SER B C     1 
ATOM   2528  O  O     . SER B 2 196 ? -47.356 12.168  -22.523  1.00 26.47 ? 196 SER B O     1 
ATOM   2529  C  CB    . SER B 2 196 ? -49.445 13.734  -24.685  1.00 3.07  ? 196 SER B CB    1 
ATOM   2530  O  OG    . SER B 2 196 ? -49.181 12.508  -25.395  1.00 44.73 ? 196 SER B OG    1 
ATOM   2531  N  N     . GLU B 2 197 ? -49.246 13.087  -21.717  1.00 7.95  ? 197 GLU B N     1 
ATOM   2532  C  CA    . GLU B 2 197 ? -49.221 12.371  -20.458  1.00 2.00  ? 197 GLU B CA    1 
ATOM   2533  C  C     . GLU B 2 197 ? -50.330 11.352  -20.412  1.00 9.07  ? 197 GLU B C     1 
ATOM   2534  O  O     . GLU B 2 197 ? -51.516 11.689  -20.493  1.00 17.12 ? 197 GLU B O     1 
ATOM   2535  C  CB    . GLU B 2 197 ? -49.446 13.292  -19.278  1.00 2.00  ? 197 GLU B CB    1 
ATOM   2536  C  CG    . GLU B 2 197 ? -49.771 12.524  -18.008  1.00 5.59  ? 197 GLU B CG    1 
ATOM   2537  C  CD    . GLU B 2 197 ? -50.496 13.398  -17.014  1.00 9.02  ? 197 GLU B CD    1 
ATOM   2538  O  OE1   . GLU B 2 197 ? -50.769 14.543  -17.372  1.00 18.20 ? 197 GLU B OE1   1 
ATOM   2539  O  OE2   . GLU B 2 197 ? -50.777 12.989  -15.876  1.00 8.74  ? 197 GLU B OE2   1 
ATOM   2540  N  N     . VAL B 2 198 ? -49.935 10.125  -20.168  1.00 2.00  ? 198 VAL B N     1 
ATOM   2541  C  CA    . VAL B 2 198 ? -50.815 9.027   -20.208  1.00 2.00  ? 198 VAL B CA    1 
ATOM   2542  C  C     . VAL B 2 198 ? -51.731 9.078   -19.015  1.00 5.08  ? 198 VAL B C     1 
ATOM   2543  O  O     . VAL B 2 198 ? -51.421 9.729   -18.018  1.00 4.36  ? 198 VAL B O     1 
ATOM   2544  C  CB    . VAL B 2 198 ? -49.926 7.791   -20.197  1.00 5.41  ? 198 VAL B CB    1 
ATOM   2545  C  CG1   . VAL B 2 198 ? -50.531 6.671   -19.506  1.00 9.48  ? 198 VAL B CG1   1 
ATOM   2546  C  CG2   . VAL B 2 198 ? -49.507 7.458   -21.639  1.00 2.00  ? 198 VAL B CG2   1 
ATOM   2547  N  N     . SER B 2 199 ? -52.872 8.406   -19.085  1.00 5.43  ? 199 SER B N     1 
ATOM   2548  C  CA    . SER B 2 199 ? -53.645 8.308   -17.888  1.00 2.94  ? 199 SER B CA    1 
ATOM   2549  C  C     . SER B 2 199 ? -52.922 7.464   -16.842  1.00 6.43  ? 199 SER B C     1 
ATOM   2550  O  O     . SER B 2 199 ? -52.427 6.353   -17.082  1.00 3.26  ? 199 SER B O     1 
ATOM   2551  C  CB    . SER B 2 199 ? -55.007 7.749   -18.141  1.00 2.00  ? 199 SER B CB    1 
ATOM   2552  O  OG    . SER B 2 199 ? -55.515 7.291   -16.891  1.00 5.44  ? 199 SER B OG    1 
ATOM   2553  N  N     . PHE B 2 200 ? -52.852 7.967   -15.643  1.00 2.00  ? 200 PHE B N     1 
ATOM   2554  C  CA    . PHE B 2 200 ? -51.964 7.281   -14.769  1.00 2.44  ? 200 PHE B CA    1 
ATOM   2555  C  C     . PHE B 2 200 ? -52.634 6.041   -14.085  1.00 11.77 ? 200 PHE B C     1 
ATOM   2556  O  O     . PHE B 2 200 ? -52.047 4.938   -14.006  1.00 2.00  ? 200 PHE B O     1 
ATOM   2557  C  CB    . PHE B 2 200 ? -51.416 8.256   -13.723  1.00 5.51  ? 200 PHE B CB    1 
ATOM   2558  C  CG    . PHE B 2 200 ? -50.646 7.565   -12.708  1.00 5.43  ? 200 PHE B CG    1 
ATOM   2559  C  CD1   . PHE B 2 200 ? -49.326 7.256   -12.938  1.00 2.00  ? 200 PHE B CD1   1 
ATOM   2560  C  CD2   . PHE B 2 200 ? -51.279 7.108   -11.553  1.00 2.94  ? 200 PHE B CD2   1 
ATOM   2561  C  CE1   . PHE B 2 200 ? -48.612 6.547   -12.001  1.00 6.88  ? 200 PHE B CE1   1 
ATOM   2562  C  CE2   . PHE B 2 200 ? -50.557 6.370   -10.571  1.00 6.44  ? 200 PHE B CE2   1 
ATOM   2563  C  CZ    . PHE B 2 200 ? -49.239 6.069   -10.814  1.00 2.00  ? 200 PHE B CZ    1 
ATOM   2564  N  N     . SER B 2 201 ? -53.865 6.186   -13.582  1.00 2.00  ? 201 SER B N     1 
ATOM   2565  C  CA    . SER B 2 201 ? -54.555 4.978   -13.130  1.00 3.66  ? 201 SER B CA    1 
ATOM   2566  C  C     . SER B 2 201 ? -54.632 3.911   -14.269  1.00 8.01  ? 201 SER B C     1 
ATOM   2567  O  O     . SER B 2 201 ? -54.479 2.723   -14.031  1.00 13.03 ? 201 SER B O     1 
ATOM   2568  C  CB    . SER B 2 201 ? -55.931 5.289   -12.554  1.00 3.96  ? 201 SER B CB    1 
ATOM   2569  O  OG    . SER B 2 201 ? -56.627 6.001   -13.555  1.00 17.94 ? 201 SER B OG    1 
ATOM   2570  N  N     . ALA B 2 202 ? -54.821 4.322   -15.516  1.00 9.43  ? 202 ALA B N     1 
ATOM   2571  C  CA    . ALA B 2 202 ? -54.817 3.346   -16.566  1.00 2.00  ? 202 ALA B CA    1 
ATOM   2572  C  C     . ALA B 2 202 ? -53.449 2.710   -16.584  1.00 2.00  ? 202 ALA B C     1 
ATOM   2573  O  O     . ALA B 2 202 ? -53.321 1.487   -16.717  1.00 9.20  ? 202 ALA B O     1 
ATOM   2574  C  CB    . ALA B 2 202 ? -55.189 3.962   -17.911  1.00 2.00  ? 202 ALA B CB    1 
ATOM   2575  N  N     . LEU B 2 203 ? -52.401 3.512   -16.467  1.00 4.72  ? 203 LEU B N     1 
ATOM   2576  C  CA    . LEU B 2 203 ? -51.040 2.929   -16.522  1.00 2.65  ? 203 LEU B CA    1 
ATOM   2577  C  C     . LEU B 2 203 ? -50.794 1.936   -15.375  1.00 9.28  ? 203 LEU B C     1 
ATOM   2578  O  O     . LEU B 2 203 ? -50.211 0.904   -15.599  1.00 5.81  ? 203 LEU B O     1 
ATOM   2579  C  CB    . LEU B 2 203 ? -49.999 4.007   -16.460  1.00 2.00  ? 203 LEU B CB    1 
ATOM   2580  C  CG    . LEU B 2 203 ? -48.517 3.676   -16.428  1.00 2.00  ? 203 LEU B CG    1 
ATOM   2581  C  CD1   . LEU B 2 203 ? -48.094 3.048   -17.720  1.00 2.00  ? 203 LEU B CD1   1 
ATOM   2582  C  CD2   . LEU B 2 203 ? -47.694 4.945   -16.166  1.00 2.00  ? 203 LEU B CD2   1 
ATOM   2583  N  N     . GLU B 2 204 ? -51.280 2.228   -14.176  1.00 2.00  ? 204 GLU B N     1 
ATOM   2584  C  CA    . GLU B 2 204 ? -51.099 1.345   -13.050  1.00 5.68  ? 204 GLU B CA    1 
ATOM   2585  C  C     . GLU B 2 204 ? -51.878 0.019   -13.149  1.00 14.67 ? 204 GLU B C     1 
ATOM   2586  O  O     . GLU B 2 204 ? -51.353 -1.046  -12.805  1.00 15.78 ? 204 GLU B O     1 
ATOM   2587  C  CB    . GLU B 2 204 ? -51.512 2.066   -11.762  1.00 2.00  ? 204 GLU B CB    1 
ATOM   2588  C  CG    . GLU B 2 204 ? -51.758 1.135   -10.606  1.00 9.30  ? 204 GLU B CG    1 
ATOM   2589  C  CD    . GLU B 2 204 ? -51.769 1.863   -9.233   1.00 34.25 ? 204 GLU B CD    1 
ATOM   2590  O  OE1   . GLU B 2 204 ? -51.770 3.139   -9.195   1.00 19.01 ? 204 GLU B OE1   1 
ATOM   2591  O  OE2   . GLU B 2 204 ? -51.786 1.151   -8.184   1.00 36.03 ? 204 GLU B OE2   1 
ATOM   2592  N  N     . ARG B 2 205 ? -53.140 0.094   -13.580  1.00 14.69 ? 205 ARG B N     1 
ATOM   2593  C  CA    . ARG B 2 205 ? -53.968 -1.074  -13.978  1.00 4.85  ? 205 ARG B CA    1 
ATOM   2594  C  C     . ARG B 2 205 ? -53.311 -1.936  -15.059  1.00 8.02  ? 205 ARG B C     1 
ATOM   2595  O  O     . ARG B 2 205 ? -53.191 -3.154  -14.965  1.00 5.53  ? 205 ARG B O     1 
ATOM   2596  C  CB    . ARG B 2 205 ? -55.377 -0.613  -14.400  1.00 2.19  ? 205 ARG B CB    1 
ATOM   2597  C  CG    . ARG B 2 205 ? -56.244 -0.102  -13.197  1.00 2.74  ? 205 ARG B CG    1 
ATOM   2598  C  CD    . ARG B 2 205 ? -57.768 0.032   -13.535  1.00 13.39 ? 205 ARG B CD    1 
ATOM   2599  N  NE    . ARG B 2 205 ? -57.972 1.341   -14.133  1.00 35.95 ? 205 ARG B NE    1 
ATOM   2600  C  CZ    . ARG B 2 205 ? -57.985 1.620   -15.443  1.00 53.02 ? 205 ARG B CZ    1 
ATOM   2601  N  NH1   . ARG B 2 205 ? -57.891 0.656   -16.426  1.00 9.41  ? 205 ARG B NH1   1 
ATOM   2602  N  NH2   . ARG B 2 205 ? -58.120 2.917   -15.760  1.00 15.47 ? 205 ARG B NH2   1 
ATOM   2603  N  N     . LEU B 2 206 ? -52.831 -1.278  -16.082  1.00 8.51  ? 206 LEU B N     1 
ATOM   2604  C  CA    . LEU B 2 206 ? -52.113 -1.976  -17.122  1.00 4.55  ? 206 LEU B CA    1 
ATOM   2605  C  C     . LEU B 2 206 ? -50.895 -2.794  -16.522  1.00 7.53  ? 206 LEU B C     1 
ATOM   2606  O  O     . LEU B 2 206 ? -50.839 -4.045  -16.613  1.00 16.62 ? 206 LEU B O     1 
ATOM   2607  C  CB    . LEU B 2 206 ? -51.709 -0.932  -18.153  1.00 2.00  ? 206 LEU B CB    1 
ATOM   2608  C  CG    . LEU B 2 206 ? -51.370 -1.473  -19.529  1.00 2.52  ? 206 LEU B CG    1 
ATOM   2609  C  CD1   . LEU B 2 206 ? -50.126 -1.030  -20.111  1.00 2.00  ? 206 LEU B CD1   1 
ATOM   2610  C  CD2   . LEU B 2 206 ? -51.528 -2.917  -19.701  1.00 2.00  ? 206 LEU B CD2   1 
ATOM   2611  N  N     . VAL B 2 207 ? -49.927 -2.094  -15.914  1.00 17.41 ? 207 VAL B N     1 
ATOM   2612  C  CA    . VAL B 2 207 ? -48.700 -2.699  -15.361  1.00 2.11  ? 207 VAL B CA    1 
ATOM   2613  C  C     . VAL B 2 207 ? -49.141 -3.729  -14.345  1.00 7.68  ? 207 VAL B C     1 
ATOM   2614  O  O     . VAL B 2 207 ? -48.528 -4.768  -14.205  1.00 7.97  ? 207 VAL B O     1 
ATOM   2615  C  CB    . VAL B 2 207 ? -47.828 -1.644  -14.628  1.00 10.60 ? 207 VAL B CB    1 
ATOM   2616  C  CG1   . VAL B 2 207 ? -46.926 -2.307  -13.625  1.00 4.85  ? 207 VAL B CG1   1 
ATOM   2617  C  CG2   . VAL B 2 207 ? -46.998 -0.789  -15.635  1.00 3.30  ? 207 VAL B CG2   1 
ATOM   2618  N  N     . THR B 2 208 ? -50.230 -3.462  -13.639  1.00 4.68  ? 208 THR B N     1 
ATOM   2619  C  CA    . THR B 2 208 ? -50.539 -4.336  -12.560  1.00 2.25  ? 208 THR B CA    1 
ATOM   2620  C  C     . THR B 2 208 ? -50.965 -5.688  -13.110  1.00 13.39 ? 208 THR B C     1 
ATOM   2621  O  O     . THR B 2 208 ? -50.669 -6.707  -12.508  1.00 8.00  ? 208 THR B O     1 
ATOM   2622  C  CB    . THR B 2 208 ? -51.697 -3.812  -11.702  1.00 9.41  ? 208 THR B CB    1 
ATOM   2623  O  OG1   . THR B 2 208 ? -51.173 -2.867  -10.774  1.00 8.23  ? 208 THR B OG1   1 
ATOM   2624  C  CG2   . THR B 2 208 ? -52.385 -5.012  -10.900  1.00 2.00  ? 208 THR B CG2   1 
ATOM   2625  N  N     . ARG B 2 209 ? -51.695 -5.696  -14.229  1.00 12.08 ? 209 ARG B N     1 
ATOM   2626  C  CA    . ARG B 2 209 ? -52.287 -6.941  -14.723  1.00 7.53  ? 209 ARG B CA    1 
ATOM   2627  C  C     . ARG B 2 209 ? -51.446 -7.588  -15.861  1.00 4.71  ? 209 ARG B C     1 
ATOM   2628  O  O     . ARG B 2 209 ? -51.904 -8.461  -16.505  1.00 3.51  ? 209 ARG B O     1 
ATOM   2629  C  CB    . ARG B 2 209 ? -53.752 -6.715  -15.125  1.00 2.00  ? 209 ARG B CB    1 
ATOM   2630  C  CG    . ARG B 2 209 ? -53.921 -6.147  -16.545  1.00 2.59  ? 209 ARG B CG    1 
ATOM   2631  C  CD    . ARG B 2 209 ? -55.276 -5.412  -16.694  1.00 2.72  ? 209 ARG B CD    1 
ATOM   2632  N  NE    . ARG B 2 209 ? -55.390 -4.917  -18.086  1.00 2.62  ? 209 ARG B NE    1 
ATOM   2633  C  CZ    . ARG B 2 209 ? -55.457 -3.610  -18.389  1.00 23.35 ? 209 ARG B CZ    1 
ATOM   2634  N  NH1   . ARG B 2 209 ? -55.470 -2.673  -17.421  1.00 8.36  ? 209 ARG B NH1   1 
ATOM   2635  N  NH2   . ARG B 2 209 ? -55.471 -3.213  -19.641  1.00 2.00  ? 209 ARG B NH2   1 
ATOM   2636  N  N     . CYS B 2 210 ? -50.216 -7.157  -16.102  1.00 2.00  ? 210 CYS B N     1 
ATOM   2637  C  CA    . CYS B 2 210 ? -49.371 -7.869  -17.051  1.00 9.39  ? 210 CYS B CA    1 
ATOM   2638  C  C     . CYS B 2 210 ? -48.148 -8.427  -16.383  1.00 12.29 ? 210 CYS B C     1 
ATOM   2639  O  O     . CYS B 2 210 ? -47.083 -7.808  -16.415  1.00 10.72 ? 210 CYS B O     1 
ATOM   2640  C  CB    . CYS B 2 210 ? -48.887 -6.998  -18.211  1.00 7.75  ? 210 CYS B CB    1 
ATOM   2641  S  SG    . CYS B 2 210 ? -50.192 -5.928  -19.047  1.00 6.27  ? 210 CYS B SG    1 
ATOM   2642  N  N     . PRO B 2 211 ? -48.297 -9.626  -15.817  1.00 10.50 ? 211 PRO B N     1 
ATOM   2643  C  CA    . PRO B 2 211 ? -47.305 -10.266 -14.925  1.00 7.30  ? 211 PRO B CA    1 
ATOM   2644  C  C     . PRO B 2 211 ? -46.034 -10.596 -15.699  1.00 3.22  ? 211 PRO B C     1 
ATOM   2645  O  O     . PRO B 2 211 ? -45.030 -10.867 -15.074  1.00 11.93 ? 211 PRO B O     1 
ATOM   2646  C  CB    . PRO B 2 211 ? -47.977 -11.566 -14.493  1.00 3.13  ? 211 PRO B CB    1 
ATOM   2647  C  CG    . PRO B 2 211 ? -48.994 -11.905 -15.705  1.00 6.65  ? 211 PRO B CG    1 
ATOM   2648  C  CD    . PRO B 2 211 ? -49.487 -10.465 -16.094  1.00 9.32  ? 211 PRO B CD    1 
ATOM   2649  N  N     . ASN B 2 212 ? -46.063 -10.511 -17.028  1.00 2.00  ? 212 ASN B N     1 
ATOM   2650  C  CA    . ASN B 2 212 ? -44.848 -10.683 -17.837  1.00 3.82  ? 212 ASN B CA    1 
ATOM   2651  C  C     . ASN B 2 212 ? -44.092 -9.454  -18.264  1.00 10.08 ? 212 ASN B C     1 
ATOM   2652  O  O     . ASN B 2 212 ? -43.142 -9.570  -19.060  1.00 3.75  ? 212 ASN B O     1 
ATOM   2653  C  CB    . ASN B 2 212 ? -45.121 -11.486 -19.102  1.00 2.00  ? 212 ASN B CB    1 
ATOM   2654  C  CG    . ASN B 2 212 ? -45.598 -12.907 -18.758  1.00 23.26 ? 212 ASN B CG    1 
ATOM   2655  O  OD1   . ASN B 2 212 ? -45.020 -13.541 -17.892  1.00 6.21  ? 212 ASN B OD1   1 
ATOM   2656  N  ND2   . ASN B 2 212 ? -46.689 -13.361 -19.360  1.00 2.00  ? 212 ASN B ND2   1 
ATOM   2657  N  N     . LEU B 2 213 ? -44.552 -8.292  -17.796  1.00 10.01 ? 213 LEU B N     1 
ATOM   2658  C  CA    . LEU B 2 213 ? -43.869 -7.026  -18.027  1.00 7.59  ? 213 LEU B CA    1 
ATOM   2659  C  C     . LEU B 2 213 ? -42.430 -7.116  -17.534  1.00 2.00  ? 213 LEU B C     1 
ATOM   2660  O  O     . LEU B 2 213 ? -42.185 -7.520  -16.413  1.00 2.00  ? 213 LEU B O     1 
ATOM   2661  C  CB    . LEU B 2 213 ? -44.622 -5.944  -17.302  1.00 2.00  ? 213 LEU B CB    1 
ATOM   2662  C  CG    . LEU B 2 213 ? -44.094 -4.614  -17.764  1.00 9.47  ? 213 LEU B CG    1 
ATOM   2663  C  CD1   . LEU B 2 213 ? -44.165 -4.465  -19.356  1.00 8.25  ? 213 LEU B CD1   1 
ATOM   2664  C  CD2   . LEU B 2 213 ? -44.980 -3.680  -17.055  1.00 2.97  ? 213 LEU B CD2   1 
ATOM   2665  N  N     . LYS B 2 214 ? -41.500 -6.820  -18.427  1.00 2.00  ? 214 LYS B N     1 
ATOM   2666  C  CA    . LYS B 2 214 ? -40.065 -7.005  -18.171  1.00 3.75  ? 214 LYS B CA    1 
ATOM   2667  C  C     . LYS B 2 214 ? -39.277 -5.680  -18.401  1.00 14.33 ? 214 LYS B C     1 
ATOM   2668  O  O     . LYS B 2 214 ? -38.131 -5.462  -17.874  1.00 6.10  ? 214 LYS B O     1 
ATOM   2669  C  CB    . LYS B 2 214 ? -39.460 -8.164  -19.028  1.00 3.63  ? 214 LYS B CB    1 
ATOM   2670  C  CG    . LYS B 2 214 ? -39.900 -9.592  -18.557  1.00 25.97 ? 214 LYS B CG    1 
ATOM   2671  C  CD    . LYS B 2 214 ? -38.848 -10.393 -17.809  1.00 7.55  ? 214 LYS B CD    1 
ATOM   2672  C  CE    . LYS B 2 214 ? -39.307 -10.822 -16.409  1.00 25.77 ? 214 LYS B CE    1 
ATOM   2673  N  NZ    . LYS B 2 214 ? -40.498 -11.689 -16.478  1.00 21.00 ? 214 LYS B NZ    1 
ATOM   2674  N  N     . SER B 2 215 ? -39.880 -4.820  -19.216  1.00 4.22  ? 215 SER B N     1 
ATOM   2675  C  CA    . SER B 2 215 ? -39.221 -3.622  -19.622  1.00 8.38  ? 215 SER B CA    1 
ATOM   2676  C  C     . SER B 2 215 ? -40.198 -2.450  -19.737  1.00 5.89  ? 215 SER B C     1 
ATOM   2677  O  O     . SER B 2 215 ? -41.083 -2.490  -20.598  1.00 9.24  ? 215 SER B O     1 
ATOM   2678  C  CB    . SER B 2 215 ? -38.531 -3.839  -20.921  1.00 2.00  ? 215 SER B CB    1 
ATOM   2679  O  OG    . SER B 2 215 ? -37.975 -2.571  -21.254  1.00 9.30  ? 215 SER B OG    1 
ATOM   2680  N  N     . LEU B 2 216 ? -40.079 -1.466  -18.834  1.00 2.20  ? 216 LEU B N     1 
ATOM   2681  C  CA    . LEU B 2 216 ? -40.975 -0.283  -18.733  1.00 2.00  ? 216 LEU B CA    1 
ATOM   2682  C  C     . LEU B 2 216 ? -40.157 1.054   -18.790  1.00 2.00  ? 216 LEU B C     1 
ATOM   2683  O  O     . LEU B 2 216 ? -39.511 1.429   -17.866  1.00 2.00  ? 216 LEU B O     1 
ATOM   2684  C  CB    . LEU B 2 216 ? -41.824 -0.387  -17.471  1.00 2.00  ? 216 LEU B CB    1 
ATOM   2685  C  CG    . LEU B 2 216 ? -42.870 0.676   -17.176  1.00 2.00  ? 216 LEU B CG    1 
ATOM   2686  C  CD1   . LEU B 2 216 ? -43.863 0.807   -18.320  1.00 2.00  ? 216 LEU B CD1   1 
ATOM   2687  C  CD2   . LEU B 2 216 ? -43.564 0.393   -15.935  1.00 2.00  ? 216 LEU B CD2   1 
ATOM   2688  N  N     . LYS B 2 217 ? -40.209 1.712   -19.933  1.00 2.00  ? 217 LYS B N     1 
ATOM   2689  C  CA    . LYS B 2 217 ? -39.550 2.986   -20.099  1.00 5.48  ? 217 LYS B CA    1 
ATOM   2690  C  C     . LYS B 2 217 ? -40.532 4.123   -20.248  1.00 2.49  ? 217 LYS B C     1 
ATOM   2691  O  O     . LYS B 2 217 ? -41.254 4.202   -21.219  1.00 2.97  ? 217 LYS B O     1 
ATOM   2692  C  CB    . LYS B 2 217 ? -38.587 2.940   -21.266  1.00 2.00  ? 217 LYS B CB    1 
ATOM   2693  C  CG    . LYS B 2 217 ? -37.624 1.810   -21.174  1.00 2.00  ? 217 LYS B CG    1 
ATOM   2694  C  CD    . LYS B 2 217 ? -36.760 1.731   -22.375  1.00 2.00  ? 217 LYS B CD    1 
ATOM   2695  C  CE    . LYS B 2 217 ? -35.625 0.797   -22.143  1.00 3.72  ? 217 LYS B CE    1 
ATOM   2696  N  NZ    . LYS B 2 217 ? -34.697 0.816   -23.261  1.00 2.00  ? 217 LYS B NZ    1 
ATOM   2697  N  N     . LEU B 2 218 ? -40.549 5.004   -19.262  1.00 2.00  ? 218 LEU B N     1 
ATOM   2698  C  CA    . LEU B 2 218 ? -41.577 6.017   -19.152  1.00 2.00  ? 218 LEU B CA    1 
ATOM   2699  C  C     . LEU B 2 218 ? -41.190 7.294   -19.877  1.00 2.92  ? 218 LEU B C     1 
ATOM   2700  O  O     . LEU B 2 218 ? -40.046 7.689   -19.848  1.00 9.26  ? 218 LEU B O     1 
ATOM   2701  C  CB    . LEU B 2 218 ? -41.888 6.265   -17.691  1.00 2.00  ? 218 LEU B CB    1 
ATOM   2702  C  CG    . LEU B 2 218 ? -42.439 5.026   -16.998  1.00 7.20  ? 218 LEU B CG    1 
ATOM   2703  C  CD1   . LEU B 2 218 ? -42.259 5.086   -15.516  1.00 2.00  ? 218 LEU B CD1   1 
ATOM   2704  C  CD2   . LEU B 2 218 ? -43.871 4.801   -17.358  1.00 2.00  ? 218 LEU B CD2   1 
ATOM   2705  N  N     . ASN B 2 219 ? -42.127 7.871   -20.615  1.00 13.39 ? 219 ASN B N     1 
ATOM   2706  C  CA    . ASN B 2 219 ? -42.859 9.076   -20.240  1.00 8.24  ? 219 ASN B CA    1 
ATOM   2707  C  C     . ASN B 2 219 ? -42.251 9.883   -19.133  1.00 12.49 ? 219 ASN B C     1 
ATOM   2708  O  O     . ASN B 2 219 ? -42.064 9.396   -18.032  1.00 6.02  ? 219 ASN B O     1 
ATOM   2709  C  CB    . ASN B 2 219 ? -44.280 8.726   -19.845  1.00 15.44 ? 219 ASN B CB    1 
ATOM   2710  C  CG    . ASN B 2 219 ? -45.276 9.657   -20.420  1.00 5.36  ? 219 ASN B CG    1 
ATOM   2711  O  OD1   . ASN B 2 219 ? -45.131 10.110  -21.535  1.00 6.12  ? 219 ASN B OD1   1 
ATOM   2712  N  ND2   . ASN B 2 219 ? -46.311 9.948   -19.660  1.00 17.15 ? 219 ASN B ND2   1 
ATOM   2713  N  N     . ARG B 2 220 ? -41.981 11.145  -19.385  1.00 7.47  ? 220 ARG B N     1 
ATOM   2714  C  CA    . ARG B 2 220 ? -41.424 11.884  -18.258  1.00 4.56  ? 220 ARG B CA    1 
ATOM   2715  C  C     . ARG B 2 220 ? -42.512 12.725  -17.658  1.00 8.46  ? 220 ARG B C     1 
ATOM   2716  O  O     . ARG B 2 220 ? -42.300 13.410  -16.683  1.00 2.00  ? 220 ARG B O     1 
ATOM   2717  C  CB    . ARG B 2 220 ? -40.789 12.659  -19.390  1.00 9.24  ? 220 ARG B CB    1 
ATOM   2718  C  CG    . ARG B 2 220 ? -39.910 13.762  -18.914  1.00 13.70 ? 220 ARG B CG    1 
ATOM   2719  C  CD    . ARG B 2 220 ? -40.184 15.100  -19.528  1.00 8.77  ? 220 ARG B CD    1 
ATOM   2720  N  NE    . ARG B 2 220 ? -39.539 16.135  -18.746  1.00 9.77  ? 220 ARG B NE    1 
ATOM   2721  C  CZ    . ARG B 2 220 ? -38.447 16.773  -19.107  1.00 24.02 ? 220 ARG B CZ    1 
ATOM   2722  N  NH1   . ARG B 2 220 ? -37.868 16.512  -20.260  1.00 12.08 ? 220 ARG B NH1   1 
ATOM   2723  N  NH2   . ARG B 2 220 ? -37.933 17.688  -18.312  1.00 40.91 ? 220 ARG B NH2   1 
ATOM   2724  N  N     . ALA B 2 221 ? -43.689 12.665  -18.236  1.00 2.00  ? 221 ALA B N     1 
ATOM   2725  C  CA    . ALA B 2 221 ? -44.821 13.207  -17.529  1.00 2.00  ? 221 ALA B CA    1 
ATOM   2726  C  C     . ALA B 2 221 ? -45.356 12.297  -16.441  1.00 2.00  ? 221 ALA B C     1 
ATOM   2727  O  O     . ALA B 2 221 ? -46.384 12.582  -15.856  1.00 6.36  ? 221 ALA B O     1 
ATOM   2728  C  CB    . ALA B 2 221 ? -45.901 13.548  -18.484  1.00 2.01  ? 221 ALA B CB    1 
ATOM   2729  N  N     . VAL B 2 222 ? -44.674 11.197  -16.172  1.00 5.83  ? 222 VAL B N     1 
ATOM   2730  C  CA    . VAL B 2 222 ? -44.968 10.448  -14.949  1.00 2.50  ? 222 VAL B CA    1 
ATOM   2731  C  C     . VAL B 2 222 ? -43.936 10.910  -13.978  1.00 4.68  ? 222 VAL B C     1 
ATOM   2732  O  O     . VAL B 2 222 ? -42.726 10.696  -14.148  1.00 9.01  ? 222 VAL B O     1 
ATOM   2733  C  CB    . VAL B 2 222 ? -44.651 8.996   -15.020  1.00 9.17  ? 222 VAL B CB    1 
ATOM   2734  C  CG1   . VAL B 2 222 ? -44.958 8.374   -13.703  1.00 2.00  ? 222 VAL B CG1   1 
ATOM   2735  C  CG2   . VAL B 2 222 ? -45.299 8.304   -16.190  1.00 2.00  ? 222 VAL B CG2   1 
ATOM   2736  N  N     . PRO B 2 223 ? -44.398 11.625  -13.006  1.00 2.06  ? 223 PRO B N     1 
ATOM   2737  C  CA    . PRO B 2 223 ? -43.477 12.384  -12.176  1.00 9.42  ? 223 PRO B CA    1 
ATOM   2738  C  C     . PRO B 2 223 ? -42.894 11.507  -11.084  1.00 9.13  ? 223 PRO B C     1 
ATOM   2739  O  O     . PRO B 2 223 ? -43.548 10.575  -10.589  1.00 2.00  ? 223 PRO B O     1 
ATOM   2740  C  CB    . PRO B 2 223 ? -44.371 13.445  -11.587  1.00 2.00  ? 223 PRO B CB    1 
ATOM   2741  C  CG    . PRO B 2 223 ? -45.720 12.595  -11.388  1.00 9.92  ? 223 PRO B CG    1 
ATOM   2742  C  CD    . PRO B 2 223 ? -45.819 11.851  -12.689  1.00 2.32  ? 223 PRO B CD    1 
ATOM   2743  N  N     . LEU B 2 224 ? -41.664 11.851  -10.693  1.00 10.80 ? 224 LEU B N     1 
ATOM   2744  C  CA    . LEU B 2 224 ? -40.934 11.115  -9.654   1.00 3.30  ? 224 LEU B CA    1 
ATOM   2745  C  C     . LEU B 2 224 ? -41.796 10.646  -8.519   1.00 3.78  ? 224 LEU B C     1 
ATOM   2746  O  O     . LEU B 2 224 ? -41.597 9.547   -8.044   1.00 7.52  ? 224 LEU B O     1 
ATOM   2747  C  CB    . LEU B 2 224 ? -39.822 11.955  -9.056   1.00 13.12 ? 224 LEU B CB    1 
ATOM   2748  C  CG    . LEU B 2 224 ? -38.938 11.049  -8.221   1.00 12.82 ? 224 LEU B CG    1 
ATOM   2749  C  CD1   . LEU B 2 224 ? -38.648 9.862   -9.055   1.00 2.00  ? 224 LEU B CD1   1 
ATOM   2750  C  CD2   . LEU B 2 224 ? -37.708 11.811  -7.852   1.00 9.03  ? 224 LEU B CD2   1 
ATOM   2751  N  N     . GLU B 2 225 ? -42.726 11.450  -8.045   1.00 2.00  ? 225 GLU B N     1 
ATOM   2752  C  CA    . GLU B 2 225 ? -43.466 10.998  -6.909   1.00 3.34  ? 225 GLU B CA    1 
ATOM   2753  C  C     . GLU B 2 225 ? -44.325 9.820   -7.194   1.00 4.87  ? 225 GLU B C     1 
ATOM   2754  O  O     . GLU B 2 225 ? -44.859 9.211   -6.269   1.00 8.22  ? 225 GLU B O     1 
ATOM   2755  C  CB    . GLU B 2 225 ? -44.419 12.051  -6.420   1.00 2.00  ? 225 GLU B CB    1 
ATOM   2756  C  CG    . GLU B 2 225 ? -43.662 12.975  -5.659   1.00 16.52 ? 225 GLU B CG    1 
ATOM   2757  C  CD    . GLU B 2 225 ? -43.584 14.273  -6.387   1.00 52.05 ? 225 GLU B CD    1 
ATOM   2758  O  OE1   . GLU B 2 225 ? -44.070 15.192  -5.656   1.00 10.24 ? 225 GLU B OE1   1 
ATOM   2759  O  OE2   . GLU B 2 225 ? -43.094 14.335  -7.620   1.00 12.88 ? 225 GLU B OE2   1 
ATOM   2760  N  N     . LYS B 2 226 ? -44.551 9.536   -8.459   1.00 6.66  ? 226 LYS B N     1 
ATOM   2761  C  CA    . LYS B 2 226 ? -45.413 8.395   -8.738   1.00 18.22 ? 226 LYS B CA    1 
ATOM   2762  C  C     . LYS B 2 226 ? -44.656 7.066   -8.971   1.00 5.82  ? 226 LYS B C     1 
ATOM   2763  O  O     . LYS B 2 226 ? -45.251 6.030   -8.893   1.00 7.00  ? 226 LYS B O     1 
ATOM   2764  C  CB    . LYS B 2 226 ? -46.517 8.717   -9.780   1.00 9.49  ? 226 LYS B CB    1 
ATOM   2765  C  CG    . LYS B 2 226 ? -47.340 10.007  -9.411   1.00 8.87  ? 226 LYS B CG    1 
ATOM   2766  C  CD    . LYS B 2 226 ? -48.441 9.772   -8.367   1.00 15.48 ? 226 LYS B CD    1 
ATOM   2767  C  CE    . LYS B 2 226 ? -49.572 10.839  -8.436   1.00 41.72 ? 226 LYS B CE    1 
ATOM   2768  N  NZ    . LYS B 2 226 ? -50.439 10.758  -9.677   1.00 57.16 ? 226 LYS B NZ    1 
ATOM   2769  N  N     . LEU B 2 227 ? -43.345 7.099   -9.223   1.00 7.39  ? 227 LEU B N     1 
ATOM   2770  C  CA    . LEU B 2 227 ? -42.610 5.876   -9.647   1.00 7.56  ? 227 LEU B CA    1 
ATOM   2771  C  C     . LEU B 2 227 ? -42.805 4.710   -8.662   1.00 8.28  ? 227 LEU B C     1 
ATOM   2772  O  O     . LEU B 2 227 ? -43.148 3.624   -9.046   1.00 9.92  ? 227 LEU B O     1 
ATOM   2773  C  CB    . LEU B 2 227 ? -41.148 6.169   -9.658   1.00 2.00  ? 227 LEU B CB    1 
ATOM   2774  C  CG    . LEU B 2 227 ? -40.253 5.968   -10.825  1.00 8.27  ? 227 LEU B CG    1 
ATOM   2775  C  CD1   . LEU B 2 227 ? -38.838 5.635   -10.389  1.00 2.00  ? 227 LEU B CD1   1 
ATOM   2776  C  CD2   . LEU B 2 227 ? -40.745 4.980   -11.856  1.00 2.39  ? 227 LEU B CD2   1 
ATOM   2777  N  N     . ALA B 2 228 ? -42.555 4.932   -7.386   1.00 2.00  ? 228 ALA B N     1 
ATOM   2778  C  CA    . ALA B 2 228 ? -42.814 3.901   -6.408   1.00 6.23  ? 228 ALA B CA    1 
ATOM   2779  C  C     . ALA B 2 228 ? -44.137 3.156   -6.546   1.00 8.46  ? 228 ALA B C     1 
ATOM   2780  O  O     . ALA B 2 228 ? -44.130 1.949   -6.437   1.00 2.57  ? 228 ALA B O     1 
ATOM   2781  C  CB    . ALA B 2 228 ? -42.613 4.404   -4.972   1.00 2.00  ? 228 ALA B CB    1 
ATOM   2782  N  N     . THR B 2 229 ? -45.266 3.825   -6.781   1.00 2.00  ? 229 THR B N     1 
ATOM   2783  C  CA    . THR B 2 229 ? -46.471 3.043   -7.027   1.00 6.50  ? 229 THR B CA    1 
ATOM   2784  C  C     . THR B 2 229 ? -46.289 2.017   -8.181   1.00 6.76  ? 229 THR B C     1 
ATOM   2785  O  O     . THR B 2 229 ? -46.512 0.835   -8.034   1.00 17.30 ? 229 THR B O     1 
ATOM   2786  C  CB    . THR B 2 229 ? -47.620 3.931   -7.430   1.00 10.38 ? 229 THR B CB    1 
ATOM   2787  O  OG1   . THR B 2 229 ? -47.959 4.794   -6.335   1.00 10.47 ? 229 THR B OG1   1 
ATOM   2788  C  CG2   . THR B 2 229 ? -48.833 3.030   -7.766   1.00 23.84 ? 229 THR B CG2   1 
ATOM   2789  N  N     . LEU B 2 230 ? -45.843 2.488   -9.329   1.00 4.01  ? 230 LEU B N     1 
ATOM   2790  C  CA    . LEU B 2 230 ? -45.525 1.611   -10.399  1.00 6.36  ? 230 LEU B CA    1 
ATOM   2791  C  C     . LEU B 2 230 ? -44.620 0.466   -10.005  1.00 14.72 ? 230 LEU B C     1 
ATOM   2792  O  O     . LEU B 2 230 ? -44.796 -0.655  -10.524  1.00 7.40  ? 230 LEU B O     1 
ATOM   2793  C  CB    . LEU B 2 230 ? -44.896 2.340   -11.571  1.00 2.00  ? 230 LEU B CB    1 
ATOM   2794  C  CG    . LEU B 2 230 ? -45.800 3.344   -12.206  1.00 2.93  ? 230 LEU B CG    1 
ATOM   2795  C  CD1   . LEU B 2 230 ? -45.238 4.022   -13.422  1.00 2.00  ? 230 LEU B CD1   1 
ATOM   2796  C  CD2   . LEU B 2 230 ? -47.224 2.850   -12.376  1.00 2.00  ? 230 LEU B CD2   1 
ATOM   2797  N  N     . LEU B 2 231 ? -43.609 0.727   -9.182   1.00 10.21 ? 231 LEU B N     1 
ATOM   2798  C  CA    . LEU B 2 231 ? -42.562 -0.261  -9.121   1.00 7.35  ? 231 LEU B CA    1 
ATOM   2799  C  C     . LEU B 2 231 ? -43.045 -1.321  -8.179   1.00 5.43  ? 231 LEU B C     1 
ATOM   2800  O  O     . LEU B 2 231 ? -42.836 -2.482  -8.412   1.00 9.49  ? 231 LEU B O     1 
ATOM   2801  C  CB    . LEU B 2 231 ? -41.295 0.314   -8.646   1.00 4.65  ? 231 LEU B CB    1 
ATOM   2802  C  CG    . LEU B 2 231 ? -40.765 1.298   -9.702   1.00 2.00  ? 231 LEU B CG    1 
ATOM   2803  C  CD1   . LEU B 2 231 ? -39.523 1.837   -9.104   1.00 2.00  ? 231 LEU B CD1   1 
ATOM   2804  C  CD2   . LEU B 2 231 ? -40.292 0.590   -10.989  1.00 2.71  ? 231 LEU B CD2   1 
ATOM   2805  N  N     . GLN B 2 232 ? -43.807 -0.939  -7.170   1.00 2.06  ? 232 GLN B N     1 
ATOM   2806  C  CA    . GLN B 2 232 ? -44.445 -1.916  -6.287   1.00 2.00  ? 232 GLN B CA    1 
ATOM   2807  C  C     . GLN B 2 232 ? -45.369 -2.884  -7.153   1.00 13.62 ? 232 GLN B C     1 
ATOM   2808  O  O     . GLN B 2 232 ? -45.511 -4.060  -6.859   1.00 6.18  ? 232 GLN B O     1 
ATOM   2809  C  CB    . GLN B 2 232 ? -45.298 -1.146  -5.216   1.00 4.77  ? 232 GLN B CB    1 
ATOM   2810  C  CG    . GLN B 2 232 ? -44.506 -0.375  -4.045   1.00 2.00  ? 232 GLN B CG    1 
ATOM   2811  C  CD    . GLN B 2 232 ? -43.676 -1.355  -3.136   1.00 56.31 ? 232 GLN B CD    1 
ATOM   2812  O  OE1   . GLN B 2 232 ? -42.962 -0.936  -2.197   1.00 14.79 ? 232 GLN B OE1   1 
ATOM   2813  N  NE2   . GLN B 2 232 ? -43.763 -2.667  -3.440   1.00 55.95 ? 232 GLN B NE2   1 
ATOM   2814  N  N     . ARG B 2 233 ? -46.031 -2.377  -8.197   1.00 6.52  ? 233 ARG B N     1 
ATOM   2815  C  CA    . ARG B 2 233 ? -46.775 -3.255  -9.108   1.00 2.28  ? 233 ARG B CA    1 
ATOM   2816  C  C     . ARG B 2 233 ? -45.879 -4.139  -10.029  1.00 12.20 ? 233 ARG B C     1 
ATOM   2817  O  O     . ARG B 2 233 ? -46.379 -5.063  -10.589  1.00 18.47 ? 233 ARG B O     1 
ATOM   2818  C  CB    . ARG B 2 233 ? -47.647 -2.395  -9.998   1.00 2.81  ? 233 ARG B CB    1 
ATOM   2819  C  CG    . ARG B 2 233 ? -48.580 -1.535  -9.263   1.00 2.00  ? 233 ARG B CG    1 
ATOM   2820  C  CD    . ARG B 2 233 ? -49.247 -2.345  -8.277   1.00 2.00  ? 233 ARG B CD    1 
ATOM   2821  N  NE    . ARG B 2 233 ? -50.365 -1.564  -7.812   1.00 24.16 ? 233 ARG B NE    1 
ATOM   2822  C  CZ    . ARG B 2 233 ? -51.521 -2.073  -7.391   1.00 40.02 ? 233 ARG B CZ    1 
ATOM   2823  N  NH1   . ARG B 2 233 ? -51.740 -3.397  -7.352   1.00 31.31 ? 233 ARG B NH1   1 
ATOM   2824  N  NH2   . ARG B 2 233 ? -52.465 -1.243  -6.995   1.00 38.88 ? 233 ARG B NH2   1 
ATOM   2825  N  N     . ALA B 2 234 ? -44.585 -3.870  -10.237  1.00 4.66  ? 234 ALA B N     1 
ATOM   2826  C  CA    . ALA B 2 234 ? -43.824 -4.662  -11.208  1.00 2.00  ? 234 ALA B CA    1 
ATOM   2827  C  C     . ALA B 2 234 ? -42.454 -5.043  -10.644  1.00 2.00  ? 234 ALA B C     1 
ATOM   2828  O  O     . ALA B 2 234 ? -41.380 -4.791  -11.202  1.00 2.87  ? 234 ALA B O     1 
ATOM   2829  C  CB    . ALA B 2 234 ? -43.671 -3.915  -12.467  1.00 2.00  ? 234 ALA B CB    1 
ATOM   2830  N  N     . PRO B 2 235 ? -42.481 -5.715  -9.532   1.00 2.50  ? 235 PRO B N     1 
ATOM   2831  C  CA    . PRO B 2 235 ? -41.209 -6.069  -8.991   1.00 2.00  ? 235 PRO B CA    1 
ATOM   2832  C  C     . PRO B 2 235 ? -40.299 -6.918  -9.897   1.00 9.64  ? 235 PRO B C     1 
ATOM   2833  O  O     . PRO B 2 235 ? -39.100 -7.068  -9.545   1.00 2.19  ? 235 PRO B O     1 
ATOM   2834  C  CB    . PRO B 2 235 ? -41.567 -6.801  -7.720   1.00 2.00  ? 235 PRO B CB    1 
ATOM   2835  C  CG    . PRO B 2 235 ? -42.993 -7.192  -7.884   1.00 2.00  ? 235 PRO B CG    1 
ATOM   2836  C  CD    . PRO B 2 235 ? -43.626 -6.170  -8.723   1.00 2.00  ? 235 PRO B CD    1 
ATOM   2837  N  N     . GLN B 2 236 ? -40.812 -7.464  -11.015  1.00 2.00  ? 236 GLN B N     1 
ATOM   2838  C  CA    . GLN B 2 236 ? -40.043 -8.445  -11.813  1.00 2.00  ? 236 GLN B CA    1 
ATOM   2839  C  C     . GLN B 2 236 ? -39.271 -7.731  -12.909  1.00 2.00  ? 236 GLN B C     1 
ATOM   2840  O  O     . GLN B 2 236 ? -38.582 -8.359  -13.743  1.00 9.93  ? 236 GLN B O     1 
ATOM   2841  C  CB    . GLN B 2 236 ? -40.940 -9.512  -12.475  1.00 2.00  ? 236 GLN B CB    1 
ATOM   2842  C  CG    . GLN B 2 236 ? -41.840 -8.989  -13.600  1.00 2.00  ? 236 GLN B CG    1 
ATOM   2843  C  CD    . GLN B 2 236 ? -42.972 -8.075  -13.045  1.00 10.06 ? 236 GLN B CD    1 
ATOM   2844  O  OE1   . GLN B 2 236 ? -43.252 -8.037  -11.852  1.00 2.00  ? 236 GLN B OE1   1 
ATOM   2845  N  NE2   . GLN B 2 236 ? -43.627 -7.367  -13.937  1.00 2.18  ? 236 GLN B NE2   1 
ATOM   2846  N  N     . LEU B 2 237 ? -39.415 -6.420  -12.944  1.00 2.66  ? 237 LEU B N     1 
ATOM   2847  C  CA    . LEU B 2 237 ? -38.806 -5.633  -14.007  1.00 7.62  ? 237 LEU B CA    1 
ATOM   2848  C  C     . LEU B 2 237 ? -37.293 -5.929  -14.250  1.00 2.00  ? 237 LEU B C     1 
ATOM   2849  O  O     . LEU B 2 237 ? -36.533 -5.998  -13.302  1.00 2.00  ? 237 LEU B O     1 
ATOM   2850  C  CB    . LEU B 2 237 ? -38.980 -4.182  -13.567  1.00 9.97  ? 237 LEU B CB    1 
ATOM   2851  C  CG    . LEU B 2 237 ? -39.612 -3.215  -14.507  1.00 2.54  ? 237 LEU B CG    1 
ATOM   2852  C  CD1   . LEU B 2 237 ? -40.642 -3.930  -15.399  1.00 4.16  ? 237 LEU B CD1   1 
ATOM   2853  C  CD2   . LEU B 2 237 ? -40.217 -2.192  -13.652  1.00 3.67  ? 237 LEU B CD2   1 
ATOM   2854  N  N     . GLU B 2 238 ? -36.862 -6.047  -15.497  1.00 2.00  ? 238 GLU B N     1 
ATOM   2855  C  CA    . GLU B 2 238 ? -35.430 -6.029  -15.848  1.00 4.08  ? 238 GLU B CA    1 
ATOM   2856  C  C     . GLU B 2 238 ? -34.831 -4.702  -16.393  1.00 4.38  ? 238 GLU B C     1 
ATOM   2857  O  O     . GLU B 2 238 ? -33.643 -4.513  -16.311  1.00 4.19  ? 238 GLU B O     1 
ATOM   2858  C  CB    . GLU B 2 238 ? -35.065 -7.151  -16.856  1.00 2.65  ? 238 GLU B CB    1 
ATOM   2859  C  CG    . GLU B 2 238 ? -35.836 -8.400  -16.581  1.00 14.98 ? 238 GLU B CG    1 
ATOM   2860  C  CD    . GLU B 2 238 ? -35.434 -9.585  -17.387  1.00 9.29  ? 238 GLU B CD    1 
ATOM   2861  O  OE1   . GLU B 2 238 ? -35.091 -9.423  -18.581  1.00 13.43 ? 238 GLU B OE1   1 
ATOM   2862  O  OE2   . GLU B 2 238 ? -35.486 -10.699 -16.793  1.00 28.56 ? 238 GLU B OE2   1 
ATOM   2863  N  N     . GLU B 2 239 ? -35.638 -3.844  -16.991  1.00 11.79 ? 239 GLU B N     1 
ATOM   2864  C  CA    . GLU B 2 239 ? -35.193 -2.578  -17.533  1.00 4.49  ? 239 GLU B CA    1 
ATOM   2865  C  C     . GLU B 2 239 ? -36.245 -1.619  -17.013  1.00 12.90 ? 239 GLU B C     1 
ATOM   2866  O  O     . GLU B 2 239 ? -37.462 -1.938  -17.098  1.00 5.14  ? 239 GLU B O     1 
ATOM   2867  C  CB    . GLU B 2 239 ? -35.353 -2.673  -19.015  1.00 2.18  ? 239 GLU B CB    1 
ATOM   2868  C  CG    . GLU B 2 239 ? -34.335 -3.538  -19.719  1.00 2.00  ? 239 GLU B CG    1 
ATOM   2869  C  CD    . GLU B 2 239 ? -34.439 -3.450  -21.303  1.00 29.78 ? 239 GLU B CD    1 
ATOM   2870  O  OE1   . GLU B 2 239 ? -35.384 -2.797  -21.881  1.00 11.41 ? 239 GLU B OE1   1 
ATOM   2871  O  OE2   . GLU B 2 239 ? -33.567 -4.069  -21.969  1.00 12.65 ? 239 GLU B OE2   1 
ATOM   2872  N  N     . LEU B 2 240 ? -35.812 -0.489  -16.435  1.00 3.68  ? 240 LEU B N     1 
ATOM   2873  C  CA    . LEU B 2 240 ? -36.721 0.619   -16.023  1.00 2.00  ? 240 LEU B CA    1 
ATOM   2874  C  C     . LEU B 2 240 ? -36.130 1.863   -16.640  1.00 2.14  ? 240 LEU B C     1 
ATOM   2875  O  O     . LEU B 2 240 ? -34.872 2.032   -16.677  1.00 4.22  ? 240 LEU B O     1 
ATOM   2876  C  CB    . LEU B 2 240 ? -36.725 0.794   -14.550  1.00 2.00  ? 240 LEU B CB    1 
ATOM   2877  C  CG    . LEU B 2 240 ? -37.392 2.043   -14.040  1.00 2.00  ? 240 LEU B CG    1 
ATOM   2878  C  CD1   . LEU B 2 240 ? -38.862 2.002   -14.312  1.00 2.00  ? 240 LEU B CD1   1 
ATOM   2879  C  CD2   . LEU B 2 240 ? -37.234 2.098   -12.489  1.00 2.00  ? 240 LEU B CD2   1 
ATOM   2880  N  N     . GLY B 2 241 ? -37.031 2.622   -17.277  1.00 8.79  ? 241 GLY B N     1 
ATOM   2881  C  CA    . GLY B 2 241 ? -36.849 3.986   -17.763  1.00 2.02  ? 241 GLY B CA    1 
ATOM   2882  C  C     . GLY B 2 241 ? -37.669 4.869   -16.807  1.00 10.61 ? 241 GLY B C     1 
ATOM   2883  O  O     . GLY B 2 241 ? -38.902 4.771   -16.767  1.00 8.83  ? 241 GLY B O     1 
ATOM   2884  N  N     . THR B 2 242 ? -37.033 5.741   -16.006  1.00 9.56  ? 242 THR B N     1 
ATOM   2885  C  CA    . THR B 2 242 ? -37.849 6.596   -15.103  1.00 2.05  ? 242 THR B CA    1 
ATOM   2886  C  C     . THR B 2 242 ? -38.653 7.577   -15.976  1.00 9.30  ? 242 THR B C     1 
ATOM   2887  O  O     . THR B 2 242 ? -38.356 7.739   -17.165  1.00 2.00  ? 242 THR B O     1 
ATOM   2888  C  CB    . THR B 2 242 ? -36.987 7.365   -14.112  1.00 4.11  ? 242 THR B CB    1 
ATOM   2889  O  OG1   . THR B 2 242 ? -36.397 8.514   -14.787  1.00 8.52  ? 242 THR B OG1   1 
ATOM   2890  C  CG2   . THR B 2 242 ? -35.930 6.470   -13.549  1.00 2.00  ? 242 THR B CG2   1 
ATOM   2891  N  N     . GLY B 2 243 ? -39.669 8.198   -15.378  1.00 2.00  ? 243 GLY B N     1 
ATOM   2892  C  CA    . GLY B 2 243 ? -40.158 9.463   -15.882  1.00 8.28  ? 243 GLY B CA    1 
ATOM   2893  C  C     . GLY B 2 243 ? -39.318 10.565  -15.273  1.00 6.09  ? 243 GLY B C     1 
ATOM   2894  O  O     . GLY B 2 243 ? -38.111 10.361  -15.020  1.00 11.52 ? 243 GLY B O     1 
ATOM   2895  N  N     . GLY B 2 244 ? -39.950 11.720  -15.022  1.00 11.09 ? 244 GLY B N     1 
ATOM   2896  C  CA    . GLY B 2 244 ? -39.277 12.846  -14.432  1.00 2.00  ? 244 GLY B CA    1 
ATOM   2897  C  C     . GLY B 2 244 ? -38.566 12.400  -13.142  1.00 11.03 ? 244 GLY B C     1 
ATOM   2898  O  O     . GLY B 2 244 ? -39.082 11.630  -12.332  1.00 2.00  ? 244 GLY B O     1 
ATOM   2899  N  N     . TYR B 2 245 ? -37.351 12.867  -12.951  1.00 2.00  ? 245 TYR B N     1 
ATOM   2900  C  CA    . TYR B 2 245 ? -36.667 12.497  -11.777  1.00 2.60  ? 245 TYR B CA    1 
ATOM   2901  C  C     . TYR B 2 245 ? -36.453 13.747  -10.874  1.00 16.49 ? 245 TYR B C     1 
ATOM   2902  O  O     . TYR B 2 245 ? -35.295 14.069  -10.462  1.00 2.39  ? 245 TYR B O     1 
ATOM   2903  C  CB    . TYR B 2 245 ? -35.344 11.892  -12.161  1.00 3.44  ? 245 TYR B CB    1 
ATOM   2904  C  CG    . TYR B 2 245 ? -34.869 10.926  -11.138  1.00 13.85 ? 245 TYR B CG    1 
ATOM   2905  C  CD1   . TYR B 2 245 ? -35.353 9.615   -11.144  1.00 2.00  ? 245 TYR B CD1   1 
ATOM   2906  C  CD2   . TYR B 2 245 ? -33.964 11.344  -10.106  1.00 9.11  ? 245 TYR B CD2   1 
ATOM   2907  C  CE1   . TYR B 2 245 ? -34.986 8.714   -10.140  1.00 7.82  ? 245 TYR B CE1   1 
ATOM   2908  C  CE2   . TYR B 2 245 ? -33.556 10.455  -9.104   1.00 7.80  ? 245 TYR B CE2   1 
ATOM   2909  C  CZ    . TYR B 2 245 ? -34.092 9.107   -9.141   1.00 4.33  ? 245 TYR B CZ    1 
ATOM   2910  O  OH    . TYR B 2 245 ? -33.731 8.163   -8.180   1.00 8.42  ? 245 TYR B OH    1 
ATOM   2911  N  N     . THR B 2 246 ? -37.565 14.448  -10.591  1.00 2.24  ? 246 THR B N     1 
ATOM   2912  C  CA    . THR B 2 246 ? -37.533 15.656  -9.733   1.00 9.49  ? 246 THR B CA    1 
ATOM   2913  C  C     . THR B 2 246 ? -38.741 15.880  -8.816   1.00 6.79  ? 246 THR B C     1 
ATOM   2914  O  O     . THR B 2 246 ? -39.869 15.615  -9.210   1.00 9.65  ? 246 THR B O     1 
ATOM   2915  C  CB    . THR B 2 246 ? -37.256 16.965  -10.536  1.00 3.73  ? 246 THR B CB    1 
ATOM   2916  O  OG1   . THR B 2 246 ? -37.151 18.037  -9.599   1.00 18.54 ? 246 THR B OG1   1 
ATOM   2917  C  CG2   . THR B 2 246 ? -38.323 17.257  -11.569  1.00 2.00  ? 246 THR B CG2   1 
ATOM   2918  N  N     . ALA B 2 247 ? -38.503 16.363  -7.592   1.00 5.92  ? 247 ALA B N     1 
ATOM   2919  C  CA    . ALA B 2 247 ? -39.566 16.505  -6.618   1.00 2.00  ? 247 ALA B CA    1 
ATOM   2920  C  C     . ALA B 2 247 ? -38.978 17.342  -5.501   1.00 7.81  ? 247 ALA B C     1 
ATOM   2921  O  O     . ALA B 2 247 ? -37.754 17.482  -5.418   1.00 2.03  ? 247 ALA B O     1 
ATOM   2922  C  CB    . ALA B 2 247 ? -40.009 15.164  -6.086   1.00 2.00  ? 247 ALA B CB    1 
ATOM   2923  N  N     . GLU B 2 248 ? -39.849 17.941  -4.686   1.00 2.00  ? 248 GLU B N     1 
ATOM   2924  C  CA    . GLU B 2 248 ? -39.433 18.565  -3.454   1.00 12.14 ? 248 GLU B CA    1 
ATOM   2925  C  C     . GLU B 2 248 ? -38.551 17.577  -2.689   1.00 7.64  ? 248 GLU B C     1 
ATOM   2926  O  O     . GLU B 2 248 ? -38.788 16.362  -2.641   1.00 2.00  ? 248 GLU B O     1 
ATOM   2927  C  CB    . GLU B 2 248 ? -40.668 18.952  -2.614   1.00 6.00  ? 248 GLU B CB    1 
ATOM   2928  C  CG    . GLU B 2 248 ? -40.523 20.240  -1.831   1.00 35.03 ? 248 GLU B CG    1 
ATOM   2929  C  CD    . GLU B 2 248 ? -41.794 20.599  -1.056   1.00 39.84 ? 248 GLU B CD    1 
ATOM   2930  O  OE1   . GLU B 2 248 ? -42.207 21.790  -1.136   1.00 63.80 ? 248 GLU B OE1   1 
ATOM   2931  O  OE2   . GLU B 2 248 ? -42.369 19.707  -0.360   1.00 42.02 ? 248 GLU B OE2   1 
ATOM   2932  N  N     . VAL B 2 249 ? -37.508 18.084  -2.084   1.00 9.41  ? 249 VAL B N     1 
ATOM   2933  C  CA    . VAL B 2 249 ? -36.790 17.197  -1.244   1.00 5.11  ? 249 VAL B CA    1 
ATOM   2934  C  C     . VAL B 2 249 ? -37.607 16.814  0.001    1.00 8.91  ? 249 VAL B C     1 
ATOM   2935  O  O     . VAL B 2 249 ? -37.777 17.614  0.882    1.00 2.00  ? 249 VAL B O     1 
ATOM   2936  C  CB    . VAL B 2 249 ? -35.476 17.819  -0.894   1.00 14.16 ? 249 VAL B CB    1 
ATOM   2937  C  CG1   . VAL B 2 249 ? -34.620 16.810  -0.101   1.00 8.99  ? 249 VAL B CG1   1 
ATOM   2938  C  CG2   . VAL B 2 249 ? -34.813 18.311  -2.166   1.00 2.00  ? 249 VAL B CG2   1 
ATOM   2939  N  N     . ARG B 2 250 ? -38.131 15.584  0.057    1.00 5.71  ? 250 ARG B N     1 
ATOM   2940  C  CA    . ARG B 2 250 ? -38.769 15.107  1.307    1.00 5.69  ? 250 ARG B CA    1 
ATOM   2941  C  C     . ARG B 2 250 ? -38.364 13.691  1.699    1.00 2.58  ? 250 ARG B C     1 
ATOM   2942  O  O     . ARG B 2 250 ? -38.212 12.867  0.842    1.00 11.37 ? 250 ARG B O     1 
ATOM   2943  C  CB    . ARG B 2 250 ? -40.304 15.236  1.311    1.00 8.44  ? 250 ARG B CB    1 
ATOM   2944  C  CG    . ARG B 2 250 ? -40.920 16.412  0.530    1.00 7.68  ? 250 ARG B CG    1 
ATOM   2945  C  CD    . ARG B 2 250 ? -42.423 16.179  0.212    1.00 2.00  ? 250 ARG B CD    1 
ATOM   2946  N  NE    . ARG B 2 250 ? -43.116 15.664  1.384    1.00 30.66 ? 250 ARG B NE    1 
ATOM   2947  C  CZ    . ARG B 2 250 ? -43.197 16.327  2.546    1.00 54.53 ? 250 ARG B CZ    1 
ATOM   2948  N  NH1   . ARG B 2 250 ? -42.648 17.542  2.670    1.00 52.18 ? 250 ARG B NH1   1 
ATOM   2949  N  NH2   . ARG B 2 250 ? -43.834 15.789  3.589    1.00 23.75 ? 250 ARG B NH2   1 
ATOM   2950  N  N     . PRO B 2 251 ? -38.151 13.423  3.004    1.00 8.73  ? 251 PRO B N     1 
ATOM   2951  C  CA    . PRO B 2 251 ? -37.926 12.063  3.525    1.00 6.52  ? 251 PRO B CA    1 
ATOM   2952  C  C     . PRO B 2 251 ? -38.981 11.004  3.285    1.00 8.13  ? 251 PRO B C     1 
ATOM   2953  O  O     . PRO B 2 251 ? -38.613 9.882   2.948    1.00 12.15 ? 251 PRO B O     1 
ATOM   2954  C  CB    . PRO B 2 251 ? -37.713 12.229  5.032    1.00 2.00  ? 251 PRO B CB    1 
ATOM   2955  C  CG    . PRO B 2 251 ? -38.084 13.648  5.340    1.00 20.81 ? 251 PRO B CG    1 
ATOM   2956  C  CD    . PRO B 2 251 ? -38.049 14.458  4.042    1.00 2.00  ? 251 PRO B CD    1 
ATOM   2957  N  N     . ASP B 2 252 ? -40.264 11.274  3.463    1.00 3.74  ? 252 ASP B N     1 
ATOM   2958  C  CA    . ASP B 2 252 ? -41.194 10.190  3.077    1.00 4.25  ? 252 ASP B CA    1 
ATOM   2959  C  C     . ASP B 2 252 ? -41.059 9.789   1.605    1.00 2.00  ? 252 ASP B C     1 
ATOM   2960  O  O     . ASP B 2 252 ? -41.070 8.646   1.321    1.00 10.20 ? 252 ASP B O     1 
ATOM   2961  C  CB    . ASP B 2 252 ? -42.628 10.432  3.505    1.00 2.00  ? 252 ASP B CB    1 
ATOM   2962  C  CG    . ASP B 2 252 ? -43.186 11.752  3.002    1.00 2.00  ? 252 ASP B CG    1 
ATOM   2963  O  OD1   . ASP B 2 252 ? -44.259 12.110  3.483    1.00 19.65 ? 252 ASP B OD1   1 
ATOM   2964  O  OD2   . ASP B 2 252 ? -42.612 12.424  2.122    1.00 4.14  ? 252 ASP B OD2   1 
ATOM   2965  N  N     . VAL B 2 253 ? -40.854 10.723  0.673    1.00 8.08  ? 253 VAL B N     1 
ATOM   2966  C  CA    . VAL B 2 253 ? -40.873 10.393  -0.747   1.00 2.00  ? 253 VAL B CA    1 
ATOM   2967  C  C     . VAL B 2 253 ? -39.606 9.678   -1.099   1.00 2.94  ? 253 VAL B C     1 
ATOM   2968  O  O     . VAL B 2 253 ? -39.641 8.778   -1.930   1.00 4.83  ? 253 VAL B O     1 
ATOM   2969  C  CB    . VAL B 2 253 ? -40.875 11.657  -1.645   1.00 2.14  ? 253 VAL B CB    1 
ATOM   2970  C  CG1   . VAL B 2 253 ? -40.525 11.330  -3.054   1.00 2.00  ? 253 VAL B CG1   1 
ATOM   2971  C  CG2   . VAL B 2 253 ? -42.136 12.487  -1.508   1.00 2.00  ? 253 VAL B CG2   1 
ATOM   2972  N  N     . TYR B 2 254 ? -38.463 10.106  -0.539   1.00 8.04  ? 254 TYR B N     1 
ATOM   2973  C  CA    . TYR B 2 254 ? -37.183 9.341   -0.678   1.00 9.07  ? 254 TYR B CA    1 
ATOM   2974  C  C     . TYR B 2 254 ? -37.256 7.909   -0.108   1.00 2.00  ? 254 TYR B C     1 
ATOM   2975  O  O     . TYR B 2 254 ? -36.963 6.960   -0.793   1.00 2.00  ? 254 TYR B O     1 
ATOM   2976  C  CB    . TYR B 2 254 ? -35.980 10.035  -0.024   1.00 2.00  ? 254 TYR B CB    1 
ATOM   2977  C  CG    . TYR B 2 254 ? -34.664 9.273   -0.268   1.00 2.00  ? 254 TYR B CG    1 
ATOM   2978  C  CD1   . TYR B 2 254 ? -33.873 9.484   -1.409   1.00 2.81  ? 254 TYR B CD1   1 
ATOM   2979  C  CD2   . TYR B 2 254 ? -34.258 8.293   0.599    1.00 2.00  ? 254 TYR B CD2   1 
ATOM   2980  C  CE1   . TYR B 2 254 ? -32.691 8.741   -1.620   1.00 2.00  ? 254 TYR B CE1   1 
ATOM   2981  C  CE2   . TYR B 2 254 ? -33.104 7.565   0.426    1.00 2.00  ? 254 TYR B CE2   1 
ATOM   2982  C  CZ    . TYR B 2 254 ? -32.326 7.785   -0.669   1.00 10.19 ? 254 TYR B CZ    1 
ATOM   2983  O  OH    . TYR B 2 254 ? -31.199 7.012   -0.762   1.00 11.90 ? 254 TYR B OH    1 
ATOM   2984  N  N     . SER B 2 255 ? -37.645 7.780   1.144    1.00 2.00  ? 255 SER B N     1 
ATOM   2985  C  CA    . SER B 2 255 ? -37.798 6.498   1.714    1.00 2.00  ? 255 SER B CA    1 
ATOM   2986  C  C     . SER B 2 255 ? -38.621 5.558   0.842    1.00 2.00  ? 255 SER B C     1 
ATOM   2987  O  O     . SER B 2 255 ? -38.194 4.470   0.593    1.00 4.21  ? 255 SER B O     1 
ATOM   2988  C  CB    . SER B 2 255 ? -38.400 6.564   3.081    1.00 2.00  ? 255 SER B CB    1 
ATOM   2989  O  OG    . SER B 2 255 ? -38.373 5.254   3.580    1.00 3.71  ? 255 SER B OG    1 
ATOM   2990  N  N     . GLY B 2 256 ? -39.795 5.974   0.380    1.00 4.25  ? 256 GLY B N     1 
ATOM   2991  C  CA    . GLY B 2 256 ? -40.655 5.167   -0.531   1.00 2.65  ? 256 GLY B CA    1 
ATOM   2992  C  C     . GLY B 2 256 ? -39.953 4.817   -1.837   1.00 6.10  ? 256 GLY B C     1 
ATOM   2993  O  O     . GLY B 2 256 ? -39.933 3.666   -2.212   1.00 14.19 ? 256 GLY B O     1 
ATOM   2994  N  N     . LEU B 2 257 ? -39.357 5.781   -2.535   1.00 3.37  ? 257 LEU B N     1 
ATOM   2995  C  CA    . LEU B 2 257 ? -38.683 5.456   -3.818   1.00 2.51  ? 257 LEU B CA    1 
ATOM   2996  C  C     . LEU B 2 257 ? -37.745 4.346   -3.462   1.00 2.96  ? 257 LEU B C     1 
ATOM   2997  O  O     . LEU B 2 257 ? -37.586 3.418   -4.218   1.00 12.95 ? 257 LEU B O     1 
ATOM   2998  C  CB    . LEU B 2 257 ? -37.763 6.557   -4.264   1.00 2.00  ? 257 LEU B CB    1 
ATOM   2999  C  CG    . LEU B 2 257 ? -38.025 7.152   -5.585   1.00 14.18 ? 257 LEU B CG    1 
ATOM   3000  C  CD1   . LEU B 2 257 ? -36.926 8.145   -5.761   1.00 25.67 ? 257 LEU B CD1   1 
ATOM   3001  C  CD2   . LEU B 2 257 ? -37.874 6.105   -6.639   1.00 3.16  ? 257 LEU B CD2   1 
ATOM   3002  N  N     . SER B 2 258 ? -37.090 4.430   -2.307   1.00 2.00  ? 258 SER B N     1 
ATOM   3003  C  CA    . SER B 2 258 ? -35.953 3.579   -2.153   1.00 2.00  ? 258 SER B CA    1 
ATOM   3004  C  C     . SER B 2 258 ? -36.306 2.127   -1.746   1.00 2.74  ? 258 SER B C     1 
ATOM   3005  O  O     . SER B 2 258 ? -35.675 1.181   -2.228   1.00 2.00  ? 258 SER B O     1 
ATOM   3006  C  CB    . SER B 2 258 ? -34.789 4.226   -1.406   1.00 2.00  ? 258 SER B CB    1 
ATOM   3007  O  OG    . SER B 2 258 ? -34.543 3.572   -0.204   1.00 2.00  ? 258 SER B OG    1 
ATOM   3008  N  N     . VAL B 2 259 ? -37.335 1.950   -0.915   1.00 2.00  ? 259 VAL B N     1 
ATOM   3009  C  CA    . VAL B 2 259 ? -37.805 0.615   -0.573   1.00 2.00  ? 259 VAL B CA    1 
ATOM   3010  C  C     . VAL B 2 259 ? -38.266 -0.006  -1.936   1.00 16.97 ? 259 VAL B C     1 
ATOM   3011  O  O     . VAL B 2 259 ? -37.978 -1.195  -2.234   1.00 27.16 ? 259 VAL B O     1 
ATOM   3012  C  CB    . VAL B 2 259 ? -38.979 0.668   0.444    1.00 9.43  ? 259 VAL B CB    1 
ATOM   3013  C  CG1   . VAL B 2 259 ? -39.496 -0.703  0.737    1.00 2.00  ? 259 VAL B CG1   1 
ATOM   3014  C  CG2   . VAL B 2 259 ? -38.621 1.380   1.720    1.00 2.00  ? 259 VAL B CG2   1 
ATOM   3015  N  N     . ALA B 2 260 ? -38.930 0.802   -2.771   1.00 4.20  ? 260 ALA B N     1 
ATOM   3016  C  CA    . ALA B 2 260 ? -39.596 0.295   -3.966   1.00 11.84 ? 260 ALA B CA    1 
ATOM   3017  C  C     . ALA B 2 260 ? -38.523 -0.129  -4.949   1.00 12.48 ? 260 ALA B C     1 
ATOM   3018  O  O     . ALA B 2 260 ? -38.679 -1.071  -5.697   1.00 17.67 ? 260 ALA B O     1 
ATOM   3019  C  CB    . ALA B 2 260 ? -40.429 1.375   -4.614   1.00 2.00  ? 260 ALA B CB    1 
ATOM   3020  N  N     . LEU B 2 261 ? -37.417 0.577   -4.997   1.00 5.66  ? 261 LEU B N     1 
ATOM   3021  C  CA    . LEU B 2 261 ? -36.459 0.180   -6.014   1.00 5.04  ? 261 LEU B CA    1 
ATOM   3022  C  C     . LEU B 2 261 ? -35.695 -1.095  -5.596   1.00 8.61  ? 261 LEU B C     1 
ATOM   3023  O  O     . LEU B 2 261 ? -35.249 -1.908  -6.418   1.00 12.88 ? 261 LEU B O     1 
ATOM   3024  C  CB    . LEU B 2 261 ? -35.509 1.325   -6.281   1.00 2.00  ? 261 LEU B CB    1 
ATOM   3025  C  CG    . LEU B 2 261 ? -36.074 2.321   -7.313   1.00 2.09  ? 261 LEU B CG    1 
ATOM   3026  C  CD1   . LEU B 2 261 ? -35.397 3.666   -6.953   1.00 4.72  ? 261 LEU B CD1   1 
ATOM   3027  C  CD2   . LEU B 2 261 ? -35.662 1.944   -8.799   1.00 2.00  ? 261 LEU B CD2   1 
ATOM   3028  N  N     . SER B 2 262 ? -35.498 -1.260  -4.304   1.00 2.06  ? 262 SER B N     1 
ATOM   3029  C  CA    . SER B 2 262 ? -34.614 -2.275  -3.880   1.00 14.25 ? 262 SER B CA    1 
ATOM   3030  C  C     . SER B 2 262 ? -35.450 -3.542  -3.717   1.00 13.13 ? 262 SER B C     1 
ATOM   3031  O  O     . SER B 2 262 ? -34.882 -4.629  -3.598   1.00 19.89 ? 262 SER B O     1 
ATOM   3032  C  CB    . SER B 2 262 ? -33.971 -1.878  -2.541   1.00 13.19 ? 262 SER B CB    1 
ATOM   3033  O  OG    . SER B 2 262 ? -34.893 -2.064  -1.478   1.00 9.99  ? 262 SER B OG    1 
ATOM   3034  N  N     . GLY B 2 263 ? -36.778 -3.393  -3.671   1.00 6.12  ? 263 GLY B N     1 
ATOM   3035  C  CA    . GLY B 2 263 ? -37.732 -4.349  -4.298   1.00 2.00  ? 263 GLY B CA    1 
ATOM   3036  C  C     . GLY B 2 263 ? -37.560 -4.944  -5.720   1.00 12.94 ? 263 GLY B C     1 
ATOM   3037  O  O     . GLY B 2 263 ? -38.056 -6.058  -6.002   1.00 6.71  ? 263 GLY B O     1 
ATOM   3038  N  N     . CYS B 2 264 ? -36.877 -4.254  -6.629   1.00 2.00  ? 264 CYS B N     1 
ATOM   3039  C  CA    . CYS B 2 264 ? -36.644 -4.800  -7.933   1.00 2.00  ? 264 CYS B CA    1 
ATOM   3040  C  C     . CYS B 2 264 ? -35.349 -5.504  -8.050   1.00 2.00  ? 264 CYS B C     1 
ATOM   3041  O  O     . CYS B 2 264 ? -34.341 -4.993  -8.599   1.00 9.33  ? 264 CYS B O     1 
ATOM   3042  C  CB    . CYS B 2 264 ? -36.715 -3.725  -8.999   1.00 2.00  ? 264 CYS B CB    1 
ATOM   3043  S  SG    . CYS B 2 264 ? -38.237 -2.834  -8.840   1.00 7.85  ? 264 CYS B SG    1 
ATOM   3044  N  N     . LYS B 2 265 ? -35.355 -6.734  -7.596   1.00 6.95  ? 265 LYS B N     1 
ATOM   3045  C  CA    . LYS B 2 265 ? -34.122 -7.508  -7.584   1.00 2.00  ? 265 LYS B CA    1 
ATOM   3046  C  C     . LYS B 2 265 ? -33.624 -7.928  -8.936   1.00 2.00  ? 265 LYS B C     1 
ATOM   3047  O  O     . LYS B 2 265 ? -32.483 -8.345  -8.998   1.00 2.00  ? 265 LYS B O     1 
ATOM   3048  C  CB    . LYS B 2 265 ? -34.224 -8.650  -6.606   1.00 4.26  ? 265 LYS B CB    1 
ATOM   3049  C  CG    . LYS B 2 265 ? -34.840 -8.143  -5.336   1.00 2.00  ? 265 LYS B CG    1 
ATOM   3050  C  CD    . LYS B 2 265 ? -35.091 -9.211  -4.359   1.00 14.33 ? 265 LYS B CD    1 
ATOM   3051  C  CE    . LYS B 2 265 ? -34.922 -8.554  -2.978   1.00 41.59 ? 265 LYS B CE    1 
ATOM   3052  N  NZ    . LYS B 2 265 ? -33.956 -7.380  -3.065   1.00 9.53  ? 265 LYS B NZ    1 
ATOM   3053  N  N     . GLU B 2 266 ? -34.448 -7.767  -9.998   1.00 2.00  ? 266 GLU B N     1 
ATOM   3054  C  CA    . GLU B 2 266 ? -34.098 -8.154  -11.407  1.00 2.00  ? 266 GLU B CA    1 
ATOM   3055  C  C     . GLU B 2 266 ? -33.552 -7.039  -12.356  1.00 2.00  ? 266 GLU B C     1 
ATOM   3056  O  O     . GLU B 2 266 ? -33.134 -7.357  -13.488  1.00 3.87  ? 266 GLU B O     1 
ATOM   3057  C  CB    . GLU B 2 266 ? -35.236 -8.905  -12.116  1.00 2.00  ? 266 GLU B CB    1 
ATOM   3058  C  CG    . GLU B 2 266 ? -35.906 -9.930  -11.208  1.00 6.74  ? 266 GLU B CG    1 
ATOM   3059  C  CD    . GLU B 2 266 ? -34.854 -10.872 -10.650  1.00 18.84 ? 266 GLU B CD    1 
ATOM   3060  O  OE1   . GLU B 2 266 ? -34.915 -11.204 -9.422   1.00 3.25  ? 266 GLU B OE1   1 
ATOM   3061  O  OE2   . GLU B 2 266 ? -33.931 -11.236 -11.464  1.00 11.56 ? 266 GLU B OE2   1 
ATOM   3062  N  N     . LEU B 2 267 ? -33.548 -5.770  -11.923  1.00 8.74  ? 267 LEU B N     1 
ATOM   3063  C  CA    . LEU B 2 267 ? -33.034 -4.616  -12.746  1.00 2.70  ? 267 LEU B CA    1 
ATOM   3064  C  C     . LEU B 2 267 ? -31.680 -4.836  -13.292  1.00 2.00  ? 267 LEU B C     1 
ATOM   3065  O  O     . LEU B 2 267 ? -30.741 -4.910  -12.562  1.00 13.15 ? 267 LEU B O     1 
ATOM   3066  C  CB    . LEU B 2 267 ? -33.014 -3.344  -11.936  1.00 4.93  ? 267 LEU B CB    1 
ATOM   3067  C  CG    . LEU B 2 267 ? -34.462 -2.901  -11.954  1.00 2.43  ? 267 LEU B CG    1 
ATOM   3068  C  CD1   . LEU B 2 267 ? -34.605 -1.536  -11.262  1.00 2.14  ? 267 LEU B CD1   1 
ATOM   3069  C  CD2   . LEU B 2 267 ? -34.617 -2.827  -13.441  1.00 2.00  ? 267 LEU B CD2   1 
ATOM   3070  N  N     . ARG B 2 268 ? -31.550 -4.882  -14.599  1.00 6.12  ? 268 ARG B N     1 
ATOM   3071  C  CA    . ARG B 2 268 ? -30.231 -4.849  -15.195  1.00 8.59  ? 268 ARG B CA    1 
ATOM   3072  C  C     . ARG B 2 268 ? -29.937 -3.439  -15.877  1.00 13.05 ? 268 ARG B C     1 
ATOM   3073  O  O     . ARG B 2 268 ? -28.779 -3.118  -16.191  1.00 3.55  ? 268 ARG B O     1 
ATOM   3074  C  CB    . ARG B 2 268 ? -30.163 -5.990  -16.234  1.00 11.59 ? 268 ARG B CB    1 
ATOM   3075  C  CG    . ARG B 2 268 ? -29.938 -7.403  -15.693  1.00 4.64  ? 268 ARG B CG    1 
ATOM   3076  C  CD    . ARG B 2 268 ? -29.051 -7.358  -14.466  1.00 25.36 ? 268 ARG B CD    1 
ATOM   3077  N  NE    . ARG B 2 268 ? -29.089 -8.597  -13.699  1.00 7.99  ? 268 ARG B NE    1 
ATOM   3078  C  CZ    . ARG B 2 268 ? -29.822 -8.759  -12.595  1.00 22.08 ? 268 ARG B CZ    1 
ATOM   3079  N  NH1   . ARG B 2 268 ? -30.518 -7.731  -12.122  1.00 32.18 ? 268 ARG B NH1   1 
ATOM   3080  N  NH2   . ARG B 2 268 ? -29.847 -9.926  -11.950  1.00 2.00  ? 268 ARG B NH2   1 
ATOM   3081  N  N     . CYS B 2 269 ? -30.993 -2.663  -16.181  1.00 8.08  ? 269 CYS B N     1 
ATOM   3082  C  CA    . CYS B 2 269 ? -30.924 -1.490  -17.077  1.00 2.48  ? 269 CYS B CA    1 
ATOM   3083  C  C     . CYS B 2 269 ? -31.714 -0.385  -16.465  1.00 4.54  ? 269 CYS B C     1 
ATOM   3084  O  O     . CYS B 2 269 ? -32.861 -0.572  -16.137  1.00 7.34  ? 269 CYS B O     1 
ATOM   3085  C  CB    . CYS B 2 269 ? -31.514 -1.780  -18.391  1.00 2.00  ? 269 CYS B CB    1 
ATOM   3086  S  SG    . CYS B 2 269 ? -30.567 -3.135  -19.134  1.00 10.04 ? 269 CYS B SG    1 
ATOM   3087  N  N     . LEU B 2 270 ? -31.069 0.742   -16.267  1.00 2.00  ? 270 LEU B N     1 
ATOM   3088  C  CA    . LEU B 2 270 ? -31.657 1.912   -15.706  1.00 3.30  ? 270 LEU B CA    1 
ATOM   3089  C  C     . LEU B 2 270 ? -31.409 3.172   -16.689  1.00 4.31  ? 270 LEU B C     1 
ATOM   3090  O  O     . LEU B 2 270 ? -30.282 3.414   -17.266  1.00 2.00  ? 270 LEU B O     1 
ATOM   3091  C  CB    . LEU B 2 270 ? -30.976 2.071   -14.351  1.00 2.00  ? 270 LEU B CB    1 
ATOM   3092  C  CG    . LEU B 2 270 ? -31.809 2.190   -13.102  1.00 17.99 ? 270 LEU B CG    1 
ATOM   3093  C  CD1   . LEU B 2 270 ? -31.095 2.995   -11.892  1.00 6.32  ? 270 LEU B CD1   1 
ATOM   3094  C  CD2   . LEU B 2 270 ? -33.164 2.729   -13.449  1.00 2.00  ? 270 LEU B CD2   1 
ATOM   3095  N  N     . SER B 2 271 ? -32.478 3.920   -16.928  1.00 2.00  ? 271 SER B N     1 
ATOM   3096  C  CA    . SER B 2 271 ? -32.438 5.008   -17.904  1.00 3.90  ? 271 SER B CA    1 
ATOM   3097  C  C     . SER B 2 271 ? -33.495 6.057   -17.544  1.00 2.00  ? 271 SER B C     1 
ATOM   3098  O  O     . SER B 2 271 ? -34.297 5.853   -16.600  1.00 4.53  ? 271 SER B O     1 
ATOM   3099  C  CB    . SER B 2 271 ? -32.667 4.481   -19.343  1.00 2.00  ? 271 SER B CB    1 
ATOM   3100  O  OG    . SER B 2 271 ? -33.914 3.798   -19.320  1.00 8.39  ? 271 SER B OG    1 
ATOM   3101  N  N     . GLY B 2 272 ? -33.530 7.153   -18.300  1.00 2.00  ? 272 GLY B N     1 
ATOM   3102  C  CA    . GLY B 2 272 ? -34.507 8.211   -18.039  1.00 2.00  ? 272 GLY B CA    1 
ATOM   3103  C  C     . GLY B 2 272 ? -33.883 9.382   -17.281  1.00 2.15  ? 272 GLY B C     1 
ATOM   3104  O  O     . GLY B 2 272 ? -33.007 10.081  -17.795  1.00 2.00  ? 272 GLY B O     1 
ATOM   3105  N  N     . PHE B 2 273 ? -34.317 9.618   -16.043  1.00 5.54  ? 273 PHE B N     1 
ATOM   3106  C  CA    . PHE B 2 273 ? -33.641 10.666  -15.234  1.00 5.52  ? 273 PHE B CA    1 
ATOM   3107  C  C     . PHE B 2 273 ? -33.801 12.087  -15.742  1.00 6.95  ? 273 PHE B C     1 
ATOM   3108  O  O     . PHE B 2 273 ? -32.926 12.931  -15.440  1.00 9.67  ? 273 PHE B O     1 
ATOM   3109  C  CB    . PHE B 2 273 ? -32.130 10.343  -15.130  1.00 10.58 ? 273 PHE B CB    1 
ATOM   3110  C  CG    . PHE B 2 273 ? -31.850 8.983   -14.469  1.00 2.00  ? 273 PHE B CG    1 
ATOM   3111  C  CD1   . PHE B 2 273 ? -31.286 7.953   -15.182  1.00 2.00  ? 273 PHE B CD1   1 
ATOM   3112  C  CD2   . PHE B 2 273 ? -32.221 8.756   -13.147  1.00 2.24  ? 273 PHE B CD2   1 
ATOM   3113  C  CE1   . PHE B 2 273 ? -31.003 6.760   -14.621  1.00 2.00  ? 273 PHE B CE1   1 
ATOM   3114  C  CE2   . PHE B 2 273 ? -32.002 7.515   -12.559  1.00 3.70  ? 273 PHE B CE2   1 
ATOM   3115  C  CZ    . PHE B 2 273 ? -31.382 6.512   -13.318  1.00 11.11 ? 273 PHE B CZ    1 
ATOM   3116  N  N     . TRP B 2 274 ? -34.905 12.414  -16.441  1.00 3.94  ? 274 TRP B N     1 
ATOM   3117  C  CA    . TRP B 2 274 ? -35.052 13.841  -16.801  1.00 4.27  ? 274 TRP B CA    1 
ATOM   3118  C  C     . TRP B 2 274 ? -35.028 14.725  -15.558  1.00 6.28  ? 274 TRP B C     1 
ATOM   3119  O  O     . TRP B 2 274 ? -35.655 14.392  -14.487  1.00 2.32  ? 274 TRP B O     1 
ATOM   3120  C  CB    . TRP B 2 274 ? -36.208 14.195  -17.737  1.00 6.80  ? 274 TRP B CB    1 
ATOM   3121  C  CG    . TRP B 2 274 ? -36.272 13.393  -19.108  1.00 12.52 ? 274 TRP B CG    1 
ATOM   3122  C  CD1   . TRP B 2 274 ? -35.849 13.799  -20.398  1.00 4.48  ? 274 TRP B CD1   1 
ATOM   3123  C  CD2   . TRP B 2 274 ? -36.872 12.113  -19.283  1.00 3.04  ? 274 TRP B CD2   1 
ATOM   3124  N  NE1   . TRP B 2 274 ? -36.125 12.794  -21.331  1.00 7.35  ? 274 TRP B NE1   1 
ATOM   3125  C  CE2   . TRP B 2 274 ? -36.736 11.754  -20.679  1.00 10.94 ? 274 TRP B CE2   1 
ATOM   3126  C  CE3   . TRP B 2 274 ? -37.495 11.218  -18.395  1.00 2.00  ? 274 TRP B CE3   1 
ATOM   3127  C  CZ2   . TRP B 2 274 ? -37.190 10.552  -21.171  1.00 19.82 ? 274 TRP B CZ2   1 
ATOM   3128  C  CZ3   . TRP B 2 274 ? -37.948 10.046  -18.879  1.00 7.37  ? 274 TRP B CZ3   1 
ATOM   3129  C  CH2   . TRP B 2 274 ? -37.769 9.685   -20.254  1.00 6.87  ? 274 TRP B CH2   1 
ATOM   3130  N  N     . ASP B 2 275 ? -34.272 15.819  -15.682  1.00 2.94  ? 275 ASP B N     1 
ATOM   3131  C  CA    . ASP B 2 275 ? -34.303 16.882  -14.645  1.00 2.00  ? 275 ASP B CA    1 
ATOM   3132  C  C     . ASP B 2 275 ? -33.841 16.307  -13.294  1.00 7.61  ? 275 ASP B C     1 
ATOM   3133  O  O     . ASP B 2 275 ? -34.389 16.663  -12.252  1.00 3.47  ? 275 ASP B O     1 
ATOM   3134  C  CB    . ASP B 2 275 ? -35.745 17.307  -14.439  1.00 2.00  ? 275 ASP B CB    1 
ATOM   3135  C  CG    . ASP B 2 275 ? -36.358 17.920  -15.683  1.00 26.18 ? 275 ASP B CG    1 
ATOM   3136  O  OD1   . ASP B 2 275 ? -35.636 18.728  -16.313  1.00 9.76  ? 275 ASP B OD1   1 
ATOM   3137  O  OD2   . ASP B 2 275 ? -37.543 17.610  -16.037  1.00 25.92 ? 275 ASP B OD2   1 
ATOM   3138  N  N     . ALA B 2 276 ? -32.917 15.352  -13.288  1.00 8.28  ? 276 ALA B N     1 
ATOM   3139  C  CA    . ALA B 2 276 ? -32.700 14.645  -12.046  1.00 8.47  ? 276 ALA B CA    1 
ATOM   3140  C  C     . ALA B 2 276 ? -32.155 15.666  -11.038  1.00 13.02 ? 276 ALA B C     1 
ATOM   3141  O  O     . ALA B 2 276 ? -31.315 16.469  -11.418  1.00 5.10  ? 276 ALA B O     1 
ATOM   3142  C  CB    . ALA B 2 276 ? -31.753 13.521  -12.247  1.00 12.47 ? 276 ALA B CB    1 
ATOM   3143  N  N     . VAL B 2 277 ? -32.687 15.639  -9.798   1.00 4.22  ? 277 VAL B N     1 
ATOM   3144  C  CA    . VAL B 2 277 ? -32.115 16.237  -8.600   1.00 12.92 ? 277 VAL B CA    1 
ATOM   3145  C  C     . VAL B 2 277 ? -31.106 15.325  -7.802   1.00 8.68  ? 277 VAL B C     1 
ATOM   3146  O  O     . VAL B 2 277 ? -31.436 14.215  -7.331   1.00 3.41  ? 277 VAL B O     1 
ATOM   3147  C  CB    . VAL B 2 277 ? -33.286 16.610  -7.652   1.00 4.28  ? 277 VAL B CB    1 
ATOM   3148  C  CG1   . VAL B 2 277 ? -34.083 17.657  -8.298   1.00 4.37  ? 277 VAL B CG1   1 
ATOM   3149  C  CG2   . VAL B 2 277 ? -34.177 15.410  -7.566   1.00 23.10 ? 277 VAL B CG2   1 
ATOM   3150  N  N     . PRO B 2 278 ? -29.865 15.811  -7.645   1.00 14.93 ? 278 PRO B N     1 
ATOM   3151  C  CA    . PRO B 2 278 ? -28.875 15.114  -6.808   1.00 3.47  ? 278 PRO B CA    1 
ATOM   3152  C  C     . PRO B 2 278 ? -29.483 14.455  -5.608   1.00 2.00  ? 278 PRO B C     1 
ATOM   3153  O  O     . PRO B 2 278 ? -29.216 13.285  -5.373   1.00 11.46 ? 278 PRO B O     1 
ATOM   3154  C  CB    . PRO B 2 278 ? -27.903 16.231  -6.403   1.00 5.94  ? 278 PRO B CB    1 
ATOM   3155  C  CG    . PRO B 2 278 ? -27.959 17.219  -7.600   1.00 7.31  ? 278 PRO B CG    1 
ATOM   3156  C  CD    . PRO B 2 278 ? -29.306 17.017  -8.316   1.00 4.56  ? 278 PRO B CD    1 
ATOM   3157  N  N     . ALA B 2 279 ? -30.338 15.153  -4.870   1.00 6.62  ? 279 ALA B N     1 
ATOM   3158  C  CA    . ALA B 2 279 ? -30.890 14.587  -3.630   1.00 2.00  ? 279 ALA B CA    1 
ATOM   3159  C  C     . ALA B 2 279 ? -31.650 13.246  -3.760   1.00 6.67  ? 279 ALA B C     1 
ATOM   3160  O  O     . ALA B 2 279 ? -31.796 12.505  -2.800   1.00 2.00  ? 279 ALA B O     1 
ATOM   3161  C  CB    . ALA B 2 279 ? -31.699 15.625  -2.851   1.00 10.36 ? 279 ALA B CB    1 
ATOM   3162  N  N     . TYR B 2 280 ? -32.122 12.931  -4.963   1.00 8.01  ? 280 TYR B N     1 
ATOM   3163  C  CA    . TYR B 2 280 ? -32.841 11.680  -5.185   1.00 11.56 ? 280 TYR B CA    1 
ATOM   3164  C  C     . TYR B 2 280 ? -32.055 10.481  -5.855   1.00 11.77 ? 280 TYR B C     1 
ATOM   3165  O  O     . TYR B 2 280 ? -32.537 9.370   -5.813   1.00 5.08  ? 280 TYR B O     1 
ATOM   3166  C  CB    . TYR B 2 280 ? -34.103 11.998  -5.981   1.00 9.44  ? 280 TYR B CB    1 
ATOM   3167  C  CG    . TYR B 2 280 ? -35.179 12.540  -5.130   1.00 4.29  ? 280 TYR B CG    1 
ATOM   3168  C  CD1   . TYR B 2 280 ? -35.603 13.876  -5.238   1.00 12.00 ? 280 TYR B CD1   1 
ATOM   3169  C  CD2   . TYR B 2 280 ? -35.732 11.760  -4.157   1.00 2.64  ? 280 TYR B CD2   1 
ATOM   3170  C  CE1   . TYR B 2 280 ? -36.578 14.386  -4.414   1.00 2.00  ? 280 TYR B CE1   1 
ATOM   3171  C  CE2   . TYR B 2 280 ? -36.723 12.271  -3.275   1.00 2.02  ? 280 TYR B CE2   1 
ATOM   3172  C  CZ    . TYR B 2 280 ? -37.161 13.553  -3.440   1.00 3.51  ? 280 TYR B CZ    1 
ATOM   3173  O  OH    . TYR B 2 280 ? -38.133 13.969  -2.573   1.00 2.00  ? 280 TYR B OH    1 
ATOM   3174  N  N     . LEU B 2 281 ? -30.892 10.692  -6.477   1.00 2.00  ? 281 LEU B N     1 
ATOM   3175  C  CA    . LEU B 2 281 ? -30.216 9.587   -7.129   1.00 6.40  ? 281 LEU B CA    1 
ATOM   3176  C  C     . LEU B 2 281 ? -29.865 8.434   -6.192   1.00 7.74  ? 281 LEU B C     1 
ATOM   3177  O  O     . LEU B 2 281 ? -29.827 7.262   -6.577   1.00 16.10 ? 281 LEU B O     1 
ATOM   3178  C  CB    . LEU B 2 281 ? -28.943 10.082  -7.741   1.00 2.00  ? 281 LEU B CB    1 
ATOM   3179  C  CG    . LEU B 2 281 ? -29.183 11.028  -8.893   1.00 12.53 ? 281 LEU B CG    1 
ATOM   3180  C  CD1   . LEU B 2 281 ? -27.882 11.813  -9.254   1.00 2.24  ? 281 LEU B CD1   1 
ATOM   3181  C  CD2   . LEU B 2 281 ? -29.731 10.168  -10.041  1.00 2.00  ? 281 LEU B CD2   1 
ATOM   3182  N  N     . PRO B 2 282 ? -29.525 8.757   -4.958   1.00 14.51 ? 282 PRO B N     1 
ATOM   3183  C  CA    . PRO B 2 282 ? -28.945 7.662   -4.183   1.00 13.87 ? 282 PRO B CA    1 
ATOM   3184  C  C     . PRO B 2 282 ? -29.988 6.548   -3.915   1.00 8.28  ? 282 PRO B C     1 
ATOM   3185  O  O     . PRO B 2 282 ? -29.646 5.405   -3.580   1.00 12.43 ? 282 PRO B O     1 
ATOM   3186  C  CB    . PRO B 2 282 ? -28.489 8.387   -2.888   1.00 8.85  ? 282 PRO B CB    1 
ATOM   3187  C  CG    . PRO B 2 282 ? -28.275 9.897   -3.341   1.00 6.11  ? 282 PRO B CG    1 
ATOM   3188  C  CD    . PRO B 2 282 ? -29.515 10.041  -4.222   1.00 16.41 ? 282 PRO B CD    1 
ATOM   3189  N  N     . ALA B 2 283 ? -31.257 6.901   -4.064   1.00 10.46 ? 283 ALA B N     1 
ATOM   3190  C  CA    . ALA B 2 283 ? -32.385 5.973   -3.933   1.00 2.00  ? 283 ALA B CA    1 
ATOM   3191  C  C     . ALA B 2 283 ? -32.105 4.818   -4.882   1.00 3.77  ? 283 ALA B C     1 
ATOM   3192  O  O     . ALA B 2 283 ? -32.480 3.662   -4.650   1.00 11.41 ? 283 ALA B O     1 
ATOM   3193  C  CB    . ALA B 2 283 ? -33.696 6.681   -4.277   1.00 2.00  ? 283 ALA B CB    1 
ATOM   3194  N  N     . VAL B 2 284 ? -31.376 5.135   -5.930   1.00 5.27  ? 284 VAL B N     1 
ATOM   3195  C  CA    . VAL B 2 284 ? -31.161 4.178   -6.989   1.00 6.55  ? 284 VAL B CA    1 
ATOM   3196  C  C     . VAL B 2 284 ? -29.998 3.197   -6.619   1.00 16.15 ? 284 VAL B C     1 
ATOM   3197  O  O     . VAL B 2 284 ? -29.777 2.200   -7.344   1.00 4.82  ? 284 VAL B O     1 
ATOM   3198  C  CB    . VAL B 2 284 ? -30.951 4.950   -8.316   1.00 2.00  ? 284 VAL B CB    1 
ATOM   3199  C  CG1   . VAL B 2 284 ? -29.725 4.600   -9.008   1.00 2.00  ? 284 VAL B CG1   1 
ATOM   3200  C  CG2   . VAL B 2 284 ? -32.112 4.815   -9.171   1.00 4.08  ? 284 VAL B CG2   1 
ATOM   3201  N  N     . TYR B 2 285 ? -29.283 3.412   -5.520   1.00 2.00  ? 285 TYR B N     1 
ATOM   3202  C  CA    . TYR B 2 285 ? -27.992 2.736   -5.327   1.00 15.83 ? 285 TYR B CA    1 
ATOM   3203  C  C     . TYR B 2 285 ? -28.037 1.213   -5.159   1.00 13.91 ? 285 TYR B C     1 
ATOM   3204  O  O     . TYR B 2 285 ? -27.209 0.502   -5.701   1.00 39.86 ? 285 TYR B O     1 
ATOM   3205  C  CB    . TYR B 2 285 ? -27.210 3.322   -4.152   1.00 10.64 ? 285 TYR B CB    1 
ATOM   3206  C  CG    . TYR B 2 285 ? -26.635 4.705   -4.345   1.00 13.40 ? 285 TYR B CG    1 
ATOM   3207  C  CD1   . TYR B 2 285 ? -26.724 5.367   -5.554   1.00 5.15  ? 285 TYR B CD1   1 
ATOM   3208  C  CD2   . TYR B 2 285 ? -26.020 5.351   -3.301   1.00 2.00  ? 285 TYR B CD2   1 
ATOM   3209  C  CE1   . TYR B 2 285 ? -26.215 6.623   -5.706   1.00 2.00  ? 285 TYR B CE1   1 
ATOM   3210  C  CE2   . TYR B 2 285 ? -25.513 6.598   -3.447   1.00 9.73  ? 285 TYR B CE2   1 
ATOM   3211  C  CZ    . TYR B 2 285 ? -25.605 7.234   -4.644   1.00 21.92 ? 285 TYR B CZ    1 
ATOM   3212  O  OH    . TYR B 2 285 ? -25.073 8.489   -4.759   1.00 6.31  ? 285 TYR B OH    1 
ATOM   3213  N  N     . SER B 2 286 ? -28.977 0.720   -4.370   1.00 2.00  ? 286 SER B N     1 
ATOM   3214  C  CA    . SER B 2 286 ? -29.053 -0.705  -4.072   1.00 20.11 ? 286 SER B CA    1 
ATOM   3215  C  C     . SER B 2 286 ? -29.277 -1.512  -5.333   1.00 9.65  ? 286 SER B C     1 
ATOM   3216  O  O     . SER B 2 286 ? -28.924 -2.677  -5.407   1.00 2.03  ? 286 SER B O     1 
ATOM   3217  C  CB    . SER B 2 286 ? -30.203 -0.973  -3.117   1.00 12.06 ? 286 SER B CB    1 
ATOM   3218  O  OG    . SER B 2 286 ? -31.431 -0.920  -3.808   1.00 9.12  ? 286 SER B OG    1 
ATOM   3219  N  N     . VAL B 2 287 ? -29.881 -0.868  -6.318   1.00 2.00  ? 287 VAL B N     1 
ATOM   3220  C  CA    . VAL B 2 287 ? -30.116 -1.468  -7.611   1.00 8.17  ? 287 VAL B CA    1 
ATOM   3221  C  C     . VAL B 2 287 ? -28.796 -1.705  -8.320   1.00 2.00  ? 287 VAL B C     1 
ATOM   3222  O  O     . VAL B 2 287 ? -28.735 -2.406  -9.314   1.00 8.82  ? 287 VAL B O     1 
ATOM   3223  C  CB    . VAL B 2 287 ? -31.045 -0.573  -8.453   1.00 10.04 ? 287 VAL B CB    1 
ATOM   3224  C  CG1   . VAL B 2 287 ? -30.653 -0.565  -9.901   1.00 13.53 ? 287 VAL B CG1   1 
ATOM   3225  C  CG2   . VAL B 2 287 ? -32.472 -0.979  -8.285   1.00 10.85 ? 287 VAL B CG2   1 
ATOM   3226  N  N     . CYS B 2 288 ? -27.735 -1.131  -7.779   1.00 2.00  ? 288 CYS B N     1 
ATOM   3227  C  CA    . CYS B 2 288 ? -26.629 -0.683  -8.592   1.00 11.72 ? 288 CYS B CA    1 
ATOM   3228  C  C     . CYS B 2 288 ? -25.528 -1.715  -8.631   1.00 8.12  ? 288 CYS B C     1 
ATOM   3229  O  O     . CYS B 2 288 ? -24.831 -1.838  -9.624   1.00 19.03 ? 288 CYS B O     1 
ATOM   3230  C  CB    . CYS B 2 288 ? -26.097 0.659   -8.103   1.00 10.37 ? 288 CYS B CB    1 
ATOM   3231  S  SG    . CYS B 2 288 ? -26.464 2.049   -9.179   1.00 27.04 ? 288 CYS B SG    1 
ATOM   3232  N  N     . SER B 2 289 ? -25.378 -2.460  -7.547   1.00 5.25  ? 289 SER B N     1 
ATOM   3233  C  CA    . SER B 2 289 ? -24.553 -3.655  -7.543   1.00 13.33 ? 289 SER B CA    1 
ATOM   3234  C  C     . SER B 2 289 ? -24.622 -4.409  -8.847   1.00 5.71  ? 289 SER B C     1 
ATOM   3235  O  O     . SER B 2 289 ? -23.696 -5.103  -9.207   1.00 14.00 ? 289 SER B O     1 
ATOM   3236  C  CB    . SER B 2 289 ? -24.955 -4.573  -6.398   1.00 6.57  ? 289 SER B CB    1 
ATOM   3237  O  OG    . SER B 2 289 ? -26.142 -5.274  -6.700   1.00 18.74 ? 289 SER B OG    1 
ATOM   3238  N  N     . ARG B 2 290 ? -25.728 -4.276  -9.557   1.00 14.48 ? 290 ARG B N     1 
ATOM   3239  C  CA    . ARG B 2 290 ? -26.155 -5.319  -10.472  1.00 11.76 ? 290 ARG B CA    1 
ATOM   3240  C  C     . ARG B 2 290 ? -26.316 -4.861  -11.911  1.00 5.95  ? 290 ARG B C     1 
ATOM   3241  O  O     . ARG B 2 290 ? -26.477 -5.680  -12.803  1.00 6.44  ? 290 ARG B O     1 
ATOM   3242  C  CB    . ARG B 2 290 ? -27.451 -5.952  -9.987   1.00 20.52 ? 290 ARG B CB    1 
ATOM   3243  C  CG    . ARG B 2 290 ? -28.602 -4.980  -9.894   1.00 27.03 ? 290 ARG B CG    1 
ATOM   3244  C  CD    . ARG B 2 290 ? -29.879 -5.592  -9.376   1.00 28.47 ? 290 ARG B CD    1 
ATOM   3245  N  NE    . ARG B 2 290 ? -29.762 -6.005  -7.982   1.00 24.43 ? 290 ARG B NE    1 
ATOM   3246  C  CZ    . ARG B 2 290 ? -30.633 -5.689  -7.042   1.00 36.18 ? 290 ARG B CZ    1 
ATOM   3247  N  NH1   . ARG B 2 290 ? -31.687 -4.950  -7.337   1.00 8.27  ? 290 ARG B NH1   1 
ATOM   3248  N  NH2   . ARG B 2 290 ? -30.449 -6.115  -5.806   1.00 8.98  ? 290 ARG B NH2   1 
ATOM   3249  N  N     . LEU B 2 291 ? -26.280 -3.553  -12.125  1.00 6.02  ? 291 LEU B N     1 
ATOM   3250  C  CA    . LEU B 2 291 ? -26.559 -2.963  -13.431  1.00 6.02  ? 291 LEU B CA    1 
ATOM   3251  C  C     . LEU B 2 291 ? -25.523 -3.310  -14.473  1.00 4.62  ? 291 LEU B C     1 
ATOM   3252  O  O     . LEU B 2 291 ? -24.340 -3.212  -14.227  1.00 15.06 ? 291 LEU B O     1 
ATOM   3253  C  CB    . LEU B 2 291 ? -26.658 -1.458  -13.313  1.00 3.12  ? 291 LEU B CB    1 
ATOM   3254  C  CG    . LEU B 2 291 ? -27.790 -1.019  -12.410  1.00 27.98 ? 291 LEU B CG    1 
ATOM   3255  C  CD1   . LEU B 2 291 ? -27.809 0.472   -12.272  1.00 2.00  ? 291 LEU B CD1   1 
ATOM   3256  C  CD2   . LEU B 2 291 ? -29.094 -1.540  -12.973  1.00 24.03 ? 291 LEU B CD2   1 
ATOM   3257  N  N     . THR B 2 292 ? -25.969 -3.702  -15.652  1.00 3.33  ? 292 THR B N     1 
ATOM   3258  C  CA    . THR B 2 292 ? -25.058 -3.789  -16.737  1.00 2.00  ? 292 THR B CA    1 
ATOM   3259  C  C     . THR B 2 292 ? -25.270 -2.592  -17.716  1.00 3.24  ? 292 THR B C     1 
ATOM   3260  O  O     . THR B 2 292 ? -24.414 -2.304  -18.538  1.00 2.00  ? 292 THR B O     1 
ATOM   3261  C  CB    . THR B 2 292 ? -25.245 -5.144  -17.475  1.00 12.39 ? 292 THR B CB    1 
ATOM   3262  O  OG1   . THR B 2 292 ? -26.628 -5.383  -17.586  1.00 7.45  ? 292 THR B OG1   1 
ATOM   3263  C  CG2   . THR B 2 292 ? -24.633 -6.360  -16.704  1.00 2.00  ? 292 THR B CG2   1 
ATOM   3264  N  N     . THR B 2 293 ? -26.409 -1.912  -17.663  1.00 2.00  ? 293 THR B N     1 
ATOM   3265  C  CA    . THR B 2 293 ? -26.629 -0.765  -18.511  1.00 2.00  ? 293 THR B CA    1 
ATOM   3266  C  C     . THR B 2 293 ? -27.166 0.413   -17.744  1.00 2.56  ? 293 THR B C     1 
ATOM   3267  O  O     . THR B 2 293 ? -28.205 0.324   -17.074  1.00 2.00  ? 293 THR B O     1 
ATOM   3268  C  CB    . THR B 2 293 ? -27.529 -1.030  -19.728  1.00 5.14  ? 293 THR B CB    1 
ATOM   3269  O  OG1   . THR B 2 293 ? -26.756 -1.710  -20.718  1.00 2.89  ? 293 THR B OG1   1 
ATOM   3270  C  CG2   . THR B 2 293 ? -28.003 0.385   -20.346  1.00 2.00  ? 293 THR B CG2   1 
ATOM   3271  N  N     . LEU B 2 294 ? -26.397 1.502   -17.794  1.00 4.35  ? 294 LEU B N     1 
ATOM   3272  C  CA    . LEU B 2 294 ? -26.817 2.760   -17.163  1.00 2.94  ? 294 LEU B CA    1 
ATOM   3273  C  C     . LEU B 2 294 ? -26.755 3.812   -18.285  1.00 2.03  ? 294 LEU B C     1 
ATOM   3274  O  O     . LEU B 2 294 ? -25.723 3.977   -18.989  1.00 2.00  ? 294 LEU B O     1 
ATOM   3275  C  CB    . LEU B 2 294 ? -25.920 3.092   -15.992  1.00 2.00  ? 294 LEU B CB    1 
ATOM   3276  C  CG    . LEU B 2 294 ? -26.233 4.201   -14.987  1.00 2.33  ? 294 LEU B CG    1 
ATOM   3277  C  CD1   . LEU B 2 294 ? -27.570 4.008   -14.328  1.00 2.00  ? 294 LEU B CD1   1 
ATOM   3278  C  CD2   . LEU B 2 294 ? -25.066 4.313   -13.882  1.00 2.00  ? 294 LEU B CD2   1 
ATOM   3279  N  N     . ASN B 2 295 ? -27.885 4.502   -18.469  1.00 5.19  ? 295 ASN B N     1 
ATOM   3280  C  CA    . ASN B 2 295 ? -27.964 5.635   -19.438  1.00 11.01 ? 295 ASN B CA    1 
ATOM   3281  C  C     . ASN B 2 295 ? -28.303 6.933   -18.706  1.00 2.00  ? 295 ASN B C     1 
ATOM   3282  O  O     . ASN B 2 295 ? -29.474 7.180   -18.293  1.00 2.00  ? 295 ASN B O     1 
ATOM   3283  C  CB    . ASN B 2 295 ? -29.084 5.362   -20.476  1.00 2.29  ? 295 ASN B CB    1 
ATOM   3284  C  CG    . ASN B 2 295 ? -29.221 6.494   -21.496  1.00 22.41 ? 295 ASN B CG    1 
ATOM   3285  O  OD1   . ASN B 2 295 ? -28.668 7.595   -21.335  1.00 11.52 ? 295 ASN B OD1   1 
ATOM   3286  N  ND2   . ASN B 2 295 ? -29.932 6.212   -22.573  1.00 9.21  ? 295 ASN B ND2   1 
ATOM   3287  N  N     . LEU B 2 296 ? -27.298 7.760   -18.514  1.00 2.38  ? 296 LEU B N     1 
ATOM   3288  C  CA    . LEU B 2 296 ? -27.568 9.014   -17.751  1.00 11.43 ? 296 LEU B CA    1 
ATOM   3289  C  C     . LEU B 2 296 ? -27.659 10.271  -18.618  1.00 5.89  ? 296 LEU B C     1 
ATOM   3290  O  O     . LEU B 2 296 ? -27.523 11.372  -18.182  1.00 10.93 ? 296 LEU B O     1 
ATOM   3291  C  CB    . LEU B 2 296 ? -26.532 9.180   -16.635  1.00 9.04  ? 296 LEU B CB    1 
ATOM   3292  C  CG    . LEU B 2 296 ? -26.739 8.207   -15.456  1.00 17.58 ? 296 LEU B CG    1 
ATOM   3293  C  CD1   . LEU B 2 296 ? -25.338 7.724   -15.071  1.00 6.91  ? 296 LEU B CD1   1 
ATOM   3294  C  CD2   . LEU B 2 296 ? -27.523 8.844   -14.240  1.00 2.00  ? 296 LEU B CD2   1 
ATOM   3295  N  N     . SER B 2 297 ? -27.930 10.080  -19.869  1.00 6.09  ? 297 SER B N     1 
ATOM   3296  C  CA    . SER B 2 297 ? -27.626 11.043  -20.838  1.00 10.31 ? 297 SER B CA    1 
ATOM   3297  C  C     . SER B 2 297 ? -28.602 12.234  -20.805  1.00 11.43 ? 297 SER B C     1 
ATOM   3298  O  O     . SER B 2 297 ? -28.371 13.250  -21.510  1.00 15.17 ? 297 SER B O     1 
ATOM   3299  C  CB    . SER B 2 297 ? -27.455 10.347  -22.254  1.00 7.49  ? 297 SER B CB    1 
ATOM   3300  O  OG    . SER B 2 297 ? -28.660 9.988   -22.883  1.00 7.17  ? 297 SER B OG    1 
ATOM   3301  N  N     . TYR B 2 298 ? -29.663 12.150  -19.994  1.00 3.92  ? 298 TYR B N     1 
ATOM   3302  C  CA    . TYR B 2 298 ? -30.414 13.347  -19.749  1.00 2.00  ? 298 TYR B CA    1 
ATOM   3303  C  C     . TYR B 2 298 ? -30.313 13.849  -18.338  1.00 10.14 ? 298 TYR B C     1 
ATOM   3304  O  O     . TYR B 2 298 ? -31.089 14.741  -18.016  1.00 4.04  ? 298 TYR B O     1 
ATOM   3305  C  CB    . TYR B 2 298 ? -31.886 13.118  -19.926  1.00 3.25  ? 298 TYR B CB    1 
ATOM   3306  C  CG    . TYR B 2 298 ? -32.318 12.383  -21.137  1.00 8.09  ? 298 TYR B CG    1 
ATOM   3307  C  CD1   . TYR B 2 298 ? -33.496 11.652  -21.115  1.00 18.79 ? 298 TYR B CD1   1 
ATOM   3308  C  CD2   . TYR B 2 298 ? -31.613 12.459  -22.310  1.00 5.90  ? 298 TYR B CD2   1 
ATOM   3309  C  CE1   . TYR B 2 298 ? -33.950 10.976  -22.212  1.00 20.82 ? 298 TYR B CE1   1 
ATOM   3310  C  CE2   . TYR B 2 298 ? -32.037 11.757  -23.467  1.00 11.38 ? 298 TYR B CE2   1 
ATOM   3311  C  CZ    . TYR B 2 298 ? -33.204 11.001  -23.393  1.00 47.88 ? 298 TYR B CZ    1 
ATOM   3312  O  OH    . TYR B 2 298 ? -33.662 10.284  -24.496  1.00 54.47 ? 298 TYR B OH    1 
ATOM   3313  N  N     . ALA B 2 299 ? -29.462 13.277  -17.461  1.00 4.78  ? 299 ALA B N     1 
ATOM   3314  C  CA    . ALA B 2 299 ? -29.258 13.873  -16.122  1.00 11.87 ? 299 ALA B CA    1 
ATOM   3315  C  C     . ALA B 2 299 ? -28.290 14.992  -16.315  1.00 7.16  ? 299 ALA B C     1 
ATOM   3316  O  O     . ALA B 2 299 ? -27.268 14.795  -16.987  1.00 6.38  ? 299 ALA B O     1 
ATOM   3317  C  CB    . ALA B 2 299 ? -28.661 12.886  -15.116  1.00 5.41  ? 299 ALA B CB    1 
ATOM   3318  N  N     . THR B 2 300 ? -28.570 16.135  -15.713  1.00 4.72  ? 300 THR B N     1 
ATOM   3319  C  CA    . THR B 2 300 ? -27.671 17.269  -15.857  1.00 23.88 ? 300 THR B CA    1 
ATOM   3320  C  C     . THR B 2 300 ? -26.860 17.471  -14.626  1.00 16.49 ? 300 THR B C     1 
ATOM   3321  O  O     . THR B 2 300 ? -26.367 18.570  -14.416  1.00 30.61 ? 300 THR B O     1 
ATOM   3322  C  CB    . THR B 2 300 ? -28.358 18.610  -16.229  1.00 25.48 ? 300 THR B CB    1 
ATOM   3323  O  OG1   . THR B 2 300 ? -29.659 18.339  -16.738  1.00 27.59 ? 300 THR B OG1   1 
ATOM   3324  C  CG2   . THR B 2 300 ? -27.565 19.285  -17.358  1.00 27.63 ? 300 THR B CG2   1 
ATOM   3325  N  N     . VAL B 2 301 ? -26.689 16.405  -13.841  1.00 11.77 ? 301 VAL B N     1 
ATOM   3326  C  CA    . VAL B 2 301 ? -25.946 16.465  -12.591  1.00 2.00  ? 301 VAL B CA    1 
ATOM   3327  C  C     . VAL B 2 301 ? -24.359 16.478  -12.666  1.00 2.00  ? 301 VAL B C     1 
ATOM   3328  O  O     . VAL B 2 301 ? -23.754 15.985  -13.600  1.00 5.18  ? 301 VAL B O     1 
ATOM   3329  C  CB    . VAL B 2 301 ? -26.354 15.293  -11.652  1.00 7.18  ? 301 VAL B CB    1 
ATOM   3330  C  CG1   . VAL B 2 301 ? -27.767 15.374  -11.186  1.00 2.00  ? 301 VAL B CG1   1 
ATOM   3331  C  CG2   . VAL B 2 301 ? -25.926 13.950  -12.239  1.00 2.02  ? 301 VAL B CG2   1 
ATOM   3332  N  N     . GLN B 2 302 ? -23.689 16.971  -11.632  1.00 2.88  ? 302 GLN B N     1 
ATOM   3333  C  CA    . GLN B 2 302 ? -22.289 17.325  -11.746  1.00 7.57  ? 302 GLN B CA    1 
ATOM   3334  C  C     . GLN B 2 302 ? -21.374 16.112  -11.553  1.00 8.69  ? 302 GLN B C     1 
ATOM   3335  O  O     . GLN B 2 302 ? -21.757 15.070  -11.003  1.00 8.34  ? 302 GLN B O     1 
ATOM   3336  C  CB    . GLN B 2 302 ? -21.968 18.409  -10.689  1.00 5.98  ? 302 GLN B CB    1 
ATOM   3337  C  CG    . GLN B 2 302 ? -22.064 19.847  -11.196  1.00 23.08 ? 302 GLN B CG    1 
ATOM   3338  C  CD    . GLN B 2 302 ? -22.629 19.950  -12.625  1.00 60.41 ? 302 GLN B CD    1 
ATOM   3339  O  OE1   . GLN B 2 302 ? -23.843 19.770  -12.819  1.00 51.91 ? 302 GLN B OE1   1 
ATOM   3340  N  NE2   . GLN B 2 302 ? -21.750 20.252  -13.635  1.00 26.64 ? 302 GLN B NE2   1 
ATOM   3341  N  N     . SER B 2 303 ? -20.130 16.271  -11.947  1.00 3.01  ? 303 SER B N     1 
ATOM   3342  C  CA    . SER B 2 303 ? -19.299 15.133  -12.077  1.00 2.00  ? 303 SER B CA    1 
ATOM   3343  C  C     . SER B 2 303 ? -19.215 14.354  -10.753  1.00 7.22  ? 303 SER B C     1 
ATOM   3344  O  O     . SER B 2 303 ? -19.230 13.097  -10.675  1.00 3.08  ? 303 SER B O     1 
ATOM   3345  C  CB    . SER B 2 303 ? -17.928 15.614  -12.435  1.00 2.00  ? 303 SER B CB    1 
ATOM   3346  O  OG    . SER B 2 303 ? -16.978 14.615  -12.075  1.00 4.42  ? 303 SER B OG    1 
ATOM   3347  N  N     . TYR B 2 304 ? -19.089 15.117  -9.694   1.00 2.00  ? 304 TYR B N     1 
ATOM   3348  C  CA    . TYR B 2 304 ? -19.095 14.505  -8.397   1.00 9.18  ? 304 TYR B CA    1 
ATOM   3349  C  C     . TYR B 2 304 ? -20.313 13.558  -8.094   1.00 9.90  ? 304 TYR B C     1 
ATOM   3350  O  O     . TYR B 2 304 ? -20.149 12.481  -7.553   1.00 5.44  ? 304 TYR B O     1 
ATOM   3351  C  CB    . TYR B 2 304 ? -18.910 15.554  -7.322   1.00 2.00  ? 304 TYR B CB    1 
ATOM   3352  C  CG    . TYR B 2 304 ? -18.613 14.903  -6.048   1.00 10.49 ? 304 TYR B CG    1 
ATOM   3353  C  CD1   . TYR B 2 304 ? -17.391 14.222  -5.826   1.00 2.00  ? 304 TYR B CD1   1 
ATOM   3354  C  CD2   . TYR B 2 304 ? -19.581 14.862  -5.058   1.00 5.96  ? 304 TYR B CD2   1 
ATOM   3355  C  CE1   . TYR B 2 304 ? -17.215 13.542  -4.609   1.00 2.52  ? 304 TYR B CE1   1 
ATOM   3356  C  CE2   . TYR B 2 304 ? -19.369 14.229  -3.876   1.00 2.00  ? 304 TYR B CE2   1 
ATOM   3357  C  CZ    . TYR B 2 304 ? -18.212 13.580  -3.650   1.00 2.00  ? 304 TYR B CZ    1 
ATOM   3358  O  OH    . TYR B 2 304 ? -18.084 13.001  -2.394   1.00 5.33  ? 304 TYR B OH    1 
ATOM   3359  N  N     . ASP B 2 305 ? -21.534 13.973  -8.415   1.00 13.19 ? 305 ASP B N     1 
ATOM   3360  C  CA    . ASP B 2 305 ? -22.673 13.135  -8.046   1.00 8.93  ? 305 ASP B CA    1 
ATOM   3361  C  C     . ASP B 2 305 ? -22.633 11.916  -8.981   1.00 12.16 ? 305 ASP B C     1 
ATOM   3362  O  O     . ASP B 2 305 ? -22.902 10.829  -8.512   1.00 6.31  ? 305 ASP B O     1 
ATOM   3363  C  CB    . ASP B 2 305 ? -24.039 13.825  -8.257   1.00 8.25  ? 305 ASP B CB    1 
ATOM   3364  C  CG    . ASP B 2 305 ? -24.233 15.074  -7.413   1.00 2.00  ? 305 ASP B CG    1 
ATOM   3365  O  OD1   . ASP B 2 305 ? -24.622 14.936  -6.250   1.00 4.59  ? 305 ASP B OD1   1 
ATOM   3366  O  OD2   . ASP B 2 305 ? -24.047 16.193  -7.961   1.00 32.07 ? 305 ASP B OD2   1 
ATOM   3367  N  N     . LEU B 2 306 ? -22.327 12.086  -10.282  1.00 2.00  ? 306 LEU B N     1 
ATOM   3368  C  CA    . LEU B 2 306 ? -22.178 10.923  -11.185  1.00 4.03  ? 306 LEU B CA    1 
ATOM   3369  C  C     . LEU B 2 306 ? -21.253 9.908   -10.511  1.00 9.37  ? 306 LEU B C     1 
ATOM   3370  O  O     . LEU B 2 306 ? -21.600 8.748   -10.390  1.00 18.01 ? 306 LEU B O     1 
ATOM   3371  C  CB    . LEU B 2 306 ? -21.648 11.263  -12.584  1.00 2.00  ? 306 LEU B CB    1 
ATOM   3372  C  CG    . LEU B 2 306 ? -22.521 12.174  -13.496  1.00 5.81  ? 306 LEU B CG    1 
ATOM   3373  C  CD1   . LEU B 2 306 ? -21.814 12.829  -14.711  1.00 2.00  ? 306 LEU B CD1   1 
ATOM   3374  C  CD2   . LEU B 2 306 ? -23.830 11.669  -13.795  1.00 2.00  ? 306 LEU B CD2   1 
ATOM   3375  N  N     . VAL B 2 307 ? -20.090 10.365  -10.062  1.00 10.43 ? 307 VAL B N     1 
ATOM   3376  C  CA    . VAL B 2 307 ? -19.041 9.490   -9.579   1.00 8.28  ? 307 VAL B CA    1 
ATOM   3377  C  C     . VAL B 2 307 ? -19.668 8.699   -8.400   1.00 15.69 ? 307 VAL B C     1 
ATOM   3378  O  O     . VAL B 2 307 ? -19.585 7.460   -8.289   1.00 3.10  ? 307 VAL B O     1 
ATOM   3379  C  CB    . VAL B 2 307 ? -17.899 10.400  -8.985   1.00 6.94  ? 307 VAL B CB    1 
ATOM   3380  C  CG1   . VAL B 2 307 ? -17.128 9.633   -8.004   1.00 14.73 ? 307 VAL B CG1   1 
ATOM   3381  C  CG2   . VAL B 2 307 ? -16.938 10.864  -10.098  1.00 2.00  ? 307 VAL B CG2   1 
ATOM   3382  N  N     . LYS B 2 308 ? -20.327 9.410   -7.515   1.00 2.00  ? 308 LYS B N     1 
ATOM   3383  C  CA    . LYS B 2 308 ? -20.815 8.732   -6.357   1.00 8.11  ? 308 LYS B CA    1 
ATOM   3384  C  C     . LYS B 2 308 ? -21.661 7.489   -6.743   1.00 10.97 ? 308 LYS B C     1 
ATOM   3385  O  O     . LYS B 2 308 ? -21.709 6.486   -6.018   1.00 7.70  ? 308 LYS B O     1 
ATOM   3386  C  CB    . LYS B 2 308 ? -21.606 9.716   -5.494   1.00 2.00  ? 308 LYS B CB    1 
ATOM   3387  C  CG    . LYS B 2 308 ? -20.734 10.505  -4.716   1.00 2.00  ? 308 LYS B CG    1 
ATOM   3388  C  CD    . LYS B 2 308 ? -21.475 10.936  -3.517   1.00 16.43 ? 308 LYS B CD    1 
ATOM   3389  C  CE    . LYS B 2 308 ? -22.292 12.170  -3.741   1.00 2.00  ? 308 LYS B CE    1 
ATOM   3390  N  NZ    . LYS B 2 308 ? -23.158 12.327  -2.555   1.00 2.82  ? 308 LYS B NZ    1 
ATOM   3391  N  N     . LEU B 2 309 ? -22.353 7.605   -7.880   1.00 12.31 ? 309 LEU B N     1 
ATOM   3392  C  CA    . LEU B 2 309 ? -23.259 6.610   -8.395   1.00 6.19  ? 309 LEU B CA    1 
ATOM   3393  C  C     . LEU B 2 309 ? -22.416 5.528   -9.083   1.00 12.64 ? 309 LEU B C     1 
ATOM   3394  O  O     . LEU B 2 309 ? -22.566 4.319   -8.809   1.00 2.81  ? 309 LEU B O     1 
ATOM   3395  C  CB    . LEU B 2 309 ? -24.167 7.287   -9.443   1.00 2.00  ? 309 LEU B CB    1 
ATOM   3396  C  CG    . LEU B 2 309 ? -25.184 6.463   -10.284  1.00 5.60  ? 309 LEU B CG    1 
ATOM   3397  C  CD1   . LEU B 2 309 ? -26.005 5.507   -9.416   1.00 7.05  ? 309 LEU B CD1   1 
ATOM   3398  C  CD2   . LEU B 2 309 ? -26.203 7.384   -10.943  1.00 21.52 ? 309 LEU B CD2   1 
ATOM   3399  N  N     . LEU B 2 310 ? -21.576 5.959   -10.021  1.00 2.00  ? 310 LEU B N     1 
ATOM   3400  C  CA    . LEU B 2 310 ? -20.697 5.046   -10.681  1.00 4.46  ? 310 LEU B CA    1 
ATOM   3401  C  C     . LEU B 2 310 ? -19.983 4.132   -9.669   1.00 10.01 ? 310 LEU B C     1 
ATOM   3402  O  O     . LEU B 2 310 ? -19.827 2.951   -9.910   1.00 6.69  ? 310 LEU B O     1 
ATOM   3403  C  CB    . LEU B 2 310 ? -19.699 5.797   -11.567  1.00 2.00  ? 310 LEU B CB    1 
ATOM   3404  C  CG    . LEU B 2 310 ? -20.518 6.388   -12.744  1.00 6.44  ? 310 LEU B CG    1 
ATOM   3405  C  CD1   . LEU B 2 310 ? -19.632 6.970   -13.869  1.00 2.00  ? 310 LEU B CD1   1 
ATOM   3406  C  CD2   . LEU B 2 310 ? -21.551 5.377   -13.362  1.00 10.21 ? 310 LEU B CD2   1 
ATOM   3407  N  N     . CYS B 2 311 ? -19.527 4.705   -8.566   1.00 2.00  ? 311 CYS B N     1 
ATOM   3408  C  CA    . CYS B 2 311 ? -18.708 4.003   -7.635   1.00 8.31  ? 311 CYS B CA    1 
ATOM   3409  C  C     . CYS B 2 311 ? -19.303 2.694   -7.295   1.00 4.95  ? 311 CYS B C     1 
ATOM   3410  O  O     . CYS B 2 311 ? -18.594 1.846   -6.771   1.00 2.00  ? 311 CYS B O     1 
ATOM   3411  C  CB    . CYS B 2 311 ? -18.439 4.808   -6.319   1.00 3.19  ? 311 CYS B CB    1 
ATOM   3412  S  SG    . CYS B 2 311 ? -16.880 5.594   -6.746   1.00 18.17 ? 311 CYS B SG    1 
ATOM   3413  N  N     . GLN B 2 312 ? -20.582 2.517   -7.613   1.00 2.01  ? 312 GLN B N     1 
ATOM   3414  C  CA    . GLN B 2 312 ? -21.219 1.282   -7.268   1.00 2.00  ? 312 GLN B CA    1 
ATOM   3415  C  C     . GLN B 2 312 ? -21.901 0.449   -8.299   1.00 7.43  ? 312 GLN B C     1 
ATOM   3416  O  O     . GLN B 2 312 ? -22.884 -0.266  -7.971   1.00 3.68  ? 312 GLN B O     1 
ATOM   3417  C  CB    . GLN B 2 312 ? -22.064 1.348   -6.026   1.00 16.12 ? 312 GLN B CB    1 
ATOM   3418  C  CG    . GLN B 2 312 ? -22.820 2.581   -5.811   1.00 2.00  ? 312 GLN B CG    1 
ATOM   3419  C  CD    . GLN B 2 312 ? -23.011 2.720   -4.315   1.00 11.96 ? 312 GLN B CD    1 
ATOM   3420  O  OE1   . GLN B 2 312 ? -22.905 1.711   -3.589   1.00 13.04 ? 312 GLN B OE1   1 
ATOM   3421  N  NE2   . GLN B 2 312 ? -23.235 3.943   -3.833   1.00 27.11 ? 312 GLN B NE2   1 
ATOM   3422  N  N     . CYS B 2 313 ? -21.323 0.469   -9.483   1.00 2.00  ? 313 CYS B N     1 
ATOM   3423  C  CA    . CYS B 2 313 ? -21.828 -0.247  -10.578  1.00 2.00  ? 313 CYS B CA    1 
ATOM   3424  C  C     . CYS B 2 313 ? -20.673 -1.109  -11.061  1.00 2.00  ? 313 CYS B C     1 
ATOM   3425  O  O     . CYS B 2 313 ? -20.122 -0.886  -12.147  1.00 2.11  ? 313 CYS B O     1 
ATOM   3426  C  CB    . CYS B 2 313 ? -22.231 0.782   -11.655  1.00 2.00  ? 313 CYS B CB    1 
ATOM   3427  S  SG    . CYS B 2 313 ? -23.583 1.784   -10.913  1.00 7.23  ? 313 CYS B SG    1 
ATOM   3428  N  N     . PRO B 2 314 ? -20.214 -2.008  -10.210  1.00 2.00  ? 314 PRO B N     1 
ATOM   3429  C  CA    . PRO B 2 314 ? -19.107 -2.838  -10.653  1.00 2.11  ? 314 PRO B CA    1 
ATOM   3430  C  C     . PRO B 2 314 ? -19.346 -3.718  -11.872  1.00 3.81  ? 314 PRO B C     1 
ATOM   3431  O  O     . PRO B 2 314 ? -18.379 -4.027  -12.595  1.00 2.00  ? 314 PRO B O     1 
ATOM   3432  C  CB    . PRO B 2 314 ? -18.699 -3.624  -9.389   1.00 2.01  ? 314 PRO B CB    1 
ATOM   3433  C  CG    . PRO B 2 314 ? -19.883 -3.487  -8.430   1.00 2.00  ? 314 PRO B CG    1 
ATOM   3434  C  CD    . PRO B 2 314 ? -20.552 -2.195  -8.777   1.00 2.00  ? 314 PRO B CD    1 
ATOM   3435  N  N     . LYS B 2 315 ? -20.601 -4.080  -12.144  1.00 2.80  ? 315 LYS B N     1 
ATOM   3436  C  CA    . LYS B 2 315 ? -20.814 -4.962  -13.266  1.00 2.00  ? 315 LYS B CA    1 
ATOM   3437  C  C     . LYS B 2 315 ? -21.153 -4.219  -14.514  1.00 8.17  ? 315 LYS B C     1 
ATOM   3438  O  O     . LYS B 2 315 ? -21.562 -4.835  -15.483  1.00 7.95  ? 315 LYS B O     1 
ATOM   3439  C  CB    . LYS B 2 315 ? -21.886 -5.962  -12.981  1.00 2.00  ? 315 LYS B CB    1 
ATOM   3440  C  CG    . LYS B 2 315 ? -21.370 -7.164  -12.094  1.00 2.00  ? 315 LYS B CG    1 
ATOM   3441  C  CD    . LYS B 2 315 ? -22.505 -7.763  -11.369  1.00 2.00  ? 315 LYS B CD    1 
ATOM   3442  C  CE    . LYS B 2 315 ? -22.100 -9.097  -10.681  1.00 18.40 ? 315 LYS B CE    1 
ATOM   3443  N  NZ    . LYS B 2 315 ? -21.002 -9.699  -11.484  1.00 23.38 ? 315 LYS B NZ    1 
ATOM   3444  N  N     . LEU B 2 316 ? -21.008 -2.890  -14.496  1.00 6.94  ? 316 LEU B N     1 
ATOM   3445  C  CA    . LEU B 2 316 ? -21.520 -2.031  -15.530  1.00 5.12  ? 316 LEU B CA    1 
ATOM   3446  C  C     . LEU B 2 316 ? -20.889 -2.368  -16.867  1.00 4.56  ? 316 LEU B C     1 
ATOM   3447  O  O     . LEU B 2 316 ? -19.687 -2.438  -16.915  1.00 8.87  ? 316 LEU B O     1 
ATOM   3448  C  CB    . LEU B 2 316 ? -21.208 -0.578  -15.169  1.00 9.36  ? 316 LEU B CB    1 
ATOM   3449  C  CG    . LEU B 2 316 ? -22.105 0.498   -15.799  1.00 5.35  ? 316 LEU B CG    1 
ATOM   3450  C  CD1   . LEU B 2 316 ? -23.506 0.267   -15.350  1.00 3.43  ? 316 LEU B CD1   1 
ATOM   3451  C  CD2   . LEU B 2 316 ? -21.658 1.894   -15.398  1.00 5.16  ? 316 LEU B CD2   1 
ATOM   3452  N  N     . GLN B 2 317 ? -21.671 -2.603  -17.944  1.00 2.00  ? 317 GLN B N     1 
ATOM   3453  C  CA    . GLN B 2 317 ? -21.105 -3.048  -19.187  1.00 2.00  ? 317 GLN B CA    1 
ATOM   3454  C  C     . GLN B 2 317 ? -21.171 -1.975  -20.236  1.00 2.00  ? 317 GLN B C     1 
ATOM   3455  O  O     . GLN B 2 317 ? -20.384 -1.968  -21.202  1.00 2.00  ? 317 GLN B O     1 
ATOM   3456  C  CB    . GLN B 2 317 ? -21.860 -4.253  -19.699  1.00 4.22  ? 317 GLN B CB    1 
ATOM   3457  C  CG    . GLN B 2 317 ? -21.467 -5.563  -19.089  1.00 8.97  ? 317 GLN B CG    1 
ATOM   3458  C  CD    . GLN B 2 317 ? -22.111 -6.784  -19.782  1.00 5.26  ? 317 GLN B CD    1 
ATOM   3459  O  OE1   . GLN B 2 317 ? -21.459 -7.803  -19.967  1.00 18.69 ? 317 GLN B OE1   1 
ATOM   3460  N  NE2   . GLN B 2 317 ? -23.373 -6.686  -20.132  1.00 7.44  ? 317 GLN B NE2   1 
ATOM   3461  N  N     . ARG B 2 318 ? -22.151 -1.087  -20.013  1.00 2.00  ? 318 ARG B N     1 
ATOM   3462  C  CA    . ARG B 2 318 ? -22.603 0.014   -20.928  1.00 5.82  ? 318 ARG B CA    1 
ATOM   3463  C  C     . ARG B 2 318 ? -23.039 1.237   -20.151  1.00 2.00  ? 318 ARG B C     1 
ATOM   3464  O  O     . ARG B 2 318 ? -23.987 1.121   -19.330  1.00 2.60  ? 318 ARG B O     1 
ATOM   3465  C  CB    . ARG B 2 318 ? -23.794 -0.348  -21.829  1.00 2.13  ? 318 ARG B CB    1 
ATOM   3466  C  CG    . ARG B 2 318 ? -24.167 0.861   -22.743  1.00 9.36  ? 318 ARG B CG    1 
ATOM   3467  C  CD    . ARG B 2 318 ? -25.335 0.611   -23.808  1.00 21.64 ? 318 ARG B CD    1 
ATOM   3468  N  NE    . ARG B 2 318 ? -25.029 -0.565  -24.610  1.00 46.11 ? 318 ARG B NE    1 
ATOM   3469  C  CZ    . ARG B 2 318 ? -25.778 -1.657  -24.633  1.00 53.34 ? 318 ARG B CZ    1 
ATOM   3470  N  NH1   . ARG B 2 318 ? -26.940 -1.701  -23.938  1.00 26.27 ? 318 ARG B NH1   1 
ATOM   3471  N  NH2   . ARG B 2 318 ? -25.344 -2.697  -25.355  1.00 25.03 ? 318 ARG B NH2   1 
ATOM   3472  N  N     . LEU B 2 319 ? -22.313 2.345   -20.376  1.00 2.00  ? 319 LEU B N     1 
ATOM   3473  C  CA    . LEU B 2 319 ? -22.632 3.694   -19.858  1.00 4.70  ? 319 LEU B CA    1 
ATOM   3474  C  C     . LEU B 2 319 ? -22.842 4.734   -20.985  1.00 2.03  ? 319 LEU B C     1 
ATOM   3475  O  O     . LEU B 2 319 ? -21.990 4.974   -21.791  1.00 2.05  ? 319 LEU B O     1 
ATOM   3476  C  CB    . LEU B 2 319 ? -21.423 4.262   -19.105  1.00 10.69 ? 319 LEU B CB    1 
ATOM   3477  C  CG    . LEU B 2 319 ? -21.636 5.588   -18.322  1.00 2.00  ? 319 LEU B CG    1 
ATOM   3478  C  CD1   . LEU B 2 319 ? -22.921 5.512   -17.452  1.00 2.00  ? 319 LEU B CD1   1 
ATOM   3479  C  CD2   . LEU B 2 319 ? -20.376 5.965   -17.521  1.00 2.00  ? 319 LEU B CD2   1 
ATOM   3480  N  N     . TRP B 2 320 ? -23.955 5.379   -20.959  1.00 2.00  ? 320 TRP B N     1 
ATOM   3481  C  CA    . TRP B 2 320 ? -24.181 6.557   -21.741  1.00 10.00 ? 320 TRP B CA    1 
ATOM   3482  C  C     . TRP B 2 320 ? -24.375 7.696   -20.676  1.00 7.01  ? 320 TRP B C     1 
ATOM   3483  O  O     . TRP B 2 320 ? -25.248 7.585   -19.738  1.00 13.62 ? 320 TRP B O     1 
ATOM   3484  C  CB    . TRP B 2 320 ? -25.492 6.402   -22.573  1.00 2.00  ? 320 TRP B CB    1 
ATOM   3485  C  CG    . TRP B 2 320 ? -25.460 5.402   -23.659  1.00 5.16  ? 320 TRP B CG    1 
ATOM   3486  C  CD1   . TRP B 2 320 ? -24.541 4.441   -23.845  1.00 4.68  ? 320 TRP B CD1   1 
ATOM   3487  C  CD2   . TRP B 2 320 ? -26.381 5.321   -24.790  1.00 5.76  ? 320 TRP B CD2   1 
ATOM   3488  N  NE1   . TRP B 2 320 ? -24.820 3.758   -25.023  1.00 17.55 ? 320 TRP B NE1   1 
ATOM   3489  C  CE2   . TRP B 2 320 ? -25.929 4.274   -25.612  1.00 2.00  ? 320 TRP B CE2   1 
ATOM   3490  C  CE3   . TRP B 2 320 ? -27.523 6.070   -25.179  1.00 2.00  ? 320 TRP B CE3   1 
ATOM   3491  C  CZ2   . TRP B 2 320 ? -26.550 3.925   -26.781  1.00 8.16  ? 320 TRP B CZ2   1 
ATOM   3492  C  CZ3   . TRP B 2 320 ? -28.184 5.717   -26.361  1.00 2.00  ? 320 TRP B CZ3   1 
ATOM   3493  C  CH2   . TRP B 2 320 ? -27.718 4.624   -27.133  1.00 6.81  ? 320 TRP B CH2   1 
ATOM   3494  N  N     . VAL B 2 321 ? -23.620 8.784   -20.843  1.00 9.02  ? 321 VAL B N     1 
ATOM   3495  C  CA    . VAL B 2 321 ? -23.636 9.911   -19.878  1.00 8.70  ? 321 VAL B CA    1 
ATOM   3496  C  C     . VAL B 2 321 ? -23.328 11.247  -20.494  1.00 2.04  ? 321 VAL B C     1 
ATOM   3497  O  O     . VAL B 2 321 ? -22.537 11.316  -21.458  1.00 5.34  ? 321 VAL B O     1 
ATOM   3498  C  CB    . VAL B 2 321 ? -22.363 9.840   -19.016  1.00 7.02  ? 321 VAL B CB    1 
ATOM   3499  C  CG1   . VAL B 2 321 ? -22.534 10.016  -17.591  1.00 5.10  ? 321 VAL B CG1   1 
ATOM   3500  C  CG2   . VAL B 2 321 ? -21.157 9.045   -19.627  1.00 10.49 ? 321 VAL B CG2   1 
ATOM   3501  N  N     . LEU B 2 322 ? -23.733 12.325  -19.826  1.00 3.08  ? 322 LEU B N     1 
ATOM   3502  C  CA    . LEU B 2 322 ? -23.210 13.598  -20.201  1.00 2.00  ? 322 LEU B CA    1 
ATOM   3503  C  C     . LEU B 2 322 ? -21.683 13.849  -19.971  1.00 11.36 ? 322 LEU B C     1 
ATOM   3504  O  O     . LEU B 2 322 ? -21.046 13.288  -19.016  1.00 2.00  ? 322 LEU B O     1 
ATOM   3505  C  CB    . LEU B 2 322 ? -24.105 14.684  -19.671  1.00 2.68  ? 322 LEU B CB    1 
ATOM   3506  C  CG    . LEU B 2 322 ? -25.431 14.827  -20.419  1.00 2.73  ? 322 LEU B CG    1 
ATOM   3507  C  CD1   . LEU B 2 322 ? -26.328 15.776  -19.638  1.00 2.00  ? 322 LEU B CD1   1 
ATOM   3508  C  CD2   . LEU B 2 322 ? -25.226 15.368  -21.883  1.00 2.00  ? 322 LEU B CD2   1 
ATOM   3509  N  N     . ASP B 2 323 ? -21.095 14.677  -20.847  1.00 2.00  ? 323 ASP B N     1 
ATOM   3510  C  CA    . ASP B 2 323 ? -19.748 15.235  -20.578  1.00 3.23  ? 323 ASP B CA    1 
ATOM   3511  C  C     . ASP B 2 323 ? -19.490 15.831  -19.204  1.00 2.00  ? 323 ASP B C     1 
ATOM   3512  O  O     . ASP B 2 323 ? -18.332 15.963  -18.828  1.00 3.15  ? 323 ASP B O     1 
ATOM   3513  C  CB    . ASP B 2 323 ? -19.174 16.143  -21.666  1.00 2.00  ? 323 ASP B CB    1 
ATOM   3514  C  CG    . ASP B 2 323 ? -19.975 17.436  -21.851  1.00 2.00  ? 323 ASP B CG    1 
ATOM   3515  O  OD1   . ASP B 2 323 ? -20.822 17.846  -21.026  1.00 4.65  ? 323 ASP B OD1   1 
ATOM   3516  O  OD2   . ASP B 2 323 ? -19.777 18.073  -22.886  1.00 2.02  ? 323 ASP B OD2   1 
ATOM   3517  N  N     . TYR B 2 324 ? -20.534 16.152  -18.460  1.00 2.00  ? 324 TYR B N     1 
ATOM   3518  C  CA    . TYR B 2 324 ? -20.398 16.556  -17.075  1.00 2.00  ? 324 TYR B CA    1 
ATOM   3519  C  C     . TYR B 2 324 ? -19.564 15.587  -16.237  1.00 9.19  ? 324 TYR B C     1 
ATOM   3520  O  O     . TYR B 2 324 ? -19.094 15.924  -15.170  1.00 4.66  ? 324 TYR B O     1 
ATOM   3521  C  CB    . TYR B 2 324 ? -21.771 16.770  -16.449  1.00 3.25  ? 324 TYR B CB    1 
ATOM   3522  C  CG    . TYR B 2 324 ? -22.498 18.015  -16.901  1.00 2.00  ? 324 TYR B CG    1 
ATOM   3523  C  CD1   . TYR B 2 324 ? -23.807 17.961  -17.306  1.00 2.00  ? 324 TYR B CD1   1 
ATOM   3524  C  CD2   . TYR B 2 324 ? -21.872 19.241  -16.919  1.00 25.38 ? 324 TYR B CD2   1 
ATOM   3525  C  CE1   . TYR B 2 324 ? -24.459 19.077  -17.711  1.00 6.34  ? 324 TYR B CE1   1 
ATOM   3526  C  CE2   . TYR B 2 324 ? -22.526 20.361  -17.330  1.00 2.00  ? 324 TYR B CE2   1 
ATOM   3527  C  CZ    . TYR B 2 324 ? -23.819 20.278  -17.714  1.00 2.56  ? 324 TYR B CZ    1 
ATOM   3528  O  OH    . TYR B 2 324 ? -24.484 21.393  -18.130  1.00 2.00  ? 324 TYR B OH    1 
ATOM   3529  N  N     . ILE B 2 325 ? -19.355 14.385  -16.749  1.00 13.58 ? 325 ILE B N     1 
ATOM   3530  C  CA    . ILE B 2 325 ? -18.591 13.379  -16.034  1.00 8.55  ? 325 ILE B CA    1 
ATOM   3531  C  C     . ILE B 2 325 ? -17.119 13.716  -15.870  1.00 6.73  ? 325 ILE B C     1 
ATOM   3532  O  O     . ILE B 2 325 ? -16.529 13.434  -14.838  1.00 3.43  ? 325 ILE B O     1 
ATOM   3533  C  CB    . ILE B 2 325 ? -18.790 11.981  -16.655  1.00 10.68 ? 325 ILE B CB    1 
ATOM   3534  C  CG1   . ILE B 2 325 ? -18.448 10.893  -15.648  1.00 9.99  ? 325 ILE B CG1   1 
ATOM   3535  C  CG2   . ILE B 2 325 ? -18.000 11.812  -17.920  1.00 2.00  ? 325 ILE B CG2   1 
ATOM   3536  C  CD1   . ILE B 2 325 ? -17.309 10.068  -16.037  1.00 21.98 ? 325 ILE B CD1   1 
ATOM   3537  N  N     . GLU B 2 326 ? -16.538 14.303  -16.908  1.00 2.13  ? 326 GLU B N     1 
ATOM   3538  C  CA    . GLU B 2 326 ? -15.250 14.974  -16.832  1.00 3.92  ? 326 GLU B CA    1 
ATOM   3539  C  C     . GLU B 2 326 ? -14.098 13.992  -16.789  1.00 4.24  ? 326 GLU B C     1 
ATOM   3540  O  O     . GLU B 2 326 ? -14.307 12.799  -16.724  1.00 17.30 ? 326 GLU B O     1 
ATOM   3541  C  CB    . GLU B 2 326 ? -15.205 15.965  -15.674  1.00 2.00  ? 326 GLU B CB    1 
ATOM   3542  C  CG    . GLU B 2 326 ? -16.109 17.170  -15.876  1.00 11.86 ? 326 GLU B CG    1 
ATOM   3543  C  CD    . GLU B 2 326 ? -15.838 18.317  -14.921  1.00 16.24 ? 326 GLU B CD    1 
ATOM   3544  O  OE1   . GLU B 2 326 ? -15.300 18.090  -13.827  1.00 2.00  ? 326 GLU B OE1   1 
ATOM   3545  O  OE2   . GLU B 2 326 ? -16.181 19.455  -15.272  1.00 5.24  ? 326 GLU B OE2   1 
ATOM   3546  N  N     . ASP B 2 327 ? -12.879 14.496  -16.846  1.00 6.24  ? 327 ASP B N     1 
ATOM   3547  C  CA    . ASP B 2 327 ? -11.711 13.636  -16.897  1.00 9.37  ? 327 ASP B CA    1 
ATOM   3548  C  C     . ASP B 2 327 ? -11.571 12.844  -15.616  1.00 4.29  ? 327 ASP B C     1 
ATOM   3549  O  O     . ASP B 2 327 ? -11.145 11.702  -15.623  1.00 12.97 ? 327 ASP B O     1 
ATOM   3550  C  CB    . ASP B 2 327 ? -10.447 14.458  -17.130  1.00 2.00  ? 327 ASP B CB    1 
ATOM   3551  C  CG    . ASP B 2 327 ? -10.322 14.951  -18.545  1.00 18.76 ? 327 ASP B CG    1 
ATOM   3552  O  OD1   . ASP B 2 327 ? -11.164 14.598  -19.378  1.00 2.00  ? 327 ASP B OD1   1 
ATOM   3553  O  OD2   . ASP B 2 327 ? -9.411  15.707  -18.915  1.00 8.49  ? 327 ASP B OD2   1 
ATOM   3554  N  N     . ALA B 2 328 ? -11.914 13.477  -14.509  1.00 5.68  ? 328 ALA B N     1 
ATOM   3555  C  CA    . ALA B 2 328 ? -11.701 12.900  -13.204  1.00 8.40  ? 328 ALA B CA    1 
ATOM   3556  C  C     . ALA B 2 328 ? -12.797 11.898  -12.914  1.00 13.27 ? 328 ALA B C     1 
ATOM   3557  O  O     . ALA B 2 328 ? -12.578 10.904  -12.234  1.00 3.00  ? 328 ALA B O     1 
ATOM   3558  C  CB    . ALA B 2 328 ? -11.665 13.976  -12.148  1.00 2.50  ? 328 ALA B CB    1 
ATOM   3559  N  N     . GLY B 2 329 ? -13.977 12.161  -13.451  1.00 3.56  ? 329 GLY B N     1 
ATOM   3560  C  CA    . GLY B 2 329 ? -15.092 11.242  -13.234  1.00 5.01  ? 329 GLY B CA    1 
ATOM   3561  C  C     . GLY B 2 329 ? -14.846 9.935   -14.054  1.00 8.01  ? 329 GLY B C     1 
ATOM   3562  O  O     . GLY B 2 329 ? -15.303 8.867   -13.676  1.00 9.50  ? 329 GLY B O     1 
ATOM   3563  N  N     . LEU B 2 330 ? -14.127 10.045  -15.183  1.00 6.02  ? 330 LEU B N     1 
ATOM   3564  C  CA    . LEU B 2 330 ? -13.903 8.978   -16.148  1.00 5.48  ? 330 LEU B CA    1 
ATOM   3565  C  C     . LEU B 2 330 ? -12.706 8.167   -15.627  1.00 19.97 ? 330 LEU B C     1 
ATOM   3566  O  O     . LEU B 2 330 ? -12.558 6.955   -15.878  1.00 11.93 ? 330 LEU B O     1 
ATOM   3567  C  CB    . LEU B 2 330 ? -13.575 9.586   -17.514  1.00 2.00  ? 330 LEU B CB    1 
ATOM   3568  C  CG    . LEU B 2 330 ? -14.753 9.793   -18.496  1.00 2.11  ? 330 LEU B CG    1 
ATOM   3569  C  CD1   . LEU B 2 330 ? -14.320 10.252  -19.914  1.00 2.00  ? 330 LEU B CD1   1 
ATOM   3570  C  CD2   . LEU B 2 330 ? -15.580 8.447   -18.603  1.00 2.00  ? 330 LEU B CD2   1 
ATOM   3571  N  N     . GLU B 2 331 ? -11.827 8.827   -14.893  1.00 15.48 ? 331 GLU B N     1 
ATOM   3572  C  CA    . GLU B 2 331 ? -10.756 8.099   -14.386  1.00 12.66 ? 331 GLU B CA    1 
ATOM   3573  C  C     . GLU B 2 331 ? -11.283 7.080   -13.333  1.00 17.49 ? 331 GLU B C     1 
ATOM   3574  O  O     . GLU B 2 331 ? -10.859 5.884   -13.281  1.00 6.10  ? 331 GLU B O     1 
ATOM   3575  C  CB    . GLU B 2 331 ? -9.897  9.070   -13.695  1.00 12.66 ? 331 GLU B CB    1 
ATOM   3576  C  CG    . GLU B 2 331 ? -8.702  8.372   -13.167  1.00 23.82 ? 331 GLU B CG    1 
ATOM   3577  C  CD    . GLU B 2 331 ? -7.723  9.391   -12.780  1.00 51.96 ? 331 GLU B CD    1 
ATOM   3578  O  OE1   . GLU B 2 331 ? -6.937  9.716   -13.691  1.00 29.93 ? 331 GLU B OE1   1 
ATOM   3579  O  OE2   . GLU B 2 331 ? -7.807  9.911   -11.629  1.00 36.93 ? 331 GLU B OE2   1 
ATOM   3580  N  N     . VAL B 2 332 ? -12.206 7.565   -12.503  1.00 3.54  ? 332 VAL B N     1 
ATOM   3581  C  CA    . VAL B 2 332 ? -12.860 6.740   -11.485  1.00 10.72 ? 332 VAL B CA    1 
ATOM   3582  C  C     . VAL B 2 332 ? -13.610 5.621   -12.184  1.00 11.37 ? 332 VAL B C     1 
ATOM   3583  O  O     . VAL B 2 332 ? -13.464 4.469   -11.825  1.00 12.30 ? 332 VAL B O     1 
ATOM   3584  C  CB    . VAL B 2 332 ? -13.813 7.550   -10.618  1.00 8.50  ? 332 VAL B CB    1 
ATOM   3585  C  CG1   . VAL B 2 332 ? -14.575 6.653   -9.620   1.00 10.06 ? 332 VAL B CG1   1 
ATOM   3586  C  CG2   . VAL B 2 332 ? -13.016 8.587   -9.883   1.00 2.00  ? 332 VAL B CG2   1 
ATOM   3587  N  N     . LEU B 2 333 ? -14.361 5.954   -13.220  1.00 9.13  ? 333 LEU B N     1 
ATOM   3588  C  CA    . LEU B 2 333 ? -14.780 4.954   -14.187  1.00 6.85  ? 333 LEU B CA    1 
ATOM   3589  C  C     . LEU B 2 333 ? -13.736 3.859   -14.540  1.00 2.00  ? 333 LEU B C     1 
ATOM   3590  O  O     . LEU B 2 333 ? -14.031 2.691   -14.431  1.00 8.83  ? 333 LEU B O     1 
ATOM   3591  C  CB    . LEU B 2 333 ? -15.394 5.592   -15.435  1.00 5.67  ? 333 LEU B CB    1 
ATOM   3592  C  CG    . LEU B 2 333 ? -16.198 4.626   -16.358  1.00 3.90  ? 333 LEU B CG    1 
ATOM   3593  C  CD1   . LEU B 2 333 ? -17.529 4.331   -15.775  1.00 3.95  ? 333 LEU B CD1   1 
ATOM   3594  C  CD2   . LEU B 2 333 ? -16.441 5.122   -17.765  1.00 4.30  ? 333 LEU B CD2   1 
ATOM   3595  N  N     . ALA B 2 334 ? -12.548 4.211   -14.979  1.00 3.49  ? 334 ALA B N     1 
ATOM   3596  C  CA    . ALA B 2 334 ? -11.548 3.227   -15.462  1.00 7.39  ? 334 ALA B CA    1 
ATOM   3597  C  C     . ALA B 2 334 ? -11.190 2.275   -14.339  1.00 6.53  ? 334 ALA B C     1 
ATOM   3598  O  O     . ALA B 2 334 ? -10.701 1.189   -14.559  1.00 11.20 ? 334 ALA B O     1 
ATOM   3599  C  CB    . ALA B 2 334 ? -10.235 3.943   -15.918  1.00 10.56 ? 334 ALA B CB    1 
ATOM   3600  N  N     . SER B 2 335 ? -11.417 2.720   -13.132  1.00 2.00  ? 335 SER B N     1 
ATOM   3601  C  CA    . SER B 2 335 ? -10.961 2.026   -12.004  1.00 2.00  ? 335 SER B CA    1 
ATOM   3602  C  C     . SER B 2 335 ? -11.994 1.090   -11.465  1.00 2.00  ? 335 SER B C     1 
ATOM   3603  O  O     . SER B 2 335 ? -11.633 0.054   -10.997  1.00 11.19 ? 335 SER B O     1 
ATOM   3604  C  CB    . SER B 2 335 ? -10.347 3.044   -10.978  1.00 6.39  ? 335 SER B CB    1 
ATOM   3605  O  OG    . SER B 2 335 ? -10.796 2.885   -9.655   1.00 6.34  ? 335 SER B OG    1 
ATOM   3606  N  N     . THR B 2 336 ? -13.282 1.417   -11.563  1.00 7.87  ? 336 THR B N     1 
ATOM   3607  C  CA    . THR B 2 336 ? -14.382 0.616   -10.986  1.00 3.12  ? 336 THR B CA    1 
ATOM   3608  C  C     . THR B 2 336 ? -15.128 -0.343  -11.904  1.00 2.00  ? 336 THR B C     1 
ATOM   3609  O  O     . THR B 2 336 ? -15.781 -1.247  -11.450  1.00 12.53 ? 336 THR B O     1 
ATOM   3610  C  CB    . THR B 2 336 ? -15.359 1.449   -10.034  1.00 7.64  ? 336 THR B CB    1 
ATOM   3611  O  OG1   . THR B 2 336 ? -15.571 2.757   -10.560  1.00 9.49  ? 336 THR B OG1   1 
ATOM   3612  C  CG2   . THR B 2 336 ? -14.634 1.730   -8.603   1.00 26.42 ? 336 THR B CG2   1 
ATOM   3613  N  N     . CYS B 2 337 ? -15.027 -0.174  -13.201  1.00 5.63  ? 337 CYS B N     1 
ATOM   3614  C  CA    . CYS B 2 337 ? -15.847 -0.936  -14.112  1.00 2.00  ? 337 CYS B CA    1 
ATOM   3615  C  C     . CYS B 2 337 ? -15.003 -1.798  -15.034  1.00 7.04  ? 337 CYS B C     1 
ATOM   3616  O  O     . CYS B 2 337 ? -14.725 -1.435  -16.199  1.00 2.32  ? 337 CYS B O     1 
ATOM   3617  C  CB    . CYS B 2 337 ? -16.686 0.003   -14.863  1.00 2.00  ? 337 CYS B CB    1 
ATOM   3618  S  SG    . CYS B 2 337 ? -17.906 0.814   -13.749  1.00 3.32  ? 337 CYS B SG    1 
ATOM   3619  N  N     . LYS B 2 338 ? -14.530 -2.939  -14.539  1.00 2.00  ? 338 LYS B N     1 
ATOM   3620  C  CA    . LYS B 2 338 ? -13.519 -3.567  -15.342  1.00 6.30  ? 338 LYS B CA    1 
ATOM   3621  C  C     . LYS B 2 338 ? -14.211 -4.314  -16.477  1.00 6.49  ? 338 LYS B C     1 
ATOM   3622  O  O     . LYS B 2 338 ? -13.560 -4.766  -17.426  1.00 2.00  ? 338 LYS B O     1 
ATOM   3623  C  CB    . LYS B 2 338 ? -12.469 -4.324  -14.500  1.00 3.66  ? 338 LYS B CB    1 
ATOM   3624  C  CG    . LYS B 2 338 ? -11.676 -3.322  -13.528  1.00 2.99  ? 338 LYS B CG    1 
ATOM   3625  C  CD    . LYS B 2 338 ? -10.203 -3.118  -13.972  1.00 12.75 ? 338 LYS B CD    1 
ATOM   3626  C  CE    . LYS B 2 338 ? -9.742  -1.646  -14.166  1.00 5.74  ? 338 LYS B CE    1 
ATOM   3627  N  NZ    . LYS B 2 338 ? -9.832  -0.790  -12.932  1.00 5.70  ? 338 LYS B NZ    1 
ATOM   3628  N  N     . ASP B 2 339 ? -15.551 -4.387  -16.376  1.00 2.00  ? 339 ASP B N     1 
ATOM   3629  C  CA    . ASP B 2 339 ? -16.314 -5.126  -17.370  1.00 11.49 ? 339 ASP B CA    1 
ATOM   3630  C  C     . ASP B 2 339 ? -16.958 -4.200  -18.476  1.00 17.36 ? 339 ASP B C     1 
ATOM   3631  O  O     . ASP B 2 339 ? -17.683 -4.713  -19.346  1.00 4.32  ? 339 ASP B O     1 
ATOM   3632  C  CB    . ASP B 2 339 ? -17.284 -6.138  -16.723  1.00 2.00  ? 339 ASP B CB    1 
ATOM   3633  C  CG    . ASP B 2 339 ? -17.819 -7.289  -17.715  1.00 4.82  ? 339 ASP B CG    1 
ATOM   3634  O  OD1   . ASP B 2 339 ? -17.201 -7.834  -18.683  1.00 2.00  ? 339 ASP B OD1   1 
ATOM   3635  O  OD2   . ASP B 2 339 ? -18.961 -7.693  -17.455  1.00 9.72  ? 339 ASP B OD2   1 
ATOM   3636  N  N     . LEU B 2 340 ? -16.618 -2.893  -18.509  1.00 7.60  ? 340 LEU B N     1 
ATOM   3637  C  CA    . LEU B 2 340 ? -17.050 -2.045  -19.619  1.00 2.45  ? 340 LEU B CA    1 
ATOM   3638  C  C     . LEU B 2 340 ? -16.738 -2.492  -21.030  1.00 2.00  ? 340 LEU B C     1 
ATOM   3639  O  O     . LEU B 2 340 ? -15.590 -2.695  -21.443  1.00 5.17  ? 340 LEU B O     1 
ATOM   3640  C  CB    . LEU B 2 340 ? -16.710 -0.628  -19.396  1.00 2.00  ? 340 LEU B CB    1 
ATOM   3641  C  CG    . LEU B 2 340 ? -17.730 0.443   -19.767  1.00 12.82 ? 340 LEU B CG    1 
ATOM   3642  C  CD1   . LEU B 2 340 ? -18.893 0.582   -18.768  1.00 2.00  ? 340 LEU B CD1   1 
ATOM   3643  C  CD2   . LEU B 2 340 ? -16.912 1.785   -19.834  1.00 2.00  ? 340 LEU B CD2   1 
ATOM   3644  N  N     . ARG B 2 341 ? -17.815 -2.620  -21.789  1.00 2.81  ? 341 ARG B N     1 
ATOM   3645  C  CA    . ARG B 2 341 ? -17.763 -2.770  -23.229  1.00 10.22 ? 341 ARG B CA    1 
ATOM   3646  C  C     . ARG B 2 341 ? -17.951 -1.456  -24.046  1.00 14.33 ? 341 ARG B C     1 
ATOM   3647  O  O     . ARG B 2 341 ? -17.410 -1.334  -25.156  1.00 5.54  ? 341 ARG B O     1 
ATOM   3648  C  CB    . ARG B 2 341 ? -18.899 -3.668  -23.658  1.00 8.73  ? 341 ARG B CB    1 
ATOM   3649  C  CG    . ARG B 2 341 ? -19.085 -4.835  -22.794  1.00 11.75 ? 341 ARG B CG    1 
ATOM   3650  C  CD    . ARG B 2 341 ? -17.767 -5.515  -22.682  1.00 9.97  ? 341 ARG B CD    1 
ATOM   3651  N  NE    . ARG B 2 341 ? -17.895 -6.521  -21.651  1.00 2.59  ? 341 ARG B NE    1 
ATOM   3652  C  CZ    . ARG B 2 341 ? -18.024 -7.810  -21.944  1.00 26.13 ? 341 ARG B CZ    1 
ATOM   3653  N  NH1   . ARG B 2 341 ? -18.029 -8.184  -23.213  1.00 3.21  ? 341 ARG B NH1   1 
ATOM   3654  N  NH2   . ARG B 2 341 ? -18.117 -8.712  -20.991  1.00 2.00  ? 341 ARG B NH2   1 
ATOM   3655  N  N     . GLU B 2 342 ? -18.738 -0.506  -23.532  1.00 2.89  ? 342 GLU B N     1 
ATOM   3656  C  CA    . GLU B 2 342 ? -19.282 0.527   -24.411  1.00 8.20  ? 342 GLU B CA    1 
ATOM   3657  C  C     . GLU B 2 342 ? -19.362 1.722   -23.565  1.00 2.00  ? 342 GLU B C     1 
ATOM   3658  O  O     . GLU B 2 342 ? -20.007 1.689   -22.511  1.00 4.43  ? 342 GLU B O     1 
ATOM   3659  C  CB    . GLU B 2 342 ? -20.735 0.256   -24.785  1.00 2.12  ? 342 GLU B CB    1 
ATOM   3660  C  CG    . GLU B 2 342 ? -21.223 1.276   -25.838  1.00 6.44  ? 342 GLU B CG    1 
ATOM   3661  C  CD    . GLU B 2 342 ? -22.615 0.943   -26.391  1.00 2.00  ? 342 GLU B CD    1 
ATOM   3662  O  OE1   . GLU B 2 342 ? -22.775 0.030   -27.226  1.00 11.27 ? 342 GLU B OE1   1 
ATOM   3663  O  OE2   . GLU B 2 342 ? -23.590 1.572   -25.997  1.00 10.42 ? 342 GLU B OE2   1 
ATOM   3664  N  N     . LEU B 2 343 ? -18.767 2.798   -24.048  1.00 7.46  ? 343 LEU B N     1 
ATOM   3665  C  CA    . LEU B 2 343 ? -18.850 4.145   -23.430  1.00 4.36  ? 343 LEU B CA    1 
ATOM   3666  C  C     . LEU B 2 343 ? -19.336 5.187   -24.447  1.00 6.37  ? 343 LEU B C     1 
ATOM   3667  O  O     . LEU B 2 343 ? -18.722 5.411   -25.543  1.00 3.97  ? 343 LEU B O     1 
ATOM   3668  C  CB    . LEU B 2 343 ? -17.461 4.590   -22.888  1.00 6.61  ? 343 LEU B CB    1 
ATOM   3669  C  CG    . LEU B 2 343 ? -17.336 6.087   -22.546  1.00 5.24  ? 343 LEU B CG    1 
ATOM   3670  C  CD1   . LEU B 2 343 ? -18.250 6.455   -21.448  1.00 2.00  ? 343 LEU B CD1   1 
ATOM   3671  C  CD2   . LEU B 2 343 ? -15.959 6.421   -22.152  1.00 6.01  ? 343 LEU B CD2   1 
ATOM   3672  N  N     . ARG B 2 344 ? -20.446 5.822   -24.084  1.00 2.99  ? 344 ARG B N     1 
ATOM   3673  C  CA    . ARG B 2 344 ? -20.953 7.015   -24.854  1.00 5.85  ? 344 ARG B CA    1 
ATOM   3674  C  C     . ARG B 2 344 ? -20.938 8.265   -24.010  1.00 2.00  ? 344 ARG B C     1 
ATOM   3675  O  O     . ARG B 2 344 ? -21.679 8.368   -22.971  1.00 2.00  ? 344 ARG B O     1 
ATOM   3676  C  CB    . ARG B 2 344 ? -22.354 6.744   -25.503  1.00 2.11  ? 344 ARG B CB    1 
ATOM   3677  C  CG    . ARG B 2 344 ? -22.245 5.666   -26.647  1.00 2.00  ? 344 ARG B CG    1 
ATOM   3678  C  CD    . ARG B 2 344 ? -23.563 5.326   -27.273  1.00 4.52  ? 344 ARG B CD    1 
ATOM   3679  N  NE    . ARG B 2 344 ? -23.526 4.074   -28.036  1.00 20.64 ? 344 ARG B NE    1 
ATOM   3680  C  CZ    . ARG B 2 344 ? -24.182 3.840   -29.174  1.00 15.87 ? 344 ARG B CZ    1 
ATOM   3681  N  NH1   . ARG B 2 344 ? -24.965 4.741   -29.770  1.00 11.34 ? 344 ARG B NH1   1 
ATOM   3682  N  NH2   . ARG B 2 344 ? -24.030 2.689   -29.739  1.00 6.53  ? 344 ARG B NH2   1 
ATOM   3683  N  N     . VAL B 2 345 ? -20.120 9.216   -24.436  1.00 2.00  ? 345 VAL B N     1 
ATOM   3684  C  CA    . VAL B 2 345 ? -20.146 10.535  -23.752  1.00 2.14  ? 345 VAL B CA    1 
ATOM   3685  C  C     . VAL B 2 345 ? -20.710 11.653  -24.649  1.00 2.90  ? 345 VAL B C     1 
ATOM   3686  O  O     . VAL B 2 345 ? -20.118 12.031  -25.677  1.00 2.00  ? 345 VAL B O     1 
ATOM   3687  C  CB    . VAL B 2 345 ? -18.770 10.975  -23.236  1.00 2.60  ? 345 VAL B CB    1 
ATOM   3688  C  CG1   . VAL B 2 345 ? -18.863 12.306  -22.468  1.00 2.00  ? 345 VAL B CG1   1 
ATOM   3689  C  CG2   . VAL B 2 345 ? -18.081 9.836   -22.437  1.00 2.00  ? 345 VAL B CG2   1 
ATOM   3690  N  N     . PHE B 2 346 ? -21.839 12.184  -24.241  1.00 2.00  ? 346 PHE B N     1 
ATOM   3691  C  CA    . PHE B 2 346 ? -22.549 13.128  -25.066  1.00 2.79  ? 346 PHE B CA    1 
ATOM   3692  C  C     . PHE B 2 346 ? -22.180 14.577  -24.671  1.00 5.28  ? 346 PHE B C     1 
ATOM   3693  O  O     . PHE B 2 346 ? -21.824 14.806  -23.518  1.00 2.00  ? 346 PHE B O     1 
ATOM   3694  C  CB    . PHE B 2 346 ? -24.051 12.886  -24.936  1.00 2.56  ? 346 PHE B CB    1 
ATOM   3695  C  CG    . PHE B 2 346 ? -24.502 11.640  -25.611  1.00 2.00  ? 346 PHE B CG    1 
ATOM   3696  C  CD1   . PHE B 2 346 ? -24.712 10.486  -24.894  1.00 2.00  ? 346 PHE B CD1   1 
ATOM   3697  C  CD2   . PHE B 2 346 ? -24.661 11.608  -26.984  1.00 4.86  ? 346 PHE B CD2   1 
ATOM   3698  C  CE1   . PHE B 2 346 ? -25.113 9.277   -25.545  1.00 2.00  ? 346 PHE B CE1   1 
ATOM   3699  C  CE2   . PHE B 2 346 ? -25.088 10.412  -27.668  1.00 2.00  ? 346 PHE B CE2   1 
ATOM   3700  C  CZ    . PHE B 2 346 ? -25.282 9.263   -26.916  1.00 4.45  ? 346 PHE B CZ    1 
ATOM   3701  N  N     . PRO B 2 347 ? -22.315 15.547  -25.627  1.00 2.00  ? 347 PRO B N     1 
ATOM   3702  C  CA    . PRO B 2 347 ? -21.953 16.984  -25.364  1.00 2.00  ? 347 PRO B CA    1 
ATOM   3703  C  C     . PRO B 2 347 ? -23.082 17.633  -24.465  1.00 2.00  ? 347 PRO B C     1 
ATOM   3704  O  O     . PRO B 2 347 ? -24.255 17.566  -24.863  1.00 2.00  ? 347 PRO B O     1 
ATOM   3705  C  CB    . PRO B 2 347 ? -21.923 17.608  -26.764  1.00 2.00  ? 347 PRO B CB    1 
ATOM   3706  C  CG    . PRO B 2 347 ? -22.919 16.781  -27.626  1.00 3.06  ? 347 PRO B CG    1 
ATOM   3707  C  CD    . PRO B 2 347 ? -22.978 15.352  -26.947  1.00 2.00  ? 347 PRO B CD    1 
ATOM   3708  N  N     . SER B 2 348 ? -22.759 18.152  -23.269  1.00 2.00  ? 348 SER B N     1 
ATOM   3709  C  CA    . SER B 2 348 ? -23.737 19.018  -22.568  1.00 2.00  ? 348 SER B CA    1 
ATOM   3710  C  C     . SER B 2 348 ? -24.073 20.341  -23.224  1.00 2.00  ? 348 SER B C     1 
ATOM   3711  O  O     . SER B 2 348 ? -25.185 20.767  -23.158  1.00 2.00  ? 348 SER B O     1 
ATOM   3712  C  CB    . SER B 2 348 ? -23.401 19.260  -21.085  1.00 6.78  ? 348 SER B CB    1 
ATOM   3713  O  OG    . SER B 2 348 ? -22.352 20.175  -21.006  1.00 11.97 ? 348 SER B OG    1 
ATOM   3714  N  N     . GLU B 2 349 ? -23.107 20.948  -23.898  1.00 2.00  ? 349 GLU B N     1 
ATOM   3715  C  CA    . GLU B 2 349 ? -23.354 22.191  -24.570  1.00 2.00  ? 349 GLU B CA    1 
ATOM   3716  C  C     . GLU B 2 349 ? -22.731 22.263  -25.975  1.00 3.45  ? 349 GLU B C     1 
ATOM   3717  O  O     . GLU B 2 349 ? -21.837 23.056  -26.227  1.00 2.05  ? 349 GLU B O     1 
ATOM   3718  C  CB    . GLU B 2 349 ? -22.767 23.284  -23.724  1.00 2.00  ? 349 GLU B CB    1 
ATOM   3719  C  CG    . GLU B 2 349 ? -23.371 23.297  -22.383  1.00 2.29  ? 349 GLU B CG    1 
ATOM   3720  C  CD    . GLU B 2 349 ? -24.387 24.385  -22.283  1.00 23.96 ? 349 GLU B CD    1 
ATOM   3721  O  OE1   . GLU B 2 349 ? -24.861 24.790  -23.375  1.00 10.60 ? 349 GLU B OE1   1 
ATOM   3722  O  OE2   . GLU B 2 349 ? -24.697 24.838  -21.148  1.00 31.13 ? 349 GLU B OE2   1 
ATOM   3723  N  N     . PRO B 2 350 ? -23.222 21.438  -26.907  1.00 2.00  ? 350 PRO B N     1 
ATOM   3724  C  CA    . PRO B 2 350 ? -22.547 21.254  -28.182  1.00 2.00  ? 350 PRO B CA    1 
ATOM   3725  C  C     . PRO B 2 350 ? -22.616 22.521  -29.043  1.00 2.00  ? 350 PRO B C     1 
ATOM   3726  O  O     . PRO B 2 350 ? -22.063 22.523  -30.102  1.00 2.00  ? 350 PRO B O     1 
ATOM   3727  C  CB    . PRO B 2 350 ? -23.391 20.207  -28.822  1.00 2.00  ? 350 PRO B CB    1 
ATOM   3728  C  CG    . PRO B 2 350 ? -24.771 20.442  -28.202  1.00 2.00  ? 350 PRO B CG    1 
ATOM   3729  C  CD    . PRO B 2 350 ? -24.480 20.685  -26.809  1.00 2.00  ? 350 PRO B CD    1 
ATOM   3730  N  N     . PHE B 2 351 ? -23.322 23.568  -28.623  1.00 2.00  ? 351 PHE B N     1 
ATOM   3731  C  CA    . PHE B 2 351 ? -23.421 24.771  -29.479  1.00 2.00  ? 351 PHE B CA    1 
ATOM   3732  C  C     . PHE B 2 351 ? -22.693 26.018  -29.005  1.00 2.00  ? 351 PHE B C     1 
ATOM   3733  O  O     . PHE B 2 351 ? -22.799 27.038  -29.634  1.00 2.00  ? 351 PHE B O     1 
ATOM   3734  C  CB    . PHE B 2 351 ? -24.859 25.123  -29.903  1.00 2.00  ? 351 PHE B CB    1 
ATOM   3735  C  CG    . PHE B 2 351 ? -25.596 23.978  -30.533  1.00 7.52  ? 351 PHE B CG    1 
ATOM   3736  C  CD1   . PHE B 2 351 ? -26.678 23.392  -29.895  1.00 10.32 ? 351 PHE B CD1   1 
ATOM   3737  C  CD2   . PHE B 2 351 ? -25.191 23.456  -31.757  1.00 18.67 ? 351 PHE B CD2   1 
ATOM   3738  C  CE1   . PHE B 2 351 ? -27.344 22.279  -30.470  1.00 2.19  ? 351 PHE B CE1   1 
ATOM   3739  C  CE2   . PHE B 2 351 ? -25.845 22.363  -32.324  1.00 2.36  ? 351 PHE B CE2   1 
ATOM   3740  C  CZ    . PHE B 2 351 ? -26.921 21.781  -31.668  1.00 2.00  ? 351 PHE B CZ    1 
ATOM   3741  N  N     . VAL B 2 352 ? -21.946 25.929  -27.903  1.00 6.93  ? 352 VAL B N     1 
ATOM   3742  C  CA    . VAL B 2 352 ? -20.970 26.966  -27.589  1.00 11.88 ? 352 VAL B CA    1 
ATOM   3743  C  C     . VAL B 2 352 ? -19.494 26.510  -27.764  1.00 13.09 ? 352 VAL B C     1 
ATOM   3744  O  O     . VAL B 2 352 ? -19.160 25.345  -27.452  1.00 7.34  ? 352 VAL B O     1 
ATOM   3745  C  CB    . VAL B 2 352 ? -21.239 27.544  -26.185  1.00 9.62  ? 352 VAL B CB    1 
ATOM   3746  C  CG1   . VAL B 2 352 ? -20.958 26.529  -25.130  1.00 2.00  ? 352 VAL B CG1   1 
ATOM   3747  C  CG2   . VAL B 2 352 ? -20.440 28.847  -25.995  1.00 31.20 ? 352 VAL B CG2   1 
ATOM   3748  N  N     . MET B 2 353 ? -18.623 27.415  -28.235  1.00 2.00  ? 353 MET B N     1 
ATOM   3749  C  CA    . MET B 2 353 ? -17.205 27.079  -28.469  1.00 3.18  ? 353 MET B CA    1 
ATOM   3750  C  C     . MET B 2 353 ? -16.451 26.785  -27.202  1.00 9.97  ? 353 MET B C     1 
ATOM   3751  O  O     . MET B 2 353 ? -15.826 25.707  -27.078  1.00 2.00  ? 353 MET B O     1 
ATOM   3752  C  CB    . MET B 2 353 ? -16.464 28.160  -29.176  1.00 2.00  ? 353 MET B CB    1 
ATOM   3753  C  CG    . MET B 2 353 ? -15.475 27.705  -30.266  1.00 2.61  ? 353 MET B CG    1 
ATOM   3754  S  SD    . MET B 2 353 ? -14.870 29.212  -31.226  1.00 31.62 ? 353 MET B SD    1 
ATOM   3755  C  CE    . MET B 2 353 ? -15.475 29.120  -32.943  1.00 11.88 ? 353 MET B CE    1 
ATOM   3756  N  N     . GLU B 2 354 ? -16.482 27.730  -26.255  1.00 8.99  ? 354 GLU B N     1 
ATOM   3757  C  CA    . GLU B 2 354 ? -15.713 27.512  -25.030  1.00 7.89  ? 354 GLU B CA    1 
ATOM   3758  C  C     . GLU B 2 354 ? -16.191 26.326  -24.277  1.00 4.92  ? 354 GLU B C     1 
ATOM   3759  O  O     . GLU B 2 354 ? -17.383 26.192  -23.999  1.00 2.00  ? 354 GLU B O     1 
ATOM   3760  C  CB    . GLU B 2 354 ? -15.598 28.716  -24.089  1.00 10.91 ? 354 GLU B CB    1 
ATOM   3761  C  CG    . GLU B 2 354 ? -14.865 29.874  -24.721  1.00 36.28 ? 354 GLU B CG    1 
ATOM   3762  C  CD    . GLU B 2 354 ? -15.571 30.312  -26.004  1.00 63.14 ? 354 GLU B CD    1 
ATOM   3763  O  OE1   . GLU B 2 354 ? -15.057 31.239  -26.667  1.00 66.88 ? 354 GLU B OE1   1 
ATOM   3764  O  OE2   . GLU B 2 354 ? -16.640 29.726  -26.352  1.00 58.17 ? 354 GLU B OE2   1 
ATOM   3765  N  N     . PRO B 2 355 ? -15.224 25.516  -23.852  1.00 11.97 ? 355 PRO B N     1 
ATOM   3766  C  CA    . PRO B 2 355 ? -15.404 24.372  -22.947  1.00 7.30  ? 355 PRO B CA    1 
ATOM   3767  C  C     . PRO B 2 355 ? -16.122 24.869  -21.681  1.00 2.21  ? 355 PRO B C     1 
ATOM   3768  O  O     . PRO B 2 355 ? -15.699 25.893  -21.100  1.00 13.25 ? 355 PRO B O     1 
ATOM   3769  C  CB    . PRO B 2 355 ? -13.952 23.923  -22.660  1.00 12.65 ? 355 PRO B CB    1 
ATOM   3770  C  CG    . PRO B 2 355 ? -13.110 24.486  -23.845  1.00 22.86 ? 355 PRO B CG    1 
ATOM   3771  C  CD    . PRO B 2 355 ? -13.801 25.790  -24.167  1.00 7.39  ? 355 PRO B CD    1 
ATOM   3772  N  N     . ASN B 2 356 ? -17.232 24.208  -21.317  1.00 2.00  ? 356 ASN B N     1 
ATOM   3773  C  CA    . ASN B 2 356 ? -17.928 24.427  -20.063  1.00 2.00  ? 356 ASN B CA    1 
ATOM   3774  C  C     . ASN B 2 356 ? -17.629 23.273  -19.173  1.00 2.00  ? 356 ASN B C     1 
ATOM   3775  O  O     . ASN B 2 356 ? -18.164 23.105  -18.125  1.00 2.00  ? 356 ASN B O     1 
ATOM   3776  C  CB    . ASN B 2 356 ? -19.457 24.549  -20.236  1.00 2.00  ? 356 ASN B CB    1 
ATOM   3777  C  CG    . ASN B 2 356 ? -20.177 23.184  -20.682  1.00 17.31 ? 356 ASN B CG    1 
ATOM   3778  O  OD1   . ASN B 2 356 ? -19.679 22.492  -21.556  1.00 3.23  ? 356 ASN B OD1   1 
ATOM   3779  N  ND2   . ASN B 2 356 ? -21.346 22.876  -20.114  1.00 2.00  ? 356 ASN B ND2   1 
ATOM   3780  N  N     . VAL B 2 357 ? -16.767 22.407  -19.572  1.00 4.83  ? 357 VAL B N     1 
ATOM   3781  C  CA    . VAL B 2 357 ? -16.692 21.250  -18.774  1.00 2.00  ? 357 VAL B CA    1 
ATOM   3782  C  C     . VAL B 2 357 ? -15.238 20.805  -18.968  1.00 9.53  ? 357 VAL B C     1 
ATOM   3783  O  O     . VAL B 2 357 ? -14.663 21.035  -20.035  1.00 5.45  ? 357 VAL B O     1 
ATOM   3784  C  CB    . VAL B 2 357 ? -17.740 20.298  -19.315  1.00 14.90 ? 357 VAL B CB    1 
ATOM   3785  C  CG1   . VAL B 2 357 ? -17.100 19.161  -20.115  1.00 7.40  ? 357 VAL B CG1   1 
ATOM   3786  C  CG2   . VAL B 2 357 ? -18.732 19.941  -18.274  1.00 2.00  ? 357 VAL B CG2   1 
ATOM   3787  N  N     . ALA B 2 358 ? -14.623 20.293  -17.910  1.00 2.00  ? 358 ALA B N     1 
ATOM   3788  C  CA    . ALA B 2 358 ? -13.257 19.828  -17.974  1.00 8.98  ? 358 ALA B CA    1 
ATOM   3789  C  C     . ALA B 2 358 ? -13.239 18.354  -18.566  1.00 2.12  ? 358 ALA B C     1 
ATOM   3790  O  O     . ALA B 2 358 ? -12.961 17.425  -17.836  1.00 9.74  ? 358 ALA B O     1 
ATOM   3791  C  CB    . ALA B 2 358 ? -12.692 19.834  -16.516  1.00 2.09  ? 358 ALA B CB    1 
ATOM   3792  N  N     . LEU B 2 359 ? -13.579 18.139  -19.832  1.00 7.76  ? 359 LEU B N     1 
ATOM   3793  C  CA    . LEU B 2 359 ? -13.645 16.785  -20.347  1.00 2.00  ? 359 LEU B CA    1 
ATOM   3794  C  C     . LEU B 2 359 ? -12.867 16.859  -21.650  1.00 16.06 ? 359 LEU B C     1 
ATOM   3795  O  O     . LEU B 2 359 ? -13.246 17.672  -22.495  1.00 16.62 ? 359 LEU B O     1 
ATOM   3796  C  CB    . LEU B 2 359 ? -15.055 16.543  -20.749  1.00 2.00  ? 359 LEU B CB    1 
ATOM   3797  C  CG    . LEU B 2 359 ? -15.145 15.198  -21.454  1.00 9.99  ? 359 LEU B CG    1 
ATOM   3798  C  CD1   . LEU B 2 359 ? -15.745 14.064  -20.698  1.00 8.12  ? 359 LEU B CD1   1 
ATOM   3799  C  CD2   . LEU B 2 359 ? -15.142 15.055  -23.011  1.00 3.99  ? 359 LEU B CD2   1 
ATOM   3800  N  N     . THR B 2 360 ? -11.837 16.019  -21.844  1.00 4.65  ? 360 THR B N     1 
ATOM   3801  C  CA    . THR B 2 360 ? -10.785 16.214  -22.933  1.00 8.56  ? 360 THR B CA    1 
ATOM   3802  C  C     . THR B 2 360 ? -10.176 14.861  -23.399  1.00 2.00  ? 360 THR B C     1 
ATOM   3803  O  O     . THR B 2 360 ? -10.581 13.841  -22.918  1.00 7.12  ? 360 THR B O     1 
ATOM   3804  C  CB    . THR B 2 360 ? -9.575  17.068  -22.339  1.00 10.58 ? 360 THR B CB    1 
ATOM   3805  O  OG1   . THR B 2 360 ? -8.765  16.237  -21.484  1.00 4.72  ? 360 THR B OG1   1 
ATOM   3806  C  CG2   . THR B 2 360 ? -10.130 18.195  -21.511  1.00 2.00  ? 360 THR B CG2   1 
ATOM   3807  N  N     . GLU B 2 361 ? -9.165  14.822  -24.238  1.00 2.00  ? 361 GLU B N     1 
ATOM   3808  C  CA    . GLU B 2 361 ? -8.551  13.529  -24.590  1.00 2.00  ? 361 GLU B CA    1 
ATOM   3809  C  C     . GLU B 2 361 ? -8.269  12.677  -23.395  1.00 2.06  ? 361 GLU B C     1 
ATOM   3810  O  O     . GLU B 2 361 ? -8.289  11.446  -23.464  1.00 10.27 ? 361 GLU B O     1 
ATOM   3811  C  CB    . GLU B 2 361 ? -7.158  13.621  -25.289  1.00 2.37  ? 361 GLU B CB    1 
ATOM   3812  C  CG    . GLU B 2 361 ? -6.705  14.967  -25.651  1.00 29.31 ? 361 GLU B CG    1 
ATOM   3813  C  CD    . GLU B 2 361 ? -6.364  15.778  -24.455  1.00 2.00  ? 361 GLU B CD    1 
ATOM   3814  O  OE1   . GLU B 2 361 ? -5.153  15.956  -24.189  1.00 12.29 ? 361 GLU B OE1   1 
ATOM   3815  O  OE2   . GLU B 2 361 ? -7.317  16.197  -23.792  1.00 13.40 ? 361 GLU B OE2   1 
ATOM   3816  N  N     . GLN B 2 362 ? -7.900  13.299  -22.318  1.00 2.00  ? 362 GLN B N     1 
ATOM   3817  C  CA    . GLN B 2 362 ? -7.493  12.538  -21.164  1.00 3.91  ? 362 GLN B CA    1 
ATOM   3818  C  C     . GLN B 2 362 ? -8.528  11.486  -20.637  1.00 2.00  ? 362 GLN B C     1 
ATOM   3819  O  O     . GLN B 2 362 ? -8.147  10.360  -20.313  1.00 6.16  ? 362 GLN B O     1 
ATOM   3820  C  CB    . GLN B 2 362 ? -6.970  13.507  -20.019  1.00 2.00  ? 362 GLN B CB    1 
ATOM   3821  C  CG    . GLN B 2 362 ? -5.852  12.952  -19.033  1.00 13.91 ? 362 GLN B CG    1 
ATOM   3822  C  CD    . GLN B 2 362 ? -5.069  11.664  -19.543  1.00 36.22 ? 362 GLN B CD    1 
ATOM   3823  O  OE1   . GLN B 2 362 ? -4.224  11.723  -20.502  1.00 10.93 ? 362 GLN B OE1   1 
ATOM   3824  N  NE2   . GLN B 2 362 ? -5.343  10.498  -18.874  1.00 17.62 ? 362 GLN B NE2   1 
ATOM   3825  N  N     . GLY B 2 363 ? -9.785  11.844  -20.410  1.00 2.79  ? 363 GLY B N     1 
ATOM   3826  C  CA    . GLY B 2 363 ? -10.772 10.827  -19.880  1.00 2.00  ? 363 GLY B CA    1 
ATOM   3827  C  C     . GLY B 2 363 ? -10.824 9.583   -20.766  1.00 9.73  ? 363 GLY B C     1 
ATOM   3828  O  O     . GLY B 2 363 ? -10.887 8.470   -20.262  1.00 13.01 ? 363 GLY B O     1 
ATOM   3829  N  N     . LEU B 2 364 ? -10.714 9.758   -22.092  1.00 2.15  ? 364 LEU B N     1 
ATOM   3830  C  CA    . LEU B 2 364 ? -10.826 8.631   -22.993  1.00 4.27  ? 364 LEU B CA    1 
ATOM   3831  C  C     . LEU B 2 364 ? -9.630  7.757   -22.867  1.00 11.55 ? 364 LEU B C     1 
ATOM   3832  O  O     . LEU B 2 364 ? -9.794  6.528   -22.956  1.00 9.64  ? 364 LEU B O     1 
ATOM   3833  C  CB    . LEU B 2 364 ? -10.906 9.059   -24.480  1.00 4.24  ? 364 LEU B CB    1 
ATOM   3834  C  CG    . LEU B 2 364 ? -11.747 8.219   -25.459  1.00 2.00  ? 364 LEU B CG    1 
ATOM   3835  C  CD1   . LEU B 2 364 ? -11.490 8.406   -26.817  1.00 2.00  ? 364 LEU B CD1   1 
ATOM   3836  C  CD2   . LEU B 2 364 ? -12.116 6.763   -25.105  1.00 11.14 ? 364 LEU B CD2   1 
ATOM   3837  N  N     . VAL B 2 365 ? -8.436  8.381   -22.764  1.00 6.50  ? 365 VAL B N     1 
ATOM   3838  C  CA    . VAL B 2 365 ? -7.173  7.680   -22.442  1.00 2.09  ? 365 VAL B CA    1 
ATOM   3839  C  C     . VAL B 2 365 ? -7.303  6.860   -21.134  1.00 2.00  ? 365 VAL B C     1 
ATOM   3840  O  O     . VAL B 2 365 ? -7.051  5.660   -21.114  1.00 3.22  ? 365 VAL B O     1 
ATOM   3841  C  CB    . VAL B 2 365 ? -5.890  8.631   -22.452  1.00 4.87  ? 365 VAL B CB    1 
ATOM   3842  C  CG1   . VAL B 2 365 ? -4.641  7.851   -22.109  1.00 2.00  ? 365 VAL B CG1   1 
ATOM   3843  C  CG2   . VAL B 2 365 ? -5.661  9.328   -23.799  1.00 7.42  ? 365 VAL B CG2   1 
ATOM   3844  N  N     . SER B 2 366 ? -7.763  7.487   -20.072  1.00 2.00  ? 366 SER B N     1 
ATOM   3845  C  CA    . SER B 2 366 ? -8.002  6.751   -18.832  1.00 7.64  ? 366 SER B CA    1 
ATOM   3846  C  C     . SER B 2 366 ? -8.689  5.409   -19.074  1.00 4.32  ? 366 SER B C     1 
ATOM   3847  O  O     . SER B 2 366 ? -8.161  4.306   -18.790  1.00 6.10  ? 366 SER B O     1 
ATOM   3848  C  CB    . SER B 2 366 ? -8.866  7.556   -17.887  1.00 2.00  ? 366 SER B CB    1 
ATOM   3849  O  OG    . SER B 2 366 ? -8.056  8.534   -17.318  1.00 5.49  ? 366 SER B OG    1 
ATOM   3850  N  N     . VAL B 2 367 ? -9.874  5.557   -19.605  1.00 2.00  ? 367 VAL B N     1 
ATOM   3851  C  CA    . VAL B 2 367 ? -10.733 4.456   -19.958  1.00 8.42  ? 367 VAL B CA    1 
ATOM   3852  C  C     . VAL B 2 367 ? -10.096 3.500   -20.996  1.00 6.28  ? 367 VAL B C     1 
ATOM   3853  O  O     . VAL B 2 367 ? -10.264 2.288   -20.936  1.00 8.32  ? 367 VAL B O     1 
ATOM   3854  C  CB    . VAL B 2 367 ? -12.030 5.075   -20.365  1.00 4.88  ? 367 VAL B CB    1 
ATOM   3855  C  CG1   . VAL B 2 367 ? -12.867 4.151   -21.050  1.00 7.02  ? 367 VAL B CG1   1 
ATOM   3856  C  CG2   . VAL B 2 367 ? -12.698 5.553   -19.072  1.00 4.49  ? 367 VAL B CG2   1 
ATOM   3857  N  N     . SER B 2 368 ? -9.244  4.020   -21.854  1.00 7.44  ? 368 SER B N     1 
ATOM   3858  C  CA    . SER B 2 368 ? -8.518  3.130   -22.749  1.00 17.64 ? 368 SER B CA    1 
ATOM   3859  C  C     . SER B 2 368 ? -7.691  2.148   -21.965  1.00 17.21 ? 368 SER B C     1 
ATOM   3860  O  O     . SER B 2 368 ? -7.472  1.024   -22.406  1.00 5.25  ? 368 SER B O     1 
ATOM   3861  C  CB    . SER B 2 368 ? -7.520  3.944   -23.551  1.00 9.50  ? 368 SER B CB    1 
ATOM   3862  O  OG    . SER B 2 368 ? -8.192  4.308   -24.716  1.00 28.26 ? 368 SER B OG    1 
ATOM   3863  N  N     . MET B 2 369 ? -7.116  2.612   -20.862  1.00 9.16  ? 369 MET B N     1 
ATOM   3864  C  CA    . MET B 2 369 ? -6.091  1.793   -20.278  1.00 24.15 ? 369 MET B CA    1 
ATOM   3865  C  C     . MET B 2 369 ? -6.702  0.936   -19.199  1.00 5.83  ? 369 MET B C     1 
ATOM   3866  O  O     . MET B 2 369 ? -6.184  -0.076  -18.880  1.00 8.61  ? 369 MET B O     1 
ATOM   3867  C  CB    . MET B 2 369 ? -4.927  2.640   -19.774  1.00 32.53 ? 369 MET B CB    1 
ATOM   3868  C  CG    . MET B 2 369 ? -4.478  3.683   -20.846  1.00 51.06 ? 369 MET B CG    1 
ATOM   3869  S  SD    . MET B 2 369 ? -2.892  4.549   -20.542  1.00 41.43 ? 369 MET B SD    1 
ATOM   3870  C  CE    . MET B 2 369 ? -1.650  3.303   -20.995  1.00 32.47 ? 369 MET B CE    1 
ATOM   3871  N  N     . GLY B 2 370 ? -7.833  1.349   -18.666  1.00 2.00  ? 370 GLY B N     1 
ATOM   3872  C  CA    . GLY B 2 370 ? -8.335  0.728   -17.512  1.00 5.75  ? 370 GLY B CA    1 
ATOM   3873  C  C     . GLY B 2 370 ? -9.421  -0.308  -17.775  1.00 6.30  ? 370 GLY B C     1 
ATOM   3874  O  O     . GLY B 2 370 ? -9.776  -1.036  -16.858  1.00 10.12 ? 370 GLY B O     1 
ATOM   3875  N  N     . CYS B 2 371 ? -9.948  -0.398  -18.996  1.00 5.37  ? 371 CYS B N     1 
ATOM   3876  C  CA    . CYS B 2 371 ? -11.141 -1.248  -19.258  1.00 2.34  ? 371 CYS B CA    1 
ATOM   3877  C  C     . CYS B 2 371 ? -10.852 -2.267  -20.340  1.00 2.00  ? 371 CYS B C     1 
ATOM   3878  O  O     . CYS B 2 371 ? -11.179 -2.069  -21.423  1.00 4.28  ? 371 CYS B O     1 
ATOM   3879  C  CB    . CYS B 2 371 ? -12.275 -0.366  -19.715  1.00 2.00  ? 371 CYS B CB    1 
ATOM   3880  S  SG    . CYS B 2 371 ? -12.826 0.766   -18.395  1.00 2.64  ? 371 CYS B SG    1 
ATOM   3881  N  N     . PRO B 2 372 ? -10.176 -3.361  -20.032  1.00 6.66  ? 372 PRO B N     1 
ATOM   3882  C  CA    . PRO B 2 372 ? -9.571  -4.168  -21.102  1.00 2.00  ? 372 PRO B CA    1 
ATOM   3883  C  C     . PRO B 2 372 ? -10.602 -4.648  -22.101  1.00 2.74  ? 372 PRO B C     1 
ATOM   3884  O  O     . PRO B 2 372 ? -10.244 -5.097  -23.164  1.00 4.97  ? 372 PRO B O     1 
ATOM   3885  C  CB    . PRO B 2 372 ? -9.082  -5.393  -20.369  1.00 2.81  ? 372 PRO B CB    1 
ATOM   3886  C  CG    . PRO B 2 372 ? -9.582  -5.260  -18.905  1.00 2.35  ? 372 PRO B CG    1 
ATOM   3887  C  CD    . PRO B 2 372 ? -9.930  -3.904  -18.668  1.00 2.00  ? 372 PRO B CD    1 
ATOM   3888  N  N     . LYS B 2 373 ? -11.883 -4.547  -21.763  1.00 10.51 ? 373 LYS B N     1 
ATOM   3889  C  CA    . LYS B 2 373 ? -12.960 -5.075  -22.624  1.00 11.40 ? 373 LYS B CA    1 
ATOM   3890  C  C     . LYS B 2 373 ? -13.791 -3.988  -23.379  1.00 9.04  ? 373 LYS B C     1 
ATOM   3891  O  O     . LYS B 2 373 ? -14.850 -4.278  -23.995  1.00 19.62 ? 373 LYS B O     1 
ATOM   3892  C  CB    . LYS B 2 373 ? -13.883 -5.980  -21.801  1.00 9.47  ? 373 LYS B CB    1 
ATOM   3893  C  CG    . LYS B 2 373 ? -13.365 -7.356  -21.504  1.00 2.01  ? 373 LYS B CG    1 
ATOM   3894  C  CD    . LYS B 2 373 ? -14.251 -7.930  -20.424  1.00 27.83 ? 373 LYS B CD    1 
ATOM   3895  C  CE    . LYS B 2 373 ? -13.757 -9.288  -19.956  1.00 17.48 ? 373 LYS B CE    1 
ATOM   3896  N  NZ    . LYS B 2 373 ? -13.660 -10.235 -21.130  1.00 14.32 ? 373 LYS B NZ    1 
ATOM   3897  N  N     . LEU B 2 374 ? -13.289 -2.757  -23.365  1.00 11.69 ? 374 LEU B N     1 
ATOM   3898  C  CA    . LEU B 2 374 ? -13.954 -1.658  -24.033  1.00 9.66  ? 374 LEU B CA    1 
ATOM   3899  C  C     . LEU B 2 374 ? -13.759 -1.800  -25.543  1.00 4.12  ? 374 LEU B C     1 
ATOM   3900  O  O     . LEU B 2 374 ? -12.628 -1.904  -26.097  1.00 2.00  ? 374 LEU B O     1 
ATOM   3901  C  CB    . LEU B 2 374 ? -13.448 -0.338  -23.497  1.00 8.34  ? 374 LEU B CB    1 
ATOM   3902  C  CG    . LEU B 2 374 ? -13.852 0.987   -24.151  1.00 13.02 ? 374 LEU B CG    1 
ATOM   3903  C  CD1   . LEU B 2 374 ? -15.297 1.346   -23.744  1.00 2.00  ? 374 LEU B CD1   1 
ATOM   3904  C  CD2   . LEU B 2 374 ? -12.860 2.054   -23.655  1.00 2.00  ? 374 LEU B CD2   1 
ATOM   3905  N  N     . GLU B 2 375 ? -14.873 -1.817  -26.238  1.00 2.00  ? 375 GLU B N     1 
ATOM   3906  C  CA    . GLU B 2 375 ? -14.740 -2.111  -27.662  1.00 2.00  ? 375 GLU B CA    1 
ATOM   3907  C  C     . GLU B 2 375 ? -15.471 -1.062  -28.441  1.00 2.08  ? 375 GLU B C     1 
ATOM   3908  O  O     . GLU B 2 375 ? -15.364 -0.934  -29.707  1.00 2.90  ? 375 GLU B O     1 
ATOM   3909  C  CB    . GLU B 2 375 ? -15.176 -3.573  -28.006  1.00 5.19  ? 375 GLU B CB    1 
ATOM   3910  C  CG    . GLU B 2 375 ? -16.609 -3.968  -27.715  1.00 2.00  ? 375 GLU B CG    1 
ATOM   3911  C  CD    . GLU B 2 375 ? -16.937 -5.238  -28.464  1.00 7.09  ? 375 GLU B CD    1 
ATOM   3912  O  OE1   . GLU B 2 375 ? -16.842 -5.216  -29.712  1.00 14.50 ? 375 GLU B OE1   1 
ATOM   3913  O  OE2   . GLU B 2 375 ? -17.257 -6.262  -27.833  1.00 3.18  ? 375 GLU B OE2   1 
ATOM   3914  N  N     . SER B 2 376 ? -16.231 -0.308  -27.692  1.00 2.00  ? 376 SER B N     1 
ATOM   3915  C  CA    . SER B 2 376 ? -17.222 0.493   -28.340  1.00 6.17  ? 376 SER B CA    1 
ATOM   3916  C  C     . SER B 2 376 ? -17.300 1.850   -27.750  1.00 5.89  ? 376 SER B C     1 
ATOM   3917  O  O     . SER B 2 376 ? -17.659 1.979   -26.534  1.00 3.84  ? 376 SER B O     1 
ATOM   3918  C  CB    . SER B 2 376 ? -18.604 -0.097  -28.209  1.00 19.76 ? 376 SER B CB    1 
ATOM   3919  O  OG    . SER B 2 376 ? -19.498 0.775   -28.878  1.00 5.97  ? 376 SER B OG    1 
ATOM   3920  N  N     . VAL B 2 377 ? -16.941 2.835   -28.587  1.00 4.25  ? 377 VAL B N     1 
ATOM   3921  C  CA    . VAL B 2 377 ? -16.778 4.226   -28.119  1.00 9.33  ? 377 VAL B CA    1 
ATOM   3922  C  C     . VAL B 2 377 ? -17.494 5.267   -28.973  1.00 7.43  ? 377 VAL B C     1 
ATOM   3923  O  O     . VAL B 2 377 ? -17.289 5.327   -30.204  1.00 2.00  ? 377 VAL B O     1 
ATOM   3924  C  CB    . VAL B 2 377 ? -15.259 4.598   -27.913  1.00 16.66 ? 377 VAL B CB    1 
ATOM   3925  C  CG1   . VAL B 2 377 ? -15.068 6.143   -27.744  1.00 3.53  ? 377 VAL B CG1   1 
ATOM   3926  C  CG2   . VAL B 2 377 ? -14.818 3.888   -26.634  1.00 2.00  ? 377 VAL B CG2   1 
ATOM   3927  N  N     . LEU B 2 378 ? -18.279 6.117   -28.290  1.00 5.99  ? 378 LEU B N     1 
ATOM   3928  C  CA    . LEU B 2 378 ? -18.753 7.382   -28.912  1.00 10.12 ? 378 LEU B CA    1 
ATOM   3929  C  C     . LEU B 2 378 ? -18.385 8.535   -28.009  1.00 6.23  ? 378 LEU B C     1 
ATOM   3930  O  O     . LEU B 2 378 ? -18.798 8.551   -26.816  1.00 7.38  ? 378 LEU B O     1 
ATOM   3931  C  CB    . LEU B 2 378 ? -20.312 7.406   -29.093  1.00 7.83  ? 378 LEU B CB    1 
ATOM   3932  C  CG    . LEU B 2 378 ? -20.941 8.724   -29.712  1.00 6.97  ? 378 LEU B CG    1 
ATOM   3933  C  CD1   . LEU B 2 378 ? -20.402 9.157   -31.051  1.00 2.00  ? 378 LEU B CD1   1 
ATOM   3934  C  CD2   . LEU B 2 378 ? -22.436 8.589   -29.861  1.00 2.87  ? 378 LEU B CD2   1 
ATOM   3935  N  N     . TYR B 2 379 ? -17.695 9.517   -28.558  1.00 2.00  ? 379 TYR B N     1 
ATOM   3936  C  CA    . TYR B 2 379 ? -17.101 10.542  -27.719  1.00 2.00  ? 379 TYR B CA    1 
ATOM   3937  C  C     . TYR B 2 379 ? -17.163 11.950  -28.339  1.00 7.12  ? 379 TYR B C     1 
ATOM   3938  O  O     . TYR B 2 379 ? -16.618 12.216  -29.436  1.00 2.00  ? 379 TYR B O     1 
ATOM   3939  C  CB    . TYR B 2 379 ? -15.686 10.119  -27.393  1.00 3.98  ? 379 TYR B CB    1 
ATOM   3940  C  CG    . TYR B 2 379 ? -15.027 10.695  -26.165  1.00 2.79  ? 379 TYR B CG    1 
ATOM   3941  C  CD1   . TYR B 2 379 ? -15.310 10.217  -24.899  1.00 11.23 ? 379 TYR B CD1   1 
ATOM   3942  C  CD2   . TYR B 2 379 ? -14.051 11.696  -26.301  1.00 9.98  ? 379 TYR B CD2   1 
ATOM   3943  C  CE1   . TYR B 2 379 ? -14.650 10.738  -23.761  1.00 8.65  ? 379 TYR B CE1   1 
ATOM   3944  C  CE2   . TYR B 2 379 ? -13.387 12.185  -25.230  1.00 6.63  ? 379 TYR B CE2   1 
ATOM   3945  C  CZ    . TYR B 2 379 ? -13.660 11.714  -23.928  1.00 8.07  ? 379 TYR B CZ    1 
ATOM   3946  O  OH    . TYR B 2 379 ? -12.964 12.295  -22.796  1.00 6.64  ? 379 TYR B OH    1 
ATOM   3947  N  N     . PHE B 2 380 ? -17.842 12.854  -27.596  1.00 6.77  ? 380 PHE B N     1 
ATOM   3948  C  CA    . PHE B 2 380 ? -17.792 14.310  -27.915  1.00 12.48 ? 380 PHE B CA    1 
ATOM   3949  C  C     . PHE B 2 380 ? -16.925 15.068  -26.990  1.00 4.95  ? 380 PHE B C     1 
ATOM   3950  O  O     . PHE B 2 380 ? -17.209 15.077  -25.794  1.00 2.00  ? 380 PHE B O     1 
ATOM   3951  C  CB    . PHE B 2 380 ? -19.188 14.923  -27.877  1.00 11.08 ? 380 PHE B CB    1 
ATOM   3952  C  CG    . PHE B 2 380 ? -20.130 14.341  -28.939  1.00 2.51  ? 380 PHE B CG    1 
ATOM   3953  C  CD1   . PHE B 2 380 ? -20.793 13.164  -28.730  1.00 10.86 ? 380 PHE B CD1   1 
ATOM   3954  C  CD2   . PHE B 2 380 ? -20.305 14.963  -30.163  1.00 7.96  ? 380 PHE B CD2   1 
ATOM   3955  C  CE1   . PHE B 2 380 ? -21.694 12.643  -29.730  1.00 2.00  ? 380 PHE B CE1   1 
ATOM   3956  C  CE2   . PHE B 2 380 ? -21.182 14.476  -31.147  1.00 2.00  ? 380 PHE B CE2   1 
ATOM   3957  C  CZ    . PHE B 2 380 ? -21.866 13.332  -30.923  1.00 3.50  ? 380 PHE B CZ    1 
ATOM   3958  N  N     . CYS B 2 381 ? -15.866 15.696  -27.545  1.00 2.00  ? 381 CYS B N     1 
ATOM   3959  C  CA    . CYS B 2 381 ? -15.040 16.651  -26.768  1.00 2.00  ? 381 CYS B CA    1 
ATOM   3960  C  C     . CYS B 2 381 ? -14.604 17.948  -27.547  1.00 2.00  ? 381 CYS B C     1 
ATOM   3961  O  O     . CYS B 2 381 ? -14.740 18.074  -28.765  1.00 2.15  ? 381 CYS B O     1 
ATOM   3962  C  CB    . CYS B 2 381 ? -13.783 15.923  -26.334  1.00 2.00  ? 381 CYS B CB    1 
ATOM   3963  S  SG    . CYS B 2 381 ? -12.944 15.216  -27.819  1.00 2.58  ? 381 CYS B SG    1 
ATOM   3964  N  N     . ARG B 2 382 ? -13.954 18.896  -26.890  1.00 10.10 ? 382 ARG B N     1 
ATOM   3965  C  CA    . ARG B 2 382 ? -13.446 19.958  -27.735  1.00 5.52  ? 382 ARG B CA    1 
ATOM   3966  C  C     . ARG B 2 382 ? -12.052 19.966  -28.131  1.00 10.84 ? 382 ARG B C     1 
ATOM   3967  O  O     . ARG B 2 382 ? -11.697 20.907  -28.854  1.00 3.78  ? 382 ARG B O     1 
ATOM   3968  C  CB    . ARG B 2 382 ? -13.849 21.325  -27.329  1.00 2.00  ? 382 ARG B CB    1 
ATOM   3969  C  CG    . ARG B 2 382 ? -15.248 21.413  -26.990  1.00 2.00  ? 382 ARG B CG    1 
ATOM   3970  C  CD    . ARG B 2 382 ? -15.369 22.484  -26.024  1.00 2.00  ? 382 ARG B CD    1 
ATOM   3971  N  NE    . ARG B 2 382 ? -16.609 23.155  -26.281  1.00 7.02  ? 382 ARG B NE    1 
ATOM   3972  C  CZ    . ARG B 2 382 ? -17.744 22.764  -25.748  1.00 14.79 ? 382 ARG B CZ    1 
ATOM   3973  N  NH1   . ARG B 2 382 ? -17.712 21.698  -24.932  1.00 19.18 ? 382 ARG B NH1   1 
ATOM   3974  N  NH2   . ARG B 2 382 ? -18.878 23.421  -26.028  1.00 24.76 ? 382 ARG B NH2   1 
ATOM   3975  N  N     . GLN B 2 383 ? -11.248 18.971  -27.693  1.00 4.51  ? 383 GLN B N     1 
ATOM   3976  C  CA    . GLN B 2 383 ? -9.787  18.912  -28.143  1.00 5.12  ? 383 GLN B CA    1 
ATOM   3977  C  C     . GLN B 2 383 ? -9.195  17.458  -28.132  1.00 2.00  ? 383 GLN B C     1 
ATOM   3978  O  O     . GLN B 2 383 ? -9.734  16.570  -27.470  1.00 4.59  ? 383 GLN B O     1 
ATOM   3979  C  CB    . GLN B 2 383 ? -8.950  19.773  -27.150  1.00 10.35 ? 383 GLN B CB    1 
ATOM   3980  C  CG    . GLN B 2 383 ? -8.670  19.021  -25.808  1.00 2.00  ? 383 GLN B CG    1 
ATOM   3981  C  CD    . GLN B 2 383 ? -8.196  19.933  -24.744  1.00 16.79 ? 383 GLN B CD    1 
ATOM   3982  O  OE1   . GLN B 2 383 ? -7.395  19.553  -23.887  1.00 2.00  ? 383 GLN B OE1   1 
ATOM   3983  N  NE2   . GLN B 2 383 ? -8.706  21.156  -24.759  1.00 5.92  ? 383 GLN B NE2   1 
ATOM   3984  N  N     . MET B 2 384 ? -8.071  17.218  -28.748  1.00 2.00  ? 384 MET B N     1 
ATOM   3985  C  CA    . MET B 2 384 ? -7.638  15.883  -28.930  1.00 2.00  ? 384 MET B CA    1 
ATOM   3986  C  C     . MET B 2 384 ? -6.199  15.924  -29.438  1.00 9.21  ? 384 MET B C     1 
ATOM   3987  O  O     . MET B 2 384 ? -5.767  16.982  -29.908  1.00 11.28 ? 384 MET B O     1 
ATOM   3988  C  CB    . MET B 2 384 ? -8.519  15.306  -30.024  1.00 13.84 ? 384 MET B CB    1 
ATOM   3989  C  CG    . MET B 2 384 ? -8.136  13.901  -30.469  1.00 2.07  ? 384 MET B CG    1 
ATOM   3990  S  SD    . MET B 2 384 ? -8.103  12.831  -29.000  1.00 4.98  ? 384 MET B SD    1 
ATOM   3991  C  CE    . MET B 2 384 ? -9.674  13.119  -28.213  1.00 2.00  ? 384 MET B CE    1 
ATOM   3992  N  N     . THR B 2 385 ? -5.450  14.818  -29.410  1.00 3.03  ? 385 THR B N     1 
ATOM   3993  C  CA    . THR B 2 385 ? -4.085  14.871  -29.994  1.00 2.00  ? 385 THR B CA    1 
ATOM   3994  C  C     . THR B 2 385 ? -3.808  13.603  -30.723  1.00 2.00  ? 385 THR B C     1 
ATOM   3995  O  O     . THR B 2 385 ? -4.391  12.547  -30.470  1.00 7.33  ? 385 THR B O     1 
ATOM   3996  C  CB    . THR B 2 385 ? -3.013  14.964  -28.870  1.00 11.80 ? 385 THR B CB    1 
ATOM   3997  O  OG1   . THR B 2 385 ? -3.267  13.931  -27.900  1.00 2.22  ? 385 THR B OG1   1 
ATOM   3998  C  CG2   . THR B 2 385 ? -3.194  16.294  -28.089  1.00 19.73 ? 385 THR B CG2   1 
ATOM   3999  N  N     . ASN B 2 386 ? -2.909  13.695  -31.658  1.00 8.74  ? 386 ASN B N     1 
ATOM   4000  C  CA    . ASN B 2 386 ? -2.258  12.552  -32.162  1.00 7.84  ? 386 ASN B CA    1 
ATOM   4001  C  C     . ASN B 2 386 ? -1.727  11.612  -31.075  1.00 13.95 ? 386 ASN B C     1 
ATOM   4002  O  O     . ASN B 2 386 ? -1.967  10.400  -31.111  1.00 6.03  ? 386 ASN B O     1 
ATOM   4003  C  CB    . ASN B 2 386 ? -1.213  13.052  -33.115  1.00 2.00  ? 386 ASN B CB    1 
ATOM   4004  C  CG    . ASN B 2 386 ? -1.840  13.464  -34.434  1.00 16.48 ? 386 ASN B CG    1 
ATOM   4005  O  OD1   . ASN B 2 386 ? -2.799  12.850  -34.855  1.00 2.00  ? 386 ASN B OD1   1 
ATOM   4006  N  ND2   . ASN B 2 386 ? -1.346  14.526  -35.059  1.00 13.74 ? 386 ASN B ND2   1 
ATOM   4007  N  N     . ALA B 2 387 ? -1.058  12.164  -30.069  1.00 7.09  ? 387 ALA B N     1 
ATOM   4008  C  CA    . ALA B 2 387 ? -0.542  11.296  -29.025  1.00 18.47 ? 387 ALA B CA    1 
ATOM   4009  C  C     . ALA B 2 387 ? -1.676  10.530  -28.343  1.00 10.17 ? 387 ALA B C     1 
ATOM   4010  O  O     . ALA B 2 387 ? -1.555  9.338   -28.115  1.00 15.08 ? 387 ALA B O     1 
ATOM   4011  C  CB    . ALA B 2 387 ? 0.314   12.064  -27.985  1.00 5.74  ? 387 ALA B CB    1 
ATOM   4012  N  N     . ALA B 2 388 ? -2.754  11.202  -27.961  1.00 11.40 ? 388 ALA B N     1 
ATOM   4013  C  CA    . ALA B 2 388 ? -3.814  10.477  -27.287  1.00 9.78  ? 388 ALA B CA    1 
ATOM   4014  C  C     . ALA B 2 388 ? -4.390  9.346   -28.162  1.00 20.76 ? 388 ALA B C     1 
ATOM   4015  O  O     . ALA B 2 388 ? -4.719  8.246   -27.652  1.00 7.45  ? 388 ALA B O     1 
ATOM   4016  C  CB    . ALA B 2 388 ? -4.938  11.392  -26.752  1.00 7.85  ? 388 ALA B CB    1 
ATOM   4017  N  N     . LEU B 2 389 ? -4.534  9.597   -29.456  1.00 2.75  ? 389 LEU B N     1 
ATOM   4018  C  CA    . LEU B 2 389 ? -5.195  8.579   -30.252  1.00 5.83  ? 389 LEU B CA    1 
ATOM   4019  C  C     . LEU B 2 389 ? -4.269  7.395   -30.286  1.00 12.58 ? 389 LEU B C     1 
ATOM   4020  O  O     . LEU B 2 389 ? -4.724  6.252   -30.261  1.00 11.27 ? 389 LEU B O     1 
ATOM   4021  C  CB    . LEU B 2 389 ? -5.390  9.041   -31.665  1.00 2.00  ? 389 LEU B CB    1 
ATOM   4022  C  CG    . LEU B 2 389 ? -6.505  10.090  -31.497  1.00 4.52  ? 389 LEU B CG    1 
ATOM   4023  C  CD1   . LEU B 2 389 ? -6.628  10.903  -32.786  1.00 3.33  ? 389 LEU B CD1   1 
ATOM   4024  C  CD2   . LEU B 2 389 ? -7.886  9.587   -31.174  1.00 2.00  ? 389 LEU B CD2   1 
ATOM   4025  N  N     . ILE B 2 390 ? -2.966  7.686   -30.421  1.00 4.82  ? 390 ILE B N     1 
ATOM   4026  C  CA    . ILE B 2 390 ? -2.013  6.648   -30.586  1.00 2.00  ? 390 ILE B CA    1 
ATOM   4027  C  C     . ILE B 2 390 ? -2.017  5.774   -29.320  1.00 2.42  ? 390 ILE B C     1 
ATOM   4028  O  O     . ILE B 2 390 ? -1.705  4.654   -29.450  1.00 7.48  ? 390 ILE B O     1 
ATOM   4029  C  CB    . ILE B 2 390 ? -0.607  7.214   -30.797  1.00 6.98  ? 390 ILE B CB    1 
ATOM   4030  C  CG1   . ILE B 2 390 ? -0.460  7.876   -32.157  1.00 3.71  ? 390 ILE B CG1   1 
ATOM   4031  C  CG2   . ILE B 2 390 ? 0.437   6.124   -30.662  1.00 2.98  ? 390 ILE B CG2   1 
ATOM   4032  C  CD1   . ILE B 2 390 ? 0.939   8.335   -32.443  1.00 2.00  ? 390 ILE B CD1   1 
ATOM   4033  N  N     . THR B 2 391 ? -2.358  6.267   -28.126  1.00 2.00  ? 391 THR B N     1 
ATOM   4034  C  CA    . THR B 2 391 ? -2.210  5.519   -26.863  1.00 2.11  ? 391 THR B CA    1 
ATOM   4035  C  C     . THR B 2 391 ? -3.504  4.679   -26.730  1.00 10.65 ? 391 THR B C     1 
ATOM   4036  O  O     . THR B 2 391 ? -3.560  3.551   -26.140  1.00 12.21 ? 391 THR B O     1 
ATOM   4037  C  CB    . THR B 2 391 ? -2.138  6.546   -25.603  1.00 15.42 ? 391 THR B CB    1 
ATOM   4038  O  OG1   . THR B 2 391 ? -0.883  7.221   -25.558  1.00 7.90  ? 391 THR B OG1   1 
ATOM   4039  C  CG2   . THR B 2 391 ? -2.317  5.893   -24.207  1.00 2.00  ? 391 THR B CG2   1 
ATOM   4040  N  N     . ILE B 2 392 ? -4.559  5.244   -27.282  1.00 4.08  ? 392 ILE B N     1 
ATOM   4041  C  CA    . ILE B 2 392 ? -5.841  4.613   -27.298  1.00 5.21  ? 392 ILE B CA    1 
ATOM   4042  C  C     . ILE B 2 392 ? -5.758  3.388   -28.238  1.00 5.63  ? 392 ILE B C     1 
ATOM   4043  O  O     . ILE B 2 392 ? -6.219  2.264   -27.884  1.00 8.13  ? 392 ILE B O     1 
ATOM   4044  C  CB    . ILE B 2 392 ? -6.945  5.624   -27.720  1.00 7.26  ? 392 ILE B CB    1 
ATOM   4045  C  CG1   . ILE B 2 392 ? -7.194  6.583   -26.573  1.00 2.00  ? 392 ILE B CG1   1 
ATOM   4046  C  CG2   . ILE B 2 392 ? -8.299  4.948   -27.950  1.00 4.04  ? 392 ILE B CG2   1 
ATOM   4047  C  CD1   . ILE B 2 392 ? -7.997  7.888   -27.008  1.00 4.50  ? 392 ILE B CD1   1 
ATOM   4048  N  N     . ALA B 2 393 ? -5.095  3.541   -29.350  1.00 2.00  ? 393 ALA B N     1 
ATOM   4049  C  CA    . ALA B 2 393 ? -5.064  2.437   -30.310  1.00 10.75 ? 393 ALA B CA    1 
ATOM   4050  C  C     . ALA B 2 393 ? -4.126  1.333   -29.757  1.00 13.86 ? 393 ALA B C     1 
ATOM   4051  O  O     . ALA B 2 393 ? -4.452  0.163   -29.700  1.00 14.61 ? 393 ALA B O     1 
ATOM   4052  C  CB    . ALA B 2 393 ? -4.529  2.911   -31.657  1.00 2.00  ? 393 ALA B CB    1 
ATOM   4053  N  N     . ARG B 2 394 ? -2.946  1.727   -29.352  1.00 11.77 ? 394 ARG B N     1 
ATOM   4054  C  CA    . ARG B 2 394 ? -2.130  0.872   -28.553  1.00 15.66 ? 394 ARG B CA    1 
ATOM   4055  C  C     . ARG B 2 394 ? -2.938  0.132   -27.439  1.00 14.17 ? 394 ARG B C     1 
ATOM   4056  O  O     . ARG B 2 394 ? -2.709  -1.070  -27.233  1.00 10.01 ? 394 ARG B O     1 
ATOM   4057  C  CB    . ARG B 2 394 ? -0.996  1.690   -27.968  1.00 5.23  ? 394 ARG B CB    1 
ATOM   4058  C  CG    . ARG B 2 394 ? 0.322   1.097   -28.110  1.00 5.61  ? 394 ARG B CG    1 
ATOM   4059  C  CD    . ARG B 2 394 ? 1.378   2.173   -28.436  1.00 36.05 ? 394 ARG B CD    1 
ATOM   4060  N  NE    . ARG B 2 394 ? 1.636   2.149   -29.878  1.00 67.15 ? 394 ARG B NE    1 
ATOM   4061  C  CZ    . ARG B 2 394 ? 2.592   2.825   -30.513  1.00 56.60 ? 394 ARG B CZ    1 
ATOM   4062  N  NH1   . ARG B 2 394 ? 3.411   3.623   -29.833  1.00 33.09 ? 394 ARG B NH1   1 
ATOM   4063  N  NH2   . ARG B 2 394 ? 2.720   2.700   -31.841  1.00 43.94 ? 394 ARG B NH2   1 
ATOM   4064  N  N     . ASN B 2 395 ? -3.831  0.781   -26.681  1.00 7.94  ? 395 ASN B N     1 
ATOM   4065  C  CA    . ASN B 2 395 ? -4.288  0.052   -25.436  1.00 7.60  ? 395 ASN B CA    1 
ATOM   4066  C  C     . ASN B 2 395 ? -5.439  -0.902  -25.768  1.00 16.03 ? 395 ASN B C     1 
ATOM   4067  O  O     . ASN B 2 395 ? -5.684  -1.890  -25.017  1.00 10.43 ? 395 ASN B O     1 
ATOM   4068  C  CB    . ASN B 2 395 ? -4.759  0.952   -24.306  1.00 7.37  ? 395 ASN B CB    1 
ATOM   4069  C  CG    . ASN B 2 395 ? -3.692  1.906   -23.790  1.00 11.58 ? 395 ASN B CG    1 
ATOM   4070  O  OD1   . ASN B 2 395 ? -2.545  1.543   -23.671  1.00 8.44  ? 395 ASN B OD1   1 
ATOM   4071  N  ND2   . ASN B 2 395 ? -4.095  3.118   -23.421  1.00 24.77 ? 395 ASN B ND2   1 
ATOM   4072  N  N     . ARG B 2 396 ? -6.123  -0.598  -26.898  1.00 10.91 ? 396 ARG B N     1 
ATOM   4073  C  CA    . ARG B 2 396 ? -7.400  -1.232  -27.260  1.00 6.80  ? 396 ARG B CA    1 
ATOM   4074  C  C     . ARG B 2 396 ? -7.471  -1.819  -28.647  1.00 2.00  ? 396 ARG B C     1 
ATOM   4075  O  O     . ARG B 2 396 ? -8.291  -1.482  -29.436  1.00 6.37  ? 396 ARG B O     1 
ATOM   4076  C  CB    . ARG B 2 396 ? -8.499  -0.267  -26.979  1.00 2.00  ? 396 ARG B CB    1 
ATOM   4077  C  CG    . ARG B 2 396 ? -8.505  0.019   -25.522  1.00 2.00  ? 396 ARG B CG    1 
ATOM   4078  C  CD    . ARG B 2 396 ? -9.383  -1.009  -24.726  1.00 4.54  ? 396 ARG B CD    1 
ATOM   4079  N  NE    . ARG B 2 396 ? -8.787  -2.346  -24.688  1.00 8.16  ? 396 ARG B NE    1 
ATOM   4080  C  CZ    . ARG B 2 396 ? -7.880  -2.755  -23.799  1.00 10.94 ? 396 ARG B CZ    1 
ATOM   4081  N  NH1   . ARG B 2 396 ? -7.465  -1.996  -22.801  1.00 2.00  ? 396 ARG B NH1   1 
ATOM   4082  N  NH2   . ARG B 2 396 ? -7.412  -3.954  -23.908  1.00 4.00  ? 396 ARG B NH2   1 
ATOM   4083  N  N     . PRO B 2 397 ? -6.546  -2.685  -28.967  1.00 7.52  ? 397 PRO B N     1 
ATOM   4084  C  CA    . PRO B 2 397 ? -6.566  -3.230  -30.321  1.00 3.62  ? 397 PRO B CA    1 
ATOM   4085  C  C     . PRO B 2 397 ? -7.839  -4.071  -30.585  1.00 9.80  ? 397 PRO B C     1 
ATOM   4086  O  O     . PRO B 2 397 ? -8.084  -4.516  -31.718  1.00 6.07  ? 397 PRO B O     1 
ATOM   4087  C  CB    . PRO B 2 397 ? -5.291  -4.110  -30.364  1.00 2.00  ? 397 PRO B CB    1 
ATOM   4088  C  CG    . PRO B 2 397 ? -5.048  -4.427  -28.911  1.00 3.55  ? 397 PRO B CG    1 
ATOM   4089  C  CD    . PRO B 2 397 ? -5.442  -3.216  -28.149  1.00 2.00  ? 397 PRO B CD    1 
ATOM   4090  N  N     . ASN B 2 398 ? -8.647  -4.276  -29.557  1.00 2.97  ? 398 ASN B N     1 
ATOM   4091  C  CA    . ASN B 2 398 ? -9.886  -5.017  -29.726  1.00 7.22  ? 398 ASN B CA    1 
ATOM   4092  C  C     . ASN B 2 398 ? -11.079 -4.072  -30.010  1.00 3.67  ? 398 ASN B C     1 
ATOM   4093  O  O     . ASN B 2 398 ? -12.221 -4.518  -30.160  1.00 7.85  ? 398 ASN B O     1 
ATOM   4094  C  CB    . ASN B 2 398 ? -10.173 -5.740  -28.412  1.00 2.00  ? 398 ASN B CB    1 
ATOM   4095  C  CG    . ASN B 2 398 ? -10.131 -4.770  -27.201  1.00 2.43  ? 398 ASN B CG    1 
ATOM   4096  O  OD1   . ASN B 2 398 ? -9.180  -3.933  -27.060  1.00 8.88  ? 398 ASN B OD1   1 
ATOM   4097  N  ND2   . ASN B 2 398 ? -11.139 -4.861  -26.333  1.00 2.00  ? 398 ASN B ND2   1 
ATOM   4098  N  N     . MET B 2 399 ? -10.838 -2.784  -30.102  1.00 2.35  ? 399 MET B N     1 
ATOM   4099  C  CA    . MET B 2 399 ? -11.930 -1.809  -30.416  1.00 2.00  ? 399 MET B CA    1 
ATOM   4100  C  C     . MET B 2 399 ? -12.614 -2.171  -31.751  1.00 2.00  ? 399 MET B C     1 
ATOM   4101  O  O     . MET B 2 399 ? -11.955 -2.594  -32.734  1.00 2.00  ? 399 MET B O     1 
ATOM   4102  C  CB    . MET B 2 399 ? -11.261 -0.414  -30.534  1.00 2.00  ? 399 MET B CB    1 
ATOM   4103  C  CG    . MET B 2 399 ? -12.097 0.761   -30.575  1.00 2.00  ? 399 MET B CG    1 
ATOM   4104  S  SD    . MET B 2 399 ? -12.877 1.150   -28.990  1.00 5.40  ? 399 MET B SD    1 
ATOM   4105  C  CE    . MET B 2 399 ? -11.399 1.968   -28.330  1.00 2.00  ? 399 MET B CE    1 
ATOM   4106  N  N     . THR B 2 400 ? -13.910 -1.888  -31.798  1.00 2.73  ? 400 THR B N     1 
ATOM   4107  C  CA    . THR B 2 400 ? -14.906 -2.440  -32.780  1.00 2.68  ? 400 THR B CA    1 
ATOM   4108  C  C     . THR B 2 400 ? -15.600 -1.249  -33.511  1.00 5.91  ? 400 THR B C     1 
ATOM   4109  O  O     . THR B 2 400 ? -15.834 -1.230  -34.777  1.00 2.83  ? 400 THR B O     1 
ATOM   4110  C  CB    . THR B 2 400 ? -15.787 -3.418  -31.960  1.00 2.00  ? 400 THR B CB    1 
ATOM   4111  O  OG1   . THR B 2 400 ? -15.369 -4.750  -32.250  1.00 7.49  ? 400 THR B OG1   1 
ATOM   4112  C  CG2   . THR B 2 400 ? -17.220 -3.252  -32.006  1.00 2.00  ? 400 THR B CG2   1 
ATOM   4113  N  N     . ARG B 2 401 ? -15.832 -0.230  -32.705  1.00 2.00  ? 401 ARG B N     1 
ATOM   4114  C  CA    . ARG B 2 401 ? -16.738 0.861   -33.022  1.00 7.22  ? 401 ARG B CA    1 
ATOM   4115  C  C     . ARG B 2 401 ? -16.164 2.116   -32.324  1.00 10.13 ? 401 ARG B C     1 
ATOM   4116  O  O     . ARG B 2 401 ? -16.214 2.296   -31.049  1.00 2.96  ? 401 ARG B O     1 
ATOM   4117  C  CB    . ARG B 2 401 ? -18.153 0.572   -32.503  1.00 2.00  ? 401 ARG B CB    1 
ATOM   4118  C  CG    . ARG B 2 401 ? -18.902 -0.205  -33.490  1.00 2.56  ? 401 ARG B CG    1 
ATOM   4119  C  CD    . ARG B 2 401 ? -19.908 -1.336  -32.955  1.00 2.00  ? 401 ARG B CD    1 
ATOM   4120  N  NE    . ARG B 2 401 ? -19.484 -2.140  -31.821  1.00 3.19  ? 401 ARG B NE    1 
ATOM   4121  C  CZ    . ARG B 2 401 ? -20.322 -2.654  -30.938  1.00 7.86  ? 401 ARG B CZ    1 
ATOM   4122  N  NH1   . ARG B 2 401 ? -21.568 -2.379  -31.116  1.00 19.39 ? 401 ARG B NH1   1 
ATOM   4123  N  NH2   . ARG B 2 401 ? -19.943 -3.341  -29.840  1.00 8.63  ? 401 ARG B NH2   1 
ATOM   4124  N  N     . PHE B 2 402 ? -15.620 2.959   -33.165  1.00 2.00  ? 402 PHE B N     1 
ATOM   4125  C  CA    . PHE B 2 402 ? -14.903 4.141   -32.687  1.00 3.70  ? 402 PHE B CA    1 
ATOM   4126  C  C     . PHE B 2 402 ? -15.352 5.473   -33.360  1.00 5.99  ? 402 PHE B C     1 
ATOM   4127  O  O     . PHE B 2 402 ? -15.037 5.760   -34.538  1.00 2.00  ? 402 PHE B O     1 
ATOM   4128  C  CB    . PHE B 2 402 ? -13.398 4.016   -32.930  1.00 2.00  ? 402 PHE B CB    1 
ATOM   4129  C  CG    . PHE B 2 402 ? -12.609 4.978   -32.085  1.00 2.30  ? 402 PHE B CG    1 
ATOM   4130  C  CD1   . PHE B 2 402 ? -12.423 4.737   -30.731  1.00 4.60  ? 402 PHE B CD1   1 
ATOM   4131  C  CD2   . PHE B 2 402 ? -12.024 6.118   -32.642  1.00 2.19  ? 402 PHE B CD2   1 
ATOM   4132  C  CE1   . PHE B 2 402 ? -11.655 5.634   -29.933  1.00 2.00  ? 402 PHE B CE1   1 
ATOM   4133  C  CE2   . PHE B 2 402 ? -11.288 7.013   -31.860  1.00 2.00  ? 402 PHE B CE2   1 
ATOM   4134  C  CZ    . PHE B 2 402 ? -11.136 6.772   -30.496  1.00 4.01  ? 402 PHE B CZ    1 
ATOM   4135  N  N     . ARG B 2 403 ? -16.048 6.258   -32.579  1.00 2.00  ? 403 ARG B N     1 
ATOM   4136  C  CA    . ARG B 2 403 ? -16.780 7.367   -33.101  1.00 2.00  ? 403 ARG B CA    1 
ATOM   4137  C  C     . ARG B 2 403 ? -16.325 8.555   -32.232  1.00 2.69  ? 403 ARG B C     1 
ATOM   4138  O  O     . ARG B 2 403 ? -16.653 8.680   -30.981  1.00 2.00  ? 403 ARG B O     1 
ATOM   4139  C  CB    . ARG B 2 403 ? -18.323 7.116   -32.910  1.00 2.00  ? 403 ARG B CB    1 
ATOM   4140  C  CG    . ARG B 2 403 ? -18.908 6.134   -34.020  1.00 5.93  ? 403 ARG B CG    1 
ATOM   4141  C  CD    . ARG B 2 403 ? -20.155 5.513   -33.666  1.00 2.00  ? 403 ARG B CD    1 
ATOM   4142  N  NE    . ARG B 2 403 ? -21.228 6.479   -33.780  1.00 2.82  ? 403 ARG B NE    1 
ATOM   4143  C  CZ    . ARG B 2 403 ? -22.503 6.235   -33.520  1.00 3.05  ? 403 ARG B CZ    1 
ATOM   4144  N  NH1   . ARG B 2 403 ? -22.883 4.972   -33.149  1.00 8.55  ? 403 ARG B NH1   1 
ATOM   4145  N  NH2   . ARG B 2 403 ? -23.392 7.204   -33.627  1.00 2.00  ? 403 ARG B NH2   1 
ATOM   4146  N  N     . LEU B 2 404 ? -15.566 9.444   -32.860  1.00 3.20  ? 404 LEU B N     1 
ATOM   4147  C  CA    . LEU B 2 404 ? -14.946 10.489  -32.055  1.00 2.00  ? 404 LEU B CA    1 
ATOM   4148  C  C     . LEU B 2 404 ? -15.112 11.804  -32.737  1.00 3.29  ? 404 LEU B C     1 
ATOM   4149  O  O     . LEU B 2 404 ? -14.503 12.093  -33.792  1.00 11.91 ? 404 LEU B O     1 
ATOM   4150  C  CB    . LEU B 2 404 ? -13.473 10.210  -31.759  1.00 5.95  ? 404 LEU B CB    1 
ATOM   4151  C  CG    . LEU B 2 404 ? -12.692 11.463  -31.335  1.00 4.74  ? 404 LEU B CG    1 
ATOM   4152  C  CD1   . LEU B 2 404 ? -12.286 11.296  -30.065  1.00 2.88  ? 404 LEU B CD1   1 
ATOM   4153  C  CD2   . LEU B 2 404 ? -11.514 11.571  -32.177  1.00 8.61  ? 404 LEU B CD2   1 
ATOM   4154  N  N     . CYS B 2 405 ? -15.938 12.634  -32.120  1.00 8.21  ? 405 CYS B N     1 
ATOM   4155  C  CA    . CYS B 2 405 ? -16.428 13.840  -32.754  1.00 7.08  ? 405 CYS B CA    1 
ATOM   4156  C  C     . CYS B 2 405 ? -15.875 15.107  -31.994  1.00 2.00  ? 405 CYS B C     1 
ATOM   4157  O  O     . CYS B 2 405 ? -16.273 15.374  -30.851  1.00 3.24  ? 405 CYS B O     1 
ATOM   4158  C  CB    . CYS B 2 405 ? -17.954 13.827  -32.661  1.00 7.77  ? 405 CYS B CB    1 
ATOM   4159  S  SG    . CYS B 2 405 ? -18.507 15.550  -33.265  1.00 10.72 ? 405 CYS B SG    1 
ATOM   4160  N  N     . ILE B 2 406 ? -14.934 15.813  -32.605  1.00 5.41  ? 406 ILE B N     1 
ATOM   4161  C  CA    . ILE B 2 406 ? -14.444 17.095  -32.072  1.00 2.00  ? 406 ILE B CA    1 
ATOM   4162  C  C     . ILE B 2 406 ? -15.346 18.237  -32.622  1.00 3.73  ? 406 ILE B C     1 
ATOM   4163  O  O     . ILE B 2 406 ? -15.634 18.379  -33.857  1.00 2.00  ? 406 ILE B O     1 
ATOM   4164  C  CB    . ILE B 2 406 ? -12.948 17.372  -32.457  1.00 7.03  ? 406 ILE B CB    1 
ATOM   4165  C  CG1   . ILE B 2 406 ? -11.939 16.310  -31.939  1.00 2.00  ? 406 ILE B CG1   1 
ATOM   4166  C  CG2   . ILE B 2 406 ? -12.583 18.911  -32.253  1.00 2.00  ? 406 ILE B CG2   1 
ATOM   4167  C  CD1   . ILE B 2 406 ? -10.693 16.264  -32.802  1.00 2.00  ? 406 ILE B CD1   1 
ATOM   4168  N  N     . ILE B 2 407 ? -15.819 19.021  -31.699  1.00 2.00  ? 407 ILE B N     1 
ATOM   4169  C  CA    . ILE B 2 407 ? -16.950 19.890  -31.896  1.00 6.21  ? 407 ILE B CA    1 
ATOM   4170  C  C     . ILE B 2 407 ? -16.598 21.050  -32.893  1.00 15.30 ? 407 ILE B C     1 
ATOM   4171  O  O     . ILE B 2 407 ? -17.392 21.390  -33.766  1.00 10.40 ? 407 ILE B O     1 
ATOM   4172  C  CB    . ILE B 2 407 ? -17.144 20.457  -30.491  1.00 12.86 ? 407 ILE B CB    1 
ATOM   4173  C  CG1   . ILE B 2 407 ? -17.655 19.324  -29.642  1.00 2.00  ? 407 ILE B CG1   1 
ATOM   4174  C  CG2   . ILE B 2 407 ? -18.068 21.638  -30.426  1.00 6.44  ? 407 ILE B CG2   1 
ATOM   4175  C  CD1   . ILE B 2 407 ? -19.086 19.489  -29.453  1.00 16.96 ? 407 ILE B CD1   1 
ATOM   4176  N  N     . GLU B 2 408 ? -15.389 21.612  -32.775  1.00 4.97  ? 408 GLU B N     1 
ATOM   4177  C  CA    . GLU B 2 408 ? -14.847 22.563  -33.738  1.00 6.99  ? 408 GLU B CA    1 
ATOM   4178  C  C     . GLU B 2 408 ? -14.488 21.919  -35.057  1.00 2.23  ? 408 GLU B C     1 
ATOM   4179  O  O     . GLU B 2 408 ? -13.533 21.169  -35.147  1.00 15.51 ? 408 GLU B O     1 
ATOM   4180  C  CB    . GLU B 2 408 ? -13.604 23.255  -33.130  1.00 16.79 ? 408 GLU B CB    1 
ATOM   4181  C  CG    . GLU B 2 408 ? -13.045 24.507  -33.829  1.00 13.46 ? 408 GLU B CG    1 
ATOM   4182  C  CD    . GLU B 2 408 ? -14.098 25.555  -34.110  1.00 44.17 ? 408 GLU B CD    1 
ATOM   4183  O  OE1   . GLU B 2 408 ? -14.989 25.818  -33.241  1.00 41.66 ? 408 GLU B OE1   1 
ATOM   4184  O  OE2   . GLU B 2 408 ? -14.015 26.113  -35.226  1.00 33.81 ? 408 GLU B OE2   1 
ATOM   4185  N  N     . PRO B 2 409 ? -15.196 22.278  -36.124  1.00 4.79  ? 409 PRO B N     1 
ATOM   4186  C  CA    . PRO B 2 409 ? -14.695 21.798  -37.415  1.00 2.59  ? 409 PRO B CA    1 
ATOM   4187  C  C     . PRO B 2 409 ? -13.233 21.585  -37.847  1.00 7.60  ? 409 PRO B C     1 
ATOM   4188  O  O     . PRO B 2 409 ? -12.936 20.532  -38.385  1.00 27.02 ? 409 PRO B O     1 
ATOM   4189  C  CB    . PRO B 2 409 ? -15.652 22.362  -38.482  1.00 2.00  ? 409 PRO B CB    1 
ATOM   4190  C  CG    . PRO B 2 409 ? -16.862 22.858  -37.723  1.00 2.00  ? 409 PRO B CG    1 
ATOM   4191  C  CD    . PRO B 2 409 ? -16.459 23.038  -36.230  1.00 2.00  ? 409 PRO B CD    1 
ATOM   4192  N  N     . LYS B 2 410 ? -12.245 22.423  -37.710  1.00 12.80 ? 410 LYS B N     1 
ATOM   4193  C  CA    . LYS B 2 410 ? -11.041 21.649  -38.211  1.00 5.20  ? 410 LYS B CA    1 
ATOM   4194  C  C     . LYS B 2 410 ? -9.878  21.654  -37.282  1.00 10.03 ? 410 LYS B C     1 
ATOM   4195  O  O     . LYS B 2 410 ? -8.693  21.843  -37.665  1.00 2.01  ? 410 LYS B O     1 
ATOM   4196  C  CB    . LYS B 2 410 ? -10.652 21.929  -39.631  1.00 2.00  ? 410 LYS B CB    1 
ATOM   4197  C  CG    . LYS B 2 410 ? -11.871 22.212  -40.530  1.00 7.72  ? 410 LYS B CG    1 
ATOM   4198  C  CD    . LYS B 2 410 ? -11.479 22.817  -41.885  1.00 2.00  ? 410 LYS B CD    1 
ATOM   4199  C  CE    . LYS B 2 410 ? -12.457 22.381  -43.010  1.00 2.78  ? 410 LYS B CE    1 
ATOM   4200  N  NZ    . LYS B 2 410 ? -12.332 23.304  -44.277  1.00 11.21 ? 410 LYS B NZ    1 
ATOM   4201  N  N     . ALA B 2 411 ? -10.267 21.443  -36.033  1.00 5.42  ? 411 ALA B N     1 
ATOM   4202  C  CA    . ALA B 2 411 ? -9.374  21.586  -34.924  1.00 4.42  ? 411 ALA B CA    1 
ATOM   4203  C  C     . ALA B 2 411 ? -8.133  20.676  -35.140  1.00 4.86  ? 411 ALA B C     1 
ATOM   4204  O  O     . ALA B 2 411 ? -8.201  19.463  -35.310  1.00 2.08  ? 411 ALA B O     1 
ATOM   4205  C  CB    . ALA B 2 411 ? -10.114 21.271  -33.637  1.00 2.00  ? 411 ALA B CB    1 
ATOM   4206  N  N     . PRO B 2 412 ? -6.974  21.284  -35.204  1.00 7.35  ? 412 PRO B N     1 
ATOM   4207  C  CA    . PRO B 2 412 ? -5.827  20.395  -35.147  1.00 2.22  ? 412 PRO B CA    1 
ATOM   4208  C  C     . PRO B 2 412 ? -5.502  19.819  -33.799  1.00 2.78  ? 412 PRO B C     1 
ATOM   4209  O  O     . PRO B 2 412 ? -6.191  20.025  -32.788  1.00 2.00  ? 412 PRO B O     1 
ATOM   4210  C  CB    . PRO B 2 412 ? -4.691  21.298  -35.578  1.00 14.92 ? 412 PRO B CB    1 
ATOM   4211  C  CG    . PRO B 2 412 ? -5.210  22.709  -35.238  1.00 3.97  ? 412 PRO B CG    1 
ATOM   4212  C  CD    . PRO B 2 412 ? -6.635  22.694  -35.454  1.00 2.00  ? 412 PRO B CD    1 
ATOM   4213  N  N     . ASP B 2 413 ? -4.406  19.079  -33.795  1.00 3.88  ? 413 ASP B N     1 
ATOM   4214  C  CA    . ASP B 2 413 ? -3.801  18.647  -32.544  1.00 2.12  ? 413 ASP B CA    1 
ATOM   4215  C  C     . ASP B 2 413 ? -3.491  19.931  -31.787  1.00 2.56  ? 413 ASP B C     1 
ATOM   4216  O  O     . ASP B 2 413 ? -2.906  20.791  -32.376  1.00 11.20 ? 413 ASP B O     1 
ATOM   4217  C  CB    . ASP B 2 413 ? -2.515  17.918  -32.867  1.00 2.00  ? 413 ASP B CB    1 
ATOM   4218  C  CG    . ASP B 2 413 ? -1.904  17.333  -31.654  1.00 17.90 ? 413 ASP B CG    1 
ATOM   4219  O  OD1   . ASP B 2 413 ? -1.811  18.041  -30.625  1.00 2.00  ? 413 ASP B OD1   1 
ATOM   4220  O  OD2   . ASP B 2 413 ? -1.571  16.147  -31.741  1.00 2.00  ? 413 ASP B OD2   1 
ATOM   4221  N  N     . TYR B 2 414 ? -3.881  20.075  -30.528  1.00 5.22  ? 414 TYR B N     1 
ATOM   4222  C  CA    . TYR B 2 414 ? -3.806  21.377  -29.874  1.00 2.00  ? 414 TYR B CA    1 
ATOM   4223  C  C     . TYR B 2 414 ? -2.448  21.634  -29.228  1.00 2.00  ? 414 TYR B C     1 
ATOM   4224  O  O     . TYR B 2 414 ? -2.158  22.742  -28.831  1.00 8.34  ? 414 TYR B O     1 
ATOM   4225  C  CB    . TYR B 2 414 ? -4.927  21.563  -28.850  1.00 2.00  ? 414 TYR B CB    1 
ATOM   4226  C  CG    . TYR B 2 414 ? -4.693  20.796  -27.570  1.00 11.90 ? 414 TYR B CG    1 
ATOM   4227  C  CD1   . TYR B 2 414 ? -4.060  21.384  -26.485  1.00 7.16  ? 414 TYR B CD1   1 
ATOM   4228  C  CD2   . TYR B 2 414 ? -5.079  19.480  -27.461  1.00 2.00  ? 414 TYR B CD2   1 
ATOM   4229  C  CE1   . TYR B 2 414 ? -3.833  20.682  -25.339  1.00 2.00  ? 414 TYR B CE1   1 
ATOM   4230  C  CE2   . TYR B 2 414 ? -4.855  18.776  -26.333  1.00 2.00  ? 414 TYR B CE2   1 
ATOM   4231  C  CZ    . TYR B 2 414 ? -4.232  19.374  -25.262  1.00 33.93 ? 414 TYR B CZ    1 
ATOM   4232  O  OH    . TYR B 2 414 ? -4.016  18.660  -24.119  1.00 2.00  ? 414 TYR B OH    1 
ATOM   4233  N  N     . LEU B 2 415 ? -1.621  20.606  -29.133  1.00 2.00  ? 415 LEU B N     1 
ATOM   4234  C  CA    . LEU B 2 415 ? -0.337  20.714  -28.473  1.00 2.02  ? 415 LEU B CA    1 
ATOM   4235  C  C     . LEU B 2 415 ? 0.745   20.915  -29.501  1.00 8.68  ? 415 LEU B C     1 
ATOM   4236  O  O     . LEU B 2 415 ? 1.886   21.202  -29.163  1.00 30.89 ? 415 LEU B O     1 
ATOM   4237  C  CB    . LEU B 2 415 ? -0.025  19.450  -27.682  1.00 2.00  ? 415 LEU B CB    1 
ATOM   4238  C  CG    . LEU B 2 415 ? -0.711  19.215  -26.344  1.00 17.25 ? 415 LEU B CG    1 
ATOM   4239  C  CD1   . LEU B 2 415 ? -0.660  17.756  -25.982  1.00 2.00  ? 415 LEU B CD1   1 
ATOM   4240  C  CD2   . LEU B 2 415 ? -0.045  20.031  -25.289  1.00 3.19  ? 415 LEU B CD2   1 
ATOM   4241  N  N     . THR B 2 416 ? 0.387   20.751  -30.761  1.00 3.22  ? 416 THR B N     1 
ATOM   4242  C  CA    . THR B 2 416 ? 1.296   20.195  -31.737  1.00 5.83  ? 416 THR B CA    1 
ATOM   4243  C  C     . THR B 2 416 ? 0.904   20.752  -33.069  1.00 2.17  ? 416 THR B C     1 
ATOM   4244  O  O     . THR B 2 416 ? 1.737   21.127  -33.865  1.00 11.77 ? 416 THR B O     1 
ATOM   4245  C  CB    . THR B 2 416 ? 1.173   18.682  -31.764  1.00 23.20 ? 416 THR B CB    1 
ATOM   4246  O  OG1   . THR B 2 416 ? 2.403   18.088  -31.348  1.00 14.57 ? 416 THR B OG1   1 
ATOM   4247  C  CG2   . THR B 2 416 ? 1.005   18.191  -33.173  1.00 2.00  ? 416 THR B CG2   1 
ATOM   4248  N  N     . LEU B 2 417 ? -0.396  20.815  -33.292  1.00 14.22 ? 417 LEU B N     1 
ATOM   4249  C  CA    . LEU B 2 417 ? -0.966  21.762  -34.223  1.00 6.71  ? 417 LEU B CA    1 
ATOM   4250  C  C     . LEU B 2 417 ? -0.946  21.158  -35.592  1.00 2.50  ? 417 LEU B C     1 
ATOM   4251  O  O     . LEU B 2 417 ? -1.217  21.809  -36.585  1.00 11.01 ? 417 LEU B O     1 
ATOM   4252  C  CB    . LEU B 2 417 ? -0.208  23.069  -34.174  1.00 2.00  ? 417 LEU B CB    1 
ATOM   4253  C  CG    . LEU B 2 417 ? -0.786  23.924  -33.060  1.00 6.67  ? 417 LEU B CG    1 
ATOM   4254  C  CD1   . LEU B 2 417 ? 0.232   24.903  -32.553  1.00 9.86  ? 417 LEU B CD1   1 
ATOM   4255  C  CD2   . LEU B 2 417 ? -2.021  24.619  -33.524  1.00 2.00  ? 417 LEU B CD2   1 
ATOM   4256  N  N     . GLU B 2 418 ? -0.652  19.873  -35.622  1.00 11.06 ? 418 GLU B N     1 
ATOM   4257  C  CA    . GLU B 2 418 ? -0.728  19.124  -36.867  1.00 9.81  ? 418 GLU B CA    1 
ATOM   4258  C  C     . GLU B 2 418 ? -2.153  18.628  -37.105  1.00 6.62  ? 418 GLU B C     1 
ATOM   4259  O  O     . GLU B 2 418 ? -3.054  18.724  -36.218  1.00 13.01 ? 418 GLU B O     1 
ATOM   4260  C  CB    . GLU B 2 418 ? 0.288   17.981  -36.857  1.00 9.73  ? 418 GLU B CB    1 
ATOM   4261  C  CG    . GLU B 2 418 ? 1.623   18.374  -36.178  1.00 2.00  ? 418 GLU B CG    1 
ATOM   4262  C  CD    . GLU B 2 418 ? 2.704   18.379  -37.177  1.00 24.28 ? 418 GLU B CD    1 
ATOM   4263  O  OE1   . GLU B 2 418 ? 3.822   18.824  -36.848  1.00 36.88 ? 418 GLU B OE1   1 
ATOM   4264  O  OE2   . GLU B 2 418 ? 2.427   17.955  -38.326  1.00 36.92 ? 418 GLU B OE2   1 
ATOM   4265  N  N     . PRO B 2 419 ? -2.383  18.108  -38.307  1.00 2.94  ? 419 PRO B N     1 
ATOM   4266  C  CA    . PRO B 2 419 ? -3.590  17.328  -38.562  1.00 2.00  ? 419 PRO B CA    1 
ATOM   4267  C  C     . PRO B 2 419 ? -3.581  16.065  -37.742  1.00 9.33  ? 419 PRO B C     1 
ATOM   4268  O  O     . PRO B 2 419 ? -2.501  15.615  -37.349  1.00 2.00  ? 419 PRO B O     1 
ATOM   4269  C  CB    . PRO B 2 419 ? -3.468  16.954  -40.035  1.00 7.09  ? 419 PRO B CB    1 
ATOM   4270  C  CG    . PRO B 2 419 ? -2.483  17.974  -40.629  1.00 2.00  ? 419 PRO B CG    1 
ATOM   4271  C  CD    . PRO B 2 419 ? -1.505  18.231  -39.488  1.00 2.00  ? 419 PRO B CD    1 
ATOM   4272  N  N     . LEU B 2 420 ? -4.770  15.511  -37.458  1.00 7.18  ? 420 LEU B N     1 
ATOM   4273  C  CA    . LEU B 2 420 ? -4.859  14.293  -36.689  1.00 2.00  ? 420 LEU B CA    1 
ATOM   4274  C  C     . LEU B 2 420 ? -4.580  12.997  -37.531  1.00 14.37 ? 420 LEU B C     1 
ATOM   4275  O  O     . LEU B 2 420 ? -4.862  11.839  -37.124  1.00 9.02  ? 420 LEU B O     1 
ATOM   4276  C  CB    . LEU B 2 420 ? -6.190  14.315  -36.004  1.00 2.66  ? 420 LEU B CB    1 
ATOM   4277  C  CG    . LEU B 2 420 ? -6.323  15.430  -34.910  1.00 2.97  ? 420 LEU B CG    1 
ATOM   4278  C  CD1   . LEU B 2 420 ? -7.699  15.454  -34.429  1.00 2.00  ? 420 LEU B CD1   1 
ATOM   4279  C  CD2   . LEU B 2 420 ? -5.280  15.175  -33.731  1.00 2.00  ? 420 LEU B CD2   1 
ATOM   4280  N  N     . ASP B 2 421 ? -4.007  13.172  -38.719  1.00 2.42  ? 421 ASP B N     1 
ATOM   4281  C  CA    . ASP B 2 421 ? -3.817  12.018  -39.560  1.00 7.59  ? 421 ASP B CA    1 
ATOM   4282  C  C     . ASP B 2 421 ? -3.124  10.877  -38.799  1.00 16.20 ? 421 ASP B C     1 
ATOM   4283  O  O     . ASP B 2 421 ? -3.612  9.744   -38.820  1.00 9.24  ? 421 ASP B O     1 
ATOM   4284  C  CB    . ASP B 2 421 ? -3.064  12.397  -40.814  1.00 2.00  ? 421 ASP B CB    1 
ATOM   4285  C  CG    . ASP B 2 421 ? -3.819  13.441  -41.645  1.00 2.00  ? 421 ASP B CG    1 
ATOM   4286  O  OD1   . ASP B 2 421 ? -5.030  13.691  -41.469  1.00 7.77  ? 421 ASP B OD1   1 
ATOM   4287  O  OD2   . ASP B 2 421 ? -3.201  14.033  -42.504  1.00 4.16  ? 421 ASP B OD2   1 
ATOM   4288  N  N     . ILE B 2 422 ? -1.987  11.098  -38.133  1.00 13.61 ? 422 ILE B N     1 
ATOM   4289  C  CA    . ILE B 2 422 ? -1.405  9.880   -37.545  1.00 8.70  ? 422 ILE B CA    1 
ATOM   4290  C  C     . ILE B 2 422 ? -2.180  9.242   -36.389  1.00 9.45  ? 422 ILE B C     1 
ATOM   4291  O  O     . ILE B 2 422 ? -2.086  8.032   -36.138  1.00 3.39  ? 422 ILE B O     1 
ATOM   4292  C  CB    . ILE B 2 422 ? 0.042   9.953   -37.253  1.00 13.41 ? 422 ILE B CB    1 
ATOM   4293  C  CG1   . ILE B 2 422 ? 0.317   10.962  -36.144  1.00 29.99 ? 422 ILE B CG1   1 
ATOM   4294  C  CG2   . ILE B 2 422 ? 0.849   10.184  -38.554  1.00 17.92 ? 422 ILE B CG2   1 
ATOM   4295  C  CD1   . ILE B 2 422 ? 1.025   12.205  -36.649  1.00 49.24 ? 422 ILE B CD1   1 
ATOM   4296  N  N     . GLY B 2 423 ? -2.958  10.050  -35.675  1.00 2.02  ? 423 GLY B N     1 
ATOM   4297  C  CA    . GLY B 2 423 ? -3.762  9.522   -34.568  1.00 8.95  ? 423 GLY B CA    1 
ATOM   4298  C  C     . GLY B 2 423 ? -4.814  8.538   -35.120  1.00 21.97 ? 423 GLY B C     1 
ATOM   4299  O  O     . GLY B 2 423 ? -4.870  7.353   -34.754  1.00 13.47 ? 423 GLY B O     1 
ATOM   4300  N  N     . PHE B 2 424 ? -5.594  9.000   -36.078  1.00 12.08 ? 424 PHE B N     1 
ATOM   4301  C  CA    . PHE B 2 424 ? -6.422  8.089   -36.791  1.00 4.31  ? 424 PHE B CA    1 
ATOM   4302  C  C     . PHE B 2 424 ? -5.727  6.995   -37.536  1.00 2.33  ? 424 PHE B C     1 
ATOM   4303  O  O     . PHE B 2 424 ? -6.247  5.873   -37.536  1.00 4.79  ? 424 PHE B O     1 
ATOM   4304  C  CB    . PHE B 2 424 ? -7.513  8.814   -37.554  1.00 4.20  ? 424 PHE B CB    1 
ATOM   4305  C  CG    . PHE B 2 424 ? -8.477  9.600   -36.630  1.00 2.00  ? 424 PHE B CG    1 
ATOM   4306  C  CD1   . PHE B 2 424 ? -8.435  11.038  -36.559  1.00 2.00  ? 424 PHE B CD1   1 
ATOM   4307  C  CD2   . PHE B 2 424 ? -9.373  8.944   -35.862  1.00 2.00  ? 424 PHE B CD2   1 
ATOM   4308  C  CE1   . PHE B 2 424 ? -9.293  11.764  -35.746  1.00 2.00  ? 424 PHE B CE1   1 
ATOM   4309  C  CE2   . PHE B 2 424 ? -10.308 9.667   -34.972  1.00 2.00  ? 424 PHE B CE2   1 
ATOM   4310  C  CZ    . PHE B 2 424 ? -10.242 11.069  -34.902  1.00 2.20  ? 424 PHE B CZ    1 
ATOM   4311  N  N     . GLY B 2 425 ? -4.560  7.253   -38.144  1.00 6.35  ? 425 GLY B N     1 
ATOM   4312  C  CA    . GLY B 2 425 ? -3.801  6.154   -38.819  1.00 2.00  ? 425 GLY B CA    1 
ATOM   4313  C  C     . GLY B 2 425 ? -3.687  5.102   -37.700  1.00 10.14 ? 425 GLY B C     1 
ATOM   4314  O  O     . GLY B 2 425 ? -4.128  3.971   -37.828  1.00 7.24  ? 425 GLY B O     1 
ATOM   4315  N  N     . ALA B 2 426 ? -3.210  5.495   -36.535  1.00 2.97  ? 426 ALA B N     1 
ATOM   4316  C  CA    . ALA B 2 426 ? -2.980  4.490   -35.524  1.00 10.57 ? 426 ALA B CA    1 
ATOM   4317  C  C     . ALA B 2 426 ? -4.249  3.629   -35.113  1.00 9.09  ? 426 ALA B C     1 
ATOM   4318  O  O     . ALA B 2 426 ? -4.154  2.409   -34.803  1.00 3.34  ? 426 ALA B O     1 
ATOM   4319  C  CB    . ALA B 2 426 ? -2.312  5.112   -34.319  1.00 2.00  ? 426 ALA B CB    1 
ATOM   4320  N  N     . ILE B 2 427 ? -5.421  4.246   -35.072  1.00 2.00  ? 427 ILE B N     1 
ATOM   4321  C  CA    . ILE B 2 427 ? -6.613  3.560   -34.539  1.00 3.20  ? 427 ILE B CA    1 
ATOM   4322  C  C     . ILE B 2 427 ? -6.857  2.500   -35.644  1.00 16.84 ? 427 ILE B C     1 
ATOM   4323  O  O     . ILE B 2 427 ? -7.248  1.357   -35.404  1.00 4.40  ? 427 ILE B O     1 
ATOM   4324  C  CB    . ILE B 2 427 ? -7.830  4.518   -34.589  1.00 5.79  ? 427 ILE B CB    1 
ATOM   4325  C  CG1   . ILE B 2 427 ? -7.898  5.398   -33.344  1.00 3.52  ? 427 ILE B CG1   1 
ATOM   4326  C  CG2   . ILE B 2 427 ? -9.135  3.700   -34.654  1.00 2.41  ? 427 ILE B CG2   1 
ATOM   4327  C  CD1   . ILE B 2 427 ? -7.756  4.576   -32.138  1.00 9.19  ? 427 ILE B CD1   1 
ATOM   4328  N  N     . VAL B 2 428 ? -6.579  2.897   -36.872  1.00 2.00  ? 428 VAL B N     1 
ATOM   4329  C  CA    . VAL B 2 428 ? -7.030  2.112   -37.968  1.00 10.07 ? 428 VAL B CA    1 
ATOM   4330  C  C     . VAL B 2 428 ? -5.953  0.974   -38.281  1.00 17.96 ? 428 VAL B C     1 
ATOM   4331  O  O     . VAL B 2 428 ? -6.282  -0.167  -38.598  1.00 11.59 ? 428 VAL B O     1 
ATOM   4332  C  CB    . VAL B 2 428 ? -7.429  3.098   -39.116  1.00 2.94  ? 428 VAL B CB    1 
ATOM   4333  C  CG1   . VAL B 2 428 ? -6.475  3.221   -40.248  1.00 2.00  ? 428 VAL B CG1   1 
ATOM   4334  C  CG2   . VAL B 2 428 ? -8.737  2.884   -39.470  1.00 3.09  ? 428 VAL B CG2   1 
ATOM   4335  N  N     . GLU B 2 429 ? -4.673  1.280   -38.157  1.00 10.64 ? 429 GLU B N     1 
ATOM   4336  C  CA    . GLU B 2 429 ? -3.632  0.281   -38.286  1.00 5.20  ? 429 GLU B CA    1 
ATOM   4337  C  C     . GLU B 2 429 ? -3.772  -0.711  -37.149  1.00 13.99 ? 429 GLU B C     1 
ATOM   4338  O  O     . GLU B 2 429 ? -3.647  -1.938  -37.341  1.00 2.44  ? 429 GLU B O     1 
ATOM   4339  C  CB    . GLU B 2 429 ? -2.278  0.957   -38.070  1.00 9.55  ? 429 GLU B CB    1 
ATOM   4340  C  CG    . GLU B 2 429 ? -1.078  0.039   -38.385  1.00 18.18 ? 429 GLU B CG    1 
ATOM   4341  C  CD    . GLU B 2 429 ? 0.277   0.742   -38.203  1.00 5.96  ? 429 GLU B CD    1 
ATOM   4342  O  OE1   . GLU B 2 429 ? 0.273   1.927   -37.821  1.00 15.04 ? 429 GLU B OE1   1 
ATOM   4343  O  OE2   . GLU B 2 429 ? 1.347   0.117   -38.472  1.00 25.30 ? 429 GLU B OE2   1 
ATOM   4344  N  N     . HIS B 2 430 ? -4.012  -0.195  -35.948  1.00 2.12  ? 430 HIS B N     1 
ATOM   4345  C  CA    . HIS B 2 430 ? -3.930  -1.100  -34.806  1.00 7.63  ? 430 HIS B CA    1 
ATOM   4346  C  C     . HIS B 2 430 ? -5.180  -1.880  -34.469  1.00 5.52  ? 430 HIS B C     1 
ATOM   4347  O  O     . HIS B 2 430 ? -5.075  -2.863  -33.727  1.00 9.28  ? 430 HIS B O     1 
ATOM   4348  C  CB    . HIS B 2 430 ? -3.247  -0.513  -33.518  1.00 2.00  ? 430 HIS B CB    1 
ATOM   4349  C  CG    . HIS B 2 430 ? -1.777  -0.190  -33.706  1.00 23.70 ? 430 HIS B CG    1 
ATOM   4350  N  ND1   . HIS B 2 430 ? -1.062  -0.575  -34.826  1.00 36.16 ? 430 HIS B ND1   1 
ATOM   4351  C  CD2   . HIS B 2 430 ? -0.910  0.512   -32.942  1.00 2.00  ? 430 HIS B CD2   1 
ATOM   4352  C  CE1   . HIS B 2 430 ? 0.177   -0.127  -34.736  1.00 30.05 ? 430 HIS B CE1   1 
ATOM   4353  N  NE2   . HIS B 2 430 ? 0.299   0.526   -33.594  1.00 37.02 ? 430 HIS B NE2   1 
ATOM   4354  N  N     . CYS B 2 431 ? -6.347  -1.449  -34.936  1.00 3.53  ? 431 CYS B N     1 
ATOM   4355  C  CA    . CYS B 2 431 ? -7.618  -2.030  -34.393  1.00 2.00  ? 431 CYS B CA    1 
ATOM   4356  C  C     . CYS B 2 431 ? -8.193  -2.794  -35.569  1.00 7.95  ? 431 CYS B C     1 
ATOM   4357  O  O     . CYS B 2 431 ? -8.941  -2.242  -36.406  1.00 6.13  ? 431 CYS B O     1 
ATOM   4358  C  CB    . CYS B 2 431 ? -8.617  -0.967  -34.006  1.00 2.09  ? 431 CYS B CB    1 
ATOM   4359  S  SG    . CYS B 2 431 ? -7.993  0.188   -32.690  1.00 6.71  ? 431 CYS B SG    1 
ATOM   4360  N  N     . LYS B 2 432 ? -7.790  -4.045  -35.666  1.00 2.00  ? 432 LYS B N     1 
ATOM   4361  C  CA    . LYS B 2 432 ? -7.798  -4.679  -36.924  1.00 8.74  ? 432 LYS B CA    1 
ATOM   4362  C  C     . LYS B 2 432 ? -9.210  -5.098  -37.282  1.00 10.66 ? 432 LYS B C     1 
ATOM   4363  O  O     . LYS B 2 432 ? -9.440  -5.348  -38.479  1.00 2.61  ? 432 LYS B O     1 
ATOM   4364  C  CB    . LYS B 2 432 ? -6.812  -5.849  -36.960  1.00 7.98  ? 432 LYS B CB    1 
ATOM   4365  C  CG    . LYS B 2 432 ? -5.360  -5.356  -37.149  1.00 19.97 ? 432 LYS B CG    1 
ATOM   4366  C  CD    . LYS B 2 432 ? -4.460  -6.399  -37.801  1.00 47.92 ? 432 LYS B CD    1 
ATOM   4367  C  CE    . LYS B 2 432 ? -4.624  -7.817  -37.169  1.00 69.54 ? 432 LYS B CE    1 
ATOM   4368  N  NZ    . LYS B 2 432 ? -3.468  -8.290  -36.314  1.00 58.72 ? 432 LYS B NZ    1 
ATOM   4369  N  N     . ASP B 2 433 ? -10.104 -5.141  -36.266  1.00 2.45  ? 433 ASP B N     1 
ATOM   4370  C  CA    . ASP B 2 433 ? -11.542 -5.544  -36.345  1.00 4.14  ? 433 ASP B CA    1 
ATOM   4371  C  C     . ASP B 2 433 ? -12.443 -4.294  -36.166  1.00 5.75  ? 433 ASP B C     1 
ATOM   4372  O  O     . ASP B 2 433 ? -13.685 -4.357  -35.888  1.00 2.00  ? 433 ASP B O     1 
ATOM   4373  C  CB    . ASP B 2 433 ? -11.870 -6.562  -35.241  1.00 2.00  ? 433 ASP B CB    1 
ATOM   4374  C  CG    . ASP B 2 433 ? -11.145 -7.982  -35.450  1.00 2.04  ? 433 ASP B CG    1 
ATOM   4375  O  OD1   . ASP B 2 433 ? -11.124 -8.806  -34.531  1.00 15.29 ? 433 ASP B OD1   1 
ATOM   4376  O  OD2   . ASP B 2 433 ? -10.577 -8.330  -36.486  1.00 4.29  ? 433 ASP B OD2   1 
ATOM   4377  N  N     . LEU B 2 434 ? -11.832 -3.134  -36.309  1.00 2.00  ? 434 LEU B N     1 
ATOM   4378  C  CA    . LEU B 2 434 ? -12.672 -1.952  -36.370  1.00 2.00  ? 434 LEU B CA    1 
ATOM   4379  C  C     . LEU B 2 434 ? -13.686 -2.057  -37.549  1.00 2.00  ? 434 LEU B C     1 
ATOM   4380  O  O     . LEU B 2 434 ? -13.358 -1.966  -38.744  1.00 2.00  ? 434 LEU B O     1 
ATOM   4381  C  CB    . LEU B 2 434 ? -11.802 -0.722  -36.540  1.00 2.00  ? 434 LEU B CB    1 
ATOM   4382  C  CG    . LEU B 2 434 ? -12.516 0.600   -36.360  1.00 2.08  ? 434 LEU B CG    1 
ATOM   4383  C  CD1   . LEU B 2 434 ? -12.969 0.716   -34.967  1.00 2.00  ? 434 LEU B CD1   1 
ATOM   4384  C  CD2   . LEU B 2 434 ? -11.498 1.684   -36.745  1.00 3.75  ? 434 LEU B CD2   1 
ATOM   4385  N  N     . ARG B 2 435 ? -14.946 -2.189  -37.207  1.00 3.47  ? 435 ARG B N     1 
ATOM   4386  C  CA    . ARG B 2 435 ? -15.973 -2.256  -38.303  1.00 16.89 ? 435 ARG B CA    1 
ATOM   4387  C  C     . ARG B 2 435 ? -16.677 -0.867  -38.525  1.00 13.62 ? 435 ARG B C     1 
ATOM   4388  O  O     . ARG B 2 435 ? -17.377 -0.660  -39.532  1.00 8.01  ? 435 ARG B O     1 
ATOM   4389  C  CB    . ARG B 2 435 ? -16.988 -3.411  -37.977  1.00 2.07  ? 435 ARG B CB    1 
ATOM   4390  C  CG    . ARG B 2 435 ? -17.956 -2.999  -36.948  1.00 4.97  ? 435 ARG B CG    1 
ATOM   4391  C  CD    . ARG B 2 435 ? -19.129 -4.048  -36.805  1.00 14.94 ? 435 ARG B CD    1 
ATOM   4392  N  NE    . ARG B 2 435 ? -18.621 -4.931  -35.820  1.00 7.73  ? 435 ARG B NE    1 
ATOM   4393  C  CZ    . ARG B 2 435 ? -19.131 -5.081  -34.624  1.00 12.96 ? 435 ARG B CZ    1 
ATOM   4394  N  NH1   . ARG B 2 435 ? -20.308 -4.481  -34.324  1.00 9.44  ? 435 ARG B NH1   1 
ATOM   4395  N  NH2   . ARG B 2 435 ? -18.454 -5.836  -33.769  1.00 2.00  ? 435 ARG B NH2   1 
ATOM   4396  N  N     . ARG B 2 436 ? -16.500 0.042   -37.539  1.00 5.32  ? 436 ARG B N     1 
ATOM   4397  C  CA    . ARG B 2 436 ? -17.139 1.362   -37.493  1.00 5.25  ? 436 ARG B CA    1 
ATOM   4398  C  C     . ARG B 2 436 ? -16.197 2.483   -37.011  1.00 14.11 ? 436 ARG B C     1 
ATOM   4399  O  O     . ARG B 2 436 ? -15.625 2.419   -35.853  1.00 6.51  ? 436 ARG B O     1 
ATOM   4400  C  CB    . ARG B 2 436 ? -18.391 1.438   -36.634  1.00 2.00  ? 436 ARG B CB    1 
ATOM   4401  C  CG    . ARG B 2 436 ? -18.991 2.873   -36.843  1.00 2.30  ? 436 ARG B CG    1 
ATOM   4402  C  CD    . ARG B 2 436 ? -20.515 2.963   -36.703  1.00 10.94 ? 436 ARG B CD    1 
ATOM   4403  N  NE    . ARG B 2 436 ? -21.216 4.230   -37.037  1.00 2.00  ? 436 ARG B NE    1 
ATOM   4404  C  CZ    . ARG B 2 436 ? -22.450 4.465   -36.563  1.00 6.87  ? 436 ARG B CZ    1 
ATOM   4405  N  NH1   . ARG B 2 436 ? -23.027 3.524   -35.802  1.00 2.00  ? 436 ARG B NH1   1 
ATOM   4406  N  NH2   . ARG B 2 436 ? -23.121 5.612   -36.788  1.00 2.00  ? 436 ARG B NH2   1 
ATOM   4407  N  N     . LEU B 2 437 ? -16.089 3.513   -37.878  1.00 6.50  ? 437 LEU B N     1 
ATOM   4408  C  CA    . LEU B 2 437 ? -15.266 4.709   -37.667  1.00 2.21  ? 437 LEU B CA    1 
ATOM   4409  C  C     . LEU B 2 437 ? -16.082 5.967   -38.025  1.00 14.38 ? 437 LEU B C     1 
ATOM   4410  O  O     . LEU B 2 437 ? -16.711 6.157   -39.157  1.00 2.91  ? 437 LEU B O     1 
ATOM   4411  C  CB    . LEU B 2 437 ? -14.035 4.628   -38.553  1.00 2.00  ? 437 LEU B CB    1 
ATOM   4412  C  CG    . LEU B 2 437 ? -12.988 5.729   -38.326  1.00 4.30  ? 437 LEU B CG    1 
ATOM   4413  C  CD1   . LEU B 2 437 ? -12.584 6.097   -36.915  1.00 2.27  ? 437 LEU B CD1   1 
ATOM   4414  C  CD2   . LEU B 2 437 ? -11.812 5.670   -39.224  1.00 2.00  ? 437 LEU B CD2   1 
ATOM   4415  N  N     . SER B 2 438 ? -16.072 6.867   -37.075  1.00 5.00  ? 438 SER B N     1 
ATOM   4416  C  CA    . SER B 2 438 ? -16.334 8.251   -37.415  1.00 9.59  ? 438 SER B CA    1 
ATOM   4417  C  C     . SER B 2 438 ? -15.255 9.094   -36.769  1.00 9.45  ? 438 SER B C     1 
ATOM   4418  O  O     . SER B 2 438 ? -15.048 8.957   -35.550  1.00 10.48 ? 438 SER B O     1 
ATOM   4419  C  CB    . SER B 2 438 ? -17.755 8.701   -37.113  1.00 2.00  ? 438 SER B CB    1 
ATOM   4420  O  OG    . SER B 2 438 ? -17.970 8.812   -35.762  1.00 4.32  ? 438 SER B OG    1 
ATOM   4421  N  N     . LEU B 2 439 ? -14.644 9.949   -37.589  1.00 12.15 ? 439 LEU B N     1 
ATOM   4422  C  CA    . LEU B 2 439 ? -13.562 10.856  -37.237  1.00 10.68 ? 439 LEU B CA    1 
ATOM   4423  C  C     . LEU B 2 439 ? -13.812 12.313  -37.639  1.00 15.73 ? 439 LEU B C     1 
ATOM   4424  O  O     . LEU B 2 439 ? -14.768 12.628  -38.319  1.00 12.75 ? 439 LEU B O     1 
ATOM   4425  C  CB    . LEU B 2 439 ? -12.231 10.377  -37.826  1.00 8.10  ? 439 LEU B CB    1 
ATOM   4426  C  CG    . LEU B 2 439 ? -12.033 9.924   -39.271  1.00 2.00  ? 439 LEU B CG    1 
ATOM   4427  C  CD1   . LEU B 2 439 ? -12.958 10.592  -40.213  1.00 18.73 ? 439 LEU B CD1   1 
ATOM   4428  C  CD2   . LEU B 2 439 ? -10.626 10.150  -39.704  1.00 4.26  ? 439 LEU B CD2   1 
ATOM   4429  N  N     . SER B 2 440 ? -12.917 13.185  -37.208  1.00 10.56 ? 440 SER B N     1 
ATOM   4430  C  CA    . SER B 2 440 ? -13.142 14.621  -37.154  1.00 2.24  ? 440 SER B CA    1 
ATOM   4431  C  C     . SER B 2 440 ? -11.844 15.356  -36.822  1.00 5.00  ? 440 SER B C     1 
ATOM   4432  O  O     . SER B 2 440 ? -10.816 14.744  -36.621  1.00 2.00  ? 440 SER B O     1 
ATOM   4433  C  CB    . SER B 2 440 ? -14.242 14.975  -36.149  1.00 3.82  ? 440 SER B CB    1 
ATOM   4434  O  OG    . SER B 2 440 ? -13.799 14.814  -34.828  1.00 25.59 ? 440 SER B OG    1 
ATOM   4435  N  N     . GLY B 2 441 ? -11.898 16.675  -36.793  1.00 2.00  ? 441 GLY B N     1 
ATOM   4436  C  CA    . GLY B 2 441 ? -10.697 17.474  -36.712  1.00 2.44  ? 441 GLY B CA    1 
ATOM   4437  C  C     . GLY B 2 441 ? -9.966  17.672  -38.023  1.00 10.62 ? 441 GLY B C     1 
ATOM   4438  O  O     . GLY B 2 441 ? -10.506 17.400  -39.076  1.00 2.00  ? 441 GLY B O     1 
ATOM   4439  N  N     . LEU B 2 442 ? -8.731  18.150  -37.939  1.00 6.20  ? 442 LEU B N     1 
ATOM   4440  C  CA    . LEU B 2 442 ? -8.019  18.618  -39.091  1.00 2.89  ? 442 LEU B CA    1 
ATOM   4441  C  C     . LEU B 2 442 ? -7.426  17.399  -39.789  1.00 2.76  ? 442 LEU B C     1 
ATOM   4442  O  O     . LEU B 2 442 ? -6.580  16.707  -39.196  1.00 8.15  ? 442 LEU B O     1 
ATOM   4443  C  CB    . LEU B 2 442 ? -6.895  19.596  -38.646  1.00 2.00  ? 442 LEU B CB    1 
ATOM   4444  C  CG    . LEU B 2 442 ? -5.946  20.044  -39.784  1.00 7.38  ? 442 LEU B CG    1 
ATOM   4445  C  CD1   . LEU B 2 442 ? -6.668  20.731  -40.977  1.00 2.00  ? 442 LEU B CD1   1 
ATOM   4446  C  CD2   . LEU B 2 442 ? -4.672  20.871  -39.333  1.00 2.00  ? 442 LEU B CD2   1 
ATOM   4447  N  N     . LEU B 2 443 ? -7.773  17.164  -41.061  1.00 4.10  ? 443 LEU B N     1 
ATOM   4448  C  CA    . LEU B 2 443 ? -7.459  15.878  -41.646  1.00 2.00  ? 443 LEU B CA    1 
ATOM   4449  C  C     . LEU B 2 443 ? -7.102  16.067  -43.084  1.00 10.05 ? 443 LEU B C     1 
ATOM   4450  O  O     . LEU B 2 443 ? -7.783  16.837  -43.804  1.00 2.12  ? 443 LEU B O     1 
ATOM   4451  C  CB    . LEU B 2 443 ? -8.629  14.933  -41.459  1.00 2.00  ? 443 LEU B CB    1 
ATOM   4452  C  CG    . LEU B 2 443 ? -9.085  14.542  -40.020  1.00 3.47  ? 443 LEU B CG    1 
ATOM   4453  C  CD1   . LEU B 2 443 ? -10.447 13.944  -40.100  1.00 2.00  ? 443 LEU B CD1   1 
ATOM   4454  C  CD2   . LEU B 2 443 ? -8.111  13.507  -39.386  1.00 2.00  ? 443 LEU B CD2   1 
ATOM   4455  N  N     . THR B 2 444 ? -5.989  15.452  -43.503  1.00 2.73  ? 444 THR B N     1 
ATOM   4456  C  CA    . THR B 2 444 ? -5.514  15.701  -44.853  1.00 3.09  ? 444 THR B CA    1 
ATOM   4457  C  C     . THR B 2 444 ? -5.695  14.442  -45.650  1.00 2.05  ? 444 THR B C     1 
ATOM   4458  O  O     . THR B 2 444 ? -6.156  13.464  -45.122  1.00 7.72  ? 444 THR B O     1 
ATOM   4459  C  CB    . THR B 2 444 ? -4.074  16.139  -44.941  1.00 4.18  ? 444 THR B CB    1 
ATOM   4460  O  OG1   . THR B 2 444 ? -3.216  14.986  -44.991  1.00 3.26  ? 444 THR B OG1   1 
ATOM   4461  C  CG2   . THR B 2 444 ? -3.700  17.059  -43.777  1.00 6.36  ? 444 THR B CG2   1 
ATOM   4462  N  N     . ASP B 2 445 ? -5.443  14.487  -46.952  1.00 6.82  ? 445 ASP B N     1 
ATOM   4463  C  CA    . ASP B 2 445 ? -5.731  13.337  -47.812  1.00 7.24  ? 445 ASP B CA    1 
ATOM   4464  C  C     . ASP B 2 445 ? -5.052  12.130  -47.156  1.00 10.85 ? 445 ASP B C     1 
ATOM   4465  O  O     . ASP B 2 445 ? -5.345  10.985  -47.405  1.00 18.34 ? 445 ASP B O     1 
ATOM   4466  C  CB    . ASP B 2 445 ? -5.185  13.592  -49.213  1.00 2.00  ? 445 ASP B CB    1 
ATOM   4467  C  CG    . ASP B 2 445 ? -6.256  14.178  -50.146  1.00 14.48 ? 445 ASP B CG    1 
ATOM   4468  O  OD1   . ASP B 2 445 ? -5.987  14.477  -51.352  1.00 3.01  ? 445 ASP B OD1   1 
ATOM   4469  O  OD2   . ASP B 2 445 ? -7.404  14.315  -49.653  1.00 3.47  ? 445 ASP B OD2   1 
ATOM   4470  N  N     . LYS B 2 446 ? -4.139  12.382  -46.255  1.00 19.26 ? 446 LYS B N     1 
ATOM   4471  C  CA    . LYS B 2 446 ? -3.382  11.263  -45.779  1.00 16.00 ? 446 LYS B CA    1 
ATOM   4472  C  C     . LYS B 2 446 ? -4.087  10.254  -44.774  1.00 10.00 ? 446 LYS B C     1 
ATOM   4473  O  O     . LYS B 2 446 ? -3.888  9.024   -44.895  1.00 5.76  ? 446 LYS B O     1 
ATOM   4474  C  CB    . LYS B 2 446 ? -1.968  11.731  -45.407  1.00 12.73 ? 446 LYS B CB    1 
ATOM   4475  C  CG    . LYS B 2 446 ? -1.249  10.879  -44.335  1.00 16.82 ? 446 LYS B CG    1 
ATOM   4476  C  CD    . LYS B 2 446 ? 0.158   10.513  -44.829  1.00 7.80  ? 446 LYS B CD    1 
ATOM   4477  C  CE    . LYS B 2 446 ? 0.400   10.799  -46.330  1.00 22.74 ? 446 LYS B CE    1 
ATOM   4478  N  NZ    . LYS B 2 446 ? 0.936   9.594   -47.021  1.00 12.89 ? 446 LYS B NZ    1 
ATOM   4479  N  N     . VAL B 2 447 ? -4.934  10.732  -43.850  1.00 2.00  ? 447 VAL B N     1 
ATOM   4480  C  CA    . VAL B 2 447 ? -5.789  9.795   -43.105  1.00 8.05  ? 447 VAL B CA    1 
ATOM   4481  C  C     . VAL B 2 447 ? -6.478  8.889   -44.059  1.00 5.87  ? 447 VAL B C     1 
ATOM   4482  O  O     . VAL B 2 447 ? -6.552  7.697   -43.777  1.00 10.63 ? 447 VAL B O     1 
ATOM   4483  C  CB    . VAL B 2 447 ? -7.005  10.325  -42.236  1.00 4.90  ? 447 VAL B CB    1 
ATOM   4484  C  CG1   . VAL B 2 447 ? -7.002  9.905   -40.822  1.00 14.71 ? 447 VAL B CG1   1 
ATOM   4485  C  CG2   . VAL B 2 447 ? -7.496  11.654  -42.490  1.00 13.21 ? 447 VAL B CG2   1 
ATOM   4486  N  N     . PHE B 2 448 ? -7.007  9.449   -45.159  1.00 5.48  ? 448 PHE B N     1 
ATOM   4487  C  CA    . PHE B 2 448 ? -7.799  8.670   -46.042  1.00 2.00  ? 448 PHE B CA    1 
ATOM   4488  C  C     . PHE B 2 448 ? -6.954  7.538   -46.536  1.00 5.66  ? 448 PHE B C     1 
ATOM   4489  O  O     . PHE B 2 448 ? -7.361  6.389   -46.578  1.00 8.77  ? 448 PHE B O     1 
ATOM   4490  C  CB    . PHE B 2 448 ? -8.407  9.535   -47.085  1.00 2.00  ? 448 PHE B CB    1 
ATOM   4491  C  CG    . PHE B 2 448 ? -9.483  10.316  -46.515  1.00 2.03  ? 448 PHE B CG    1 
ATOM   4492  C  CD1   . PHE B 2 448 ? -9.288  11.668  -46.179  1.00 16.88 ? 448 PHE B CD1   1 
ATOM   4493  C  CD2   . PHE B 2 448 ? -10.643 9.669   -46.078  1.00 5.06  ? 448 PHE B CD2   1 
ATOM   4494  C  CE1   . PHE B 2 448 ? -10.299 12.429  -45.491  1.00 9.15  ? 448 PHE B CE1   1 
ATOM   4495  C  CE2   . PHE B 2 448 ? -11.663 10.385  -45.430  1.00 12.42 ? 448 PHE B CE2   1 
ATOM   4496  C  CZ    . PHE B 2 448 ? -11.472 11.819  -45.106  1.00 7.88  ? 448 PHE B CZ    1 
ATOM   4497  N  N     . GLU B 2 449 ? -5.712  7.857   -46.766  1.00 4.31  ? 449 GLU B N     1 
ATOM   4498  C  CA    . GLU B 2 449 ? -4.809  6.883   -47.270  1.00 9.34  ? 449 GLU B CA    1 
ATOM   4499  C  C     . GLU B 2 449 ? -4.610  5.818   -46.238  1.00 11.01 ? 449 GLU B C     1 
ATOM   4500  O  O     . GLU B 2 449 ? -4.540  4.624   -46.574  1.00 11.06 ? 449 GLU B O     1 
ATOM   4501  C  CB    . GLU B 2 449 ? -3.490  7.512   -47.609  1.00 2.00  ? 449 GLU B CB    1 
ATOM   4502  C  CG    . GLU B 2 449 ? -2.493  6.502   -48.226  1.00 14.31 ? 449 GLU B CG    1 
ATOM   4503  C  CD    . GLU B 2 449 ? -1.095  7.158   -48.483  1.00 19.61 ? 449 GLU B CD    1 
ATOM   4504  O  OE1   . GLU B 2 449 ? -1.013  8.229   -49.173  1.00 11.86 ? 449 GLU B OE1   1 
ATOM   4505  O  OE2   . GLU B 2 449 ? -0.096  6.619   -47.945  1.00 21.82 ? 449 GLU B OE2   1 
ATOM   4506  N  N     . TYR B 2 450 ? -4.521  6.217   -44.990  1.00 2.00  ? 450 TYR B N     1 
ATOM   4507  C  CA    . TYR B 2 450 ? -4.291  5.181   -43.999  1.00 14.35 ? 450 TYR B CA    1 
ATOM   4508  C  C     . TYR B 2 450 ? -5.513  4.309   -43.980  1.00 4.18  ? 450 TYR B C     1 
ATOM   4509  O  O     . TYR B 2 450 ? -5.451  3.154   -43.618  1.00 4.12  ? 450 TYR B O     1 
ATOM   4510  C  CB    . TYR B 2 450 ? -4.162  5.794   -42.608  1.00 16.36 ? 450 TYR B CB    1 
ATOM   4511  C  CG    . TYR B 2 450 ? -2.927  6.625   -42.485  1.00 11.31 ? 450 TYR B CG    1 
ATOM   4512  C  CD1   . TYR B 2 450 ? -2.879  7.679   -41.643  1.00 2.05  ? 450 TYR B CD1   1 
ATOM   4513  C  CD2   . TYR B 2 450 ? -1.828  6.357   -43.244  1.00 2.05  ? 450 TYR B CD2   1 
ATOM   4514  C  CE1   . TYR B 2 450 ? -1.755  8.454   -41.541  1.00 9.39  ? 450 TYR B CE1   1 
ATOM   4515  C  CE2   . TYR B 2 450 ? -0.672  7.111   -43.124  1.00 3.01  ? 450 TYR B CE2   1 
ATOM   4516  C  CZ    . TYR B 2 450 ? -0.643  8.168   -42.274  1.00 8.52  ? 450 TYR B CZ    1 
ATOM   4517  O  OH    . TYR B 2 450 ? 0.513   8.961   -42.119  1.00 11.04 ? 450 TYR B OH    1 
ATOM   4518  N  N     . ILE B 2 451 ? -6.648  4.929   -44.256  1.00 11.91 ? 451 ILE B N     1 
ATOM   4519  C  CA    . ILE B 2 451 ? -7.930  4.317   -43.985  1.00 3.20  ? 451 ILE B CA    1 
ATOM   4520  C  C     . ILE B 2 451 ? -8.010  3.204   -45.024  1.00 6.93  ? 451 ILE B C     1 
ATOM   4521  O  O     . ILE B 2 451 ? -8.478  2.124   -44.692  1.00 9.42  ? 451 ILE B O     1 
ATOM   4522  C  CB    . ILE B 2 451 ? -9.100  5.353   -44.034  1.00 2.00  ? 451 ILE B CB    1 
ATOM   4523  C  CG1   . ILE B 2 451 ? -9.063  6.074   -42.735  1.00 2.00  ? 451 ILE B CG1   1 
ATOM   4524  C  CG2   . ILE B 2 451 ? -10.513 4.709   -43.970  1.00 2.00  ? 451 ILE B CG2   1 
ATOM   4525  C  CD1   . ILE B 2 451 ? -10.229 6.882   -42.477  1.00 2.00  ? 451 ILE B CD1   1 
ATOM   4526  N  N     . GLY B 2 452 ? -7.493  3.470   -46.240  1.00 8.54  ? 452 GLY B N     1 
ATOM   4527  C  CA    . GLY B 2 452 ? -7.578  2.549   -47.437  1.00 5.91  ? 452 GLY B CA    1 
ATOM   4528  C  C     . GLY B 2 452 ? -6.575  1.408   -47.272  1.00 11.04 ? 452 GLY B C     1 
ATOM   4529  O  O     . GLY B 2 452 ? -6.788  0.285   -47.710  1.00 3.43  ? 452 GLY B O     1 
ATOM   4530  N  N     . THR B 2 453 ? -5.456  1.716   -46.620  1.00 13.23 ? 453 THR B N     1 
ATOM   4531  C  CA    . THR B 2 453 ? -4.490  0.704   -46.356  1.00 5.98  ? 453 THR B CA    1 
ATOM   4532  C  C     . THR B 2 453 ? -4.763  -0.243  -45.198  1.00 4.28  ? 453 THR B C     1 
ATOM   4533  O  O     . THR B 2 453 ? -4.638  -1.435  -45.378  1.00 7.04  ? 453 THR B O     1 
ATOM   4534  C  CB    . THR B 2 453 ? -3.033  1.082   -46.681  1.00 10.52 ? 453 THR B CB    1 
ATOM   4535  O  OG1   . THR B 2 453 ? -2.187  0.858   -45.551  1.00 8.92  ? 453 THR B OG1   1 
ATOM   4536  C  CG2   . THR B 2 453 ? -2.958  2.450   -47.129  1.00 2.00  ? 453 THR B CG2   1 
ATOM   4537  N  N     . TYR B 2 454 ? -5.229  0.272   -44.067  1.00 2.00  ? 454 TYR B N     1 
ATOM   4538  C  CA    . TYR B 2 454 ? -5.430  -0.522  -42.881  1.00 2.00  ? 454 TYR B CA    1 
ATOM   4539  C  C     . TYR B 2 454 ? -6.854  -0.890  -42.559  1.00 9.09  ? 454 TYR B C     1 
ATOM   4540  O  O     . TYR B 2 454 ? -7.028  -1.755  -41.710  1.00 5.84  ? 454 TYR B O     1 
ATOM   4541  C  CB    . TYR B 2 454 ? -4.906  0.228   -41.646  1.00 3.15  ? 454 TYR B CB    1 
ATOM   4542  C  CG    . TYR B 2 454 ? -3.461  0.375   -41.792  1.00 14.98 ? 454 TYR B CG    1 
ATOM   4543  C  CD1   . TYR B 2 454 ? -2.904  1.590   -42.227  1.00 2.14  ? 454 TYR B CD1   1 
ATOM   4544  C  CD2   . TYR B 2 454 ? -2.632  -0.735  -41.660  1.00 12.98 ? 454 TYR B CD2   1 
ATOM   4545  C  CE1   . TYR B 2 454 ? -1.569  1.709   -42.473  1.00 2.00  ? 454 TYR B CE1   1 
ATOM   4546  C  CE2   . TYR B 2 454 ? -1.245  -0.615  -41.877  1.00 13.21 ? 454 TYR B CE2   1 
ATOM   4547  C  CZ    . TYR B 2 454 ? -0.739  0.622   -42.293  1.00 20.56 ? 454 TYR B CZ    1 
ATOM   4548  O  OH    . TYR B 2 454 ? 0.599   0.766   -42.531  1.00 13.03 ? 454 TYR B OH    1 
ATOM   4549  N  N     . ALA B 2 455 ? -7.881  -0.192  -43.071  1.00 2.96  ? 455 ALA B N     1 
ATOM   4550  C  CA    . ALA B 2 455 ? -9.203  -0.386  -42.462  1.00 4.38  ? 455 ALA B CA    1 
ATOM   4551  C  C     . ALA B 2 455 ? -10.006 -1.445  -43.227  1.00 10.41 ? 455 ALA B C     1 
ATOM   4552  O  O     . ALA B 2 455 ? -11.116 -1.184  -43.687  1.00 9.27  ? 455 ALA B O     1 
ATOM   4553  C  CB    . ALA B 2 455 ? -9.958  0.906   -42.314  1.00 5.17  ? 455 ALA B CB    1 
ATOM   4554  N  N     . LYS B 2 456 ? -9.430  -2.647  -43.340  1.00 6.08  ? 456 LYS B N     1 
ATOM   4555  C  CA    . LYS B 2 456 ? -9.950  -3.743  -44.189  1.00 2.48  ? 456 LYS B CA    1 
ATOM   4556  C  C     . LYS B 2 456 ? -11.302 -4.376  -43.662  1.00 3.52  ? 456 LYS B C     1 
ATOM   4557  O  O     . LYS B 2 456 ? -11.984 -5.075  -44.371  1.00 2.35  ? 456 LYS B O     1 
ATOM   4558  C  CB    . LYS B 2 456 ? -8.882  -4.818  -44.228  1.00 5.67  ? 456 LYS B CB    1 
ATOM   4559  C  CG    . LYS B 2 456 ? -7.676  -4.716  -45.182  1.00 2.00  ? 456 LYS B CG    1 
ATOM   4560  C  CD    . LYS B 2 456 ? -7.367  -3.452  -45.841  1.00 3.85  ? 456 LYS B CD    1 
ATOM   4561  C  CE    . LYS B 2 456 ? -6.573  -3.618  -47.190  1.00 2.00  ? 456 LYS B CE    1 
ATOM   4562  N  NZ    . LYS B 2 456 ? -6.948  -2.723  -48.325  1.00 5.89  ? 456 LYS B NZ    1 
ATOM   4563  N  N     . LYS B 2 457 ? -11.721 -4.063  -42.451  1.00 2.00  ? 457 LYS B N     1 
ATOM   4564  C  CA    . LYS B 2 457 ? -12.829 -4.737  -41.831  1.00 4.34  ? 457 LYS B CA    1 
ATOM   4565  C  C     . LYS B 2 457 ? -13.895 -3.743  -41.661  1.00 2.00  ? 457 LYS B C     1 
ATOM   4566  O  O     . LYS B 2 457 ? -14.948 -3.990  -41.094  1.00 2.00  ? 457 LYS B O     1 
ATOM   4567  C  CB    . LYS B 2 457 ? -12.450 -5.238  -40.425  1.00 3.94  ? 457 LYS B CB    1 
ATOM   4568  C  CG    . LYS B 2 457 ? -11.636 -6.564  -40.449  1.00 8.76  ? 457 LYS B CG    1 
ATOM   4569  C  CD    . LYS B 2 457 ? -12.341 -7.593  -41.220  1.00 4.95  ? 457 LYS B CD    1 
ATOM   4570  C  CE    . LYS B 2 457 ? -11.430 -8.871  -41.544  1.00 12.36 ? 457 LYS B CE    1 
ATOM   4571  N  NZ    . LYS B 2 457 ? -11.301 -9.629  -40.207  1.00 38.98 ? 457 LYS B NZ    1 
ATOM   4572  N  N     . MET B 2 458 ? -13.586 -2.556  -42.103  1.00 6.62  ? 458 MET B N     1 
ATOM   4573  C  CA    . MET B 2 458 ? -14.400 -1.476  -41.698  1.00 4.74  ? 458 MET B CA    1 
ATOM   4574  C  C     . MET B 2 458 ? -15.654 -1.333  -42.611  1.00 11.65 ? 458 MET B C     1 
ATOM   4575  O  O     . MET B 2 458 ? -15.521 -1.298  -43.906  1.00 2.00  ? 458 MET B O     1 
ATOM   4576  C  CB    . MET B 2 458 ? -13.602 -0.204  -41.860  1.00 3.77  ? 458 MET B CB    1 
ATOM   4577  C  CG    . MET B 2 458 ? -14.282 0.820   -40.950  1.00 16.86 ? 458 MET B CG    1 
ATOM   4578  S  SD    . MET B 2 458 ? -14.247 2.495   -41.543  1.00 17.61 ? 458 MET B SD    1 
ATOM   4579  C  CE    . MET B 2 458 ? -13.272 2.629   -43.007  1.00 2.00  ? 458 MET B CE    1 
ATOM   4580  N  N     . GLU B 2 459 ? -16.811 -1.200  -41.961  1.00 2.00  ? 459 GLU B N     1 
ATOM   4581  C  CA    . GLU B 2 459 ? -18.102 -1.300  -42.626  1.00 2.69  ? 459 GLU B CA    1 
ATOM   4582  C  C     . GLU B 2 459 ? -18.858 0.021   -42.846  1.00 15.37 ? 459 GLU B C     1 
ATOM   4583  O  O     . GLU B 2 459 ? -19.550 0.257   -43.938  1.00 2.86  ? 459 GLU B O     1 
ATOM   4584  C  CB    . GLU B 2 459 ? -19.025 -2.207  -41.837  1.00 2.00  ? 459 GLU B CB    1 
ATOM   4585  C  CG    . GLU B 2 459 ? -18.615 -3.688  -42.079  1.00 7.65  ? 459 GLU B CG    1 
ATOM   4586  C  CD    . GLU B 2 459 ? -19.354 -4.728  -41.191  1.00 4.70  ? 459 GLU B CD    1 
ATOM   4587  O  OE1   . GLU B 2 459 ? -20.585 -4.612  -41.036  1.00 3.09  ? 459 GLU B OE1   1 
ATOM   4588  O  OE2   . GLU B 2 459 ? -18.711 -5.679  -40.684  1.00 6.77  ? 459 GLU B OE2   1 
ATOM   4589  N  N     . MET B 2 460 ? -18.784 0.850   -41.789  1.00 10.74 ? 460 MET B N     1 
ATOM   4590  C  CA    . MET B 2 460 ? -19.451 2.176   -41.797  1.00 21.73 ? 460 MET B CA    1 
ATOM   4591  C  C     . MET B 2 460 ? -18.396 3.242   -41.470  1.00 15.35 ? 460 MET B C     1 
ATOM   4592  O  O     . MET B 2 460 ? -17.632 3.083   -40.481  1.00 10.67 ? 460 MET B O     1 
ATOM   4593  C  CB    . MET B 2 460 ? -20.653 2.199   -40.811  1.00 4.70  ? 460 MET B CB    1 
ATOM   4594  C  CG    . MET B 2 460 ? -21.439 3.448   -40.894  1.00 2.00  ? 460 MET B CG    1 
ATOM   4595  S  SD    . MET B 2 460 ? -22.876 3.155   -39.837  1.00 7.75  ? 460 MET B SD    1 
ATOM   4596  C  CE    . MET B 2 460 ? -23.727 4.689   -40.322  1.00 14.65 ? 460 MET B CE    1 
ATOM   4597  N  N     . LEU B 2 461 ? -18.310 4.262   -42.324  1.00 2.73  ? 461 LEU B N     1 
ATOM   4598  C  CA    . LEU B 2 461 ? -17.370 5.369   -42.132  1.00 2.98  ? 461 LEU B CA    1 
ATOM   4599  C  C     . LEU B 2 461 ? -18.098 6.678   -42.294  1.00 12.49 ? 461 LEU B C     1 
ATOM   4600  O  O     . LEU B 2 461 ? -18.787 6.789   -43.278  1.00 5.83  ? 461 LEU B O     1 
ATOM   4601  C  CB    . LEU B 2 461 ? -16.376 5.385   -43.206  1.00 2.00  ? 461 LEU B CB    1 
ATOM   4602  C  CG    . LEU B 2 461 ? -15.409 6.567   -43.171  1.00 8.80  ? 461 LEU B CG    1 
ATOM   4603  C  CD1   . LEU B 2 461 ? -14.748 6.582   -41.844  1.00 2.00  ? 461 LEU B CD1   1 
ATOM   4604  C  CD2   . LEU B 2 461 ? -14.391 6.351   -44.295  1.00 2.00  ? 461 LEU B CD2   1 
ATOM   4605  N  N     . SER B 2 462 ? -17.954 7.627   -41.337  1.00 13.40 ? 462 SER B N     1 
ATOM   4606  C  CA    . SER B 2 462 ? -18.640 8.902   -41.312  1.00 2.00  ? 462 SER B CA    1 
ATOM   4607  C  C     . SER B 2 462 ? -17.614 10.030  -41.332  1.00 15.33 ? 462 SER B C     1 
ATOM   4608  O  O     . SER B 2 462 ? -16.724 10.128  -40.496  1.00 6.25  ? 462 SER B O     1 
ATOM   4609  C  CB    . SER B 2 462 ? -19.374 9.034   -40.018  1.00 9.40  ? 462 SER B CB    1 
ATOM   4610  O  OG    . SER B 2 462 ? -20.579 8.337   -40.118  1.00 3.07  ? 462 SER B OG    1 
ATOM   4611  N  N     . VAL B 2 463 ? -17.704 10.920  -42.275  1.00 7.98  ? 463 VAL B N     1 
ATOM   4612  C  CA    . VAL B 2 463 ? -16.807 12.012  -42.144  1.00 18.59 ? 463 VAL B CA    1 
ATOM   4613  C  C     . VAL B 2 463 ? -17.297 13.444  -42.679  1.00 20.23 ? 463 VAL B C     1 
ATOM   4614  O  O     . VAL B 2 463 ? -18.192 13.495  -43.549  1.00 13.01 ? 463 VAL B O     1 
ATOM   4615  C  CB    . VAL B 2 463 ? -15.554 11.525  -42.756  1.00 10.36 ? 463 VAL B CB    1 
ATOM   4616  C  CG1   . VAL B 2 463 ? -15.678 11.591  -44.258  1.00 2.00  ? 463 VAL B CG1   1 
ATOM   4617  C  CG2   . VAL B 2 463 ? -14.304 12.345  -42.230  1.00 22.21 ? 463 VAL B CG2   1 
ATOM   4618  N  N     . ALA B 2 464 ? -16.712 14.550  -42.175  1.00 3.39  ? 464 ALA B N     1 
ATOM   4619  C  CA    . ALA B 2 464 ? -17.145 15.994  -42.395  1.00 4.68  ? 464 ALA B CA    1 
ATOM   4620  C  C     . ALA B 2 464 ? -15.845 16.878  -42.478  1.00 3.68  ? 464 ALA B C     1 
ATOM   4621  O  O     . ALA B 2 464 ? -14.879 16.592  -41.791  1.00 2.00  ? 464 ALA B O     1 
ATOM   4622  C  CB    . ALA B 2 464 ? -17.979 16.450  -41.189  1.00 2.73  ? 464 ALA B CB    1 
ATOM   4623  N  N     . PHE B 2 465 ? -15.779 17.872  -43.367  1.00 6.18  ? 465 PHE B N     1 
ATOM   4624  C  CA    . PHE B 2 465 ? -14.792 18.906  -43.211  1.00 2.00  ? 465 PHE B CA    1 
ATOM   4625  C  C     . PHE B 2 465 ? -13.414 18.296  -43.227  1.00 4.46  ? 465 PHE B C     1 
ATOM   4626  O  O     . PHE B 2 465 ? -12.504 18.579  -42.377  1.00 2.00  ? 465 PHE B O     1 
ATOM   4627  C  CB    . PHE B 2 465 ? -15.011 19.631  -41.891  1.00 9.65  ? 465 PHE B CB    1 
ATOM   4628  C  CG    . PHE B 2 465 ? -16.308 20.345  -41.847  1.00 10.09 ? 465 PHE B CG    1 
ATOM   4629  C  CD1   . PHE B 2 465 ? -17.269 20.023  -40.891  1.00 8.49  ? 465 PHE B CD1   1 
ATOM   4630  C  CD2   . PHE B 2 465 ? -16.606 21.332  -42.825  1.00 2.26  ? 465 PHE B CD2   1 
ATOM   4631  C  CE1   . PHE B 2 465 ? -18.535 20.673  -40.880  1.00 5.70  ? 465 PHE B CE1   1 
ATOM   4632  C  CE2   . PHE B 2 465 ? -17.876 21.982  -42.821  1.00 2.80  ? 465 PHE B CE2   1 
ATOM   4633  C  CZ    . PHE B 2 465 ? -18.829 21.648  -41.861  1.00 2.00  ? 465 PHE B CZ    1 
ATOM   4634  N  N     . ALA B 2 466 ? -13.191 17.540  -44.278  1.00 2.00  ? 466 ALA B N     1 
ATOM   4635  C  CA    . ALA B 2 466 ? -11.962 16.793  -44.262  1.00 6.20  ? 466 ALA B CA    1 
ATOM   4636  C  C     . ALA B 2 466 ? -11.445 16.456  -45.651  1.00 9.04  ? 466 ALA B C     1 
ATOM   4637  O  O     . ALA B 2 466 ? -12.253 16.418  -46.596  1.00 4.31  ? 466 ALA B O     1 
ATOM   4638  C  CB    . ALA B 2 466 ? -12.192 15.563  -43.454  1.00 2.91  ? 466 ALA B CB    1 
ATOM   4639  N  N     . GLY B 2 467 ? -10.118 16.218  -45.720  1.00 2.00  ? 467 GLY B N     1 
ATOM   4640  C  CA    . GLY B 2 467 ? -9.357  15.825  -46.897  1.00 2.00  ? 467 GLY B CA    1 
ATOM   4641  C  C     . GLY B 2 467 ? -9.011  17.052  -47.749  1.00 12.03 ? 467 GLY B C     1 
ATOM   4642  O  O     . GLY B 2 467 ? -9.470  18.168  -47.435  1.00 11.54 ? 467 GLY B O     1 
ATOM   4643  N  N     . ASP B 2 468 ? -8.211  16.885  -48.801  1.00 4.33  ? 468 ASP B N     1 
ATOM   4644  C  CA    . ASP B 2 468 ? -7.844  18.008  -49.709  1.00 8.78  ? 468 ASP B CA    1 
ATOM   4645  C  C     . ASP B 2 468 ? -8.231  17.804  -51.136  1.00 8.21  ? 468 ASP B C     1 
ATOM   4646  O  O     . ASP B 2 468 ? -8.251  18.751  -51.936  1.00 9.71  ? 468 ASP B O     1 
ATOM   4647  C  CB    . ASP B 2 468 ? -6.348  18.120  -49.767  1.00 2.00  ? 468 ASP B CB    1 
ATOM   4648  C  CG    . ASP B 2 468 ? -5.759  18.167  -48.403  1.00 30.13 ? 468 ASP B CG    1 
ATOM   4649  O  OD1   . ASP B 2 468 ? -6.219  19.057  -47.632  1.00 17.02 ? 468 ASP B OD1   1 
ATOM   4650  O  OD2   . ASP B 2 468 ? -4.883  17.313  -48.095  1.00 7.13  ? 468 ASP B OD2   1 
ATOM   4651  N  N     . SER B 2 469 ? -8.470  16.565  -51.509  1.00 5.56  ? 469 SER B N     1 
ATOM   4652  C  CA    . SER B 2 469 ? -8.867  16.362  -52.895  1.00 7.47  ? 469 SER B CA    1 
ATOM   4653  C  C     . SER B 2 469 ? -9.437  14.975  -53.140  1.00 2.07  ? 469 SER B C     1 
ATOM   4654  O  O     . SER B 2 469 ? -9.634  14.164  -52.234  1.00 9.95  ? 469 SER B O     1 
ATOM   4655  C  CB    . SER B 2 469 ? -7.629  16.517  -53.735  1.00 2.00  ? 469 SER B CB    1 
ATOM   4656  O  OG    . SER B 2 469 ? -6.935  15.245  -53.745  1.00 16.77 ? 469 SER B OG    1 
ATOM   4657  N  N     . ASP B 2 470 ? -9.674  14.681  -54.398  1.00 6.04  ? 470 ASP B N     1 
ATOM   4658  C  CA    . ASP B 2 470 ? -10.417 13.517  -54.742  1.00 3.16  ? 470 ASP B CA    1 
ATOM   4659  C  C     . ASP B 2 470 ? -9.583  12.223  -54.358  1.00 20.10 ? 470 ASP B C     1 
ATOM   4660  O  O     . ASP B 2 470 ? -10.178 11.164  -54.142  1.00 2.92  ? 470 ASP B O     1 
ATOM   4661  C  CB    . ASP B 2 470 ? -10.574 13.546  -56.221  1.00 9.76  ? 470 ASP B CB    1 
ATOM   4662  C  CG    . ASP B 2 470 ? -11.795 14.238  -56.644  1.00 19.18 ? 470 ASP B CG    1 
ATOM   4663  O  OD1   . ASP B 2 470 ? -12.878 13.620  -56.530  1.00 3.02  ? 470 ASP B OD1   1 
ATOM   4664  O  OD2   . ASP B 2 470 ? -11.630 15.383  -57.147  1.00 12.31 ? 470 ASP B OD2   1 
ATOM   4665  N  N     . LEU B 2 471 ? -8.234  12.307  -54.372  1.00 2.23  ? 471 LEU B N     1 
ATOM   4666  C  CA    . LEU B 2 471 ? -7.356  11.234  -53.926  1.00 7.17  ? 471 LEU B CA    1 
ATOM   4667  C  C     . LEU B 2 471 ? -7.844  10.618  -52.613  1.00 7.12  ? 471 LEU B C     1 
ATOM   4668  O  O     . LEU B 2 471 ? -7.864  9.373   -52.424  1.00 12.38 ? 471 LEU B O     1 
ATOM   4669  C  CB    . LEU B 2 471 ? -5.912  11.728  -53.773  1.00 3.41  ? 471 LEU B CB    1 
ATOM   4670  C  CG    . LEU B 2 471 ? -4.805  10.924  -54.432  1.00 38.32 ? 471 LEU B CG    1 
ATOM   4671  C  CD1   . LEU B 2 471 ? -3.446  11.072  -53.698  1.00 9.75  ? 471 LEU B CD1   1 
ATOM   4672  C  CD2   . LEU B 2 471 ? -5.245  9.429   -54.566  1.00 14.60 ? 471 LEU B CD2   1 
ATOM   4673  N  N     . GLY B 2 472 ? -8.306  11.438  -51.697  1.00 2.00  ? 472 GLY B N     1 
ATOM   4674  C  CA    . GLY B 2 472 ? -8.665  10.822  -50.441  1.00 2.00  ? 472 GLY B CA    1 
ATOM   4675  C  C     . GLY B 2 472 ? -9.837  9.836   -50.522  1.00 11.45 ? 472 GLY B C     1 
ATOM   4676  O  O     . GLY B 2 472 ? -9.804  8.757   -49.890  1.00 17.12 ? 472 GLY B O     1 
ATOM   4677  N  N     . MET B 2 473 ? -10.908 10.229  -51.208  1.00 9.87  ? 473 MET B N     1 
ATOM   4678  C  CA    . MET B 2 473 ? -12.114 9.437   -51.271  1.00 2.21  ? 473 MET B CA    1 
ATOM   4679  C  C     . MET B 2 473 ? -11.742 8.263   -52.152  1.00 4.77  ? 473 MET B C     1 
ATOM   4680  O  O     . MET B 2 473 ? -12.122 7.088   -51.904  1.00 5.91  ? 473 MET B O     1 
ATOM   4681  C  CB    . MET B 2 473 ? -13.233 10.158  -51.973  1.00 2.00  ? 473 MET B CB    1 
ATOM   4682  C  CG    . MET B 2 473 ? -14.389 9.273   -51.799  1.00 2.00  ? 473 MET B CG    1 
ATOM   4683  S  SD    . MET B 2 473 ? -15.995 9.829   -52.331  1.00 7.91  ? 473 MET B SD    1 
ATOM   4684  C  CE    . MET B 2 473 ? -15.866 9.961   -54.128  1.00 2.00  ? 473 MET B CE    1 
ATOM   4685  N  N     . HIS B 2 474 ? -10.945 8.521   -53.148  1.00 2.00  ? 474 HIS B N     1 
ATOM   4686  C  CA    . HIS B 2 474 ? -10.410 7.368   -53.868  1.00 6.37  ? 474 HIS B CA    1 
ATOM   4687  C  C     . HIS B 2 474 ? -9.758  6.290   -53.013  1.00 5.70  ? 474 HIS B C     1 
ATOM   4688  O  O     . HIS B 2 474 ? -9.999  5.126   -53.264  1.00 7.86  ? 474 HIS B O     1 
ATOM   4689  C  CB    . HIS B 2 474 ? -9.467  7.809   -54.933  1.00 2.00  ? 474 HIS B CB    1 
ATOM   4690  C  CG    . HIS B 2 474 ? -8.725  6.711   -55.600  1.00 19.91 ? 474 HIS B CG    1 
ATOM   4691  N  ND1   . HIS B 2 474 ? -9.242  6.024   -56.679  1.00 5.67  ? 474 HIS B ND1   1 
ATOM   4692  C  CD2   . HIS B 2 474 ? -7.460  6.235   -55.417  1.00 7.45  ? 474 HIS B CD2   1 
ATOM   4693  C  CE1   . HIS B 2 474 ? -8.336  5.147   -57.114  1.00 2.00  ? 474 HIS B CE1   1 
ATOM   4694  N  NE2   . HIS B 2 474 ? -7.251  5.264   -56.372  1.00 2.00  ? 474 HIS B NE2   1 
ATOM   4695  N  N     . HIS B 2 475 ? -8.901  6.644   -52.038  1.00 9.23  ? 475 HIS B N     1 
ATOM   4696  C  CA    . HIS B 2 475 ? -8.220  5.603   -51.243  1.00 2.00  ? 475 HIS B CA    1 
ATOM   4697  C  C     . HIS B 2 475 ? -9.279  4.854   -50.494  1.00 9.56  ? 475 HIS B C     1 
ATOM   4698  O  O     . HIS B 2 475 ? -9.120  3.650   -50.274  1.00 9.40  ? 475 HIS B O     1 
ATOM   4699  C  CB    . HIS B 2 475 ? -7.281  6.209   -50.242  1.00 4.16  ? 475 HIS B CB    1 
ATOM   4700  C  CG    . HIS B 2 475 ? -6.094  6.874   -50.871  1.00 2.95  ? 475 HIS B CG    1 
ATOM   4701  N  ND1   . HIS B 2 475 ? -5.372  6.294   -51.890  1.00 4.31  ? 475 HIS B ND1   1 
ATOM   4702  C  CD2   . HIS B 2 475 ? -5.469  8.045   -50.590  1.00 2.00  ? 475 HIS B CD2   1 
ATOM   4703  C  CE1   . HIS B 2 475 ? -4.354  7.068   -52.213  1.00 2.00  ? 475 HIS B CE1   1 
ATOM   4704  N  NE2   . HIS B 2 475 ? -4.397  8.141   -51.446  1.00 15.26 ? 475 HIS B NE2   1 
ATOM   4705  N  N     . VAL B 2 476 ? -10.381 5.507   -50.112  1.00 2.00  ? 476 VAL B N     1 
ATOM   4706  C  CA    . VAL B 2 476 ? -11.356 4.792   -49.319  1.00 2.84  ? 476 VAL B CA    1 
ATOM   4707  C  C     . VAL B 2 476 ? -12.058 3.771   -50.252  1.00 2.16  ? 476 VAL B C     1 
ATOM   4708  O  O     . VAL B 2 476 ? -12.166 2.628   -49.928  1.00 8.12  ? 476 VAL B O     1 
ATOM   4709  C  CB    . VAL B 2 476 ? -12.394 5.708   -48.537  1.00 2.40  ? 476 VAL B CB    1 
ATOM   4710  C  CG1   . VAL B 2 476 ? -13.540 4.866   -47.843  1.00 2.00  ? 476 VAL B CG1   1 
ATOM   4711  C  CG2   . VAL B 2 476 ? -11.670 6.624   -47.469  1.00 3.25  ? 476 VAL B CG2   1 
ATOM   4712  N  N     . LEU B 2 477 ? -12.557 4.182   -51.384  1.00 7.25  ? 477 LEU B N     1 
ATOM   4713  C  CA    . LEU B 2 477 ? -13.473 3.330   -52.128  1.00 5.32  ? 477 LEU B CA    1 
ATOM   4714  C  C     . LEU B 2 477 ? -12.507 2.281   -52.669  1.00 10.70 ? 477 LEU B C     1 
ATOM   4715  O  O     . LEU B 2 477 ? -12.861 1.130   -52.818  1.00 9.22  ? 477 LEU B O     1 
ATOM   4716  C  CB    . LEU B 2 477 ? -14.071 4.096   -53.344  1.00 2.69  ? 477 LEU B CB    1 
ATOM   4717  C  CG    . LEU B 2 477 ? -15.173 5.058   -52.927  1.00 11.08 ? 477 LEU B CG    1 
ATOM   4718  C  CD1   . LEU B 2 477 ? -15.572 6.161   -53.911  1.00 5.44  ? 477 LEU B CD1   1 
ATOM   4719  C  CD2   . LEU B 2 477 ? -16.348 4.414   -52.315  1.00 2.00  ? 477 LEU B CD2   1 
ATOM   4720  N  N     . SER B 2 478 ? -11.279 2.674   -52.963  1.00 8.63  ? 478 SER B N     1 
ATOM   4721  C  CA    . SER B 2 478 ? -10.216 1.696   -53.224  1.00 4.75  ? 478 SER B CA    1 
ATOM   4722  C  C     . SER B 2 478 ? -9.762  0.491   -52.352  1.00 12.39 ? 478 SER B C     1 
ATOM   4723  O  O     . SER B 2 478 ? -9.601  -0.657  -52.835  1.00 4.30  ? 478 SER B O     1 
ATOM   4724  C  CB    . SER B 2 478 ? -9.646  1.789   -54.571  1.00 9.50  ? 478 SER B CB    1 
ATOM   4725  O  OG    . SER B 2 478 ? -8.399  2.381   -54.460  1.00 11.78 ? 478 SER B OG    1 
ATOM   4726  N  N     . GLY B 2 479 ? -9.630  0.760   -51.054  1.00 6.43  ? 479 GLY B N     1 
ATOM   4727  C  CA    . GLY B 2 479 ? -8.821  -0.018  -50.125  1.00 2.00  ? 479 GLY B CA    1 
ATOM   4728  C  C     . GLY B 2 479 ? -9.785  -0.683  -49.219  1.00 2.00  ? 479 GLY B C     1 
ATOM   4729  O  O     . GLY B 2 479 ? -9.490  -1.727  -48.710  1.00 7.26  ? 479 GLY B O     1 
ATOM   4730  N  N     . CYS B 2 480 ? -10.966 -0.118  -49.049  1.00 2.00  ? 480 CYS B N     1 
ATOM   4731  C  CA    . CYS B 2 480 ? -11.834 -0.524  -48.033  1.00 2.00  ? 480 CYS B CA    1 
ATOM   4732  C  C     . CYS B 2 480 ? -12.689 -1.748  -48.334  1.00 7.44  ? 480 CYS B C     1 
ATOM   4733  O  O     . CYS B 2 480 ? -13.910 -1.638  -48.500  1.00 9.78  ? 480 CYS B O     1 
ATOM   4734  C  CB    . CYS B 2 480 ? -12.648 0.662   -47.562  1.00 7.88  ? 480 CYS B CB    1 
ATOM   4735  S  SG    . CYS B 2 480 ? -11.697 1.798   -46.539  1.00 5.78  ? 480 CYS B SG    1 
ATOM   4736  N  N     . ASP B 2 481 ? -12.031 -2.903  -48.455  1.00 10.47 ? 481 ASP B N     1 
ATOM   4737  C  CA    . ASP B 2 481 ? -12.670 -4.243  -48.660  1.00 14.20 ? 481 ASP B CA    1 
ATOM   4738  C  C     . ASP B 2 481 ? -14.051 -4.421  -48.061  1.00 6.06  ? 481 ASP B C     1 
ATOM   4739  O  O     . ASP B 2 481 ? -14.940 -4.965  -48.696  1.00 2.69  ? 481 ASP B O     1 
ATOM   4740  C  CB    . ASP B 2 481 ? -11.814 -5.389  -48.048  1.00 15.68 ? 481 ASP B CB    1 
ATOM   4741  C  CG    . ASP B 2 481 ? -10.474 -5.563  -48.755  1.00 15.00 ? 481 ASP B CG    1 
ATOM   4742  O  OD1   . ASP B 2 481 ? -10.255 -4.860  -49.778  1.00 11.68 ? 481 ASP B OD1   1 
ATOM   4743  O  OD2   . ASP B 2 481 ? -9.638  -6.359  -48.262  1.00 13.97 ? 481 ASP B OD2   1 
ATOM   4744  N  N     . SER B 2 482 ? -14.254 -4.075  -46.824  1.00 2.00  ? 482 SER B N     1 
ATOM   4745  C  CA    . SER B 2 482 ? -15.551 -4.440  -46.312  1.00 3.80  ? 482 SER B CA    1 
ATOM   4746  C  C     . SER B 2 482 ? -16.593 -3.260  -46.274  1.00 5.49  ? 482 SER B C     1 
ATOM   4747  O  O     . SER B 2 482 ? -17.702 -3.365  -45.609  1.00 4.46  ? 482 SER B O     1 
ATOM   4748  C  CB    . SER B 2 482 ? -15.452 -5.253  -44.989  1.00 7.57  ? 482 SER B CB    1 
ATOM   4749  O  OG    . SER B 2 482 ? -14.203 -5.976  -44.875  1.00 2.27  ? 482 SER B OG    1 
ATOM   4750  N  N     . LEU B 2 483 ? -16.284 -2.158  -46.984  1.00 2.16  ? 483 LEU B N     1 
ATOM   4751  C  CA    . LEU B 2 483 ? -17.197 -0.966  -46.874  1.00 10.51 ? 483 LEU B CA    1 
ATOM   4752  C  C     . LEU B 2 483 ? -18.662 -1.282  -47.137  1.00 2.00  ? 483 LEU B C     1 
ATOM   4753  O  O     . LEU B 2 483 ? -18.961 -1.729  -48.188  1.00 5.71  ? 483 LEU B O     1 
ATOM   4754  C  CB    . LEU B 2 483 ? -16.803 0.190   -47.788  1.00 3.72  ? 483 LEU B CB    1 
ATOM   4755  C  CG    . LEU B 2 483 ? -16.796 1.535   -47.066  1.00 15.10 ? 483 LEU B CG    1 
ATOM   4756  C  CD1   . LEU B 2 483 ? -16.674 2.663   -48.081  1.00 13.66 ? 483 LEU B CD1   1 
ATOM   4757  C  CD2   . LEU B 2 483 ? -17.795 1.793   -45.930  1.00 3.97  ? 483 LEU B CD2   1 
ATOM   4758  N  N     . ARG B 2 484 ? -19.585 -0.980  -46.242  1.00 2.00  ? 484 ARG B N     1 
ATOM   4759  C  CA    . ARG B 2 484 ? -21.001 -1.111  -46.571  1.00 2.00  ? 484 ARG B CA    1 
ATOM   4760  C  C     . ARG B 2 484 ? -21.705 0.234   -46.762  1.00 10.58 ? 484 ARG B C     1 
ATOM   4761  O  O     . ARG B 2 484 ? -22.557 0.399   -47.653  1.00 8.42  ? 484 ARG B O     1 
ATOM   4762  C  CB    . ARG B 2 484 ? -21.687 -1.893  -45.442  1.00 2.00  ? 484 ARG B CB    1 
ATOM   4763  C  CG    . ARG B 2 484 ? -21.140 -3.360  -45.422  1.00 7.40  ? 484 ARG B CG    1 
ATOM   4764  C  CD    . ARG B 2 484 ? -21.840 -4.220  -44.288  1.00 4.35  ? 484 ARG B CD    1 
ATOM   4765  N  NE    . ARG B 2 484 ? -23.178 -3.707  -44.053  1.00 24.10 ? 484 ARG B NE    1 
ATOM   4766  C  CZ    . ARG B 2 484 ? -23.589 -3.193  -42.891  1.00 19.08 ? 484 ARG B CZ    1 
ATOM   4767  N  NH1   . ARG B 2 484 ? -22.753 -3.125  -41.862  1.00 3.80  ? 484 ARG B NH1   1 
ATOM   4768  N  NH2   . ARG B 2 484 ? -24.836 -2.724  -42.749  1.00 10.83 ? 484 ARG B NH2   1 
ATOM   4769  N  N     . LYS B 2 485 ? -21.373 1.175   -45.860  1.00 9.18  ? 485 LYS B N     1 
ATOM   4770  C  CA    . LYS B 2 485 ? -21.998 2.519   -45.770  1.00 5.31  ? 485 LYS B CA    1 
ATOM   4771  C  C     . LYS B 2 485 ? -20.871 3.563   -45.635  1.00 12.23 ? 485 LYS B C     1 
ATOM   4772  O  O     . LYS B 2 485 ? -19.958 3.480   -44.690  1.00 10.99 ? 485 LYS B O     1 
ATOM   4773  C  CB    . LYS B 2 485 ? -22.909 2.601   -44.584  1.00 2.00  ? 485 LYS B CB    1 
ATOM   4774  C  CG    . LYS B 2 485 ? -24.328 2.084   -44.846  1.00 2.01  ? 485 LYS B CG    1 
ATOM   4775  C  CD    . LYS B 2 485 ? -25.169 1.920   -43.503  1.00 2.00  ? 485 LYS B CD    1 
ATOM   4776  C  CE    . LYS B 2 485 ? -24.493 0.912   -42.564  1.00 2.00  ? 485 LYS B CE    1 
ATOM   4777  N  NZ    . LYS B 2 485 ? -25.330 0.599   -41.322  1.00 2.46  ? 485 LYS B NZ    1 
ATOM   4778  N  N     . LEU B 2 486 ? -20.853 4.438   -46.640  1.00 2.00  ? 486 LEU B N     1 
ATOM   4779  C  CA    . LEU B 2 486 ? -19.918 5.576   -46.726  1.00 5.38  ? 486 LEU B CA    1 
ATOM   4780  C  C     . LEU B 2 486 ? -20.814 6.850   -46.723  1.00 17.94 ? 486 LEU B C     1 
ATOM   4781  O  O     . LEU B 2 486 ? -21.777 6.942   -47.515  1.00 11.46 ? 486 LEU B O     1 
ATOM   4782  C  CB    . LEU B 2 486 ? -19.037 5.535   -47.969  1.00 2.00  ? 486 LEU B CB    1 
ATOM   4783  C  CG    . LEU B 2 486 ? -18.026 6.709   -47.980  1.00 12.64 ? 486 LEU B CG    1 
ATOM   4784  C  CD1   . LEU B 2 486 ? -17.209 6.868   -46.613  1.00 2.00  ? 486 LEU B CD1   1 
ATOM   4785  C  CD2   . LEU B 2 486 ? -17.067 6.656   -49.161  1.00 2.00  ? 486 LEU B CD2   1 
ATOM   4786  N  N     . GLU B 2 487 ? -20.564 7.765   -45.785  1.00 3.47  ? 487 GLU B N     1 
ATOM   4787  C  CA    . GLU B 2 487 ? -21.386 8.994   -45.667  1.00 14.93 ? 487 GLU B CA    1 
ATOM   4788  C  C     . GLU B 2 487 ? -20.497 10.179  -45.297  1.00 14.26 ? 487 GLU B C     1 
ATOM   4789  O  O     . GLU B 2 487 ? -19.825 10.146  -44.253  1.00 7.29  ? 487 GLU B O     1 
ATOM   4790  C  CB    . GLU B 2 487 ? -22.520 8.914   -44.639  1.00 2.00  ? 487 GLU B CB    1 
ATOM   4791  C  CG    . GLU B 2 487 ? -22.062 8.584   -43.250  1.00 2.25  ? 487 GLU B CG    1 
ATOM   4792  C  CD    . GLU B 2 487 ? -23.207 8.159   -42.386  1.00 2.00  ? 487 GLU B CD    1 
ATOM   4793  O  OE1   . GLU B 2 487 ? -23.159 8.233   -41.155  1.00 4.67  ? 487 GLU B OE1   1 
ATOM   4794  O  OE2   . GLU B 2 487 ? -24.241 7.761   -42.927  1.00 26.71 ? 487 GLU B OE2   1 
ATOM   4795  N  N     . ILE B 2 488 ? -20.548 11.202  -46.165  1.00 7.96  ? 488 ILE B N     1 
ATOM   4796  C  CA    . ILE B 2 488 ? -19.587 12.277  -46.280  1.00 4.12  ? 488 ILE B CA    1 
ATOM   4797  C  C     . ILE B 2 488 ? -20.281 13.590  -46.527  1.00 3.58  ? 488 ILE B C     1 
ATOM   4798  O  O     . ILE B 2 488 ? -21.047 13.723  -47.504  1.00 7.13  ? 488 ILE B O     1 
ATOM   4799  C  CB    . ILE B 2 488 ? -18.799 12.077  -47.496  1.00 2.03  ? 488 ILE B CB    1 
ATOM   4800  C  CG1   . ILE B 2 488 ? -18.186 10.667  -47.379  1.00 8.45  ? 488 ILE B CG1   1 
ATOM   4801  C  CG2   . ILE B 2 488 ? -17.671 13.075  -47.483  1.00 2.00  ? 488 ILE B CG2   1 
ATOM   4802  C  CD1   . ILE B 2 488 ? -17.314 10.235  -48.597  1.00 8.53  ? 488 ILE B CD1   1 
ATOM   4803  N  N     . ARG B 2 489 ? -19.950 14.572  -45.694  1.00 4.67  ? 489 ARG B N     1 
ATOM   4804  C  CA    . ARG B 2 489 ? -20.405 15.958  -45.860  1.00 2.49  ? 489 ARG B CA    1 
ATOM   4805  C  C     . ARG B 2 489 ? -19.217 16.911  -45.854  1.00 14.26 ? 489 ARG B C     1 
ATOM   4806  O  O     . ARG B 2 489 ? -18.264 16.752  -45.024  1.00 8.01  ? 489 ARG B O     1 
ATOM   4807  C  CB    . ARG B 2 489 ? -21.488 16.281  -44.861  1.00 8.61  ? 489 ARG B CB    1 
ATOM   4808  C  CG    . ARG B 2 489 ? -21.012 16.259  -43.425  1.00 3.04  ? 489 ARG B CG    1 
ATOM   4809  C  CD    . ARG B 2 489 ? -20.878 17.629  -43.008  1.00 3.27  ? 489 ARG B CD    1 
ATOM   4810  N  NE    . ARG B 2 489 ? -21.980 17.824  -42.157  1.00 2.76  ? 489 ARG B NE    1 
ATOM   4811  C  CZ    . ARG B 2 489 ? -22.595 19.000  -41.940  1.00 18.07 ? 489 ARG B CZ    1 
ATOM   4812  N  NH1   . ARG B 2 489 ? -22.213 20.101  -42.551  1.00 2.00  ? 489 ARG B NH1   1 
ATOM   4813  N  NH2   . ARG B 2 489 ? -23.650 19.046  -41.100  1.00 3.44  ? 489 ARG B NH2   1 
ATOM   4814  N  N     . ASP B 2 490 ? -19.230 17.835  -46.833  1.00 3.00  ? 490 ASP B N     1 
ATOM   4815  C  CA    . ASP B 2 490 ? -18.523 19.090  -46.705  1.00 2.00  ? 490 ASP B CA    1 
ATOM   4816  C  C     . ASP B 2 490 ? -17.026 18.797  -46.902  1.00 2.00  ? 490 ASP B C     1 
ATOM   4817  O  O     . ASP B 2 490 ? -16.148 19.268  -46.118  1.00 2.71  ? 490 ASP B O     1 
ATOM   4818  C  CB    . ASP B 2 490 ? -18.781 19.697  -45.325  1.00 2.00  ? 490 ASP B CB    1 
ATOM   4819  C  CG    . ASP B 2 490 ? -20.123 20.395  -45.228  1.00 2.00  ? 490 ASP B CG    1 
ATOM   4820  O  OD1   . ASP B 2 490 ? -20.262 21.415  -45.931  1.00 5.31  ? 490 ASP B OD1   1 
ATOM   4821  O  OD2   . ASP B 2 490 ? -21.066 19.963  -44.480  1.00 2.97  ? 490 ASP B OD2   1 
ATOM   4822  N  N     . CYS B 2 491 ? -16.703 18.047  -47.952  1.00 2.00  ? 491 CYS B N     1 
ATOM   4823  C  CA    . CYS B 2 491 ? -15.305 17.661  -48.248  1.00 2.00  ? 491 CYS B CA    1 
ATOM   4824  C  C     . CYS B 2 491 ? -15.044 17.861  -49.681  1.00 2.50  ? 491 CYS B C     1 
ATOM   4825  O  O     . CYS B 2 491 ? -15.959 17.667  -50.483  1.00 4.67  ? 491 CYS B O     1 
ATOM   4826  C  CB    . CYS B 2 491 ? -15.067 16.116  -48.060  1.00 2.00  ? 491 CYS B CB    1 
ATOM   4827  S  SG    . CYS B 2 491 ? -15.101 15.583  -46.289  1.00 5.96  ? 491 CYS B SG    1 
ATOM   4828  N  N     . PRO B 2 492 ? -13.763 18.126  -50.022  1.00 3.31  ? 492 PRO B N     1 
ATOM   4829  C  CA    . PRO B 2 492 ? -13.449 18.308  -51.449  1.00 2.00  ? 492 PRO B CA    1 
ATOM   4830  C  C     . PRO B 2 492 ? -13.395 17.037  -52.294  1.00 2.00  ? 492 PRO B C     1 
ATOM   4831  O  O     . PRO B 2 492 ? -12.394 16.797  -52.951  1.00 2.90  ? 492 PRO B O     1 
ATOM   4832  C  CB    . PRO B 2 492 ? -12.058 19.052  -51.438  1.00 2.00  ? 492 PRO B CB    1 
ATOM   4833  C  CG    . PRO B 2 492 ? -11.491 18.881  -50.014  1.00 2.00  ? 492 PRO B CG    1 
ATOM   4834  C  CD    . PRO B 2 492 ? -12.597 18.354  -49.105  1.00 2.00  ? 492 PRO B CD    1 
ATOM   4835  N  N     . PHE B 2 493 ? -14.457 16.239  -52.291  1.00 12.23 ? 493 PHE B N     1 
ATOM   4836  C  CA    . PHE B 2 493 ? -14.514 14.890  -52.984  1.00 3.59  ? 493 PHE B CA    1 
ATOM   4837  C  C     . PHE B 2 493 ? -15.580 15.102  -54.051  1.00 7.46  ? 493 PHE B C     1 
ATOM   4838  O  O     . PHE B 2 493 ? -16.618 15.736  -53.774  1.00 8.50  ? 493 PHE B O     1 
ATOM   4839  C  CB    . PHE B 2 493 ? -14.984 13.824  -51.954  1.00 12.18 ? 493 PHE B CB    1 
ATOM   4840  C  CG    . PHE B 2 493 ? -13.967 13.572  -50.851  1.00 2.88  ? 493 PHE B CG    1 
ATOM   4841  C  CD1   . PHE B 2 493 ? -14.339 12.957  -49.665  1.00 8.10  ? 493 PHE B CD1   1 
ATOM   4842  C  CD2   . PHE B 2 493 ? -12.622 13.989  -51.026  1.00 2.70  ? 493 PHE B CD2   1 
ATOM   4843  C  CE1   . PHE B 2 493 ? -13.396 12.741  -48.642  1.00 2.00  ? 493 PHE B CE1   1 
ATOM   4844  C  CE2   . PHE B 2 493 ? -11.682 13.789  -50.058  1.00 2.00  ? 493 PHE B CE2   1 
ATOM   4845  C  CZ    . PHE B 2 493 ? -12.074 13.161  -48.848  1.00 8.68  ? 493 PHE B CZ    1 
ATOM   4846  N  N     . GLY B 2 494 ? -15.290 14.711  -55.284  1.00 3.41  ? 494 GLY B N     1 
ATOM   4847  C  CA    . GLY B 2 494 ? -16.198 15.004  -56.426  1.00 2.82  ? 494 GLY B CA    1 
ATOM   4848  C  C     . GLY B 2 494 ? -16.179 13.881  -57.480  1.00 9.87  ? 494 GLY B C     1 
ATOM   4849  O  O     . GLY B 2 494 ? -16.252 12.679  -57.163  1.00 17.31 ? 494 GLY B O     1 
ATOM   4850  N  N     . ASP B 2 495 ? -16.045 14.281  -58.727  1.00 4.00  ? 495 ASP B N     1 
ATOM   4851  C  CA    . ASP B 2 495 ? -16.494 13.547  -59.904  1.00 5.12  ? 495 ASP B CA    1 
ATOM   4852  C  C     . ASP B 2 495 ? -15.412 12.475  -60.152  1.00 5.35  ? 495 ASP B C     1 
ATOM   4853  O  O     . ASP B 2 495 ? -15.688 11.330  -60.522  1.00 15.71 ? 495 ASP B O     1 
ATOM   4854  C  CB    . ASP B 2 495 ? -16.450 14.521  -61.120  1.00 2.00  ? 495 ASP B CB    1 
ATOM   4855  C  CG    . ASP B 2 495 ? -17.518 15.626  -61.058  1.00 3.36  ? 495 ASP B CG    1 
ATOM   4856  O  OD1   . ASP B 2 495 ? -18.134 15.759  -60.010  1.00 5.63  ? 495 ASP B OD1   1 
ATOM   4857  O  OD2   . ASP B 2 495 ? -17.786 16.373  -62.068  1.00 7.93  ? 495 ASP B OD2   1 
ATOM   4858  N  N     . LYS B 2 496 ? -14.171 12.904  -60.044  1.00 9.60  ? 496 LYS B N     1 
ATOM   4859  C  CA    . LYS B 2 496 ? -13.030 12.109  -60.433  1.00 7.88  ? 496 LYS B CA    1 
ATOM   4860  C  C     . LYS B 2 496 ? -12.931 10.836  -59.528  1.00 7.44  ? 496 LYS B C     1 
ATOM   4861  O  O     . LYS B 2 496 ? -12.845 9.735   -60.046  1.00 7.05  ? 496 LYS B O     1 
ATOM   4862  C  CB    . LYS B 2 496 ? -11.811 12.981  -60.314  1.00 2.91  ? 496 LYS B CB    1 
ATOM   4863  C  CG    . LYS B 2 496 ? -11.847 14.090  -61.285  1.00 2.00  ? 496 LYS B CG    1 
ATOM   4864  C  CD    . LYS B 2 496 ? -10.406 14.630  -61.596  1.00 8.52  ? 496 LYS B CD    1 
ATOM   4865  C  CE    . LYS B 2 496 ? -9.744  15.326  -60.383  1.00 2.00  ? 496 LYS B CE    1 
ATOM   4866  N  NZ    . LYS B 2 496 ? -10.747 16.034  -59.582  1.00 2.00  ? 496 LYS B NZ    1 
ATOM   4867  N  N     . ALA B 2 497 ? -13.003 10.961  -58.193  1.00 12.50 ? 497 ALA B N     1 
ATOM   4868  C  CA    . ALA B 2 497 ? -12.920 9.778   -57.360  1.00 2.00  ? 497 ALA B CA    1 
ATOM   4869  C  C     . ALA B 2 497 ? -14.212 8.959   -57.423  1.00 8.06  ? 497 ALA B C     1 
ATOM   4870  O  O     . ALA B 2 497 ? -14.237 7.734   -57.288  1.00 12.40 ? 497 ALA B O     1 
ATOM   4871  C  CB    . ALA B 2 497 ? -12.588 10.161  -55.929  1.00 6.83  ? 497 ALA B CB    1 
ATOM   4872  N  N     . LEU B 2 498 ? -15.324 9.623   -57.654  1.00 14.89 ? 498 LEU B N     1 
ATOM   4873  C  CA    . LEU B 2 498 ? -16.590 8.932   -57.603  1.00 5.36  ? 498 LEU B CA    1 
ATOM   4874  C  C     . LEU B 2 498 ? -16.688 8.020   -58.876  1.00 13.76 ? 498 LEU B C     1 
ATOM   4875  O  O     . LEU B 2 498 ? -17.104 6.868   -58.809  1.00 2.69  ? 498 LEU B O     1 
ATOM   4876  C  CB    . LEU B 2 498 ? -17.716 9.956   -57.614  1.00 2.00  ? 498 LEU B CB    1 
ATOM   4877  C  CG    . LEU B 2 498 ? -19.056 9.220   -57.699  1.00 2.00  ? 498 LEU B CG    1 
ATOM   4878  C  CD1   . LEU B 2 498 ? -19.568 8.740   -56.292  1.00 2.54  ? 498 LEU B CD1   1 
ATOM   4879  C  CD2   . LEU B 2 498 ? -20.031 10.238  -58.294  1.00 6.64  ? 498 LEU B CD2   1 
ATOM   4880  N  N     . LEU B 2 499 ? -16.382 8.562   -60.037  1.00 2.00  ? 499 LEU B N     1 
ATOM   4881  C  CA    . LEU B 2 499 ? -16.599 7.763   -61.207  1.00 4.74  ? 499 LEU B CA    1 
ATOM   4882  C  C     . LEU B 2 499 ? -15.402 6.799   -61.339  1.00 10.06 ? 499 LEU B C     1 
ATOM   4883  O  O     . LEU B 2 499 ? -15.492 5.815   -62.044  1.00 8.71  ? 499 LEU B O     1 
ATOM   4884  C  CB    . LEU B 2 499 ? -16.729 8.601   -62.495  1.00 2.00  ? 499 LEU B CB    1 
ATOM   4885  C  CG    . LEU B 2 499 ? -17.792 9.729   -62.655  1.00 6.93  ? 499 LEU B CG    1 
ATOM   4886  C  CD1   . LEU B 2 499 ? -17.448 10.709  -63.776  1.00 5.64  ? 499 LEU B CD1   1 
ATOM   4887  C  CD2   . LEU B 2 499 ? -19.159 9.167   -62.839  1.00 4.43  ? 499 LEU B CD2   1 
ATOM   4888  N  N     . ALA B 2 500 ? -14.255 7.070   -60.716  1.00 11.01 ? 500 ALA B N     1 
ATOM   4889  C  CA    . ALA B 2 500 ? -13.166 6.157   -61.033  1.00 9.25  ? 500 ALA B CA    1 
ATOM   4890  C  C     . ALA B 2 500 ? -13.400 4.867   -60.275  1.00 11.07 ? 500 ALA B C     1 
ATOM   4891  O  O     . ALA B 2 500 ? -12.806 3.824   -60.601  1.00 6.68  ? 500 ALA B O     1 
ATOM   4892  C  CB    . ALA B 2 500 ? -11.833 6.733   -60.837  1.00 2.04  ? 500 ALA B CB    1 
ATOM   4893  N  N     . ASN B 2 501 ? -14.384 4.938   -59.384  1.00 5.43  ? 501 ASN B N     1 
ATOM   4894  C  CA    . ASN B 2 501 ? -14.685 3.833   -58.490  1.00 11.93 ? 501 ASN B CA    1 
ATOM   4895  C  C     . ASN B 2 501 ? -16.124 3.438   -58.619  1.00 11.27 ? 501 ASN B C     1 
ATOM   4896  O  O     . ASN B 2 501 ? -16.761 3.088   -57.677  1.00 2.00  ? 501 ASN B O     1 
ATOM   4897  C  CB    . ASN B 2 501 ? -14.333 4.132   -57.029  1.00 8.78  ? 501 ASN B CB    1 
ATOM   4898  C  CG    . ASN B 2 501 ? -12.824 4.290   -56.842  1.00 9.17  ? 501 ASN B CG    1 
ATOM   4899  O  OD1   . ASN B 2 501 ? -12.328 5.417   -56.670  1.00 18.31 ? 501 ASN B OD1   1 
ATOM   4900  N  ND2   . ASN B 2 501 ? -12.079 3.193   -56.951  1.00 9.64  ? 501 ASN B ND2   1 
ATOM   4901  N  N     . ALA B 2 502 ? -16.634 3.519   -59.828  1.00 9.60  ? 502 ALA B N     1 
ATOM   4902  C  CA    . ALA B 2 502 ? -18.063 3.506   -59.933  1.00 4.32  ? 502 ALA B CA    1 
ATOM   4903  C  C     . ALA B 2 502 ? -18.453 2.117   -59.453  1.00 4.73  ? 502 ALA B C     1 
ATOM   4904  O  O     . ALA B 2 502 ? -19.483 1.899   -58.772  1.00 5.55  ? 502 ALA B O     1 
ATOM   4905  C  CB    . ALA B 2 502 ? -18.398 3.673   -61.373  1.00 9.88  ? 502 ALA B CB    1 
ATOM   4906  N  N     . SER B 2 503 ? -17.660 1.135   -59.832  1.00 4.17  ? 503 SER B N     1 
ATOM   4907  C  CA    . SER B 2 503 ? -18.142 -0.214  -59.649  1.00 4.95  ? 503 SER B CA    1 
ATOM   4908  C  C     . SER B 2 503 ? -18.102 -0.766  -58.191  1.00 5.35  ? 503 SER B C     1 
ATOM   4909  O  O     . SER B 2 503 ? -18.952 -1.638  -57.747  1.00 10.53 ? 503 SER B O     1 
ATOM   4910  C  CB    . SER B 2 503 ? -17.653 -1.127  -60.791  1.00 8.32  ? 503 SER B CB    1 
ATOM   4911  O  OG    . SER B 2 503 ? -16.338 -1.581  -60.518  1.00 24.70 ? 503 SER B OG    1 
ATOM   4912  N  N     . LYS B 2 504 ? -17.201 -0.199  -57.375  1.00 17.72 ? 504 LYS B N     1 
ATOM   4913  C  CA    . LYS B 2 504 ? -17.360 -0.285  -55.886  1.00 3.14  ? 504 LYS B CA    1 
ATOM   4914  C  C     . LYS B 2 504 ? -18.780 -0.143  -55.359  1.00 4.55  ? 504 LYS B C     1 
ATOM   4915  O  O     . LYS B 2 504 ? -19.120 -0.753  -54.319  1.00 2.14  ? 504 LYS B O     1 
ATOM   4916  C  CB    . LYS B 2 504 ? -16.448 0.688   -55.108  1.00 10.00 ? 504 LYS B CB    1 
ATOM   4917  C  CG    . LYS B 2 504 ? -15.598 0.032   -53.947  1.00 5.44  ? 504 LYS B CG    1 
ATOM   4918  C  CD    . LYS B 2 504 ? -16.386 -0.698  -52.914  1.00 12.41 ? 504 LYS B CD    1 
ATOM   4919  C  CE    . LYS B 2 504 ? -15.594 -0.818  -51.605  1.00 19.50 ? 504 LYS B CE    1 
ATOM   4920  N  NZ    . LYS B 2 504 ? -14.924 -2.127  -51.221  1.00 2.61  ? 504 LYS B NZ    1 
ATOM   4921  N  N     . LEU B 2 505 ? -19.607 0.679   -56.022  1.00 2.50  ? 505 LEU B N     1 
ATOM   4922  C  CA    . LEU B 2 505 ? -20.843 1.145   -55.375  1.00 2.00  ? 505 LEU B CA    1 
ATOM   4923  C  C     . LEU B 2 505 ? -21.798 -0.041  -55.333  1.00 2.09  ? 505 LEU B C     1 
ATOM   4924  O  O     . LEU B 2 505 ? -22.652 -0.121  -54.465  1.00 9.55  ? 505 LEU B O     1 
ATOM   4925  C  CB    . LEU B 2 505 ? -21.448 2.358   -56.177  1.00 2.00  ? 505 LEU B CB    1 
ATOM   4926  C  CG    . LEU B 2 505 ? -20.535 3.614   -56.164  1.00 8.71  ? 505 LEU B CG    1 
ATOM   4927  C  CD1   . LEU B 2 505 ? -20.996 4.793   -56.981  1.00 2.00  ? 505 LEU B CD1   1 
ATOM   4928  C  CD2   . LEU B 2 505 ? -20.189 4.088   -54.730  1.00 5.95  ? 505 LEU B CD2   1 
ATOM   4929  N  N     . GLU B 2 506 ? -21.677 -0.954  -56.305  1.00 11.65 ? 506 GLU B N     1 
ATOM   4930  C  CA    . GLU B 2 506 ? -22.511 -2.165  -56.320  1.00 6.54  ? 506 GLU B CA    1 
ATOM   4931  C  C     . GLU B 2 506 ? -22.248 -3.105  -55.164  1.00 5.59  ? 506 GLU B C     1 
ATOM   4932  O  O     . GLU B 2 506 ? -23.062 -4.024  -54.878  1.00 5.81  ? 506 GLU B O     1 
ATOM   4933  C  CB    . GLU B 2 506 ? -22.469 -2.868  -57.659  1.00 7.47  ? 506 GLU B CB    1 
ATOM   4934  C  CG    . GLU B 2 506 ? -23.410 -2.206  -58.639  1.00 2.00  ? 506 GLU B CG    1 
ATOM   4935  C  CD    . GLU B 2 506 ? -23.435 -2.887  -59.998  1.00 10.55 ? 506 GLU B CD    1 
ATOM   4936  O  OE1   . GLU B 2 506 ? -22.457 -3.589  -60.289  1.00 11.63 ? 506 GLU B OE1   1 
ATOM   4937  O  OE2   . GLU B 2 506 ? -24.426 -2.739  -60.789  1.00 6.64  ? 506 GLU B OE2   1 
ATOM   4938  N  N     . THR B 2 507 ? -21.229 -2.799  -54.372  1.00 2.00  ? 507 THR B N     1 
ATOM   4939  C  CA    . THR B 2 507 ? -20.921 -3.706  -53.296  1.00 2.00  ? 507 THR B CA    1 
ATOM   4940  C  C     . THR B 2 507 ? -21.257 -3.193  -51.980  1.00 4.27  ? 507 THR B C     1 
ATOM   4941  O  O     . THR B 2 507 ? -20.787 -3.763  -51.022  1.00 2.00  ? 507 THR B O     1 
ATOM   4942  C  CB    . THR B 2 507 ? -19.469 -4.078  -53.194  1.00 2.00  ? 507 THR B CB    1 
ATOM   4943  O  OG1   . THR B 2 507 ? -18.723 -2.983  -52.614  1.00 2.00  ? 507 THR B OG1   1 
ATOM   4944  C  CG2   . THR B 2 507 ? -18.917 -4.561  -54.593  1.00 2.00  ? 507 THR B CG2   1 
ATOM   4945  N  N     . MET B 2 508 ? -22.016 -2.090  -51.927  1.00 2.25  ? 508 MET B N     1 
ATOM   4946  C  CA    . MET B 2 508 ? -22.076 -1.258  -50.740  1.00 2.00  ? 508 MET B CA    1 
ATOM   4947  C  C     . MET B 2 508 ? -23.547 -1.044  -50.543  1.00 2.00  ? 508 MET B C     1 
ATOM   4948  O  O     . MET B 2 508 ? -24.290 -1.038  -51.498  1.00 6.83  ? 508 MET B O     1 
ATOM   4949  C  CB    . MET B 2 508 ? -21.388 0.064   -51.051  1.00 2.00  ? 508 MET B CB    1 
ATOM   4950  C  CG    . MET B 2 508 ? -19.933 0.041   -50.828  1.00 2.00  ? 508 MET B CG    1 
ATOM   4951  S  SD    . MET B 2 508 ? -19.326 1.641   -51.367  1.00 5.66  ? 508 MET B SD    1 
ATOM   4952  C  CE    . MET B 2 508 ? -19.802 2.757   -49.959  1.00 2.00  ? 508 MET B CE    1 
ATOM   4953  N  N     . ARG B 2 509 ? -24.045 -0.876  -49.348  1.00 2.00  ? 509 ARG B N     1 
ATOM   4954  C  CA    . ARG B 2 509 ? -25.483 -0.511  -49.315  1.00 4.44  ? 509 ARG B CA    1 
ATOM   4955  C  C     . ARG B 2 509 ? -25.811 0.914   -49.924  1.00 13.36 ? 509 ARG B C     1 
ATOM   4956  O  O     . ARG B 2 509 ? -26.750 0.998   -50.698  1.00 6.49  ? 509 ARG B O     1 
ATOM   4957  C  CB    . ARG B 2 509 ? -26.135 -0.686  -47.948  1.00 2.00  ? 509 ARG B CB    1 
ATOM   4958  C  CG    . ARG B 2 509 ? -27.320 0.213   -47.924  1.00 3.24  ? 509 ARG B CG    1 
ATOM   4959  C  CD    . ARG B 2 509 ? -27.829 0.492   -46.478  1.00 6.86  ? 509 ARG B CD    1 
ATOM   4960  N  NE    . ARG B 2 509 ? -27.913 -0.727  -45.661  1.00 2.32  ? 509 ARG B NE    1 
ATOM   4961  C  CZ    . ARG B 2 509 ? -28.165 -0.726  -44.352  1.00 5.98  ? 509 ARG B CZ    1 
ATOM   4962  N  NH1   . ARG B 2 509 ? -28.288 0.458   -43.660  1.00 11.75 ? 509 ARG B NH1   1 
ATOM   4963  N  NH2   . ARG B 2 509 ? -28.241 -1.895  -43.723  1.00 4.46  ? 509 ARG B NH2   1 
ATOM   4964  N  N     . SER B 2 510 ? -25.042 1.984   -49.575  1.00 5.65  ? 510 SER B N     1 
ATOM   4965  C  CA    . SER B 2 510 ? -25.334 3.400   -49.913  1.00 2.00  ? 510 SER B CA    1 
ATOM   4966  C  C     . SER B 2 510 ? -24.066 4.226   -49.867  1.00 2.65  ? 510 SER B C     1 
ATOM   4967  O  O     . SER B 2 510 ? -23.224 3.914   -49.071  1.00 6.22  ? 510 SER B O     1 
ATOM   4968  C  CB    . SER B 2 510 ? -26.469 3.996   -49.036  1.00 2.88  ? 510 SER B CB    1 
ATOM   4969  O  OG    . SER B 2 510 ? -26.168 4.111   -47.649  1.00 2.00  ? 510 SER B OG    1 
ATOM   4970  N  N     . LEU B 2 511 ? -23.866 5.201   -50.785  1.00 13.52 ? 511 LEU B N     1 
ATOM   4971  C  CA    . LEU B 2 511 ? -22.963 6.399   -50.595  1.00 5.15  ? 511 LEU B CA    1 
ATOM   4972  C  C     . LEU B 2 511 ? -23.848 7.634   -50.401  1.00 12.86 ? 511 LEU B C     1 
ATOM   4973  O  O     . LEU B 2 511 ? -24.599 7.969   -51.330  1.00 2.28  ? 511 LEU B O     1 
ATOM   4974  C  CB    . LEU B 2 511 ? -22.177 6.658   -51.866  1.00 4.90  ? 511 LEU B CB    1 
ATOM   4975  C  CG    . LEU B 2 511 ? -21.123 7.752   -51.931  1.00 9.18  ? 511 LEU B CG    1 
ATOM   4976  C  CD1   . LEU B 2 511 ? -20.087 7.630   -50.887  1.00 3.27  ? 511 LEU B CD1   1 
ATOM   4977  C  CD2   . LEU B 2 511 ? -20.449 7.853   -53.285  1.00 9.07  ? 511 LEU B CD2   1 
ATOM   4978  N  N     . TRP B 2 512 ? -23.774 8.284   -49.230  1.00 2.00  ? 512 TRP B N     1 
ATOM   4979  C  CA    . TRP B 2 512 ? -24.132 9.712   -49.073  1.00 2.01  ? 512 TRP B CA    1 
ATOM   4980  C  C     . TRP B 2 512 ? -23.028 10.769  -49.263  1.00 7.84  ? 512 TRP B C     1 
ATOM   4981  O  O     . TRP B 2 512 ? -21.974 10.731  -48.550  1.00 6.86  ? 512 TRP B O     1 
ATOM   4982  C  CB    . TRP B 2 512 ? -24.736 9.894   -47.683  1.00 4.91  ? 512 TRP B CB    1 
ATOM   4983  C  CG    . TRP B 2 512 ? -25.216 11.236  -47.475  1.00 18.60 ? 512 TRP B CG    1 
ATOM   4984  C  CD1   . TRP B 2 512 ? -24.459 12.348  -47.126  1.00 8.26  ? 512 TRP B CD1   1 
ATOM   4985  C  CD2   . TRP B 2 512 ? -26.554 11.677  -47.634  1.00 14.34 ? 512 TRP B CD2   1 
ATOM   4986  N  NE1   . TRP B 2 512 ? -25.264 13.439  -47.107  1.00 2.94  ? 512 TRP B NE1   1 
ATOM   4987  C  CE2   . TRP B 2 512 ? -26.552 13.081  -47.425  1.00 18.65 ? 512 TRP B CE2   1 
ATOM   4988  C  CE3   . TRP B 2 512 ? -27.740 11.053  -48.023  1.00 4.42  ? 512 TRP B CE3   1 
ATOM   4989  C  CZ2   . TRP B 2 512 ? -27.731 13.883  -47.530  1.00 2.00  ? 512 TRP B CZ2   1 
ATOM   4990  C  CZ3   . TRP B 2 512 ? -28.931 11.858  -48.133  1.00 7.25  ? 512 TRP B CZ3   1 
ATOM   4991  C  CH2   . TRP B 2 512 ? -28.891 13.274  -47.880  1.00 5.48  ? 512 TRP B CH2   1 
ATOM   4992  N  N     . MET B 2 513 ? -23.252 11.735  -50.164  1.00 5.75  ? 513 MET B N     1 
ATOM   4993  C  CA    . MET B 2 513 ? -22.343 12.977  -50.289  1.00 4.11  ? 513 MET B CA    1 
ATOM   4994  C  C     . MET B 2 513 ? -23.107 14.337  -50.357  1.00 8.60  ? 513 MET B C     1 
ATOM   4995  O  O     . MET B 2 513 ? -23.749 14.694  -51.387  1.00 2.46  ? 513 MET B O     1 
ATOM   4996  C  CB    . MET B 2 513 ? -21.434 12.840  -51.499  1.00 2.00  ? 513 MET B CB    1 
ATOM   4997  C  CG    . MET B 2 513 ? -20.495 11.627  -51.467  1.00 2.00  ? 513 MET B CG    1 
ATOM   4998  S  SD    . MET B 2 513 ? -19.537 11.529  -53.029  1.00 3.96  ? 513 MET B SD    1 
ATOM   4999  C  CE    . MET B 2 513 ? -18.208 12.790  -52.889  1.00 5.49  ? 513 MET B CE    1 
ATOM   5000  N  N     . SER B 2 514 ? -23.102 15.090  -49.267  1.00 4.56  ? 514 SER B N     1 
ATOM   5001  C  CA    . SER B 2 514 ? -23.730 16.446  -49.294  1.00 2.00  ? 514 SER B CA    1 
ATOM   5002  C  C     . SER B 2 514 ? -22.646 17.596  -49.099  1.00 14.47 ? 514 SER B C     1 
ATOM   5003  O  O     . SER B 2 514 ? -21.641 17.492  -48.305  1.00 6.06  ? 514 SER B O     1 
ATOM   5004  C  CB    . SER B 2 514 ? -24.800 16.495  -48.222  1.00 2.00  ? 514 SER B CB    1 
ATOM   5005  O  OG    . SER B 2 514 ? -24.209 16.158  -46.969  1.00 2.00  ? 514 SER B OG    1 
ATOM   5006  N  N     . SER B 2 515 ? -22.841 18.664  -49.870  1.00 4.90  ? 515 SER B N     1 
ATOM   5007  C  CA    . SER B 2 515 ? -21.925 19.762  -49.952  1.00 2.00  ? 515 SER B CA    1 
ATOM   5008  C  C     . SER B 2 515 ? -20.601 19.280  -50.298  1.00 2.00  ? 515 SER B C     1 
ATOM   5009  O  O     . SER B 2 515 ? -19.642 19.677  -49.645  1.00 3.92  ? 515 SER B O     1 
ATOM   5010  C  CB    . SER B 2 515 ? -21.766 20.513  -48.594  1.00 2.00  ? 515 SER B CB    1 
ATOM   5011  O  OG    . SER B 2 515 ? -23.012 20.902  -48.048  1.00 2.00  ? 515 SER B OG    1 
ATOM   5012  N  N     . CYS B 2 516 ? -20.454 18.445  -51.303  1.00 5.12  ? 516 CYS B N     1 
ATOM   5013  C  CA    . CYS B 2 516 ? -19.079 18.171  -51.694  1.00 3.93  ? 516 CYS B CA    1 
ATOM   5014  C  C     . CYS B 2 516 ? -18.891 18.869  -53.011  1.00 6.26  ? 516 CYS B C     1 
ATOM   5015  O  O     . CYS B 2 516 ? -19.643 19.763  -53.295  1.00 11.60 ? 516 CYS B O     1 
ATOM   5016  C  CB    . CYS B 2 516 ? -18.800 16.681  -51.746  1.00 2.15  ? 516 CYS B CB    1 
ATOM   5017  S  SG    . CYS B 2 516 ? -18.838 15.963  -50.054  1.00 4.15  ? 516 CYS B SG    1 
ATOM   5018  N  N     . SER B 2 517 ? -17.933 18.458  -53.830  1.00 13.00 ? 517 SER B N     1 
ATOM   5019  C  CA    . SER B 2 517 ? -17.931 18.952  -55.206  1.00 12.35 ? 517 SER B CA    1 
ATOM   5020  C  C     . SER B 2 517 ? -18.367 17.948  -56.247  1.00 11.93 ? 517 SER B C     1 
ATOM   5021  O  O     . SER B 2 517 ? -17.687 17.856  -57.235  1.00 3.85  ? 517 SER B O     1 
ATOM   5022  C  CB    . SER B 2 517 ? -16.527 19.413  -55.592  1.00 2.53  ? 517 SER B CB    1 
ATOM   5023  O  OG    . SER B 2 517 ? -15.786 19.740  -54.423  1.00 16.04 ? 517 SER B OG    1 
ATOM   5024  N  N     . VAL B 2 518 ? -19.485 17.236  -56.086  1.00 2.49  ? 518 VAL B N     1 
ATOM   5025  C  CA    . VAL B 2 518 ? -20.006 16.431  -57.228  1.00 3.52  ? 518 VAL B CA    1 
ATOM   5026  C  C     . VAL B 2 518 ? -20.869 17.220  -58.258  1.00 8.82  ? 518 VAL B C     1 
ATOM   5027  O  O     . VAL B 2 518 ? -21.964 17.692  -57.936  1.00 2.00  ? 518 VAL B O     1 
ATOM   5028  C  CB    . VAL B 2 518 ? -20.797 15.216  -56.725  1.00 2.77  ? 518 VAL B CB    1 
ATOM   5029  C  CG1   . VAL B 2 518 ? -21.258 14.346  -57.895  1.00 2.00  ? 518 VAL B CG1   1 
ATOM   5030  C  CG2   . VAL B 2 518 ? -19.916 14.431  -55.806  1.00 2.05  ? 518 VAL B CG2   1 
ATOM   5031  N  N     . SER B 2 519 ? -20.387 17.346  -59.509  1.00 11.51 ? 519 SER B N     1 
ATOM   5032  C  CA    . SER B 2 519 ? -21.156 18.096  -60.505  1.00 5.83  ? 519 SER B CA    1 
ATOM   5033  C  C     . SER B 2 519 ? -22.438 17.336  -60.811  1.00 7.08  ? 519 SER B C     1 
ATOM   5034  O  O     . SER B 2 519 ? -22.479 16.117  -60.658  1.00 16.71 ? 519 SER B O     1 
ATOM   5035  C  CB    . SER B 2 519 ? -20.371 18.372  -61.771  1.00 2.00  ? 519 SER B CB    1 
ATOM   5036  O  OG    . SER B 2 519 ? -20.176 17.159  -62.485  1.00 5.59  ? 519 SER B OG    1 
ATOM   5037  N  N     . PHE B 2 520 ? -23.476 18.056  -61.259  1.00 6.11  ? 520 PHE B N     1 
ATOM   5038  C  CA    . PHE B 2 520 ? -24.653 17.430  -61.811  1.00 2.00  ? 520 PHE B CA    1 
ATOM   5039  C  C     . PHE B 2 520 ? -24.215 16.536  -62.993  1.00 2.00  ? 520 PHE B C     1 
ATOM   5040  O  O     . PHE B 2 520 ? -24.729 15.455  -63.175  1.00 2.00  ? 520 PHE B O     1 
ATOM   5041  C  CB    . PHE B 2 520 ? -25.648 18.510  -62.227  1.00 2.00  ? 520 PHE B CB    1 
ATOM   5042  C  CG    . PHE B 2 520 ? -26.846 17.997  -62.975  1.00 2.00  ? 520 PHE B CG    1 
ATOM   5043  C  CD1   . PHE B 2 520 ? -27.684 17.014  -62.410  1.00 6.32  ? 520 PHE B CD1   1 
ATOM   5044  C  CD2   . PHE B 2 520 ? -27.191 18.521  -64.243  1.00 16.65 ? 520 PHE B CD2   1 
ATOM   5045  C  CE1   . PHE B 2 520 ? -28.847 16.554  -63.159  1.00 12.37 ? 520 PHE B CE1   1 
ATOM   5046  C  CE2   . PHE B 2 520 ? -28.385 18.091  -64.987  1.00 2.00  ? 520 PHE B CE2   1 
ATOM   5047  C  CZ    . PHE B 2 520 ? -29.174 17.112  -64.463  1.00 2.00  ? 520 PHE B CZ    1 
ATOM   5048  N  N     . GLY B 2 521 ? -23.305 17.002  -63.817  1.00 2.00  ? 521 GLY B N     1 
ATOM   5049  C  CA    . GLY B 2 521 ? -22.914 16.178  -64.983  1.00 3.86  ? 521 GLY B CA    1 
ATOM   5050  C  C     . GLY B 2 521 ? -22.377 14.763  -64.607  1.00 12.33 ? 521 GLY B C     1 
ATOM   5051  O  O     . GLY B 2 521 ? -22.658 13.810  -65.272  1.00 3.14  ? 521 GLY B O     1 
ATOM   5052  N  N     . ALA B 2 522 ? -21.593 14.643  -63.530  1.00 11.60 ? 522 ALA B N     1 
ATOM   5053  C  CA    . ALA B 2 522 ? -21.061 13.358  -63.101  1.00 4.70  ? 522 ALA B CA    1 
ATOM   5054  C  C     . ALA B 2 522 ? -22.198 12.530  -62.544  1.00 2.00  ? 522 ALA B C     1 
ATOM   5055  O  O     . ALA B 2 522 ? -22.266 11.355  -62.809  1.00 2.00  ? 522 ALA B O     1 
ATOM   5056  C  CB    . ALA B 2 522 ? -19.989 13.534  -62.059  1.00 2.00  ? 522 ALA B CB    1 
ATOM   5057  N  N     . CYS B 2 523 ? -23.130 13.149  -61.826  1.00 5.54  ? 523 CYS B N     1 
ATOM   5058  C  CA    . CYS B 2 523 ? -24.366 12.464  -61.478  1.00 2.69  ? 523 CYS B CA    1 
ATOM   5059  C  C     . CYS B 2 523 ? -25.081 11.833  -62.739  1.00 6.96  ? 523 CYS B C     1 
ATOM   5060  O  O     . CYS B 2 523 ? -25.492 10.680  -62.672  1.00 3.94  ? 523 CYS B O     1 
ATOM   5061  C  CB    . CYS B 2 523 ? -25.316 13.365  -60.680  1.00 3.08  ? 523 CYS B CB    1 
ATOM   5062  S  SG    . CYS B 2 523 ? -24.900 13.652  -58.998  1.00 4.06  ? 523 CYS B SG    1 
ATOM   5063  N  N     . LYS B 2 524 ? -25.210 12.542  -63.877  1.00 4.58  ? 524 LYS B N     1 
ATOM   5064  C  CA    . LYS B 2 524 ? -25.951 11.955  -65.005  1.00 2.08  ? 524 LYS B CA    1 
ATOM   5065  C  C     . LYS B 2 524 ? -25.123 10.845  -65.612  1.00 6.08  ? 524 LYS B C     1 
ATOM   5066  O  O     . LYS B 2 524 ? -25.686 9.791   -65.962  1.00 9.93  ? 524 LYS B O     1 
ATOM   5067  C  CB    . LYS B 2 524 ? -26.206 12.940  -66.142  1.00 6.07  ? 524 LYS B CB    1 
ATOM   5068  C  CG    . LYS B 2 524 ? -27.197 14.075  -65.900  1.00 32.73 ? 524 LYS B CG    1 
ATOM   5069  C  CD    . LYS B 2 524 ? -26.823 15.274  -66.828  1.00 5.49  ? 524 LYS B CD    1 
ATOM   5070  C  CE    . LYS B 2 524 ? -26.510 14.845  -68.231  1.00 16.68 ? 524 LYS B CE    1 
ATOM   5071  N  NZ    . LYS B 2 524 ? -27.565 15.400  -69.116  1.00 18.74 ? 524 LYS B NZ    1 
ATOM   5072  N  N     . LEU B 2 525 ? -23.818 11.091  -65.835  1.00 4.45  ? 525 LEU B N     1 
ATOM   5073  C  CA    . LEU B 2 525 ? -22.916 10.031  -66.335  1.00 5.07  ? 525 LEU B CA    1 
ATOM   5074  C  C     . LEU B 2 525 ? -22.990 8.810   -65.377  1.00 8.51  ? 525 LEU B C     1 
ATOM   5075  O  O     . LEU B 2 525 ? -23.282 7.711   -65.836  1.00 2.00  ? 525 LEU B O     1 
ATOM   5076  C  CB    . LEU B 2 525 ? -21.485 10.517  -66.437  1.00 3.88  ? 525 LEU B CB    1 
ATOM   5077  C  CG    . LEU B 2 525 ? -20.728 10.072  -67.716  1.00 3.22  ? 525 LEU B CG    1 
ATOM   5078  C  CD1   . LEU B 2 525 ? -19.376 9.474   -67.552  1.00 3.26  ? 525 LEU B CD1   1 
ATOM   5079  C  CD2   . LEU B 2 525 ? -21.457 9.428   -68.801  1.00 9.63  ? 525 LEU B CD2   1 
ATOM   5080  N  N     . LEU B 2 526 ? -22.784 8.998   -64.072  1.00 2.00  ? 526 LEU B N     1 
ATOM   5081  C  CA    . LEU B 2 526 ? -22.907 7.831   -63.175  1.00 3.88  ? 526 LEU B CA    1 
ATOM   5082  C  C     . LEU B 2 526 ? -24.214 7.015   -63.366  1.00 9.03  ? 526 LEU B C     1 
ATOM   5083  O  O     . LEU B 2 526 ? -24.144 5.790   -63.463  1.00 11.37 ? 526 LEU B O     1 
ATOM   5084  C  CB    . LEU B 2 526 ? -22.646 8.136   -61.712  1.00 2.00  ? 526 LEU B CB    1 
ATOM   5085  C  CG    . LEU B 2 526 ? -22.831 6.964   -60.714  1.00 3.70  ? 526 LEU B CG    1 
ATOM   5086  C  CD1   . LEU B 2 526 ? -21.708 5.883   -60.934  1.00 7.13  ? 526 LEU B CD1   1 
ATOM   5087  C  CD2   . LEU B 2 526 ? -22.791 7.516   -59.274  1.00 2.00  ? 526 LEU B CD2   1 
ATOM   5088  N  N     . GLY B 2 527 ? -25.367 7.683   -63.529  1.00 3.26  ? 527 GLY B N     1 
ATOM   5089  C  CA    . GLY B 2 527 ? -26.665 7.050   -63.667  1.00 2.00  ? 527 GLY B CA    1 
ATOM   5090  C  C     . GLY B 2 527 ? -26.664 6.174   -64.907  1.00 9.01  ? 527 GLY B C     1 
ATOM   5091  O  O     . GLY B 2 527 ? -27.259 5.105   -64.914  1.00 7.61  ? 527 GLY B O     1 
ATOM   5092  N  N     . GLN B 2 528 ? -25.949 6.615   -65.937  1.00 2.33  ? 528 GLN B N     1 
ATOM   5093  C  CA    . GLN B 2 528 ? -25.898 5.944   -67.243  1.00 10.19 ? 528 GLN B CA    1 
ATOM   5094  C  C     . GLN B 2 528 ? -24.956 4.764   -67.185  1.00 9.52  ? 528 GLN B C     1 
ATOM   5095  O  O     . GLN B 2 528 ? -25.236 3.762   -67.811  1.00 5.23  ? 528 GLN B O     1 
ATOM   5096  C  CB    . GLN B 2 528 ? -25.261 6.845   -68.352  1.00 8.98  ? 528 GLN B CB    1 
ATOM   5097  C  CG    . GLN B 2 528 ? -26.251 7.712   -69.128  1.00 41.65 ? 528 GLN B CG    1 
ATOM   5098  C  CD    . GLN B 2 528 ? -26.614 7.091   -70.450  1.00 48.13 ? 528 GLN B CD    1 
ATOM   5099  O  OE1   . GLN B 2 528 ? -26.074 6.045   -70.818  1.00 21.98 ? 528 GLN B OE1   1 
ATOM   5100  N  NE2   . GLN B 2 528 ? -27.528 7.723   -71.176  1.00 54.94 ? 528 GLN B NE2   1 
ATOM   5101  N  N     . LYS B 2 529 ? -23.783 4.923   -66.577  1.00 5.62  ? 529 LYS B N     1 
ATOM   5102  C  CA    . LYS B 2 529 ? -22.877 3.799   -66.468  1.00 6.38  ? 529 LYS B CA    1 
ATOM   5103  C  C     . LYS B 2 529 ? -23.571 2.693   -65.663  1.00 9.01  ? 529 LYS B C     1 
ATOM   5104  O  O     . LYS B 2 529 ? -23.488 1.498   -66.030  1.00 4.26  ? 529 LYS B O     1 
ATOM   5105  C  CB    . LYS B 2 529 ? -21.584 4.163   -65.764  1.00 2.35  ? 529 LYS B CB    1 
ATOM   5106  C  CG    . LYS B 2 529 ? -20.434 3.150   -65.996  1.00 2.00  ? 529 LYS B CG    1 
ATOM   5107  C  CD    . LYS B 2 529 ? -19.333 3.402   -65.007  1.00 2.00  ? 529 LYS B CD    1 
ATOM   5108  C  CE    . LYS B 2 529 ? -18.159 2.431   -65.145  1.00 2.00  ? 529 LYS B CE    1 
ATOM   5109  N  NZ    . LYS B 2 529 ? -18.033 1.712   -66.403  1.00 5.71  ? 529 LYS B NZ    1 
ATOM   5110  N  N     . MET B 2 530 ? -24.276 3.086   -64.604  1.00 2.08  ? 530 MET B N     1 
ATOM   5111  C  CA    . MET B 2 530 ? -24.636 2.140   -63.536  1.00 2.00  ? 530 MET B CA    1 
ATOM   5112  C  C     . MET B 2 530 ? -26.118 1.998   -63.357  1.00 6.75  ? 530 MET B C     1 
ATOM   5113  O  O     . MET B 2 530 ? -26.694 2.501   -62.355  1.00 3.97  ? 530 MET B O     1 
ATOM   5114  C  CB    . MET B 2 530 ? -24.116 2.626   -62.220  1.00 2.00  ? 530 MET B CB    1 
ATOM   5115  C  CG    . MET B 2 530 ? -22.605 2.726   -62.237  1.00 11.62 ? 530 MET B CG    1 
ATOM   5116  S  SD    . MET B 2 530 ? -21.732 1.144   -62.370  1.00 11.49 ? 530 MET B SD    1 
ATOM   5117  C  CE    . MET B 2 530 ? -21.357 1.171   -64.097  1.00 27.73 ? 530 MET B CE    1 
ATOM   5118  N  N     . PRO B 2 531 ? -26.768 1.345   -64.318  1.00 2.00  ? 531 PRO B N     1 
ATOM   5119  C  CA    . PRO B 2 531 ? -28.240 1.301   -64.287  1.00 2.00  ? 531 PRO B CA    1 
ATOM   5120  C  C     . PRO B 2 531 ? -28.787 0.559   -63.080  1.00 4.74  ? 531 PRO B C     1 
ATOM   5121  O  O     . PRO B 2 531 ? -29.974 0.604   -62.804  1.00 4.83  ? 531 PRO B O     1 
ATOM   5122  C  CB    . PRO B 2 531 ? -28.636 0.569   -65.607  1.00 2.18  ? 531 PRO B CB    1 
ATOM   5123  C  CG    . PRO B 2 531 ? -27.297 -0.228  -66.050  1.00 2.04  ? 531 PRO B CG    1 
ATOM   5124  C  CD    . PRO B 2 531 ? -26.146 0.653   -65.466  1.00 2.23  ? 531 PRO B CD    1 
ATOM   5125  N  N     . LYS B 2 532 ? -27.982 -0.148  -62.327  1.00 2.28  ? 532 LYS B N     1 
ATOM   5126  C  CA    . LYS B 2 532 ? -28.603 -0.665  -61.119  1.00 2.00  ? 532 LYS B CA    1 
ATOM   5127  C  C     . LYS B 2 532 ? -28.320 0.042   -59.839  1.00 2.00  ? 532 LYS B C     1 
ATOM   5128  O  O     . LYS B 2 532 ? -28.730 -0.431  -58.759  1.00 3.19  ? 532 LYS B O     1 
ATOM   5129  C  CB    . LYS B 2 532 ? -28.396 -2.166  -60.978  1.00 5.85  ? 532 LYS B CB    1 
ATOM   5130  C  CG    . LYS B 2 532 ? -28.433 -2.833  -62.252  1.00 2.00  ? 532 LYS B CG    1 
ATOM   5131  C  CD    . LYS B 2 532 ? -27.814 -4.196  -62.090  1.00 31.69 ? 532 LYS B CD    1 
ATOM   5132  C  CE    . LYS B 2 532 ? -28.945 -5.194  -61.858  1.00 36.70 ? 532 LYS B CE    1 
ATOM   5133  N  NZ    . LYS B 2 532 ? -29.574 -5.428  -63.194  1.00 35.96 ? 532 LYS B NZ    1 
ATOM   5134  N  N     . LEU B 2 533 ? -27.634 1.163   -59.931  1.00 2.00  ? 533 LEU B N     1 
ATOM   5135  C  CA    . LEU B 2 533 ? -27.781 2.191   -58.915  1.00 8.54  ? 533 LEU B CA    1 
ATOM   5136  C  C     . LEU B 2 533 ? -28.979 3.148   -59.190  1.00 2.00  ? 533 LEU B C     1 
ATOM   5137  O  O     . LEU B 2 533 ? -29.162 3.667   -60.293  1.00 10.60 ? 533 LEU B O     1 
ATOM   5138  C  CB    . LEU B 2 533 ? -26.469 2.994   -58.804  1.00 2.00  ? 533 LEU B CB    1 
ATOM   5139  C  CG    . LEU B 2 533 ? -25.202 2.311   -58.382  1.00 3.85  ? 533 LEU B CG    1 
ATOM   5140  C  CD1   . LEU B 2 533 ? -25.451 0.910   -58.125  1.00 2.00  ? 533 LEU B CD1   1 
ATOM   5141  C  CD2   . LEU B 2 533 ? -24.113 2.555   -59.316  1.00 2.00  ? 533 LEU B CD2   1 
ATOM   5142  N  N     . ASN B 2 534 ? -29.774 3.389   -58.194  1.00 2.00  ? 534 ASN B N     1 
ATOM   5143  C  CA    . ASN B 2 534 ? -30.499 4.641   -58.070  1.00 2.00  ? 534 ASN B CA    1 
ATOM   5144  C  C     . ASN B 2 534 ? -29.490 5.714   -57.603  1.00 2.00  ? 534 ASN B C     1 
ATOM   5145  O  O     . ASN B 2 534 ? -29.033 5.659   -56.471  1.00 3.81  ? 534 ASN B O     1 
ATOM   5146  C  CB    . ASN B 2 534 ? -31.595 4.431   -57.030  1.00 2.00  ? 534 ASN B CB    1 
ATOM   5147  C  CG    . ASN B 2 534 ? -32.782 3.692   -57.586  1.00 2.00  ? 534 ASN B CG    1 
ATOM   5148  O  OD1   . ASN B 2 534 ? -32.780 3.378   -58.749  1.00 6.79  ? 534 ASN B OD1   1 
ATOM   5149  N  ND2   . ASN B 2 534 ? -33.817 3.474   -56.782  1.00 2.00  ? 534 ASN B ND2   1 
ATOM   5150  N  N     . VAL B 2 535 ? -29.100 6.637   -58.489  1.00 2.00  ? 535 VAL B N     1 
ATOM   5151  C  CA    . VAL B 2 535 ? -28.320 7.825   -58.159  1.00 2.00  ? 535 VAL B CA    1 
ATOM   5152  C  C     . VAL B 2 535 ? -29.267 9.034   -57.934  1.00 6.20  ? 535 VAL B C     1 
ATOM   5153  O  O     . VAL B 2 535 ? -29.845 9.513   -58.913  1.00 4.35  ? 535 VAL B O     1 
ATOM   5154  C  CB    . VAL B 2 535 ? -27.404 8.094   -59.305  1.00 2.00  ? 535 VAL B CB    1 
ATOM   5155  C  CG1   . VAL B 2 535 ? -26.487 9.179   -58.952  1.00 3.80  ? 535 VAL B CG1   1 
ATOM   5156  C  CG2   . VAL B 2 535 ? -26.568 6.853   -59.639  1.00 2.00  ? 535 VAL B CG2   1 
ATOM   5157  N  N     . GLU B 2 536 ? -29.507 9.453   -56.680  1.00 2.00  ? 536 GLU B N     1 
ATOM   5158  C  CA    . GLU B 2 536 ? -30.455 10.474  -56.408  1.00 2.00  ? 536 GLU B CA    1 
ATOM   5159  C  C     . GLU B 2 536 ? -29.861 11.820  -56.043  1.00 13.29 ? 536 GLU B C     1 
ATOM   5160  O  O     . GLU B 2 536 ? -29.158 11.945  -55.016  1.00 8.88  ? 536 GLU B O     1 
ATOM   5161  C  CB    . GLU B 2 536 ? -31.487 10.075  -55.362  1.00 3.69  ? 536 GLU B CB    1 
ATOM   5162  C  CG    . GLU B 2 536 ? -32.193 8.734   -55.659  1.00 2.14  ? 536 GLU B CG    1 
ATOM   5163  C  CD    . GLU B 2 536 ? -33.226 8.416   -54.621  1.00 4.75  ? 536 GLU B CD    1 
ATOM   5164  O  OE1   . GLU B 2 536 ? -33.442 9.233   -53.668  1.00 2.00  ? 536 GLU B OE1   1 
ATOM   5165  O  OE2   . GLU B 2 536 ? -33.877 7.346   -54.783  1.00 8.65  ? 536 GLU B OE2   1 
ATOM   5166  N  N     . VAL B 2 537 ? -30.163 12.843  -56.876  1.00 10.27 ? 537 VAL B N     1 
ATOM   5167  C  CA    . VAL B 2 537 ? -29.796 14.214  -56.586  1.00 2.00  ? 537 VAL B CA    1 
ATOM   5168  C  C     . VAL B 2 537 ? -30.902 14.833  -55.784  1.00 2.00  ? 537 VAL B C     1 
ATOM   5169  O  O     . VAL B 2 537 ? -32.095 14.773  -56.158  1.00 11.07 ? 537 VAL B O     1 
ATOM   5170  C  CB    . VAL B 2 537 ? -29.607 15.046  -57.856  1.00 13.98 ? 537 VAL B CB    1 
ATOM   5171  C  CG1   . VAL B 2 537 ? -29.279 16.565  -57.506  1.00 2.00  ? 537 VAL B CG1   1 
ATOM   5172  C  CG2   . VAL B 2 537 ? -28.522 14.472  -58.683  1.00 2.00  ? 537 VAL B CG2   1 
ATOM   5173  N  N     . ILE B 2 538 ? -30.535 15.427  -54.653  1.00 2.00  ? 538 ILE B N     1 
ATOM   5174  C  CA    . ILE B 2 538 ? -31.513 15.861  -53.699  1.00 2.00  ? 538 ILE B CA    1 
ATOM   5175  C  C     . ILE B 2 538 ? -31.151 17.323  -53.425  1.00 6.08  ? 538 ILE B C     1 
ATOM   5176  O  O     . ILE B 2 538 ? -30.114 17.616  -52.796  1.00 12.77 ? 538 ILE B O     1 
ATOM   5177  C  CB    . ILE B 2 538 ? -31.348 15.060  -52.383  1.00 2.35  ? 538 ILE B CB    1 
ATOM   5178  C  CG1   . ILE B 2 538 ? -31.436 13.516  -52.574  1.00 3.92  ? 538 ILE B CG1   1 
ATOM   5179  C  CG2   . ILE B 2 538 ? -32.401 15.510  -51.234  1.00 2.00  ? 538 ILE B CG2   1 
ATOM   5180  C  CD1   . ILE B 2 538 ? -31.073 12.812  -51.120  1.00 2.00  ? 538 ILE B CD1   1 
ATOM   5181  N  N     . ASP B 2 539 ? -31.936 18.250  -53.940  1.00 2.00  ? 539 ASP B N     1 
ATOM   5182  C  CA    . ASP B 2 539 ? -31.379 19.626  -54.175  1.00 9.67  ? 539 ASP B CA    1 
ATOM   5183  C  C     . ASP B 2 539 ? -32.499 20.648  -54.225  1.00 5.07  ? 539 ASP B C     1 
ATOM   5184  O  O     . ASP B 2 539 ? -33.235 20.685  -55.156  1.00 11.48 ? 539 ASP B O     1 
ATOM   5185  C  CB    . ASP B 2 539 ? -30.665 19.655  -55.483  1.00 2.00  ? 539 ASP B CB    1 
ATOM   5186  C  CG    . ASP B 2 539 ? -29.886 20.899  -55.703  1.00 2.00  ? 539 ASP B CG    1 
ATOM   5187  O  OD1   . ASP B 2 539 ? -28.726 20.754  -56.057  1.00 2.00  ? 539 ASP B OD1   1 
ATOM   5188  O  OD2   . ASP B 2 539 ? -30.423 22.026  -55.612  1.00 7.68  ? 539 ASP B OD2   1 
ATOM   5189  N  N     . GLU B 2 540 ? -32.686 21.411  -53.180  1.00 4.64  ? 540 GLU B N     1 
ATOM   5190  C  CA    . GLU B 2 540 ? -33.829 22.262  -53.141  1.00 7.39  ? 540 GLU B CA    1 
ATOM   5191  C  C     . GLU B 2 540 ? -33.824 23.479  -54.046  1.00 2.75  ? 540 GLU B C     1 
ATOM   5192  O  O     . GLU B 2 540 ? -34.607 24.295  -53.809  1.00 6.55  ? 540 GLU B O     1 
ATOM   5193  C  CB    . GLU B 2 540 ? -34.014 22.760  -51.739  1.00 2.00  ? 540 GLU B CB    1 
ATOM   5194  C  CG    . GLU B 2 540 ? -34.951 21.909  -51.080  1.00 3.42  ? 540 GLU B CG    1 
ATOM   5195  C  CD    . GLU B 2 540 ? -34.754 21.808  -49.610  1.00 11.12 ? 540 GLU B CD    1 
ATOM   5196  O  OE1   . GLU B 2 540 ? -33.593 22.012  -49.145  1.00 2.00  ? 540 GLU B OE1   1 
ATOM   5197  O  OE2   . GLU B 2 540 ? -35.778 21.487  -48.934  1.00 2.00  ? 540 GLU B OE2   1 
ATOM   5198  N  N     . ARG B 2 541 ? -32.935 23.648  -55.029  1.00 10.43 ? 541 ARG B N     1 
ATOM   5199  C  CA    . ARG B 2 541 ? -32.774 24.969  -55.710  1.00 2.00  ? 541 ARG B CA    1 
ATOM   5200  C  C     . ARG B 2 541 ? -33.577 24.920  -56.983  1.00 10.28 ? 541 ARG B C     1 
ATOM   5201  O  O     . ARG B 2 541 ? -33.404 25.764  -57.889  1.00 16.72 ? 541 ARG B O     1 
ATOM   5202  C  CB    . ARG B 2 541 ? -31.330 25.241  -56.148  1.00 2.00  ? 541 ARG B CB    1 
ATOM   5203  C  CG    . ARG B 2 541 ? -30.387 25.718  -55.068  1.00 2.00  ? 541 ARG B CG    1 
ATOM   5204  C  CD    . ARG B 2 541 ? -29.207 24.700  -54.889  1.00 30.17 ? 541 ARG B CD    1 
ATOM   5205  N  NE    . ARG B 2 541 ? -28.082 25.178  -55.638  1.00 4.42  ? 541 ARG B NE    1 
ATOM   5206  C  CZ    . ARG B 2 541 ? -27.158 24.458  -56.244  1.00 2.00  ? 541 ARG B CZ    1 
ATOM   5207  N  NH1   . ARG B 2 541 ? -27.107 23.135  -56.201  1.00 2.96  ? 541 ARG B NH1   1 
ATOM   5208  N  NH2   . ARG B 2 541 ? -26.246 25.112  -56.925  1.00 8.18  ? 541 ARG B NH2   1 
ATOM   5209  N  N     . GLY B 2 542 ? -34.417 23.908  -57.120  1.00 10.11 ? 542 GLY B N     1 
ATOM   5210  C  CA    . GLY B 2 542 ? -35.050 23.744  -58.417  1.00 11.10 ? 542 GLY B CA    1 
ATOM   5211  C  C     . GLY B 2 542 ? -34.241 22.889  -59.400  1.00 18.88 ? 542 GLY B C     1 
ATOM   5212  O  O     . GLY B 2 542 ? -33.151 22.320  -59.086  1.00 12.07 ? 542 GLY B O     1 
ATOM   5213  N  N     . ALA B 2 543 ? -34.807 22.765  -60.591  1.00 3.77  ? 543 ALA B N     1 
ATOM   5214  C  CA    . ALA B 2 543 ? -34.404 21.737  -61.505  1.00 3.37  ? 543 ALA B CA    1 
ATOM   5215  C  C     . ALA B 2 543 ? -32.980 22.057  -61.921  1.00 12.82 ? 543 ALA B C     1 
ATOM   5216  O  O     . ALA B 2 543 ? -32.666 23.209  -62.265  1.00 7.91  ? 543 ALA B O     1 
ATOM   5217  C  CB    . ALA B 2 543 ? -35.322 21.712  -62.739  1.00 2.76  ? 543 ALA B CB    1 
ATOM   5218  N  N     . PRO B 2 544 ? -32.127 21.036  -61.876  1.00 2.00  ? 544 PRO B N     1 
ATOM   5219  C  CA    . PRO B 2 544 ? -30.745 20.991  -62.181  1.00 5.59  ? 544 PRO B CA    1 
ATOM   5220  C  C     . PRO B 2 544 ? -30.220 21.363  -63.572  1.00 5.47  ? 544 PRO B C     1 
ATOM   5221  O  O     . PRO B 2 544 ? -29.101 21.893  -63.654  1.00 10.51 ? 544 PRO B O     1 
ATOM   5222  C  CB    . PRO B 2 544 ? -30.342 19.583  -61.742  1.00 2.00  ? 544 PRO B CB    1 
ATOM   5223  C  CG    . PRO B 2 544 ? -31.302 19.246  -60.742  1.00 2.00  ? 544 PRO B CG    1 
ATOM   5224  C  CD    . PRO B 2 544 ? -32.568 19.753  -61.340  1.00 2.00  ? 544 PRO B CD    1 
ATOM   5225  N  N     . ASP B 2 545 ? -30.984 21.217  -64.651  1.00 20.64 ? 545 ASP B N     1 
ATOM   5226  C  CA    . ASP B 2 545 ? -30.688 22.122  -65.826  1.00 24.17 ? 545 ASP B CA    1 
ATOM   5227  C  C     . ASP B 2 545 ? -30.876 23.632  -65.656  1.00 15.88 ? 545 ASP B C     1 
ATOM   5228  O  O     . ASP B 2 545 ? -30.536 24.375  -66.569  1.00 17.29 ? 545 ASP B O     1 
ATOM   5229  C  CB    . ASP B 2 545 ? -31.374 21.710  -67.130  1.00 25.84 ? 545 ASP B CB    1 
ATOM   5230  C  CG    . ASP B 2 545 ? -32.285 20.534  -66.946  1.00 30.31 ? 545 ASP B CG    1 
ATOM   5231  O  OD1   . ASP B 2 545 ? -31.792 19.426  -67.245  1.00 9.63  ? 545 ASP B OD1   1 
ATOM   5232  O  OD2   . ASP B 2 545 ? -33.454 20.728  -66.484  1.00 8.40  ? 545 ASP B OD2   1 
ATOM   5233  N  N     . SER B 2 546 ? -31.442 24.081  -64.538  1.00 8.38  ? 546 SER B N     1 
ATOM   5234  C  CA    . SER B 2 546 ? -31.462 25.515  -64.222  1.00 16.37 ? 546 SER B CA    1 
ATOM   5235  C  C     . SER B 2 546 ? -30.043 26.055  -64.280  1.00 11.80 ? 546 SER B C     1 
ATOM   5236  O  O     . SER B 2 546 ? -29.828 27.222  -64.616  1.00 19.40 ? 546 SER B O     1 
ATOM   5237  C  CB    . SER B 2 546 ? -31.990 25.763  -62.795  1.00 19.77 ? 546 SER B CB    1 
ATOM   5238  O  OG    . SER B 2 546 ? -33.397 25.867  -62.778  1.00 43.04 ? 546 SER B OG    1 
ATOM   5239  N  N     . ARG B 2 547 ? -29.092 25.211  -63.883  1.00 6.78  ? 547 ARG B N     1 
ATOM   5240  C  CA    . ARG B 2 547 ? -27.724 25.615  -63.703  1.00 2.00  ? 547 ARG B CA    1 
ATOM   5241  C  C     . ARG B 2 547 ? -26.898 24.755  -64.672  1.00 2.00  ? 547 ARG B C     1 
ATOM   5242  O  O     . ARG B 2 547 ? -27.391 23.756  -65.212  1.00 2.00  ? 547 ARG B O     1 
ATOM   5243  C  CB    . ARG B 2 547 ? -27.283 25.409  -62.258  1.00 6.94  ? 547 ARG B CB    1 
ATOM   5244  C  CG    . ARG B 2 547 ? -28.299 25.699  -61.130  1.00 3.50  ? 547 ARG B CG    1 
ATOM   5245  C  CD    . ARG B 2 547 ? -27.800 24.967  -59.786  1.00 5.89  ? 547 ARG B CD    1 
ATOM   5246  N  NE    . ARG B 2 547 ? -28.472 23.690  -59.591  1.00 12.17 ? 547 ARG B NE    1 
ATOM   5247  C  CZ    . ARG B 2 547 ? -29.741 23.567  -59.196  1.00 17.92 ? 547 ARG B CZ    1 
ATOM   5248  N  NH1   . ARG B 2 547 ? -30.468 24.644  -58.918  1.00 19.32 ? 547 ARG B NH1   1 
ATOM   5249  N  NH2   . ARG B 2 547 ? -30.292 22.367  -59.076  1.00 25.41 ? 547 ARG B NH2   1 
ATOM   5250  N  N     . PRO B 2 548 ? -25.664 25.191  -64.967  1.00 2.00  ? 548 PRO B N     1 
ATOM   5251  C  CA    . PRO B 2 548 ? -24.700 24.403  -65.759  1.00 5.94  ? 548 PRO B CA    1 
ATOM   5252  C  C     . PRO B 2 548 ? -24.296 23.032  -65.134  1.00 12.01 ? 548 PRO B C     1 
ATOM   5253  O  O     . PRO B 2 548 ? -24.271 22.848  -63.918  1.00 2.32  ? 548 PRO B O     1 
ATOM   5254  C  CB    . PRO B 2 548 ? -23.470 25.328  -65.864  1.00 6.93  ? 548 PRO B CB    1 
ATOM   5255  C  CG    . PRO B 2 548 ? -23.935 26.702  -65.391  1.00 2.00  ? 548 PRO B CG    1 
ATOM   5256  C  CD    . PRO B 2 548 ? -25.136 26.512  -64.554  1.00 7.23  ? 548 PRO B CD    1 
ATOM   5257  N  N     . GLU B 2 549 ? -23.995 22.060  -65.969  1.00 6.61  ? 549 GLU B N     1 
ATOM   5258  C  CA    . GLU B 2 549 ? -23.867 20.730  -65.436  1.00 20.60 ? 549 GLU B CA    1 
ATOM   5259  C  C     . GLU B 2 549 ? -22.591 20.513  -64.654  1.00 16.36 ? 549 GLU B C     1 
ATOM   5260  O  O     . GLU B 2 549 ? -22.563 19.773  -63.695  1.00 27.30 ? 549 GLU B O     1 
ATOM   5261  C  CB    . GLU B 2 549 ? -24.169 19.652  -66.473  1.00 24.85 ? 549 GLU B CB    1 
ATOM   5262  C  CG    . GLU B 2 549 ? -23.065 19.273  -67.434  1.00 14.31 ? 549 GLU B CG    1 
ATOM   5263  C  CD    . GLU B 2 549 ? -23.474 18.080  -68.284  1.00 43.27 ? 549 GLU B CD    1 
ATOM   5264  O  OE1   . GLU B 2 549 ? -24.689 17.854  -68.429  1.00 47.69 ? 549 GLU B OE1   1 
ATOM   5265  O  OE2   . GLU B 2 549 ? -22.598 17.360  -68.800  1.00 9.41  ? 549 GLU B OE2   1 
ATOM   5266  N  N     . SER B 2 550 ? -21.540 21.187  -65.071  1.00 2.00  ? 550 SER B N     1 
ATOM   5267  C  CA    . SER B 2 550 ? -20.589 21.830  -64.180  1.00 2.00  ? 550 SER B CA    1 
ATOM   5268  C  C     . SER B 2 550 ? -20.927 22.300  -62.765  1.00 10.27 ? 550 SER B C     1 
ATOM   5269  O  O     . SER B 2 550 ? -20.075 22.838  -62.070  1.00 7.91  ? 550 SER B O     1 
ATOM   5270  C  CB    . SER B 2 550 ? -20.245 23.211  -64.712  1.00 7.24  ? 550 SER B CB    1 
ATOM   5271  O  OG    . SER B 2 550 ? -19.134 23.744  -64.041  1.00 4.11  ? 550 SER B OG    1 
ATOM   5272  N  N     . CYS B 2 551 ? -21.991 22.106  -62.204  1.00 2.00  ? 551 CYS B N     1 
ATOM   5273  C  CA    . CYS B 2 551 ? -22.352 22.845  -61.004  1.00 10.61 ? 551 CYS B CA    1 
ATOM   5274  C  C     . CYS B 2 551 ? -22.610 21.728  -60.009  1.00 8.09  ? 551 CYS B C     1 
ATOM   5275  O  O     . CYS B 2 551 ? -23.350 20.802  -60.290  1.00 2.00  ? 551 CYS B O     1 
ATOM   5276  C  CB    . CYS B 2 551 ? -23.528 23.835  -61.056  1.00 2.00  ? 551 CYS B CB    1 
ATOM   5277  S  SG    . CYS B 2 551 ? -23.983 24.673  -59.522  1.00 10.40 ? 551 CYS B SG    1 
ATOM   5278  N  N     . PRO B 2 552 ? -21.977 21.826  -58.849  1.00 10.35 ? 552 PRO B N     1 
ATOM   5279  C  CA    . PRO B 2 552 ? -22.197 20.877  -57.766  1.00 2.19  ? 552 PRO B CA    1 
ATOM   5280  C  C     . PRO B 2 552 ? -23.640 20.871  -57.327  1.00 8.58  ? 552 PRO B C     1 
ATOM   5281  O  O     . PRO B 2 552 ? -24.266 21.908  -57.194  1.00 10.93 ? 552 PRO B O     1 
ATOM   5282  C  CB    . PRO B 2 552 ? -21.290 21.398  -56.655  1.00 2.00  ? 552 PRO B CB    1 
ATOM   5283  C  CG    . PRO B 2 552 ? -20.356 22.266  -57.326  1.00 8.96  ? 552 PRO B CG    1 
ATOM   5284  C  CD    . PRO B 2 552 ? -21.095 22.918  -58.429  1.00 6.59  ? 552 PRO B CD    1 
ATOM   5285  N  N     . VAL B 2 553 ? -24.160 19.676  -57.122  1.00 3.16  ? 553 VAL B N     1 
ATOM   5286  C  CA    . VAL B 2 553 ? -25.491 19.491  -56.594  1.00 2.00  ? 553 VAL B CA    1 
ATOM   5287  C  C     . VAL B 2 553 ? -25.299 19.551  -55.110  1.00 8.88  ? 553 VAL B C     1 
ATOM   5288  O  O     . VAL B 2 553 ? -24.155 19.362  -54.629  1.00 3.19  ? 553 VAL B O     1 
ATOM   5289  C  CB    . VAL B 2 553 ? -26.017 18.087  -56.935  1.00 9.87  ? 553 VAL B CB    1 
ATOM   5290  C  CG1   . VAL B 2 553 ? -26.239 17.955  -58.464  1.00 2.47  ? 553 VAL B CG1   1 
ATOM   5291  C  CG2   . VAL B 2 553 ? -25.020 16.925  -56.415  1.00 2.00  ? 553 VAL B CG2   1 
ATOM   5292  N  N     . GLU B 2 554 ? -26.387 19.832  -54.382  1.00 2.00  ? 554 GLU B N     1 
ATOM   5293  C  CA    . GLU B 2 554 ? -26.351 20.017  -52.944  1.00 11.86 ? 554 GLU B CA    1 
ATOM   5294  C  C     . GLU B 2 554 ? -26.100 18.690  -52.162  1.00 12.69 ? 554 GLU B C     1 
ATOM   5295  O  O     . GLU B 2 554 ? -25.489 18.711  -51.063  1.00 7.71  ? 554 GLU B O     1 
ATOM   5296  C  CB    . GLU B 2 554 ? -27.703 20.633  -52.432  1.00 6.34  ? 554 GLU B CB    1 
ATOM   5297  C  CG    . GLU B 2 554 ? -27.935 22.008  -52.901  1.00 9.52  ? 554 GLU B CG    1 
ATOM   5298  C  CD    . GLU B 2 554 ? -29.159 22.595  -52.303  1.00 12.27 ? 554 GLU B CD    1 
ATOM   5299  O  OE1   . GLU B 2 554 ? -29.256 23.844  -52.367  1.00 4.80  ? 554 GLU B OE1   1 
ATOM   5300  O  OE2   . GLU B 2 554 ? -30.014 21.829  -51.782  1.00 3.26  ? 554 GLU B OE2   1 
ATOM   5301  N  N     . ARG B 2 555 ? -26.681 17.591  -52.675  1.00 5.88  ? 555 ARG B N     1 
ATOM   5302  C  CA    . ARG B 2 555 ? -26.616 16.239  -52.027  1.00 9.83  ? 555 ARG B CA    1 
ATOM   5303  C  C     . ARG B 2 555 ? -26.832 15.283  -53.178  1.00 14.75 ? 555 ARG B C     1 
ATOM   5304  O  O     . ARG B 2 555 ? -27.829 15.484  -53.916  1.00 11.33 ? 555 ARG B O     1 
ATOM   5305  C  CB    . ARG B 2 555 ? -27.736 15.999  -51.016  1.00 2.00  ? 555 ARG B CB    1 
ATOM   5306  C  CG    . ARG B 2 555 ? -28.075 17.148  -50.073  1.00 2.00  ? 555 ARG B CG    1 
ATOM   5307  C  CD    . ARG B 2 555 ? -29.356 16.797  -49.338  1.00 2.00  ? 555 ARG B CD    1 
ATOM   5308  N  NE    . ARG B 2 555 ? -29.808 17.900  -48.502  1.00 23.70 ? 555 ARG B NE    1 
ATOM   5309  C  CZ    . ARG B 2 555 ? -30.181 19.103  -48.972  1.00 2.36  ? 555 ARG B CZ    1 
ATOM   5310  N  NH1   . ARG B 2 555 ? -30.172 19.372  -50.280  1.00 2.00  ? 555 ARG B NH1   1 
ATOM   5311  N  NH2   . ARG B 2 555 ? -30.582 19.992  -48.114  1.00 4.79  ? 555 ARG B NH2   1 
ATOM   5312  N  N     . VAL B 2 556 ? -25.913 14.316  -53.377  1.00 2.00  ? 556 VAL B N     1 
ATOM   5313  C  CA    . VAL B 2 556 ? -26.279 13.007  -53.981  1.00 8.43  ? 556 VAL B CA    1 
ATOM   5314  C  C     . VAL B 2 556 ? -26.332 11.832  -52.940  1.00 12.08 ? 556 VAL B C     1 
ATOM   5315  O  O     . VAL B 2 556 ? -25.384 11.637  -52.158  1.00 5.49  ? 556 VAL B O     1 
ATOM   5316  C  CB    . VAL B 2 556 ? -25.201 12.509  -54.945  1.00 2.00  ? 556 VAL B CB    1 
ATOM   5317  C  CG1   . VAL B 2 556 ? -25.601 12.046  -56.286  1.00 2.00  ? 556 VAL B CG1   1 
ATOM   5318  C  CG2   . VAL B 2 556 ? -23.870 12.956  -54.687  1.00 2.00  ? 556 VAL B CG2   1 
ATOM   5319  N  N     . PHE B 2 557 ? -27.378 11.012  -53.022  1.00 8.91  ? 557 PHE B N     1 
ATOM   5320  C  CA    . PHE B 2 557 ? -27.528 9.788   -52.286  1.00 6.64  ? 557 PHE B CA    1 
ATOM   5321  C  C     . PHE B 2 557 ? -27.513 8.642   -53.280  1.00 8.41  ? 557 PHE B C     1 
ATOM   5322  O  O     . PHE B 2 557 ? -28.390 8.643   -54.144  1.00 7.14  ? 557 PHE B O     1 
ATOM   5323  C  CB    . PHE B 2 557 ? -28.887 9.800   -51.692  1.00 2.00  ? 557 PHE B CB    1 
ATOM   5324  C  CG    . PHE B 2 557 ? -29.114 8.663   -50.787  1.00 12.37 ? 557 PHE B CG    1 
ATOM   5325  C  CD1   . PHE B 2 557 ? -28.057 8.209   -49.973  1.00 9.33  ? 557 PHE B CD1   1 
ATOM   5326  C  CD2   . PHE B 2 557 ? -30.372 8.010   -50.711  1.00 20.24 ? 557 PHE B CD2   1 
ATOM   5327  C  CE1   . PHE B 2 557 ? -28.249 7.105   -49.070  1.00 10.47 ? 557 PHE B CE1   1 
ATOM   5328  C  CE2   . PHE B 2 557 ? -30.599 6.868   -49.796  1.00 14.99 ? 557 PHE B CE2   1 
ATOM   5329  C  CZ    . PHE B 2 557 ? -29.503 6.417   -49.010  1.00 8.87  ? 557 PHE B CZ    1 
ATOM   5330  N  N     . ILE B 2 558 ? -26.590 7.675   -53.182  1.00 2.00  ? 558 ILE B N     1 
ATOM   5331  C  CA    . ILE B 2 558 ? -26.482 6.580   -54.208  1.00 2.00  ? 558 ILE B CA    1 
ATOM   5332  C  C     . ILE B 2 558 ? -26.640 5.155   -53.602  1.00 8.04  ? 558 ILE B C     1 
ATOM   5333  O  O     . ILE B 2 558 ? -26.003 4.785   -52.597  1.00 7.17  ? 558 ILE B O     1 
ATOM   5334  C  CB    . ILE B 2 558 ? -25.195 6.665   -54.919  1.00 2.00  ? 558 ILE B CB    1 
ATOM   5335  C  CG1   . ILE B 2 558 ? -25.040 7.963   -55.695  1.00 8.29  ? 558 ILE B CG1   1 
ATOM   5336  C  CG2   . ILE B 2 558 ? -24.831 5.429   -55.755  1.00 2.15  ? 558 ILE B CG2   1 
ATOM   5337  C  CD1   . ILE B 2 558 ? -23.509 8.308   -56.071  1.00 4.20  ? 558 ILE B CD1   1 
ATOM   5338  N  N     . TYR B 2 559 ? -27.537 4.342   -54.119  1.00 5.00  ? 559 TYR B N     1 
ATOM   5339  C  CA    . TYR B 2 559 ? -27.672 3.043   -53.431  1.00 4.89  ? 559 TYR B CA    1 
ATOM   5340  C  C     . TYR B 2 559 ? -28.054 2.002   -54.426  1.00 6.03  ? 559 TYR B C     1 
ATOM   5341  O  O     . TYR B 2 559 ? -28.807 2.339   -55.359  1.00 4.91  ? 559 TYR B O     1 
ATOM   5342  C  CB    . TYR B 2 559 ? -28.750 3.118   -52.395  1.00 2.00  ? 559 TYR B CB    1 
ATOM   5343  C  CG    . TYR B 2 559 ? -30.082 3.566   -52.883  1.00 2.74  ? 559 TYR B CG    1 
ATOM   5344  C  CD1   . TYR B 2 559 ? -30.950 2.684   -53.522  1.00 4.80  ? 559 TYR B CD1   1 
ATOM   5345  C  CD2   . TYR B 2 559 ? -30.559 4.889   -52.616  1.00 3.95  ? 559 TYR B CD2   1 
ATOM   5346  C  CE1   . TYR B 2 559 ? -32.250 3.100   -53.912  1.00 2.00  ? 559 TYR B CE1   1 
ATOM   5347  C  CE2   . TYR B 2 559 ? -31.823 5.307   -53.034  1.00 2.00  ? 559 TYR B CE2   1 
ATOM   5348  C  CZ    . TYR B 2 559 ? -32.657 4.390   -53.719  1.00 5.31  ? 559 TYR B CZ    1 
ATOM   5349  O  OH    . TYR B 2 559 ? -33.931 4.809   -54.178  1.00 14.06 ? 559 TYR B OH    1 
ATOM   5350  N  N     . ARG B 2 560 ? -27.560 0.765   -54.279  1.00 4.83  ? 560 ARG B N     1 
ATOM   5351  C  CA    . ARG B 2 560 ? -27.803 -0.261  -55.366  1.00 7.75  ? 560 ARG B CA    1 
ATOM   5352  C  C     . ARG B 2 560 ? -29.202 -0.891  -55.128  1.00 2.67  ? 560 ARG B C     1 
ATOM   5353  O  O     . ARG B 2 560 ? -29.754 -0.835  -54.040  1.00 2.76  ? 560 ARG B O     1 
ATOM   5354  C  CB    . ARG B 2 560 ? -26.789 -1.357  -55.245  1.00 2.00  ? 560 ARG B CB    1 
ATOM   5355  C  CG    . ARG B 2 560 ? -27.029 -2.051  -53.860  1.00 6.69  ? 560 ARG B CG    1 
ATOM   5356  C  CD    . ARG B 2 560 ? -25.792 -2.945  -53.552  1.00 13.19 ? 560 ARG B CD    1 
ATOM   5357  N  NE    . ARG B 2 560 ? -25.925 -3.586  -52.227  1.00 8.90  ? 560 ARG B NE    1 
ATOM   5358  C  CZ    . ARG B 2 560 ? -25.029 -4.475  -51.769  1.00 6.06  ? 560 ARG B CZ    1 
ATOM   5359  N  NH1   . ARG B 2 560 ? -23.949 -4.789  -52.484  1.00 2.00  ? 560 ARG B NH1   1 
ATOM   5360  N  NH2   . ARG B 2 560 ? -25.255 -5.001  -50.595  1.00 2.00  ? 560 ARG B NH2   1 
ATOM   5361  N  N     . THR B 2 561 ? -29.853 -1.406  -56.134  1.00 2.52  ? 561 THR B N     1 
ATOM   5362  C  CA    . THR B 2 561 ? -31.221 -1.883  -55.845  1.00 3.94  ? 561 THR B CA    1 
ATOM   5363  C  C     . THR B 2 561 ? -31.667 -2.852  -56.886  1.00 2.00  ? 561 THR B C     1 
ATOM   5364  O  O     . THR B 2 561 ? -31.169 -2.890  -58.040  1.00 4.02  ? 561 THR B O     1 
ATOM   5365  C  CB    . THR B 2 561 ? -32.257 -0.755  -55.829  1.00 11.27 ? 561 THR B CB    1 
ATOM   5366  O  OG1   . THR B 2 561 ? -33.600 -1.305  -55.954  1.00 7.53  ? 561 THR B OG1   1 
ATOM   5367  C  CG2   . THR B 2 561 ? -31.947 0.200   -57.055  1.00 11.71 ? 561 THR B CG2   1 
ATOM   5368  N  N     . VAL B 2 562 ? -32.601 -3.668  -56.520  1.00 2.00  ? 562 VAL B N     1 
ATOM   5369  C  CA    . VAL B 2 562 ? -33.229 -4.456  -57.627  1.00 8.80  ? 562 VAL B CA    1 
ATOM   5370  C  C     . VAL B 2 562 ? -34.610 -3.954  -58.045  1.00 6.17  ? 562 VAL B C     1 
ATOM   5371  O  O     . VAL B 2 562 ? -35.197 -4.572  -58.889  1.00 2.56  ? 562 VAL B O     1 
ATOM   5372  C  CB    . VAL B 2 562 ? -33.316 -5.955  -57.292  1.00 2.00  ? 562 VAL B CB    1 
ATOM   5373  C  CG1   . VAL B 2 562 ? -31.903 -6.472  -57.040  1.00 2.00  ? 562 VAL B CG1   1 
ATOM   5374  C  CG2   . VAL B 2 562 ? -34.103 -6.106  -56.060  1.00 2.00  ? 562 VAL B CG2   1 
ATOM   5375  N  N     . ALA B 2 563 ? -35.121 -2.848  -57.447  1.00 2.02  ? 563 ALA B N     1 
ATOM   5376  C  CA    . ALA B 2 563 ? -36.443 -2.360  -57.756  1.00 2.00  ? 563 ALA B CA    1 
ATOM   5377  C  C     . ALA B 2 563 ? -36.361 -1.313  -58.890  1.00 3.12  ? 563 ALA B C     1 
ATOM   5378  O  O     . ALA B 2 563 ? -37.377 -0.816  -59.378  1.00 4.90  ? 563 ALA B O     1 
ATOM   5379  C  CB    . ALA B 2 563 ? -37.100 -1.803  -56.506  1.00 2.00  ? 563 ALA B CB    1 
ATOM   5380  N  N     . GLY B 2 564 ? -35.159 -0.994  -59.341  1.00 2.00  ? 564 GLY B N     1 
ATOM   5381  C  CA    . GLY B 2 564 ? -35.010 0.185   -60.134  1.00 4.31  ? 564 GLY B CA    1 
ATOM   5382  C  C     . GLY B 2 564 ? -35.480 1.443   -59.416  1.00 3.14  ? 564 GLY B C     1 
ATOM   5383  O  O     . GLY B 2 564 ? -35.736 1.447   -58.234  1.00 2.00  ? 564 GLY B O     1 
ATOM   5384  N  N     . PRO B 2 565 ? -35.675 2.502   -60.193  1.00 2.00  ? 565 PRO B N     1 
ATOM   5385  C  CA    . PRO B 2 565 ? -36.059 3.791   -59.707  1.00 3.37  ? 565 PRO B CA    1 
ATOM   5386  C  C     . PRO B 2 565 ? -37.412 3.776   -58.990  1.00 2.05  ? 565 PRO B C     1 
ATOM   5387  O  O     . PRO B 2 565 ? -38.309 2.979   -59.282  1.00 12.51 ? 565 PRO B O     1 
ATOM   5388  C  CB    . PRO B 2 565 ? -36.149 4.622   -60.986  1.00 2.00  ? 565 PRO B CB    1 
ATOM   5389  C  CG    . PRO B 2 565 ? -35.395 3.840   -62.042  1.00 2.00  ? 565 PRO B CG    1 
ATOM   5390  C  CD    . PRO B 2 565 ? -35.564 2.454   -61.661  1.00 2.00  ? 565 PRO B CD    1 
ATOM   5391  N  N     . ARG B 2 566 ? -37.547 4.669   -58.041  1.00 2.00  ? 566 ARG B N     1 
ATOM   5392  C  CA    . ARG B 2 566 ? -38.560 4.514   -57.044  1.00 4.01  ? 566 ARG B CA    1 
ATOM   5393  C  C     . ARG B 2 566 ? -39.696 5.441   -57.387  1.00 4.52  ? 566 ARG B C     1 
ATOM   5394  O  O     . ARG B 2 566 ? -39.518 6.398   -58.114  1.00 2.00  ? 566 ARG B O     1 
ATOM   5395  C  CB    . ARG B 2 566 ? -37.985 4.759   -55.642  1.00 2.00  ? 566 ARG B CB    1 
ATOM   5396  C  CG    . ARG B 2 566 ? -37.794 6.189   -55.154  1.00 11.00 ? 566 ARG B CG    1 
ATOM   5397  C  CD    . ARG B 2 566 ? -37.053 6.197   -53.781  1.00 5.28  ? 566 ARG B CD    1 
ATOM   5398  N  NE    . ARG B 2 566 ? -36.526 7.532   -53.430  1.00 4.46  ? 566 ARG B NE    1 
ATOM   5399  C  CZ    . ARG B 2 566 ? -37.233 8.483   -52.813  1.00 7.37  ? 566 ARG B CZ    1 
ATOM   5400  N  NH1   . ARG B 2 566 ? -38.536 8.282   -52.553  1.00 3.28  ? 566 ARG B NH1   1 
ATOM   5401  N  NH2   . ARG B 2 566 ? -36.645 9.655   -52.475  1.00 9.13  ? 566 ARG B NH2   1 
ATOM   5402  N  N     . PHE B 2 567 ? -40.865 5.177   -56.839  1.00 3.78  ? 567 PHE B N     1 
ATOM   5403  C  CA    . PHE B 2 567 ? -42.068 5.786   -57.390  1.00 9.36  ? 567 PHE B CA    1 
ATOM   5404  C  C     . PHE B 2 567 ? -42.521 7.036   -56.679  1.00 2.00  ? 567 PHE B C     1 
ATOM   5405  O  O     . PHE B 2 567 ? -43.367 7.748   -57.171  1.00 3.72  ? 567 PHE B O     1 
ATOM   5406  C  CB    . PHE B 2 567 ? -43.198 4.745   -57.594  1.00 2.08  ? 567 PHE B CB    1 
ATOM   5407  C  CG    . PHE B 2 567 ? -42.962 3.873   -58.765  1.00 13.72 ? 567 PHE B CG    1 
ATOM   5408  C  CD1   . PHE B 2 567 ? -43.269 4.337   -60.065  1.00 13.57 ? 567 PHE B CD1   1 
ATOM   5409  C  CD2   . PHE B 2 567 ? -42.346 2.609   -58.601  1.00 22.27 ? 567 PHE B CD2   1 
ATOM   5410  C  CE1   . PHE B 2 567 ? -43.014 3.538   -61.201  1.00 4.31  ? 567 PHE B CE1   1 
ATOM   5411  C  CE2   . PHE B 2 567 ? -42.067 1.792   -59.721  1.00 28.06 ? 567 PHE B CE2   1 
ATOM   5412  C  CZ    . PHE B 2 567 ? -42.399 2.267   -61.028  1.00 32.13 ? 567 PHE B CZ    1 
ATOM   5413  N  N     . ASP B 2 568 ? -41.934 7.316   -55.530  1.00 2.08  ? 568 ASP B N     1 
ATOM   5414  C  CA    . ASP B 2 568 ? -42.434 8.353   -54.643  1.00 2.00  ? 568 ASP B CA    1 
ATOM   5415  C  C     . ASP B 2 568 ? -41.353 9.434   -54.374  1.00 4.23  ? 568 ASP B C     1 
ATOM   5416  O  O     . ASP B 2 568 ? -41.385 10.135  -53.353  1.00 7.72  ? 568 ASP B O     1 
ATOM   5417  C  CB    . ASP B 2 568 ? -42.836 7.674   -53.364  1.00 2.00  ? 568 ASP B CB    1 
ATOM   5418  C  CG    . ASP B 2 568 ? -41.659 6.892   -52.704  1.00 5.99  ? 568 ASP B CG    1 
ATOM   5419  O  OD1   . ASP B 2 568 ? -40.501 6.842   -53.198  1.00 2.00  ? 568 ASP B OD1   1 
ATOM   5420  O  OD2   . ASP B 2 568 ? -41.930 6.339   -51.641  1.00 2.00  ? 568 ASP B OD2   1 
ATOM   5421  N  N     . MET B 2 569 ? -40.403 9.632   -55.296  1.00 5.46  ? 569 MET B N     1 
ATOM   5422  C  CA    . MET B 2 569 ? -39.697 10.908  -55.276  1.00 2.00  ? 569 MET B CA    1 
ATOM   5423  C  C     . MET B 2 569 ? -40.610 12.119  -55.151  1.00 2.00  ? 569 MET B C     1 
ATOM   5424  O  O     . MET B 2 569 ? -41.621 12.237  -55.808  1.00 9.13  ? 569 MET B O     1 
ATOM   5425  C  CB    . MET B 2 569 ? -38.774 11.039  -56.438  1.00 2.00  ? 569 MET B CB    1 
ATOM   5426  C  CG    . MET B 2 569 ? -37.490 10.329  -56.221  1.00 2.00  ? 569 MET B CG    1 
ATOM   5427  S  SD    . MET B 2 569 ? -36.988 9.605   -57.794  1.00 13.10 ? 569 MET B SD    1 
ATOM   5428  C  CE    . MET B 2 569 ? -35.403 10.428  -57.987  1.00 35.55 ? 569 MET B CE    1 
ATOM   5429  N  N     . PRO B 2 570 ? -40.254 13.061  -54.299  1.00 11.75 ? 570 PRO B N     1 
ATOM   5430  C  CA    . PRO B 2 570 ? -40.886 14.415  -54.347  1.00 3.28  ? 570 PRO B CA    1 
ATOM   5431  C  C     . PRO B 2 570 ? -40.154 15.399  -55.262  1.00 2.00  ? 570 PRO B C     1 
ATOM   5432  O  O     . PRO B 2 570 ? -39.201 15.033  -55.972  1.00 2.00  ? 570 PRO B O     1 
ATOM   5433  C  CB    . PRO B 2 570 ? -40.646 14.922  -52.938  1.00 2.00  ? 570 PRO B CB    1 
ATOM   5434  C  CG    . PRO B 2 570 ? -39.171 14.435  -52.741  1.00 4.15  ? 570 PRO B CG    1 
ATOM   5435  C  CD    . PRO B 2 570 ? -39.256 12.956  -53.224  1.00 2.00  ? 570 PRO B CD    1 
ATOM   5436  N  N     . GLY B 2 571 ? -40.625 16.658  -55.230  1.00 2.00  ? 571 GLY B N     1 
ATOM   5437  C  CA    . GLY B 2 571 ? -40.213 17.639  -56.231  1.00 2.00  ? 571 GLY B CA    1 
ATOM   5438  C  C     . GLY B 2 571 ? -38.712 17.894  -56.322  1.00 2.00  ? 571 GLY B C     1 
ATOM   5439  O  O     . GLY B 2 571 ? -38.226 18.426  -57.308  1.00 7.48  ? 571 GLY B O     1 
ATOM   5440  N  N     . PHE B 2 572 ? -37.959 17.567  -55.280  1.00 2.00  ? 572 PHE B N     1 
ATOM   5441  C  CA    . PHE B 2 572 ? -36.537 17.976  -55.216  1.00 2.82  ? 572 PHE B CA    1 
ATOM   5442  C  C     . PHE B 2 572 ? -35.563 16.799  -55.295  1.00 2.83  ? 572 PHE B C     1 
ATOM   5443  O  O     . PHE B 2 572 ? -34.370 16.900  -54.980  1.00 9.34  ? 572 PHE B O     1 
ATOM   5444  C  CB    . PHE B 2 572 ? -36.280 18.743  -53.940  1.00 2.00  ? 572 PHE B CB    1 
ATOM   5445  C  CG    . PHE B 2 572 ? -36.747 18.032  -52.690  1.00 6.34  ? 572 PHE B CG    1 
ATOM   5446  C  CD1   . PHE B 2 572 ? -35.879 17.187  -51.987  1.00 2.00  ? 572 PHE B CD1   1 
ATOM   5447  C  CD2   . PHE B 2 572 ? -38.052 18.198  -52.225  1.00 2.00  ? 572 PHE B CD2   1 
ATOM   5448  C  CE1   . PHE B 2 572 ? -36.320 16.543  -50.803  1.00 2.00  ? 572 PHE B CE1   1 
ATOM   5449  C  CE2   . PHE B 2 572 ? -38.490 17.608  -51.056  1.00 2.00  ? 572 PHE B CE2   1 
ATOM   5450  C  CZ    . PHE B 2 572 ? -37.640 16.793  -50.325  1.00 3.03  ? 572 PHE B CZ    1 
ATOM   5451  N  N     . VAL B 2 573 ? -36.083 15.669  -55.737  1.00 6.51  ? 573 VAL B N     1 
ATOM   5452  C  CA    . VAL B 2 573 ? -35.235 14.507  -55.885  1.00 5.79  ? 573 VAL B CA    1 
ATOM   5453  C  C     . VAL B 2 573 ? -35.444 14.037  -57.298  1.00 6.55  ? 573 VAL B C     1 
ATOM   5454  O  O     . VAL B 2 573 ? -36.600 13.885  -57.759  1.00 2.00  ? 573 VAL B O     1 
ATOM   5455  C  CB    . VAL B 2 573 ? -35.692 13.346  -54.932  1.00 11.63 ? 573 VAL B CB    1 
ATOM   5456  C  CG1   . VAL B 2 573 ? -34.902 12.113  -55.241  1.00 2.00  ? 573 VAL B CG1   1 
ATOM   5457  C  CG2   . VAL B 2 573 ? -35.646 13.758  -53.388  1.00 2.00  ? 573 VAL B CG2   1 
ATOM   5458  N  N     . TRP B 2 574 ? -34.313 13.774  -57.948  1.00 2.00  ? 574 TRP B N     1 
ATOM   5459  C  CA    . TRP B 2 574 ? -34.271 13.367  -59.338  1.00 6.99  ? 574 TRP B CA    1 
ATOM   5460  C  C     . TRP B 2 574 ? -33.492 12.086  -59.423  1.00 2.00  ? 574 TRP B C     1 
ATOM   5461  O  O     . TRP B 2 574 ? -32.438 11.973  -58.898  1.00 2.00  ? 574 TRP B O     1 
ATOM   5462  C  CB    . TRP B 2 574 ? -33.545 14.431  -60.216  1.00 2.15  ? 574 TRP B CB    1 
ATOM   5463  C  CG    . TRP B 2 574 ? -34.389 15.640  -60.439  1.00 13.57 ? 574 TRP B CG    1 
ATOM   5464  C  CD1   . TRP B 2 574 ? -35.218 15.886  -61.499  1.00 23.11 ? 574 TRP B CD1   1 
ATOM   5465  C  CD2   . TRP B 2 574 ? -34.496 16.777  -59.570  1.00 2.00  ? 574 TRP B CD2   1 
ATOM   5466  N  NE1   . TRP B 2 574 ? -35.835 17.108  -61.341  1.00 16.79 ? 574 TRP B NE1   1 
ATOM   5467  C  CE2   . TRP B 2 574 ? -35.425 17.666  -60.157  1.00 15.47 ? 574 TRP B CE2   1 
ATOM   5468  C  CE3   . TRP B 2 574 ? -33.915 17.116  -58.336  1.00 7.89  ? 574 TRP B CE3   1 
ATOM   5469  C  CZ2   . TRP B 2 574 ? -35.794 18.882  -59.551  1.00 29.03 ? 574 TRP B CZ2   1 
ATOM   5470  C  CZ3   . TRP B 2 574 ? -34.288 18.318  -57.722  1.00 29.05 ? 574 TRP B CZ3   1 
ATOM   5471  C  CH2   . TRP B 2 574 ? -35.218 19.195  -58.342  1.00 25.17 ? 574 TRP B CH2   1 
ATOM   5472  N  N     . ASN B 2 575 ? -33.954 11.133  -60.176  1.00 2.00  ? 575 ASN B N     1 
ATOM   5473  C  CA    . ASN B 2 575 ? -33.146 9.974   -60.331  1.00 2.00  ? 575 ASN B CA    1 
ATOM   5474  C  C     . ASN B 2 575 ? -32.383 10.094  -61.649  1.00 2.09  ? 575 ASN B C     1 
ATOM   5475  O  O     . ASN B 2 575 ? -32.975 10.483  -62.644  1.00 2.00  ? 575 ASN B O     1 
ATOM   5476  C  CB    . ASN B 2 575 ? -34.099 8.793   -60.301  1.00 2.00  ? 575 ASN B CB    1 
ATOM   5477  C  CG    . ASN B 2 575 ? -33.384 7.482   -60.373  1.00 2.00  ? 575 ASN B CG    1 
ATOM   5478  O  OD1   . ASN B 2 575 ? -33.356 6.758   -59.403  1.00 11.56 ? 575 ASN B OD1   1 
ATOM   5479  N  ND2   . ASN B 2 575 ? -32.821 7.160   -61.525  1.00 2.00  ? 575 ASN B ND2   1 
ATOM   5480  N  N     . MET B 2 576 ? -31.097 9.759   -61.690  1.00 2.00  ? 576 MET B N     1 
ATOM   5481  C  CA    . MET B 2 576 ? -30.379 9.779   -62.963  1.00 2.00  ? 576 MET B CA    1 
ATOM   5482  C  C     . MET B 2 576 ? -30.510 8.610   -63.882  1.00 2.00  ? 576 MET B C     1 
ATOM   5483  O  O     . MET B 2 576 ? -29.717 8.415   -64.814  1.00 7.95  ? 576 MET B O     1 
ATOM   5484  C  CB    . MET B 2 576 ? -28.956 10.128  -62.722  1.00 2.00  ? 576 MET B CB    1 
ATOM   5485  C  CG    . MET B 2 576 ? -28.977 11.136  -61.571  1.00 6.31  ? 576 MET B CG    1 
ATOM   5486  S  SD    . MET B 2 576 ? -29.081 12.750  -62.404  1.00 6.31  ? 576 MET B SD    1 
ATOM   5487  C  CE    . MET B 2 576 ? -30.710 13.349  -61.848  1.00 2.00  ? 576 MET B CE    1 
ATOM   5488  N  N     . ASP B 2 577 ? -31.528 7.808   -63.718  1.00 2.68  ? 577 ASP B N     1 
ATOM   5489  C  CA    . ASP B 2 577 ? -31.662 6.731   -64.721  1.00 13.86 ? 577 ASP B CA    1 
ATOM   5490  C  C     . ASP B 2 577 ? -31.831 7.233   -66.136  1.00 13.60 ? 577 ASP B C     1 
ATOM   5491  O  O     . ASP B 2 577 ? -30.950 6.973   -66.953  1.00 24.55 ? 577 ASP B O     1 
ATOM   5492  C  CB    . ASP B 2 577 ? -32.701 5.664   -64.346  1.00 18.43 ? 577 ASP B CB    1 
ATOM   5493  C  CG    . ASP B 2 577 ? -34.078 5.935   -64.954  1.00 44.30 ? 577 ASP B CG    1 
ATOM   5494  O  OD1   . ASP B 2 577 ? -34.864 6.719   -64.359  1.00 16.32 ? 577 ASP B OD1   1 
ATOM   5495  O  OD2   . ASP B 2 577 ? -34.381 5.346   -66.024  1.00 66.29 ? 577 ASP B OD2   1 
ATOM   5496  N  N     . GLN B 2 578 ? -32.941 7.912   -66.458  1.00 19.18 ? 578 GLN B N     1 
ATOM   5497  C  CA    . GLN B 2 578 ? -33.506 7.856   -67.873  1.00 45.58 ? 578 GLN B CA    1 
ATOM   5498  C  C     . GLN B 2 578 ? -33.527 6.498   -68.688  1.00 44.63 ? 578 GLN B C     1 
ATOM   5499  O  O     . GLN B 2 578 ? -34.475 6.210   -69.460  1.00 35.12 ? 578 GLN B O     1 
ATOM   5500  C  CB    . GLN B 2 578 ? -32.905 8.966   -68.792  1.00 53.61 ? 578 GLN B CB    1 
ATOM   5501  C  CG    . GLN B 2 578 ? -32.673 8.549   -70.313  1.00 38.67 ? 578 GLN B CG    1 
ATOM   5502  C  CD    . GLN B 2 578 ? -31.662 7.339   -70.547  1.00 57.67 ? 578 GLN B CD    1 
ATOM   5503  O  OE1   . GLN B 2 578 ? -31.219 6.640   -69.606  1.00 41.86 ? 578 GLN B OE1   1 
ATOM   5504  N  NE2   . GLN B 2 578 ? -31.318 7.110   -71.818  1.00 35.77 ? 578 GLN B NE2   1 
ATOM   5505  N  N     . GLN C 3 1   ? -21.912 28.993  -37.129  1.00 2.00  ? 1   GLN C N     1 
ATOM   5506  C  CA    . GLN C 3 1   ? -22.354 27.583  -36.986  1.00 23.66 ? 1   GLN C CA    1 
ATOM   5507  C  C     . GLN C 3 1   ? -22.557 26.951  -38.342  1.00 22.46 ? 1   GLN C C     1 
ATOM   5508  O  O     . GLN C 3 1   ? -22.601 27.627  -39.365  1.00 21.53 ? 1   GLN C O     1 
ATOM   5509  C  CB    . GLN C 3 1   ? -23.647 27.449  -36.172  1.00 27.04 ? 1   GLN C CB    1 
ATOM   5510  C  CG    . GLN C 3 1   ? -24.824 28.264  -36.678  1.00 5.20  ? 1   GLN C CG    1 
ATOM   5511  C  CD    . GLN C 3 1   ? -25.349 29.140  -35.587  1.00 20.94 ? 1   GLN C CD    1 
ATOM   5512  O  OE1   . GLN C 3 1   ? -26.204 28.722  -34.787  1.00 18.45 ? 1   GLN C OE1   1 
ATOM   5513  N  NE2   . GLN C 3 1   ? -24.812 30.366  -35.506  1.00 2.78  ? 1   GLN C NE2   1 
ATOM   5514  N  N     . VAL C 3 2   ? -22.677 25.640  -38.352  1.00 15.69 ? 2   VAL C N     1 
ATOM   5515  C  CA    . VAL C 3 2   ? -22.963 25.042  -39.591  1.00 9.83  ? 2   VAL C CA    1 
ATOM   5516  C  C     . VAL C 3 2   ? -24.103 24.139  -39.430  1.00 7.32  ? 2   VAL C C     1 
ATOM   5517  O  O     . VAL C 3 2   ? -24.330 23.643  -38.344  1.00 2.00  ? 2   VAL C O     1 
ATOM   5518  C  CB    . VAL C 3 2   ? -21.790 24.390  -40.178  1.00 9.28  ? 2   VAL C CB    1 
ATOM   5519  C  CG1   . VAL C 3 2   ? -22.012 24.398  -41.692  1.00 9.16  ? 2   VAL C CG1   1 
ATOM   5520  C  CG2   . VAL C 3 2   ? -20.561 25.243  -39.808  1.00 3.11  ? 2   VAL C CG2   1 
ATOM   5521  N  N     . VAL C 3 3   ? -24.872 23.987  -40.503  1.00 7.85  ? 3   VAL C N     1 
ATOM   5522  C  CA    . VAL C 3 3   ? -26.073 23.193  -40.428  1.00 5.99  ? 3   VAL C CA    1 
ATOM   5523  C  C     . VAL C 3 3   ? -25.739 21.741  -40.132  1.00 9.67  ? 3   VAL C C     1 
ATOM   5524  O  O     . VAL C 3 3   ? -24.807 21.160  -40.706  1.00 4.06  ? 3   VAL C O     1 
ATOM   5525  C  CB    . VAL C 3 3   ? -26.872 23.296  -41.679  1.00 6.60  ? 3   VAL C CB    1 
ATOM   5526  C  CG1   . VAL C 3 3   ? -28.034 22.265  -41.645  1.00 2.00  ? 3   VAL C CG1   1 
ATOM   5527  C  CG2   . VAL C 3 3   ? -27.382 24.736  -41.774  1.00 2.00  ? 3   VAL C CG2   1 
ATOM   5528  N  N     . GLY C 3 4   ? -26.474 21.157  -39.197  1.00 6.25  ? 4   GLY C N     1 
ATOM   5529  C  CA    . GLY C 3 4   ? -26.197 19.770  -38.869  1.00 6.04  ? 4   GLY C CA    1 
ATOM   5530  C  C     . GLY C 3 4   ? -24.882 19.503  -38.114  1.00 10.46 ? 4   GLY C C     1 
ATOM   5531  O  O     . GLY C 3 4   ? -24.536 18.350  -37.853  1.00 7.15  ? 4   GLY C O     1 
ATOM   5532  N  N     . TRP C 3 5   ? -24.129 20.532  -37.772  1.00 2.00  ? 5   TRP C N     1 
ATOM   5533  C  CA    . TRP C 3 5   ? -22.983 20.318  -36.949  1.00 3.18  ? 5   TRP C CA    1 
ATOM   5534  C  C     . TRP C 3 5   ? -23.010 21.068  -35.660  1.00 4.77  ? 5   TRP C C     1 
ATOM   5535  O  O     . TRP C 3 5   ? -23.496 22.181  -35.562  1.00 4.50  ? 5   TRP C O     1 
ATOM   5536  C  CB    . TRP C 3 5   ? -21.779 20.694  -37.692  1.00 2.05  ? 5   TRP C CB    1 
ATOM   5537  C  CG    . TRP C 3 5   ? -20.605 20.183  -37.094  1.00 15.03 ? 5   TRP C CG    1 
ATOM   5538  C  CD1   . TRP C 3 5   ? -19.785 20.835  -36.219  1.00 4.71  ? 5   TRP C CD1   1 
ATOM   5539  C  CD2   . TRP C 3 5   ? -20.018 18.907  -37.342  1.00 4.62  ? 5   TRP C CD2   1 
ATOM   5540  N  NE1   . TRP C 3 5   ? -18.698 20.034  -35.907  1.00 6.31  ? 5   TRP C NE1   1 
ATOM   5541  C  CE2   . TRP C 3 5   ? -18.831 18.836  -36.574  1.00 24.84 ? 5   TRP C CE2   1 
ATOM   5542  C  CE3   . TRP C 3 5   ? -20.369 17.825  -38.139  1.00 10.76 ? 5   TRP C CE3   1 
ATOM   5543  C  CZ2   . TRP C 3 5   ? -18.001 17.677  -36.555  1.00 2.00  ? 5   TRP C CZ2   1 
ATOM   5544  C  CZ3   . TRP C 3 5   ? -19.532 16.686  -38.163  1.00 16.06 ? 5   TRP C CZ3   1 
ATOM   5545  C  CH2   . TRP C 3 5   ? -18.363 16.619  -37.357  1.00 8.44  ? 5   TRP C CH2   1 
ATOM   5546  N  N     . PRO C 3 6   ? -22.518 20.445  -34.621  1.00 4.77  ? 6   PRO C N     1 
ATOM   5547  C  CA    . PRO C 3 6   ? -21.984 19.118  -34.613  1.00 5.17  ? 6   PRO C CA    1 
ATOM   5548  C  C     . PRO C 3 6   ? -23.102 18.070  -34.621  1.00 5.75  ? 6   PRO C C     1 
ATOM   5549  O  O     . PRO C 3 6   ? -24.228 18.357  -34.322  1.00 2.00  ? 6   PRO C O     1 
ATOM   5550  C  CB    . PRO C 3 6   ? -21.268 19.059  -33.264  1.00 9.70  ? 6   PRO C CB    1 
ATOM   5551  C  CG    . PRO C 3 6   ? -22.125 20.018  -32.345  1.00 6.87  ? 6   PRO C CG    1 
ATOM   5552  C  CD    . PRO C 3 6   ? -22.521 21.108  -33.291  1.00 7.10  ? 6   PRO C CD    1 
ATOM   5553  N  N     . PRO C 3 7   ? -22.780 16.827  -34.949  1.00 9.13  ? 7   PRO C N     1 
ATOM   5554  C  CA    . PRO C 3 7   ? -23.891 15.955  -35.330  1.00 8.86  ? 7   PRO C CA    1 
ATOM   5555  C  C     . PRO C 3 7   ? -24.558 15.310  -34.144  1.00 11.10 ? 7   PRO C C     1 
ATOM   5556  O  O     . PRO C 3 7   ? -24.069 14.341  -33.618  1.00 8.57  ? 7   PRO C O     1 
ATOM   5557  C  CB    . PRO C 3 7   ? -23.250 14.937  -36.214  1.00 9.42  ? 7   PRO C CB    1 
ATOM   5558  C  CG    . PRO C 3 7   ? -21.763 14.891  -35.673  1.00 9.83  ? 7   PRO C CG    1 
ATOM   5559  C  CD    . PRO C 3 7   ? -21.465 16.193  -35.054  1.00 7.49  ? 7   PRO C CD    1 
ATOM   5560  N  N     . VAL C 3 8   ? -25.714 15.829  -33.750  1.00 4.08  ? 8   VAL C N     1 
ATOM   5561  C  CA    . VAL C 3 8   ? -26.245 15.500  -32.484  1.00 2.17  ? 8   VAL C CA    1 
ATOM   5562  C  C     . VAL C 3 8   ? -27.736 15.751  -32.680  1.00 3.67  ? 8   VAL C C     1 
ATOM   5563  O  O     . VAL C 3 8   ? -28.100 16.535  -33.538  1.00 10.24 ? 8   VAL C O     1 
ATOM   5564  C  CB    . VAL C 3 8   ? -25.623 16.525  -31.551  1.00 8.80  ? 8   VAL C CB    1 
ATOM   5565  C  CG1   . VAL C 3 8   ? -26.637 17.297  -30.809  1.00 2.69  ? 8   VAL C CG1   1 
ATOM   5566  C  CG2   . VAL C 3 8   ? -24.581 15.904  -30.697  1.00 14.67 ? 8   VAL C CG2   1 
ATOM   5567  N  N     . ARG C 3 9   ? -28.588 15.196  -31.852  1.00 4.82  ? 9   ARG C N     1 
ATOM   5568  C  CA    . ARG C 3 9   ? -29.984 15.488  -32.021  1.00 4.19  ? 9   ARG C CA    1 
ATOM   5569  C  C     . ARG C 3 9   ? -30.613 16.531  -31.099  1.00 13.87 ? 9   ARG C C     1 
ATOM   5570  O  O     . ARG C 3 9   ? -31.831 16.621  -31.016  1.00 15.86 ? 9   ARG C O     1 
ATOM   5571  C  CB    . ARG C 3 9   ? -30.777 14.202  -32.096  1.00 15.01 ? 9   ARG C CB    1 
ATOM   5572  C  CG    . ARG C 3 9   ? -30.338 13.333  -33.244  1.00 27.85 ? 9   ARG C CG    1 
ATOM   5573  C  CD    . ARG C 3 9   ? -30.830 11.914  -33.184  1.00 20.06 ? 9   ARG C CD    1 
ATOM   5574  N  NE    . ARG C 3 9   ? -32.188 11.810  -33.690  1.00 11.30 ? 9   ARG C NE    1 
ATOM   5575  C  CZ    . ARG C 3 9   ? -32.856 10.677  -33.797  1.00 28.52 ? 9   ARG C CZ    1 
ATOM   5576  N  NH1   . ARG C 3 9   ? -32.289 9.536   -33.444  1.00 2.00  ? 9   ARG C NH1   1 
ATOM   5577  N  NH2   . ARG C 3 9   ? -34.094 10.686  -34.268  1.00 2.00  ? 9   ARG C NH2   1 
ATOM   5578  N  N     . ASN C 3 10  ? -29.785 17.342  -30.444  1.00 6.76  ? 10  ASN C N     1 
ATOM   5579  C  CA    . ASN C 3 10  ? -30.246 18.467  -29.624  1.00 7.77  ? 10  ASN C CA    1 
ATOM   5580  C  C     . ASN C 3 10  ? -30.848 19.645  -30.398  1.00 5.44  ? 10  ASN C C     1 
ATOM   5581  O  O     . ASN C 3 10  ? -30.798 19.675  -31.616  1.00 2.49  ? 10  ASN C O     1 
ATOM   5582  C  CB    . ASN C 3 10  ? -29.108 18.963  -28.733  1.00 2.69  ? 10  ASN C CB    1 
ATOM   5583  C  CG    . ASN C 3 10  ? -28.344 17.834  -28.071  1.00 12.64 ? 10  ASN C CG    1 
ATOM   5584  O  OD1   . ASN C 3 10  ? -28.099 16.798  -28.674  1.00 2.00  ? 10  ASN C OD1   1 
ATOM   5585  N  ND2   . ASN C 3 10  ? -27.962 18.036  -26.825  1.00 2.00  ? 10  ASN C ND2   1 
ATOM   5586  N  N     . TYR C 3 11  ? -31.415 20.616  -29.687  1.00 12.39 ? 11  TYR C N     1 
ATOM   5587  C  CA    . TYR C 3 11  ? -32.507 21.416  -30.237  1.00 17.24 ? 11  TYR C CA    1 
ATOM   5588  C  C     . TYR C 3 11  ? -32.133 22.636  -31.084  1.00 12.72 ? 11  TYR C C     1 
ATOM   5589  O  O     . TYR C 3 11  ? -32.865 23.020  -31.997  1.00 11.00 ? 11  TYR C O     1 
ATOM   5590  C  CB    . TYR C 3 11  ? -33.545 21.780  -29.178  1.00 14.40 ? 11  TYR C CB    1 
ATOM   5591  C  CG    . TYR C 3 11  ? -34.858 21.059  -29.372  1.00 16.28 ? 11  TYR C CG    1 
ATOM   5592  C  CD1   . TYR C 3 11  ? -35.655 20.726  -28.297  1.00 2.00  ? 11  TYR C CD1   1 
ATOM   5593  C  CD2   . TYR C 3 11  ? -35.284 20.689  -30.636  1.00 5.23  ? 11  TYR C CD2   1 
ATOM   5594  C  CE1   . TYR C 3 11  ? -36.839 20.059  -28.471  1.00 15.07 ? 11  TYR C CE1   1 
ATOM   5595  C  CE2   . TYR C 3 11  ? -36.471 20.020  -30.817  1.00 13.68 ? 11  TYR C CE2   1 
ATOM   5596  C  CZ    . TYR C 3 11  ? -37.246 19.708  -29.731  1.00 12.51 ? 11  TYR C CZ    1 
ATOM   5597  O  OH    . TYR C 3 11  ? -38.435 19.037  -29.900  1.00 6.53  ? 11  TYR C OH    1 
ATOM   5598  N  N     . ARG C 3 12  ? -31.000 23.247  -30.790  1.00 2.00  ? 12  ARG C N     1 
ATOM   5599  C  CA    . ARG C 3 12  ? -30.765 24.596  -31.254  1.00 10.84 ? 12  ARG C CA    1 
ATOM   5600  C  C     . ARG C 3 12  ? -29.426 24.781  -31.948  1.00 14.40 ? 12  ARG C C     1 
ATOM   5601  O  O     . ARG C 3 12  ? -28.418 25.015  -31.307  1.00 23.71 ? 12  ARG C O     1 
ATOM   5602  C  CB    . ARG C 3 12  ? -30.932 25.578  -30.107  1.00 2.00  ? 12  ARG C CB    1 
ATOM   5603  C  CG    . ARG C 3 12  ? -32.338 25.574  -29.552  1.00 2.00  ? 12  ARG C CG    1 
ATOM   5604  C  CD    . ARG C 3 12  ? -32.405 25.708  -28.065  1.00 2.00  ? 12  ARG C CD    1 
ATOM   5605  N  NE    . ARG C 3 12  ? -31.071 25.793  -27.498  1.00 2.00  ? 12  ARG C NE    1 
ATOM   5606  C  CZ    . ARG C 3 12  ? -30.448 26.925  -27.224  1.00 18.16 ? 12  ARG C CZ    1 
ATOM   5607  N  NH1   . ARG C 3 12  ? -31.031 28.093  -27.459  1.00 2.00  ? 12  ARG C NH1   1 
ATOM   5608  N  NH2   . ARG C 3 12  ? -29.231 26.890  -26.712  1.00 11.31 ? 12  ARG C NH2   1 
ATOM   5609  N  N     . LYS C 3 13  ? -29.434 24.654  -33.266  1.00 14.90 ? 13  LYS C N     1 
ATOM   5610  C  CA    . LYS C 3 13  ? -28.369 25.141  -34.130  1.00 14.36 ? 13  LYS C CA    1 
ATOM   5611  C  C     . LYS C 3 13  ? -27.766 24.048  -34.984  1.00 12.70 ? 13  LYS C C     1 
ATOM   5612  O  O     . LYS C 3 13  ? -26.549 24.008  -35.178  1.00 7.74  ? 13  LYS C O     1 
ATOM   5613  C  CB    . LYS C 3 13  ? -27.261 25.789  -33.320  1.00 19.59 ? 13  LYS C CB    1 
ATOM   5614  C  CG    . LYS C 3 13  ? -25.989 25.970  -34.112  1.00 14.07 ? 13  LYS C CG    1 
ATOM   5615  C  CD    . LYS C 3 13  ? -24.902 24.963  -33.732  1.00 7.80  ? 13  LYS C CD    1 
ATOM   5616  C  CE    . LYS C 3 13  ? -23.583 25.671  -33.397  1.00 2.00  ? 13  LYS C CE    1 
ATOM   5617  N  NZ    . LYS C 3 13  ? -22.432 24.749  -33.282  1.00 2.00  ? 13  LYS C NZ    1 
ATOM   5618  O  OXT   . LYS C 3 13  ? -27.815 23.808  -35.341  1.00 10.01 ? 13  LYS C OXT   1 
ATOM   5619  N  N     . LYS D 1 5   ? 11.152  -57.059 -102.702 1.00 2.00  ? 5   LYS D N     1 
ATOM   5620  C  CA    . LYS D 1 5   ? 12.602  -56.768 -102.520 1.00 4.93  ? 5   LYS D CA    1 
ATOM   5621  C  C     . LYS D 1 5   ? 13.181  -56.383 -101.127 1.00 6.42  ? 5   LYS D C     1 
ATOM   5622  O  O     . LYS D 1 5   ? 14.275  -56.838 -100.816 1.00 12.10 ? 5   LYS D O     1 
ATOM   5623  C  CB    . LYS D 1 5   ? 13.194  -55.949 -103.675 1.00 2.00  ? 5   LYS D CB    1 
ATOM   5624  C  CG    . LYS D 1 5   ? 14.672  -55.630 -103.495 1.00 3.68  ? 5   LYS D CG    1 
ATOM   5625  C  CD    . LYS D 1 5   ? 15.219  -54.972 -104.740 1.00 2.00  ? 5   LYS D CD    1 
ATOM   5626  C  CE    . LYS D 1 5   ? 14.053  -54.449 -105.537 1.00 3.03  ? 5   LYS D CE    1 
ATOM   5627  N  NZ    . LYS D 1 5   ? 13.834  -55.384 -106.644 1.00 2.00  ? 5   LYS D NZ    1 
ATOM   5628  N  N     . ILE D 1 6   ? 12.507  -55.580 -100.284 1.00 2.00  ? 6   ILE D N     1 
ATOM   5629  C  CA    . ILE D 1 6   ? 12.924  -55.493 -98.864  1.00 2.00  ? 6   ILE D CA    1 
ATOM   5630  C  C     . ILE D 1 6   ? 11.800  -55.882 -97.936  1.00 2.00  ? 6   ILE D C     1 
ATOM   5631  O  O     . ILE D 1 6   ? 10.651  -55.590 -98.238  1.00 4.76  ? 6   ILE D O     1 
ATOM   5632  C  CB    . ILE D 1 6   ? 13.484  -54.067 -98.440  1.00 6.93  ? 6   ILE D CB    1 
ATOM   5633  C  CG1   . ILE D 1 6   ? 14.891  -53.801 -99.034  1.00 9.77  ? 6   ILE D CG1   1 
ATOM   5634  C  CG2   . ILE D 1 6   ? 13.566  -53.895 -96.906  1.00 2.00  ? 6   ILE D CG2   1 
ATOM   5635  C  CD1   . ILE D 1 6   ? 15.825  -55.055 -99.201  1.00 9.37  ? 6   ILE D CD1   1 
ATOM   5636  N  N     . VAL D 1 7   ? 12.120  -56.537 -96.819  1.00 2.00  ? 7   VAL D N     1 
ATOM   5637  C  CA    . VAL D 1 7   ? 11.085  -56.993 -95.890  1.00 3.84  ? 7   VAL D CA    1 
ATOM   5638  C  C     . VAL D 1 7   ? 11.123  -56.196 -94.570  1.00 10.12 ? 7   VAL D C     1 
ATOM   5639  O  O     . VAL D 1 7   ? 12.157  -56.181 -93.907  1.00 22.67 ? 7   VAL D O     1 
ATOM   5640  C  CB    . VAL D 1 7   ? 11.214  -58.535 -95.535  1.00 13.26 ? 7   VAL D CB    1 
ATOM   5641  C  CG1   . VAL D 1 7   ? 10.095  -58.972 -94.564  1.00 2.00  ? 7   VAL D CG1   1 
ATOM   5642  C  CG2   . VAL D 1 7   ? 11.246  -59.438 -96.802  1.00 2.00  ? 7   VAL D CG2   1 
ATOM   5643  N  N     . LEU D 1 8   ? 10.006  -55.562 -94.194  1.00 2.00  ? 8   LEU D N     1 
ATOM   5644  C  CA    . LEU D 1 8   ? 9.877   -54.863 -92.904  1.00 7.01  ? 8   LEU D CA    1 
ATOM   5645  C  C     . LEU D 1 8   ? 8.973   -55.632 -91.949  1.00 5.10  ? 8   LEU D C     1 
ATOM   5646  O  O     . LEU D 1 8   ? 7.921   -56.128 -92.365  1.00 7.67  ? 8   LEU D O     1 
ATOM   5647  C  CB    . LEU D 1 8   ? 9.339   -53.404 -93.096  1.00 2.00  ? 8   LEU D CB    1 
ATOM   5648  C  CG    . LEU D 1 8   ? 9.805   -52.767 -94.405  1.00 2.29  ? 8   LEU D CG    1 
ATOM   5649  C  CD1   . LEU D 1 8   ? 9.064   -51.507 -94.741  1.00 2.00  ? 8   LEU D CD1   1 
ATOM   5650  C  CD2   . LEU D 1 8   ? 11.295  -52.527 -94.384  1.00 2.00  ? 8   LEU D CD2   1 
ATOM   5651  N  N     . LYS D 1 9   ? 9.336   -55.702 -90.670  1.00 2.00  ? 9   LYS D N     1 
ATOM   5652  C  CA    . LYS D 1 9   ? 8.483   -56.393 -89.717  1.00 2.00  ? 9   LYS D CA    1 
ATOM   5653  C  C     . LYS D 1 9   ? 7.986   -55.468 -88.646  1.00 2.00  ? 9   LYS D C     1 
ATOM   5654  O  O     . LYS D 1 9   ? 8.760   -54.725 -88.097  1.00 2.00  ? 9   LYS D O     1 
ATOM   5655  C  CB    . LYS D 1 9   ? 9.252   -57.518 -89.035  1.00 5.75  ? 9   LYS D CB    1 
ATOM   5656  C  CG    . LYS D 1 9   ? 9.847   -58.549 -89.960  1.00 2.00  ? 9   LYS D CG    1 
ATOM   5657  C  CD    . LYS D 1 9   ? 11.073  -59.238 -89.288  1.00 38.80 ? 9   LYS D CD    1 
ATOM   5658  C  CE    . LYS D 1 9   ? 11.003  -60.778 -89.322  1.00 19.12 ? 9   LYS D CE    1 
ATOM   5659  N  NZ    . LYS D 1 9   ? 11.151  -61.335 -87.948  1.00 5.50  ? 9   LYS D NZ    1 
ATOM   5660  N  N     . SER D 1 10  ? 6.712   -55.529 -88.312  1.00 2.00  ? 10  SER D N     1 
ATOM   5661  C  CA    . SER D 1 10  ? 6.179   -54.518 -87.448  1.00 2.00  ? 10  SER D CA    1 
ATOM   5662  C  C     . SER D 1 10  ? 6.485   -54.922 -86.048  1.00 2.00  ? 10  SER D C     1 
ATOM   5663  O  O     . SER D 1 10  ? 7.148   -55.941 -85.839  1.00 3.70  ? 10  SER D O     1 
ATOM   5664  C  CB    . SER D 1 10  ? 4.677   -54.394 -87.633  1.00 2.00  ? 10  SER D CB    1 
ATOM   5665  O  OG    . SER D 1 10  ? 4.003   -55.501 -87.114  1.00 2.00  ? 10  SER D OG    1 
ATOM   5666  N  N     . SER D 1 11  ? 6.011   -54.157 -85.071  1.00 2.00  ? 11  SER D N     1 
ATOM   5667  C  CA    . SER D 1 11  ? 6.403   -54.434 -83.707  1.00 2.08  ? 11  SER D CA    1 
ATOM   5668  C  C     . SER D 1 11  ? 5.582   -55.594 -83.158  1.00 10.49 ? 11  SER D C     1 
ATOM   5669  O  O     . SER D 1 11  ? 5.821   -56.087 -82.027  1.00 3.55  ? 11  SER D O     1 
ATOM   5670  C  CB    . SER D 1 11  ? 6.237   -53.216 -82.828  1.00 2.00  ? 11  SER D CB    1 
ATOM   5671  O  OG    . SER D 1 11  ? 4.888   -52.850 -82.793  1.00 2.00  ? 11  SER D OG    1 
ATOM   5672  N  N     . ASP D 1 12  ? 4.619   -56.051 -83.961  1.00 6.68  ? 12  ASP D N     1 
ATOM   5673  C  CA    . ASP D 1 12  ? 3.972   -57.320 -83.619  1.00 12.13 ? 12  ASP D CA    1 
ATOM   5674  C  C     . ASP D 1 12  ? 4.157   -58.400 -84.654  1.00 2.86  ? 12  ASP D C     1 
ATOM   5675  O  O     . ASP D 1 12  ? 3.216   -59.050 -85.039  1.00 2.75  ? 12  ASP D O     1 
ATOM   5676  C  CB    . ASP D 1 12  ? 2.495   -57.153 -83.214  1.00 20.17 ? 12  ASP D CB    1 
ATOM   5677  C  CG    . ASP D 1 12  ? 1.846   -55.936 -83.853  1.00 8.28  ? 12  ASP D CG    1 
ATOM   5678  O  OD1   . ASP D 1 12  ? 1.086   -55.223 -83.161  1.00 2.00  ? 12  ASP D OD1   1 
ATOM   5679  O  OD2   . ASP D 1 12  ? 2.125   -55.709 -85.047  1.00 11.67 ? 12  ASP D OD2   1 
ATOM   5680  N  N     . GLY D 1 13  ? 5.387   -58.590 -85.091  1.00 2.00  ? 13  GLY D N     1 
ATOM   5681  C  CA    . GLY D 1 13  ? 5.781   -59.835 -85.664  1.00 2.00  ? 13  GLY D CA    1 
ATOM   5682  C  C     . GLY D 1 13  ? 5.418   -59.974 -87.128  1.00 2.00  ? 13  GLY D C     1 
ATOM   5683  O  O     . GLY D 1 13  ? 5.959   -60.846 -87.751  1.00 2.51  ? 13  GLY D O     1 
ATOM   5684  N  N     . GLU D 1 14  ? 4.490   -59.183 -87.692  1.00 2.00  ? 14  GLU D N     1 
ATOM   5685  C  CA    . GLU D 1 14  ? 3.931   -59.542 -89.010  1.00 2.00  ? 14  GLU D CA    1 
ATOM   5686  C  C     . GLU D 1 14  ? 4.831   -58.862 -89.930  1.00 3.80  ? 14  GLU D C     1 
ATOM   5687  O  O     . GLU D 1 14  ? 5.427   -57.864 -89.568  1.00 15.77 ? 14  GLU D O     1 
ATOM   5688  C  CB    . GLU D 1 14  ? 2.590   -58.937 -89.254  1.00 2.00  ? 14  GLU D CB    1 
ATOM   5689  C  CG    . GLU D 1 14  ? 1.679   -59.131 -88.186  1.00 2.00  ? 14  GLU D CG    1 
ATOM   5690  C  CD    . GLU D 1 14  ? 0.342   -59.072 -88.703  1.00 2.00  ? 14  GLU D CD    1 
ATOM   5691  O  OE1   . GLU D 1 14  ? -0.095  -57.925 -88.865  1.00 9.60  ? 14  GLU D OE1   1 
ATOM   5692  O  OE2   . GLU D 1 14  ? -0.277  -60.139 -88.994  1.00 2.00  ? 14  GLU D OE2   1 
ATOM   5693  N  N     . SER D 1 15  ? 4.955   -59.347 -91.135  1.00 2.00  ? 15  SER D N     1 
ATOM   5694  C  CA    . SER D 1 15  ? 6.008   -58.810 -91.882  1.00 2.00  ? 15  SER D CA    1 
ATOM   5695  C  C     . SER D 1 15  ? 5.568   -58.389 -93.289  1.00 2.00  ? 15  SER D C     1 
ATOM   5696  O  O     . SER D 1 15  ? 4.549   -58.862 -93.753  1.00 15.16 ? 15  SER D O     1 
ATOM   5697  C  CB    . SER D 1 15  ? 7.227   -59.744 -91.777  1.00 2.00  ? 15  SER D CB    1 
ATOM   5698  O  OG    . SER D 1 15  ? 7.195   -60.762 -92.735  1.00 2.00  ? 15  SER D OG    1 
ATOM   5699  N  N     . PHE D 1 16  ? 6.314   -57.488 -93.947  1.00 5.44  ? 16  PHE D N     1 
ATOM   5700  C  CA    . PHE D 1 16  ? 5.805   -56.592 -95.040  1.00 2.00  ? 16  PHE D CA    1 
ATOM   5701  C  C     . PHE D 1 16  ? 6.827   -56.587 -96.161  1.00 2.00  ? 16  PHE D C     1 
ATOM   5702  O  O     . PHE D 1 16  ? 8.024   -56.553 -95.914  1.00 2.00  ? 16  PHE D O     1 
ATOM   5703  C  CB    . PHE D 1 16  ? 5.612   -55.117 -94.552  1.00 2.00  ? 16  PHE D CB    1 
ATOM   5704  C  CG    . PHE D 1 16  ? 4.314   -54.858 -93.770  1.00 2.00  ? 16  PHE D CG    1 
ATOM   5705  C  CD1   . PHE D 1 16  ? 4.193   -55.227 -92.434  1.00 2.00  ? 16  PHE D CD1   1 
ATOM   5706  C  CD2   . PHE D 1 16  ? 3.254   -54.242 -94.365  1.00 2.00  ? 16  PHE D CD2   1 
ATOM   5707  C  CE1   . PHE D 1 16  ? 3.036   -55.006 -91.742  1.00 2.00  ? 16  PHE D CE1   1 
ATOM   5708  C  CE2   . PHE D 1 16  ? 2.100   -54.004 -93.661  1.00 2.00  ? 16  PHE D CE2   1 
ATOM   5709  C  CZ    . PHE D 1 16  ? 1.998   -54.390 -92.349  1.00 2.00  ? 16  PHE D CZ    1 
ATOM   5710  N  N     . GLU D 1 17  ? 6.368   -56.661 -97.400  1.00 5.92  ? 17  GLU D N     1 
ATOM   5711  C  CA    . GLU D 1 17  ? 7.322   -56.745 -98.516  1.00 6.62  ? 17  GLU D CA    1 
ATOM   5712  C  C     . GLU D 1 17  ? 7.204   -55.604 -99.461  1.00 14.89 ? 17  GLU D C     1 
ATOM   5713  O  O     . GLU D 1 17  ? 6.132   -55.436 -100.088 1.00 10.73 ? 17  GLU D O     1 
ATOM   5714  C  CB    . GLU D 1 17  ? 7.187   -58.047 -99.323  1.00 12.99 ? 17  GLU D CB    1 
ATOM   5715  C  CG    . GLU D 1 17  ? 8.555   -58.654 -99.786  1.00 8.25  ? 17  GLU D CG    1 
ATOM   5716  C  CD    . GLU D 1 17  ? 8.377   -59.738 -100.869 1.00 18.07 ? 17  GLU D CD    1 
ATOM   5717  O  OE1   . GLU D 1 17  ? 7.297   -59.755 -101.507 1.00 13.35 ? 17  GLU D OE1   1 
ATOM   5718  O  OE2   . GLU D 1 17  ? 9.315   -60.553 -101.098 1.00 2.26  ? 17  GLU D OE2   1 
ATOM   5719  N  N     . VAL D 1 18  ? 8.288   -54.827 -99.591  1.00 4.65  ? 18  VAL D N     1 
ATOM   5720  C  CA    . VAL D 1 18  ? 8.182   -53.567 -100.347 1.00 12.64 ? 18  VAL D CA    1 
ATOM   5721  C  C     . VAL D 1 18  ? 9.275   -53.519 -101.395 1.00 10.14 ? 18  VAL D C     1 
ATOM   5722  O  O     . VAL D 1 18  ? 10.368  -54.053 -101.166 1.00 17.31 ? 18  VAL D O     1 
ATOM   5723  C  CB    . VAL D 1 18  ? 8.296   -52.324 -99.411  1.00 15.15 ? 18  VAL D CB    1 
ATOM   5724  C  CG1   . VAL D 1 18  ? 7.017   -52.178 -98.541  1.00 2.00  ? 18  VAL D CG1   1 
ATOM   5725  C  CG2   . VAL D 1 18  ? 9.569   -52.435 -98.546  1.00 2.00  ? 18  VAL D CG2   1 
ATOM   5726  N  N     . GLU D 1 19  ? 9.027   -52.876 -102.530 1.00 2.00  ? 19  GLU D N     1 
ATOM   5727  C  CA    . GLU D 1 19  ? 10.139  -52.695 -103.428 1.00 3.36  ? 19  GLU D CA    1 
ATOM   5728  C  C     . GLU D 1 19  ? 11.151  -51.825 -102.719 1.00 13.75 ? 19  GLU D C     1 
ATOM   5729  O  O     . GLU D 1 19  ? 10.789  -50.900 -101.984 1.00 14.21 ? 19  GLU D O     1 
ATOM   5730  C  CB    . GLU D 1 19  ? 9.732   -52.038 -104.738 1.00 15.25 ? 19  GLU D CB    1 
ATOM   5731  C  CG    . GLU D 1 19  ? 8.560   -52.697 -105.476 1.00 19.47 ? 19  GLU D CG    1 
ATOM   5732  C  CD    . GLU D 1 19  ? 7.786   -51.676 -106.315 1.00 18.87 ? 19  GLU D CD    1 
ATOM   5733  O  OE1   . GLU D 1 19  ? 8.202   -51.429 -107.463 1.00 14.40 ? 19  GLU D OE1   1 
ATOM   5734  O  OE2   . GLU D 1 19  ? 6.787   -51.097 -105.820 1.00 2.00  ? 19  GLU D OE2   1 
ATOM   5735  N  N     . GLU D 1 20  ? 12.429  -52.097 -102.952 1.00 22.91 ? 20  GLU D N     1 
ATOM   5736  C  CA    . GLU D 1 20  ? 13.471  -51.322 -102.285 1.00 24.05 ? 20  GLU D CA    1 
ATOM   5737  C  C     . GLU D 1 20  ? 13.408  -49.775 -102.288 1.00 18.81 ? 20  GLU D C     1 
ATOM   5738  O  O     . GLU D 1 20  ? 13.779  -49.163 -101.293 1.00 13.88 ? 20  GLU D O     1 
ATOM   5739  C  CB    . GLU D 1 20  ? 14.870  -51.912 -102.488 1.00 19.76 ? 20  GLU D CB    1 
ATOM   5740  C  CG    . GLU D 1 20  ? 15.956  -50.905 -102.683 1.00 18.72 ? 20  GLU D CG    1 
ATOM   5741  C  CD    . GLU D 1 20  ? 16.225  -50.726 -104.146 1.00 28.52 ? 20  GLU D CD    1 
ATOM   5742  O  OE1   . GLU D 1 20  ? 15.271  -50.865 -104.948 1.00 34.18 ? 20  GLU D OE1   1 
ATOM   5743  O  OE2   . GLU D 1 20  ? 17.383  -50.476 -104.501 1.00 15.19 ? 20  GLU D OE2   1 
ATOM   5744  N  N     . ALA D 1 21  ? 12.901  -49.155 -103.360 1.00 17.95 ? 21  ALA D N     1 
ATOM   5745  C  CA    . ALA D 1 21  ? 12.599  -47.704 -103.363 1.00 13.04 ? 21  ALA D CA    1 
ATOM   5746  C  C     . ALA D 1 21  ? 11.582  -47.264 -102.303 1.00 11.59 ? 21  ALA D C     1 
ATOM   5747  O  O     . ALA D 1 21  ? 11.810  -46.344 -101.535 1.00 4.66  ? 21  ALA D O     1 
ATOM   5748  C  CB    . ALA D 1 21  ? 12.140  -47.241 -104.747 1.00 15.40 ? 21  ALA D CB    1 
ATOM   5749  N  N     . VAL D 1 22  ? 10.436  -47.903 -102.246 1.00 8.05  ? 22  VAL D N     1 
ATOM   5750  C  CA    . VAL D 1 22  ? 9.558   -47.574 -101.158 1.00 2.00  ? 22  VAL D CA    1 
ATOM   5751  C  C     . VAL D 1 22  ? 10.284  -47.577 -99.766  1.00 9.32  ? 22  VAL D C     1 
ATOM   5752  O  O     . VAL D 1 22  ? 10.212  -46.624 -99.009  1.00 2.00  ? 22  VAL D O     1 
ATOM   5753  C  CB    . VAL D 1 22  ? 8.260   -48.413 -101.236 1.00 2.00  ? 22  VAL D CB    1 
ATOM   5754  C  CG1   . VAL D 1 22  ? 7.407   -48.203 -99.995  1.00 2.00  ? 22  VAL D CG1   1 
ATOM   5755  C  CG2   . VAL D 1 22  ? 7.469   -48.049 -102.528 1.00 2.00  ? 22  VAL D CG2   1 
ATOM   5756  N  N     . ALA D 1 23  ? 11.019  -48.632 -99.430  1.00 18.25 ? 23  ALA D N     1 
ATOM   5757  C  CA    . ALA D 1 23  ? 11.657  -48.708 -98.098  1.00 14.04 ? 23  ALA D CA    1 
ATOM   5758  C  C     . ALA D 1 23  ? 12.677  -47.606 -97.758  1.00 13.78 ? 23  ALA D C     1 
ATOM   5759  O  O     . ALA D 1 23  ? 12.740  -47.152 -96.603  1.00 17.24 ? 23  ALA D O     1 
ATOM   5760  C  CB    . ALA D 1 23  ? 12.275  -50.077 -97.861  1.00 15.03 ? 23  ALA D CB    1 
ATOM   5761  N  N     . LEU D 1 24  ? 13.378  -47.114 -98.765  1.00 7.17  ? 24  LEU D N     1 
ATOM   5762  C  CA    . LEU D 1 24  ? 14.439  -46.149 -98.547  1.00 8.97  ? 24  LEU D CA    1 
ATOM   5763  C  C     . LEU D 1 24  ? 13.975  -44.713 -98.437  1.00 5.45  ? 24  LEU D C     1 
ATOM   5764  O  O     . LEU D 1 24  ? 14.773  -43.822 -98.197  1.00 20.50 ? 24  LEU D O     1 
ATOM   5765  C  CB    . LEU D 1 24  ? 15.510  -46.288 -99.612  1.00 3.98  ? 24  LEU D CB    1 
ATOM   5766  C  CG    . LEU D 1 24  ? 16.361  -47.519 -99.372  1.00 2.00  ? 24  LEU D CG    1 
ATOM   5767  C  CD1   . LEU D 1 24  ? 17.032  -47.947 -100.634 1.00 13.83 ? 24  LEU D CD1   1 
ATOM   5768  C  CD2   . LEU D 1 24  ? 17.357  -47.209 -98.315  1.00 2.00  ? 24  LEU D CD2   1 
ATOM   5769  N  N     . GLU D 1 25  ? 12.678  -44.494 -98.582  1.00 10.53 ? 25  GLU D N     1 
ATOM   5770  C  CA    . GLU D 1 25  ? 12.065  -43.242 -98.172  1.00 6.07  ? 25  GLU D CA    1 
ATOM   5771  C  C     . GLU D 1 25  ? 12.196  -42.918 -96.699  1.00 2.00  ? 25  GLU D C     1 
ATOM   5772  O  O     . GLU D 1 25  ? 12.252  -41.758 -96.330  1.00 14.61 ? 25  GLU D O     1 
ATOM   5773  C  CB    . GLU D 1 25  ? 10.599  -43.217 -98.557  1.00 2.00  ? 25  GLU D CB    1 
ATOM   5774  C  CG    . GLU D 1 25  ? 10.241  -42.057 -99.440  1.00 2.00  ? 25  GLU D CG    1 
ATOM   5775  C  CD    . GLU D 1 25  ? 10.527  -42.350 -100.879 1.00 7.71  ? 25  GLU D CD    1 
ATOM   5776  O  OE1   . GLU D 1 25  ? 9.747   -43.103 -101.483 1.00 31.62 ? 25  GLU D OE1   1 
ATOM   5777  O  OE2   . GLU D 1 25  ? 11.534  -41.845 -101.396 1.00 2.00  ? 25  GLU D OE2   1 
ATOM   5778  N  N     . SER D 1 26  ? 12.211  -43.937 -95.852  1.00 2.00  ? 26  SER D N     1 
ATOM   5779  C  CA    . SER D 1 26  ? 12.625  -43.760 -94.473  1.00 2.00  ? 26  SER D CA    1 
ATOM   5780  C  C     . SER D 1 26  ? 14.126  -43.763 -94.427  1.00 2.00  ? 26  SER D C     1 
ATOM   5781  O  O     . SER D 1 26  ? 14.754  -44.701 -94.895  1.00 3.30  ? 26  SER D O     1 
ATOM   5782  C  CB    . SER D 1 26  ? 12.100  -44.895 -93.599  1.00 2.00  ? 26  SER D CB    1 
ATOM   5783  O  OG    . SER D 1 26  ? 12.862  -45.028 -92.420  1.00 2.00  ? 26  SER D OG    1 
ATOM   5784  N  N     . GLN D 1 27  ? 14.722  -42.732 -93.850  1.00 2.41  ? 27  GLN D N     1 
ATOM   5785  C  CA    . GLN D 1 27  ? 16.142  -42.828 -93.629  1.00 3.74  ? 27  GLN D CA    1 
ATOM   5786  C  C     . GLN D 1 27  ? 16.435  -43.701 -92.447  1.00 2.00  ? 27  GLN D C     1 
ATOM   5787  O  O     . GLN D 1 27  ? 17.537  -44.243 -92.383  1.00 7.65  ? 27  GLN D O     1 
ATOM   5788  C  CB    . GLN D 1 27  ? 16.764  -41.480 -93.397  1.00 2.11  ? 27  GLN D CB    1 
ATOM   5789  C  CG    . GLN D 1 27  ? 17.327  -40.921 -94.632  1.00 25.26 ? 27  GLN D CG    1 
ATOM   5790  C  CD    . GLN D 1 27  ? 16.898  -39.506 -94.744  1.00 39.56 ? 27  GLN D CD    1 
ATOM   5791  O  OE1   . GLN D 1 27  ? 16.061  -39.047 -93.949  1.00 31.57 ? 27  GLN D OE1   1 
ATOM   5792  N  NE2   . GLN D 1 27  ? 17.470  -38.783 -95.700  1.00 26.44 ? 27  GLN D NE2   1 
ATOM   5793  N  N     . THR D 1 28  ? 15.484  -43.831 -91.510  1.00 2.00  ? 28  THR D N     1 
ATOM   5794  C  CA    . THR D 1 28  ? 15.661  -44.772 -90.426  1.00 2.00  ? 28  THR D CA    1 
ATOM   5795  C  C     . THR D 1 28  ? 15.931  -46.181 -91.009  1.00 9.08  ? 28  THR D C     1 
ATOM   5796  O  O     . THR D 1 28  ? 16.995  -46.802 -90.748  1.00 2.00  ? 28  THR D O     1 
ATOM   5797  C  CB    . THR D 1 28  ? 14.537  -44.761 -89.400  1.00 9.62  ? 28  THR D CB    1 
ATOM   5798  O  OG1   . THR D 1 28  ? 14.627  -43.589 -88.576  1.00 2.00  ? 28  THR D OG1   1 
ATOM   5799  C  CG2   . THR D 1 28  ? 14.703  -45.971 -88.501  1.00 8.87  ? 28  THR D CG2   1 
ATOM   5800  N  N     . ILE D 1 29  ? 15.040  -46.646 -91.885  1.00 4.13  ? 29  ILE D N     1 
ATOM   5801  C  CA    . ILE D 1 29  ? 15.341  -47.877 -92.656  1.00 9.56  ? 29  ILE D CA    1 
ATOM   5802  C  C     . ILE D 1 29  ? 16.741  -47.898 -93.332  1.00 7.33  ? 29  ILE D C     1 
ATOM   5803  O  O     . ILE D 1 29  ? 17.568  -48.801 -93.045  1.00 3.02  ? 29  ILE D O     1 
ATOM   5804  C  CB    . ILE D 1 29  ? 14.249  -48.283 -93.702  1.00 2.00  ? 29  ILE D CB    1 
ATOM   5805  C  CG1   . ILE D 1 29  ? 12.814  -48.320 -93.135  1.00 2.00  ? 29  ILE D CG1   1 
ATOM   5806  C  CG2   . ILE D 1 29  ? 14.647  -49.561 -94.371  1.00 2.00  ? 29  ILE D CG2   1 
ATOM   5807  C  CD1   . ILE D 1 29  ? 12.594  -49.199 -92.001  1.00 2.00  ? 29  ILE D CD1   1 
ATOM   5808  N  N     . ALA D 1 30  ? 16.991  -46.925 -94.220  1.00 2.00  ? 30  ALA D N     1 
ATOM   5809  C  CA    . ALA D 1 30  ? 18.217  -46.881 -95.044  1.00 4.00  ? 30  ALA D CA    1 
ATOM   5810  C  C     . ALA D 1 30  ? 19.474  -47.263 -94.252  1.00 2.81  ? 30  ALA D C     1 
ATOM   5811  O  O     . ALA D 1 30  ? 20.401  -47.882 -94.787  1.00 2.81  ? 30  ALA D O     1 
ATOM   5812  C  CB    . ALA D 1 30  ? 18.398  -45.461 -95.735  1.00 2.00  ? 30  ALA D CB    1 
ATOM   5813  N  N     . HIS D 1 31  ? 19.485  -46.871 -92.977  1.00 9.68  ? 31  HIS D N     1 
ATOM   5814  C  CA    . HIS D 1 31  ? 20.679  -46.877 -92.131  1.00 7.42  ? 31  HIS D CA    1 
ATOM   5815  C  C     . HIS D 1 31  ? 20.643  -48.136 -91.302  1.00 11.28 ? 31  HIS D C     1 
ATOM   5816  O  O     . HIS D 1 31  ? 21.693  -48.617 -90.855  1.00 7.81  ? 31  HIS D O     1 
ATOM   5817  C  CB    . HIS D 1 31  ? 20.705  -45.641 -91.193  1.00 9.13  ? 31  HIS D CB    1 
ATOM   5818  C  CG    . HIS D 1 31  ? 20.925  -44.337 -91.910  1.00 13.03 ? 31  HIS D CG    1 
ATOM   5819  N  ND1   . HIS D 1 31  ? 22.028  -44.102 -92.708  1.00 6.87  ? 31  HIS D ND1   1 
ATOM   5820  C  CD2   . HIS D 1 31  ? 20.170  -43.208 -91.963  1.00 22.57 ? 31  HIS D CD2   1 
ATOM   5821  C  CE1   . HIS D 1 31  ? 21.945  -42.885 -93.218  1.00 29.32 ? 31  HIS D CE1   1 
ATOM   5822  N  NE2   . HIS D 1 31  ? 20.826  -42.322 -92.784  1.00 29.26 ? 31  HIS D NE2   1 
ATOM   5823  N  N     . MET D 1 32  ? 19.422  -48.653 -91.090  1.00 11.06 ? 32  MET D N     1 
ATOM   5824  C  CA    . MET D 1 32  ? 19.229  -50.046 -90.679  1.00 9.17  ? 32  MET D CA    1 
ATOM   5825  C  C     . MET D 1 32  ? 19.830  -51.097 -91.636  1.00 13.04 ? 32  MET D C     1 
ATOM   5826  O  O     . MET D 1 32  ? 20.566  -51.986 -91.180  1.00 3.36  ? 32  MET D O     1 
ATOM   5827  C  CB    . MET D 1 32  ? 17.795  -50.344 -90.206  1.00 2.00  ? 32  MET D CB    1 
ATOM   5828  C  CG    . MET D 1 32  ? 17.663  -50.061 -88.739  1.00 2.00  ? 32  MET D CG    1 
ATOM   5829  S  SD    . MET D 1 32  ? 15.975  -49.711 -88.306  1.00 2.15  ? 32  MET D SD    1 
ATOM   5830  C  CE    . MET D 1 32  ? 15.919  -49.328 -86.516  1.00 2.00  ? 32  MET D CE    1 
ATOM   5831  N  N     . VAL D 1 33  ? 19.575  -50.966 -92.943  1.00 8.13  ? 33  VAL D N     1 
ATOM   5832  C  CA    . VAL D 1 33  ? 20.448  -51.565 -93.955  1.00 5.04  ? 33  VAL D CA    1 
ATOM   5833  C  C     . VAL D 1 33  ? 21.942  -51.220 -93.731  1.00 5.80  ? 33  VAL D C     1 
ATOM   5834  O  O     . VAL D 1 33  ? 22.857  -51.905 -94.234  1.00 2.73  ? 33  VAL D O     1 
ATOM   5835  C  CB    . VAL D 1 33  ? 20.003  -51.167 -95.385  1.00 2.00  ? 33  VAL D CB    1 
ATOM   5836  C  CG1   . VAL D 1 33  ? 20.909  -51.831 -96.442  1.00 18.93 ? 33  VAL D CG1   1 
ATOM   5837  C  CG2   . VAL D 1 33  ? 18.540  -51.504 -95.601  1.00 2.00  ? 33  VAL D CG2   1 
ATOM   5838  N  N     . ASN D 1 40  ? 17.320  -62.073 -90.820  1.00 11.79 ? 40  ASN D N     1 
ATOM   5839  C  CA    . ASN D 1 40  ? 17.213  -61.411 -92.122  1.00 14.42 ? 40  ASN D CA    1 
ATOM   5840  C  C     . ASN D 1 40  ? 15.809  -60.831 -92.361  1.00 16.80 ? 40  ASN D C     1 
ATOM   5841  O  O     . ASN D 1 40  ? 14.850  -61.588 -92.489  1.00 20.51 ? 40  ASN D O     1 
ATOM   5842  C  CB    . ASN D 1 40  ? 17.556  -62.413 -93.230  1.00 13.43 ? 40  ASN D CB    1 
ATOM   5843  C  CG    . ASN D 1 40  ? 17.696  -61.757 -94.603  1.00 14.03 ? 40  ASN D CG    1 
ATOM   5844  O  OD1   . ASN D 1 40  ? 17.867  -60.543 -94.720  1.00 2.00  ? 40  ASN D OD1   1 
ATOM   5845  N  ND2   . ASN D 1 40  ? 17.629  -62.573 -95.654  1.00 17.64 ? 40  ASN D ND2   1 
ATOM   5846  N  N     . GLY D 1 41  ? 15.696  -59.502 -92.433  1.00 14.62 ? 41  GLY D N     1 
ATOM   5847  C  CA    . GLY D 1 41  ? 14.395  -58.812 -92.446  1.00 9.77  ? 41  GLY D CA    1 
ATOM   5848  C  C     . GLY D 1 41  ? 14.281  -57.783 -91.323  1.00 10.90 ? 41  GLY D C     1 
ATOM   5849  O  O     . GLY D 1 41  ? 14.389  -58.140 -90.146  1.00 12.94 ? 41  GLY D O     1 
ATOM   5850  N  N     . VAL D 1 42  ? 14.032  -56.520 -91.677  1.00 3.62  ? 42  VAL D N     1 
ATOM   5851  C  CA    . VAL D 1 42  ? 14.264  -55.357 -90.776  1.00 3.26  ? 42  VAL D CA    1 
ATOM   5852  C  C     . VAL D 1 42  ? 13.253  -55.029 -89.623  1.00 10.43 ? 42  VAL D C     1 
ATOM   5853  O  O     . VAL D 1 42  ? 12.111  -54.598 -89.889  1.00 5.98  ? 42  VAL D O     1 
ATOM   5854  C  CB    . VAL D 1 42  ? 14.380  -54.118 -91.604  1.00 2.67  ? 42  VAL D CB    1 
ATOM   5855  C  CG1   . VAL D 1 42  ? 14.134  -52.938 -90.755  1.00 2.00  ? 42  VAL D CG1   1 
ATOM   5856  C  CG2   . VAL D 1 42  ? 15.722  -54.074 -92.333  1.00 2.00  ? 42  VAL D CG2   1 
ATOM   5857  N  N     . PRO D 1 43  ? 13.650  -55.221 -88.334  1.00 2.00  ? 43  PRO D N     1 
ATOM   5858  C  CA    . PRO D 1 43  ? 12.519  -55.129 -87.403  1.00 12.24 ? 43  PRO D CA    1 
ATOM   5859  C  C     . PRO D 1 43  ? 12.196  -53.666 -86.963  1.00 11.54 ? 43  PRO D C     1 
ATOM   5860  O  O     . PRO D 1 43  ? 13.009  -52.765 -87.105  1.00 10.03 ? 43  PRO D O     1 
ATOM   5861  C  CB    . PRO D 1 43  ? 12.971  -56.007 -86.209  1.00 9.90  ? 43  PRO D CB    1 
ATOM   5862  C  CG    . PRO D 1 43  ? 14.501  -55.978 -86.234  1.00 2.00  ? 43  PRO D CG    1 
ATOM   5863  C  CD    . PRO D 1 43  ? 14.921  -55.508 -87.641  1.00 2.00  ? 43  PRO D CD    1 
ATOM   5864  N  N     . LEU D 1 44  ? 11.019  -53.412 -86.431  1.00 8.89  ? 44  LEU D N     1 
ATOM   5865  C  CA    . LEU D 1 44  ? 10.645  -52.032 -86.318  1.00 6.89  ? 44  LEU D CA    1 
ATOM   5866  C  C     . LEU D 1 44  ? 9.904   -51.931 -84.999  1.00 5.91  ? 44  LEU D C     1 
ATOM   5867  O  O     . LEU D 1 44  ? 8.670   -51.771 -84.975  1.00 4.05  ? 44  LEU D O     1 
ATOM   5868  C  CB    . LEU D 1 44  ? 9.826   -51.511 -87.561  1.00 5.56  ? 44  LEU D CB    1 
ATOM   5869  C  CG    . LEU D 1 44  ? 10.404  -51.372 -88.993  1.00 2.00  ? 44  LEU D CG    1 
ATOM   5870  C  CD1   . LEU D 1 44  ? 9.598   -50.685 -90.116  1.00 2.00  ? 44  LEU D CD1   1 
ATOM   5871  C  CD2   . LEU D 1 44  ? 11.776  -50.763 -88.940  1.00 3.28  ? 44  LEU D CD2   1 
ATOM   5872  N  N     . PRO D 1 45  ? 10.650  -52.028 -83.895  1.00 2.00  ? 45  PRO D N     1 
ATOM   5873  C  CA    . PRO D 1 45  ? 9.959   -52.188 -82.629  1.00 2.00  ? 45  PRO D CA    1 
ATOM   5874  C  C     . PRO D 1 45  ? 9.037   -51.012 -82.228  1.00 7.28  ? 45  PRO D C     1 
ATOM   5875  O  O     . PRO D 1 45  ? 8.350   -51.110 -81.193  1.00 13.08 ? 45  PRO D O     1 
ATOM   5876  C  CB    . PRO D 1 45  ? 11.106  -52.411 -81.591  1.00 5.13  ? 45  PRO D CB    1 
ATOM   5877  C  CG    . PRO D 1 45  ? 12.354  -51.812 -82.223  1.00 2.00  ? 45  PRO D CG    1 
ATOM   5878  C  CD    . PRO D 1 45  ? 12.118  -52.009 -83.756  1.00 5.22  ? 45  PRO D CD    1 
ATOM   5879  N  N     . ASN D 1 46  ? 8.989   -49.931 -83.016  1.00 2.04  ? 46  ASN D N     1 
ATOM   5880  C  CA    . ASN D 1 46  ? 8.019   -48.827 -82.738  1.00 11.53 ? 46  ASN D CA    1 
ATOM   5881  C  C     . ASN D 1 46  ? 6.787   -48.554 -83.664  1.00 16.24 ? 46  ASN D C     1 
ATOM   5882  O  O     . ASN D 1 46  ? 5.976   -47.636 -83.374  1.00 4.59  ? 46  ASN D O     1 
ATOM   5883  C  CB    . ASN D 1 46  ? 8.767   -47.524 -82.516  1.00 3.34  ? 46  ASN D CB    1 
ATOM   5884  C  CG    . ASN D 1 46  ? 9.769   -47.631 -81.382  1.00 24.15 ? 46  ASN D CG    1 
ATOM   5885  O  OD1   . ASN D 1 46  ? 9.377   -47.905 -80.243  1.00 14.79 ? 46  ASN D OD1   1 
ATOM   5886  N  ND2   . ASN D 1 46  ? 11.069  -47.445 -81.686  1.00 2.00  ? 46  ASN D ND2   1 
ATOM   5887  N  N     . VAL D 1 47  ? 6.661   -49.329 -84.737  1.00 3.34  ? 47  VAL D N     1 
ATOM   5888  C  CA    . VAL D 1 47  ? 5.533   -49.194 -85.651  1.00 10.78 ? 47  VAL D CA    1 
ATOM   5889  C  C     . VAL D 1 47  ? 4.634   -50.425 -85.603  1.00 7.21  ? 47  VAL D C     1 
ATOM   5890  O  O     . VAL D 1 47  ? 4.992   -51.486 -86.113  1.00 2.00  ? 47  VAL D O     1 
ATOM   5891  C  CB    . VAL D 1 47  ? 6.005   -48.970 -87.100  1.00 8.22  ? 47  VAL D CB    1 
ATOM   5892  C  CG1   . VAL D 1 47  ? 5.004   -48.112 -87.859  1.00 15.99 ? 47  VAL D CG1   1 
ATOM   5893  C  CG2   . VAL D 1 47  ? 7.385   -48.332 -87.118  1.00 2.00  ? 47  VAL D CG2   1 
ATOM   5894  N  N     . THR D 1 48  ? 3.466   -50.275 -84.987  1.00 2.00  ? 48  THR D N     1 
ATOM   5895  C  CA    . THR D 1 48  ? 2.294   -51.053 -85.369  1.00 2.00  ? 48  THR D CA    1 
ATOM   5896  C  C     . THR D 1 48  ? 2.389   -51.520 -86.817  1.00 2.00  ? 48  THR D C     1 
ATOM   5897  O  O     . THR D 1 48  ? 2.887   -50.798 -87.681  1.00 2.74  ? 48  THR D O     1 
ATOM   5898  C  CB    . THR D 1 48  ? 1.009   -50.228 -85.162  1.00 2.00  ? 48  THR D CB    1 
ATOM   5899  O  OG1   . THR D 1 48  ? 0.428   -50.554 -83.893  1.00 2.00  ? 48  THR D OG1   1 
ATOM   5900  C  CG2   . THR D 1 48  ? -0.061  -50.652 -86.156  1.00 2.00  ? 48  THR D CG2   1 
ATOM   5901  N  N     . SER D 1 49  ? 1.909   -52.732 -87.076  1.00 5.80  ? 49  SER D N     1 
ATOM   5902  C  CA    . SER D 1 49  ? 1.408   -53.092 -88.397  1.00 11.51 ? 49  SER D CA    1 
ATOM   5903  C  C     . SER D 1 49  ? 0.422   -52.050 -88.915  1.00 2.00  ? 49  SER D C     1 
ATOM   5904  O  O     . SER D 1 49  ? 0.647   -51.432 -89.956  1.00 2.00  ? 49  SER D O     1 
ATOM   5905  C  CB    . SER D 1 49  ? 0.746   -54.471 -88.361  1.00 2.00  ? 49  SER D CB    1 
ATOM   5906  O  OG    . SER D 1 49  ? 1.707   -55.493 -88.163  1.00 2.00  ? 49  SER D OG    1 
ATOM   5907  N  N     . LYS D 1 50  ? -0.671  -51.861 -88.183  1.00 2.00  ? 50  LYS D N     1 
ATOM   5908  C  CA    . LYS D 1 50  ? -1.680  -50.896 -88.559  1.00 5.94  ? 50  LYS D CA    1 
ATOM   5909  C  C     . LYS D 1 50  ? -1.052  -49.701 -89.304  1.00 7.11  ? 50  LYS D C     1 
ATOM   5910  O  O     . LYS D 1 50  ? -1.450  -49.369 -90.473  1.00 2.00  ? 50  LYS D O     1 
ATOM   5911  C  CB    . LYS D 1 50  ? -2.523  -50.485 -87.321  1.00 2.50  ? 50  LYS D CB    1 
ATOM   5912  C  CG    . LYS D 1 50  ? -3.889  -49.863 -87.641  1.00 2.00  ? 50  LYS D CG    1 
ATOM   5913  C  CD    . LYS D 1 50  ? -4.450  -49.112 -86.417  1.00 9.64  ? 50  LYS D CD    1 
ATOM   5914  C  CE    . LYS D 1 50  ? -5.063  -47.760 -86.792  1.00 12.45 ? 50  LYS D CE    1 
ATOM   5915  N  NZ    . LYS D 1 50  ? -6.576  -47.692 -86.657  1.00 14.57 ? 50  LYS D NZ    1 
ATOM   5916  N  N     . ILE D 1 51  ? -0.047  -49.121 -88.626  1.00 2.00  ? 51  ILE D N     1 
ATOM   5917  C  CA    . ILE D 1 51  ? 0.560   -47.873 -88.986  1.00 3.27  ? 51  ILE D CA    1 
ATOM   5918  C  C     . ILE D 1 51  ? 1.631   -48.088 -89.983  1.00 2.00  ? 51  ILE D C     1 
ATOM   5919  O  O     . ILE D 1 51  ? 1.750   -47.309 -90.933  1.00 10.58 ? 51  ILE D O     1 
ATOM   5920  C  CB    . ILE D 1 51  ? 1.072   -47.085 -87.751  1.00 6.48  ? 51  ILE D CB    1 
ATOM   5921  C  CG1   . ILE D 1 51  ? -0.014  -46.162 -87.204  1.00 6.33  ? 51  ILE D CG1   1 
ATOM   5922  C  CG2   . ILE D 1 51  ? 2.205   -46.206 -88.116  1.00 15.50 ? 51  ILE D CG2   1 
ATOM   5923  C  CD1   . ILE D 1 51  ? -1.336  -46.789 -87.180  1.00 8.04  ? 51  ILE D CD1   1 
ATOM   5924  N  N     . LEU D 1 52  ? 2.410   -49.145 -89.842  1.00 4.76  ? 52  LEU D N     1 
ATOM   5925  C  CA    . LEU D 1 52  ? 3.356   -49.481 -90.955  1.00 2.25  ? 52  LEU D CA    1 
ATOM   5926  C  C     . LEU D 1 52  ? 2.581   -49.588 -92.261  1.00 2.00  ? 52  LEU D C     1 
ATOM   5927  O  O     . LEU D 1 52  ? 3.074   -49.168 -93.264  1.00 3.51  ? 52  LEU D O     1 
ATOM   5928  C  CB    . LEU D 1 52  ? 4.147   -50.763 -90.687  1.00 2.00  ? 52  LEU D CB    1 
ATOM   5929  C  CG    . LEU D 1 52  ? 5.566   -50.959 -91.248  1.00 11.33 ? 52  LEU D CG    1 
ATOM   5930  C  CD1   . LEU D 1 52  ? 6.109   -52.380 -91.279  1.00 2.00  ? 52  LEU D CD1   1 
ATOM   5931  C  CD2   . LEU D 1 52  ? 5.923   -50.240 -92.505  1.00 6.87  ? 52  LEU D CD2   1 
ATOM   5932  N  N     . ALA D 1 53  ? 1.353   -50.133 -92.231  1.00 2.13  ? 53  ALA D N     1 
ATOM   5933  C  CA    . ALA D 1 53  ? 0.579   -50.328 -93.448  1.00 2.00  ? 53  ALA D CA    1 
ATOM   5934  C  C     . ALA D 1 53  ? 0.334   -48.980 -94.143  1.00 2.00  ? 53  ALA D C     1 
ATOM   5935  O  O     . ALA D 1 53  ? 0.616   -48.840 -95.344  1.00 3.09  ? 53  ALA D O     1 
ATOM   5936  C  CB    . ALA D 1 53  ? -0.750  -51.044 -93.125  1.00 2.00  ? 53  ALA D CB    1 
ATOM   5937  N  N     . LYS D 1 54  ? -0.191  -48.001 -93.370  1.00 3.23  ? 54  LYS D N     1 
ATOM   5938  C  CA    . LYS D 1 54  ? -0.468  -46.600 -93.787  1.00 2.00  ? 54  LYS D CA    1 
ATOM   5939  C  C     . LYS D 1 54  ? 0.799   -45.968 -94.303  1.00 2.00  ? 54  LYS D C     1 
ATOM   5940  O  O     . LYS D 1 54  ? 0.836   -45.526 -95.445  1.00 2.86  ? 54  LYS D O     1 
ATOM   5941  C  CB    . LYS D 1 54  ? -0.953  -45.764 -92.609  1.00 2.00  ? 54  LYS D CB    1 
ATOM   5942  C  CG    . LYS D 1 54  ? -2.445  -45.689 -92.463  1.00 6.80  ? 54  LYS D CG    1 
ATOM   5943  C  CD    . LYS D 1 54  ? -3.101  -44.827 -93.561  1.00 30.67 ? 54  LYS D CD    1 
ATOM   5944  C  CE    . LYS D 1 54  ? -4.128  -43.825 -92.997  1.00 2.00  ? 54  LYS D CE    1 
ATOM   5945  N  NZ    . LYS D 1 54  ? -5.343  -43.570 -93.891  1.00 22.28 ? 54  LYS D NZ    1 
ATOM   5946  N  N     . VAL D 1 55  ? 1.853   -45.940 -93.484  1.00 2.00  ? 55  VAL D N     1 
ATOM   5947  C  CA    . VAL D 1 55  ? 3.167   -45.499 -93.979  1.00 2.00  ? 55  VAL D CA    1 
ATOM   5948  C  C     . VAL D 1 55  ? 3.626   -46.137 -95.344  1.00 2.20  ? 55  VAL D C     1 
ATOM   5949  O  O     . VAL D 1 55  ? 4.283   -45.462 -96.173  1.00 2.00  ? 55  VAL D O     1 
ATOM   5950  C  CB    . VAL D 1 55  ? 4.261   -45.680 -92.861  1.00 4.01  ? 55  VAL D CB    1 
ATOM   5951  C  CG1   . VAL D 1 55  ? 5.617   -45.630 -93.390  1.00 2.00  ? 55  VAL D CG1   1 
ATOM   5952  C  CG2   . VAL D 1 55  ? 4.023   -44.735 -91.661  1.00 2.00  ? 55  VAL D CG2   1 
ATOM   5953  N  N     . ILE D 1 56  ? 3.328   -47.428 -95.581  1.00 2.00  ? 56  ILE D N     1 
ATOM   5954  C  CA    . ILE D 1 56  ? 3.751   -48.089 -96.838  1.00 2.00  ? 56  ILE D CA    1 
ATOM   5955  C  C     . ILE D 1 56  ? 2.889   -47.511 -97.952  1.00 2.58  ? 56  ILE D C     1 
ATOM   5956  O  O     . ILE D 1 56  ? 3.360   -47.178 -99.049  1.00 2.00  ? 56  ILE D O     1 
ATOM   5957  C  CB    . ILE D 1 56  ? 3.502   -49.611 -96.787  1.00 6.69  ? 56  ILE D CB    1 
ATOM   5958  C  CG1   . ILE D 1 56  ? 4.070   -50.229 -95.503  1.00 12.99 ? 56  ILE D CG1   1 
ATOM   5959  C  CG2   . ILE D 1 56  ? 3.945   -50.302 -98.045  1.00 5.47  ? 56  ILE D CG2   1 
ATOM   5960  C  CD1   . ILE D 1 56  ? 5.283   -51.162 -95.692  1.00 8.15  ? 56  ILE D CD1   1 
ATOM   5961  N  N     . GLU D 1 57  ? 1.608   -47.384 -97.631  1.00 2.00  ? 57  GLU D N     1 
ATOM   5962  C  CA    . GLU D 1 57  ? 0.669   -46.921 -98.608  1.00 2.00  ? 57  GLU D CA    1 
ATOM   5963  C  C     . GLU D 1 57  ? 1.066   -45.543 -99.206  1.00 2.00  ? 57  GLU D C     1 
ATOM   5964  O  O     . GLU D 1 57  ? 1.088   -45.340 -100.438 1.00 2.00  ? 57  GLU D O     1 
ATOM   5965  C  CB    . GLU D 1 57  ? -0.722  -46.865 -97.988  1.00 2.00  ? 57  GLU D CB    1 
ATOM   5966  C  CG    . GLU D 1 57  ? -1.751  -46.294 -98.940  1.00 10.14 ? 57  GLU D CG    1 
ATOM   5967  C  CD    . GLU D 1 57  ? -3.091  -46.055 -98.272  1.00 21.22 ? 57  GLU D CD    1 
ATOM   5968  O  OE1   . GLU D 1 57  ? -3.166  -46.110 -97.022  1.00 22.06 ? 57  GLU D OE1   1 
ATOM   5969  O  OE2   . GLU D 1 57  ? -4.071  -45.810 -99.005  1.00 5.39  ? 57  GLU D OE2   1 
ATOM   5970  N  N     . TYR D 1 58  ? 1.360   -44.612 -98.306  1.00 2.00  ? 58  TYR D N     1 
ATOM   5971  C  CA    . TYR D 1 58  ? 1.782   -43.268 -98.669  1.00 2.57  ? 58  TYR D CA    1 
ATOM   5972  C  C     . TYR D 1 58  ? 3.121   -43.331 -99.373  1.00 3.63  ? 58  TYR D C     1 
ATOM   5973  O  O     . TYR D 1 58  ? 3.308   -42.744 -100.465 1.00 2.00  ? 58  TYR D O     1 
ATOM   5974  C  CB    . TYR D 1 58  ? 1.904   -42.399 -97.399  1.00 8.50  ? 58  TYR D CB    1 
ATOM   5975  C  CG    . TYR D 1 58  ? 2.717   -41.097 -97.573  1.00 15.47 ? 58  TYR D CG    1 
ATOM   5976  C  CD1   . TYR D 1 58  ? 2.084   -39.871 -97.839  1.00 6.46  ? 58  TYR D CD1   1 
ATOM   5977  C  CD2   . TYR D 1 58  ? 4.110   -41.089 -97.461  1.00 6.43  ? 58  TYR D CD2   1 
ATOM   5978  C  CE1   . TYR D 1 58  ? 2.824   -38.687 -98.007  1.00 18.28 ? 58  TYR D CE1   1 
ATOM   5979  C  CE2   . TYR D 1 58  ? 4.843   -39.910 -97.606  1.00 6.94  ? 58  TYR D CE2   1 
ATOM   5980  C  CZ    . TYR D 1 58  ? 4.205   -38.717 -97.882  1.00 8.08  ? 58  TYR D CZ    1 
ATOM   5981  O  OH    . TYR D 1 58  ? 4.938   -37.557 -98.038  1.00 2.00  ? 58  TYR D OH    1 
ATOM   5982  N  N     . CYS D 1 59  ? 4.080   -44.043 -98.773  1.00 5.42  ? 59  CYS D N     1 
ATOM   5983  C  CA    . CYS D 1 59  ? 5.386   -44.086 -99.425  1.00 2.38  ? 59  CYS D CA    1 
ATOM   5984  C  C     . CYS D 1 59  ? 5.250   -44.671 -100.818 1.00 11.80 ? 59  CYS D C     1 
ATOM   5985  O  O     . CYS D 1 59  ? 6.050   -44.309 -101.703 1.00 8.00  ? 59  CYS D O     1 
ATOM   5986  C  CB    . CYS D 1 59  ? 6.433   -44.852 -98.628  1.00 2.00  ? 59  CYS D CB    1 
ATOM   5987  S  SG    . CYS D 1 59  ? 7.226   -43.940 -97.217  1.00 5.63  ? 59  CYS D SG    1 
ATOM   5988  N  N     . LYS D 1 60  ? 4.273   -45.595 -101.015 1.00 9.69  ? 60  LYS D N     1 
ATOM   5989  C  CA    . LYS D 1 60  ? 4.040   -46.165 -102.368 1.00 8.48  ? 60  LYS D CA    1 
ATOM   5990  C  C     . LYS D 1 60  ? 3.649   -45.048 -103.354 1.00 14.11 ? 60  LYS D C     1 
ATOM   5991  O  O     . LYS D 1 60  ? 4.269   -44.939 -104.399 1.00 8.64  ? 60  LYS D O     1 
ATOM   5992  C  CB    . LYS D 1 60  ? 3.032   -47.327 -102.398 1.00 10.31 ? 60  LYS D CB    1 
ATOM   5993  C  CG    . LYS D 1 60  ? 3.534   -48.692 -101.842 1.00 3.12  ? 60  LYS D CG    1 
ATOM   5994  C  CD    . LYS D 1 60  ? 2.597   -49.938 -102.144 1.00 11.91 ? 60  LYS D CD    1 
ATOM   5995  C  CE    . LYS D 1 60  ? 1.166   -49.859 -101.545 1.00 23.06 ? 60  LYS D CE    1 
ATOM   5996  N  NZ    . LYS D 1 60  ? 0.856   -50.961 -100.574 1.00 2.00  ? 60  LYS D NZ    1 
ATOM   5997  N  N     . ARG D 1 61  ? 2.673   -44.184 -103.011 1.00 19.21 ? 61  ARG D N     1 
ATOM   5998  C  CA    . ARG D 1 61  ? 2.329   -43.013 -103.885 1.00 13.90 ? 61  ARG D CA    1 
ATOM   5999  C  C     . ARG D 1 61  ? 3.484   -42.084 -104.278 1.00 11.25 ? 61  ARG D C     1 
ATOM   6000  O  O     . ARG D 1 61  ? 3.779   -41.944 -105.451 1.00 2.29  ? 61  ARG D O     1 
ATOM   6001  C  CB    . ARG D 1 61  ? 1.124   -42.215 -103.392 1.00 7.20  ? 61  ARG D CB    1 
ATOM   6002  C  CG    . ARG D 1 61  ? -0.196  -42.838 -103.765 1.00 13.29 ? 61  ARG D CG    1 
ATOM   6003  C  CD    . ARG D 1 61  ? -1.128  -41.877 -104.465 1.00 2.00  ? 61  ARG D CD    1 
ATOM   6004  N  NE    . ARG D 1 61  ? -1.881  -41.015 -103.540 1.00 15.07 ? 61  ARG D NE    1 
ATOM   6005  C  CZ    . ARG D 1 61  ? -2.976  -41.359 -102.862 1.00 12.77 ? 61  ARG D CZ    1 
ATOM   6006  N  NH1   . ARG D 1 61  ? -3.452  -42.585 -102.952 1.00 2.00  ? 61  ARG D NH1   1 
ATOM   6007  N  NH2   . ARG D 1 61  ? -3.589  -40.466 -102.084 1.00 2.68  ? 61  ARG D NH2   1 
ATOM   6008  N  N     . HIS D 1 62  ? 4.153   -41.486 -103.296 1.00 11.88 ? 62  HIS D N     1 
ATOM   6009  C  CA    . HIS D 1 62  ? 5.389   -40.702 -103.549 1.00 15.30 ? 62  HIS D CA    1 
ATOM   6010  C  C     . HIS D 1 62  ? 6.648   -41.511 -103.948 1.00 2.46  ? 62  HIS D C     1 
ATOM   6011  O  O     . HIS D 1 62  ? 6.651   -42.260 -104.926 1.00 2.00  ? 62  HIS D O     1 
ATOM   6012  C  CB    . HIS D 1 62  ? 5.661   -39.739 -102.352 1.00 11.60 ? 62  HIS D CB    1 
ATOM   6013  C  CG    . HIS D 1 62  ? 4.474   -38.883 -101.980 1.00 18.50 ? 62  HIS D CG    1 
ATOM   6014  N  ND1   . HIS D 1 62  ? 3.303   -39.416 -101.468 1.00 8.90  ? 62  HIS D ND1   1 
ATOM   6015  C  CD2   . HIS D 1 62  ? 4.262   -37.541 -102.091 1.00 9.57  ? 62  HIS D CD2   1 
ATOM   6016  C  CE1   . HIS D 1 62  ? 2.436   -38.436 -101.237 1.00 4.91  ? 62  HIS D CE1   1 
ATOM   6017  N  NE2   . HIS D 1 62  ? 2.988   -37.292 -101.625 1.00 16.39 ? 62  HIS D NE2   1 
ATOM   6018  N  N     . TRP D 1 86  ? -7.169  -36.999 -101.540 1.00 4.89  ? 86  TRP D N     1 
ATOM   6019  C  CA    . TRP D 1 86  ? -5.900  -36.810 -102.232 1.00 4.29  ? 86  TRP D CA    1 
ATOM   6020  C  C     . TRP D 1 86  ? -4.741  -37.382 -101.425 1.00 10.72 ? 86  TRP D C     1 
ATOM   6021  O  O     . TRP D 1 86  ? -4.840  -38.475 -100.866 1.00 2.00  ? 86  TRP D O     1 
ATOM   6022  C  CB    . TRP D 1 86  ? -5.662  -35.325 -102.516 1.00 2.00  ? 86  TRP D CB    1 
ATOM   6023  C  CG    . TRP D 1 86  ? -4.561  -35.072 -103.500 1.00 2.00  ? 86  TRP D CG    1 
ATOM   6024  C  CD1   . TRP D 1 86  ? -4.412  -35.643 -104.731 1.00 2.00  ? 86  TRP D CD1   1 
ATOM   6025  C  CD2   . TRP D 1 86  ? -3.451  -34.182 -103.337 1.00 2.00  ? 86  TRP D CD2   1 
ATOM   6026  N  NE1   . TRP D 1 86  ? -3.279  -35.162 -105.343 1.00 2.00  ? 86  TRP D NE1   1 
ATOM   6027  C  CE2   . TRP D 1 86  ? -2.670  -34.263 -104.507 1.00 14.51 ? 86  TRP D CE2   1 
ATOM   6028  C  CE3   . TRP D 1 86  ? -3.035  -33.319 -102.316 1.00 2.00  ? 86  TRP D CE3   1 
ATOM   6029  C  CZ2   . TRP D 1 86  ? -1.505  -33.519 -104.684 1.00 9.93  ? 86  TRP D CZ2   1 
ATOM   6030  C  CZ3   . TRP D 1 86  ? -1.878  -32.583 -102.494 1.00 2.00  ? 86  TRP D CZ3   1 
ATOM   6031  C  CH2   . TRP D 1 86  ? -1.127  -32.687 -103.668 1.00 2.41  ? 86  TRP D CH2   1 
ATOM   6032  N  N     . ASP D 1 87  ? -3.642  -36.637 -101.367 1.00 11.83 ? 87  ASP D N     1 
ATOM   6033  C  CA    . ASP D 1 87  ? -2.758  -36.663 -100.207 1.00 11.10 ? 87  ASP D CA    1 
ATOM   6034  C  C     . ASP D 1 87  ? -3.535  -36.419 -98.917  1.00 18.69 ? 87  ASP D C     1 
ATOM   6035  O  O     . ASP D 1 87  ? -2.953  -36.089 -97.884  1.00 28.42 ? 87  ASP D O     1 
ATOM   6036  C  CB    . ASP D 1 87  ? -1.647  -35.622 -100.357 1.00 11.91 ? 87  ASP D CB    1 
ATOM   6037  C  CG    . ASP D 1 87  ? -0.263  -36.222 -100.213 1.00 4.59  ? 87  ASP D CG    1 
ATOM   6038  O  OD1   . ASP D 1 87  ? -0.163  -37.457 -100.055 1.00 3.56  ? 87  ASP D OD1   1 
ATOM   6039  O  OD2   . ASP D 1 87  ? 0.782   -35.539 -100.245 1.00 12.92 ? 87  ASP D OD2   1 
ATOM   6040  N  N     . ALA D 1 88  ? -4.852  -36.583 -98.986  1.00 18.34 ? 88  ALA D N     1 
ATOM   6041  C  CA    . ALA D 1 88  ? -5.774  -35.650 -98.349  1.00 11.09 ? 88  ALA D CA    1 
ATOM   6042  C  C     . ALA D 1 88  ? -7.130  -36.301 -98.097  1.00 15.20 ? 88  ALA D C     1 
ATOM   6043  O  O     . ALA D 1 88  ? -7.704  -36.164 -97.017  1.00 9.42  ? 88  ALA D O     1 
ATOM   6044  C  CB    . ALA D 1 88  ? -5.933  -34.399 -99.198  1.00 6.94  ? 88  ALA D CB    1 
ATOM   6045  N  N     . ASP D 1 89  ? -7.637  -37.008 -99.102  1.00 15.77 ? 89  ASP D N     1 
ATOM   6046  C  CA    . ASP D 1 89  ? -8.181  -38.336 -98.900  1.00 21.38 ? 89  ASP D CA    1 
ATOM   6047  C  C     . ASP D 1 89  ? -7.407  -39.005 -97.783  1.00 21.19 ? 89  ASP D C     1 
ATOM   6048  O  O     . ASP D 1 89  ? -7.988  -39.555 -96.851  1.00 7.74  ? 89  ASP D O     1 
ATOM   6049  C  CB    . ASP D 1 89  ? -8.064  -39.163 -100.176 1.00 22.85 ? 89  ASP D CB    1 
ATOM   6050  C  CG    . ASP D 1 89  ? -8.162  -40.643 -99.913  1.00 22.07 ? 89  ASP D CG    1 
ATOM   6051  O  OD1   . ASP D 1 89  ? -9.269  -41.111 -99.582  1.00 4.20  ? 89  ASP D OD1   1 
ATOM   6052  O  OD2   . ASP D 1 89  ? -7.186  -41.416 -100.004 1.00 2.18  ? 89  ASP D OD2   1 
ATOM   6053  N  N     . PHE D 1 90  ? -6.085  -38.953 -97.885  1.00 18.07 ? 90  PHE D N     1 
ATOM   6054  C  CA    . PHE D 1 90  ? -5.245  -39.851 -97.118  1.00 13.15 ? 90  PHE D CA    1 
ATOM   6055  C  C     . PHE D 1 90  ? -5.267  -39.428 -95.677  1.00 9.37  ? 90  PHE D C     1 
ATOM   6056  O  O     . PHE D 1 90  ? -5.044  -40.233 -94.781  1.00 4.89  ? 90  PHE D O     1 
ATOM   6057  C  CB    . PHE D 1 90  ? -3.813  -39.840 -97.628  1.00 11.19 ? 90  PHE D CB    1 
ATOM   6058  C  CG    . PHE D 1 90  ? -2.856  -40.576 -96.741  1.00 21.20 ? 90  PHE D CG    1 
ATOM   6059  C  CD1   . PHE D 1 90  ? -2.661  -41.935 -96.891  1.00 19.18 ? 90  PHE D CD1   1 
ATOM   6060  C  CD2   . PHE D 1 90  ? -2.155  -39.912 -95.757  1.00 2.00  ? 90  PHE D CD2   1 
ATOM   6061  C  CE1   . PHE D 1 90  ? -1.788  -42.612 -96.080  1.00 2.00  ? 90  PHE D CE1   1 
ATOM   6062  C  CE2   . PHE D 1 90  ? -1.284  -40.586 -94.947  1.00 2.00  ? 90  PHE D CE2   1 
ATOM   6063  C  CZ    . PHE D 1 90  ? -1.099  -41.939 -95.107  1.00 13.49 ? 90  PHE D CZ    1 
ATOM   6064  N  N     . MET D 1 91  ? -5.540  -38.154 -95.448  1.00 4.15  ? 91  MET D N     1 
ATOM   6065  C  CA    . MET D 1 91  ? -5.422  -37.643 -94.094  1.00 7.72  ? 91  MET D CA    1 
ATOM   6066  C  C     . MET D 1 91  ? -6.752  -37.655 -93.366  1.00 2.00  ? 91  MET D C     1 
ATOM   6067  O  O     . MET D 1 91  ? -6.795  -37.475 -92.146  1.00 2.00  ? 91  MET D O     1 
ATOM   6068  C  CB    . MET D 1 91  ? -4.756  -36.254 -94.075  1.00 9.18  ? 91  MET D CB    1 
ATOM   6069  C  CG    . MET D 1 91  ? -3.208  -36.289 -94.182  1.00 5.26  ? 91  MET D CG    1 
ATOM   6070  S  SD    . MET D 1 91  ? -2.399  -37.231 -92.845  1.00 2.16  ? 91  MET D SD    1 
ATOM   6071  C  CE    . MET D 1 91  ? -3.846  -37.709 -91.892  1.00 9.08  ? 91  MET D CE    1 
ATOM   6072  N  N     . LYS D 1 92  ? -7.828  -37.905 -94.112  1.00 2.54  ? 92  LYS D N     1 
ATOM   6073  C  CA    . LYS D 1 92  ? -9.107  -38.275 -93.513  1.00 3.04  ? 92  LYS D CA    1 
ATOM   6074  C  C     . LYS D 1 92  ? -8.949  -39.577 -92.735  1.00 6.92  ? 92  LYS D C     1 
ATOM   6075  O  O     . LYS D 1 92  ? -9.276  -40.648 -93.229  1.00 8.45  ? 92  LYS D O     1 
ATOM   6076  C  CB    . LYS D 1 92  ? -10.188 -38.428 -94.579  1.00 2.00  ? 92  LYS D CB    1 
ATOM   6077  C  CG    . LYS D 1 92  ? -10.174 -37.323 -95.627  1.00 12.97 ? 92  LYS D CG    1 
ATOM   6078  C  CD    . LYS D 1 92  ? -11.600 -36.937 -96.008  1.00 10.88 ? 92  LYS D CD    1 
ATOM   6079  C  CE    . LYS D 1 92  ? -12.551 -38.156 -95.803  1.00 5.36  ? 92  LYS D CE    1 
ATOM   6080  N  NZ    . LYS D 1 92  ? -13.644 -37.789 -94.783  1.00 2.00  ? 92  LYS D NZ    1 
ATOM   6081  N  N     . ILE D 1 93  ? -8.409  -39.474 -91.526  1.00 3.87  ? 93  ILE D N     1 
ATOM   6082  C  CA    . ILE D 1 93  ? -8.145  -40.627 -90.674  1.00 2.00  ? 93  ILE D CA    1 
ATOM   6083  C  C     . ILE D 1 93  ? -8.336  -39.920 -89.385  1.00 5.67  ? 93  ILE D C     1 
ATOM   6084  O  O     . ILE D 1 93  ? -8.414  -38.695 -89.378  1.00 2.00  ? 93  ILE D O     1 
ATOM   6085  C  CB    . ILE D 1 93  ? -6.658  -41.213 -90.820  1.00 2.00  ? 93  ILE D CB    1 
ATOM   6086  C  CG1   . ILE D 1 93  ? -5.638  -40.734 -89.737  1.00 10.18 ? 93  ILE D CG1   1 
ATOM   6087  C  CG2   . ILE D 1 93  ? -6.205  -41.200 -92.252  1.00 2.00  ? 93  ILE D CG2   1 
ATOM   6088  C  CD1   . ILE D 1 93  ? -5.024  -39.302 -89.902  1.00 2.00  ? 93  ILE D CD1   1 
ATOM   6089  N  N     . ASP D 1 94  ? -8.451  -40.656 -88.296  1.00 3.99  ? 94  ASP D N     1 
ATOM   6090  C  CA    . ASP D 1 94  ? -8.977  -40.030 -87.107  1.00 4.28  ? 94  ASP D CA    1 
ATOM   6091  C  C     . ASP D 1 94  ? -7.838  -39.543 -86.241  1.00 5.45  ? 94  ASP D C     1 
ATOM   6092  O  O     . ASP D 1 94  ? -6.680  -39.513 -86.669  1.00 6.74  ? 94  ASP D O     1 
ATOM   6093  C  CB    . ASP D 1 94  ? -9.797  -41.018 -86.324  1.00 5.77  ? 94  ASP D CB    1 
ATOM   6094  C  CG    . ASP D 1 94  ? -8.942  -42.079 -85.696  1.00 17.74 ? 94  ASP D CG    1 
ATOM   6095  O  OD1   . ASP D 1 94  ? -8.837  -43.171 -86.291  1.00 17.56 ? 94  ASP D OD1   1 
ATOM   6096  O  OD2   . ASP D 1 94  ? -8.357  -41.806 -84.622  1.00 27.64 ? 94  ASP D OD2   1 
ATOM   6097  N  N     . GLN D 1 95  ? -8.178  -39.172 -85.010  1.00 13.28 ? 95  GLN D N     1 
ATOM   6098  C  CA    . GLN D 1 95  ? -7.266  -38.412 -84.173  1.00 11.72 ? 95  GLN D CA    1 
ATOM   6099  C  C     . GLN D 1 95  ? -6.201  -39.318 -83.627  1.00 6.67  ? 95  GLN D C     1 
ATOM   6100  O  O     . GLN D 1 95  ? -5.024  -39.125 -83.896  1.00 2.00  ? 95  GLN D O     1 
ATOM   6101  C  CB    . GLN D 1 95  ? -7.976  -37.740 -82.995  1.00 11.99 ? 95  GLN D CB    1 
ATOM   6102  C  CG    . GLN D 1 95  ? -6.983  -36.863 -82.208  1.00 13.48 ? 95  GLN D CG    1 
ATOM   6103  C  CD    . GLN D 1 95  ? -7.579  -35.589 -81.632  1.00 9.39  ? 95  GLN D CD    1 
ATOM   6104  O  OE1   . GLN D 1 95  ? -8.250  -34.852 -82.345  1.00 2.00  ? 95  GLN D OE1   1 
ATOM   6105  N  NE2   . GLN D 1 95  ? -7.354  -35.330 -80.342  1.00 2.00  ? 95  GLN D NE2   1 
ATOM   6106  N  N     . ALA D 1 96  ? -6.616  -40.299 -82.827  1.00 11.28 ? 96  ALA D N     1 
ATOM   6107  C  CA    . ALA D 1 96  ? -5.633  -41.157 -82.179  1.00 5.89  ? 96  ALA D CA    1 
ATOM   6108  C  C     . ALA D 1 96  ? -4.609  -41.656 -83.219  1.00 5.73  ? 96  ALA D C     1 
ATOM   6109  O  O     . ALA D 1 96  ? -3.422  -41.796 -82.916  1.00 2.68  ? 96  ALA D O     1 
ATOM   6110  C  CB    . ALA D 1 96  ? -6.302  -42.288 -81.444  1.00 7.59  ? 96  ALA D CB    1 
ATOM   6111  N  N     . THR D 1 97  ? -5.068  -41.863 -84.452  1.00 2.00  ? 97  THR D N     1 
ATOM   6112  C  CA    . THR D 1 97  ? -4.283  -42.540 -85.471  1.00 2.00  ? 97  THR D CA    1 
ATOM   6113  C  C     . THR D 1 97  ? -3.261  -41.653 -86.191  1.00 4.13  ? 97  THR D C     1 
ATOM   6114  O  O     . THR D 1 97  ? -2.075  -42.014 -86.306  1.00 3.10  ? 97  THR D O     1 
ATOM   6115  C  CB    . THR D 1 97  ? -5.198  -43.167 -86.565  1.00 3.89  ? 97  THR D CB    1 
ATOM   6116  O  OG1   . THR D 1 97  ? -5.926  -44.291 -86.035  1.00 2.00  ? 97  THR D OG1   1 
ATOM   6117  C  CG2   . THR D 1 97  ? -4.344  -43.634 -87.787  1.00 5.66  ? 97  THR D CG2   1 
ATOM   6118  N  N     . LEU D 1 98  ? -3.726  -40.527 -86.736  1.00 2.00  ? 98  LEU D N     1 
ATOM   6119  C  CA    . LEU D 1 98  ? -2.835  -39.401 -87.016  1.00 14.23 ? 98  LEU D CA    1 
ATOM   6120  C  C     . LEU D 1 98  ? -1.752  -39.054 -85.922  1.00 8.10  ? 98  LEU D C     1 
ATOM   6121  O  O     . LEU D 1 98  ? -0.579  -38.906 -86.238  1.00 2.00  ? 98  LEU D O     1 
ATOM   6122  C  CB    . LEU D 1 98  ? -3.660  -38.182 -87.418  1.00 13.80 ? 98  LEU D CB    1 
ATOM   6123  C  CG    . LEU D 1 98  ? -2.968  -36.826 -87.436  1.00 5.78  ? 98  LEU D CG    1 
ATOM   6124  C  CD1   . LEU D 1 98  ? -2.573  -36.622 -88.861  1.00 2.00  ? 98  LEU D CD1   1 
ATOM   6125  C  CD2   . LEU D 1 98  ? -3.944  -35.741 -86.960  1.00 2.00  ? 98  LEU D CD2   1 
ATOM   6126  N  N     . PHE D 1 99  ? -2.138  -38.972 -84.656  1.00 2.00  ? 99  PHE D N     1 
ATOM   6127  C  CA    . PHE D 1 99  ? -1.160  -39.062 -83.576  1.00 4.16  ? 99  PHE D CA    1 
ATOM   6128  C  C     . PHE D 1 99  ? -0.020  -40.121 -83.683  1.00 2.00  ? 99  PHE D C     1 
ATOM   6129  O  O     . PHE D 1 99  ? 1.129   -39.854 -83.301  1.00 2.00  ? 99  PHE D O     1 
ATOM   6130  C  CB    . PHE D 1 99  ? -1.851  -39.079 -82.194  1.00 3.21  ? 99  PHE D CB    1 
ATOM   6131  C  CG    . PHE D 1 99  ? -2.447  -37.731 -81.773  1.00 15.39 ? 99  PHE D CG    1 
ATOM   6132  C  CD1   . PHE D 1 99  ? -2.744  -37.472 -80.428  1.00 23.28 ? 99  PHE D CD1   1 
ATOM   6133  C  CD2   . PHE D 1 99  ? -2.716  -36.727 -82.709  1.00 5.92  ? 99  PHE D CD2   1 
ATOM   6134  C  CE1   . PHE D 1 99  ? -3.304  -36.241 -80.027  1.00 7.08  ? 99  PHE D CE1   1 
ATOM   6135  C  CE2   . PHE D 1 99  ? -3.269  -35.491 -82.301  1.00 2.00  ? 99  PHE D CE2   1 
ATOM   6136  C  CZ    . PHE D 1 99  ? -3.568  -35.263 -80.965  1.00 2.00  ? 99  PHE D CZ    1 
ATOM   6137  N  N     . GLU D 1 100 ? -0.333  -41.325 -84.171  1.00 2.40  ? 100 GLU D N     1 
ATOM   6138  C  CA    . GLU D 1 100 ? 0.626   -42.428 -84.136  1.00 2.00  ? 100 GLU D CA    1 
ATOM   6139  C  C     . GLU D 1 100 ? 1.437   -42.375 -85.435  1.00 2.00  ? 100 GLU D C     1 
ATOM   6140  O  O     . GLU D 1 100 ? 2.665   -42.637 -85.444  1.00 2.00  ? 100 GLU D O     1 
ATOM   6141  C  CB    . GLU D 1 100 ? -0.086  -43.775 -83.984  1.00 2.00  ? 100 GLU D CB    1 
ATOM   6142  C  CG    . GLU D 1 100 ? 0.420   -44.691 -82.805  1.00 9.85  ? 100 GLU D CG    1 
ATOM   6143  C  CD    . GLU D 1 100 ? -0.255  -46.093 -82.811  1.00 8.63  ? 100 GLU D CD    1 
ATOM   6144  O  OE1   . GLU D 1 100 ? -1.312  -46.250 -83.471  1.00 15.77 ? 100 GLU D OE1   1 
ATOM   6145  O  OE2   . GLU D 1 100 ? 0.268   -47.043 -82.174  1.00 10.98 ? 100 GLU D OE2   1 
ATOM   6146  N  N     . LEU D 1 101 ? 0.737   -42.041 -86.514  1.00 2.00  ? 101 LEU D N     1 
ATOM   6147  C  CA    . LEU D 1 101 ? 1.321   -41.581 -87.767  1.00 2.00  ? 101 LEU D CA    1 
ATOM   6148  C  C     . LEU D 1 101 ? 2.470   -40.589 -87.620  1.00 2.95  ? 101 LEU D C     1 
ATOM   6149  O  O     . LEU D 1 101 ? 3.584   -40.861 -88.033  1.00 2.28  ? 101 LEU D O     1 
ATOM   6150  C  CB    . LEU D 1 101 ? 0.231   -40.978 -88.643  1.00 2.00  ? 101 LEU D CB    1 
ATOM   6151  C  CG    . LEU D 1 101 ? -0.111  -41.636 -89.972  1.00 5.86  ? 101 LEU D CG    1 
ATOM   6152  C  CD1   . LEU D 1 101 ? -0.366  -40.605 -91.015  1.00 2.00  ? 101 LEU D CD1   1 
ATOM   6153  C  CD2   . LEU D 1 101 ? 0.959   -42.604 -90.421  1.00 2.00  ? 101 LEU D CD2   1 
ATOM   6154  N  N     . ILE D 1 102 ? 2.184   -39.435 -87.035  1.00 2.00  ? 102 ILE D N     1 
ATOM   6155  C  CA    . ILE D 1 102 ? 3.209   -38.463 -86.694  1.00 10.42 ? 102 ILE D CA    1 
ATOM   6156  C  C     . ILE D 1 102 ? 4.438   -39.123 -86.110  1.00 7.01  ? 102 ILE D C     1 
ATOM   6157  O  O     . ILE D 1 102 ? 5.550   -38.892 -86.558  1.00 4.39  ? 102 ILE D O     1 
ATOM   6158  C  CB    . ILE D 1 102 ? 2.665   -37.428 -85.691  1.00 12.14 ? 102 ILE D CB    1 
ATOM   6159  C  CG1   . ILE D 1 102 ? 1.806   -36.397 -86.399  1.00 2.00  ? 102 ILE D CG1   1 
ATOM   6160  C  CG2   . ILE D 1 102 ? 3.796   -36.695 -85.028  1.00 13.23 ? 102 ILE D CG2   1 
ATOM   6161  C  CD1   . ILE D 1 102 ? 2.361   -35.015 -86.302  1.00 21.79 ? 102 ILE D CD1   1 
ATOM   6162  N  N     . LEU D 1 103 ? 4.225   -39.938 -85.088  1.00 8.55  ? 103 LEU D N     1 
ATOM   6163  C  CA    . LEU D 1 103 ? 5.327   -40.536 -84.363  1.00 11.99 ? 103 LEU D CA    1 
ATOM   6164  C  C     . LEU D 1 103 ? 6.114   -41.485 -85.241  1.00 12.90 ? 103 LEU D C     1 
ATOM   6165  O  O     . LEU D 1 103 ? 7.339   -41.482 -85.218  1.00 15.90 ? 103 LEU D O     1 
ATOM   6166  C  CB    . LEU D 1 103 ? 4.825   -41.268 -83.124  1.00 2.00  ? 103 LEU D CB    1 
ATOM   6167  C  CG    . LEU D 1 103 ? 4.291   -40.415 -81.982  1.00 2.00  ? 103 LEU D CG    1 
ATOM   6168  C  CD1   . LEU D 1 103 ? 3.602   -41.289 -80.979  1.00 2.00  ? 103 LEU D CD1   1 
ATOM   6169  C  CD2   . LEU D 1 103 ? 5.417   -39.660 -81.334  1.00 2.00  ? 103 LEU D CD2   1 
ATOM   6170  N  N     . ALA D 1 104 ? 5.398   -42.299 -86.010  1.00 5.68  ? 104 ALA D N     1 
ATOM   6171  C  CA    . ALA D 1 104 ? 6.038   -43.251 -86.952  1.00 10.95 ? 104 ALA D CA    1 
ATOM   6172  C  C     . ALA D 1 104 ? 6.871   -42.552 -87.993  1.00 12.26 ? 104 ALA D C     1 
ATOM   6173  O  O     . ALA D 1 104 ? 7.951   -43.073 -88.377  1.00 10.88 ? 104 ALA D O     1 
ATOM   6174  C  CB    . ALA D 1 104 ? 5.000   -44.159 -87.686  1.00 5.46  ? 104 ALA D CB    1 
ATOM   6175  N  N     . ALA D 1 105 ? 6.347   -41.410 -88.483  1.00 3.91  ? 105 ALA D N     1 
ATOM   6176  C  CA    . ALA D 1 105 ? 7.059   -40.601 -89.505  1.00 8.86  ? 105 ALA D CA    1 
ATOM   6177  C  C     . ALA D 1 105 ? 8.389   -39.992 -88.967  1.00 3.31  ? 105 ALA D C     1 
ATOM   6178  O  O     . ALA D 1 105 ? 9.449   -39.919 -89.638  1.00 2.34  ? 105 ALA D O     1 
ATOM   6179  C  CB    . ALA D 1 105 ? 6.133   -39.527 -90.048  1.00 2.00  ? 105 ALA D CB    1 
ATOM   6180  N  N     . ASN D 1 106 ? 8.328   -39.571 -87.722  1.00 5.67  ? 106 ASN D N     1 
ATOM   6181  C  CA    . ASN D 1 106 ? 9.505   -39.044 -87.109  1.00 4.81  ? 106 ASN D CA    1 
ATOM   6182  C  C     . ASN D 1 106 ? 10.533  -40.173 -86.852  1.00 5.77  ? 106 ASN D C     1 
ATOM   6183  O  O     . ASN D 1 106 ? 11.720  -40.048 -87.094  1.00 2.00  ? 106 ASN D O     1 
ATOM   6184  C  CB    . ASN D 1 106 ? 9.019   -38.423 -85.812  1.00 10.17 ? 106 ASN D CB    1 
ATOM   6185  C  CG    . ASN D 1 106 ? 10.103  -37.649 -85.105  1.00 14.30 ? 106 ASN D CG    1 
ATOM   6186  O  OD1   . ASN D 1 106 ? 10.732  -36.756 -85.701  1.00 13.54 ? 106 ASN D OD1   1 
ATOM   6187  N  ND2   . ASN D 1 106 ? 10.351  -37.994 -83.839  1.00 2.00  ? 106 ASN D ND2   1 
ATOM   6188  N  N     . TYR D 1 107 ? 9.985   -41.298 -86.362  1.00 11.60 ? 107 TYR D N     1 
ATOM   6189  C  CA    . TYR D 1 107 ? 10.754  -42.487 -86.049  1.00 2.31  ? 107 TYR D CA    1 
ATOM   6190  C  C     . TYR D 1 107 ? 11.379  -43.102 -87.257  1.00 2.00  ? 107 TYR D C     1 
ATOM   6191  O  O     . TYR D 1 107 ? 12.533  -43.578 -87.189  1.00 4.99  ? 107 TYR D O     1 
ATOM   6192  C  CB    . TYR D 1 107 ? 9.897   -43.517 -85.337  1.00 13.19 ? 107 TYR D CB    1 
ATOM   6193  C  CG    . TYR D 1 107 ? 10.595  -44.836 -85.160  1.00 6.98  ? 107 TYR D CG    1 
ATOM   6194  C  CD1   . TYR D 1 107 ? 11.946  -44.902 -84.814  1.00 19.68 ? 107 TYR D CD1   1 
ATOM   6195  C  CD2   . TYR D 1 107 ? 9.917   -46.021 -85.410  1.00 5.79  ? 107 TYR D CD2   1 
ATOM   6196  C  CE1   . TYR D 1 107 ? 12.589  -46.134 -84.690  1.00 14.33 ? 107 TYR D CE1   1 
ATOM   6197  C  CE2   . TYR D 1 107 ? 10.541  -47.257 -85.280  1.00 11.81 ? 107 TYR D CE2   1 
ATOM   6198  C  CZ    . TYR D 1 107 ? 11.864  -47.317 -84.917  1.00 17.65 ? 107 TYR D CZ    1 
ATOM   6199  O  OH    . TYR D 1 107 ? 12.443  -48.577 -84.784  1.00 15.07 ? 107 TYR D OH    1 
ATOM   6200  N  N     . LEU D 1 108 ? 10.647  -43.108 -88.367  1.00 2.00  ? 108 LEU D N     1 
ATOM   6201  C  CA    . LEU D 1 108 ? 11.270  -43.584 -89.607  1.00 2.18  ? 108 LEU D CA    1 
ATOM   6202  C  C     . LEU D 1 108 ? 12.023  -42.536 -90.403  1.00 2.00  ? 108 LEU D C     1 
ATOM   6203  O  O     . LEU D 1 108 ? 12.656  -42.908 -91.390  1.00 2.00  ? 108 LEU D O     1 
ATOM   6204  C  CB    . LEU D 1 108 ? 10.294  -44.312 -90.516  1.00 2.00  ? 108 LEU D CB    1 
ATOM   6205  C  CG    . LEU D 1 108 ? 9.629   -45.472 -89.807  1.00 2.00  ? 108 LEU D CG    1 
ATOM   6206  C  CD1   . LEU D 1 108 ? 8.240   -45.585 -90.333  1.00 2.00  ? 108 LEU D CD1   1 
ATOM   6207  C  CD2   . LEU D 1 108 ? 10.416  -46.786 -90.050  1.00 3.43  ? 108 LEU D CD2   1 
ATOM   6208  N  N     . ASN D 1 109 ? 11.955  -41.252 -89.982  1.00 2.00  ? 109 ASN D N     1 
ATOM   6209  C  CA    . ASN D 1 109 ? 12.642  -40.158 -90.680  1.00 2.00  ? 109 ASN D CA    1 
ATOM   6210  C  C     . ASN D 1 109 ? 12.199  -40.055 -92.122  1.00 2.86  ? 109 ASN D C     1 
ATOM   6211  O  O     . ASN D 1 109 ? 13.008  -40.219 -93.053  1.00 2.00  ? 109 ASN D O     1 
ATOM   6212  C  CB    . ASN D 1 109 ? 14.141  -40.385 -90.714  1.00 2.00  ? 109 ASN D CB    1 
ATOM   6213  C  CG    . ASN D 1 109 ? 14.819  -39.861 -89.489  1.00 28.36 ? 109 ASN D CG    1 
ATOM   6214  O  OD1   . ASN D 1 109 ? 14.139  -39.487 -88.519  1.00 34.92 ? 109 ASN D OD1   1 
ATOM   6215  N  ND2   . ASN D 1 109 ? 16.167  -39.832 -89.500  1.00 25.59 ? 109 ASN D ND2   1 
ATOM   6216  N  N     . ILE D 1 110 ? 10.909  -39.835 -92.316  1.00 3.69  ? 110 ILE D N     1 
ATOM   6217  C  CA    . ILE D 1 110 ? 10.371  -39.669 -93.678  1.00 9.38  ? 110 ILE D CA    1 
ATOM   6218  C  C     . ILE D 1 110 ? 9.952   -38.206 -93.810  1.00 8.56  ? 110 ILE D C     1 
ATOM   6219  O  O     . ILE D 1 110 ? 8.834   -37.873 -93.402  1.00 2.00  ? 110 ILE D O     1 
ATOM   6220  C  CB    . ILE D 1 110 ? 9.065   -40.501 -93.904  1.00 6.27  ? 110 ILE D CB    1 
ATOM   6221  C  CG1   . ILE D 1 110 ? 9.031   -41.770 -93.007  1.00 25.72 ? 110 ILE D CG1   1 
ATOM   6222  C  CG2   . ILE D 1 110 ? 8.785   -40.655 -95.394  1.00 2.00  ? 110 ILE D CG2   1 
ATOM   6223  C  CD1   . ILE D 1 110 ? 8.874   -43.131 -93.699  1.00 2.00  ? 110 ILE D CD1   1 
ATOM   6224  N  N     . LYS D 1 111 ? 10.829  -37.359 -94.373  1.00 2.37  ? 111 LYS D N     1 
ATOM   6225  C  CA    . LYS D 1 111 ? 10.586  -35.922 -94.438  1.00 2.00  ? 111 LYS D CA    1 
ATOM   6226  C  C     . LYS D 1 111 ? 9.167   -35.511 -94.934  1.00 2.00  ? 111 LYS D C     1 
ATOM   6227  O  O     . LYS D 1 111 ? 8.405   -34.950 -94.126  1.00 2.00  ? 111 LYS D O     1 
ATOM   6228  C  CB    . LYS D 1 111 ? 11.761  -35.174 -95.069  1.00 2.00  ? 111 LYS D CB    1 
ATOM   6229  C  CG    . LYS D 1 111 ? 11.402  -33.902 -95.844  1.00 25.27 ? 111 LYS D CG    1 
ATOM   6230  C  CD    . LYS D 1 111 ? 11.221  -32.642 -94.946  1.00 27.92 ? 111 LYS D CD    1 
ATOM   6231  C  CE    . LYS D 1 111 ? 11.701  -31.444 -95.723  1.00 12.22 ? 111 LYS D CE    1 
ATOM   6232  N  NZ    . LYS D 1 111 ? 12.478  -32.055 -96.867  1.00 2.65  ? 111 LYS D NZ    1 
ATOM   6233  N  N     . ASN D 1 112 ? 8.776   -35.871 -96.185  1.00 2.00  ? 112 ASN D N     1 
ATOM   6234  C  CA    . ASN D 1 112 ? 7.420   -35.559 -96.722  1.00 2.47  ? 112 ASN D CA    1 
ATOM   6235  C  C     . ASN D 1 112 ? 6.293   -35.932 -95.791  1.00 3.17  ? 112 ASN D C     1 
ATOM   6236  O  O     . ASN D 1 112 ? 5.347   -35.166 -95.592  1.00 6.61  ? 112 ASN D O     1 
ATOM   6237  C  CB    . ASN D 1 112 ? 7.148   -36.111 -98.128  1.00 8.61  ? 112 ASN D CB    1 
ATOM   6238  C  CG    . ASN D 1 112 ? 8.116   -37.262 -98.531  1.00 40.88 ? 112 ASN D CG    1 
ATOM   6239  O  OD1   . ASN D 1 112 ? 9.313   -37.209 -98.201  1.00 40.67 ? 112 ASN D OD1   1 
ATOM   6240  N  ND2   . ASN D 1 112 ? 7.598   -38.301 -99.252  1.00 2.00  ? 112 ASN D ND2   1 
ATOM   6241  N  N     . LEU D 1 113 ? 6.393   -37.118 -95.201  1.00 14.45 ? 113 LEU D N     1 
ATOM   6242  C  CA    . LEU D 1 113 ? 5.278   -37.653 -94.392  1.00 9.48  ? 113 LEU D CA    1 
ATOM   6243  C  C     . LEU D 1 113 ? 5.189   -36.889 -93.078  1.00 2.39  ? 113 LEU D C     1 
ATOM   6244  O  O     . LEU D 1 113 ? 4.077   -36.515 -92.636  1.00 5.16  ? 113 LEU D O     1 
ATOM   6245  C  CB    . LEU D 1 113 ? 5.345   -39.201 -94.187  1.00 2.00  ? 113 LEU D CB    1 
ATOM   6246  C  CG    . LEU D 1 113 ? 4.333   -39.805 -93.159  1.00 13.58 ? 113 LEU D CG    1 
ATOM   6247  C  CD1   . LEU D 1 113 ? 2.876   -39.802 -93.641  1.00 2.00  ? 113 LEU D CD1   1 
ATOM   6248  C  CD2   . LEU D 1 113 ? 4.693   -41.192 -92.518  1.00 6.10  ? 113 LEU D CD2   1 
ATOM   6249  N  N     . LEU D 1 114 ? 6.351   -36.659 -92.470  1.00 2.00  ? 114 LEU D N     1 
ATOM   6250  C  CA    . LEU D 1 114 ? 6.484   -35.760 -91.347  1.00 2.00  ? 114 LEU D CA    1 
ATOM   6251  C  C     . LEU D 1 114 ? 5.893   -34.347 -91.651  1.00 9.19  ? 114 LEU D C     1 
ATOM   6252  O  O     . LEU D 1 114 ? 5.183   -33.762 -90.811  1.00 2.00  ? 114 LEU D O     1 
ATOM   6253  C  CB    . LEU D 1 114 ? 7.979   -35.653 -90.977  1.00 12.62 ? 114 LEU D CB    1 
ATOM   6254  C  CG    . LEU D 1 114 ? 8.524   -35.716 -89.537  1.00 13.04 ? 114 LEU D CG    1 
ATOM   6255  C  CD1   . LEU D 1 114 ? 9.721   -34.804 -89.419  1.00 2.00  ? 114 LEU D CD1   1 
ATOM   6256  C  CD2   . LEU D 1 114 ? 7.488   -35.430 -88.440  1.00 12.78 ? 114 LEU D CD2   1 
ATOM   6257  N  N     . ASP D 1 115 ? 6.192   -33.824 -92.848  1.00 2.00  ? 115 ASP D N     1 
ATOM   6258  C  CA    . ASP D 1 115 ? 5.591   -32.569 -93.273  1.00 4.91  ? 115 ASP D CA    1 
ATOM   6259  C  C     . ASP D 1 115 ? 4.089   -32.662 -93.276  1.00 3.57  ? 115 ASP D C     1 
ATOM   6260  O  O     . ASP D 1 115 ? 3.448   -32.010 -92.448  1.00 4.56  ? 115 ASP D O     1 
ATOM   6261  C  CB    . ASP D 1 115 ? 6.128   -32.049 -94.609  1.00 2.00  ? 115 ASP D CB    1 
ATOM   6262  C  CG    . ASP D 1 115 ? 7.539   -31.501 -94.476  1.00 3.55  ? 115 ASP D CG    1 
ATOM   6263  O  OD1   . ASP D 1 115 ? 7.972   -31.351 -93.299  1.00 2.00  ? 115 ASP D OD1   1 
ATOM   6264  O  OD2   . ASP D 1 115 ? 8.223   -31.279 -95.519  1.00 2.00  ? 115 ASP D OD2   1 
ATOM   6265  N  N     . LEU D 1 116 ? 3.534   -33.463 -94.180  1.00 2.00  ? 116 LEU D N     1 
ATOM   6266  C  CA    . LEU D 1 116 ? 2.115   -33.597 -94.218  1.00 2.00  ? 116 LEU D CA    1 
ATOM   6267  C  C     . LEU D 1 116 ? 1.496   -33.818 -92.839  1.00 4.89  ? 116 LEU D C     1 
ATOM   6268  O  O     . LEU D 1 116 ? 0.469   -33.200 -92.525  1.00 3.82  ? 116 LEU D O     1 
ATOM   6269  C  CB    . LEU D 1 116 ? 1.681   -34.668 -95.196  1.00 2.47  ? 116 LEU D CB    1 
ATOM   6270  C  CG    . LEU D 1 116 ? 0.215   -35.123 -95.120  1.00 9.40  ? 116 LEU D CG    1 
ATOM   6271  C  CD1   . LEU D 1 116 ? -0.669  -33.898 -95.382  1.00 2.00  ? 116 LEU D CD1   1 
ATOM   6272  C  CD2   . LEU D 1 116 ? -0.078  -36.211 -96.188  1.00 2.00  ? 116 LEU D CD2   1 
ATOM   6273  N  N     . THR D 1 117 ? 2.071   -34.664 -91.987  1.00 2.00  ? 117 THR D N     1 
ATOM   6274  C  CA    . THR D 1 117 ? 1.414   -34.827 -90.701  1.00 2.00  ? 117 THR D CA    1 
ATOM   6275  C  C     . THR D 1 117 ? 1.609   -33.682 -89.749  1.00 2.11  ? 117 THR D C     1 
ATOM   6276  O  O     . THR D 1 117 ? 0.729   -33.415 -88.928  1.00 7.37  ? 117 THR D O     1 
ATOM   6277  C  CB    . THR D 1 117 ? 1.765   -36.094 -89.945  1.00 2.00  ? 117 THR D CB    1 
ATOM   6278  O  OG1   . THR D 1 117 ? 3.181   -36.112 -89.786  1.00 8.80  ? 117 THR D OG1   1 
ATOM   6279  C  CG2   . THR D 1 117 ? 1.236   -37.349 -90.679  1.00 2.00  ? 117 THR D CG2   1 
ATOM   6280  N  N     . CYS D 1 118 ? 2.741   -33.002 -89.816  1.00 2.00  ? 118 CYS D N     1 
ATOM   6281  C  CA    . CYS D 1 118 ? 2.844   -31.756 -89.033  1.00 6.74  ? 118 CYS D CA    1 
ATOM   6282  C  C     . CYS D 1 118 ? 1.929   -30.608 -89.430  1.00 2.00  ? 118 CYS D C     1 
ATOM   6283  O  O     . CYS D 1 118 ? 1.208   -30.088 -88.570  1.00 2.00  ? 118 CYS D O     1 
ATOM   6284  C  CB    . CYS D 1 118 ? 4.277   -31.325 -88.689  1.00 2.00  ? 118 CYS D CB    1 
ATOM   6285  S  SG    . CYS D 1 118 ? 5.178   -32.617 -87.710  1.00 3.63  ? 118 CYS D SG    1 
ATOM   6286  N  N     . GLN D 1 119 ? 1.915   -30.252 -90.719  1.00 2.00  ? 119 GLN D N     1 
ATOM   6287  C  CA    . GLN D 1 119 ? 0.909   -29.323 -91.267  1.00 2.00  ? 119 GLN D CA    1 
ATOM   6288  C  C     . GLN D 1 119 ? -0.464  -29.574 -90.708  1.00 2.00  ? 119 GLN D C     1 
ATOM   6289  O  O     . GLN D 1 119 ? -1.197  -28.659 -90.291  1.00 8.92  ? 119 GLN D O     1 
ATOM   6290  C  CB    . GLN D 1 119 ? 0.832   -29.453 -92.766  1.00 2.00  ? 119 GLN D CB    1 
ATOM   6291  C  CG    . GLN D 1 119 ? 2.165   -29.870 -93.332  1.00 6.94  ? 119 GLN D CG    1 
ATOM   6292  C  CD    . GLN D 1 119 ? 2.554   -29.059 -94.556  1.00 40.35 ? 119 GLN D CD    1 
ATOM   6293  O  OE1   . GLN D 1 119 ? 3.094   -29.613 -95.545  1.00 12.26 ? 119 GLN D OE1   1 
ATOM   6294  N  NE2   . GLN D 1 119 ? 2.281   -27.724 -94.504  1.00 19.49 ? 119 GLN D NE2   1 
ATOM   6295  N  N     . THR D 1 120 ? -0.799  -30.846 -90.685  1.00 2.31  ? 120 THR D N     1 
ATOM   6296  C  CA    . THR D 1 120 ? -2.142  -31.269 -90.434  1.00 2.00  ? 120 THR D CA    1 
ATOM   6297  C  C     . THR D 1 120 ? -2.481  -30.953 -89.008  1.00 2.00  ? 120 THR D C     1 
ATOM   6298  O  O     . THR D 1 120 ? -3.538  -30.385 -88.764  1.00 2.66  ? 120 THR D O     1 
ATOM   6299  C  CB    . THR D 1 120 ? -2.347  -32.775 -90.752  1.00 2.00  ? 120 THR D CB    1 
ATOM   6300  O  OG1   . THR D 1 120 ? -2.149  -33.014 -92.151  1.00 2.00  ? 120 THR D OG1   1 
ATOM   6301  C  CG2   . THR D 1 120 ? -3.758  -33.219 -90.345  1.00 2.00  ? 120 THR D CG2   1 
ATOM   6302  N  N     . VAL D 1 121 ? -1.579  -31.293 -88.082  1.00 2.00  ? 121 VAL D N     1 
ATOM   6303  C  CA    . VAL D 1 121 ? -1.716  -30.958 -86.634  1.00 3.81  ? 121 VAL D CA    1 
ATOM   6304  C  C     . VAL D 1 121 ? -1.746  -29.432 -86.333  1.00 12.32 ? 121 VAL D C     1 
ATOM   6305  O  O     . VAL D 1 121 ? -2.576  -28.945 -85.519  1.00 5.54  ? 121 VAL D O     1 
ATOM   6306  C  CB    . VAL D 1 121 ? -0.603  -31.693 -85.755  1.00 5.81  ? 121 VAL D CB    1 
ATOM   6307  C  CG1   . VAL D 1 121 ? -0.569  -31.200 -84.299  1.00 2.00  ? 121 VAL D CG1   1 
ATOM   6308  C  CG2   . VAL D 1 121 ? -0.826  -33.215 -85.794  1.00 2.00  ? 121 VAL D CG2   1 
ATOM   6309  N  N     . ALA D 1 122 ? -0.842  -28.685 -86.984  1.00 13.64 ? 122 ALA D N     1 
ATOM   6310  C  CA    . ALA D 1 122 ? -0.873  -27.222 -86.917  1.00 10.44 ? 122 ALA D CA    1 
ATOM   6311  C  C     . ALA D 1 122 ? -2.257  -26.768 -87.325  1.00 9.89  ? 122 ALA D C     1 
ATOM   6312  O  O     . ALA D 1 122 ? -2.881  -25.982 -86.592  1.00 7.01  ? 122 ALA D O     1 
ATOM   6313  C  CB    . ALA D 1 122 ? 0.181   -26.603 -87.819  1.00 13.29 ? 122 ALA D CB    1 
ATOM   6314  N  N     . ASP D 1 123 ? -2.743  -27.266 -88.465  1.00 2.00  ? 123 ASP D N     1 
ATOM   6315  C  CA    . ASP D 1 123 ? -4.023  -26.781 -88.966  1.00 2.06  ? 123 ASP D CA    1 
ATOM   6316  C  C     . ASP D 1 123 ? -5.061  -27.039 -87.903  1.00 3.08  ? 123 ASP D C     1 
ATOM   6317  O  O     . ASP D 1 123 ? -6.182  -26.506 -87.942  1.00 2.00  ? 123 ASP D O     1 
ATOM   6318  C  CB    . ASP D 1 123 ? -4.420  -27.498 -90.222  1.00 2.00  ? 123 ASP D CB    1 
ATOM   6319  C  CG    . ASP D 1 123 ? -3.692  -26.988 -91.413  1.00 3.90  ? 123 ASP D CG    1 
ATOM   6320  O  OD1   . ASP D 1 123 ? -3.053  -25.911 -91.325  1.00 2.44  ? 123 ASP D OD1   1 
ATOM   6321  O  OD2   . ASP D 1 123 ? -3.728  -27.687 -92.443  1.00 9.39  ? 123 ASP D OD2   1 
ATOM   6322  N  N     . MET D 1 124 ? -4.657  -27.846 -86.921  1.00 2.76  ? 124 MET D N     1 
ATOM   6323  C  CA    . MET D 1 124 ? -5.563  -28.205 -85.815  1.00 11.69 ? 124 MET D CA    1 
ATOM   6324  C  C     . MET D 1 124 ? -5.419  -27.155 -84.736  1.00 9.95  ? 124 MET D C     1 
ATOM   6325  O  O     . MET D 1 124 ? -6.276  -26.956 -83.865  1.00 2.48  ? 124 MET D O     1 
ATOM   6326  C  CB    . MET D 1 124 ? -5.244  -29.602 -85.264  1.00 14.43 ? 124 MET D CB    1 
ATOM   6327  C  CG    . MET D 1 124 ? -5.909  -30.759 -86.051  1.00 2.00  ? 124 MET D CG    1 
ATOM   6328  S  SD    . MET D 1 124 ? -5.519  -32.412 -85.403  1.00 14.54 ? 124 MET D SD    1 
ATOM   6329  C  CE    . MET D 1 124 ? -5.631  -32.236 -83.598  1.00 6.36  ? 124 MET D CE    1 
ATOM   6330  N  N     . ILE D 1 125 ? -4.320  -26.449 -84.819  1.00 3.34  ? 125 ILE D N     1 
ATOM   6331  C  CA    . ILE D 1 125 ? -4.091  -25.523 -83.782  1.00 18.19 ? 125 ILE D CA    1 
ATOM   6332  C  C     . ILE D 1 125 ? -4.625  -24.105 -84.077  1.00 12.56 ? 125 ILE D C     1 
ATOM   6333  O  O     . ILE D 1 125 ? -5.133  -23.454 -83.168  1.00 7.99  ? 125 ILE D O     1 
ATOM   6334  C  CB    . ILE D 1 125 ? -2.655  -25.633 -83.246  1.00 18.68 ? 125 ILE D CB    1 
ATOM   6335  C  CG1   . ILE D 1 125 ? -2.515  -26.949 -82.473  1.00 2.00  ? 125 ILE D CG1   1 
ATOM   6336  C  CG2   . ILE D 1 125 ? -2.330  -24.425 -82.396  1.00 5.71  ? 125 ILE D CG2   1 
ATOM   6337  C  CD1   . ILE D 1 125 ? -1.184  -27.584 -82.632  1.00 2.09  ? 125 ILE D CD1   1 
ATOM   6338  N  N     . LYS D 1 126 ? -4.566  -23.673 -85.343  1.00 8.16  ? 126 LYS D N     1 
ATOM   6339  C  CA    . LYS D 1 126 ? -4.686  -22.227 -85.710  1.00 3.52  ? 126 LYS D CA    1 
ATOM   6340  C  C     . LYS D 1 126 ? -6.108  -21.757 -85.476  1.00 7.97  ? 126 LYS D C     1 
ATOM   6341  O  O     . LYS D 1 126 ? -7.071  -22.449 -85.875  1.00 2.89  ? 126 LYS D O     1 
ATOM   6342  C  CB    . LYS D 1 126 ? -4.302  -21.946 -87.177  1.00 2.00  ? 126 LYS D CB    1 
ATOM   6343  C  CG    . LYS D 1 126 ? -3.136  -22.791 -87.731  1.00 2.00  ? 126 LYS D CG    1 
ATOM   6344  C  CD    . LYS D 1 126 ? -2.497  -22.198 -88.984  1.00 2.00  ? 126 LYS D CD    1 
ATOM   6345  C  CE    . LYS D 1 126 ? -2.751  -22.967 -90.286  1.00 2.00  ? 126 LYS D CE    1 
ATOM   6346  N  NZ    . LYS D 1 126 ? -1.639  -22.864 -91.314  1.00 2.00  ? 126 LYS D NZ    1 
ATOM   6347  N  N     . GLY D 1 127 ? -6.249  -20.621 -84.788  1.00 2.00  ? 127 GLY D N     1 
ATOM   6348  C  CA    . GLY D 1 127 ? -7.569  -20.082 -84.555  1.00 2.00  ? 127 GLY D CA    1 
ATOM   6349  C  C     . GLY D 1 127 ? -8.234  -20.548 -83.270  1.00 3.24  ? 127 GLY D C     1 
ATOM   6350  O  O     . GLY D 1 127 ? -9.415  -20.289 -83.064  1.00 9.04  ? 127 GLY D O     1 
ATOM   6351  N  N     . LYS D 1 128 ? -7.487  -21.204 -82.390  1.00 2.00  ? 128 LYS D N     1 
ATOM   6352  C  CA    . LYS D 1 128 ? -8.084  -21.850 -81.236  1.00 2.00  ? 128 LYS D CA    1 
ATOM   6353  C  C     . LYS D 1 128 ? -7.566  -21.140 -79.984  1.00 5.75  ? 128 LYS D C     1 
ATOM   6354  O  O     . LYS D 1 128 ? -6.391  -20.767 -79.916  1.00 2.00  ? 128 LYS D O     1 
ATOM   6355  C  CB    . LYS D 1 128 ? -7.643  -23.331 -81.165  1.00 12.18 ? 128 LYS D CB    1 
ATOM   6356  C  CG    . LYS D 1 128 ? -8.042  -24.218 -82.351  1.00 10.64 ? 128 LYS D CG    1 
ATOM   6357  C  CD    . LYS D 1 128 ? -8.676  -25.530 -81.854  1.00 27.54 ? 128 LYS D CD    1 
ATOM   6358  C  CE    . LYS D 1 128 ? -9.234  -26.431 -82.997  1.00 23.22 ? 128 LYS D CE    1 
ATOM   6359  N  NZ    . LYS D 1 128 ? -10.232 -25.738 -83.892  1.00 24.66 ? 128 LYS D NZ    1 
ATOM   6360  N  N     . THR D 1 129 ? -8.408  -20.995 -78.969  1.00 2.00  ? 129 THR D N     1 
ATOM   6361  C  CA    . THR D 1 129 ? -7.868  -20.652 -77.678  1.00 3.64  ? 129 THR D CA    1 
ATOM   6362  C  C     . THR D 1 129 ? -7.101  -21.844 -77.106  1.00 7.84  ? 129 THR D C     1 
ATOM   6363  O  O     . THR D 1 129 ? -7.380  -23.020 -77.420  1.00 13.31 ? 129 THR D O     1 
ATOM   6364  C  CB    . THR D 1 129 ? -8.942  -20.410 -76.611  1.00 5.40  ? 129 THR D CB    1 
ATOM   6365  O  OG1   . THR D 1 129 ? -9.639  -21.646 -76.394  1.00 6.72  ? 129 THR D OG1   1 
ATOM   6366  C  CG2   . THR D 1 129 ? -9.880  -19.268 -76.932  1.00 2.00  ? 129 THR D CG2   1 
ATOM   6367  N  N     . PRO D 1 130 ? -6.218  -21.529 -76.159  1.00 6.09  ? 130 PRO D N     1 
ATOM   6368  C  CA    . PRO D 1 130 ? -5.449  -22.384 -75.274  1.00 3.49  ? 130 PRO D CA    1 
ATOM   6369  C  C     . PRO D 1 130 ? -6.293  -23.506 -74.657  1.00 7.48  ? 130 PRO D C     1 
ATOM   6370  O  O     . PRO D 1 130 ? -5.777  -24.593 -74.494  1.00 10.50 ? 130 PRO D O     1 
ATOM   6371  C  CB    . PRO D 1 130 ? -5.011  -21.415 -74.162  1.00 7.57  ? 130 PRO D CB    1 
ATOM   6372  C  CG    . PRO D 1 130 ? -4.890  -20.072 -74.861  1.00 3.48  ? 130 PRO D CG    1 
ATOM   6373  C  CD    . PRO D 1 130 ? -6.010  -20.087 -75.882  1.00 2.00  ? 130 PRO D CD    1 
ATOM   6374  N  N     . GLU D 1 131 ? -7.537  -23.226 -74.261  1.00 2.00  ? 131 GLU D N     1 
ATOM   6375  C  CA    . GLU D 1 131 ? -8.425  -24.251 -73.675  1.00 12.79 ? 131 GLU D CA    1 
ATOM   6376  C  C     . GLU D 1 131 ? -8.910  -25.223 -74.777  1.00 12.25 ? 131 GLU D C     1 
ATOM   6377  O  O     . GLU D 1 131 ? -9.200  -26.389 -74.492  1.00 9.38  ? 131 GLU D O     1 
ATOM   6378  C  CB    . GLU D 1 131 ? -9.664  -23.640 -72.941  1.00 2.00  ? 131 GLU D CB    1 
ATOM   6379  C  CG    . GLU D 1 131 ? -9.350  -22.924 -71.655  1.00 16.97 ? 131 GLU D CG    1 
ATOM   6380  C  CD    . GLU D 1 131 ? -8.839  -21.446 -71.840  1.00 40.56 ? 131 GLU D CD    1 
ATOM   6381  O  OE1   . GLU D 1 131 ? -9.041  -20.835 -72.936  1.00 15.96 ? 131 GLU D OE1   1 
ATOM   6382  O  OE2   . GLU D 1 131 ? -8.240  -20.888 -70.868  1.00 9.03  ? 131 GLU D OE2   1 
ATOM   6383  N  N     . GLU D 1 132 ? -9.036  -24.734 -76.016  1.00 10.05 ? 132 GLU D N     1 
ATOM   6384  C  CA    . GLU D 1 132 ? -9.678  -25.527 -77.058  1.00 7.30  ? 132 GLU D CA    1 
ATOM   6385  C  C     . GLU D 1 132 ? -8.589  -26.447 -77.566  1.00 16.02 ? 132 GLU D C     1 
ATOM   6386  O  O     . GLU D 1 132 ? -8.872  -27.598 -77.934  1.00 14.63 ? 132 GLU D O     1 
ATOM   6387  C  CB    . GLU D 1 132 ? -10.195 -24.668 -78.231  1.00 6.07  ? 132 GLU D CB    1 
ATOM   6388  C  CG    . GLU D 1 132 ? -11.146 -23.540 -77.891  1.00 2.00  ? 132 GLU D CG    1 
ATOM   6389  C  CD    . GLU D 1 132 ? -11.248 -22.526 -79.012  1.00 5.22  ? 132 GLU D CD    1 
ATOM   6390  O  OE1   . GLU D 1 132 ? -12.363 -22.319 -79.546  1.00 2.00  ? 132 GLU D OE1   1 
ATOM   6391  O  OE2   . GLU D 1 132 ? -10.203 -21.932 -79.359  1.00 3.24  ? 132 GLU D OE2   1 
ATOM   6392  N  N     . ILE D 1 133 ? -7.367  -25.936 -77.594  1.00 14.78 ? 133 ILE D N     1 
ATOM   6393  C  CA    . ILE D 1 133 ? -6.187  -26.745 -77.804  1.00 2.24  ? 133 ILE D CA    1 
ATOM   6394  C  C     . ILE D 1 133 ? -5.992  -27.667 -76.623  1.00 5.00  ? 133 ILE D C     1 
ATOM   6395  O  O     . ILE D 1 133 ? -5.858  -28.869 -76.782  1.00 5.20  ? 133 ILE D O     1 
ATOM   6396  C  CB    . ILE D 1 133 ? -4.975  -25.830 -77.974  1.00 2.00  ? 133 ILE D CB    1 
ATOM   6397  C  CG1   . ILE D 1 133 ? -5.280  -24.761 -79.014  1.00 2.00  ? 133 ILE D CG1   1 
ATOM   6398  C  CG2   . ILE D 1 133 ? -3.768  -26.619 -78.373  1.00 2.00  ? 133 ILE D CG2   1 
ATOM   6399  C  CD1   . ILE D 1 133 ? -4.128  -23.887 -79.340  1.00 2.00  ? 133 ILE D CD1   1 
ATOM   6400  N  N     . ARG D 1 134 ? -5.987  -27.089 -75.433  1.00 2.00  ? 134 ARG D N     1 
ATOM   6401  C  CA    . ARG D 1 134 ? -5.844  -27.853 -74.210  1.00 5.76  ? 134 ARG D CA    1 
ATOM   6402  C  C     . ARG D 1 134 ? -6.801  -29.027 -74.203  1.00 14.75 ? 134 ARG D C     1 
ATOM   6403  O  O     . ARG D 1 134 ? -6.804  -29.829 -73.280  1.00 18.14 ? 134 ARG D O     1 
ATOM   6404  C  CB    . ARG D 1 134 ? -6.126  -26.969 -73.005  1.00 11.70 ? 134 ARG D CB    1 
ATOM   6405  C  CG    . ARG D 1 134 ? -4.970  -26.815 -72.058  1.00 2.00  ? 134 ARG D CG    1 
ATOM   6406  C  CD    . ARG D 1 134 ? -5.386  -26.329 -70.702  1.00 2.00  ? 134 ARG D CD    1 
ATOM   6407  N  NE    . ARG D 1 134 ? -6.133  -25.084 -70.795  1.00 17.29 ? 134 ARG D NE    1 
ATOM   6408  C  CZ    . ARG D 1 134 ? -5.586  -23.882 -70.706  1.00 2.00  ? 134 ARG D CZ    1 
ATOM   6409  N  NH1   . ARG D 1 134 ? -4.288  -23.749 -70.523  1.00 2.00  ? 134 ARG D NH1   1 
ATOM   6410  N  NH2   . ARG D 1 134 ? -6.338  -22.810 -70.804  1.00 7.72  ? 134 ARG D NH2   1 
ATOM   6411  N  N     . THR D 1 135 ? -7.616  -29.119 -75.244  1.00 15.45 ? 135 THR D N     1 
ATOM   6412  C  CA    . THR D 1 135 ? -8.837  -29.897 -75.185  1.00 2.00  ? 135 THR D CA    1 
ATOM   6413  C  C     . THR D 1 135 ? -9.022  -30.776 -76.403  1.00 2.00  ? 135 THR D C     1 
ATOM   6414  O  O     . THR D 1 135 ? -9.369  -31.935 -76.269  1.00 5.32  ? 135 THR D O     1 
ATOM   6415  C  CB    . THR D 1 135 ? -10.050 -28.993 -74.998  1.00 3.82  ? 135 THR D CB    1 
ATOM   6416  O  OG1   . THR D 1 135 ? -10.600 -29.202 -73.695  1.00 2.00  ? 135 THR D OG1   1 
ATOM   6417  C  CG2   . THR D 1 135 ? -11.162 -29.419 -75.906  1.00 2.00  ? 135 THR D CG2   1 
ATOM   6418  N  N     . THR D 1 136 ? -8.729  -30.234 -77.574  1.00 2.00  ? 136 THR D N     1 
ATOM   6419  C  CA    . THR D 1 136 ? -8.599  -31.029 -78.784  1.00 2.00  ? 136 THR D CA    1 
ATOM   6420  C  C     . THR D 1 136 ? -7.549  -32.126 -78.664  1.00 3.87  ? 136 THR D C     1 
ATOM   6421  O  O     . THR D 1 136 ? -7.852  -33.303 -78.814  1.00 3.59  ? 136 THR D O     1 
ATOM   6422  C  CB    . THR D 1 136 ? -8.299  -30.128 -79.980  1.00 2.00  ? 136 THR D CB    1 
ATOM   6423  O  OG1   . THR D 1 136 ? -8.576  -28.772 -79.630  1.00 6.11  ? 136 THR D OG1   1 
ATOM   6424  C  CG2   . THR D 1 136 ? -9.283  -30.376 -81.079  1.00 2.00  ? 136 THR D CG2   1 
ATOM   6425  N  N     . PHE D 1 137 ? -6.310  -31.742 -78.402  1.00 2.00  ? 137 PHE D N     1 
ATOM   6426  C  CA    . PHE D 1 137 ? -5.415  -32.586 -77.642  1.00 2.00  ? 137 PHE D CA    1 
ATOM   6427  C  C     . PHE D 1 137 ? -6.035  -32.747 -76.284  1.00 2.33  ? 137 PHE D C     1 
ATOM   6428  O  O     . PHE D 1 137 ? -7.149  -32.288 -76.054  1.00 2.00  ? 137 PHE D O     1 
ATOM   6429  C  CB    . PHE D 1 137 ? -4.045  -31.933 -77.519  1.00 4.05  ? 137 PHE D CB    1 
ATOM   6430  C  CG    . PHE D 1 137 ? -3.454  -31.524 -78.836  1.00 14.75 ? 137 PHE D CG    1 
ATOM   6431  C  CD1   . PHE D 1 137 ? -2.162  -31.867 -79.167  1.00 11.20 ? 137 PHE D CD1   1 
ATOM   6432  C  CD2   . PHE D 1 137 ? -4.198  -30.807 -79.748  1.00 11.70 ? 137 PHE D CD2   1 
ATOM   6433  C  CE1   . PHE D 1 137 ? -1.632  -31.501 -80.370  1.00 2.00  ? 137 PHE D CE1   1 
ATOM   6434  C  CE2   . PHE D 1 137 ? -3.665  -30.445 -80.950  1.00 18.57 ? 137 PHE D CE2   1 
ATOM   6435  C  CZ    . PHE D 1 137 ? -2.382  -30.789 -81.259  1.00 6.73  ? 137 PHE D CZ    1 
ATOM   6436  N  N     . ASN D 1 138 ? -5.319  -33.392 -75.378  1.00 2.00  ? 138 ASN D N     1 
ATOM   6437  C  CA    . ASN D 1 138 ? -5.734  -33.398 -73.994  1.00 2.00  ? 138 ASN D CA    1 
ATOM   6438  C  C     . ASN D 1 138 ? -4.580  -33.046 -73.099  1.00 6.62  ? 138 ASN D C     1 
ATOM   6439  O  O     . ASN D 1 138 ? -4.144  -33.847 -72.286  1.00 14.15 ? 138 ASN D O     1 
ATOM   6440  C  CB    . ASN D 1 138 ? -6.296  -34.754 -73.598  1.00 2.00  ? 138 ASN D CB    1 
ATOM   6441  C  CG    . ASN D 1 138 ? -6.598  -34.840 -72.127  1.00 6.14  ? 138 ASN D CG    1 
ATOM   6442  O  OD1   . ASN D 1 138 ? -5.738  -35.200 -71.328  1.00 3.59  ? 138 ASN D OD1   1 
ATOM   6443  N  ND2   . ASN D 1 138 ? -7.821  -34.492 -71.753  1.00 2.00  ? 138 ASN D ND2   1 
ATOM   6444  N  N     . ILE D 1 139 ? -4.084  -31.833 -73.256  1.00 4.41  ? 139 ILE D N     1 
ATOM   6445  C  CA    . ILE D 1 139 ? -3.136  -31.285 -72.318  1.00 6.01  ? 139 ILE D CA    1 
ATOM   6446  C  C     . ILE D 1 139 ? -3.889  -30.726 -71.126  1.00 7.33  ? 139 ILE D C     1 
ATOM   6447  O  O     . ILE D 1 139 ? -4.977  -30.177 -71.266  1.00 2.00  ? 139 ILE D O     1 
ATOM   6448  C  CB    . ILE D 1 139 ? -2.326  -30.195 -73.009  1.00 9.88  ? 139 ILE D CB    1 
ATOM   6449  C  CG1   . ILE D 1 139 ? -2.011  -30.618 -74.437  1.00 12.02 ? 139 ILE D CG1   1 
ATOM   6450  C  CG2   . ILE D 1 139 ? -1.058  -29.896 -72.253  1.00 2.00  ? 139 ILE D CG2   1 
ATOM   6451  C  CD1   . ILE D 1 139 ? -0.553  -30.635 -74.746  1.00 10.76 ? 139 ILE D CD1   1 
ATOM   6452  N  N     . LYS D 1 140 ? -3.311  -30.886 -69.949  1.00 6.10  ? 140 LYS D N     1 
ATOM   6453  C  CA    . LYS D 1 140 ? -3.855  -30.268 -68.758  1.00 12.49 ? 140 LYS D CA    1 
ATOM   6454  C  C     . LYS D 1 140 ? -3.036  -29.043 -68.417  1.00 10.78 ? 140 LYS D C     1 
ATOM   6455  O  O     . LYS D 1 140 ? -1.813  -29.074 -68.496  1.00 2.97  ? 140 LYS D O     1 
ATOM   6456  C  CB    . LYS D 1 140 ? -3.841  -31.254 -67.590  1.00 4.30  ? 140 LYS D CB    1 
ATOM   6457  C  CG    . LYS D 1 140 ? -2.882  -30.880 -66.491  1.00 18.39 ? 140 LYS D CG    1 
ATOM   6458  C  CD    . LYS D 1 140 ? -3.609  -30.678 -65.183  1.00 19.97 ? 140 LYS D CD    1 
ATOM   6459  C  CE    . LYS D 1 140 ? -4.305  -31.952 -64.764  1.00 28.19 ? 140 LYS D CE    1 
ATOM   6460  N  NZ    . LYS D 1 140 ? -4.803  -32.675 -65.953  1.00 2.00  ? 140 LYS D NZ    1 
ATOM   6461  N  N     . ASN D 1 141 ? -3.706  -27.958 -68.041  1.00 9.75  ? 141 ASN D N     1 
ATOM   6462  C  CA    . ASN D 1 141 ? -2.985  -26.699 -67.894  1.00 4.05  ? 141 ASN D CA    1 
ATOM   6463  C  C     . ASN D 1 141 ? -2.215  -26.426 -66.592  1.00 2.00  ? 141 ASN D C     1 
ATOM   6464  O  O     . ASN D 1 141 ? -2.825  -26.233 -65.545  1.00 2.12  ? 141 ASN D O     1 
ATOM   6465  C  CB    . ASN D 1 141 ? -3.924  -25.557 -68.105  1.00 3.53  ? 141 ASN D CB    1 
ATOM   6466  C  CG    . ASN D 1 141 ? -3.398  -24.310 -67.529  1.00 2.00  ? 141 ASN D CG    1 
ATOM   6467  O  OD1   . ASN D 1 141 ? -2.194  -24.058 -67.512  1.00 2.00  ? 141 ASN D OD1   1 
ATOM   6468  N  ND2   . ASN D 1 141 ? -4.292  -23.518 -67.017  1.00 2.00  ? 141 ASN D ND2   1 
ATOM   6469  N  N     . ASP D 1 142 ? -0.885  -26.364 -66.667  1.00 2.00  ? 142 ASP D N     1 
ATOM   6470  C  CA    . ASP D 1 142 ? -0.056  -26.401 -65.470  1.00 2.00  ? 142 ASP D CA    1 
ATOM   6471  C  C     . ASP D 1 142 ? 0.606   -25.057 -65.259  1.00 9.49  ? 142 ASP D C     1 
ATOM   6472  O  O     . ASP D 1 142 ? 1.722   -24.982 -64.717  1.00 15.57 ? 142 ASP D O     1 
ATOM   6473  C  CB    . ASP D 1 142 ? 1.035   -27.397 -65.678  1.00 2.00  ? 142 ASP D CB    1 
ATOM   6474  C  CG    . ASP D 1 142 ? 1.705   -27.178 -66.940  1.00 2.00  ? 142 ASP D CG    1 
ATOM   6475  O  OD1   . ASP D 1 142 ? 1.064   -26.526 -67.813  1.00 2.00  ? 142 ASP D OD1   1 
ATOM   6476  O  OD2   . ASP D 1 142 ? 2.871   -27.601 -67.052  1.00 2.00  ? 142 ASP D OD2   1 
ATOM   6477  N  N     . PHE D 1 143 ? -0.092  -24.009 -65.710  1.00 4.97  ? 143 PHE D N     1 
ATOM   6478  C  CA    . PHE D 1 143 ? 0.090   -22.632 -65.239  1.00 5.16  ? 143 PHE D CA    1 
ATOM   6479  C  C     . PHE D 1 143 ? -0.707  -22.369 -63.962  1.00 2.00  ? 143 PHE D C     1 
ATOM   6480  O  O     . PHE D 1 143 ? -1.838  -22.772 -63.842  1.00 2.00  ? 143 PHE D O     1 
ATOM   6481  C  CB    . PHE D 1 143 ? -0.376  -21.632 -66.337  1.00 2.49  ? 143 PHE D CB    1 
ATOM   6482  C  CG    . PHE D 1 143 ? 0.539   -21.561 -67.567  1.00 2.00  ? 143 PHE D CG    1 
ATOM   6483  C  CD1   . PHE D 1 143 ? 0.131   -22.101 -68.801  1.00 2.00  ? 143 PHE D CD1   1 
ATOM   6484  C  CD2   . PHE D 1 143 ? 1.772   -20.942 -67.500  1.00 2.00  ? 143 PHE D CD2   1 
ATOM   6485  C  CE1   . PHE D 1 143 ? 0.928   -22.005 -69.929  1.00 2.00  ? 143 PHE D CE1   1 
ATOM   6486  C  CE2   . PHE D 1 143 ? 2.586   -20.865 -68.638  1.00 2.43  ? 143 PHE D CE2   1 
ATOM   6487  C  CZ    . PHE D 1 143 ? 2.155   -21.386 -69.845  1.00 2.00  ? 143 PHE D CZ    1 
ATOM   6488  N  N     . THR D 1 144 ? -0.138  -21.634 -63.028  1.00 2.00  ? 144 THR D N     1 
ATOM   6489  C  CA    . THR D 1 144 ? -0.973  -20.961 -62.031  1.00 6.67  ? 144 THR D CA    1 
ATOM   6490  C  C     . THR D 1 144 ? -1.832  -19.792 -62.596  1.00 5.97  ? 144 THR D C     1 
ATOM   6491  O  O     . THR D 1 144 ? -1.556  -19.220 -63.664  1.00 9.01  ? 144 THR D O     1 
ATOM   6492  C  CB    . THR D 1 144 ? -0.130  -20.490 -60.859  1.00 2.29  ? 144 THR D CB    1 
ATOM   6493  O  OG1   . THR D 1 144 ? 0.556   -19.297 -61.250  1.00 10.32 ? 144 THR D OG1   1 
ATOM   6494  C  CG2   . THR D 1 144 ? 0.921   -21.551 -60.510  1.00 2.00  ? 144 THR D CG2   1 
ATOM   6495  N  N     . PRO D 1 145 ? -2.987  -19.620 -61.971  1.00 2.76  ? 145 PRO D N     1 
ATOM   6496  C  CA    . PRO D 1 145 ? -3.657  -18.333 -61.860  1.00 2.00  ? 145 PRO D CA    1 
ATOM   6497  C  C     . PRO D 1 145 ? -2.802  -17.193 -62.373  1.00 3.99  ? 145 PRO D C     1 
ATOM   6498  O  O     . PRO D 1 145 ? -2.975  -16.728 -63.490  1.00 2.73  ? 145 PRO D O     1 
ATOM   6499  C  CB    . PRO D 1 145 ? -3.821  -18.197 -60.357  1.00 8.27  ? 145 PRO D CB    1 
ATOM   6500  C  CG    . PRO D 1 145 ? -2.635  -18.958 -59.781  1.00 2.00  ? 145 PRO D CG    1 
ATOM   6501  C  CD    . PRO D 1 145 ? -2.043  -19.829 -60.867  1.00 2.00  ? 145 PRO D CD    1 
ATOM   6502  N  N     . GLU D 1 146 ? -1.870  -16.742 -61.540  1.00 2.00  ? 146 GLU D N     1 
ATOM   6503  C  CA    . GLU D 1 146 ? -1.278  -15.419 -61.695  1.00 4.17  ? 146 GLU D CA    1 
ATOM   6504  C  C     . GLU D 1 146 ? -0.221  -15.413 -62.794  1.00 2.16  ? 146 GLU D C     1 
ATOM   6505  O  O     . GLU D 1 146 ? 0.008   -14.392 -63.443  1.00 7.37  ? 146 GLU D O     1 
ATOM   6506  C  CB    . GLU D 1 146 ? -0.667  -14.947 -60.374  1.00 2.00  ? 146 GLU D CB    1 
ATOM   6507  C  CG    . GLU D 1 146 ? 0.700   -15.542 -60.075  1.00 2.00  ? 146 GLU D CG    1 
ATOM   6508  C  CD    . GLU D 1 146 ? 0.611   -16.933 -59.479  1.00 37.56 ? 146 GLU D CD    1 
ATOM   6509  O  OE1   . GLU D 1 146 ? -0.318  -17.183 -58.684  1.00 18.60 ? 146 GLU D OE1   1 
ATOM   6510  O  OE2   . GLU D 1 146 ? 1.472   -17.777 -59.807  1.00 43.52 ? 146 GLU D OE2   1 
ATOM   6511  N  N     . GLU D 1 147 ? 0.421   -16.559 -62.997  1.00 9.72  ? 147 GLU D N     1 
ATOM   6512  C  CA    . GLU D 1 147 ? 1.339   -16.735 -64.115  1.00 3.28  ? 147 GLU D CA    1 
ATOM   6513  C  C     . GLU D 1 147 ? 0.613   -16.608 -65.451  1.00 2.00  ? 147 GLU D C     1 
ATOM   6514  O  O     . GLU D 1 147 ? 0.915   -15.723 -66.251  1.00 4.40  ? 147 GLU D O     1 
ATOM   6515  C  CB    . GLU D 1 147 ? 2.040   -18.092 -64.024  1.00 9.46  ? 147 GLU D CB    1 
ATOM   6516  C  CG    . GLU D 1 147 ? 2.913   -18.258 -62.791  1.00 11.28 ? 147 GLU D CG    1 
ATOM   6517  C  CD    . GLU D 1 147 ? 3.540   -19.635 -62.703  1.00 2.00  ? 147 GLU D CD    1 
ATOM   6518  O  OE1   . GLU D 1 147 ? 2.799   -20.635 -62.801  1.00 8.16  ? 147 GLU D OE1   1 
ATOM   6519  O  OE2   . GLU D 1 147 ? 4.775   -19.718 -62.535  1.00 8.53  ? 147 GLU D OE2   1 
ATOM   6520  N  N     . GLU D 1 148 ? -0.305  -17.536 -65.698  1.00 3.96  ? 148 GLU D N     1 
ATOM   6521  C  CA    . GLU D 1 148 ? -1.014  -17.603 -66.967  1.00 3.80  ? 148 GLU D CA    1 
ATOM   6522  C  C     . GLU D 1 148 ? -1.459  -16.211 -67.367  1.00 2.00  ? 148 GLU D C     1 
ATOM   6523  O  O     . GLU D 1 148 ? -1.662  -15.910 -68.531  1.00 2.00  ? 148 GLU D O     1 
ATOM   6524  C  CB    . GLU D 1 148 ? -2.228  -18.509 -66.850  1.00 2.00  ? 148 GLU D CB    1 
ATOM   6525  C  CG    . GLU D 1 148 ? -3.214  -18.355 -67.990  1.00 18.22 ? 148 GLU D CG    1 
ATOM   6526  C  CD    . GLU D 1 148 ? -4.299  -19.411 -67.987  1.00 15.46 ? 148 GLU D CD    1 
ATOM   6527  O  OE1   . GLU D 1 148 ? -4.800  -19.763 -69.075  1.00 2.00  ? 148 GLU D OE1   1 
ATOM   6528  O  OE2   . GLU D 1 148 ? -4.650  -19.889 -66.894  1.00 19.98 ? 148 GLU D OE2   1 
ATOM   6529  N  N     . GLU D 1 149 ? -1.608  -15.362 -66.371  1.00 2.03  ? 149 GLU D N     1 
ATOM   6530  C  CA    . GLU D 1 149 ? -2.196  -14.069 -66.575  1.00 4.45  ? 149 GLU D CA    1 
ATOM   6531  C  C     . GLU D 1 149 ? -1.105  -13.066 -66.880  1.00 5.96  ? 149 GLU D C     1 
ATOM   6532  O  O     . GLU D 1 149 ? -1.302  -12.151 -67.657  1.00 2.00  ? 149 GLU D O     1 
ATOM   6533  C  CB    . GLU D 1 149 ? -3.017  -13.683 -65.354  1.00 2.00  ? 149 GLU D CB    1 
ATOM   6534  C  CG    . GLU D 1 149 ? -2.909  -12.249 -64.905  1.00 10.41 ? 149 GLU D CG    1 
ATOM   6535  C  CD    . GLU D 1 149 ? -3.993  -11.910 -63.910  1.00 29.34 ? 149 GLU D CD    1 
ATOM   6536  O  OE1   . GLU D 1 149 ? -4.741  -12.826 -63.516  1.00 24.94 ? 149 GLU D OE1   1 
ATOM   6537  O  OE2   . GLU D 1 149 ? -4.102  -10.733 -63.521  1.00 19.70 ? 149 GLU D OE2   1 
ATOM   6538  N  N     . GLU D 1 150 ? 0.067   -13.271 -66.301  1.00 2.00  ? 150 GLU D N     1 
ATOM   6539  C  CA    . GLU D 1 150 ? 1.226   -12.503 -66.703  1.00 2.00  ? 150 GLU D CA    1 
ATOM   6540  C  C     . GLU D 1 150 ? 1.682   -12.785 -68.119  1.00 2.00  ? 150 GLU D C     1 
ATOM   6541  O  O     . GLU D 1 150 ? 2.085   -11.872 -68.821  1.00 3.06  ? 150 GLU D O     1 
ATOM   6542  C  CB    . GLU D 1 150 ? 2.385   -12.650 -65.725  1.00 2.00  ? 150 GLU D CB    1 
ATOM   6543  C  CG    . GLU D 1 150 ? 3.283   -11.430 -65.691  1.00 2.00  ? 150 GLU D CG    1 
ATOM   6544  C  CD    . GLU D 1 150 ? 4.651   -11.691 -65.097  1.00 31.92 ? 150 GLU D CD    1 
ATOM   6545  O  OE1   . GLU D 1 150 ? 5.648   -11.633 -65.846  1.00 12.80 ? 150 GLU D OE1   1 
ATOM   6546  O  OE2   . GLU D 1 150 ? 4.739   -11.932 -63.873  1.00 28.64 ? 150 GLU D OE2   1 
ATOM   6547  N  N     . VAL D 1 151 ? 1.642   -14.044 -68.539  1.00 5.91  ? 151 VAL D N     1 
ATOM   6548  C  CA    . VAL D 1 151 ? 2.024   -14.365 -69.918  1.00 5.33  ? 151 VAL D CA    1 
ATOM   6549  C  C     . VAL D 1 151 ? 0.972   -13.848 -70.912  1.00 2.00  ? 151 VAL D C     1 
ATOM   6550  O  O     . VAL D 1 151 ? 1.296   -13.235 -71.923  1.00 2.00  ? 151 VAL D O     1 
ATOM   6551  C  CB    . VAL D 1 151 ? 2.272   -15.930 -70.129  1.00 5.78  ? 151 VAL D CB    1 
ATOM   6552  C  CG1   . VAL D 1 151 ? 2.381   -16.278 -71.593  1.00 2.00  ? 151 VAL D CG1   1 
ATOM   6553  C  CG2   . VAL D 1 151 ? 3.566   -16.423 -69.392  1.00 2.00  ? 151 VAL D CG2   1 
ATOM   6554  N  N     . ARG D 1 152 ? -0.283  -14.167 -70.657  1.00 2.00  ? 152 ARG D N     1 
ATOM   6555  C  CA    . ARG D 1 152 ? -1.371  -13.583 -71.442  1.00 4.27  ? 152 ARG D CA    1 
ATOM   6556  C  C     . ARG D 1 152 ? -1.204  -12.035 -71.686  1.00 6.78  ? 152 ARG D C     1 
ATOM   6557  O  O     . ARG D 1 152 ? -1.360  -11.527 -72.840  1.00 2.47  ? 152 ARG D O     1 
ATOM   6558  C  CB    . ARG D 1 152 ? -2.730  -13.890 -70.814  1.00 2.00  ? 152 ARG D CB    1 
ATOM   6559  C  CG    . ARG D 1 152 ? -3.792  -13.123 -71.515  1.00 3.21  ? 152 ARG D CG    1 
ATOM   6560  C  CD    . ARG D 1 152 ? -5.213  -13.564 -71.207  1.00 2.00  ? 152 ARG D CD    1 
ATOM   6561  N  NE    . ARG D 1 152 ? -5.313  -14.984 -71.501  1.00 35.73 ? 152 ARG D NE    1 
ATOM   6562  C  CZ    . ARG D 1 152 ? -5.287  -15.943 -70.580  1.00 30.00 ? 152 ARG D CZ    1 
ATOM   6563  N  NH1   . ARG D 1 152 ? -5.208  -15.643 -69.275  1.00 2.00  ? 152 ARG D NH1   1 
ATOM   6564  N  NH2   . ARG D 1 152 ? -5.360  -17.205 -70.979  1.00 20.49 ? 152 ARG D NH2   1 
ATOM   6565  N  N     . ARG D 1 153 ? -0.849  -11.312 -70.618  1.00 2.00  ? 153 ARG D N     1 
ATOM   6566  C  CA    . ARG D 1 153 ? -0.826  -9.874  -70.647  1.00 2.00  ? 153 ARG D CA    1 
ATOM   6567  C  C     . ARG D 1 153 ? 0.327   -9.411  -71.508  1.00 2.00  ? 153 ARG D C     1 
ATOM   6568  O  O     . ARG D 1 153 ? 0.144   -8.557  -72.395  1.00 2.00  ? 153 ARG D O     1 
ATOM   6569  C  CB    . ARG D 1 153 ? -0.782  -9.268  -69.269  1.00 2.00  ? 153 ARG D CB    1 
ATOM   6570  C  CG    . ARG D 1 153 ? -0.692  -7.808  -69.317  1.00 2.00  ? 153 ARG D CG    1 
ATOM   6571  C  CD    . ARG D 1 153 ? -0.764  -7.273  -67.968  1.00 2.00  ? 153 ARG D CD    1 
ATOM   6572  N  NE    . ARG D 1 153 ? 0.344   -7.800  -67.199  1.00 28.02 ? 153 ARG D NE    1 
ATOM   6573  C  CZ    . ARG D 1 153 ? 0.253   -8.356  -65.985  1.00 30.67 ? 153 ARG D CZ    1 
ATOM   6574  N  NH1   . ARG D 1 153 ? -0.918  -8.484  -65.359  1.00 2.00  ? 153 ARG D NH1   1 
ATOM   6575  N  NH2   . ARG D 1 153 ? 1.355   -8.789  -65.382  1.00 2.00  ? 153 ARG D NH2   1 
ATOM   6576  N  N     . GLU D 1 154 ? 1.499   -10.004 -71.334  1.00 2.00  ? 154 GLU D N     1 
ATOM   6577  C  CA    . GLU D 1 154 ? 2.613   -9.722  -72.289  1.00 2.00  ? 154 GLU D CA    1 
ATOM   6578  C  C     . GLU D 1 154 ? 2.353   -10.212 -73.742  1.00 2.04  ? 154 GLU D C     1 
ATOM   6579  O  O     . GLU D 1 154 ? 2.723   -9.597  -74.692  1.00 3.56  ? 154 GLU D O     1 
ATOM   6580  C  CB    . GLU D 1 154 ? 3.781   -10.518 -71.777  1.00 5.37  ? 154 GLU D CB    1 
ATOM   6581  C  CG    . GLU D 1 154 ? 5.154   -10.335 -72.437  1.00 2.33  ? 154 GLU D CG    1 
ATOM   6582  C  CD    . GLU D 1 154 ? 6.207   -11.036 -71.516  1.00 5.24  ? 154 GLU D CD    1 
ATOM   6583  O  OE1   . GLU D 1 154 ? 6.373   -10.668 -70.318  1.00 2.00  ? 154 GLU D OE1   1 
ATOM   6584  O  OE2   . GLU D 1 154 ? 6.785   -12.021 -71.985  1.00 3.00  ? 154 GLU D OE2   1 
ATOM   6585  N  N     . ASN D 1 155 ? 1.776   -11.395 -73.942  1.00 12.49 ? 155 ASN D N     1 
ATOM   6586  C  CA    . ASN D 1 155 ? 1.406   -11.737 -75.316  1.00 7.79  ? 155 ASN D CA    1 
ATOM   6587  C  C     . ASN D 1 155 ? 0.644   -10.557 -75.966  1.00 9.73  ? 155 ASN D C     1 
ATOM   6588  O  O     . ASN D 1 155 ? 1.053   -10.073 -77.014  1.00 7.84  ? 155 ASN D O     1 
ATOM   6589  C  CB    . ASN D 1 155 ? 0.552   -13.030 -75.352  1.00 2.00  ? 155 ASN D CB    1 
ATOM   6590  C  CG    . ASN D 1 155 ? 1.404   -14.275 -75.168  1.00 26.43 ? 155 ASN D CG    1 
ATOM   6591  O  OD1   . ASN D 1 155 ? 2.625   -14.200 -74.813  1.00 6.43  ? 155 ASN D OD1   1 
ATOM   6592  N  ND2   . ASN D 1 155 ? 0.800   -15.431 -75.438  1.00 6.58  ? 155 ASN D ND2   1 
ATOM   6593  N  N     . GLN D 1 156 ? -0.480  -10.146 -75.351  1.00 3.14  ? 156 GLN D N     1 
ATOM   6594  C  CA    . GLN D 1 156 ? -1.461  -9.299  -75.974  1.00 2.00  ? 156 GLN D CA    1 
ATOM   6595  C  C     . GLN D 1 156 ? -0.924  -7.863  -75.990  1.00 5.80  ? 156 GLN D C     1 
ATOM   6596  O  O     . GLN D 1 156 ? -1.103  -7.181  -77.000  1.00 2.08  ? 156 GLN D O     1 
ATOM   6597  C  CB    . GLN D 1 156 ? -2.770  -9.307  -75.186  1.00 5.80  ? 156 GLN D CB    1 
ATOM   6598  C  CG    . GLN D 1 156 ? -3.708  -10.481 -75.408  1.00 2.00  ? 156 GLN D CG    1 
ATOM   6599  C  CD    . GLN D 1 156 ? -4.735  -10.570 -74.319  1.00 11.11 ? 156 GLN D CD    1 
ATOM   6600  O  OE1   . GLN D 1 156 ? -4.761  -9.723  -73.407  1.00 24.47 ? 156 GLN D OE1   1 
ATOM   6601  N  NE2   . GLN D 1 156 ? -5.605  -11.587 -74.385  1.00 9.33  ? 156 GLN D NE2   1 
ATOM   6602  N  N     . TRP D 1 157 ? -0.246  -7.412  -74.935  1.00 2.00  ? 157 TRP D N     1 
ATOM   6603  C  CA    . TRP D 1 157 ? 0.084   -6.003  -74.858  1.00 2.00  ? 157 TRP D CA    1 
ATOM   6604  C  C     . TRP D 1 157 ? 1.372   -5.721  -75.545  1.00 3.88  ? 157 TRP D C     1 
ATOM   6605  O  O     . TRP D 1 157 ? 1.576   -4.571  -76.018  1.00 7.62  ? 157 TRP D O     1 
ATOM   6606  C  CB    . TRP D 1 157 ? 0.194   -5.454  -73.436  1.00 2.00  ? 157 TRP D CB    1 
ATOM   6607  C  CG    . TRP D 1 157 ? -1.027  -5.501  -72.537  1.00 2.00  ? 157 TRP D CG    1 
ATOM   6608  C  CD1   . TRP D 1 157 ? -2.208  -6.155  -72.755  1.00 2.00  ? 157 TRP D CD1   1 
ATOM   6609  C  CD2   . TRP D 1 157 ? -1.129  -4.909  -71.229  1.00 2.00  ? 157 TRP D CD2   1 
ATOM   6610  N  NE1   . TRP D 1 157 ? -3.048  -6.024  -71.635  1.00 2.00  ? 157 TRP D NE1   1 
ATOM   6611  C  CE2   . TRP D 1 157 ? -2.410  -5.258  -70.698  1.00 2.00  ? 157 TRP D CE2   1 
ATOM   6612  C  CE3   . TRP D 1 157 ? -0.252  -4.130  -70.444  1.00 2.00  ? 157 TRP D CE3   1 
ATOM   6613  C  CZ2   . TRP D 1 157 ? -2.847  -4.820  -69.440  1.00 2.00  ? 157 TRP D CZ2   1 
ATOM   6614  C  CZ3   . TRP D 1 157 ? -0.666  -3.737  -69.166  1.00 2.00  ? 157 TRP D CZ3   1 
ATOM   6615  C  CH2   . TRP D 1 157 ? -1.965  -4.067  -68.679  1.00 2.00  ? 157 TRP D CH2   1 
ATOM   6616  N  N     . ALA D 1 158 ? 2.254   -6.714  -75.641  1.00 2.00  ? 158 ALA D N     1 
ATOM   6617  C  CA    . ALA D 1 158 ? 3.587   -6.529  -76.283  1.00 7.20  ? 158 ALA D CA    1 
ATOM   6618  C  C     . ALA D 1 158 ? 3.622   -7.134  -77.677  1.00 7.19  ? 158 ALA D C     1 
ATOM   6619  O  O     . ALA D 1 158 ? 4.394   -6.717  -78.546  1.00 2.11  ? 158 ALA D O     1 
ATOM   6620  C  CB    . ALA D 1 158 ? 4.729   -7.263  -75.420  1.00 4.18  ? 158 ALA D CB    1 
ATOM   6621  N  N     . PHE D 1 159 ? 2.894   -8.222  -77.892  1.00 2.69  ? 159 PHE D N     1 
ATOM   6622  C  CA    . PHE D 1 159 ? 3.237   -8.986  -79.087  1.00 3.94  ? 159 PHE D CA    1 
ATOM   6623  C  C     . PHE D 1 159 ? 2.175   -9.193  -80.148  1.00 2.18  ? 159 PHE D C     1 
ATOM   6624  O  O     . PHE D 1 159 ? 2.393   -9.812  -81.182  1.00 5.20  ? 159 PHE D O     1 
ATOM   6625  C  CB    . PHE D 1 159 ? 3.878   -10.322 -78.725  1.00 4.64  ? 159 PHE D CB    1 
ATOM   6626  C  CG    . PHE D 1 159 ? 5.086   -10.206 -77.769  1.00 2.00  ? 159 PHE D CG    1 
ATOM   6627  C  CD1   . PHE D 1 159 ? 4.979   -10.579 -76.414  1.00 2.00  ? 159 PHE D CD1   1 
ATOM   6628  C  CD2   . PHE D 1 159 ? 6.309   -9.808  -78.226  1.00 2.00  ? 159 PHE D CD2   1 
ATOM   6629  C  CE1   . PHE D 1 159 ? 6.107   -10.529 -75.563  1.00 4.87  ? 159 PHE D CE1   1 
ATOM   6630  C  CE2   . PHE D 1 159 ? 7.423   -9.743  -77.378  1.00 2.00  ? 159 PHE D CE2   1 
ATOM   6631  C  CZ    . PHE D 1 159 ? 7.344   -10.121 -76.067  1.00 2.00  ? 159 PHE D CZ    1 
ATOM   6632  N  N     . GLU D 1 160 ? 0.995   -8.707  -79.916  1.00 2.29  ? 160 GLU D N     1 
ATOM   6633  C  CA    . GLU D 1 160 ? 0.051   -8.705  -81.007  1.00 2.27  ? 160 GLU D CA    1 
ATOM   6634  C  C     . GLU D 1 160 ? -0.151  -7.233  -81.178  1.00 2.00  ? 160 GLU D C     1 
ATOM   6635  O  O     . GLU D 1 160 ? -0.123  -6.900  -82.298  1.00 2.88  ? 160 GLU D O     1 
ATOM   6636  C  CB    . GLU D 1 160 ? -1.287  -9.382  -80.628  1.00 2.00  ? 160 GLU D CB    1 
ATOM   6637  C  CG    . GLU D 1 160 ? -1.267  -10.880 -80.578  1.00 20.84 ? 160 GLU D CG    1 
ATOM   6638  C  CD    . GLU D 1 160 ? -2.269  -11.458 -79.553  1.00 21.73 ? 160 GLU D CD    1 
ATOM   6639  O  OE1   . GLU D 1 160 ? -2.906  -10.672 -78.824  1.00 18.12 ? 160 GLU D OE1   1 
ATOM   6640  O  OE2   . GLU D 1 160 ? -2.427  -12.701 -79.495  1.00 15.32 ? 160 GLU D OE2   1 
ATOM   6641  O  OXT   . GLU D 1 160 ? -0.352  -6.392  -80.273  1.00 2.00  ? 160 GLU D OXT   1 
ATOM   6642  N  N     . SER E 2 8   ? 3.002   -37.522 -75.362  1.00 2.00  ? 8   SER E N     1 
ATOM   6643  C  CA    . SER E 2 8   ? 2.527   -36.455 -76.335  1.00 14.59 ? 8   SER E CA    1 
ATOM   6644  C  C     . SER E 2 8   ? 3.299   -36.386 -77.670  1.00 14.63 ? 8   SER E C     1 
ATOM   6645  O  O     . SER E 2 8   ? 3.105   -37.237 -78.540  1.00 33.26 ? 8   SER E O     1 
ATOM   6646  C  CB    . SER E 2 8   ? 2.510   -35.072 -75.678  1.00 3.58  ? 8   SER E CB    1 
ATOM   6647  O  OG    . SER E 2 8   ? 3.377   -35.106 -74.562  1.00 2.00  ? 8   SER E OG    1 
ATOM   6648  N  N     . PHE E 2 9   ? 4.181   -35.403 -77.840  1.00 12.80 ? 9   PHE E N     1 
ATOM   6649  C  CA    . PHE E 2 9   ? 5.266   -35.558 -78.816  1.00 9.43  ? 9   PHE E CA    1 
ATOM   6650  C  C     . PHE E 2 9   ? 6.601   -35.062 -78.353  1.00 4.45  ? 9   PHE E C     1 
ATOM   6651  O  O     . PHE E 2 9   ? 6.675   -34.013 -77.711  1.00 16.62 ? 9   PHE E O     1 
ATOM   6652  C  CB    . PHE E 2 9   ? 4.957   -34.799 -80.082  1.00 14.83 ? 9   PHE E CB    1 
ATOM   6653  C  CG    . PHE E 2 9   ? 3.530   -34.836 -80.458  1.00 30.93 ? 9   PHE E CG    1 
ATOM   6654  C  CD1   . PHE E 2 9   ? 2.765   -33.682 -80.421  1.00 25.22 ? 9   PHE E CD1   1 
ATOM   6655  C  CD2   . PHE E 2 9   ? 2.946   -36.029 -80.861  1.00 29.85 ? 9   PHE E CD2   1 
ATOM   6656  C  CE1   . PHE E 2 9   ? 1.439   -33.715 -80.783  1.00 38.70 ? 9   PHE E CE1   1 
ATOM   6657  C  CE2   . PHE E 2 9   ? 1.617   -36.069 -81.223  1.00 34.78 ? 9   PHE E CE2   1 
ATOM   6658  C  CZ    . PHE E 2 9   ? 0.861   -34.913 -81.192  1.00 28.77 ? 9   PHE E CZ    1 
ATOM   6659  N  N     . PRO E 2 10  ? 7.647   -35.802 -78.674  1.00 4.18  ? 10  PRO E N     1 
ATOM   6660  C  CA    . PRO E 2 10  ? 9.002   -35.272 -78.615  1.00 2.00  ? 10  PRO E CA    1 
ATOM   6661  C  C     . PRO E 2 10  ? 9.038   -33.788 -78.948  1.00 4.40  ? 10  PRO E C     1 
ATOM   6662  O  O     . PRO E 2 10  ? 8.527   -33.370 -79.978  1.00 2.00  ? 10  PRO E O     1 
ATOM   6663  C  CB    . PRO E 2 10  ? 9.742   -36.089 -79.672  1.00 2.00  ? 10  PRO E CB    1 
ATOM   6664  C  CG    . PRO E 2 10  ? 8.695   -36.831 -80.406  1.00 6.29  ? 10  PRO E CG    1 
ATOM   6665  C  CD    . PRO E 2 10  ? 7.565   -37.021 -79.487  1.00 2.08  ? 10  PRO E CD    1 
ATOM   6666  N  N     . GLU E 2 11  ? 9.640   -33.009 -78.059  1.00 4.36  ? 11  GLU E N     1 
ATOM   6667  C  CA    . GLU E 2 11  ? 10.199  -31.716 -78.405  1.00 13.26 ? 11  GLU E CA    1 
ATOM   6668  C  C     . GLU E 2 11  ? 10.173  -31.441 -79.901  1.00 16.73 ? 11  GLU E C     1 
ATOM   6669  O  O     . GLU E 2 11  ? 9.547   -30.487 -80.351  1.00 8.76  ? 11  GLU E O     1 
ATOM   6670  C  CB    . GLU E 2 11  ? 11.616  -31.573 -77.866  1.00 12.60 ? 11  GLU E CB    1 
ATOM   6671  C  CG    . GLU E 2 11  ? 11.705  -31.394 -76.360  1.00 36.05 ? 11  GLU E CG    1 
ATOM   6672  C  CD    . GLU E 2 11  ? 12.788  -32.263 -75.725  1.00 46.37 ? 11  GLU E CD    1 
ATOM   6673  O  OE1   . GLU E 2 11  ? 13.940  -32.249 -76.216  1.00 14.23 ? 11  GLU E OE1   1 
ATOM   6674  O  OE2   . GLU E 2 11  ? 12.489  -32.962 -74.734  1.00 5.16  ? 11  GLU E OE2   1 
ATOM   6675  N  N     . GLU E 2 12  ? 10.860  -32.274 -80.668  1.00 9.46  ? 12  GLU E N     1 
ATOM   6676  C  CA    . GLU E 2 12  ? 11.275  -31.895 -82.006  1.00 6.97  ? 12  GLU E CA    1 
ATOM   6677  C  C     . GLU E 2 12  ? 10.146  -32.054 -83.002  1.00 8.49  ? 12  GLU E C     1 
ATOM   6678  O  O     . GLU E 2 12  ? 10.137  -31.408 -84.039  1.00 2.00  ? 12  GLU E O     1 
ATOM   6679  C  CB    . GLU E 2 12  ? 12.481  -32.712 -82.445  1.00 3.75  ? 12  GLU E CB    1 
ATOM   6680  C  CG    . GLU E 2 12  ? 12.149  -33.812 -83.434  1.00 16.01 ? 12  GLU E CG    1 
ATOM   6681  C  CD    . GLU E 2 12  ? 13.112  -34.976 -83.351  1.00 44.29 ? 12  GLU E CD    1 
ATOM   6682  O  OE1   . GLU E 2 12  ? 12.892  -35.869 -82.506  1.00 35.82 ? 12  GLU E OE1   1 
ATOM   6683  O  OE2   . GLU E 2 12  ? 14.090  -34.996 -84.130  1.00 7.67  ? 12  GLU E OE2   1 
ATOM   6684  N  N     . VAL E 2 13  ? 9.186   -32.908 -82.675  1.00 2.35  ? 13  VAL E N     1 
ATOM   6685  C  CA    . VAL E 2 13  ? 7.848   -32.832 -83.292  1.00 2.00  ? 13  VAL E CA    1 
ATOM   6686  C  C     . VAL E 2 13  ? 7.055   -31.521 -82.990  1.00 2.00  ? 13  VAL E C     1 
ATOM   6687  O  O     . VAL E 2 13  ? 6.529   -30.870 -83.894  1.00 2.11  ? 13  VAL E O     1 
ATOM   6688  C  CB    . VAL E 2 13  ? 7.031   -34.159 -83.109  1.00 2.00  ? 13  VAL E CB    1 
ATOM   6689  C  CG1   . VAL E 2 13  ? 5.582   -34.048 -83.603  1.00 2.00  ? 13  VAL E CG1   1 
ATOM   6690  C  CG2   . VAL E 2 13  ? 7.748   -35.331 -83.793  1.00 2.00  ? 13  VAL E CG2   1 
ATOM   6691  N  N     . LEU E 2 14  ? 6.999   -31.109 -81.736  1.00 2.11  ? 14  LEU E N     1 
ATOM   6692  C  CA    . LEU E 2 14  ? 6.215   -29.924 -81.361  1.00 2.00  ? 14  LEU E CA    1 
ATOM   6693  C  C     . LEU E 2 14  ? 6.789   -28.775 -82.138  1.00 2.00  ? 14  LEU E C     1 
ATOM   6694  O  O     . LEU E 2 14  ? 6.086   -28.183 -82.944  1.00 2.00  ? 14  LEU E O     1 
ATOM   6695  C  CB    . LEU E 2 14  ? 6.273   -29.650 -79.853  1.00 2.00  ? 14  LEU E CB    1 
ATOM   6696  C  CG    . LEU E 2 14  ? 5.113   -30.401 -79.203  1.00 2.00  ? 14  LEU E CG    1 
ATOM   6697  C  CD1   . LEU E 2 14  ? 5.448   -31.148 -77.902  1.00 26.17 ? 14  LEU E CD1   1 
ATOM   6698  C  CD2   . LEU E 2 14  ? 3.901   -29.575 -79.065  1.00 5.03  ? 14  LEU E CD2   1 
ATOM   6699  N  N     . GLU E 2 15  ? 8.091   -28.539 -81.960  1.00 3.65  ? 15  GLU E N     1 
ATOM   6700  C  CA    . GLU E 2 15  ? 8.860   -27.686 -82.872  1.00 9.51  ? 15  GLU E CA    1 
ATOM   6701  C  C     . GLU E 2 15  ? 8.438   -27.736 -84.340  1.00 14.17 ? 15  GLU E C     1 
ATOM   6702  O  O     . GLU E 2 15  ? 8.034   -26.709 -84.898  1.00 19.31 ? 15  GLU E O     1 
ATOM   6703  C  CB    . GLU E 2 15  ? 10.371  -27.818 -82.718  1.00 2.00  ? 15  GLU E CB    1 
ATOM   6704  C  CG    . GLU E 2 15  ? 11.131  -26.869 -83.653  1.00 6.11  ? 15  GLU E CG    1 
ATOM   6705  C  CD    . GLU E 2 15  ? 12.620  -26.665 -83.265  1.00 9.38  ? 15  GLU E CD    1 
ATOM   6706  O  OE1   . GLU E 2 15  ? 12.961  -26.049 -82.227  1.00 13.94 ? 15  GLU E OE1   1 
ATOM   6707  O  OE2   . GLU E 2 15  ? 13.478  -27.128 -84.025  1.00 27.76 ? 15  GLU E OE2   1 
ATOM   6708  N  N     . HIS E 2 16  ? 8.499   -28.901 -84.971  1.00 2.00  ? 16  HIS E N     1 
ATOM   6709  C  CA    . HIS E 2 16  ? 8.212   -28.932 -86.408  1.00 2.00  ? 16  HIS E CA    1 
ATOM   6710  C  C     . HIS E 2 16  ? 6.742   -28.560 -86.661  1.00 2.00  ? 16  HIS E C     1 
ATOM   6711  O  O     . HIS E 2 16  ? 6.412   -27.920 -87.633  1.00 2.00  ? 16  HIS E O     1 
ATOM   6712  C  CB    . HIS E 2 16  ? 8.551   -30.306 -87.027  1.00 2.00  ? 16  HIS E CB    1 
ATOM   6713  C  CG    . HIS E 2 16  ? 8.473   -30.343 -88.531  1.00 6.56  ? 16  HIS E CG    1 
ATOM   6714  N  ND1   . HIS E 2 16  ? 9.531   -29.996 -89.344  1.00 7.90  ? 16  HIS E ND1   1 
ATOM   6715  C  CD2   . HIS E 2 16  ? 7.461   -30.682 -89.368  1.00 4.23  ? 16  HIS E CD2   1 
ATOM   6716  C  CE1   . HIS E 2 16  ? 9.181   -30.118 -90.611  1.00 2.00  ? 16  HIS E CE1   1 
ATOM   6717  N  NE2   . HIS E 2 16  ? 7.929   -30.536 -90.653  1.00 17.40 ? 16  HIS E NE2   1 
ATOM   6718  N  N     . VAL E 2 17  ? 5.857   -28.922 -85.763  1.00 2.00  ? 17  VAL E N     1 
ATOM   6719  C  CA    . VAL E 2 17  ? 4.500   -28.432 -85.891  1.00 2.00  ? 17  VAL E CA    1 
ATOM   6720  C  C     . VAL E 2 17  ? 4.354   -26.861 -85.882  1.00 2.38  ? 17  VAL E C     1 
ATOM   6721  O  O     . VAL E 2 17  ? 4.004   -26.288 -86.908  1.00 2.00  ? 17  VAL E O     1 
ATOM   6722  C  CB    . VAL E 2 17  ? 3.531   -29.078 -84.841  1.00 2.00  ? 17  VAL E CB    1 
ATOM   6723  C  CG1   . VAL E 2 17  ? 2.227   -28.402 -84.958  1.00 2.69  ? 17  VAL E CG1   1 
ATOM   6724  C  CG2   . VAL E 2 17  ? 3.350   -30.660 -85.041  1.00 2.00  ? 17  VAL E CG2   1 
ATOM   6725  N  N     . PHE E 2 18  ? 4.575   -26.218 -84.729  1.00 2.00  ? 18  PHE E N     1 
ATOM   6726  C  CA    . PHE E 2 18  ? 5.115   -24.864 -84.603  1.00 2.00  ? 18  PHE E CA    1 
ATOM   6727  C  C     . PHE E 2 18  ? 5.662   -24.134 -85.843  1.00 5.19  ? 18  PHE E C     1 
ATOM   6728  O  O     . PHE E 2 18  ? 5.068   -23.168 -86.256  1.00 5.06  ? 18  PHE E O     1 
ATOM   6729  C  CB    . PHE E 2 18  ? 5.957   -24.669 -83.368  1.00 2.00  ? 18  PHE E CB    1 
ATOM   6730  C  CG    . PHE E 2 18  ? 5.232   -25.052 -82.089  1.00 2.22  ? 18  PHE E CG    1 
ATOM   6731  C  CD1   . PHE E 2 18  ? 5.782   -24.768 -80.833  1.00 2.00  ? 18  PHE E CD1   1 
ATOM   6732  C  CD2   . PHE E 2 18  ? 4.038   -25.747 -82.146  1.00 2.00  ? 18  PHE E CD2   1 
ATOM   6733  C  CE1   . PHE E 2 18  ? 5.127   -25.136 -79.670  1.00 2.62  ? 18  PHE E CE1   1 
ATOM   6734  C  CE2   . PHE E 2 18  ? 3.372   -26.124 -80.968  1.00 7.88  ? 18  PHE E CE2   1 
ATOM   6735  C  CZ    . PHE E 2 18  ? 3.906   -25.814 -79.721  1.00 2.00  ? 18  PHE E CZ    1 
ATOM   6736  N  N     . SER E 2 19  ? 6.692   -24.640 -86.515  1.00 9.01  ? 19  SER E N     1 
ATOM   6737  C  CA    . SER E 2 19  ? 7.066   -24.085 -87.828  1.00 5.09  ? 19  SER E CA    1 
ATOM   6738  C  C     . SER E 2 19  ? 5.984   -23.843 -88.914  1.00 2.00  ? 19  SER E C     1 
ATOM   6739  O  O     . SER E 2 19  ? 6.211   -23.103 -89.861  1.00 2.00  ? 19  SER E O     1 
ATOM   6740  C  CB    . SER E 2 19  ? 8.278   -24.801 -88.408  1.00 2.00  ? 19  SER E CB    1 
ATOM   6741  O  OG    . SER E 2 19  ? 7.835   -25.915 -89.166  1.00 12.94 ? 19  SER E OG    1 
ATOM   6742  N  N     . PHE E 2 20  ? 4.831   -24.495 -88.803  1.00 2.00  ? 20  PHE E N     1 
ATOM   6743  C  CA    . PHE E 2 20  ? 3.799   -24.357 -89.815  1.00 2.00  ? 20  PHE E CA    1 
ATOM   6744  C  C     . PHE E 2 20  ? 2.799   -23.289 -89.409  1.00 9.48  ? 20  PHE E C     1 
ATOM   6745  O  O     . PHE E 2 20  ? 1.696   -23.175 -89.986  1.00 2.00  ? 20  PHE E O     1 
ATOM   6746  C  CB    . PHE E 2 20  ? 3.140   -25.698 -90.063  1.00 2.00  ? 20  PHE E CB    1 
ATOM   6747  C  CG    . PHE E 2 20  ? 4.007   -26.605 -90.842  1.00 7.87  ? 20  PHE E CG    1 
ATOM   6748  C  CD1   . PHE E 2 20  ? 4.510   -27.781 -90.285  1.00 2.00  ? 20  PHE E CD1   1 
ATOM   6749  C  CD2   . PHE E 2 20  ? 4.426   -26.233 -92.121  1.00 7.54  ? 20  PHE E CD2   1 
ATOM   6750  C  CE1   . PHE E 2 20  ? 5.381   -28.600 -91.019  1.00 6.49  ? 20  PHE E CE1   1 
ATOM   6751  C  CE2   . PHE E 2 20  ? 5.310   -27.048 -92.876  1.00 11.66 ? 20  PHE E CE2   1 
ATOM   6752  C  CZ    . PHE E 2 20  ? 5.773   -28.235 -92.338  1.00 7.30  ? 20  PHE E CZ    1 
ATOM   6753  N  N     . ILE E 2 21  ? 3.212   -22.529 -88.388  1.00 3.44  ? 21  ILE E N     1 
ATOM   6754  C  CA    . ILE E 2 21  ? 2.348   -21.599 -87.642  1.00 8.05  ? 21  ILE E CA    1 
ATOM   6755  C  C     . ILE E 2 21  ? 2.974   -20.189 -87.475  1.00 9.61  ? 21  ILE E C     1 
ATOM   6756  O  O     . ILE E 2 21  ? 3.942   -20.005 -86.705  1.00 2.36  ? 21  ILE E O     1 
ATOM   6757  C  CB    . ILE E 2 21  ? 2.089   -22.086 -86.232  1.00 14.79 ? 21  ILE E CB    1 
ATOM   6758  C  CG1   . ILE E 2 21  ? 0.958   -23.123 -86.239  1.00 14.31 ? 21  ILE E CG1   1 
ATOM   6759  C  CG2   . ILE E 2 21  ? 1.726   -20.880 -85.381  1.00 2.00  ? 21  ILE E CG2   1 
ATOM   6760  C  CD1   . ILE E 2 21  ? 1.211   -24.314 -85.413  1.00 8.54  ? 21  ILE E CD1   1 
ATOM   6761  N  N     . GLN E 2 22  ? 2.407   -19.209 -88.190  1.00 10.65 ? 22  GLN E N     1 
ATOM   6762  C  CA    . GLN E 2 22  ? 3.094   -17.954 -88.492  1.00 10.68 ? 22  GLN E CA    1 
ATOM   6763  C  C     . GLN E 2 22  ? 2.455   -16.687 -87.901  1.00 5.11  ? 22  GLN E C     1 
ATOM   6764  O  O     . GLN E 2 22  ? 3.178   -15.719 -87.656  1.00 2.02  ? 22  GLN E O     1 
ATOM   6765  C  CB    . GLN E 2 22  ? 3.384   -17.821 -89.989  1.00 10.69 ? 22  GLN E CB    1 
ATOM   6766  C  CG    . GLN E 2 22  ? 4.523   -18.734 -90.421  1.00 21.07 ? 22  GLN E CG    1 
ATOM   6767  C  CD    . GLN E 2 22  ? 5.774   -18.553 -89.556  1.00 25.64 ? 22  GLN E CD    1 
ATOM   6768  O  OE1   . GLN E 2 22  ? 5.894   -19.126 -88.451  1.00 17.16 ? 22  GLN E OE1   1 
ATOM   6769  N  NE2   . GLN E 2 22  ? 6.714   -17.746 -90.055  1.00 30.20 ? 22  GLN E NE2   1 
ATOM   6770  N  N     . LEU E 2 23  ? 1.141   -16.721 -87.625  1.00 4.86  ? 23  LEU E N     1 
ATOM   6771  C  CA    . LEU E 2 23  ? 0.399   -15.565 -87.074  1.00 2.00  ? 23  LEU E CA    1 
ATOM   6772  C  C     . LEU E 2 23  ? 0.707   -15.353 -85.639  1.00 2.00  ? 23  LEU E C     1 
ATOM   6773  O  O     . LEU E 2 23  ? 0.534   -16.269 -84.841  1.00 5.56  ? 23  LEU E O     1 
ATOM   6774  C  CB    . LEU E 2 23  ? -1.108  -15.764 -87.154  1.00 2.00  ? 23  LEU E CB    1 
ATOM   6775  C  CG    . LEU E 2 23  ? -1.961  -15.252 -88.329  1.00 9.70  ? 23  LEU E CG    1 
ATOM   6776  C  CD1   . LEU E 2 23  ? -1.117  -14.820 -89.571  1.00 10.12 ? 23  LEU E CD1   1 
ATOM   6777  C  CD2   . LEU E 2 23  ? -2.942  -16.378 -88.719  1.00 5.88  ? 23  LEU E CD2   1 
ATOM   6778  N  N     . ASP E 2 24  ? 1.115   -14.138 -85.289  1.00 2.00  ? 24  ASP E N     1 
ATOM   6779  C  CA    . ASP E 2 24  ? 1.303   -13.804 -83.907  1.00 2.00  ? 24  ASP E CA    1 
ATOM   6780  C  C     . ASP E 2 24  ? 0.195   -14.326 -82.989  1.00 2.00  ? 24  ASP E C     1 
ATOM   6781  O  O     . ASP E 2 24  ? 0.479   -14.852 -81.923  1.00 3.89  ? 24  ASP E O     1 
ATOM   6782  C  CB    . ASP E 2 24  ? 1.484   -12.291 -83.676  1.00 2.00  ? 24  ASP E CB    1 
ATOM   6783  C  CG    . ASP E 2 24  ? 2.431   -11.620 -84.658  1.00 2.00  ? 24  ASP E CG    1 
ATOM   6784  O  OD1   . ASP E 2 24  ? 3.460   -12.198 -85.055  1.00 22.32 ? 24  ASP E OD1   1 
ATOM   6785  O  OD2   . ASP E 2 24  ? 2.161   -10.438 -85.004  1.00 15.54 ? 24  ASP E OD2   1 
ATOM   6786  N  N     . LYS E 2 25  ? -1.070  -14.148 -83.327  1.00 2.00  ? 25  LYS E N     1 
ATOM   6787  C  CA    . LYS E 2 25  ? -2.107  -14.622 -82.357  1.00 15.95 ? 25  LYS E CA    1 
ATOM   6788  C  C     . LYS E 2 25  ? -2.021  -16.135 -82.176  1.00 8.39  ? 25  LYS E C     1 
ATOM   6789  O  O     . LYS E 2 25  ? -2.220  -16.639 -81.075  1.00 8.00  ? 25  LYS E O     1 
ATOM   6790  C  CB    . LYS E 2 25  ? -3.572  -14.228 -82.702  1.00 8.17  ? 25  LYS E CB    1 
ATOM   6791  C  CG    . LYS E 2 25  ? -3.759  -12.748 -83.005  1.00 18.22 ? 25  LYS E CG    1 
ATOM   6792  C  CD    . LYS E 2 25  ? -4.750  -12.036 -82.077  1.00 8.92  ? 25  LYS E CD    1 
ATOM   6793  C  CE    . LYS E 2 25  ? -5.563  -10.960 -82.864  1.00 19.48 ? 25  LYS E CE    1 
ATOM   6794  N  NZ    . LYS E 2 25  ? -5.590  -9.645  -82.127  1.00 44.86 ? 25  LYS E NZ    1 
ATOM   6795  N  N     . ASP E 2 26  ? -1.734  -16.855 -83.259  1.00 4.42  ? 26  ASP E N     1 
ATOM   6796  C  CA    . ASP E 2 26  ? -1.643  -18.307 -83.182  1.00 2.88  ? 26  ASP E CA    1 
ATOM   6797  C  C     . ASP E 2 26  ? -0.492  -18.638 -82.212  1.00 4.42  ? 26  ASP E C     1 
ATOM   6798  O  O     . ASP E 2 26  ? -0.686  -19.399 -81.282  1.00 2.00  ? 26  ASP E O     1 
ATOM   6799  C  CB    . ASP E 2 26  ? -1.359  -18.909 -84.546  1.00 2.00  ? 26  ASP E CB    1 
ATOM   6800  C  CG    . ASP E 2 26  ? -2.565  -18.927 -85.466  1.00 2.00  ? 26  ASP E CG    1 
ATOM   6801  O  OD1   . ASP E 2 26  ? -3.691  -18.886 -84.928  1.00 2.00  ? 26  ASP E OD1   1 
ATOM   6802  O  OD2   . ASP E 2 26  ? -2.337  -19.014 -86.727  1.00 3.89  ? 26  ASP E OD2   1 
ATOM   6803  N  N     . ARG E 2 27  ? 0.682   -18.052 -82.434  1.00 2.00  ? 27  ARG E N     1 
ATOM   6804  C  CA    . ARG E 2 27  ? 1.843   -18.248 -81.567  1.00 2.00  ? 27  ARG E CA    1 
ATOM   6805  C  C     . ARG E 2 27  ? 1.528   -17.965 -80.067  1.00 16.25 ? 27  ARG E C     1 
ATOM   6806  O  O     . ARG E 2 27  ? 2.006   -18.721 -79.181  1.00 19.92 ? 27  ARG E O     1 
ATOM   6807  C  CB    . ARG E 2 27  ? 2.947   -17.310 -82.020  1.00 2.00  ? 27  ARG E CB    1 
ATOM   6808  C  CG    . ARG E 2 27  ? 3.694   -17.757 -83.307  1.00 2.00  ? 27  ARG E CG    1 
ATOM   6809  C  CD    . ARG E 2 27  ? 4.633   -18.725 -82.794  1.00 3.92  ? 27  ARG E CD    1 
ATOM   6810  N  NE    . ARG E 2 27  ? 5.168   -19.513 -83.854  1.00 17.58 ? 27  ARG E NE    1 
ATOM   6811  C  CZ    . ARG E 2 27  ? 6.271   -20.214 -83.723  1.00 2.00  ? 27  ARG E CZ    1 
ATOM   6812  N  NH1   . ARG E 2 27  ? 6.936   -20.214 -82.580  1.00 5.01  ? 27  ARG E NH1   1 
ATOM   6813  N  NH2   . ARG E 2 27  ? 6.738   -20.834 -84.756  1.00 3.48  ? 27  ARG E NH2   1 
ATOM   6814  N  N     . ASN E 2 28  ? 0.755   -16.905 -79.743  1.00 2.17  ? 28  ASN E N     1 
ATOM   6815  C  CA    . ASN E 2 28  ? 0.530   -16.577 -78.319  1.00 8.98  ? 28  ASN E CA    1 
ATOM   6816  C  C     . ASN E 2 28  ? -0.388  -17.561 -77.673  1.00 6.02  ? 28  ASN E C     1 
ATOM   6817  O  O     . ASN E 2 28  ? -0.199  -17.893 -76.495  1.00 2.00  ? 28  ASN E O     1 
ATOM   6818  C  CB    . ASN E 2 28  ? -0.120  -15.201 -78.113  1.00 10.34 ? 28  ASN E CB    1 
ATOM   6819  C  CG    . ASN E 2 28  ? 0.764   -14.111 -78.524  1.00 5.60  ? 28  ASN E CG    1 
ATOM   6820  O  OD1   . ASN E 2 28  ? 1.829   -14.362 -79.056  1.00 4.74  ? 28  ASN E OD1   1 
ATOM   6821  N  ND2   . ASN E 2 28  ? 0.343   -12.877 -78.304  1.00 7.87  ? 28  ASN E ND2   1 
ATOM   6822  N  N     . SER E 2 29  ? -1.432  -17.926 -78.421  1.00 2.00  ? 29  SER E N     1 
ATOM   6823  C  CA    . SER E 2 29  ? -2.174  -19.138 -78.187  1.00 7.40  ? 29  SER E CA    1 
ATOM   6824  C  C     . SER E 2 29  ? -1.335  -20.364 -77.737  1.00 9.53  ? 29  SER E C     1 
ATOM   6825  O  O     . SER E 2 29  ? -1.507  -20.872 -76.582  1.00 4.57  ? 29  SER E O     1 
ATOM   6826  C  CB    . SER E 2 29  ? -2.940  -19.498 -79.440  1.00 7.38  ? 29  SER E CB    1 
ATOM   6827  O  OG    . SER E 2 29  ? -4.277  -19.105 -79.239  1.00 4.06  ? 29  SER E OG    1 
ATOM   6828  N  N     . VAL E 2 30  ? -0.444  -20.814 -78.630  1.00 2.00  ? 30  VAL E N     1 
ATOM   6829  C  CA    . VAL E 2 30  ? 0.424   -21.894 -78.328  1.00 2.00  ? 30  VAL E CA    1 
ATOM   6830  C  C     . VAL E 2 30  ? 1.224   -21.773 -77.023  1.00 8.31  ? 30  VAL E C     1 
ATOM   6831  O  O     . VAL E 2 30  ? 1.222   -22.679 -76.167  1.00 5.63  ? 30  VAL E O     1 
ATOM   6832  C  CB    . VAL E 2 30  ? 1.143   -22.545 -79.543  1.00 2.01  ? 30  VAL E CB    1 
ATOM   6833  C  CG1   . VAL E 2 30  ? 0.310   -22.613 -80.846  1.00 2.00  ? 30  VAL E CG1   1 
ATOM   6834  C  CG2   . VAL E 2 30  ? 2.421   -22.050 -79.711  1.00 2.00  ? 30  VAL E CG2   1 
ATOM   6835  N  N     . SER E 2 31  ? 1.818   -20.605 -76.844  1.00 4.71  ? 31  SER E N     1 
ATOM   6836  C  CA    . SER E 2 31  ? 2.535   -20.278 -75.653  1.00 2.00  ? 31  SER E CA    1 
ATOM   6837  C  C     . SER E 2 31  ? 1.660   -20.414 -74.440  1.00 2.00  ? 31  SER E C     1 
ATOM   6838  O  O     . SER E 2 31  ? 2.151   -20.440 -73.315  1.00 2.00  ? 31  SER E O     1 
ATOM   6839  C  CB    . SER E 2 31  ? 3.075   -18.824 -75.732  1.00 13.72 ? 31  SER E CB    1 
ATOM   6840  O  OG    . SER E 2 31  ? 2.023   -17.885 -75.677  1.00 2.00  ? 31  SER E OG    1 
ATOM   6841  N  N     . LEU E 2 32  ? 0.358   -20.424 -74.611  1.00 2.00  ? 32  LEU E N     1 
ATOM   6842  C  CA    . LEU E 2 32  ? -0.418  -20.351 -73.393  1.00 2.00  ? 32  LEU E CA    1 
ATOM   6843  C  C     . LEU E 2 32  ? -1.029  -21.694 -73.077  1.00 7.64  ? 32  LEU E C     1 
ATOM   6844  O  O     . LEU E 2 32  ? -1.865  -21.805 -72.164  1.00 2.00  ? 32  LEU E O     1 
ATOM   6845  C  CB    . LEU E 2 32  ? -1.420  -19.171 -73.352  1.00 12.72 ? 32  LEU E CB    1 
ATOM   6846  C  CG    . LEU E 2 32  ? -1.017  -17.797 -72.712  1.00 4.82  ? 32  LEU E CG    1 
ATOM   6847  C  CD1   . LEU E 2 32  ? -2.220  -16.877 -72.726  1.00 5.68  ? 32  LEU E CD1   1 
ATOM   6848  C  CD2   . LEU E 2 32  ? -0.560  -17.863 -71.266  1.00 2.00  ? 32  LEU E CD2   1 
ATOM   6849  N  N     . VAL E 2 33  ? -0.606  -22.745 -73.811  1.00 10.41 ? 33  VAL E N     1 
ATOM   6850  C  CA    . VAL E 2 33  ? -1.213  -24.033 -73.504  1.00 7.74  ? 33  VAL E CA    1 
ATOM   6851  C  C     . VAL E 2 33  ? -0.729  -24.789 -72.282  1.00 4.92  ? 33  VAL E C     1 
ATOM   6852  O  O     . VAL E 2 33  ? -1.565  -25.272 -71.539  1.00 2.00  ? 33  VAL E O     1 
ATOM   6853  C  CB    . VAL E 2 33  ? -1.811  -24.936 -74.671  1.00 14.67 ? 33  VAL E CB    1 
ATOM   6854  C  CG1   . VAL E 2 33  ? -1.628  -24.353 -76.068  1.00 2.00  ? 33  VAL E CG1   1 
ATOM   6855  C  CG2   . VAL E 2 33  ? -1.285  -26.345 -74.554  1.00 2.00  ? 33  VAL E CG2   1 
ATOM   6856  N  N     . CYS E 2 34  ? 0.599   -24.865 -72.089  1.00 2.00  ? 34  CYS E N     1 
ATOM   6857  C  CA    . CYS E 2 34  ? 1.249   -25.423 -70.869  1.00 7.54  ? 34  CYS E CA    1 
ATOM   6858  C  C     . CYS E 2 34  ? 2.672   -24.910 -70.843  1.00 9.40  ? 34  CYS E C     1 
ATOM   6859  O  O     . CYS E 2 34  ? 3.119   -24.327 -71.858  1.00 2.03  ? 34  CYS E O     1 
ATOM   6860  C  CB    . CYS E 2 34  ? 1.314   -26.961 -70.885  1.00 2.00  ? 34  CYS E CB    1 
ATOM   6861  S  SG    . CYS E 2 34  ? 2.010   -27.554 -72.396  1.00 3.83  ? 34  CYS E SG    1 
ATOM   6862  N  N     . LYS E 2 35  ? 3.373   -25.140 -69.711  1.00 6.68  ? 35  LYS E N     1 
ATOM   6863  C  CA    . LYS E 2 35  ? 4.717   -24.570 -69.470  1.00 3.57  ? 35  LYS E CA    1 
ATOM   6864  C  C     . LYS E 2 35  ? 5.685   -25.149 -70.516  1.00 7.10  ? 35  LYS E C     1 
ATOM   6865  O  O     . LYS E 2 35  ? 6.772   -24.609 -70.783  1.00 13.67 ? 35  LYS E O     1 
ATOM   6866  C  CB    . LYS E 2 35  ? 5.203   -24.925 -68.058  1.00 3.43  ? 35  LYS E CB    1 
ATOM   6867  C  CG    . LYS E 2 35  ? 4.483   -24.222 -66.897  1.00 18.61 ? 35  LYS E CG    1 
ATOM   6868  C  CD    . LYS E 2 35  ? 5.391   -23.994 -65.624  1.00 15.27 ? 35  LYS E CD    1 
ATOM   6869  C  CE    . LYS E 2 35  ? 6.718   -23.192 -65.903  1.00 24.88 ? 35  LYS E CE    1 
ATOM   6870  N  NZ    . LYS E 2 35  ? 6.577   -21.952 -66.757  1.00 10.13 ? 35  LYS E NZ    1 
ATOM   6871  N  N     . SER E 2 36  ? 5.257   -26.252 -71.125  1.00 4.96  ? 36  SER E N     1 
ATOM   6872  C  CA    . SER E 2 36  ? 6.053   -27.011 -72.076  1.00 2.00  ? 36  SER E CA    1 
ATOM   6873  C  C     . SER E 2 36  ? 6.008   -26.370 -73.465  1.00 2.00  ? 36  SER E C     1 
ATOM   6874  O  O     . SER E 2 36  ? 7.047   -26.132 -74.118  1.00 2.00  ? 36  SER E O     1 
ATOM   6875  C  CB    . SER E 2 36  ? 5.498   -28.449 -72.126  1.00 3.14  ? 36  SER E CB    1 
ATOM   6876  O  OG    . SER E 2 36  ? 6.375   -29.342 -72.767  1.00 2.00  ? 36  SER E OG    1 
ATOM   6877  N  N     . TRP E 2 37  ? 4.795   -26.132 -73.928  1.00 2.00  ? 37  TRP E N     1 
ATOM   6878  C  CA    . TRP E 2 37  ? 4.601   -25.356 -75.160  1.00 10.15 ? 37  TRP E CA    1 
ATOM   6879  C  C     . TRP E 2 37  ? 5.079   -23.887 -75.061  1.00 3.38  ? 37  TRP E C     1 
ATOM   6880  O  O     . TRP E 2 37  ? 5.598   -23.325 -75.996  1.00 2.00  ? 37  TRP E O     1 
ATOM   6881  C  CB    . TRP E 2 37  ? 3.141   -25.364 -75.530  1.00 5.99  ? 37  TRP E CB    1 
ATOM   6882  C  CG    . TRP E 2 37  ? 2.740   -26.669 -75.937  1.00 10.07 ? 37  TRP E CG    1 
ATOM   6883  C  CD1   . TRP E 2 37  ? 3.221   -27.855 -75.459  1.00 8.27  ? 37  TRP E CD1   1 
ATOM   6884  C  CD2   . TRP E 2 37  ? 1.758   -26.986 -76.918  1.00 19.66 ? 37  TRP E CD2   1 
ATOM   6885  N  NE1   . TRP E 2 37  ? 2.603   -28.880 -76.089  1.00 2.00  ? 37  TRP E NE1   1 
ATOM   6886  C  CE2   . TRP E 2 37  ? 1.701   -28.391 -76.994  1.00 2.00  ? 37  TRP E CE2   1 
ATOM   6887  C  CE3   . TRP E 2 37  ? 0.910   -26.216 -77.741  1.00 11.91 ? 37  TRP E CE3   1 
ATOM   6888  C  CZ2   . TRP E 2 37  ? 0.819   -29.054 -77.846  1.00 15.96 ? 37  TRP E CZ2   1 
ATOM   6889  C  CZ3   . TRP E 2 37  ? 0.041   -26.866 -78.608  1.00 2.00  ? 37  TRP E CZ3   1 
ATOM   6890  C  CH2   . TRP E 2 37  ? 0.002   -28.273 -78.658  1.00 18.63 ? 37  TRP E CH2   1 
ATOM   6891  N  N     . TYR E 2 38  ? 4.961   -23.320 -73.875  1.00 2.00  ? 38  TYR E N     1 
ATOM   6892  C  CA    . TYR E 2 38  ? 5.608   -22.109 -73.649  1.00 2.00  ? 38  TYR E CA    1 
ATOM   6893  C  C     . TYR E 2 38  ? 7.081   -22.115 -73.936  1.00 2.00  ? 38  TYR E C     1 
ATOM   6894  O  O     . TYR E 2 38  ? 7.543   -21.291 -74.663  1.00 6.56  ? 38  TYR E O     1 
ATOM   6895  C  CB    . TYR E 2 38  ? 5.271   -21.570 -72.314  1.00 2.00  ? 38  TYR E CB    1 
ATOM   6896  C  CG    . TYR E 2 38  ? 5.938   -20.285 -72.064  1.00 5.76  ? 38  TYR E CG    1 
ATOM   6897  C  CD1   . TYR E 2 38  ? 7.201   -20.252 -71.491  1.00 2.00  ? 38  TYR E CD1   1 
ATOM   6898  C  CD2   . TYR E 2 38  ? 5.343   -19.098 -72.438  1.00 2.03  ? 38  TYR E CD2   1 
ATOM   6899  C  CE1   . TYR E 2 38  ? 7.837   -19.067 -71.236  1.00 13.71 ? 38  TYR E CE1   1 
ATOM   6900  C  CE2   . TYR E 2 38  ? 5.967   -17.915 -72.193  1.00 6.13  ? 38  TYR E CE2   1 
ATOM   6901  C  CZ    . TYR E 2 38  ? 7.215   -17.889 -71.583  1.00 4.74  ? 38  TYR E CZ    1 
ATOM   6902  O  OH    . TYR E 2 38  ? 7.884   -16.681 -71.359  1.00 5.93  ? 38  TYR E OH    1 
ATOM   6903  N  N     . GLU E 2 39  ? 7.833   -23.050 -73.407  1.00 4.97  ? 39  GLU E N     1 
ATOM   6904  C  CA    . GLU E 2 39  ? 9.250   -23.144 -73.776  1.00 2.00  ? 39  GLU E CA    1 
ATOM   6905  C  C     . GLU E 2 39  ? 9.525   -23.519 -75.243  1.00 5.11  ? 39  GLU E C     1 
ATOM   6906  O  O     . GLU E 2 39  ? 10.436  -22.967 -75.905  1.00 3.20  ? 39  GLU E O     1 
ATOM   6907  C  CB    . GLU E 2 39  ? 9.935   -24.130 -72.840  1.00 2.69  ? 39  GLU E CB    1 
ATOM   6908  C  CG    . GLU E 2 39  ? 9.578   -23.839 -71.370  1.00 11.71 ? 39  GLU E CG    1 
ATOM   6909  C  CD    . GLU E 2 39  ? 10.418  -22.679 -70.792  1.00 24.06 ? 39  GLU E CD    1 
ATOM   6910  O  OE1   . GLU E 2 39  ? 10.255  -22.343 -69.575  1.00 12.23 ? 39  GLU E OE1   1 
ATOM   6911  O  OE2   . GLU E 2 39  ? 11.256  -22.129 -71.565  1.00 2.41  ? 39  GLU E OE2   1 
ATOM   6912  N  N     . ILE E 2 40  ? 8.803   -24.480 -75.772  1.00 2.00  ? 40  ILE E N     1 
ATOM   6913  C  CA    . ILE E 2 40  ? 9.096   -24.875 -77.130  1.00 4.67  ? 40  ILE E CA    1 
ATOM   6914  C  C     . ILE E 2 40  ? 8.776   -23.725 -78.075  1.00 2.05  ? 40  ILE E C     1 
ATOM   6915  O  O     . ILE E 2 40  ? 9.567   -23.388 -78.936  1.00 5.58  ? 40  ILE E O     1 
ATOM   6916  C  CB    . ILE E 2 40  ? 8.347   -26.157 -77.500  1.00 2.03  ? 40  ILE E CB    1 
ATOM   6917  C  CG1   . ILE E 2 40  ? 8.671   -27.257 -76.495  1.00 2.00  ? 40  ILE E CG1   1 
ATOM   6918  C  CG2   . ILE E 2 40  ? 8.712   -26.595 -78.882  1.00 2.00  ? 40  ILE E CG2   1 
ATOM   6919  C  CD1   . ILE E 2 40  ? 8.539   -28.631 -77.043  1.00 2.00  ? 40  ILE E CD1   1 
ATOM   6920  N  N     . GLU E 2 41  ? 7.603   -23.132 -77.892  1.00 7.66  ? 41  GLU E N     1 
ATOM   6921  C  CA    . GLU E 2 41  ? 7.348   -21.710 -78.108  1.00 2.00  ? 41  GLU E CA    1 
ATOM   6922  C  C     . GLU E 2 41  ? 8.528   -20.768 -78.309  1.00 4.02  ? 41  GLU E C     1 
ATOM   6923  O  O     . GLU E 2 41  ? 8.970   -20.536 -79.424  1.00 2.00  ? 41  GLU E O     1 
ATOM   6924  C  CB    . GLU E 2 41  ? 6.309   -21.516 -79.198  1.00 6.11  ? 41  GLU E CB    1 
ATOM   6925  C  CG    . GLU E 2 41  ? 5.253   -20.486 -78.856  1.00 15.28 ? 41  GLU E CG    1 
ATOM   6926  C  CD    . GLU E 2 41  ? 5.726   -19.079 -79.092  1.00 2.00  ? 41  GLU E CD    1 
ATOM   6927  O  OE1   . GLU E 2 41  ? 5.753   -18.304 -78.131  1.00 10.37 ? 41  GLU E OE1   1 
ATOM   6928  O  OE2   . GLU E 2 41  ? 6.071   -18.762 -80.233  1.00 2.00  ? 41  GLU E OE2   1 
ATOM   6929  N  N     . ARG E 2 42  ? 9.006   -20.203 -77.213  1.00 2.00  ? 42  ARG E N     1 
ATOM   6930  C  CA    . ARG E 2 42  ? 9.933   -19.103 -77.270  1.00 2.00  ? 42  ARG E CA    1 
ATOM   6931  C  C     . ARG E 2 42  ? 11.036  -19.363 -78.281  1.00 2.00  ? 42  ARG E C     1 
ATOM   6932  O  O     . ARG E 2 42  ? 11.437  -18.470 -79.017  1.00 11.91 ? 42  ARG E O     1 
ATOM   6933  C  CB    . ARG E 2 42  ? 10.534  -18.847 -75.895  1.00 2.00  ? 42  ARG E CB    1 
ATOM   6934  C  CG    . ARG E 2 42  ? 9.861   -19.593 -74.772  1.00 24.40 ? 42  ARG E CG    1 
ATOM   6935  C  CD    . ARG E 2 42  ? 10.743  -19.847 -73.572  1.00 2.00  ? 42  ARG E CD    1 
ATOM   6936  N  NE    . ARG E 2 42  ? 11.888  -18.953 -73.549  1.00 31.26 ? 42  ARG E NE    1 
ATOM   6937  C  CZ    . ARG E 2 42  ? 12.862  -19.016 -72.666  1.00 13.39 ? 42  ARG E CZ    1 
ATOM   6938  N  NH1   . ARG E 2 42  ? 12.842  -19.936 -71.724  1.00 2.00  ? 42  ARG E NH1   1 
ATOM   6939  N  NH2   . ARG E 2 42  ? 13.862  -18.158 -72.723  1.00 30.41 ? 42  ARG E NH2   1 
ATOM   6940  N  N     . TRP E 2 43  ? 11.531  -20.591 -78.300  1.00 2.87  ? 43  TRP E N     1 
ATOM   6941  C  CA    . TRP E 2 43  ? 12.844  -20.880 -78.833  1.00 2.00  ? 43  TRP E CA    1 
ATOM   6942  C  C     . TRP E 2 43  ? 12.744  -21.090 -80.328  1.00 2.00  ? 43  TRP E C     1 
ATOM   6943  O  O     . TRP E 2 43  ? 13.745  -21.143 -81.010  1.00 8.82  ? 43  TRP E O     1 
ATOM   6944  C  CB    . TRP E 2 43  ? 13.458  -22.107 -78.144  1.00 2.02  ? 43  TRP E CB    1 
ATOM   6945  C  CG    . TRP E 2 43  ? 14.119  -21.796 -76.837  1.00 4.86  ? 43  TRP E CG    1 
ATOM   6946  C  CD1   . TRP E 2 43  ? 13.618  -22.019 -75.602  1.00 2.00  ? 43  TRP E CD1   1 
ATOM   6947  C  CD2   . TRP E 2 43  ? 15.401  -21.196 -76.644  1.00 2.00  ? 43  TRP E CD2   1 
ATOM   6948  N  NE1   . TRP E 2 43  ? 14.502  -21.588 -74.647  1.00 2.00  ? 43  TRP E NE1   1 
ATOM   6949  C  CE2   . TRP E 2 43  ? 15.607  -21.080 -75.268  1.00 2.00  ? 43  TRP E CE2   1 
ATOM   6950  C  CE3   . TRP E 2 43  ? 16.397  -20.737 -77.502  1.00 7.54  ? 43  TRP E CE3   1 
ATOM   6951  C  CZ2   . TRP E 2 43  ? 16.756  -20.537 -74.735  1.00 2.00  ? 43  TRP E CZ2   1 
ATOM   6952  C  CZ3   . TRP E 2 43  ? 17.534  -20.198 -76.966  1.00 2.00  ? 43  TRP E CZ3   1 
ATOM   6953  C  CH2   . TRP E 2 43  ? 17.705  -20.099 -75.600  1.00 2.00  ? 43  TRP E CH2   1 
ATOM   6954  N  N     . CYS E 2 44  ? 11.523  -21.188 -80.833  1.00 2.00  ? 44  CYS E N     1 
ATOM   6955  C  CA    . CYS E 2 44  ? 11.291  -21.234 -82.269  1.00 5.22  ? 44  CYS E CA    1 
ATOM   6956  C  C     . CYS E 2 44  ? 10.405  -20.128 -82.872  1.00 3.57  ? 44  CYS E C     1 
ATOM   6957  O  O     . CYS E 2 44  ? 10.103  -20.160 -84.056  1.00 2.00  ? 44  CYS E O     1 
ATOM   6958  C  CB    . CYS E 2 44  ? 10.840  -22.631 -82.708  1.00 2.00  ? 44  CYS E CB    1 
ATOM   6959  S  SG    . CYS E 2 44  ? 9.187   -23.148 -82.258  1.00 2.00  ? 44  CYS E SG    1 
ATOM   6960  N  N     . ARG E 2 45  ? 10.000  -19.157 -82.061  1.00 2.00  ? 45  ARG E N     1 
ATOM   6961  C  CA    . ARG E 2 45  ? 9.543   -17.837 -82.601  1.00 7.01  ? 45  ARG E CA    1 
ATOM   6962  C  C     . ARG E 2 45  ? 10.469  -17.104 -83.586  1.00 2.54  ? 45  ARG E C     1 
ATOM   6963  O  O     . ARG E 2 45  ? 11.636  -16.849 -83.282  1.00 8.93  ? 45  ARG E O     1 
ATOM   6964  C  CB    . ARG E 2 45  ? 9.079   -16.826 -81.519  1.00 7.03  ? 45  ARG E CB    1 
ATOM   6965  C  CG    . ARG E 2 45  ? 8.007   -15.808 -82.153  1.00 3.37  ? 45  ARG E CG    1 
ATOM   6966  C  CD    . ARG E 2 45  ? 7.259   -14.951 -81.227  1.00 2.00  ? 45  ARG E CD    1 
ATOM   6967  N  NE    . ARG E 2 45  ? 6.460   -15.666 -80.264  1.00 3.32  ? 45  ARG E NE    1 
ATOM   6968  C  CZ    . ARG E 2 45  ? 5.248   -15.284 -79.838  1.00 18.33 ? 45  ARG E CZ    1 
ATOM   6969  N  NH1   . ARG E 2 45  ? 4.660   -14.185 -80.334  1.00 6.58  ? 45  ARG E NH1   1 
ATOM   6970  N  NH2   . ARG E 2 45  ? 4.616   -16.005 -78.910  1.00 2.00  ? 45  ARG E NH2   1 
ATOM   6971  N  N     . ARG E 2 46  ? 9.960   -16.755 -84.764  1.00 3.80  ? 46  ARG E N     1 
ATOM   6972  C  CA    . ARG E 2 46  ? 10.853  -16.368 -85.844  1.00 2.00  ? 46  ARG E CA    1 
ATOM   6973  C  C     . ARG E 2 46  ? 10.836  -14.844 -85.905  1.00 10.99 ? 46  ARG E C     1 
ATOM   6974  O  O     . ARG E 2 46  ? 11.821  -14.178 -86.303  1.00 9.41  ? 46  ARG E O     1 
ATOM   6975  C  CB    . ARG E 2 46  ? 10.328  -16.944 -87.149  1.00 8.93  ? 46  ARG E CB    1 
ATOM   6976  C  CG    . ARG E 2 46  ? 10.917  -18.351 -87.545  1.00 15.43 ? 46  ARG E CG    1 
ATOM   6977  C  CD    . ARG E 2 46  ? 12.167  -18.191 -88.469  1.00 48.49 ? 46  ARG E CD    1 
ATOM   6978  N  NE    . ARG E 2 46  ? 13.305  -19.051 -88.091  1.00 60.71 ? 46  ARG E NE    1 
ATOM   6979  C  CZ    . ARG E 2 46  ? 14.490  -19.077 -88.718  1.00 44.45 ? 46  ARG E CZ    1 
ATOM   6980  N  NH1   . ARG E 2 46  ? 14.740  -18.278 -89.750  1.00 51.05 ? 46  ARG E NH1   1 
ATOM   6981  N  NH2   . ARG E 2 46  ? 15.438  -19.898 -88.306  1.00 39.87 ? 46  ARG E NH2   1 
ATOM   6982  N  N     . LYS E 2 47  ? 9.693   -14.293 -85.507  1.00 2.92  ? 47  LYS E N     1 
ATOM   6983  C  CA    . LYS E 2 47  ? 9.386   -12.898 -85.816  1.00 2.00  ? 47  LYS E CA    1 
ATOM   6984  C  C     . LYS E 2 47  ? 8.556   -12.269 -84.736  1.00 2.30  ? 47  LYS E C     1 
ATOM   6985  O  O     . LYS E 2 47  ? 7.674   -12.885 -84.117  1.00 3.12  ? 47  LYS E O     1 
ATOM   6986  C  CB    . LYS E 2 47  ? 8.674   -12.744 -87.144  1.00 8.34  ? 47  LYS E CB    1 
ATOM   6987  C  CG    . LYS E 2 47  ? 7.195   -12.405 -86.962  1.00 5.17  ? 47  LYS E CG    1 
ATOM   6988  C  CD    . LYS E 2 47  ? 6.606   -11.667 -88.176  1.00 28.83 ? 47  LYS E CD    1 
ATOM   6989  C  CE    . LYS E 2 47  ? 5.086   -11.515 -87.978  1.00 49.73 ? 47  LYS E CE    1 
ATOM   6990  N  NZ    . LYS E 2 47  ? 4.384   -12.852 -88.148  1.00 13.05 ? 47  LYS E NZ    1 
ATOM   6991  N  N     . VAL E 2 48  ? 8.857   -11.032 -84.437  1.00 2.00  ? 48  VAL E N     1 
ATOM   6992  C  CA    . VAL E 2 48  ? 8.074   -10.443 -83.393  1.00 6.42  ? 48  VAL E CA    1 
ATOM   6993  C  C     . VAL E 2 48  ? 7.439   -9.121  -83.931  1.00 12.82 ? 48  VAL E C     1 
ATOM   6994  O  O     . VAL E 2 48  ? 8.009   -8.466  -84.851  1.00 6.32  ? 48  VAL E O     1 
ATOM   6995  C  CB    . VAL E 2 48  ? 8.974   -10.294 -82.172  1.00 5.67  ? 48  VAL E CB    1 
ATOM   6996  C  CG1   . VAL E 2 48  ? 9.262   -8.881  -81.845  1.00 16.90 ? 48  VAL E CG1   1 
ATOM   6997  C  CG2   . VAL E 2 48  ? 8.452   -11.078 -81.028  1.00 2.48  ? 48  VAL E CG2   1 
ATOM   6998  N  N     . PHE E 2 49  ? 6.253   -8.749  -83.436  1.00 4.99  ? 49  PHE E N     1 
ATOM   6999  C  CA    . PHE E 2 49  ? 5.565   -7.534  -84.004  1.00 6.34  ? 49  PHE E CA    1 
ATOM   7000  C  C     . PHE E 2 49  ? 5.342   -6.646  -82.798  1.00 2.00  ? 49  PHE E C     1 
ATOM   7001  O  O     . PHE E 2 49  ? 4.681   -7.067  -81.850  1.00 3.46  ? 49  PHE E O     1 
ATOM   7002  C  CB    . PHE E 2 49  ? 4.188   -7.818  -84.675  1.00 2.00  ? 49  PHE E CB    1 
ATOM   7003  C  CG    . PHE E 2 49  ? 3.302   -6.538  -84.883  1.00 14.41 ? 49  PHE E CG    1 
ATOM   7004  C  CD1   . PHE E 2 49  ? 3.534   -5.664  -85.915  1.00 6.57  ? 49  PHE E CD1   1 
ATOM   7005  C  CD2   . PHE E 2 49  ? 2.255   -6.221  -84.028  1.00 14.69 ? 49  PHE E CD2   1 
ATOM   7006  C  CE1   . PHE E 2 49  ? 2.740   -4.492  -86.104  1.00 26.31 ? 49  PHE E CE1   1 
ATOM   7007  C  CE2   . PHE E 2 49  ? 1.449   -5.036  -84.215  1.00 25.25 ? 49  PHE E CE2   1 
ATOM   7008  C  CZ    . PHE E 2 49  ? 1.715   -4.169  -85.250  1.00 5.60  ? 49  PHE E CZ    1 
ATOM   7009  N  N     . ILE E 2 50  ? 5.912   -5.452  -82.784  1.00 2.00  ? 50  ILE E N     1 
ATOM   7010  C  CA    . ILE E 2 50  ? 5.796   -4.685  -81.556  1.00 7.68  ? 50  ILE E CA    1 
ATOM   7011  C  C     . ILE E 2 50  ? 5.171   -3.356  -81.862  1.00 7.58  ? 50  ILE E C     1 
ATOM   7012  O  O     . ILE E 2 50  ? 5.875   -2.406  -82.283  1.00 18.33 ? 50  ILE E O     1 
ATOM   7013  C  CB    . ILE E 2 50  ? 7.113   -4.593  -80.790  1.00 6.19  ? 50  ILE E CB    1 
ATOM   7014  C  CG1   . ILE E 2 50  ? 7.594   -6.014  -80.474  1.00 7.78  ? 50  ILE E CG1   1 
ATOM   7015  C  CG2   . ILE E 2 50  ? 6.813   -4.083  -79.387  1.00 10.78 ? 50  ILE E CG2   1 
ATOM   7016  C  CD1   . ILE E 2 50  ? 9.070   -6.128  -80.216  1.00 8.83  ? 50  ILE E CD1   1 
ATOM   7017  N  N     . GLY E 2 51  ? 3.841   -3.313  -81.688  1.00 3.76  ? 51  GLY E N     1 
ATOM   7018  C  CA    . GLY E 2 51  ? 2.964   -2.176  -82.041  1.00 2.00  ? 51  GLY E CA    1 
ATOM   7019  C  C     . GLY E 2 51  ? 3.220   -0.876  -81.354  1.00 2.00  ? 51  GLY E C     1 
ATOM   7020  O  O     . GLY E 2 51  ? 2.972   0.144   -81.924  1.00 6.87  ? 51  GLY E O     1 
ATOM   7021  N  N     . ASN E 2 52  ? 3.792   -0.906  -80.163  1.00 2.00  ? 52  ASN E N     1 
ATOM   7022  C  CA    . ASN E 2 52  ? 4.076   0.266   -79.379  1.00 2.00  ? 52  ASN E CA    1 
ATOM   7023  C  C     . ASN E 2 52  ? 5.375   -0.043  -78.686  1.00 2.00  ? 52  ASN E C     1 
ATOM   7024  O  O     . ASN E 2 52  ? 5.415   -0.753  -77.696  1.00 5.53  ? 52  ASN E O     1 
ATOM   7025  C  CB    . ASN E 2 52  ? 2.963   0.480   -78.357  1.00 2.00  ? 52  ASN E CB    1 
ATOM   7026  C  CG    . ASN E 2 52  ? 3.297   1.536   -77.374  1.00 2.00  ? 52  ASN E CG    1 
ATOM   7027  O  OD1   . ASN E 2 52  ? 2.590   1.761   -76.368  1.00 2.00  ? 52  ASN E OD1   1 
ATOM   7028  N  ND2   . ASN E 2 52  ? 4.355   2.201   -77.630  1.00 2.00  ? 52  ASN E ND2   1 
ATOM   7029  N  N     . CYS E 2 53  ? 6.459   0.504   -79.192  1.00 2.09  ? 53  CYS E N     1 
ATOM   7030  C  CA    . CYS E 2 53  ? 7.748   0.299   -78.635  1.00 2.00  ? 53  CYS E CA    1 
ATOM   7031  C  C     . CYS E 2 53  ? 7.845   0.554   -77.105  1.00 5.33  ? 53  CYS E C     1 
ATOM   7032  O  O     . CYS E 2 53  ? 8.748   0.005   -76.516  1.00 7.66  ? 53  CYS E O     1 
ATOM   7033  C  CB    . CYS E 2 53  ? 8.800   1.053   -79.450  1.00 2.00  ? 53  CYS E CB    1 
ATOM   7034  S  SG    . CYS E 2 53  ? 8.596   2.896   -79.134  1.00 10.90 ? 53  CYS E SG    1 
ATOM   7035  N  N     . TYR E 2 54  ? 6.969   1.324   -76.446  1.00 4.59  ? 54  TYR E N     1 
ATOM   7036  C  CA    . TYR E 2 54  ? 7.027   1.472   -74.965  1.00 2.00  ? 54  TYR E CA    1 
ATOM   7037  C  C     . TYR E 2 54  ? 6.124   0.511   -74.190  1.00 3.65  ? 54  TYR E C     1 
ATOM   7038  O  O     . TYR E 2 54  ? 6.010   0.473   -72.886  1.00 2.03  ? 54  TYR E O     1 
ATOM   7039  C  CB    . TYR E 2 54  ? 6.805   2.957   -74.556  1.00 5.74  ? 54  TYR E CB    1 
ATOM   7040  C  CG    . TYR E 2 54  ? 7.782   3.933   -75.236  1.00 11.29 ? 54  TYR E CG    1 
ATOM   7041  C  CD1   . TYR E 2 54  ? 7.348   4.928   -76.121  1.00 4.04  ? 54  TYR E CD1   1 
ATOM   7042  C  CD2   . TYR E 2 54  ? 9.123   3.879   -74.951  1.00 2.00  ? 54  TYR E CD2   1 
ATOM   7043  C  CE1   . TYR E 2 54  ? 8.264   5.839   -76.732  1.00 2.00  ? 54  TYR E CE1   1 
ATOM   7044  C  CE2   . TYR E 2 54  ? 10.036  4.784   -75.528  1.00 10.93 ? 54  TYR E CE2   1 
ATOM   7045  C  CZ    . TYR E 2 54  ? 9.606   5.740   -76.434  1.00 15.08 ? 54  TYR E CZ    1 
ATOM   7046  O  OH    . TYR E 2 54  ? 10.573  6.550   -77.010  1.00 4.40  ? 54  TYR E OH    1 
ATOM   7047  N  N     . ALA E 2 55  ? 5.426   -0.305  -74.978  1.00 7.78  ? 55  ALA E N     1 
ATOM   7048  C  CA    . ALA E 2 55  ? 4.631   -1.394  -74.382  1.00 3.99  ? 55  ALA E CA    1 
ATOM   7049  C  C     . ALA E 2 55  ? 5.539   -2.399  -73.601  1.00 2.00  ? 55  ALA E C     1 
ATOM   7050  O  O     . ALA E 2 55  ? 5.084   -3.097  -72.714  1.00 6.98  ? 55  ALA E O     1 
ATOM   7051  C  CB    . ALA E 2 55  ? 3.785   -2.103  -75.506  1.00 2.00  ? 55  ALA E CB    1 
ATOM   7052  N  N     . VAL E 2 56  ? 6.800   -2.549  -73.989  1.00 7.27  ? 56  VAL E N     1 
ATOM   7053  C  CA    . VAL E 2 56  ? 7.676   -3.625  -73.398  1.00 5.23  ? 56  VAL E CA    1 
ATOM   7054  C  C     . VAL E 2 56  ? 9.185   -3.247  -73.603  1.00 12.74 ? 56  VAL E C     1 
ATOM   7055  O  O     . VAL E 2 56  ? 9.543   -2.554  -74.582  1.00 2.00  ? 56  VAL E O     1 
ATOM   7056  C  CB    . VAL E 2 56  ? 7.439   -5.025  -74.138  1.00 7.40  ? 56  VAL E CB    1 
ATOM   7057  C  CG1   . VAL E 2 56  ? 7.706   -4.917  -75.600  1.00 2.00  ? 56  VAL E CG1   1 
ATOM   7058  C  CG2   . VAL E 2 56  ? 8.302   -6.111  -73.555  1.00 3.75  ? 56  VAL E CG2   1 
ATOM   7059  N  N     . SER E 2 57  ? 10.058  -3.730  -72.705  1.00 3.96  ? 57  SER E N     1 
ATOM   7060  C  CA    . SER E 2 57  ? 11.496  -3.346  -72.639  1.00 3.26  ? 57  SER E CA    1 
ATOM   7061  C  C     . SER E 2 57  ? 12.275  -4.172  -73.692  1.00 4.39  ? 57  SER E C     1 
ATOM   7062  O  O     . SER E 2 57  ? 11.888  -5.307  -73.982  1.00 12.12 ? 57  SER E O     1 
ATOM   7063  C  CB    . SER E 2 57  ? 11.956  -3.740  -71.241  1.00 2.17  ? 57  SER E CB    1 
ATOM   7064  O  OG    . SER E 2 57  ? 12.638  -4.982  -71.362  1.00 7.86  ? 57  SER E OG    1 
ATOM   7065  N  N     . PRO E 2 58  ? 13.324  -3.632  -74.327  1.00 8.82  ? 58  PRO E N     1 
ATOM   7066  C  CA    . PRO E 2 58  ? 13.996  -4.635  -75.237  1.00 5.70  ? 58  PRO E CA    1 
ATOM   7067  C  C     . PRO E 2 58  ? 14.533  -5.919  -74.538  1.00 14.84 ? 58  PRO E C     1 
ATOM   7068  O  O     . PRO E 2 58  ? 14.639  -7.010  -75.170  1.00 16.52 ? 58  PRO E O     1 
ATOM   7069  C  CB    . PRO E 2 58  ? 15.184  -3.885  -75.845  1.00 2.00  ? 58  PRO E CB    1 
ATOM   7070  C  CG    . PRO E 2 58  ? 15.105  -2.396  -75.263  1.00 2.04  ? 58  PRO E CG    1 
ATOM   7071  C  CD    . PRO E 2 58  ? 13.916  -2.272  -74.350  1.00 13.26 ? 58  PRO E CD    1 
ATOM   7072  N  N     . ALA E 2 59  ? 14.896  -5.780  -73.258  1.00 4.66  ? 59  ALA E N     1 
ATOM   7073  C  CA    . ALA E 2 59  ? 15.604  -6.854  -72.521  1.00 5.57  ? 59  ALA E CA    1 
ATOM   7074  C  C     . ALA E 2 59  ? 14.577  -7.922  -72.379  1.00 3.78  ? 59  ALA E C     1 
ATOM   7075  O  O     . ALA E 2 59  ? 14.879  -9.090  -72.567  1.00 2.00  ? 59  ALA E O     1 
ATOM   7076  C  CB    . ALA E 2 59  ? 16.036  -6.390  -71.104  1.00 2.00  ? 59  ALA E CB    1 
ATOM   7077  N  N     . THR E 2 60  ? 13.368  -7.497  -71.987  1.00 2.41  ? 60  THR E N     1 
ATOM   7078  C  CA    . THR E 2 60  ? 12.226  -8.314  -72.155  1.00 2.00  ? 60  THR E CA    1 
ATOM   7079  C  C     . THR E 2 60  ? 12.125  -9.272  -73.302  1.00 8.31  ? 60  THR E C     1 
ATOM   7080  O  O     . THR E 2 60  ? 11.797  -10.436 -73.121  1.00 4.73  ? 60  THR E O     1 
ATOM   7081  C  CB    . THR E 2 60  ? 11.232  -8.359  -71.067  1.00 2.00  ? 60  THR E CB    1 
ATOM   7082  O  OG1   . THR E 2 60  ? 9.935   -8.380  -71.624  1.00 10.00 ? 60  THR E OG1   1 
ATOM   7083  C  CG2   . THR E 2 60  ? 11.309  -7.205  -70.175  1.00 2.63  ? 60  THR E CG2   1 
ATOM   7084  N  N     . VAL E 2 61  ? 12.423  -8.760  -74.492  1.00 2.00  ? 61  VAL E N     1 
ATOM   7085  C  CA    . VAL E 2 61  ? 11.914  -9.369  -75.664  1.00 12.79 ? 61  VAL E CA    1 
ATOM   7086  C  C     . VAL E 2 61  ? 13.061  -10.289 -75.947  1.00 13.14 ? 61  VAL E C     1 
ATOM   7087  O  O     . VAL E 2 61  ? 12.857  -11.428 -76.341  1.00 11.31 ? 61  VAL E O     1 
ATOM   7088  C  CB    . VAL E 2 61  ? 11.785  -8.318  -76.821  1.00 11.84 ? 61  VAL E CB    1 
ATOM   7089  C  CG1   . VAL E 2 61  ? 11.805  -8.923  -78.234  1.00 2.00  ? 61  VAL E CG1   1 
ATOM   7090  C  CG2   . VAL E 2 61  ? 10.583  -7.461  -76.570  1.00 8.80  ? 61  VAL E CG2   1 
ATOM   7091  N  N     . ILE E 2 62  ? 14.283  -9.784  -75.809  1.00 9.62  ? 62  ILE E N     1 
ATOM   7092  C  CA    . ILE E 2 62  ? 15.403  -10.625 -76.177  1.00 7.79  ? 62  ILE E CA    1 
ATOM   7093  C  C     . ILE E 2 62  ? 15.498  -11.881 -75.261  1.00 10.54 ? 62  ILE E C     1 
ATOM   7094  O  O     . ILE E 2 62  ? 15.908  -12.931 -75.698  1.00 8.44  ? 62  ILE E O     1 
ATOM   7095  C  CB    . ILE E 2 62  ? 16.721  -9.857  -76.162  1.00 16.51 ? 62  ILE E CB    1 
ATOM   7096  C  CG1   . ILE E 2 62  ? 16.755  -8.778  -77.246  1.00 3.34  ? 62  ILE E CG1   1 
ATOM   7097  C  CG2   . ILE E 2 62  ? 17.938  -10.818 -76.285  1.00 2.00  ? 62  ILE E CG2   1 
ATOM   7098  C  CD1   . ILE E 2 62  ? 17.141  -7.426  -76.663  1.00 2.00  ? 62  ILE E CD1   1 
ATOM   7099  N  N     . ARG E 2 63  ? 15.095  -11.767 -74.003  1.00 4.68  ? 63  ARG E N     1 
ATOM   7100  C  CA    . ARG E 2 63  ? 15.230  -12.851 -73.073  1.00 13.41 ? 63  ARG E CA    1 
ATOM   7101  C  C     . ARG E 2 63  ? 14.211  -13.964 -73.348  1.00 9.33  ? 63  ARG E C     1 
ATOM   7102  O  O     . ARG E 2 63  ? 14.427  -15.146 -73.062  1.00 12.58 ? 63  ARG E O     1 
ATOM   7103  C  CB    . ARG E 2 63  ? 15.035  -12.325 -71.641  1.00 16.64 ? 63  ARG E CB    1 
ATOM   7104  C  CG    . ARG E 2 63  ? 15.433  -13.315 -70.562  1.00 23.00 ? 63  ARG E CG    1 
ATOM   7105  C  CD    . ARG E 2 63  ? 14.958  -12.876 -69.192  1.00 37.98 ? 63  ARG E CD    1 
ATOM   7106  N  NE    . ARG E 2 63  ? 15.148  -11.440 -68.956  1.00 32.79 ? 63  ARG E NE    1 
ATOM   7107  C  CZ    . ARG E 2 63  ? 14.200  -10.510 -69.096  1.00 45.86 ? 63  ARG E CZ    1 
ATOM   7108  N  NH1   . ARG E 2 63  ? 12.976  -10.843 -69.536  1.00 23.94 ? 63  ARG E NH1   1 
ATOM   7109  N  NH2   . ARG E 2 63  ? 14.477  -9.232  -68.812  1.00 53.27 ? 63  ARG E NH2   1 
ATOM   7110  N  N     . ARG E 2 64  ? 13.049  -13.590 -73.813  1.00 3.10  ? 64  ARG E N     1 
ATOM   7111  C  CA    . ARG E 2 64  ? 12.048  -14.596 -74.010  1.00 8.13  ? 64  ARG E CA    1 
ATOM   7112  C  C     . ARG E 2 64  ? 12.117  -15.187 -75.449  1.00 13.39 ? 64  ARG E C     1 
ATOM   7113  O  O     . ARG E 2 64  ? 11.757  -16.370 -75.678  1.00 4.74  ? 64  ARG E O     1 
ATOM   7114  C  CB    . ARG E 2 64  ? 10.700  -13.996 -73.751  1.00 2.00  ? 64  ARG E CB    1 
ATOM   7115  C  CG    . ARG E 2 64  ? 9.618   -14.645 -74.571  1.00 19.61 ? 64  ARG E CG    1 
ATOM   7116  C  CD    . ARG E 2 64  ? 8.251   -14.343 -73.997  1.00 3.71  ? 64  ARG E CD    1 
ATOM   7117  N  NE    . ARG E 2 64  ? 7.239   -15.314 -74.418  1.00 2.33  ? 64  ARG E NE    1 
ATOM   7118  C  CZ    . ARG E 2 64  ? 5.940   -15.052 -74.300  1.00 22.38 ? 64  ARG E CZ    1 
ATOM   7119  N  NH1   . ARG E 2 64  ? 5.568   -13.861 -73.805  1.00 3.13  ? 64  ARG E NH1   1 
ATOM   7120  N  NH2   . ARG E 2 64  ? 5.027   -15.948 -74.656  1.00 2.00  ? 64  ARG E NH2   1 
ATOM   7121  N  N     . PHE E 2 65  ? 12.547  -14.360 -76.410  1.00 2.00  ? 65  PHE E N     1 
ATOM   7122  C  CA    . PHE E 2 65  ? 12.599  -14.778 -77.797  1.00 2.00  ? 65  PHE E CA    1 
ATOM   7123  C  C     . PHE E 2 65  ? 14.001  -14.744 -78.341  1.00 2.00  ? 65  PHE E C     1 
ATOM   7124  O  O     . PHE E 2 65  ? 14.413  -13.848 -79.062  1.00 3.49  ? 65  PHE E O     1 
ATOM   7125  C  CB    . PHE E 2 65  ? 11.589  -14.110 -78.729  1.00 2.00  ? 65  PHE E CB    1 
ATOM   7126  C  CG    . PHE E 2 65  ? 10.128  -14.238 -78.293  1.00 10.07 ? 65  PHE E CG    1 
ATOM   7127  C  CD1   . PHE E 2 65  ? 9.297   -13.083 -78.232  1.00 6.26  ? 65  PHE E CD1   1 
ATOM   7128  C  CD2   . PHE E 2 65  ? 9.576   -15.474 -77.991  1.00 2.00  ? 65  PHE E CD2   1 
ATOM   7129  C  CE1   . PHE E 2 65  ? 7.981   -13.155 -77.882  1.00 2.00  ? 65  PHE E CE1   1 
ATOM   7130  C  CE2   . PHE E 2 65  ? 8.254   -15.563 -77.607  1.00 2.00  ? 65  PHE E CE2   1 
ATOM   7131  C  CZ    . PHE E 2 65  ? 7.446   -14.412 -77.550  1.00 12.05 ? 65  PHE E CZ    1 
ATOM   7132  N  N     . PRO E 2 66  ? 14.750  -15.750 -77.974  1.00 2.00  ? 66  PRO E N     1 
ATOM   7133  C  CA    . PRO E 2 66  ? 16.111  -15.682 -78.232  1.00 2.00  ? 66  PRO E CA    1 
ATOM   7134  C  C     . PRO E 2 66  ? 16.347  -15.829 -79.705  1.00 2.00  ? 66  PRO E C     1 
ATOM   7135  O  O     . PRO E 2 66  ? 17.384  -15.450 -80.177  1.00 2.00  ? 66  PRO E O     1 
ATOM   7136  C  CB    . PRO E 2 66  ? 16.632  -16.886 -77.446  1.00 2.00  ? 66  PRO E CB    1 
ATOM   7137  C  CG    . PRO E 2 66  ? 15.624  -17.031 -76.367  1.00 2.00  ? 66  PRO E CG    1 
ATOM   7138  C  CD    . PRO E 2 66  ? 14.423  -16.934 -77.183  1.00 2.00  ? 66  PRO E CD    1 
ATOM   7139  N  N     . LYS E 2 67  ? 15.428  -16.386 -80.472  1.00 2.00  ? 67  LYS E N     1 
ATOM   7140  C  CA    . LYS E 2 67  ? 15.884  -16.792 -81.802  1.00 2.00  ? 67  LYS E CA    1 
ATOM   7141  C  C     . LYS E 2 67  ? 15.399  -15.950 -82.905  1.00 2.00  ? 67  LYS E C     1 
ATOM   7142  O  O     . LYS E 2 67  ? 15.623  -16.299 -84.033  1.00 3.24  ? 67  LYS E O     1 
ATOM   7143  C  CB    . LYS E 2 67  ? 15.585  -18.254 -82.093  1.00 2.00  ? 67  LYS E CB    1 
ATOM   7144  C  CG    . LYS E 2 67  ? 16.640  -19.127 -81.454  1.00 2.00  ? 67  LYS E CG    1 
ATOM   7145  C  CD    . LYS E 2 67  ? 18.037  -18.599 -81.884  1.00 16.10 ? 67  LYS E CD    1 
ATOM   7146  C  CE    . LYS E 2 67  ? 18.909  -19.649 -82.669  1.00 37.16 ? 67  LYS E CE    1 
ATOM   7147  N  NZ    . LYS E 2 67  ? 19.418  -20.712 -81.720  1.00 3.60  ? 67  LYS E NZ    1 
ATOM   7148  N  N     . VAL E 2 68  ? 14.723  -14.851 -82.572  1.00 2.00  ? 68  VAL E N     1 
ATOM   7149  C  CA    . VAL E 2 68  ? 14.210  -13.892 -83.547  1.00 2.00  ? 68  VAL E CA    1 
ATOM   7150  C  C     . VAL E 2 68  ? 15.124  -13.471 -84.702  1.00 3.31  ? 68  VAL E C     1 
ATOM   7151  O  O     . VAL E 2 68  ? 16.297  -13.062 -84.482  1.00 7.25  ? 68  VAL E O     1 
ATOM   7152  C  CB    . VAL E 2 68  ? 13.649  -12.648 -82.842  1.00 12.80 ? 68  VAL E CB    1 
ATOM   7153  C  CG1   . VAL E 2 68  ? 12.958  -11.710 -83.870  1.00 2.00  ? 68  VAL E CG1   1 
ATOM   7154  C  CG2   . VAL E 2 68  ? 12.703  -13.066 -81.757  1.00 2.00  ? 68  VAL E CG2   1 
ATOM   7155  N  N     . ARG E 2 69  ? 14.568  -13.558 -85.926  1.00 2.91  ? 69  ARG E N     1 
ATOM   7156  C  CA    . ARG E 2 69  ? 15.216  -13.110 -87.195  1.00 2.00  ? 69  ARG E CA    1 
ATOM   7157  C  C     . ARG E 2 69  ? 14.509  -11.932 -87.871  1.00 13.35 ? 69  ARG E C     1 
ATOM   7158  O  O     . ARG E 2 69  ? 15.055  -11.289 -88.787  1.00 2.63  ? 69  ARG E O     1 
ATOM   7159  C  CB    . ARG E 2 69  ? 15.217  -14.265 -88.173  1.00 10.09 ? 69  ARG E CB    1 
ATOM   7160  C  CG    . ARG E 2 69  ? 15.949  -15.467 -87.611  1.00 5.32  ? 69  ARG E CG    1 
ATOM   7161  C  CD    . ARG E 2 69  ? 17.431  -15.170 -87.384  1.00 32.85 ? 69  ARG E CD    1 
ATOM   7162  N  NE    . ARG E 2 69  ? 18.234  -16.264 -87.926  1.00 36.85 ? 69  ARG E NE    1 
ATOM   7163  C  CZ    . ARG E 2 69  ? 18.693  -17.268 -87.194  1.00 37.91 ? 69  ARG E CZ    1 
ATOM   7164  N  NH1   . ARG E 2 69  ? 18.439  -17.262 -85.868  1.00 22.79 ? 69  ARG E NH1   1 
ATOM   7165  N  NH2   . ARG E 2 69  ? 19.412  -18.252 -87.784  1.00 5.20  ? 69  ARG E NH2   1 
ATOM   7166  N  N     . SER E 2 70  ? 13.298  -11.636 -87.388  1.00 10.24 ? 70  SER E N     1 
ATOM   7167  C  CA    . SER E 2 70  ? 12.521  -10.585 -87.948  1.00 3.76  ? 70  SER E CA    1 
ATOM   7168  C  C     . SER E 2 70  ? 11.829  -9.748  -86.866  1.00 2.00  ? 70  SER E C     1 
ATOM   7169  O  O     . SER E 2 70  ? 11.031  -10.291 -86.124  1.00 2.00  ? 70  SER E O     1 
ATOM   7170  C  CB    . SER E 2 70  ? 11.503  -11.186 -88.879  1.00 2.74  ? 70  SER E CB    1 
ATOM   7171  O  OG    . SER E 2 70  ? 10.741  -10.152 -89.477  1.00 4.23  ? 70  SER E OG    1 
ATOM   7172  N  N     . VAL E 2 71  ? 12.175  -8.448  -86.792  1.00 2.00  ? 71  VAL E N     1 
ATOM   7173  C  CA    . VAL E 2 71  ? 11.661  -7.491  -85.757  1.00 6.03  ? 71  VAL E CA    1 
ATOM   7174  C  C     . VAL E 2 71  ? 10.865  -6.324  -86.414  1.00 2.42  ? 71  VAL E C     1 
ATOM   7175  O  O     . VAL E 2 71  ? 11.369  -5.656  -87.335  1.00 2.00  ? 71  VAL E O     1 
ATOM   7176  C  CB    . VAL E 2 71  ? 12.824  -6.889  -84.795  1.00 14.46 ? 71  VAL E CB    1 
ATOM   7177  C  CG1   . VAL E 2 71  ? 12.277  -5.780  -83.799  1.00 5.70  ? 71  VAL E CG1   1 
ATOM   7178  C  CG2   . VAL E 2 71  ? 13.463  -8.003  -83.898  1.00 7.53  ? 71  VAL E CG2   1 
ATOM   7179  N  N     . GLU E 2 72  ? 9.634   -6.098  -85.950  1.00 2.00  ? 72  GLU E N     1 
ATOM   7180  C  CA    . GLU E 2 72  ? 8.914   -4.893  -86.335  1.00 3.43  ? 72  GLU E CA    1 
ATOM   7181  C  C     . GLU E 2 72  ? 8.533   -3.935  -85.218  1.00 2.46  ? 72  GLU E C     1 
ATOM   7182  O  O     . GLU E 2 72  ? 7.996   -4.359  -84.202  1.00 2.00  ? 72  GLU E O     1 
ATOM   7183  C  CB    . GLU E 2 72  ? 7.818   -5.100  -87.408  1.00 2.00  ? 72  GLU E CB    1 
ATOM   7184  C  CG    . GLU E 2 72  ? 6.744   -3.986  -87.487  1.00 11.14 ? 72  GLU E CG    1 
ATOM   7185  C  CD    . GLU E 2 72  ? 5.764   -4.162  -88.686  1.00 22.31 ? 72  GLU E CD    1 
ATOM   7186  O  OE1   . GLU E 2 72  ? 5.596   -5.312  -89.159  1.00 12.14 ? 72  GLU E OE1   1 
ATOM   7187  O  OE2   . GLU E 2 72  ? 5.175   -3.152  -89.181  1.00 11.30 ? 72  GLU E OE2   1 
ATOM   7188  N  N     . LEU E 2 73  ? 8.803   -2.631  -85.439  1.00 5.42  ? 73  LEU E N     1 
ATOM   7189  C  CA    . LEU E 2 73  ? 8.620   -1.603  -84.368  1.00 17.35 ? 73  LEU E CA    1 
ATOM   7190  C  C     . LEU E 2 73  ? 7.818   -0.355  -84.705  1.00 3.21  ? 73  LEU E C     1 
ATOM   7191  O  O     . LEU E 2 73  ? 8.044   0.300   -85.697  1.00 3.22  ? 73  LEU E O     1 
ATOM   7192  C  CB    . LEU E 2 73  ? 9.968   -1.203  -83.778  1.00 10.17 ? 73  LEU E CB    1 
ATOM   7193  C  CG    . LEU E 2 73  ? 10.317  -2.284  -82.750  1.00 2.00  ? 73  LEU E CG    1 
ATOM   7194  C  CD1   . LEU E 2 73  ? 11.727  -2.582  -82.714  1.00 2.00  ? 73  LEU E CD1   1 
ATOM   7195  C  CD2   . LEU E 2 73  ? 9.860   -1.842  -81.444  1.00 2.00  ? 73  LEU E CD2   1 
ATOM   7196  N  N     . LYS E 2 74  ? 6.872   -0.033  -83.878  1.00 4.27  ? 74  LYS E N     1 
ATOM   7197  C  CA    . LYS E 2 74  ? 6.128   1.224   -84.091  1.00 4.30  ? 74  LYS E CA    1 
ATOM   7198  C  C     . LYS E 2 74  ? 6.304   2.157   -82.895  1.00 7.04  ? 74  LYS E C     1 
ATOM   7199  O  O     . LYS E 2 74  ? 6.270   1.704   -81.715  1.00 2.00  ? 74  LYS E O     1 
ATOM   7200  C  CB    . LYS E 2 74  ? 4.686   0.912   -84.381  1.00 2.00  ? 74  LYS E CB    1 
ATOM   7201  C  CG    . LYS E 2 74  ? 4.554   0.367   -85.875  1.00 8.26  ? 74  LYS E CG    1 
ATOM   7202  C  CD    . LYS E 2 74  ? 3.053   -0.038  -86.139  1.00 5.57  ? 74  LYS E CD    1 
ATOM   7203  C  CE    . LYS E 2 74  ? 2.832   -0.707  -87.464  1.00 3.36  ? 74  LYS E CE    1 
ATOM   7204  N  NZ    . LYS E 2 74  ? 1.355   -0.709  -87.904  1.00 2.00  ? 74  LYS E NZ    1 
ATOM   7205  N  N     . GLY E 2 75  ? 6.596   3.422   -83.195  1.00 2.00  ? 75  GLY E N     1 
ATOM   7206  C  CA    . GLY E 2 75  ? 6.921   4.401   -82.147  1.00 2.21  ? 75  GLY E CA    1 
ATOM   7207  C  C     . GLY E 2 75  ? 5.893   5.476   -81.896  1.00 2.00  ? 75  GLY E C     1 
ATOM   7208  O  O     . GLY E 2 75  ? 4.993   5.335   -81.126  1.00 2.00  ? 75  GLY E O     1 
ATOM   7209  N  N     . LYS E 2 76  ? 6.020   6.602   -82.551  1.00 5.79  ? 76  LYS E N     1 
ATOM   7210  C  CA    . LYS E 2 76  ? 5.135   7.728   -82.150  1.00 4.13  ? 76  LYS E CA    1 
ATOM   7211  C  C     . LYS E 2 76  ? 3.707   7.466   -82.622  1.00 8.45  ? 76  LYS E C     1 
ATOM   7212  O  O     . LYS E 2 76  ? 3.517   6.809   -83.660  1.00 7.98  ? 76  LYS E O     1 
ATOM   7213  C  CB    . LYS E 2 76  ? 5.594   9.100   -82.708  1.00 3.50  ? 76  LYS E CB    1 
ATOM   7214  C  CG    . LYS E 2 76  ? 7.080   9.505   -82.585  1.00 8.41  ? 76  LYS E CG    1 
ATOM   7215  C  CD    . LYS E 2 76  ? 7.388   10.500  -83.680  1.00 7.50  ? 76  LYS E CD    1 
ATOM   7216  C  CE    . LYS E 2 76  ? 8.459   11.511  -83.294  1.00 33.23 ? 76  LYS E CE    1 
ATOM   7217  N  NZ    . LYS E 2 76  ? 9.322   11.668  -84.525  1.00 38.26 ? 76  LYS E NZ    1 
ATOM   7218  N  N     . PRO E 2 77  ? 2.708   8.062   -81.943  1.00 7.84  ? 77  PRO E N     1 
ATOM   7219  C  CA    . PRO E 2 77  ? 1.355   7.813   -82.437  1.00 6.23  ? 77  PRO E CA    1 
ATOM   7220  C  C     . PRO E 2 77  ? 1.045   8.556   -83.746  1.00 3.92  ? 77  PRO E C     1 
ATOM   7221  O  O     . PRO E 2 77  ? 1.794   9.441   -84.183  1.00 2.00  ? 77  PRO E O     1 
ATOM   7222  C  CB    . PRO E 2 77  ? 0.438   8.353   -81.282  1.00 17.29 ? 77  PRO E CB    1 
ATOM   7223  C  CG    . PRO E 2 77  ? 1.162   9.337   -80.604  1.00 2.00  ? 77  PRO E CG    1 
ATOM   7224  C  CD    . PRO E 2 77  ? 2.704   8.983   -80.783  1.00 2.84  ? 77  PRO E CD    1 
ATOM   7225  N  N     . HIS E 2 78  ? -0.086  8.172   -84.303  1.00 2.00  ? 78  HIS E N     1 
ATOM   7226  C  CA    . HIS E 2 78  ? -0.445  8.405   -85.730  1.00 6.30  ? 78  HIS E CA    1 
ATOM   7227  C  C     . HIS E 2 78  ? -0.514  9.921   -85.976  1.00 2.78  ? 78  HIS E C     1 
ATOM   7228  O  O     . HIS E 2 78  ? 0.012   10.393  -86.964  1.00 5.51  ? 78  HIS E O     1 
ATOM   7229  C  CB    . HIS E 2 78  ? -1.848  7.754   -85.965  1.00 4.91  ? 78  HIS E CB    1 
ATOM   7230  C  CG    . HIS E 2 78  ? -2.493  8.158   -87.244  1.00 2.99  ? 78  HIS E CG    1 
ATOM   7231  N  ND1   . HIS E 2 78  ? -3.861  8.327   -87.372  1.00 2.00  ? 78  HIS E ND1   1 
ATOM   7232  C  CD2   . HIS E 2 78  ? -1.949  8.472   -88.436  1.00 2.00  ? 78  HIS E CD2   1 
ATOM   7233  C  CE1   . HIS E 2 78  ? -4.112  8.726   -88.608  1.00 4.25  ? 78  HIS E CE1   1 
ATOM   7234  N  NE2   . HIS E 2 78  ? -2.968  8.805   -89.277  1.00 2.00  ? 78  HIS E NE2   1 
ATOM   7235  N  N     . PHE E 2 79  ? -1.124  10.649  -85.023  1.00 3.14  ? 79  PHE E N     1 
ATOM   7236  C  CA    . PHE E 2 79  ? -1.180  12.123  -84.982  1.00 13.63 ? 79  PHE E CA    1 
ATOM   7237  C  C     . PHE E 2 79  ? 0.150   12.831  -85.164  1.00 9.88  ? 79  PHE E C     1 
ATOM   7238  O  O     . PHE E 2 79  ? 0.178   14.024  -85.520  1.00 10.17 ? 79  PHE E O     1 
ATOM   7239  C  CB    . PHE E 2 79  ? -1.938  12.683  -83.714  1.00 2.00  ? 79  PHE E CB    1 
ATOM   7240  C  CG    . PHE E 2 79  ? -3.430  12.640  -83.839  1.00 3.34  ? 79  PHE E CG    1 
ATOM   7241  C  CD1   . PHE E 2 79  ? -4.063  11.893  -84.932  1.00 2.01  ? 79  PHE E CD1   1 
ATOM   7242  C  CD2   . PHE E 2 79  ? -4.226  13.335  -82.992  1.00 2.00  ? 79  PHE E CD2   1 
ATOM   7243  C  CE1   . PHE E 2 79  ? -5.476  11.851  -85.117  1.00 2.00  ? 79  PHE E CE1   1 
ATOM   7244  C  CE2   . PHE E 2 79  ? -5.625  13.257  -83.191  1.00 2.00  ? 79  PHE E CE2   1 
ATOM   7245  C  CZ    . PHE E 2 79  ? -6.229  12.519  -84.278  1.00 2.00  ? 79  PHE E CZ    1 
ATOM   7246  N  N     . ALA E 2 80  ? 1.260   12.146  -84.901  1.00 15.27 ? 80  ALA E N     1 
ATOM   7247  C  CA    . ALA E 2 80  ? 2.575   12.825  -85.075  1.00 5.14  ? 80  ALA E CA    1 
ATOM   7248  C  C     . ALA E 2 80  ? 2.634   13.183  -86.509  1.00 7.53  ? 80  ALA E C     1 
ATOM   7249  O  O     . ALA E 2 80  ? 3.323   14.141  -86.863  1.00 3.52  ? 80  ALA E O     1 
ATOM   7250  C  CB    . ALA E 2 80  ? 3.708   11.932  -84.803  1.00 18.86 ? 80  ALA E CB    1 
ATOM   7251  N  N     . ASP E 2 81  ? 1.902   12.446  -87.347  1.00 2.00  ? 81  ASP E N     1 
ATOM   7252  C  CA    . ASP E 2 81  ? 1.800   12.880  -88.747  1.00 4.00  ? 81  ASP E CA    1 
ATOM   7253  C  C     . ASP E 2 81  ? 1.207   14.294  -88.957  1.00 11.83 ? 81  ASP E C     1 
ATOM   7254  O  O     . ASP E 2 81  ? 1.348   14.858  -90.024  1.00 2.96  ? 81  ASP E O     1 
ATOM   7255  C  CB    . ASP E 2 81  ? 0.974   11.900  -89.527  1.00 13.61 ? 81  ASP E CB    1 
ATOM   7256  C  CG    . ASP E 2 81  ? 1.721   10.599  -89.806  1.00 15.09 ? 81  ASP E CG    1 
ATOM   7257  O  OD1   . ASP E 2 81  ? 2.851   10.318  -89.285  1.00 7.88  ? 81  ASP E OD1   1 
ATOM   7258  O  OD2   . ASP E 2 81  ? 1.119   9.839   -90.535  1.00 13.78 ? 81  ASP E OD2   1 
ATOM   7259  N  N     . PHE E 2 82  ? 0.534   14.854  -87.964  1.00 2.00  ? 82  PHE E N     1 
ATOM   7260  C  CA    . PHE E 2 82  ? 0.019   16.170  -88.146  1.00 5.45  ? 82  PHE E CA    1 
ATOM   7261  C  C     . PHE E 2 82  ? 0.673   17.219  -87.269  1.00 7.10  ? 82  PHE E C     1 
ATOM   7262  O  O     . PHE E 2 82  ? 0.037   18.153  -86.929  1.00 12.13 ? 82  PHE E O     1 
ATOM   7263  C  CB    . PHE E 2 82  ? -1.476  16.132  -87.899  1.00 5.87  ? 82  PHE E CB    1 
ATOM   7264  C  CG    . PHE E 2 82  ? -2.113  14.968  -88.534  1.00 9.17  ? 82  PHE E CG    1 
ATOM   7265  C  CD1   . PHE E 2 82  ? -1.776  14.637  -89.847  1.00 3.89  ? 82  PHE E CD1   1 
ATOM   7266  C  CD2   . PHE E 2 82  ? -2.987  14.132  -87.815  1.00 14.27 ? 82  PHE E CD2   1 
ATOM   7267  C  CE1   . PHE E 2 82  ? -2.323  13.507  -90.480  1.00 7.68  ? 82  PHE E CE1   1 
ATOM   7268  C  CE2   . PHE E 2 82  ? -3.575  13.019  -88.446  1.00 4.46  ? 82  PHE E CE2   1 
ATOM   7269  C  CZ    . PHE E 2 82  ? -3.235  12.703  -89.793  1.00 2.00  ? 82  PHE E CZ    1 
ATOM   7270  N  N     . ASN E 2 83  ? 1.958   17.085  -86.956  1.00 15.48 ? 83  ASN E N     1 
ATOM   7271  C  CA    . ASN E 2 83  ? 2.588   17.867  -85.919  1.00 2.00  ? 83  ASN E CA    1 
ATOM   7272  C  C     . ASN E 2 83  ? 1.887   18.204  -84.672  1.00 14.61 ? 83  ASN E C     1 
ATOM   7273  O  O     . ASN E 2 83  ? 1.969   19.374  -84.211  1.00 4.92  ? 83  ASN E O     1 
ATOM   7274  C  CB    . ASN E 2 83  ? 3.319   19.117  -86.387  1.00 17.02 ? 83  ASN E CB    1 
ATOM   7275  C  CG    . ASN E 2 83  ? 3.184   19.333  -87.792  1.00 10.22 ? 83  ASN E CG    1 
ATOM   7276  O  OD1   . ASN E 2 83  ? 4.068   19.020  -88.600  1.00 2.28  ? 83  ASN E OD1   1 
ATOM   7277  N  ND2   . ASN E 2 83  ? 2.027   19.786  -88.154  1.00 24.70 ? 83  ASN E ND2   1 
ATOM   7278  N  N     . LEU E 2 84  ? 1.261   17.192  -84.083  1.00 2.68  ? 84  LEU E N     1 
ATOM   7279  C  CA    . LEU E 2 84  ? 0.527   17.377  -82.853  1.00 2.00  ? 84  LEU E CA    1 
ATOM   7280  C  C     . LEU E 2 84  ? 1.343   16.789  -81.735  1.00 2.00  ? 84  LEU E C     1 
ATOM   7281  O  O     . LEU E 2 84  ? 1.032   17.001  -80.584  1.00 2.00  ? 84  LEU E O     1 
ATOM   7282  C  CB    . LEU E 2 84  ? -0.827  16.642  -82.929  1.00 2.00  ? 84  LEU E CB    1 
ATOM   7283  C  CG    . LEU E 2 84  ? -1.857  17.258  -83.870  1.00 4.82  ? 84  LEU E CG    1 
ATOM   7284  C  CD1   . LEU E 2 84  ? -3.136  16.663  -83.523  1.00 2.00  ? 84  LEU E CD1   1 
ATOM   7285  C  CD2   . LEU E 2 84  ? -2.022  18.762  -83.793  1.00 2.00  ? 84  LEU E CD2   1 
ATOM   7286  N  N     . VAL E 2 85  ? 2.351   15.999  -82.081  1.00 2.13  ? 85  VAL E N     1 
ATOM   7287  C  CA    . VAL E 2 85  ? 3.302   15.531  -81.061  1.00 6.65  ? 85  VAL E CA    1 
ATOM   7288  C  C     . VAL E 2 85  ? 4.688   16.299  -81.198  1.00 15.35 ? 85  VAL E C     1 
ATOM   7289  O  O     . VAL E 2 85  ? 5.325   16.248  -82.227  1.00 2.14  ? 85  VAL E O     1 
ATOM   7290  C  CB    . VAL E 2 85  ? 3.381   13.934  -80.841  1.00 11.04 ? 85  VAL E CB    1 
ATOM   7291  C  CG1   . VAL E 2 85  ? 2.681   13.007  -81.889  1.00 2.00  ? 85  VAL E CG1   1 
ATOM   7292  C  CG2   . VAL E 2 85  ? 4.713   13.521  -80.603  1.00 2.62  ? 85  VAL E CG2   1 
ATOM   7293  N  N     . PRO E 2 86  ? 5.079   17.131  -80.193  1.00 11.82 ? 86  PRO E N     1 
ATOM   7294  C  CA    . PRO E 2 86  ? 6.294   17.995  -80.355  1.00 8.03  ? 86  PRO E CA    1 
ATOM   7295  C  C     . PRO E 2 86  ? 7.573   17.204  -80.610  1.00 9.76  ? 86  PRO E C     1 
ATOM   7296  O  O     . PRO E 2 86  ? 7.660   16.046  -80.204  1.00 9.40  ? 86  PRO E O     1 
ATOM   7297  C  CB    . PRO E 2 86  ? 6.409   18.745  -78.988  1.00 2.00  ? 86  PRO E CB    1 
ATOM   7298  C  CG    . PRO E 2 86  ? 5.053   18.713  -78.430  1.00 5.68  ? 86  PRO E CG    1 
ATOM   7299  C  CD    . PRO E 2 86  ? 4.356   17.411  -78.937  1.00 2.00  ? 86  PRO E CD    1 
ATOM   7300  N  N     . ASP E 2 87  ? 8.577   17.830  -81.237  1.00 10.34 ? 87  ASP E N     1 
ATOM   7301  C  CA    . ASP E 2 87  ? 9.844   17.171  -81.493  1.00 2.00  ? 87  ASP E CA    1 
ATOM   7302  C  C     . ASP E 2 87  ? 10.437  16.693  -80.170  1.00 11.65 ? 87  ASP E C     1 
ATOM   7303  O  O     . ASP E 2 87  ? 10.331  17.400  -79.127  1.00 2.00  ? 87  ASP E O     1 
ATOM   7304  C  CB    . ASP E 2 87  ? 10.799  18.223  -82.011  1.00 5.93  ? 87  ASP E CB    1 
ATOM   7305  C  CG    . ASP E 2 87  ? 10.610  18.503  -83.479  1.00 7.86  ? 87  ASP E CG    1 
ATOM   7306  O  OD1   . ASP E 2 87  ? 10.948  19.617  -83.910  1.00 34.83 ? 87  ASP E OD1   1 
ATOM   7307  O  OD2   . ASP E 2 87  ? 10.099  17.640  -84.200  1.00 16.81 ? 87  ASP E OD2   1 
ATOM   7308  N  N     . GLY E 2 88  ? 11.116  15.538  -80.201  1.00 2.00  ? 88  GLY E N     1 
ATOM   7309  C  CA    . GLY E 2 88  ? 11.850  15.099  -78.996  1.00 2.00  ? 88  GLY E CA    1 
ATOM   7310  C  C     . GLY E 2 88  ? 10.989  14.254  -78.011  1.00 10.12 ? 88  GLY E C     1 
ATOM   7311  O  O     . GLY E 2 88  ? 11.419  13.882  -76.883  1.00 2.70  ? 88  GLY E O     1 
ATOM   7312  N  N     . TRP E 2 89  ? 9.770   13.964  -78.424  1.00 2.00  ? 89  TRP E N     1 
ATOM   7313  C  CA    . TRP E 2 89  ? 8.843   13.258  -77.556  1.00 8.79  ? 89  TRP E CA    1 
ATOM   7314  C  C     . TRP E 2 89  ? 9.419   11.896  -77.207  1.00 2.00  ? 89  TRP E C     1 
ATOM   7315  O  O     . TRP E 2 89  ? 9.282   11.468  -76.085  1.00 2.00  ? 89  TRP E O     1 
ATOM   7316  C  CB    . TRP E 2 89  ? 7.503   12.977  -78.281  1.00 2.00  ? 89  TRP E CB    1 
ATOM   7317  C  CG    . TRP E 2 89  ? 6.650   11.978  -77.545  1.00 3.88  ? 89  TRP E CG    1 
ATOM   7318  C  CD1   . TRP E 2 89  ? 5.850   12.218  -76.447  1.00 2.00  ? 89  TRP E CD1   1 
ATOM   7319  C  CD2   . TRP E 2 89  ? 6.496   10.581  -77.850  1.00 2.00  ? 89  TRP E CD2   1 
ATOM   7320  N  NE1   . TRP E 2 89  ? 5.174   11.079  -76.111  1.00 2.00  ? 89  TRP E NE1   1 
ATOM   7321  C  CE2   . TRP E 2 89  ? 5.571   10.057  -76.949  1.00 5.65  ? 89  TRP E CE2   1 
ATOM   7322  C  CE3   . TRP E 2 89  ? 7.017   9.741   -78.835  1.00 6.62  ? 89  TRP E CE3   1 
ATOM   7323  C  CZ2   . TRP E 2 89  ? 5.225   8.668   -76.942  1.00 2.16  ? 89  TRP E CZ2   1 
ATOM   7324  C  CZ3   . TRP E 2 89  ? 6.620   8.410   -78.878  1.00 2.00  ? 89  TRP E CZ3   1 
ATOM   7325  C  CH2   . TRP E 2 89  ? 5.762   7.884   -77.916  1.00 5.78  ? 89  TRP E CH2   1 
ATOM   7326  N  N     . GLY E 2 90  ? 9.943   11.194  -78.223  1.00 2.02  ? 90  GLY E N     1 
ATOM   7327  C  CA    . GLY E 2 90  ? 10.409  9.784   -78.078  1.00 2.00  ? 90  GLY E CA    1 
ATOM   7328  C  C     . GLY E 2 90  ? 10.417  8.953   -79.365  1.00 5.21  ? 90  GLY E C     1 
ATOM   7329  O  O     . GLY E 2 90  ? 10.479  9.514   -80.477  1.00 2.00  ? 90  GLY E O     1 
ATOM   7330  N  N     . GLY E 2 91  ? 10.292  7.617   -79.224  1.00 3.94  ? 91  GLY E N     1 
ATOM   7331  C  CA    . GLY E 2 91  ? 10.384  6.730   -80.358  1.00 2.00  ? 91  GLY E CA    1 
ATOM   7332  C  C     . GLY E 2 91  ? 11.807  6.427   -80.771  1.00 2.63  ? 91  GLY E C     1 
ATOM   7333  O  O     . GLY E 2 91  ? 12.066  6.214   -81.951  1.00 8.37  ? 91  GLY E O     1 
ATOM   7334  N  N     . TYR E 2 92  ? 12.758  6.423   -79.837  1.00 2.00  ? 92  TYR E N     1 
ATOM   7335  C  CA    . TYR E 2 92  ? 14.146  6.091   -80.232  1.00 12.44 ? 92  TYR E CA    1 
ATOM   7336  C  C     . TYR E 2 92  ? 14.381  4.593   -80.426  1.00 2.40  ? 92  TYR E C     1 
ATOM   7337  O  O     . TYR E 2 92  ? 14.064  3.814   -79.520  1.00 2.00  ? 92  TYR E O     1 
ATOM   7338  C  CB    . TYR E 2 92  ? 15.149  6.568   -79.183  1.00 2.33  ? 92  TYR E CB    1 
ATOM   7339  C  CG    . TYR E 2 92  ? 15.040  7.995   -78.999  1.00 8.79  ? 92  TYR E CG    1 
ATOM   7340  C  CD1   . TYR E 2 92  ? 14.457  8.522   -77.835  1.00 29.68 ? 92  TYR E CD1   1 
ATOM   7341  C  CD2   . TYR E 2 92  ? 15.510  8.870   -79.982  1.00 18.85 ? 92  TYR E CD2   1 
ATOM   7342  C  CE1   . TYR E 2 92  ? 14.360  9.914   -77.629  1.00 2.00  ? 92  TYR E CE1   1 
ATOM   7343  C  CE2   . TYR E 2 92  ? 15.403  10.257  -79.810  1.00 2.00  ? 92  TYR E CE2   1 
ATOM   7344  C  CZ    . TYR E 2 92  ? 14.862  10.765  -78.607  1.00 3.03  ? 92  TYR E CZ    1 
ATOM   7345  O  OH    . TYR E 2 92  ? 14.767  12.128  -78.412  1.00 8.27  ? 92  TYR E OH    1 
ATOM   7346  N  N     . VAL E 2 93  ? 15.008  4.194   -81.525  1.00 2.00  ? 93  VAL E N     1 
ATOM   7347  C  CA    . VAL E 2 93  ? 15.169  2.782   -81.726  1.00 2.00  ? 93  VAL E CA    1 
ATOM   7348  C  C     . VAL E 2 93  ? 16.555  2.338   -81.286  1.00 10.75 ? 93  VAL E C     1 
ATOM   7349  O  O     . VAL E 2 93  ? 16.816  1.142   -81.125  1.00 7.16  ? 93  VAL E O     1 
ATOM   7350  C  CB    . VAL E 2 93  ? 14.916  2.391   -83.223  1.00 2.00  ? 93  VAL E CB    1 
ATOM   7351  C  CG1   . VAL E 2 93  ? 16.029  2.844   -84.084  1.00 2.00  ? 93  VAL E CG1   1 
ATOM   7352  C  CG2   . VAL E 2 93  ? 14.671  0.919   -83.369  1.00 2.00  ? 93  VAL E CG2   1 
ATOM   7353  N  N     . TYR E 2 94  ? 17.470  3.290   -81.137  1.00 5.87  ? 94  TYR E N     1 
ATOM   7354  C  CA    . TYR E 2 94  ? 18.774  2.918   -80.665  1.00 7.15  ? 94  TYR E CA    1 
ATOM   7355  C  C     . TYR E 2 94  ? 18.783  1.879   -79.514  1.00 5.60  ? 94  TYR E C     1 
ATOM   7356  O  O     . TYR E 2 94  ? 19.564  0.933   -79.569  1.00 2.00  ? 94  TYR E O     1 
ATOM   7357  C  CB    . TYR E 2 94  ? 19.638  4.155   -80.351  1.00 6.51  ? 94  TYR E CB    1 
ATOM   7358  C  CG    . TYR E 2 94  ? 21.081  3.765   -80.130  1.00 6.27  ? 94  TYR E CG    1 
ATOM   7359  C  CD1   . TYR E 2 94  ? 21.943  3.600   -81.196  1.00 2.00  ? 94  TYR E CD1   1 
ATOM   7360  C  CD2   . TYR E 2 94  ? 21.567  3.536   -78.834  1.00 2.00  ? 94  TYR E CD2   1 
ATOM   7361  C  CE1   . TYR E 2 94  ? 23.241  3.236   -80.980  1.00 2.00  ? 94  TYR E CE1   1 
ATOM   7362  C  CE2   . TYR E 2 94  ? 22.822  3.195   -78.633  1.00 2.00  ? 94  TYR E CE2   1 
ATOM   7363  C  CZ    . TYR E 2 94  ? 23.656  3.028   -79.683  1.00 7.72  ? 94  TYR E CZ    1 
ATOM   7364  O  OH    . TYR E 2 94  ? 24.969  2.688   -79.410  1.00 4.67  ? 94  TYR E OH    1 
ATOM   7365  N  N     . PRO E 2 95  ? 17.977  2.076   -78.429  1.00 3.25  ? 95  PRO E N     1 
ATOM   7366  C  CA    . PRO E 2 95  ? 18.353  1.088   -77.381  1.00 6.15  ? 95  PRO E CA    1 
ATOM   7367  C  C     . PRO E 2 95  ? 18.075  -0.293  -77.967  1.00 7.39  ? 95  PRO E C     1 
ATOM   7368  O  O     . PRO E 2 95  ? 18.704  -1.288  -77.606  1.00 6.01  ? 95  PRO E O     1 
ATOM   7369  C  CB    . PRO E 2 95  ? 17.399  1.415   -76.174  1.00 2.00  ? 95  PRO E CB    1 
ATOM   7370  C  CG    . PRO E 2 95  ? 16.993  2.760   -76.336  1.00 2.00  ? 95  PRO E CG    1 
ATOM   7371  C  CD    . PRO E 2 95  ? 16.905  2.947   -77.940  1.00 2.00  ? 95  PRO E CD    1 
ATOM   7372  N  N     . TRP E 2 96  ? 17.133  -0.328  -78.894  1.00 3.40  ? 96  TRP E N     1 
ATOM   7373  C  CA    . TRP E 2 96  ? 16.632  -1.589  -79.363  1.00 5.50  ? 96  TRP E CA    1 
ATOM   7374  C  C     . TRP E 2 96  ? 17.754  -2.213  -80.104  1.00 4.04  ? 96  TRP E C     1 
ATOM   7375  O  O     . TRP E 2 96  ? 18.029  -3.396  -79.891  1.00 6.06  ? 96  TRP E O     1 
ATOM   7376  C  CB    . TRP E 2 96  ? 15.372  -1.463  -80.252  1.00 6.44  ? 96  TRP E CB    1 
ATOM   7377  C  CG    . TRP E 2 96  ? 14.090  -1.253  -79.423  1.00 2.00  ? 96  TRP E CG    1 
ATOM   7378  C  CD1   . TRP E 2 96  ? 13.543  -0.077  -79.052  1.00 2.00  ? 96  TRP E CD1   1 
ATOM   7379  C  CD2   . TRP E 2 96  ? 13.236  -2.276  -78.897  1.00 6.66  ? 96  TRP E CD2   1 
ATOM   7380  N  NE1   . TRP E 2 96  ? 12.404  -0.283  -78.308  1.00 2.00  ? 96  TRP E NE1   1 
ATOM   7381  C  CE2   . TRP E 2 96  ? 12.217  -1.634  -78.168  1.00 2.00  ? 96  TRP E CE2   1 
ATOM   7382  C  CE3   . TRP E 2 96  ? 13.261  -3.675  -78.935  1.00 2.00  ? 96  TRP E CE3   1 
ATOM   7383  C  CZ2   . TRP E 2 96  ? 11.221  -2.339  -77.501  1.00 2.00  ? 96  TRP E CZ2   1 
ATOM   7384  C  CZ3   . TRP E 2 96  ? 12.271  -4.368  -78.258  1.00 2.00  ? 96  TRP E CZ3   1 
ATOM   7385  C  CH2   . TRP E 2 96  ? 11.268  -3.690  -77.556  1.00 3.79  ? 96  TRP E CH2   1 
ATOM   7386  N  N     . ILE E 2 97  ? 18.413  -1.431  -80.955  1.00 2.00  ? 97  ILE E N     1 
ATOM   7387  C  CA    . ILE E 2 97  ? 19.533  -1.936  -81.664  1.00 2.00  ? 97  ILE E CA    1 
ATOM   7388  C  C     . ILE E 2 97  ? 20.671  -2.321  -80.722  1.00 3.50  ? 97  ILE E C     1 
ATOM   7389  O  O     . ILE E 2 97  ? 21.333  -3.318  -80.951  1.00 10.26 ? 97  ILE E O     1 
ATOM   7390  C  CB    . ILE E 2 97  ? 20.067  -0.945  -82.706  1.00 2.00  ? 97  ILE E CB    1 
ATOM   7391  C  CG1   . ILE E 2 97  ? 19.235  -0.960  -84.020  1.00 21.15 ? 97  ILE E CG1   1 
ATOM   7392  C  CG2   . ILE E 2 97  ? 21.290  -1.562  -83.334  1.00 2.00  ? 97  ILE E CG2   1 
ATOM   7393  C  CD1   . ILE E 2 97  ? 17.975  -0.361  -84.004  1.00 5.34  ? 97  ILE E CD1   1 
ATOM   7394  N  N     . GLU E 2 98  ? 20.928  -1.536  -79.678  1.00 2.36  ? 98  GLU E N     1 
ATOM   7395  C  CA    . GLU E 2 98  ? 22.037  -1.830  -78.800  1.00 8.68  ? 98  GLU E CA    1 
ATOM   7396  C  C     . GLU E 2 98  ? 21.838  -3.236  -78.339  1.00 4.45  ? 98  GLU E C     1 
ATOM   7397  O  O     . GLU E 2 98  ? 22.738  -4.039  -78.437  1.00 2.00  ? 98  GLU E O     1 
ATOM   7398  C  CB    . GLU E 2 98  ? 22.040  -0.921  -77.568  1.00 20.05 ? 98  GLU E CB    1 
ATOM   7399  C  CG    . GLU E 2 98  ? 23.050  -1.295  -76.484  1.00 23.56 ? 98  GLU E CG    1 
ATOM   7400  C  CD    . GLU E 2 98  ? 23.951  -0.121  -76.129  1.00 42.22 ? 98  GLU E CD    1 
ATOM   7401  O  OE1   . GLU E 2 98  ? 25.160  -0.150  -76.486  1.00 24.09 ? 98  GLU E OE1   1 
ATOM   7402  O  OE2   . GLU E 2 98  ? 23.443  0.846   -75.504  1.00 39.59 ? 98  GLU E OE2   1 
ATOM   7403  N  N     . ALA E 2 99  ? 20.632  -3.526  -77.850  1.00 9.30  ? 99  ALA E N     1 
ATOM   7404  C  CA    . ALA E 2 99  ? 20.325  -4.815  -77.224  1.00 2.00  ? 99  ALA E CA    1 
ATOM   7405  C  C     . ALA E 2 99  ? 20.400  -5.932  -78.250  1.00 4.68  ? 99  ALA E C     1 
ATOM   7406  O  O     . ALA E 2 99  ? 20.965  -7.003  -78.005  1.00 4.22  ? 99  ALA E O     1 
ATOM   7407  C  CB    . ALA E 2 99  ? 19.005  -4.779  -76.587  1.00 2.00  ? 99  ALA E CB    1 
ATOM   7408  N  N     . MET E 2 100 ? 19.871  -5.696  -79.432  1.00 6.11  ? 100 MET E N     1 
ATOM   7409  C  CA    . MET E 2 100 ? 19.867  -6.788  -80.389  1.00 9.93  ? 100 MET E CA    1 
ATOM   7410  C  C     . MET E 2 100 ? 21.278  -7.170  -80.854  1.00 2.39  ? 100 MET E C     1 
ATOM   7411  O  O     . MET E 2 100 ? 21.540  -8.337  -81.166  1.00 10.19 ? 100 MET E O     1 
ATOM   7412  C  CB    . MET E 2 100 ? 18.905  -6.512  -81.555  1.00 10.15 ? 100 MET E CB    1 
ATOM   7413  C  CG    . MET E 2 100 ? 17.541  -6.106  -81.073  1.00 3.87  ? 100 MET E CG    1 
ATOM   7414  S  SD    . MET E 2 100 ? 16.234  -6.217  -82.316  1.00 3.74  ? 100 MET E SD    1 
ATOM   7415  C  CE    . MET E 2 100 ? 16.726  -5.013  -83.559  1.00 2.00  ? 100 MET E CE    1 
ATOM   7416  N  N     . SER E 2 101 ? 22.185  -6.198  -80.912  1.00 2.42  ? 101 SER E N     1 
ATOM   7417  C  CA    . SER E 2 101 ? 23.453  -6.398  -81.644  1.00 2.00  ? 101 SER E CA    1 
ATOM   7418  C  C     . SER E 2 101 ? 24.270  -7.507  -80.932  1.00 9.10  ? 101 SER E C     1 
ATOM   7419  O  O     . SER E 2 101 ? 24.888  -8.320  -81.610  1.00 7.80  ? 101 SER E O     1 
ATOM   7420  C  CB    . SER E 2 101 ? 24.241  -5.081  -81.758  1.00 2.00  ? 101 SER E CB    1 
ATOM   7421  O  OG    . SER E 2 101 ? 24.612  -4.619  -80.439  1.00 3.18  ? 101 SER E OG    1 
ATOM   7422  N  N     . SER E 2 102 ? 24.239  -7.560  -79.585  1.00 2.00  ? 102 SER E N     1 
ATOM   7423  C  CA    . SER E 2 102 ? 24.481  -8.814  -78.843  1.00 12.90 ? 102 SER E CA    1 
ATOM   7424  C  C     . SER E 2 102 ? 23.702  -10.125 -79.040  1.00 12.33 ? 102 SER E C     1 
ATOM   7425  O  O     . SER E 2 102 ? 24.312  -11.164 -79.240  1.00 12.47 ? 102 SER E O     1 
ATOM   7426  C  CB    . SER E 2 102 ? 25.053  -8.657  -77.417  1.00 11.48 ? 102 SER E CB    1 
ATOM   7427  O  OG    . SER E 2 102 ? 24.166  -8.013  -76.506  1.00 16.28 ? 102 SER E OG    1 
ATOM   7428  N  N     . SER E 2 103 ? 22.387  -10.148 -78.946  1.00 2.00  ? 103 SER E N     1 
ATOM   7429  C  CA    . SER E 2 103 ? 21.828  -11.487 -78.878  1.00 6.97  ? 103 SER E CA    1 
ATOM   7430  C  C     . SER E 2 103 ? 21.295  -12.050 -80.216  1.00 9.22  ? 103 SER E C     1 
ATOM   7431  O  O     . SER E 2 103 ? 21.291  -13.239 -80.471  1.00 2.00  ? 103 SER E O     1 
ATOM   7432  C  CB    . SER E 2 103 ? 20.874  -11.650 -77.709  1.00 2.00  ? 103 SER E CB    1 
ATOM   7433  O  OG    . SER E 2 103 ? 21.098  -10.679 -76.684  1.00 7.24  ? 103 SER E OG    1 
ATOM   7434  N  N     . TYR E 2 104 ? 20.875  -11.174 -81.093  1.00 2.00  ? 104 TYR E N     1 
ATOM   7435  C  CA    . TYR E 2 104 ? 20.386  -11.643 -82.346  1.00 2.00  ? 104 TYR E CA    1 
ATOM   7436  C  C     . TYR E 2 104 ? 21.459  -11.447 -83.398  1.00 2.00  ? 104 TYR E C     1 
ATOM   7437  O  O     . TYR E 2 104 ? 21.229  -10.686 -84.314  1.00 8.78  ? 104 TYR E O     1 
ATOM   7438  C  CB    . TYR E 2 104 ? 19.227  -10.759 -82.707  1.00 2.00  ? 104 TYR E CB    1 
ATOM   7439  C  CG    . TYR E 2 104 ? 18.021  -10.869 -81.793  1.00 5.12  ? 104 TYR E CG    1 
ATOM   7440  C  CD1   . TYR E 2 104 ? 17.023  -9.862  -81.772  1.00 2.00  ? 104 TYR E CD1   1 
ATOM   7441  C  CD2   . TYR E 2 104 ? 17.811  -12.009 -81.022  1.00 2.00  ? 104 TYR E CD2   1 
ATOM   7442  C  CE1   . TYR E 2 104 ? 15.909  -9.986  -81.014  1.00 2.00  ? 104 TYR E CE1   1 
ATOM   7443  C  CE2   . TYR E 2 104 ? 16.636  -12.152 -80.229  1.00 2.00  ? 104 TYR E CE2   1 
ATOM   7444  C  CZ    . TYR E 2 104 ? 15.699  -11.122 -80.230  1.00 17.79 ? 104 TYR E CZ    1 
ATOM   7445  O  OH    . TYR E 2 104 ? 14.559  -11.260 -79.464  1.00 2.00  ? 104 TYR E OH    1 
ATOM   7446  N  N     . THR E 2 105 ? 22.616  -12.106 -83.307  1.00 6.65  ? 105 THR E N     1 
ATOM   7447  C  CA    . THR E 2 105 ? 23.706  -11.881 -84.306  1.00 11.53 ? 105 THR E CA    1 
ATOM   7448  C  C     . THR E 2 105 ? 23.305  -12.190 -85.730  1.00 5.83  ? 105 THR E C     1 
ATOM   7449  O  O     . THR E 2 105 ? 24.047  -11.846 -86.688  1.00 5.96  ? 105 THR E O     1 
ATOM   7450  C  CB    . THR E 2 105 ? 24.999  -12.772 -84.095  1.00 11.96 ? 105 THR E CB    1 
ATOM   7451  O  OG1   . THR E 2 105 ? 24.737  -13.762 -83.111  1.00 13.86 ? 105 THR E OG1   1 
ATOM   7452  C  CG2   . THR E 2 105 ? 26.218  -11.916 -83.675  1.00 15.44 ? 105 THR E CG2   1 
ATOM   7453  N  N     . TRP E 2 106 ? 22.195  -12.915 -85.825  1.00 2.00  ? 106 TRP E N     1 
ATOM   7454  C  CA    . TRP E 2 106 ? 21.666  -13.430 -87.040  1.00 2.00  ? 106 TRP E CA    1 
ATOM   7455  C  C     . TRP E 2 106 ? 20.359  -12.796 -87.449  1.00 8.97  ? 106 TRP E C     1 
ATOM   7456  O  O     . TRP E 2 106 ? 19.671  -13.352 -88.315  1.00 5.75  ? 106 TRP E O     1 
ATOM   7457  C  CB    . TRP E 2 106 ? 21.366  -14.864 -86.764  1.00 7.18  ? 106 TRP E CB    1 
ATOM   7458  C  CG    . TRP E 2 106 ? 22.635  -15.706 -86.356  1.00 47.28 ? 106 TRP E CG    1 
ATOM   7459  C  CD1   . TRP E 2 106 ? 22.654  -16.808 -85.519  1.00 49.35 ? 106 TRP E CD1   1 
ATOM   7460  C  CD2   . TRP E 2 106 ? 24.023  -15.514 -86.787  1.00 38.36 ? 106 TRP E CD2   1 
ATOM   7461  N  NE1   . TRP E 2 106 ? 23.948  -17.298 -85.407  1.00 59.26 ? 106 TRP E NE1   1 
ATOM   7462  C  CE2   . TRP E 2 106 ? 24.800  -16.529 -86.162  1.00 45.74 ? 106 TRP E CE2   1 
ATOM   7463  C  CE3   . TRP E 2 106 ? 24.671  -14.590 -87.642  1.00 57.88 ? 106 TRP E CE3   1 
ATOM   7464  C  CZ2   . TRP E 2 106 ? 26.195  -16.641 -86.350  1.00 37.61 ? 106 TRP E CZ2   1 
ATOM   7465  C  CZ3   . TRP E 2 106 ? 26.066  -14.702 -87.839  1.00 31.58 ? 106 TRP E CZ3   1 
ATOM   7466  C  CH2   . TRP E 2 106 ? 26.805  -15.722 -87.191  1.00 54.36 ? 106 TRP E CH2   1 
ATOM   7467  N  N     . LEU E 2 107 ? 19.986  -11.658 -86.837  1.00 2.21  ? 107 LEU E N     1 
ATOM   7468  C  CA    . LEU E 2 107 ? 18.884  -10.787 -87.397  1.00 8.78  ? 107 LEU E CA    1 
ATOM   7469  C  C     . LEU E 2 107 ? 18.918  -10.560 -88.909  1.00 2.00  ? 107 LEU E C     1 
ATOM   7470  O  O     . LEU E 2 107 ? 19.936  -10.153 -89.455  1.00 2.00  ? 107 LEU E O     1 
ATOM   7471  C  CB    . LEU E 2 107 ? 18.856  -9.424  -86.748  1.00 3.44  ? 107 LEU E CB    1 
ATOM   7472  C  CG    . LEU E 2 107 ? 17.477  -8.806  -86.689  1.00 2.53  ? 107 LEU E CG    1 
ATOM   7473  C  CD1   . LEU E 2 107 ? 16.585  -9.499  -85.680  1.00 2.00  ? 107 LEU E CD1   1 
ATOM   7474  C  CD2   . LEU E 2 107 ? 17.789  -7.425  -86.172  1.00 12.52 ? 107 LEU E CD2   1 
ATOM   7475  N  N     . GLU E 2 108 ? 17.792  -10.838 -89.548  1.00 2.00  ? 108 GLU E N     1 
ATOM   7476  C  CA    . GLU E 2 108 ? 17.649  -10.662 -90.988  1.00 11.48 ? 108 GLU E CA    1 
ATOM   7477  C  C     . GLU E 2 108 ? 16.830  -9.455  -91.419  1.00 4.24  ? 108 GLU E C     1 
ATOM   7478  O  O     . GLU E 2 108 ? 17.044  -8.970  -92.546  1.00 3.62  ? 108 GLU E O     1 
ATOM   7479  C  CB    . GLU E 2 108 ? 17.110  -11.901 -91.667  1.00 2.00  ? 108 GLU E CB    1 
ATOM   7480  C  CG    . GLU E 2 108 ? 18.164  -12.962 -91.771  1.00 21.47 ? 108 GLU E CG    1 
ATOM   7481  C  CD    . GLU E 2 108 ? 17.596  -14.348 -92.103  1.00 4.69  ? 108 GLU E CD    1 
ATOM   7482  O  OE1   . GLU E 2 108 ? 16.451  -14.393 -92.576  1.00 9.69  ? 108 GLU E OE1   1 
ATOM   7483  O  OE2   . GLU E 2 108 ? 18.283  -15.372 -91.889  1.00 24.58 ? 108 GLU E OE2   1 
ATOM   7484  N  N     . GLU E 2 109 ? 15.885  -9.034  -90.560  1.00 4.22  ? 109 GLU E N     1 
ATOM   7485  C  CA    . GLU E 2 109 ? 14.883  -7.983  -90.870  1.00 6.29  ? 109 GLU E CA    1 
ATOM   7486  C  C     . GLU E 2 109 ? 14.460  -7.068  -89.742  1.00 2.05  ? 109 GLU E C     1 
ATOM   7487  O  O     . GLU E 2 109 ? 14.059  -7.509  -88.647  1.00 2.00  ? 109 GLU E O     1 
ATOM   7488  C  CB    . GLU E 2 109 ? 13.624  -8.539  -91.429  1.00 2.57  ? 109 GLU E CB    1 
ATOM   7489  C  CG    . GLU E 2 109 ? 13.791  -9.547  -92.492  1.00 22.31 ? 109 GLU E CG    1 
ATOM   7490  C  CD    . GLU E 2 109 ? 12.437  -10.135 -92.859  1.00 5.20  ? 109 GLU E CD    1 
ATOM   7491  O  OE1   . GLU E 2 109 ? 11.451  -9.748  -92.220  1.00 8.69  ? 109 GLU E OE1   1 
ATOM   7492  O  OE2   . GLU E 2 109 ? 12.369  -10.984 -93.742  1.00 10.25 ? 109 GLU E OE2   1 
ATOM   7493  N  N     . ILE E 2 110 ? 14.506  -5.776  -90.060  1.00 4.64  ? 110 ILE E N     1 
ATOM   7494  C  CA    . ILE E 2 110 ? 14.001  -4.701  -89.174  1.00 6.51  ? 110 ILE E CA    1 
ATOM   7495  C  C     . ILE E 2 110 ? 12.979  -3.739  -89.854  1.00 3.94  ? 110 ILE E C     1 
ATOM   7496  O  O     . ILE E 2 110 ? 13.323  -3.140  -90.880  1.00 2.00  ? 110 ILE E O     1 
ATOM   7497  C  CB    . ILE E 2 110 ? 15.145  -3.869  -88.735  1.00 2.43  ? 110 ILE E CB    1 
ATOM   7498  C  CG1   . ILE E 2 110 ? 15.950  -4.628  -87.675  1.00 2.31  ? 110 ILE E CG1   1 
ATOM   7499  C  CG2   . ILE E 2 110 ? 14.665  -2.501  -88.310  1.00 2.00  ? 110 ILE E CG2   1 
ATOM   7500  C  CD1   . ILE E 2 110 ? 17.363  -4.157  -87.689  1.00 2.09  ? 110 ILE E CD1   1 
ATOM   7501  N  N     . ARG E 2 111 ? 11.741  -3.623  -89.333  1.00 2.00  ? 111 ARG E N     1 
ATOM   7502  C  CA    . ARG E 2 111 ? 10.836  -2.687  -89.934  1.00 2.00  ? 111 ARG E CA    1 
ATOM   7503  C  C     . ARG E 2 111 ? 10.380  -1.763  -88.853  1.00 7.62  ? 111 ARG E C     1 
ATOM   7504  O  O     . ARG E 2 111 ? 9.828   -2.208  -87.810  1.00 5.32  ? 111 ARG E O     1 
ATOM   7505  C  CB    . ARG E 2 111 ? 9.652   -3.273  -90.728  1.00 3.37  ? 111 ARG E CB    1 
ATOM   7506  C  CG    . ARG E 2 111 ? 9.635   -4.757  -90.996  1.00 10.10 ? 111 ARG E CG    1 
ATOM   7507  C  CD    . ARG E 2 111 ? 8.562   -5.236  -92.020  1.00 17.34 ? 111 ARG E CD    1 
ATOM   7508  N  NE    . ARG E 2 111 ? 9.055   -6.504  -92.482  1.00 12.98 ? 111 ARG E NE    1 
ATOM   7509  C  CZ    . ARG E 2 111 ? 9.140   -6.861  -93.726  1.00 11.84 ? 111 ARG E CZ    1 
ATOM   7510  N  NH1   . ARG E 2 111 ? 8.677   -6.094  -94.698  1.00 12.55 ? 111 ARG E NH1   1 
ATOM   7511  N  NH2   . ARG E 2 111 ? 9.678   -8.015  -93.970  1.00 12.54 ? 111 ARG E NH2   1 
ATOM   7512  N  N     . LEU E 2 112 ? 10.680  -0.477  -89.084  1.00 2.00  ? 112 LEU E N     1 
ATOM   7513  C  CA    . LEU E 2 112 ? 10.399  0.550   -88.140  1.00 2.00  ? 112 LEU E CA    1 
ATOM   7514  C  C     . LEU E 2 112 ? 9.338   1.537   -88.737  1.00 3.25  ? 112 LEU E C     1 
ATOM   7515  O  O     . LEU E 2 112 ? 9.378   1.912   -89.956  1.00 2.00  ? 112 LEU E O     1 
ATOM   7516  C  CB    . LEU E 2 112 ? 11.718  1.229   -87.856  1.00 2.00  ? 112 LEU E CB    1 
ATOM   7517  C  CG    . LEU E 2 112 ? 12.772  0.265   -87.369  1.00 2.00  ? 112 LEU E CG    1 
ATOM   7518  C  CD1   . LEU E 2 112 ? 14.032  1.145   -87.091  1.00 2.00  ? 112 LEU E CD1   1 
ATOM   7519  C  CD2   . LEU E 2 112 ? 12.275  -0.385  -86.076  1.00 2.00  ? 112 LEU E CD2   1 
ATOM   7520  N  N     . LYS E 2 113 ? 8.402   1.929   -87.898  1.00 2.00  ? 113 LYS E N     1 
ATOM   7521  C  CA    . LYS E 2 113 ? 7.476   2.983   -88.240  1.00 2.00  ? 113 LYS E CA    1 
ATOM   7522  C  C     . LYS E 2 113 ? 7.473   4.055   -87.160  1.00 2.00  ? 113 LYS E C     1 
ATOM   7523  O  O     . LYS E 2 113 ? 7.315   3.749   -85.951  1.00 2.00  ? 113 LYS E O     1 
ATOM   7524  C  CB    . LYS E 2 113 ? 6.049   2.466   -88.308  1.00 2.42  ? 113 LYS E CB    1 
ATOM   7525  C  CG    . LYS E 2 113 ? 5.269   2.883   -89.510  1.00 2.00  ? 113 LYS E CG    1 
ATOM   7526  C  CD    . LYS E 2 113 ? 3.791   2.817   -89.274  1.00 2.00  ? 113 LYS E CD    1 
ATOM   7527  C  CE    . LYS E 2 113 ? 3.111   3.365   -90.515  1.00 2.00  ? 113 LYS E CE    1 
ATOM   7528  N  NZ    . LYS E 2 113 ? 1.622   3.341   -90.258  1.00 2.14  ? 113 LYS E NZ    1 
ATOM   7529  N  N     . ARG E 2 114 ? 7.583   5.319   -87.613  1.00 4.50  ? 114 ARG E N     1 
ATOM   7530  C  CA    . ARG E 2 114 ? 7.646   6.511   -86.704  1.00 2.00  ? 114 ARG E CA    1 
ATOM   7531  C  C     . ARG E 2 114 ? 8.584   6.356   -85.534  1.00 2.02  ? 114 ARG E C     1 
ATOM   7532  O  O     . ARG E 2 114 ? 8.179   6.617   -84.364  1.00 5.09  ? 114 ARG E O     1 
ATOM   7533  C  CB    . ARG E 2 114 ? 6.286   6.784   -86.100  1.00 2.00  ? 114 ARG E CB    1 
ATOM   7534  C  CG    . ARG E 2 114 ? 5.334   7.214   -87.201  1.00 5.41  ? 114 ARG E CG    1 
ATOM   7535  C  CD    . ARG E 2 114 ? 3.863   7.535   -86.664  1.00 4.46  ? 114 ARG E CD    1 
ATOM   7536  N  NE    . ARG E 2 114 ? 2.977   7.661   -87.791  1.00 2.66  ? 114 ARG E NE    1 
ATOM   7537  C  CZ    . ARG E 2 114 ? 1.978   6.810   -88.020  1.00 27.56 ? 114 ARG E CZ    1 
ATOM   7538  N  NH1   . ARG E 2 114 ? 1.727   5.797   -87.173  1.00 2.52  ? 114 ARG E NH1   1 
ATOM   7539  N  NH2   . ARG E 2 114 ? 1.214   6.992   -89.085  1.00 8.42  ? 114 ARG E NH2   1 
ATOM   7540  N  N     . MET E 2 115 ? 9.813   5.945   -85.806  1.00 2.00  ? 115 MET E N     1 
ATOM   7541  C  CA    . MET E 2 115 ? 10.841  6.001   -84.764  1.00 2.59  ? 115 MET E CA    1 
ATOM   7542  C  C     . MET E 2 115 ? 11.827  7.030   -85.215  1.00 5.61  ? 115 MET E C     1 
ATOM   7543  O  O     . MET E 2 115 ? 11.998  7.268   -86.464  1.00 2.93  ? 115 MET E O     1 
ATOM   7544  C  CB    . MET E 2 115 ? 11.616  4.668   -84.600  1.00 4.03  ? 115 MET E CB    1 
ATOM   7545  C  CG    . MET E 2 115 ? 10.803  3.374   -84.941  1.00 7.21  ? 115 MET E CG    1 
ATOM   7546  S  SD    . MET E 2 115 ? 10.208  2.743   -83.381  1.00 9.95  ? 115 MET E SD    1 
ATOM   7547  C  CE    . MET E 2 115 ? 11.442  3.422   -82.212  1.00 2.00  ? 115 MET E CE    1 
ATOM   7548  N  N     . VAL E 2 116 ? 12.485  7.620   -84.210  1.00 2.23  ? 116 VAL E N     1 
ATOM   7549  C  CA    . VAL E 2 116 ? 13.720  8.299   -84.463  1.00 3.98  ? 116 VAL E CA    1 
ATOM   7550  C  C     . VAL E 2 116 ? 14.892  7.283   -84.680  1.00 7.90  ? 116 VAL E C     1 
ATOM   7551  O  O     . VAL E 2 116 ? 15.215  6.530   -83.770  1.00 2.00  ? 116 VAL E O     1 
ATOM   7552  C  CB    . VAL E 2 116 ? 14.025  9.211   -83.263  1.00 8.00  ? 116 VAL E CB    1 
ATOM   7553  C  CG1   . VAL E 2 116 ? 15.326  9.975   -83.479  1.00 2.00  ? 116 VAL E CG1   1 
ATOM   7554  C  CG2   . VAL E 2 116 ? 12.888  10.119  -83.012  1.00 2.00  ? 116 VAL E CG2   1 
ATOM   7555  N  N     . VAL E 2 117 ? 15.560  7.355   -85.844  1.00 3.00  ? 117 VAL E N     1 
ATOM   7556  C  CA    . VAL E 2 117 ? 16.599  6.415   -86.263  1.00 2.00  ? 117 VAL E CA    1 
ATOM   7557  C  C     . VAL E 2 117 ? 17.758  7.232   -86.749  1.00 6.34  ? 117 VAL E C     1 
ATOM   7558  O  O     . VAL E 2 117 ? 17.623  8.028   -87.709  1.00 10.13 ? 117 VAL E O     1 
ATOM   7559  C  CB    . VAL E 2 117 ? 16.121  5.697   -87.523  1.00 7.72  ? 117 VAL E CB    1 
ATOM   7560  C  CG1   . VAL E 2 117 ? 17.066  4.693   -88.048  1.00 2.00  ? 117 VAL E CG1   1 
ATOM   7561  C  CG2   . VAL E 2 117 ? 14.725  5.121   -87.361  1.00 6.31  ? 117 VAL E CG2   1 
ATOM   7562  N  N     . THR E 2 118 ? 18.918  6.944   -86.185  1.00 2.00  ? 118 THR E N     1 
ATOM   7563  C  CA    . THR E 2 118 ? 20.082  7.821   -86.116  1.00 2.00  ? 118 THR E CA    1 
ATOM   7564  C  C     . THR E 2 118 ? 21.212  7.239   -86.996  1.00 5.62  ? 118 THR E C     1 
ATOM   7565  O  O     . THR E 2 118 ? 21.209  6.025   -87.258  1.00 6.40  ? 118 THR E O     1 
ATOM   7566  C  CB    . THR E 2 118 ? 20.515  7.677   -84.699  1.00 2.00  ? 118 THR E CB    1 
ATOM   7567  O  OG1   . THR E 2 118 ? 19.953  8.742   -83.895  1.00 9.54  ? 118 THR E OG1   1 
ATOM   7568  C  CG2   . THR E 2 118 ? 21.950  7.385   -84.560  1.00 2.00  ? 118 THR E CG2   1 
ATOM   7569  N  N     . ASP E 2 119 ? 22.171  8.036   -87.474  1.00 2.00  ? 119 ASP E N     1 
ATOM   7570  C  CA    . ASP E 2 119 ? 23.211  7.396   -88.226  1.00 5.73  ? 119 ASP E CA    1 
ATOM   7571  C  C     . ASP E 2 119 ? 23.897  6.337   -87.380  1.00 2.39  ? 119 ASP E C     1 
ATOM   7572  O  O     . ASP E 2 119 ? 24.175  5.211   -87.796  1.00 2.55  ? 119 ASP E O     1 
ATOM   7573  C  CB    . ASP E 2 119 ? 24.196  8.402   -88.828  1.00 6.26  ? 119 ASP E CB    1 
ATOM   7574  C  CG    . ASP E 2 119 ? 23.592  9.130   -90.025  1.00 10.17 ? 119 ASP E CG    1 
ATOM   7575  O  OD1   . ASP E 2 119 ? 24.291  9.722   -90.828  1.00 4.77  ? 119 ASP E OD1   1 
ATOM   7576  O  OD2   . ASP E 2 119 ? 22.380  9.100   -90.198  1.00 12.46 ? 119 ASP E OD2   1 
ATOM   7577  N  N     . ASP E 2 120 ? 24.135  6.687   -86.146  1.00 2.29  ? 120 ASP E N     1 
ATOM   7578  C  CA    . ASP E 2 120 ? 24.581  5.683   -85.218  1.00 2.44  ? 120 ASP E CA    1 
ATOM   7579  C  C     . ASP E 2 120 ? 23.863  4.349   -85.290  1.00 4.62  ? 120 ASP E C     1 
ATOM   7580  O  O     . ASP E 2 120 ? 24.538  3.359   -85.511  1.00 11.91 ? 120 ASP E O     1 
ATOM   7581  C  CB    . ASP E 2 120 ? 24.611  6.231   -83.817  1.00 13.11 ? 120 ASP E CB    1 
ATOM   7582  C  CG    . ASP E 2 120 ? 25.893  6.898   -83.534  1.00 2.03  ? 120 ASP E CG    1 
ATOM   7583  O  OD1   . ASP E 2 120 ? 26.751  6.753   -84.415  1.00 11.53 ? 120 ASP E OD1   1 
ATOM   7584  O  OD2   . ASP E 2 120 ? 26.050  7.535   -82.459  1.00 24.27 ? 120 ASP E OD2   1 
ATOM   7585  N  N     . CYS E 2 121 ? 22.530  4.299   -85.114  1.00 5.14  ? 121 CYS E N     1 
ATOM   7586  C  CA    . CYS E 2 121 ? 21.720  3.026   -85.302  1.00 2.00  ? 121 CYS E CA    1 
ATOM   7587  C  C     . CYS E 2 121 ? 22.148  2.261   -86.589  1.00 9.11  ? 121 CYS E C     1 
ATOM   7588  O  O     . CYS E 2 121 ? 22.228  1.020   -86.662  1.00 2.00  ? 121 CYS E O     1 
ATOM   7589  C  CB    . CYS E 2 121 ? 20.274  3.418   -85.500  1.00 2.00  ? 121 CYS E CB    1 
ATOM   7590  S  SG    . CYS E 2 121 ? 19.597  4.312   -84.102  1.00 6.22  ? 121 CYS E SG    1 
ATOM   7591  N  N     . LEU E 2 122 ? 22.409  3.022   -87.631  1.00 5.23  ? 122 LEU E N     1 
ATOM   7592  C  CA    . LEU E 2 122 ? 22.486  2.406   -88.907  1.00 6.30  ? 122 LEU E CA    1 
ATOM   7593  C  C     . LEU E 2 122 ? 23.863  1.765   -89.034  1.00 11.62 ? 122 LEU E C     1 
ATOM   7594  O  O     . LEU E 2 122 ? 23.993  0.632   -89.566  1.00 6.14  ? 122 LEU E O     1 
ATOM   7595  C  CB    . LEU E 2 122 ? 22.190  3.434   -90.013  1.00 8.61  ? 122 LEU E CB    1 
ATOM   7596  C  CG    . LEU E 2 122 ? 20.688  3.854   -90.074  1.00 15.95 ? 122 LEU E CG    1 
ATOM   7597  C  CD1   . LEU E 2 122 ? 20.485  5.109   -90.906  1.00 3.70  ? 122 LEU E CD1   1 
ATOM   7598  C  CD2   . LEU E 2 122 ? 19.815  2.747   -90.709  1.00 2.00  ? 122 LEU E CD2   1 
ATOM   7599  N  N     . GLU E 2 123 ? 24.888  2.470   -88.543  1.00 6.43  ? 123 GLU E N     1 
ATOM   7600  C  CA    . GLU E 2 123 ? 26.251  1.911   -88.575  1.00 9.49  ? 123 GLU E CA    1 
ATOM   7601  C  C     . GLU E 2 123 ? 26.291  0.627   -87.766  1.00 5.69  ? 123 GLU E C     1 
ATOM   7602  O  O     . GLU E 2 123 ? 26.861  -0.355  -88.215  1.00 8.61  ? 123 GLU E O     1 
ATOM   7603  C  CB    . GLU E 2 123 ? 27.279  2.879   -87.998  1.00 2.00  ? 123 GLU E CB    1 
ATOM   7604  C  CG    . GLU E 2 123 ? 27.989  3.743   -89.048  1.00 26.42 ? 123 GLU E CG    1 
ATOM   7605  C  CD    . GLU E 2 123 ? 27.913  5.259   -88.737  1.00 46.21 ? 123 GLU E CD    1 
ATOM   7606  O  OE1   . GLU E 2 123 ? 28.310  6.068   -89.611  1.00 27.06 ? 123 GLU E OE1   1 
ATOM   7607  O  OE2   . GLU E 2 123 ? 27.442  5.654   -87.635  1.00 50.92 ? 123 GLU E OE2   1 
ATOM   7608  N  N     . LEU E 2 124 ? 25.698  0.683   -86.560  1.00 8.82  ? 124 LEU E N     1 
ATOM   7609  C  CA    . LEU E 2 124 ? 25.480  -0.459  -85.648  1.00 5.01  ? 124 LEU E CA    1 
ATOM   7610  C  C     . LEU E 2 124 ? 24.736  -1.640  -86.316  1.00 8.87  ? 124 LEU E C     1 
ATOM   7611  O  O     . LEU E 2 124 ? 25.102  -2.808  -86.109  1.00 15.37 ? 124 LEU E O     1 
ATOM   7612  C  CB    . LEU E 2 124 ? 24.823  -0.051  -84.283  1.00 2.00  ? 124 LEU E CB    1 
ATOM   7613  C  CG    . LEU E 2 124 ? 24.923  -1.115  -83.177  1.00 2.00  ? 124 LEU E CG    1 
ATOM   7614  C  CD1   . LEU E 2 124 ? 26.400  -1.473  -82.765  1.00 2.00  ? 124 LEU E CD1   1 
ATOM   7615  C  CD2   . LEU E 2 124 ? 24.222  -0.585  -81.953  1.00 2.00  ? 124 LEU E CD2   1 
ATOM   7616  N  N     . ILE E 2 125 ? 23.689  -1.357  -87.086  1.00 8.18  ? 125 ILE E N     1 
ATOM   7617  C  CA    . ILE E 2 125 ? 23.031  -2.428  -87.806  1.00 7.69  ? 125 ILE E CA    1 
ATOM   7618  C  C     . ILE E 2 125 ? 24.064  -3.036  -88.686  1.00 12.00 ? 125 ILE E C     1 
ATOM   7619  O  O     . ILE E 2 125 ? 24.167  -4.271  -88.791  1.00 12.24 ? 125 ILE E O     1 
ATOM   7620  C  CB    . ILE E 2 125 ? 21.879  -1.909  -88.727  1.00 9.42  ? 125 ILE E CB    1 
ATOM   7621  C  CG1   . ILE E 2 125 ? 20.781  -1.228  -87.880  1.00 21.11 ? 125 ILE E CG1   1 
ATOM   7622  C  CG2   . ILE E 2 125 ? 21.188  -3.075  -89.467  1.00 8.42  ? 125 ILE E CG2   1 
ATOM   7623  C  CD1   . ILE E 2 125 ? 19.616  -2.096  -87.534  1.00 45.02 ? 125 ILE E CD1   1 
ATOM   7624  N  N     . ALA E 2 126 ? 24.804  -2.155  -89.354  1.00 3.47  ? 126 ALA E N     1 
ATOM   7625  C  CA    . ALA E 2 126 ? 25.434  -2.543  -90.566  1.00 2.27  ? 126 ALA E CA    1 
ATOM   7626  C  C     . ALA E 2 126 ? 26.481  -3.468  -89.991  1.00 12.36 ? 126 ALA E C     1 
ATOM   7627  O  O     . ALA E 2 126 ? 26.655  -4.593  -90.459  1.00 5.61  ? 126 ALA E O     1 
ATOM   7628  C  CB    . ALA E 2 126 ? 26.075  -1.329  -91.285  1.00 2.24  ? 126 ALA E CB    1 
ATOM   7629  N  N     . LYS E 2 127 ? 27.129  -3.025  -88.918  1.00 10.61 ? 127 LYS E N     1 
ATOM   7630  C  CA    . LYS E 2 127 ? 28.297  -3.745  -88.465  1.00 15.29 ? 127 LYS E CA    1 
ATOM   7631  C  C     . LYS E 2 127 ? 27.970  -4.870  -87.474  1.00 11.05 ? 127 LYS E C     1 
ATOM   7632  O  O     . LYS E 2 127 ? 28.886  -5.543  -86.999  1.00 7.52  ? 127 LYS E O     1 
ATOM   7633  C  CB    . LYS E 2 127 ? 29.362  -2.810  -87.884  1.00 9.72  ? 127 LYS E CB    1 
ATOM   7634  C  CG    . LYS E 2 127 ? 29.763  -3.267  -86.471  1.00 24.04 ? 127 LYS E CG    1 
ATOM   7635  C  CD    . LYS E 2 127 ? 30.612  -2.260  -85.675  1.00 30.77 ? 127 LYS E CD    1 
ATOM   7636  C  CE    . LYS E 2 127 ? 32.129  -2.630  -85.669  1.00 35.87 ? 127 LYS E CE    1 
ATOM   7637  N  NZ    . LYS E 2 127 ? 32.664  -2.625  -84.284  1.00 11.12 ? 127 LYS E NZ    1 
ATOM   7638  N  N     . SER E 2 128 ? 26.698  -5.074  -87.137  1.00 4.09  ? 128 SER E N     1 
ATOM   7639  C  CA    . SER E 2 128 ? 26.322  -6.098  -86.107  1.00 7.58  ? 128 SER E CA    1 
ATOM   7640  C  C     . SER E 2 128 ? 25.661  -7.359  -86.687  1.00 5.55  ? 128 SER E C     1 
ATOM   7641  O  O     . SER E 2 128 ? 25.814  -8.446  -86.129  1.00 15.48 ? 128 SER E O     1 
ATOM   7642  C  CB    . SER E 2 128 ? 25.390  -5.532  -84.997  1.00 2.04  ? 128 SER E CB    1 
ATOM   7643  O  OG    . SER E 2 128 ? 25.900  -4.402  -84.277  1.00 8.54  ? 128 SER E OG    1 
ATOM   7644  N  N     . PHE E 2 129 ? 24.900  -7.204  -87.777  1.00 8.85  ? 129 PHE E N     1 
ATOM   7645  C  CA    . PHE E 2 129 ? 24.223  -8.315  -88.458  1.00 4.10  ? 129 PHE E CA    1 
ATOM   7646  C  C     . PHE E 2 129 ? 24.764  -8.654  -89.842  1.00 12.89 ? 129 PHE E C     1 
ATOM   7647  O  O     . PHE E 2 129 ? 24.521  -7.906  -90.817  1.00 15.67 ? 129 PHE E O     1 
ATOM   7648  C  CB    . PHE E 2 129 ? 22.739  -7.989  -88.629  1.00 5.73  ? 129 PHE E CB    1 
ATOM   7649  C  CG    . PHE E 2 129 ? 22.108  -7.375  -87.409  1.00 5.78  ? 129 PHE E CG    1 
ATOM   7650  C  CD1   . PHE E 2 129 ? 21.599  -6.096  -87.443  1.00 12.82 ? 129 PHE E CD1   1 
ATOM   7651  C  CD2   . PHE E 2 129 ? 22.029  -8.065  -86.245  1.00 7.12  ? 129 PHE E CD2   1 
ATOM   7652  C  CE1   . PHE E 2 129 ? 21.032  -5.559  -86.348  1.00 3.82  ? 129 PHE E CE1   1 
ATOM   7653  C  CE2   . PHE E 2 129 ? 21.500  -7.517  -85.168  1.00 2.00  ? 129 PHE E CE2   1 
ATOM   7654  C  CZ    . PHE E 2 129 ? 21.013  -6.265  -85.205  1.00 15.96 ? 129 PHE E CZ    1 
ATOM   7655  N  N     . LYS E 2 130 ? 25.455  -9.778  -89.988  1.00 5.14  ? 130 LYS E N     1 
ATOM   7656  C  CA    . LYS E 2 130 ? 26.160  -9.934  -91.250  1.00 4.74  ? 130 LYS E CA    1 
ATOM   7657  C  C     . LYS E 2 130 ? 25.188  -10.432 -92.306  1.00 15.74 ? 130 LYS E C     1 
ATOM   7658  O  O     . LYS E 2 130 ? 25.374  -10.272 -93.543  1.00 2.00  ? 130 LYS E O     1 
ATOM   7659  C  CB    . LYS E 2 130 ? 27.377  -10.829 -91.131  1.00 2.14  ? 130 LYS E CB    1 
ATOM   7660  C  CG    . LYS E 2 130 ? 28.298  -10.730 -92.377  1.00 4.27  ? 130 LYS E CG    1 
ATOM   7661  C  CD    . LYS E 2 130 ? 29.749  -10.752 -91.938  1.00 59.40 ? 130 LYS E CD    1 
ATOM   7662  C  CE    . LYS E 2 130 ? 30.069  -12.028 -91.124  1.00 30.28 ? 130 LYS E CE    1 
ATOM   7663  N  NZ    . LYS E 2 130 ? 30.528  -13.084 -92.066  1.00 8.81  ? 130 LYS E NZ    1 
ATOM   7664  N  N     . ASN E 2 131 ? 24.131  -11.013 -91.767  1.00 10.04 ? 131 ASN E N     1 
ATOM   7665  C  CA    . ASN E 2 131 ? 23.075  -11.565 -92.538  1.00 9.80  ? 131 ASN E CA    1 
ATOM   7666  C  C     . ASN E 2 131 ? 21.822  -10.669 -92.694  1.00 7.07  ? 131 ASN E C     1 
ATOM   7667  O  O     . ASN E 2 131 ? 20.752  -11.099 -93.121  1.00 2.05  ? 131 ASN E O     1 
ATOM   7668  C  CB    . ASN E 2 131 ? 22.676  -12.825 -91.842  1.00 15.87 ? 131 ASN E CB    1 
ATOM   7669  C  CG    . ASN E 2 131 ? 22.291  -13.884 -92.800  1.00 31.64 ? 131 ASN E CG    1 
ATOM   7670  O  OD1   . ASN E 2 131 ? 23.130  -14.397 -93.578  1.00 11.67 ? 131 ASN E OD1   1 
ATOM   7671  N  ND2   . ASN E 2 131 ? 21.003  -14.225 -92.781  1.00 18.72 ? 131 ASN E ND2   1 
ATOM   7672  N  N     . PHE E 2 132 ? 21.958  -9.409  -92.379  1.00 2.00  ? 132 PHE E N     1 
ATOM   7673  C  CA    . PHE E 2 132 ? 20.896  -8.477  -92.667  1.00 2.00  ? 132 PHE E CA    1 
ATOM   7674  C  C     . PHE E 2 132 ? 20.234  -8.437  -94.090  1.00 2.00  ? 132 PHE E C     1 
ATOM   7675  O  O     . PHE E 2 132 ? 20.863  -8.468  -95.163  1.00 2.00  ? 132 PHE E O     1 
ATOM   7676  C  CB    . PHE E 2 132 ? 21.397  -7.140  -92.331  1.00 2.00  ? 132 PHE E CB    1 
ATOM   7677  C  CG    . PHE E 2 132 ? 20.347  -6.205  -92.080  1.00 2.01  ? 132 PHE E CG    1 
ATOM   7678  C  CD1   . PHE E 2 132 ? 19.340  -6.527  -91.216  1.00 2.00  ? 132 PHE E CD1   1 
ATOM   7679  C  CD2   . PHE E 2 132 ? 20.308  -4.986  -92.750  1.00 8.04  ? 132 PHE E CD2   1 
ATOM   7680  C  CE1   . PHE E 2 132 ? 18.376  -5.669  -90.996  1.00 2.10  ? 132 PHE E CE1   1 
ATOM   7681  C  CE2   . PHE E 2 132 ? 19.332  -4.143  -92.524  1.00 2.00  ? 132 PHE E CE2   1 
ATOM   7682  C  CZ    . PHE E 2 132 ? 18.364  -4.476  -91.649  1.00 5.42  ? 132 PHE E CZ    1 
ATOM   7683  N  N     . LYS E 2 133 ? 18.922  -8.371  -94.065  1.00 2.00  ? 133 LYS E N     1 
ATOM   7684  C  CA    . LYS E 2 133 ? 18.206  -8.665  -95.249  1.00 6.14  ? 133 LYS E CA    1 
ATOM   7685  C  C     . LYS E 2 133 ? 17.219  -7.577  -95.693  1.00 4.65  ? 133 LYS E C     1 
ATOM   7686  O  O     . LYS E 2 133 ? 17.197  -7.191  -96.867  1.00 4.67  ? 133 LYS E O     1 
ATOM   7687  C  CB    . LYS E 2 133 ? 17.618  -10.049 -95.185  1.00 2.00  ? 133 LYS E CB    1 
ATOM   7688  C  CG    . LYS E 2 133 ? 18.451  -10.945 -96.060  1.00 5.46  ? 133 LYS E CG    1 
ATOM   7689  C  CD    . LYS E 2 133 ? 17.942  -12.318 -96.038  1.00 7.59  ? 133 LYS E CD    1 
ATOM   7690  C  CE    . LYS E 2 133 ? 19.080  -13.271 -96.297  1.00 15.63 ? 133 LYS E CE    1 
ATOM   7691  N  NZ    . LYS E 2 133 ? 18.592  -14.670 -96.210  1.00 2.00  ? 133 LYS E NZ    1 
ATOM   7692  N  N     . VAL E 2 134 ? 16.492  -7.047  -94.726  1.00 2.00  ? 134 VAL E N     1 
ATOM   7693  C  CA    . VAL E 2 134 ? 15.381  -6.170  -94.971  1.00 4.34  ? 134 VAL E CA    1 
ATOM   7694  C  C     . VAL E 2 134 ? 15.465  -5.032  -93.938  1.00 7.93  ? 134 VAL E C     1 
ATOM   7695  O  O     . VAL E 2 134 ? 15.377  -5.269  -92.693  1.00 2.00  ? 134 VAL E O     1 
ATOM   7696  C  CB    . VAL E 2 134 ? 14.008  -6.928  -94.877  1.00 11.56 ? 134 VAL E CB    1 
ATOM   7697  C  CG1   . VAL E 2 134 ? 12.852  -5.943  -94.678  1.00 2.00  ? 134 VAL E CG1   1 
ATOM   7698  C  CG2   . VAL E 2 134 ? 13.791  -7.875  -96.104  1.00 2.00  ? 134 VAL E CG2   1 
ATOM   7699  N  N     . LEU E 2 135 ? 15.665  -3.815  -94.481  1.00 2.00  ? 135 LEU E N     1 
ATOM   7700  C  CA    . LEU E 2 135 ? 15.437  -2.524  -93.727  1.00 5.77  ? 135 LEU E CA    1 
ATOM   7701  C  C     . LEU E 2 135 ? 14.272  -1.712  -94.353  1.00 6.76  ? 135 LEU E C     1 
ATOM   7702  O  O     . LEU E 2 135 ? 14.351  -1.234  -95.523  1.00 2.90  ? 135 LEU E O     1 
ATOM   7703  C  CB    . LEU E 2 135 ? 16.701  -1.648  -93.780  1.00 3.06  ? 135 LEU E CB    1 
ATOM   7704  C  CG    . LEU E 2 135 ? 16.705  -0.341  -92.999  1.00 2.48  ? 135 LEU E CG    1 
ATOM   7705  C  CD1   . LEU E 2 135 ? 16.290  -0.818  -91.624  1.00 5.65  ? 135 LEU E CD1   1 
ATOM   7706  C  CD2   . LEU E 2 135 ? 18.098  0.276   -92.987  1.00 2.00  ? 135 LEU E CD2   1 
ATOM   7707  N  N     . VAL E 2 136 ? 13.188  -1.618  -93.595  1.00 2.00  ? 136 VAL E N     1 
ATOM   7708  C  CA    . VAL E 2 136 ? 12.030  -0.819  -93.934  1.00 6.24  ? 136 VAL E CA    1 
ATOM   7709  C  C     . VAL E 2 136 ? 11.950  0.305   -92.893  1.00 2.00  ? 136 VAL E C     1 
ATOM   7710  O  O     . VAL E 2 136 ? 11.739  0.061   -91.702  1.00 4.02  ? 136 VAL E O     1 
ATOM   7711  C  CB    . VAL E 2 136 ? 10.697  -1.666  -93.979  1.00 11.57 ? 136 VAL E CB    1 
ATOM   7712  C  CG1   . VAL E 2 136 ? 9.468   -0.769  -93.998  1.00 2.00  ? 136 VAL E CG1   1 
ATOM   7713  C  CG2   . VAL E 2 136 ? 10.706  -2.559  -95.199  1.00 6.21  ? 136 VAL E CG2   1 
ATOM   7714  N  N     . LEU E 2 137 ? 12.140  1.527   -93.373  1.00 2.00  ? 137 LEU E N     1 
ATOM   7715  C  CA    . LEU E 2 137 ? 12.068  2.763   -92.562  1.00 8.64  ? 137 LEU E CA    1 
ATOM   7716  C  C     . LEU E 2 137 ? 10.868  3.602   -93.046  1.00 7.48  ? 137 LEU E C     1 
ATOM   7717  O  O     . LEU E 2 137 ? 10.840  4.173   -94.177  1.00 2.41  ? 137 LEU E O     1 
ATOM   7718  C  CB    . LEU E 2 137 ? 13.368  3.561   -92.654  1.00 2.00  ? 137 LEU E CB    1 
ATOM   7719  C  CG    . LEU E 2 137 ? 14.651  2.905   -92.056  1.00 6.18  ? 137 LEU E CG    1 
ATOM   7720  C  CD1   . LEU E 2 137 ? 15.818  3.905   -92.242  1.00 2.00  ? 137 LEU E CD1   1 
ATOM   7721  C  CD2   . LEU E 2 137 ? 14.469  2.593   -90.570  1.00 2.00  ? 137 LEU E CD2   1 
ATOM   7722  N  N     . SER E 2 138 ? 9.836   3.610   -92.226  1.00 2.00  ? 138 SER E N     1 
ATOM   7723  C  CA    . SER E 2 138 ? 8.576   4.072   -92.736  1.00 3.10  ? 138 SER E CA    1 
ATOM   7724  C  C     . SER E 2 138 ? 8.247   5.254   -91.831  1.00 2.00  ? 138 SER E C     1 
ATOM   7725  O  O     . SER E 2 138 ? 8.136   5.091   -90.665  1.00 2.00  ? 138 SER E O     1 
ATOM   7726  C  CB    . SER E 2 138 ? 7.559   2.897   -92.695  1.00 2.60  ? 138 SER E CB    1 
ATOM   7727  O  OG    . SER E 2 138 ? 6.195   3.279   -92.791  1.00 9.00  ? 138 SER E OG    1 
ATOM   7728  N  N     . SER E 2 139 ? 8.180   6.465   -92.405  1.00 2.00  ? 139 SER E N     1 
ATOM   7729  C  CA    . SER E 2 139 ? 7.929   7.694   -91.565  1.00 2.26  ? 139 SER E CA    1 
ATOM   7730  C  C     . SER E 2 139 ? 8.851   7.773   -90.400  1.00 2.00  ? 139 SER E C     1 
ATOM   7731  O  O     . SER E 2 139 ? 8.406   7.913   -89.291  1.00 2.00  ? 139 SER E O     1 
ATOM   7732  C  CB    . SER E 2 139 ? 6.518   7.724   -91.008  1.00 2.00  ? 139 SER E CB    1 
ATOM   7733  O  OG    . SER E 2 139 ? 5.693   7.780   -92.122  1.00 11.22 ? 139 SER E OG    1 
ATOM   7734  N  N     . CYS E 2 140 ? 10.123  7.645   -90.665  1.00 2.00  ? 140 CYS E N     1 
ATOM   7735  C  CA    . CYS E 2 140 ? 11.104  7.767   -89.629  1.00 2.00  ? 140 CYS E CA    1 
ATOM   7736  C  C     . CYS E 2 140 ? 11.844  9.091   -89.890  1.00 7.10  ? 140 CYS E C     1 
ATOM   7737  O  O     . CYS E 2 140 ? 11.901  9.601   -91.032  1.00 3.22  ? 140 CYS E O     1 
ATOM   7738  C  CB    . CYS E 2 140 ? 12.067  6.555   -89.718  1.00 3.46  ? 140 CYS E CB    1 
ATOM   7739  S  SG    . CYS E 2 140 ? 11.303  4.931   -89.182  1.00 4.88  ? 140 CYS E SG    1 
ATOM   7740  N  N     . GLU E 2 141 ? 12.458  9.612   -88.845  1.00 2.22  ? 141 GLU E N     1 
ATOM   7741  C  CA    . GLU E 2 141 ? 13.368  10.683  -88.982  1.00 2.57  ? 141 GLU E CA    1 
ATOM   7742  C  C     . GLU E 2 141 ? 14.623  10.467  -88.185  1.00 6.94  ? 141 GLU E C     1 
ATOM   7743  O  O     . GLU E 2 141 ? 14.610  9.732   -87.182  1.00 12.13 ? 141 GLU E O     1 
ATOM   7744  C  CB    . GLU E 2 141 ? 12.696  11.871  -88.398  1.00 3.83  ? 141 GLU E CB    1 
ATOM   7745  C  CG    . GLU E 2 141 ? 12.040  11.569  -87.133  1.00 8.19  ? 141 GLU E CG    1 
ATOM   7746  C  CD    . GLU E 2 141 ? 11.777  12.858  -86.356  1.00 25.55 ? 141 GLU E CD    1 
ATOM   7747  O  OE1   . GLU E 2 141 ? 12.703  13.714  -86.270  1.00 45.43 ? 141 GLU E OE1   1 
ATOM   7748  O  OE2   . GLU E 2 141 ? 10.655  13.000  -85.836  1.00 17.20 ? 141 GLU E OE2   1 
ATOM   7749  N  N     . GLY E 2 142 ? 15.687  11.152  -88.579  1.00 2.00  ? 142 GLY E N     1 
ATOM   7750  C  CA    . GLY E 2 142 ? 16.721  11.452  -87.640  1.00 2.00  ? 142 GLY E CA    1 
ATOM   7751  C  C     . GLY E 2 142 ? 18.031  10.948  -88.193  1.00 8.13  ? 142 GLY E C     1 
ATOM   7752  O  O     . GLY E 2 142 ? 19.065  10.919  -87.531  1.00 12.85 ? 142 GLY E O     1 
ATOM   7753  N  N     . PHE E 2 143 ? 18.006  10.549  -89.436  1.00 5.16  ? 143 PHE E N     1 
ATOM   7754  C  CA    . PHE E 2 143 ? 19.210  10.016  -89.954  1.00 5.19  ? 143 PHE E CA    1 
ATOM   7755  C  C     . PHE E 2 143 ? 19.539  10.702  -91.240  1.00 4.18  ? 143 PHE E C     1 
ATOM   7756  O  O     . PHE E 2 143 ? 18.910  11.701  -91.618  1.00 9.21  ? 143 PHE E O     1 
ATOM   7757  C  CB    . PHE E 2 143 ? 19.058  8.516   -90.179  1.00 3.71  ? 143 PHE E CB    1 
ATOM   7758  C  CG    . PHE E 2 143 ? 17.903  8.136   -91.095  1.00 9.82  ? 143 PHE E CG    1 
ATOM   7759  C  CD1   . PHE E 2 143 ? 18.153  7.756   -92.433  1.00 7.35  ? 143 PHE E CD1   1 
ATOM   7760  C  CD2   . PHE E 2 143 ? 16.602  8.094   -90.614  1.00 2.00  ? 143 PHE E CD2   1 
ATOM   7761  C  CE1   . PHE E 2 143 ? 17.140  7.405   -93.281  1.00 2.00  ? 143 PHE E CE1   1 
ATOM   7762  C  CE2   . PHE E 2 143 ? 15.572  7.733   -91.441  1.00 2.00  ? 143 PHE E CE2   1 
ATOM   7763  C  CZ    . PHE E 2 143 ? 15.847  7.387   -92.780  1.00 7.63  ? 143 PHE E CZ    1 
ATOM   7764  N  N     . SER E 2 144 ? 20.547  10.202  -91.942  1.00 9.32  ? 144 SER E N     1 
ATOM   7765  C  CA    . SER E 2 144 ? 21.057  11.018  -93.003  1.00 6.94  ? 144 SER E CA    1 
ATOM   7766  C  C     . SER E 2 144 ? 21.641  10.106  -94.030  1.00 2.00  ? 144 SER E C     1 
ATOM   7767  O  O     . SER E 2 144 ? 21.829  8.944   -93.774  1.00 6.10  ? 144 SER E O     1 
ATOM   7768  C  CB    . SER E 2 144 ? 22.091  11.993  -92.453  1.00 2.00  ? 144 SER E CB    1 
ATOM   7769  O  OG    . SER E 2 144 ? 23.393  11.495  -92.673  1.00 5.52  ? 144 SER E OG    1 
ATOM   7770  N  N     . THR E 2 145 ? 21.970  10.652  -95.190  1.00 2.33  ? 145 THR E N     1 
ATOM   7771  C  CA    . THR E 2 145 ? 22.574  9.877   -96.223  1.00 2.00  ? 145 THR E CA    1 
ATOM   7772  C  C     . THR E 2 145 ? 23.898  9.298   -95.773  1.00 9.34  ? 145 THR E C     1 
ATOM   7773  O  O     . THR E 2 145 ? 24.443  8.415   -96.446  1.00 12.55 ? 145 THR E O     1 
ATOM   7774  C  CB    . THR E 2 145 ? 22.807  10.734  -97.535  1.00 3.89  ? 145 THR E CB    1 
ATOM   7775  O  OG1   . THR E 2 145 ? 23.717  11.818  -97.275  1.00 20.09 ? 145 THR E OG1   1 
ATOM   7776  C  CG2   . THR E 2 145 ? 21.459  11.275  -98.168  1.00 9.33  ? 145 THR E CG2   1 
ATOM   7777  N  N     . ASP E 2 146 ? 24.486  9.807   -94.693  1.00 4.64  ? 146 ASP E N     1 
ATOM   7778  C  CA    . ASP E 2 146 ? 25.704  9.111   -94.222  1.00 14.30 ? 146 ASP E CA    1 
ATOM   7779  C  C     . ASP E 2 146 ? 25.435  7.682   -93.763  1.00 10.38 ? 146 ASP E C     1 
ATOM   7780  O  O     . ASP E 2 146 ? 26.186  6.741   -94.072  1.00 2.08  ? 146 ASP E O     1 
ATOM   7781  C  CB    . ASP E 2 146 ? 26.454  9.923   -93.178  1.00 14.27 ? 146 ASP E CB    1 
ATOM   7782  C  CG    . ASP E 2 146 ? 27.224  11.084  -93.811  1.00 21.22 ? 146 ASP E CG    1 
ATOM   7783  O  OD1   . ASP E 2 146 ? 27.324  11.103  -95.069  1.00 5.39  ? 146 ASP E OD1   1 
ATOM   7784  O  OD2   . ASP E 2 146 ? 27.724  11.958  -93.049  1.00 36.66 ? 146 ASP E OD2   1 
ATOM   7785  N  N     . GLY E 2 147 ? 24.308  7.546   -93.074  1.00 3.02  ? 147 GLY E N     1 
ATOM   7786  C  CA    . GLY E 2 147 ? 23.851  6.270   -92.586  1.00 13.83 ? 147 GLY E CA    1 
ATOM   7787  C  C     . GLY E 2 147 ? 23.523  5.288   -93.691  1.00 6.72  ? 147 GLY E C     1 
ATOM   7788  O  O     . GLY E 2 147 ? 24.000  4.164   -93.688  1.00 4.58  ? 147 GLY E O     1 
ATOM   7789  N  N     . LEU E 2 148 ? 22.721  5.697   -94.645  1.00 2.00  ? 148 LEU E N     1 
ATOM   7790  C  CA    . LEU E 2 148 ? 22.623  4.864   -95.771  1.00 2.03  ? 148 LEU E CA    1 
ATOM   7791  C  C     . LEU E 2 148 ? 23.977  4.537   -96.427  1.00 2.00  ? 148 LEU E C     1 
ATOM   7792  O  O     . LEU E 2 148 ? 24.188  3.378   -96.731  1.00 4.75  ? 148 LEU E O     1 
ATOM   7793  C  CB    . LEU E 2 148 ? 21.681  5.461   -96.794  1.00 2.00  ? 148 LEU E CB    1 
ATOM   7794  C  CG    . LEU E 2 148 ? 20.461  6.101   -96.218  1.00 2.00  ? 148 LEU E CG    1 
ATOM   7795  C  CD1   . LEU E 2 148 ? 19.894  6.832   -97.380  1.00 12.03 ? 148 LEU E CD1   1 
ATOM   7796  C  CD2   . LEU E 2 148 ? 19.420  5.109   -95.590  1.00 2.00  ? 148 LEU E CD2   1 
ATOM   7797  N  N     . ALA E 2 149 ? 24.897  5.484   -96.636  1.00 2.00  ? 149 ALA E N     1 
ATOM   7798  C  CA    . ALA E 2 149 ? 26.277  5.093   -97.125  1.00 2.61  ? 149 ALA E CA    1 
ATOM   7799  C  C     . ALA E 2 149 ? 26.742  3.816   -96.444  1.00 2.17  ? 149 ALA E C     1 
ATOM   7800  O  O     . ALA E 2 149 ? 27.264  2.913   -97.091  1.00 2.12  ? 149 ALA E O     1 
ATOM   7801  C  CB    . ALA E 2 149 ? 27.319  6.179   -96.895  1.00 2.00  ? 149 ALA E CB    1 
ATOM   7802  N  N     . ALA E 2 150 ? 26.512  3.746   -95.142  1.00 2.00  ? 150 ALA E N     1 
ATOM   7803  C  CA    . ALA E 2 150 ? 27.036  2.688   -94.301  1.00 3.16  ? 150 ALA E CA    1 
ATOM   7804  C  C     . ALA E 2 150 ? 26.348  1.364   -94.547  1.00 2.00  ? 150 ALA E C     1 
ATOM   7805  O  O     . ALA E 2 150 ? 26.984  0.351   -94.765  1.00 11.73 ? 150 ALA E O     1 
ATOM   7806  C  CB    . ALA E 2 150 ? 26.908  3.076   -92.862  1.00 2.00  ? 150 ALA E CB    1 
ATOM   7807  N  N     . ILE E 2 151 ? 25.033  1.386   -94.506  1.00 2.00  ? 151 ILE E N     1 
ATOM   7808  C  CA    . ILE E 2 151 ? 24.244  0.287   -95.006  1.00 2.47  ? 151 ILE E CA    1 
ATOM   7809  C  C     . ILE E 2 151 ? 24.651  -0.250  -96.366  1.00 2.00  ? 151 ILE E C     1 
ATOM   7810  O  O     . ILE E 2 151 ? 24.805  -1.450  -96.528  1.00 2.00  ? 151 ILE E O     1 
ATOM   7811  C  CB    . ILE E 2 151 ? 22.770  0.633   -94.984  1.00 4.93  ? 151 ILE E CB    1 
ATOM   7812  C  CG1   . ILE E 2 151 ? 22.344  0.915   -93.552  1.00 2.00  ? 151 ILE E CG1   1 
ATOM   7813  C  CG2   . ILE E 2 151 ? 21.969  -0.502  -95.559  1.00 2.00  ? 151 ILE E CG2   1 
ATOM   7814  C  CD1   . ILE E 2 151 ? 22.497  -0.259  -92.649  1.00 2.00  ? 151 ILE E CD1   1 
ATOM   7815  N  N     . ALA E 2 152 ? 24.819  0.609   -97.359  1.00 4.35  ? 152 ALA E N     1 
ATOM   7816  C  CA    . ALA E 2 152 ? 25.211  0.049   -98.620  1.00 2.00  ? 152 ALA E CA    1 
ATOM   7817  C  C     . ALA E 2 152 ? 26.636  -0.513  -98.741  1.00 3.16  ? 152 ALA E C     1 
ATOM   7818  O  O     . ALA E 2 152 ? 26.899  -1.289  -99.655  1.00 7.02  ? 152 ALA E O     1 
ATOM   7819  C  CB    . ALA E 2 152 ? 24.766  0.895   -99.804  1.00 5.23  ? 152 ALA E CB    1 
ATOM   7820  N  N     . ALA E 2 153 ? 27.564  -0.177  -97.832  1.00 11.28 ? 153 ALA E N     1 
ATOM   7821  C  CA    . ALA E 2 153 ? 28.965  -0.647  -98.056  1.00 10.50 ? 153 ALA E CA    1 
ATOM   7822  C  C     . ALA E 2 153 ? 29.102  -2.016  -97.370  1.00 9.48  ? 153 ALA E C     1 
ATOM   7823  O  O     . ALA E 2 153 ? 29.715  -2.935  -97.871  1.00 6.64  ? 153 ALA E O     1 
ATOM   7824  C  CB    . ALA E 2 153 ? 30.004  0.384   -97.525  1.00 2.00  ? 153 ALA E CB    1 
ATOM   7825  N  N     . THR E 2 154 ? 28.418  -2.163  -96.261  1.00 12.64 ? 154 THR E N     1 
ATOM   7826  C  CA    . THR E 2 154 ? 28.656  -3.251  -95.327  1.00 9.76  ? 154 THR E CA    1 
ATOM   7827  C  C     . THR E 2 154 ? 27.588  -4.382  -95.486  1.00 8.66  ? 154 THR E C     1 
ATOM   7828  O  O     . THR E 2 154 ? 27.890  -5.531  -95.310  1.00 9.07  ? 154 THR E O     1 
ATOM   7829  C  CB    . THR E 2 154 ? 28.753  -2.572  -93.921  1.00 8.37  ? 154 THR E CB    1 
ATOM   7830  O  OG1   . THR E 2 154 ? 29.787  -1.594  -94.036  1.00 7.44  ? 154 THR E OG1   1 
ATOM   7831  C  CG2   . THR E 2 154 ? 29.111  -3.487  -92.756  1.00 11.63 ? 154 THR E CG2   1 
ATOM   7832  N  N     . CYS E 2 155 ? 26.348  -4.084  -95.863  1.00 9.88  ? 155 CYS E N     1 
ATOM   7833  C  CA    . CYS E 2 155 ? 25.333  -5.154  -96.008  1.00 2.00  ? 155 CYS E CA    1 
ATOM   7834  C  C     . CYS E 2 155 ? 25.431  -5.964  -97.251  1.00 2.00  ? 155 CYS E C     1 
ATOM   7835  O  O     . CYS E 2 155 ? 24.716  -5.700  -98.208  1.00 2.00  ? 155 CYS E O     1 
ATOM   7836  C  CB    . CYS E 2 155 ? 23.953  -4.572  -95.930  1.00 2.00  ? 155 CYS E CB    1 
ATOM   7837  S  SG    . CYS E 2 155 ? 23.800  -3.841  -94.278  1.00 5.54  ? 155 CYS E SG    1 
ATOM   7838  N  N     . ARG E 2 156 ? 26.301  -6.959  -97.262  1.00 2.00  ? 156 ARG E N     1 
ATOM   7839  C  CA    . ARG E 2 156 ? 26.422  -7.770  -98.466  1.00 3.92  ? 156 ARG E CA    1 
ATOM   7840  C  C     . ARG E 2 156 ? 25.209  -8.584  -98.959  1.00 2.00  ? 156 ARG E C     1 
ATOM   7841  O  O     . ARG E 2 156 ? 25.050  -8.804  -100.133 1.00 2.23  ? 156 ARG E O     1 
ATOM   7842  C  CB    . ARG E 2 156 ? 27.820  -8.366  -98.680  1.00 5.67  ? 156 ARG E CB    1 
ATOM   7843  C  CG    . ARG E 2 156 ? 28.154  -9.652  -97.853  1.00 18.13 ? 156 ARG E CG    1 
ATOM   7844  C  CD    . ARG E 2 156 ? 28.339  -10.912 -98.762  1.00 4.74  ? 156 ARG E CD    1 
ATOM   7845  N  NE    . ARG E 2 156 ? 29.369  -11.791 -98.238  1.00 16.86 ? 156 ARG E NE    1 
ATOM   7846  C  CZ    . ARG E 2 156 ? 30.357  -11.376 -97.449  1.00 32.86 ? 156 ARG E CZ    1 
ATOM   7847  N  NH1   . ARG E 2 156 ? 30.431  -10.092 -97.091  1.00 26.98 ? 156 ARG E NH1   1 
ATOM   7848  N  NH2   . ARG E 2 156 ? 31.267  -12.243 -97.012  1.00 2.00  ? 156 ARG E NH2   1 
ATOM   7849  N  N     . ASN E 2 157 ? 24.302  -8.906  -98.051  1.00 2.98  ? 157 ASN E N     1 
ATOM   7850  C  CA    . ASN E 2 157 ? 23.150  -9.772  -98.327  1.00 7.16  ? 157 ASN E CA    1 
ATOM   7851  C  C     . ASN E 2 157 ? 21.803  -9.070  -98.485  1.00 8.72  ? 157 ASN E C     1 
ATOM   7852  O  O     . ASN E 2 157 ? 20.781  -9.743  -98.591  1.00 8.70  ? 157 ASN E O     1 
ATOM   7853  C  CB    . ASN E 2 157 ? 23.042  -10.758 -97.180  1.00 2.00  ? 157 ASN E CB    1 
ATOM   7854  C  CG    . ASN E 2 157 ? 24.271  -11.665 -97.107  1.00 2.00  ? 157 ASN E CG    1 
ATOM   7855  O  OD1   . ASN E 2 157 ? 24.462  -12.475 -97.999  1.00 14.29 ? 157 ASN E OD1   1 
ATOM   7856  N  ND2   . ASN E 2 157 ? 25.117  -11.490 -96.106  1.00 2.00  ? 157 ASN E ND2   1 
ATOM   7857  N  N     . LEU E 2 158 ? 21.809  -7.732  -98.444  1.00 2.00  ? 158 LEU E N     1 
ATOM   7858  C  CA    . LEU E 2 158 ? 20.596  -6.926  -98.511  1.00 4.44  ? 158 LEU E CA    1 
ATOM   7859  C  C     . LEU E 2 158 ? 19.643  -7.200  -99.629  1.00 3.30  ? 158 LEU E C     1 
ATOM   7860  O  O     . LEU E 2 158 ? 20.056  -7.449  -100.809 1.00 2.55  ? 158 LEU E O     1 
ATOM   7861  C  CB    . LEU E 2 158 ? 20.938  -5.454  -98.617  1.00 14.49 ? 158 LEU E CB    1 
ATOM   7862  C  CG    . LEU E 2 158 ? 19.804  -4.542  -98.101  1.00 17.83 ? 158 LEU E CG    1 
ATOM   7863  C  CD1   . LEU E 2 158 ? 19.680  -4.581  -96.600  1.00 4.20  ? 158 LEU E CD1   1 
ATOM   7864  C  CD2   . LEU E 2 158 ? 20.010  -3.124  -98.479  1.00 8.21  ? 158 LEU E CD2   1 
ATOM   7865  N  N     . LYS E 2 159 ? 18.359  -7.117  -99.304  1.00 2.00  ? 159 LYS E N     1 
ATOM   7866  C  CA    . LYS E 2 159 ? 17.361  -7.271  -100.374 1.00 2.00  ? 159 LYS E CA    1 
ATOM   7867  C  C     . LYS E 2 159 ? 16.365  -6.129  -100.553 1.00 8.63  ? 159 LYS E C     1 
ATOM   7868  O  O     . LYS E 2 159 ? 15.932  -5.869  -101.692 1.00 2.00  ? 159 LYS E O     1 
ATOM   7869  C  CB    . LYS E 2 159 ? 16.660  -8.583  -100.215 1.00 2.00  ? 159 LYS E CB    1 
ATOM   7870  C  CG    . LYS E 2 159 ? 17.482  -9.446  -99.343  1.00 11.06 ? 159 LYS E CG    1 
ATOM   7871  C  CD    . LYS E 2 159 ? 17.462  -10.890 -99.784  1.00 3.02  ? 159 LYS E CD    1 
ATOM   7872  C  CE    . LYS E 2 159 ? 16.572  -11.121 -100.950 1.00 2.00  ? 159 LYS E CE    1 
ATOM   7873  N  NZ    . LYS E 2 159 ? 16.089  -12.512 -100.774 1.00 9.97  ? 159 LYS E NZ    1 
ATOM   7874  N  N     . GLU E 2 160 ? 15.962  -5.531  -99.412  1.00 6.22  ? 160 GLU E N     1 
ATOM   7875  C  CA    . GLU E 2 160 ? 15.132  -4.371  -99.379  1.00 9.59  ? 160 GLU E CA    1 
ATOM   7876  C  C     . GLU E 2 160 ? 15.731  -3.244  -98.557  1.00 11.75 ? 160 GLU E C     1 
ATOM   7877  O  O     . GLU E 2 160 ? 15.857  -3.325  -97.318  1.00 4.91  ? 160 GLU E O     1 
ATOM   7878  C  CB    . GLU E 2 160 ? 13.790  -4.740  -98.811  1.00 2.00  ? 160 GLU E CB    1 
ATOM   7879  C  CG    . GLU E 2 160 ? 13.412  -6.023  -99.365  1.00 2.00  ? 160 GLU E CG    1 
ATOM   7880  C  CD    . GLU E 2 160 ? 11.955  -6.330  -99.148  1.00 18.84 ? 160 GLU E CD    1 
ATOM   7881  O  OE1   . GLU E 2 160 ? 11.595  -7.465  -99.482  1.00 14.57 ? 160 GLU E OE1   1 
ATOM   7882  O  OE2   . GLU E 2 160 ? 11.179  -5.465  -98.639  1.00 16.85 ? 160 GLU E OE2   1 
ATOM   7883  N  N     . LEU E 2 161 ? 15.946  -2.124  -99.249  1.00 9.06  ? 161 LEU E N     1 
ATOM   7884  C  CA    . LEU E 2 161 ? 15.899  -0.772  -98.607  1.00 6.11  ? 161 LEU E CA    1 
ATOM   7885  C  C     . LEU E 2 161 ? 14.654  0.032   -98.981  1.00 4.11  ? 161 LEU E C     1 
ATOM   7886  O  O     . LEU E 2 161 ? 14.537  0.567   -100.133 1.00 2.93  ? 161 LEU E O     1 
ATOM   7887  C  CB    . LEU E 2 161 ? 17.120  -0.015  -99.120  1.00 4.94  ? 161 LEU E CB    1 
ATOM   7888  C  CG    . LEU E 2 161 ? 17.602  1.183   -98.348  1.00 3.19  ? 161 LEU E CG    1 
ATOM   7889  C  CD1   . LEU E 2 161 ? 17.698  0.909   -96.875  1.00 2.00  ? 161 LEU E CD1   1 
ATOM   7890  C  CD2   . LEU E 2 161 ? 18.979  1.490   -99.011  1.00 2.29  ? 161 LEU E CD2   1 
ATOM   7891  N  N     . ASP E 2 162 ? 13.737  0.099   -98.056  1.00 2.00  ? 162 ASP E N     1 
ATOM   7892  C  CA    . ASP E 2 162 ? 12.507  0.827   -98.263  1.00 2.00  ? 162 ASP E CA    1 
ATOM   7893  C  C     . ASP E 2 162 ? 12.433  2.031   -97.282  1.00 2.06  ? 162 ASP E C     1 
ATOM   7894  O  O     . ASP E 2 162 ? 12.302  1.859   -96.071  1.00 2.00  ? 162 ASP E O     1 
ATOM   7895  C  CB    . ASP E 2 162 ? 11.364  -0.131  -97.929  1.00 2.00  ? 162 ASP E CB    1 
ATOM   7896  C  CG    . ASP E 2 162 ? 10.057  0.269   -98.562  1.00 2.53  ? 162 ASP E CG    1 
ATOM   7897  O  OD1   . ASP E 2 162 ? 9.725   1.474   -98.588  1.00 8.55  ? 162 ASP E OD1   1 
ATOM   7898  O  OD2   . ASP E 2 162 ? 9.370   -0.652  -99.071  1.00 35.85 ? 162 ASP E OD2   1 
ATOM   7899  N  N     . LEU E 2 163 ? 12.479  3.249   -97.809  1.00 5.24  ? 163 LEU E N     1 
ATOM   7900  C  CA    . LEU E 2 163 ? 12.484  4.443   -96.959  1.00 8.42  ? 163 LEU E CA    1 
ATOM   7901  C  C     . LEU E 2 163 ? 11.246  5.320   -97.014  1.00 4.88  ? 163 LEU E C     1 
ATOM   7902  O  O     . LEU E 2 163 ? 11.359  6.528   -97.057  1.00 13.37 ? 163 LEU E O     1 
ATOM   7903  C  CB    . LEU E 2 163 ? 13.696  5.324   -97.230  1.00 2.00  ? 163 LEU E CB    1 
ATOM   7904  C  CG    . LEU E 2 163 ? 15.057  4.727   -97.516  1.00 4.99  ? 163 LEU E CG    1 
ATOM   7905  C  CD1   . LEU E 2 163 ? 15.893  5.741   -98.227  1.00 2.00  ? 163 LEU E CD1   1 
ATOM   7906  C  CD2   . LEU E 2 163 ? 15.719  4.261   -96.248  1.00 2.00  ? 163 LEU E CD2   1 
ATOM   7907  N  N     . ARG E 2 164 ? 10.069  4.723   -96.995  1.00 7.33  ? 164 ARG E N     1 
ATOM   7908  C  CA    . ARG E 2 164 ? 8.865   5.426   -97.399  1.00 9.54  ? 164 ARG E CA    1 
ATOM   7909  C  C     . ARG E 2 164 ? 8.414   6.549   -96.468  1.00 8.18  ? 164 ARG E C     1 
ATOM   7910  O  O     . ARG E 2 164 ? 8.261   6.353   -95.271  1.00 3.92  ? 164 ARG E O     1 
ATOM   7911  C  CB    . ARG E 2 164 ? 7.723   4.456   -97.646  1.00 6.37  ? 164 ARG E CB    1 
ATOM   7912  C  CG    . ARG E 2 164 ? 7.518   3.452   -96.561  1.00 7.89  ? 164 ARG E CG    1 
ATOM   7913  C  CD    . ARG E 2 164 ? 6.401   2.504   -96.838  1.00 8.33  ? 164 ARG E CD    1 
ATOM   7914  N  NE    . ARG E 2 164 ? 6.855   1.347   -97.583  1.00 10.93 ? 164 ARG E NE    1 
ATOM   7915  C  CZ    . ARG E 2 164 ? 6.482   0.110   -97.322  1.00 45.02 ? 164 ARG E CZ    1 
ATOM   7916  N  NH1   . ARG E 2 164 ? 5.635   -0.134  -96.337  1.00 13.50 ? 164 ARG E NH1   1 
ATOM   7917  N  NH2   . ARG E 2 164 ? 6.947   -0.889  -98.056  1.00 30.37 ? 164 ARG E NH2   1 
ATOM   7918  N  N     . GLU E 2 165 ? 8.184   7.719   -97.054  1.00 2.00  ? 165 GLU E N     1 
ATOM   7919  C  CA    . GLU E 2 165 ? 7.895   8.947   -96.326  1.00 2.37  ? 165 GLU E CA    1 
ATOM   7920  C  C     . GLU E 2 165 ? 8.782   9.209   -95.143  1.00 2.00  ? 165 GLU E C     1 
ATOM   7921  O  O     . GLU E 2 165 ? 8.403   9.895   -94.215  1.00 2.00  ? 165 GLU E O     1 
ATOM   7922  C  CB    . GLU E 2 165 ? 6.449   8.994   -95.884  1.00 9.87  ? 165 GLU E CB    1 
ATOM   7923  C  CG    . GLU E 2 165 ? 5.727   7.697   -96.088  1.00 3.65  ? 165 GLU E CG    1 
ATOM   7924  C  CD    . GLU E 2 165 ? 5.133   7.608   -97.453  1.00 12.63 ? 165 GLU E CD    1 
ATOM   7925  O  OE1   . GLU E 2 165 ? 4.957   8.666   -98.074  1.00 22.95 ? 165 GLU E OE1   1 
ATOM   7926  O  OE2   . GLU E 2 165 ? 4.847   6.487   -97.895  1.00 38.10 ? 165 GLU E OE2   1 
ATOM   7927  N  N     . SER E 2 166 ? 9.981   8.676   -95.186  1.00 10.67 ? 166 SER E N     1 
ATOM   7928  C  CA    . SER E 2 166 ? 10.986  9.115   -94.269  1.00 2.06  ? 166 SER E CA    1 
ATOM   7929  C  C     . SER E 2 166 ? 11.556  10.469  -94.617  1.00 5.54  ? 166 SER E C     1 
ATOM   7930  O  O     . SER E 2 166 ? 11.511  10.918  -95.746  1.00 2.09  ? 166 SER E O     1 
ATOM   7931  C  CB    . SER E 2 166 ? 12.062  8.063   -94.084  1.00 2.37  ? 166 SER E CB    1 
ATOM   7932  O  OG    . SER E 2 166 ? 11.582  7.002   -93.293  1.00 2.50  ? 166 SER E OG    1 
ATOM   7933  N  N     . ASP E 2 167 ? 12.052  11.116  -93.583  1.00 2.00  ? 167 ASP E N     1 
ATOM   7934  C  CA    . ASP E 2 167 ? 12.556  12.447  -93.593  1.00 2.00  ? 167 ASP E CA    1 
ATOM   7935  C  C     . ASP E 2 167 ? 14.068  12.216  -93.477  1.00 2.00  ? 167 ASP E C     1 
ATOM   7936  O  O     . ASP E 2 167 ? 14.608  12.015  -92.392  1.00 2.00  ? 167 ASP E O     1 
ATOM   7937  C  CB    . ASP E 2 167 ? 12.028  13.097  -92.304  1.00 2.00  ? 167 ASP E CB    1 
ATOM   7938  C  CG    . ASP E 2 167 ? 12.224  14.618  -92.243  1.00 11.01 ? 167 ASP E CG    1 
ATOM   7939  O  OD1   . ASP E 2 167 ? 12.735  15.204  -93.243  1.00 20.57 ? 167 ASP E OD1   1 
ATOM   7940  O  OD2   . ASP E 2 167 ? 11.869  15.219  -91.165  1.00 17.75 ? 167 ASP E OD2   1 
ATOM   7941  N  N     . VAL E 2 168 ? 14.755  12.278  -94.590  1.00 2.00  ? 168 VAL E N     1 
ATOM   7942  C  CA    . VAL E 2 168 ? 16.148  12.078  -94.534  1.00 2.16  ? 168 VAL E CA    1 
ATOM   7943  C  C     . VAL E 2 168 ? 17.101  13.308  -94.572  1.00 9.04  ? 168 VAL E C     1 
ATOM   7944  O  O     . VAL E 2 168 ? 17.063  14.162  -95.478  1.00 2.00  ? 168 VAL E O     1 
ATOM   7945  C  CB    . VAL E 2 168 ? 16.511  10.971  -95.439  1.00 6.41  ? 168 VAL E CB    1 
ATOM   7946  C  CG1   . VAL E 2 168 ? 17.942  10.645  -95.232  1.00 2.00  ? 168 VAL E CG1   1 
ATOM   7947  C  CG2   . VAL E 2 168 ? 15.663  9.775   -95.030  1.00 2.00  ? 168 VAL E CG2   1 
ATOM   7948  N  N     . ASP E 2 169 ? 17.945  13.421  -93.558  1.00 2.17  ? 169 ASP E N     1 
ATOM   7949  C  CA    . ASP E 2 169 ? 18.883  14.543  -93.572  1.00 7.91  ? 169 ASP E CA    1 
ATOM   7950  C  C     . ASP E 2 169 ? 19.887  14.406  -94.761  1.00 9.36  ? 169 ASP E C     1 
ATOM   7951  O  O     . ASP E 2 169 ? 20.755  13.530  -94.790  1.00 18.25 ? 169 ASP E O     1 
ATOM   7952  C  CB    . ASP E 2 169 ? 19.407  14.917  -92.152  1.00 2.00  ? 169 ASP E CB    1 
ATOM   7953  C  CG    . ASP E 2 169 ? 20.905  15.290  -92.112  1.00 22.18 ? 169 ASP E CG    1 
ATOM   7954  O  OD1   . ASP E 2 169 ? 21.634  14.759  -91.224  1.00 51.43 ? 169 ASP E OD1   1 
ATOM   7955  O  OD2   . ASP E 2 169 ? 21.375  16.130  -92.910  1.00 8.01  ? 169 ASP E OD2   1 
ATOM   7956  N  N     . ASP E 2 170 ? 19.692  15.209  -95.800  1.00 15.15 ? 170 ASP E N     1 
ATOM   7957  C  CA    . ASP E 2 170 ? 19.939  14.729  -97.153  1.00 21.44 ? 170 ASP E CA    1 
ATOM   7958  C  C     . ASP E 2 170 ? 21.229  15.292  -97.681  1.00 10.51 ? 170 ASP E C     1 
ATOM   7959  O  O     . ASP E 2 170 ? 21.180  16.203  -98.483  1.00 9.61  ? 170 ASP E O     1 
ATOM   7960  C  CB    . ASP E 2 170 ? 18.832  15.195  -98.103  1.00 31.37 ? 170 ASP E CB    1 
ATOM   7961  C  CG    . ASP E 2 170 ? 18.191  14.037  -98.869  1.00 36.41 ? 170 ASP E CG    1 
ATOM   7962  O  OD1   . ASP E 2 170 ? 18.928  13.433  -99.702  1.00 25.52 ? 170 ASP E OD1   1 
ATOM   7963  O  OD2   . ASP E 2 170 ? 16.959  13.758  -98.640  1.00 4.73  ? 170 ASP E OD2   1 
ATOM   7964  N  N     . VAL E 2 171 ? 22.363  14.726  -97.258  1.00 6.77  ? 171 VAL E N     1 
ATOM   7965  C  CA    . VAL E 2 171 ? 23.644  15.428  -97.275  1.00 2.64  ? 171 VAL E CA    1 
ATOM   7966  C  C     . VAL E 2 171 ? 24.374  15.196  -98.614  1.00 9.30  ? 171 VAL E C     1 
ATOM   7967  O  O     . VAL E 2 171 ? 25.212  16.000  -99.002  1.00 14.01 ? 171 VAL E O     1 
ATOM   7968  C  CB    . VAL E 2 171 ? 24.597  14.974  -96.099  1.00 8.24  ? 171 VAL E CB    1 
ATOM   7969  C  CG1   . VAL E 2 171 ? 25.968  15.731  -96.162  1.00 2.00  ? 171 VAL E CG1   1 
ATOM   7970  C  CG2   . VAL E 2 171 ? 23.948  15.154  -94.708  1.00 2.00  ? 171 VAL E CG2   1 
ATOM   7971  N  N     . SER E 2 172 ? 24.084  14.097  -99.314  1.00 9.42  ? 172 SER E N     1 
ATOM   7972  C  CA    . SER E 2 172 ? 24.488  13.954  -100.731 1.00 7.84  ? 172 SER E CA    1 
ATOM   7973  C  C     . SER E 2 172 ? 24.210  12.531  -101.222 1.00 12.53 ? 172 SER E C     1 
ATOM   7974  O  O     . SER E 2 172 ? 23.969  11.642  -100.407 1.00 8.06  ? 172 SER E O     1 
ATOM   7975  C  CB    . SER E 2 172 ? 25.963  14.340  -100.955 1.00 8.88  ? 172 SER E CB    1 
ATOM   7976  O  OG    . SER E 2 172 ? 26.820  13.214  -100.856 1.00 2.00  ? 172 SER E OG    1 
ATOM   7977  N  N     . GLY E 2 173 ? 24.209  12.311  -102.540 1.00 10.18 ? 173 GLY E N     1 
ATOM   7978  C  CA    . GLY E 2 173 ? 23.752  11.025  -103.081 1.00 15.11 ? 173 GLY E CA    1 
ATOM   7979  C  C     . GLY E 2 173 ? 24.870  10.088  -103.522 1.00 18.70 ? 173 GLY E C     1 
ATOM   7980  O  O     . GLY E 2 173 ? 24.602  8.967   -104.032 1.00 16.03 ? 173 GLY E O     1 
ATOM   7981  N  N     . HIS E 2 174 ? 26.119  10.544  -103.338 1.00 8.61  ? 174 HIS E N     1 
ATOM   7982  C  CA    . HIS E 2 174 ? 27.238  9.637   -103.342 1.00 2.00  ? 174 HIS E CA    1 
ATOM   7983  C  C     . HIS E 2 174 ? 26.850  8.321   -102.688 1.00 3.20  ? 174 HIS E C     1 
ATOM   7984  O  O     . HIS E 2 174 ? 27.323  7.259   -103.123 1.00 2.00  ? 174 HIS E O     1 
ATOM   7985  C  CB    . HIS E 2 174 ? 28.488  10.233  -102.697 1.00 4.02  ? 174 HIS E CB    1 
ATOM   7986  C  CG    . HIS E 2 174 ? 29.748  9.449   -102.972 1.00 10.74 ? 174 HIS E CG    1 
ATOM   7987  N  ND1   . HIS E 2 174 ? 30.389  9.456   -104.200 1.00 23.47 ? 174 HIS E ND1   1 
ATOM   7988  C  CD2   . HIS E 2 174 ? 30.484  8.634   -102.177 1.00 2.16  ? 174 HIS E CD2   1 
ATOM   7989  C  CE1   . HIS E 2 174 ? 31.470  8.692   -104.149 1.00 8.75  ? 174 HIS E CE1   1 
ATOM   7990  N  NE2   . HIS E 2 174 ? 31.550  8.180   -102.932 1.00 38.11 ? 174 HIS E NE2   1 
ATOM   7991  N  N     . TRP E 2 175 ? 25.973  8.361   -101.672 1.00 2.61  ? 175 TRP E N     1 
ATOM   7992  C  CA    . TRP E 2 175 ? 25.837  7.175   -100.821 1.00 6.30  ? 175 TRP E CA    1 
ATOM   7993  C  C     . TRP E 2 175 ? 25.552  5.982   -101.683 1.00 8.18  ? 175 TRP E C     1 
ATOM   7994  O  O     . TRP E 2 175 ? 26.082  4.914   -101.427 1.00 11.41 ? 175 TRP E O     1 
ATOM   7995  C  CB    . TRP E 2 175 ? 24.793  7.285   -99.721  1.00 2.00  ? 175 TRP E CB    1 
ATOM   7996  C  CG    . TRP E 2 175 ? 23.434  7.444   -100.293 1.00 20.11 ? 175 TRP E CG    1 
ATOM   7997  C  CD1   . TRP E 2 175 ? 22.832  8.602   -100.677 1.00 3.77  ? 175 TRP E CD1   1 
ATOM   7998  C  CD2   . TRP E 2 175 ? 22.507  6.392   -100.577 1.00 22.40 ? 175 TRP E CD2   1 
ATOM   7999  N  NE1   . TRP E 2 175 ? 21.585  8.333   -101.169 1.00 21.82 ? 175 TRP E NE1   1 
ATOM   8000  C  CE2   . TRP E 2 175 ? 21.360  6.986   -101.110 1.00 2.00  ? 175 TRP E CE2   1 
ATOM   8001  C  CE3   . TRP E 2 175 ? 22.538  4.988   -100.405 1.00 15.88 ? 175 TRP E CE3   1 
ATOM   8002  C  CZ2   . TRP E 2 175 ? 20.260  6.250   -101.509 1.00 14.22 ? 175 TRP E CZ2   1 
ATOM   8003  C  CZ3   . TRP E 2 175 ? 21.452  4.259   -100.792 1.00 6.86  ? 175 TRP E CZ3   1 
ATOM   8004  C  CH2   . TRP E 2 175 ? 20.322  4.889   -101.369 1.00 5.33  ? 175 TRP E CH2   1 
ATOM   8005  N  N     . LEU E 2 176 ? 24.710  6.111   -102.705 1.00 6.58  ? 176 LEU E N     1 
ATOM   8006  C  CA    . LEU E 2 176 ? 24.358  4.886   -103.383 1.00 2.00  ? 176 LEU E CA    1 
ATOM   8007  C  C     . LEU E 2 176 ? 25.587  4.249   -104.081 1.00 2.00  ? 176 LEU E C     1 
ATOM   8008  O  O     . LEU E 2 176 ? 25.637  3.073   -104.357 1.00 2.00  ? 176 LEU E O     1 
ATOM   8009  C  CB    . LEU E 2 176 ? 23.133  5.076   -104.256 1.00 2.00  ? 176 LEU E CB    1 
ATOM   8010  C  CG    . LEU E 2 176 ? 22.672  3.851   -105.067 1.00 10.27 ? 176 LEU E CG    1 
ATOM   8011  C  CD1   . LEU E 2 176 ? 21.152  3.847   -105.062 1.00 2.00  ? 176 LEU E CD1   1 
ATOM   8012  C  CD2   . LEU E 2 176 ? 23.299  4.013   -106.478 1.00 2.00  ? 176 LEU E CD2   1 
ATOM   8013  N  N     . SER E 2 177 ? 26.615  5.029   -104.315 1.00 2.00  ? 177 SER E N     1 
ATOM   8014  C  CA    . SER E 2 177 ? 27.757  4.506   -105.016 1.00 5.73  ? 177 SER E CA    1 
ATOM   8015  C  C     . SER E 2 177 ? 28.582  3.532   -104.151 1.00 11.45 ? 177 SER E C     1 
ATOM   8016  O  O     . SER E 2 177 ? 29.541  2.918   -104.655 1.00 6.75  ? 177 SER E O     1 
ATOM   8017  C  CB    . SER E 2 177 ? 28.645  5.660   -105.445 1.00 2.76  ? 177 SER E CB    1 
ATOM   8018  O  OG    . SER E 2 177 ? 28.064  6.387   -106.515 1.00 18.69 ? 177 SER E OG    1 
ATOM   8019  N  N     . HIS E 2 178 ? 28.244  3.421   -102.856 1.00 6.90  ? 178 HIS E N     1 
ATOM   8020  C  CA    . HIS E 2 178 ? 28.908  2.464   -101.889 1.00 11.06 ? 178 HIS E CA    1 
ATOM   8021  C  C     . HIS E 2 178 ? 28.579  0.922   -101.992 1.00 12.41 ? 178 HIS E C     1 
ATOM   8022  O  O     . HIS E 2 178 ? 29.398  0.058   -101.574 1.00 9.95  ? 178 HIS E O     1 
ATOM   8023  C  CB    . HIS E 2 178 ? 28.728  2.960   -100.425 1.00 8.95  ? 178 HIS E CB    1 
ATOM   8024  C  CG    . HIS E 2 178 ? 29.367  4.288   -100.174 1.00 11.55 ? 178 HIS E CG    1 
ATOM   8025  N  ND1   . HIS E 2 178 ? 30.436  4.457   -99.320  1.00 21.47 ? 178 HIS E ND1   1 
ATOM   8026  C  CD2   . HIS E 2 178 ? 29.141  5.497   -100.734 1.00 4.58  ? 178 HIS E CD2   1 
ATOM   8027  C  CE1   . HIS E 2 178 ? 30.822  5.720   -99.338  1.00 2.00  ? 178 HIS E CE1   1 
ATOM   8028  N  NE2   . HIS E 2 178 ? 30.054  6.373   -100.191 1.00 28.52 ? 178 HIS E NE2   1 
ATOM   8029  N  N     . PHE E 2 179 ? 27.371  0.590   -102.486 1.00 10.31 ? 179 PHE E N     1 
ATOM   8030  C  CA    . PHE E 2 179 ? 27.062  -0.738  -102.980 1.00 2.05  ? 179 PHE E CA    1 
ATOM   8031  C  C     . PHE E 2 179 ? 28.212  -1.067  -103.866 1.00 7.26  ? 179 PHE E C     1 
ATOM   8032  O  O     . PHE E 2 179 ? 28.365  -0.445  -104.902 1.00 14.62 ? 179 PHE E O     1 
ATOM   8033  C  CB    . PHE E 2 179 ? 25.810  -0.714  -103.835 1.00 5.15  ? 179 PHE E CB    1 
ATOM   8034  C  CG    . PHE E 2 179 ? 24.568  -0.610  -103.045 1.00 5.29  ? 179 PHE E CG    1 
ATOM   8035  C  CD1   . PHE E 2 179 ? 23.753  0.473   -103.167 1.00 17.35 ? 179 PHE E CD1   1 
ATOM   8036  C  CD2   . PHE E 2 179 ? 24.219  -1.605  -102.185 1.00 2.00  ? 179 PHE E CD2   1 
ATOM   8037  C  CE1   . PHE E 2 179 ? 22.618  0.550   -102.418 1.00 16.07 ? 179 PHE E CE1   1 
ATOM   8038  C  CE2   . PHE E 2 179 ? 23.095  -1.555  -101.445 1.00 2.08  ? 179 PHE E CE2   1 
ATOM   8039  C  CZ    . PHE E 2 179 ? 22.284  -0.487  -101.539 1.00 12.37 ? 179 PHE E CZ    1 
ATOM   8040  N  N     . PRO E 2 180 ? 29.055  -2.012  -103.448 1.00 8.43  ? 180 PRO E N     1 
ATOM   8041  C  CA    . PRO E 2 180 ? 30.220  -2.281  -104.278 1.00 2.00  ? 180 PRO E CA    1 
ATOM   8042  C  C     . PRO E 2 180 ? 29.717  -3.219  -105.355 1.00 6.45  ? 180 PRO E C     1 
ATOM   8043  O  O     . PRO E 2 180 ? 28.524  -3.562  -105.331 1.00 2.59  ? 180 PRO E O     1 
ATOM   8044  C  CB    . PRO E 2 180 ? 31.190  -2.992  -103.311 1.00 3.68  ? 180 PRO E CB    1 
ATOM   8045  C  CG    . PRO E 2 180 ? 30.336  -3.647  -102.289 1.00 2.00  ? 180 PRO E CG    1 
ATOM   8046  C  CD    . PRO E 2 180 ? 29.008  -2.845  -102.227 1.00 6.15  ? 180 PRO E CD    1 
ATOM   8047  N  N     . ASP E 2 181 ? 30.582  -3.622  -106.286 1.00 2.00  ? 181 ASP E N     1 
ATOM   8048  C  CA    . ASP E 2 181 ? 30.125  -4.311  -107.501 1.00 11.78 ? 181 ASP E CA    1 
ATOM   8049  C  C     . ASP E 2 181 ? 29.918  -5.801  -107.343 1.00 11.91 ? 181 ASP E C     1 
ATOM   8050  O  O     . ASP E 2 181 ? 29.193  -6.423  -108.110 1.00 15.11 ? 181 ASP E O     1 
ATOM   8051  C  CB    . ASP E 2 181 ? 31.127  -4.071  -108.594 1.00 10.08 ? 181 ASP E CB    1 
ATOM   8052  C  CG    . ASP E 2 181 ? 31.956  -2.876  -108.301 1.00 29.88 ? 181 ASP E CG    1 
ATOM   8053  O  OD1   . ASP E 2 181 ? 31.946  -2.463  -107.101 1.00 23.36 ? 181 ASP E OD1   1 
ATOM   8054  O  OD2   . ASP E 2 181 ? 32.585  -2.355  -109.252 1.00 29.26 ? 181 ASP E OD2   1 
ATOM   8055  N  N     . THR E 2 182 ? 30.546  -6.338  -106.313 1.00 6.05  ? 182 THR E N     1 
ATOM   8056  C  CA    . THR E 2 182 ? 30.205  -7.620  -105.743 1.00 5.05  ? 182 THR E CA    1 
ATOM   8057  C  C     . THR E 2 182 ? 28.745  -7.767  -105.384 1.00 4.42  ? 182 THR E C     1 
ATOM   8058  O  O     . THR E 2 182 ? 28.207  -8.868  -105.419 1.00 2.00  ? 182 THR E O     1 
ATOM   8059  C  CB    . THR E 2 182 ? 31.036  -7.827  -104.502 1.00 20.81 ? 182 THR E CB    1 
ATOM   8060  O  OG1   . THR E 2 182 ? 30.718  -6.805  -103.551 1.00 15.84 ? 182 THR E OG1   1 
ATOM   8061  C  CG2   . THR E 2 182 ? 32.492  -7.582  -104.802 1.00 2.00  ? 182 THR E CG2   1 
ATOM   8062  N  N     . TYR E 2 183 ? 28.114  -6.656  -105.021 1.00 2.00  ? 183 TYR E N     1 
ATOM   8063  C  CA    . TYR E 2 183 ? 26.756  -6.671  -104.495 1.00 7.51  ? 183 TYR E CA    1 
ATOM   8064  C  C     . TYR E 2 183 ? 25.734  -6.872  -105.599 1.00 2.05  ? 183 TYR E C     1 
ATOM   8065  O  O     . TYR E 2 183 ? 25.822  -6.252  -106.639 1.00 8.97  ? 183 TYR E O     1 
ATOM   8066  C  CB    . TYR E 2 183 ? 26.467  -5.387  -103.722 1.00 2.00  ? 183 TYR E CB    1 
ATOM   8067  C  CG    . TYR E 2 183 ? 25.030  -5.244  -103.283 1.00 13.99 ? 183 TYR E CG    1 
ATOM   8068  C  CD1   . TYR E 2 183 ? 24.576  -5.867  -102.142 1.00 14.88 ? 183 TYR E CD1   1 
ATOM   8069  C  CD2   . TYR E 2 183 ? 24.125  -4.489  -104.015 1.00 17.33 ? 183 TYR E CD2   1 
ATOM   8070  C  CE1   . TYR E 2 183 ? 23.272  -5.748  -101.741 1.00 19.00 ? 183 TYR E CE1   1 
ATOM   8071  C  CE2   . TYR E 2 183 ? 22.821  -4.371  -103.618 1.00 2.00  ? 183 TYR E CE2   1 
ATOM   8072  C  CZ    . TYR E 2 183 ? 22.400  -5.001  -102.476 1.00 5.03  ? 183 TYR E CZ    1 
ATOM   8073  O  OH    . TYR E 2 183 ? 21.106  -4.899  -102.055 1.00 2.00  ? 183 TYR E OH    1 
ATOM   8074  N  N     . THR E 2 184 ? 24.773  -7.758  -105.375 1.00 2.00  ? 184 THR E N     1 
ATOM   8075  C  CA    . THR E 2 184 ? 23.853  -8.135  -106.430 1.00 2.00  ? 184 THR E CA    1 
ATOM   8076  C  C     . THR E 2 184 ? 22.501  -8.628  -105.986 1.00 6.92  ? 184 THR E C     1 
ATOM   8077  O  O     . THR E 2 184 ? 21.751  -9.155  -106.795 1.00 10.71 ? 184 THR E O     1 
ATOM   8078  C  CB    . THR E 2 184 ? 24.452  -9.179  -107.366 1.00 11.90 ? 184 THR E CB    1 
ATOM   8079  O  OG1   . THR E 2 184 ? 24.543  -10.438 -106.693 1.00 3.96  ? 184 THR E OG1   1 
ATOM   8080  C  CG2   . THR E 2 184 ? 25.862  -8.837  -107.730 1.00 2.00  ? 184 THR E CG2   1 
ATOM   8081  N  N     . SER E 2 185 ? 22.177  -8.478  -104.714 1.00 2.47  ? 185 SER E N     1 
ATOM   8082  C  CA    . SER E 2 185 ? 21.047  -9.220  -104.185 1.00 12.67 ? 185 SER E CA    1 
ATOM   8083  C  C     . SER E 2 185 ? 19.732  -8.445  -104.158 1.00 2.00  ? 185 SER E C     1 
ATOM   8084  O  O     . SER E 2 185 ? 18.704  -8.992  -103.814 1.00 21.36 ? 185 SER E O     1 
ATOM   8085  C  CB    . SER E 2 185 ? 21.366  -9.822  -102.820 1.00 5.66  ? 185 SER E CB    1 
ATOM   8086  O  OG    . SER E 2 185 ? 22.303  -9.032  -102.129 1.00 2.96  ? 185 SER E OG    1 
ATOM   8087  N  N     . LEU E 2 186 ? 19.772  -7.179  -104.544 1.00 12.65 ? 186 LEU E N     1 
ATOM   8088  C  CA    . LEU E 2 186 ? 18.693  -6.241  -104.255 1.00 14.37 ? 186 LEU E CA    1 
ATOM   8089  C  C     . LEU E 2 186 ? 17.346  -6.682  -104.812 1.00 5.91  ? 186 LEU E C     1 
ATOM   8090  O  O     . LEU E 2 186 ? 17.251  -7.063  -105.965 1.00 7.26  ? 186 LEU E O     1 
ATOM   8091  C  CB    . LEU E 2 186 ? 19.062  -4.860  -104.794 1.00 15.75 ? 186 LEU E CB    1 
ATOM   8092  C  CG    . LEU E 2 186 ? 18.125  -3.668  -104.644 1.00 8.72  ? 186 LEU E CG    1 
ATOM   8093  C  CD1   . LEU E 2 186 ? 17.957  -3.304  -103.199 1.00 10.53 ? 186 LEU E CD1   1 
ATOM   8094  C  CD2   . LEU E 2 186 ? 18.689  -2.503  -105.407 1.00 6.53  ? 186 LEU E CD2   1 
ATOM   8095  N  N     . VAL E 2 187 ? 16.303  -6.629  -103.991 1.00 6.15  ? 187 VAL E N     1 
ATOM   8096  C  CA    . VAL E 2 187 ? 14.986  -7.056  -104.449 1.00 7.85  ? 187 VAL E CA    1 
ATOM   8097  C  C     . VAL E 2 187 ? 14.100  -5.859  -104.548 1.00 9.49  ? 187 VAL E C     1 
ATOM   8098  O  O     . VAL E 2 187 ? 13.325  -5.711  -105.517 1.00 7.02  ? 187 VAL E O     1 
ATOM   8099  C  CB    . VAL E 2 187 ? 14.366  -8.011  -103.497 1.00 9.72  ? 187 VAL E CB    1 
ATOM   8100  C  CG1   . VAL E 2 187 ? 13.059  -8.394  -104.017 1.00 2.00  ? 187 VAL E CG1   1 
ATOM   8101  C  CG2   . VAL E 2 187 ? 15.320  -9.265  -103.358 1.00 6.16  ? 187 VAL E CG2   1 
ATOM   8102  N  N     . SER E 2 188 ? 14.232  -4.969  -103.570 1.00 4.90  ? 188 SER E N     1 
ATOM   8103  C  CA    . SER E 2 188 ? 13.327  -3.797  -103.478 1.00 3.00  ? 188 SER E CA    1 
ATOM   8104  C  C     . SER E 2 188 ? 14.081  -2.516  -103.021 1.00 5.45  ? 188 SER E C     1 
ATOM   8105  O  O     . SER E 2 188 ? 14.785  -2.560  -102.023 1.00 9.75  ? 188 SER E O     1 
ATOM   8106  C  CB    . SER E 2 188 ? 12.090  -4.121  -102.621 1.00 2.00  ? 188 SER E CB    1 
ATOM   8107  O  OG    . SER E 2 188 ? 11.714  -3.027  -101.768 1.00 17.52 ? 188 SER E OG    1 
ATOM   8108  N  N     . LEU E 2 189 ? 13.967  -1.420  -103.764 1.00 2.00  ? 189 LEU E N     1 
ATOM   8109  C  CA    . LEU E 2 189 ? 14.676  -0.192  -103.433 1.00 3.82  ? 189 LEU E CA    1 
ATOM   8110  C  C     . LEU E 2 189 ? 13.670  0.945   -103.556 1.00 9.62  ? 189 LEU E C     1 
ATOM   8111  O  O     . LEU E 2 189 ? 13.190  1.180   -104.637 1.00 5.29  ? 189 LEU E O     1 
ATOM   8112  C  CB    . LEU E 2 189 ? 15.723  0.090   -104.473 1.00 2.00  ? 189 LEU E CB    1 
ATOM   8113  C  CG    . LEU E 2 189 ? 16.585  1.334   -104.204 1.00 3.52  ? 189 LEU E CG    1 
ATOM   8114  C  CD1   . LEU E 2 189 ? 17.248  1.372   -102.808 1.00 2.00  ? 189 LEU E CD1   1 
ATOM   8115  C  CD2   . LEU E 2 189 ? 17.669  1.595   -105.339 1.00 2.00  ? 189 LEU E CD2   1 
ATOM   8116  N  N     . ASN E 2 190 ? 13.309  1.598   -102.461 1.00 5.90  ? 190 ASN E N     1 
ATOM   8117  C  CA    . ASN E 2 190 ? 12.378  2.679   -102.491 1.00 2.00  ? 190 ASN E CA    1 
ATOM   8118  C  C     . ASN E 2 190 ? 13.077  3.977   -101.958 1.00 4.57  ? 190 ASN E C     1 
ATOM   8119  O  O     . ASN E 2 190 ? 13.122  4.193   -100.752 1.00 3.33  ? 190 ASN E O     1 
ATOM   8120  C  CB    . ASN E 2 190 ? 11.165  2.373   -101.644 1.00 2.00  ? 190 ASN E CB    1 
ATOM   8121  C  CG    . ASN E 2 190 ? 10.174  3.571   -101.651 1.00 15.78 ? 190 ASN E CG    1 
ATOM   8122  O  OD1   . ASN E 2 190 ? 10.484  4.636   -102.221 1.00 7.26  ? 190 ASN E OD1   1 
ATOM   8123  N  ND2   . ASN E 2 190 ? 9.019   3.417   -101.030 1.00 2.00  ? 190 ASN E ND2   1 
ATOM   8124  N  N     . ILE E 2 191 ? 13.604  4.836   -102.841 1.00 7.05  ? 191 ILE E N     1 
ATOM   8125  C  CA    . ILE E 2 191 ? 14.316  6.054   -102.424 1.00 9.25  ? 191 ILE E CA    1 
ATOM   8126  C  C     . ILE E 2 191 ? 13.504  7.320   -102.720 1.00 16.02 ? 191 ILE E C     1 
ATOM   8127  O  O     . ILE E 2 191 ? 14.059  8.449   -102.941 1.00 6.04  ? 191 ILE E O     1 
ATOM   8128  C  CB    . ILE E 2 191 ? 15.677  6.180   -103.122 1.00 2.20  ? 191 ILE E CB    1 
ATOM   8129  C  CG1   . ILE E 2 191 ? 15.490  6.176   -104.621 1.00 6.06  ? 191 ILE E CG1   1 
ATOM   8130  C  CG2   . ILE E 2 191 ? 16.579  5.062   -102.671 1.00 3.36  ? 191 ILE E CG2   1 
ATOM   8131  C  CD1   . ILE E 2 191 ? 16.816  6.379   -105.469 1.00 2.00  ? 191 ILE E CD1   1 
ATOM   8132  N  N     . SER E 2 192 ? 12.185  7.141   -102.760 1.00 4.80  ? 192 SER E N     1 
ATOM   8133  C  CA    . SER E 2 192 ? 11.399  8.139   -103.449 1.00 11.32 ? 192 SER E CA    1 
ATOM   8134  C  C     . SER E 2 192 ? 11.231  9.304   -102.470 1.00 8.78  ? 192 SER E C     1 
ATOM   8135  O  O     . SER E 2 192 ? 10.648  10.283  -102.833 1.00 8.38  ? 192 SER E O     1 
ATOM   8136  C  CB    . SER E 2 192 ? 10.040  7.572   -103.821 1.00 2.00  ? 192 SER E CB    1 
ATOM   8137  O  OG    . SER E 2 192 ? 9.373   7.385   -102.595 1.00 4.19  ? 192 SER E OG    1 
ATOM   8138  N  N     . CYS E 2 193 ? 11.708  9.211   -101.231 1.00 2.54  ? 193 CYS E N     1 
ATOM   8139  C  CA    . CYS E 2 193 ? 11.629  10.395  -100.325 1.00 3.36  ? 193 CYS E CA    1 
ATOM   8140  C  C     . CYS E 2 193 ? 12.947  11.157  -100.304 1.00 4.42  ? 193 CYS E C     1 
ATOM   8141  O  O     . CYS E 2 193 ? 13.111  11.984  -99.496  1.00 8.28  ? 193 CYS E O     1 
ATOM   8142  C  CB    . CYS E 2 193 ? 11.294  10.004  -98.881  1.00 2.00  ? 193 CYS E CB    1 
ATOM   8143  S  SG    . CYS E 2 193 ? 12.545  8.779   -98.180  1.00 9.79  ? 193 CYS E SG    1 
ATOM   8144  N  N     . LEU E 2 194 ? 13.890  10.867  -101.160 1.00 2.00  ? 194 LEU E N     1 
ATOM   8145  C  CA    . LEU E 2 194 ? 15.130  11.486  -101.061 1.00 2.00  ? 194 LEU E CA    1 
ATOM   8146  C  C     . LEU E 2 194 ? 15.246  12.647  -102.047 1.00 2.00  ? 194 LEU E C     1 
ATOM   8147  O  O     . LEU E 2 194 ? 15.168  12.476  -103.261 1.00 7.69  ? 194 LEU E O     1 
ATOM   8148  C  CB    . LEU E 2 194 ? 16.202  10.460  -101.429 1.00 2.00  ? 194 LEU E CB    1 
ATOM   8149  C  CG    . LEU E 2 194 ? 16.522  9.471   -100.321 1.00 3.68  ? 194 LEU E CG    1 
ATOM   8150  C  CD1   . LEU E 2 194 ? 17.579  8.575   -100.861 1.00 2.00  ? 194 LEU E CD1   1 
ATOM   8151  C  CD2   . LEU E 2 194 ? 16.948  10.113  -99.021  1.00 2.00  ? 194 LEU E CD2   1 
ATOM   8152  N  N     . ALA E 2 195 ? 15.547  13.818  -101.521 1.00 7.71  ? 195 ALA E N     1 
ATOM   8153  C  CA    . ALA E 2 195 ? 15.827  15.010  -102.329 1.00 7.02  ? 195 ALA E CA    1 
ATOM   8154  C  C     . ALA E 2 195 ? 17.145  14.906  -103.020 1.00 3.17  ? 195 ALA E C     1 
ATOM   8155  O  O     . ALA E 2 195 ? 17.355  15.529  -104.012 1.00 10.96 ? 195 ALA E O     1 
ATOM   8156  C  CB    . ALA E 2 195 ? 15.783  16.372  -101.440 1.00 2.00  ? 195 ALA E CB    1 
ATOM   8157  N  N     . SER E 2 196 ? 18.101  14.154  -102.549 1.00 9.23  ? 196 SER E N     1 
ATOM   8158  C  CA    . SER E 2 196 ? 19.348  14.387  -103.280 1.00 10.33 ? 196 SER E CA    1 
ATOM   8159  C  C     . SER E 2 196 ? 19.441  13.471  -104.488 1.00 7.88  ? 196 SER E C     1 
ATOM   8160  O  O     . SER E 2 196 ? 18.859  12.368  -104.519 1.00 11.61 ? 196 SER E O     1 
ATOM   8161  C  CB    . SER E 2 196 ? 20.600  14.303  -102.389 1.00 8.77  ? 196 SER E CB    1 
ATOM   8162  O  OG    . SER E 2 196 ? 20.591  13.082  -101.657 1.00 18.70 ? 196 SER E OG    1 
ATOM   8163  N  N     . GLU E 2 197 ? 20.189  13.918  -105.493 1.00 7.18  ? 197 GLU E N     1 
ATOM   8164  C  CA    . GLU E 2 197 ? 20.344  13.145  -106.695 1.00 2.00  ? 197 GLU E CA    1 
ATOM   8165  C  C     . GLU E 2 197 ? 21.491  12.148  -106.547 1.00 6.76  ? 197 GLU E C     1 
ATOM   8166  O  O     . GLU E 2 197 ? 22.662  12.544  -106.485 1.00 24.62 ? 197 GLU E O     1 
ATOM   8167  C  CB    . GLU E 2 197 ? 20.553  14.033  -107.889 1.00 2.00  ? 197 GLU E CB    1 
ATOM   8168  C  CG    . GLU E 2 197 ? 21.234  13.271  -108.994 1.00 2.00  ? 197 GLU E CG    1 
ATOM   8169  C  CD    . GLU E 2 197 ? 21.644  14.178  -110.092 1.00 2.00  ? 197 GLU E CD    1 
ATOM   8170  O  OE1   . GLU E 2 197 ? 21.580  15.402  -109.860 1.00 13.78 ? 197 GLU E OE1   1 
ATOM   8171  O  OE2   . GLU E 2 197 ? 22.028  13.700  -111.177 1.00 7.89  ? 197 GLU E OE2   1 
ATOM   8172  N  N     . VAL E 2 198 ? 21.145  10.871  -106.434 1.00 6.85  ? 198 VAL E N     1 
ATOM   8173  C  CA    . VAL E 2 198 ? 22.025  9.729   -106.650 1.00 2.00  ? 198 VAL E CA    1 
ATOM   8174  C  C     . VAL E 2 198 ? 22.762  9.813   -107.971 1.00 8.04  ? 198 VAL E C     1 
ATOM   8175  O  O     . VAL E 2 198 ? 22.320  10.475  -108.939 1.00 3.16  ? 198 VAL E O     1 
ATOM   8176  C  CB    . VAL E 2 198 ? 21.089  8.531   -106.702 1.00 8.76  ? 198 VAL E CB    1 
ATOM   8177  C  CG1   . VAL E 2 198 ? 21.532  7.405   -107.669 1.00 2.00  ? 198 VAL E CG1   1 
ATOM   8178  C  CG2   . VAL E 2 198 ? 20.570  8.151   -105.287 1.00 2.00  ? 198 VAL E CG2   1 
ATOM   8179  N  N     . SER E 2 199 ? 23.892  9.127   -108.028 1.00 5.70  ? 199 SER E N     1 
ATOM   8180  C  CA    . SER E 2 199 ? 24.699  9.119   -109.225 1.00 4.14  ? 199 SER E CA    1 
ATOM   8181  C  C     . SER E 2 199 ? 24.045  8.195   -110.264 1.00 7.23  ? 199 SER E C     1 
ATOM   8182  O  O     . SER E 2 199 ? 23.726  7.037   -109.983 1.00 7.29  ? 199 SER E O     1 
ATOM   8183  C  CB    . SER E 2 199 ? 26.096  8.578   -108.935 1.00 2.00  ? 199 SER E CB    1 
ATOM   8184  O  OG    . SER E 2 199 ? 26.621  8.059   -110.161 1.00 16.73 ? 199 SER E OG    1 
ATOM   8185  N  N     . PHE E 2 200 ? 23.814  8.684   -111.456 1.00 2.00  ? 200 PHE E N     1 
ATOM   8186  C  CA    . PHE E 2 200 ? 22.938  7.907   -112.276 1.00 4.82  ? 200 PHE E CA    1 
ATOM   8187  C  C     . PHE E 2 200 ? 23.711  6.719   -112.871 1.00 11.29 ? 200 PHE E C     1 
ATOM   8188  O  O     . PHE E 2 200 ? 23.175  5.618   -113.021 1.00 7.03  ? 200 PHE E O     1 
ATOM   8189  C  CB    . PHE E 2 200 ? 22.380  8.752   -113.418 1.00 5.65  ? 200 PHE E CB    1 
ATOM   8190  C  CG    . PHE E 2 200 ? 21.571  7.964   -114.353 1.00 4.32  ? 200 PHE E CG    1 
ATOM   8191  C  CD1   . PHE E 2 200 ? 20.267  7.597   -114.029 1.00 2.00  ? 200 PHE E CD1   1 
ATOM   8192  C  CD2   . PHE E 2 200 ? 22.109  7.504   -115.521 1.00 2.00  ? 200 PHE E CD2   1 
ATOM   8193  C  CE1   . PHE E 2 200 ? 19.526  6.816   -114.910 1.00 5.90  ? 200 PHE E CE1   1 
ATOM   8194  C  CE2   . PHE E 2 200 ? 21.344  6.704   -116.413 1.00 5.42  ? 200 PHE E CE2   1 
ATOM   8195  C  CZ    . PHE E 2 200 ? 20.072  6.360   -116.085 1.00 2.00  ? 200 PHE E CZ    1 
ATOM   8196  N  N     . SER E 2 201 ? 24.972  6.929   -113.258 1.00 7.61  ? 201 SER E N     1 
ATOM   8197  C  CA    . SER E 2 201 ? 25.683  5.788   -113.776 1.00 5.55  ? 201 SER E CA    1 
ATOM   8198  C  C     . SER E 2 201 ? 25.815  4.725   -112.682 1.00 2.90  ? 201 SER E C     1 
ATOM   8199  O  O     . SER E 2 201 ? 25.752  3.541   -112.987 1.00 16.92 ? 201 SER E O     1 
ATOM   8200  C  CB    . SER E 2 201 ? 27.026  6.144   -114.401 1.00 8.62  ? 201 SER E CB    1 
ATOM   8201  O  OG    . SER E 2 201 ? 27.860  6.745   -113.418 1.00 13.22 ? 201 SER E OG    1 
ATOM   8202  N  N     . ALA E 2 202 ? 25.933  5.117   -111.415 1.00 2.88  ? 202 ALA E N     1 
ATOM   8203  C  CA    . ALA E 2 202 ? 25.951  4.108   -110.317 1.00 7.64  ? 202 ALA E CA    1 
ATOM   8204  C  C     . ALA E 2 202 ? 24.623  3.359   -110.221 1.00 7.74  ? 202 ALA E C     1 
ATOM   8205  O  O     . ALA E 2 202 ? 24.561  2.113   -110.222 1.00 18.08 ? 202 ALA E O     1 
ATOM   8206  C  CB    . ALA E 2 202 ? 26.376  4.746   -108.919 1.00 2.00  ? 202 ALA E CB    1 
ATOM   8207  N  N     . LEU E 2 203 ? 23.549  4.121   -110.154 1.00 10.89 ? 203 LEU E N     1 
ATOM   8208  C  CA    . LEU E 2 203 ? 22.232  3.528   -110.244 1.00 12.80 ? 203 LEU E CA    1 
ATOM   8209  C  C     . LEU E 2 203 ? 22.122  2.594   -111.460 1.00 6.21  ? 203 LEU E C     1 
ATOM   8210  O  O     . LEU E 2 203 ? 21.602  1.509   -111.379 1.00 5.94  ? 203 LEU E O     1 
ATOM   8211  C  CB    . LEU E 2 203 ? 21.154  4.624   -110.255 1.00 2.86  ? 203 LEU E CB    1 
ATOM   8212  C  CG    . LEU E 2 203 ? 19.684  4.191   -110.205 1.00 6.46  ? 203 LEU E CG    1 
ATOM   8213  C  CD1   . LEU E 2 203 ? 19.278  3.658   -108.790 1.00 2.00  ? 203 LEU E CD1   1 
ATOM   8214  C  CD2   . LEU E 2 203 ? 18.852  5.388   -110.556 1.00 2.00  ? 203 LEU E CD2   1 
ATOM   8215  N  N     . GLU E 2 204 ? 22.590  2.993   -112.604 1.00 2.00  ? 204 GLU E N     1 
ATOM   8216  C  CA    . GLU E 2 204 ? 22.254  2.135   -113.730 1.00 8.71  ? 204 GLU E CA    1 
ATOM   8217  C  C     . GLU E 2 204 ? 23.064  0.817   -113.610 1.00 15.34 ? 204 GLU E C     1 
ATOM   8218  O  O     . GLU E 2 204 ? 22.583  -0.292  -113.926 1.00 13.66 ? 204 GLU E O     1 
ATOM   8219  C  CB    . GLU E 2 204 ? 22.621  2.837   -115.039 1.00 6.31  ? 204 GLU E CB    1 
ATOM   8220  C  CG    . GLU E 2 204 ? 22.868  1.847   -116.195 1.00 6.08  ? 204 GLU E CG    1 
ATOM   8221  C  CD    . GLU E 2 204 ? 22.965  2.527   -117.548 1.00 11.60 ? 204 GLU E CD    1 
ATOM   8222  O  OE1   . GLU E 2 204 ? 23.105  3.784   -117.585 1.00 39.64 ? 204 GLU E OE1   1 
ATOM   8223  O  OE2   . GLU E 2 204 ? 22.903  1.811   -118.574 1.00 13.68 ? 204 GLU E OE2   1 
ATOM   8224  N  N     . ARG E 2 205 ? 24.321  0.964   -113.186 1.00 20.15 ? 205 ARG E N     1 
ATOM   8225  C  CA    . ARG E 2 205 ? 25.255  -0.158  -112.994 1.00 14.88 ? 205 ARG E CA    1 
ATOM   8226  C  C     . ARG E 2 205 ? 24.691  -1.116  -111.916 1.00 21.01 ? 205 ARG E C     1 
ATOM   8227  O  O     . ARG E 2 205 ? 24.748  -2.366  -112.028 1.00 12.62 ? 205 ARG E O     1 
ATOM   8228  C  CB    . ARG E 2 205 ? 26.657  0.382   -112.623 1.00 9.74  ? 205 ARG E CB    1 
ATOM   8229  C  CG    . ARG E 2 205 ? 27.737  -0.140  -113.572 1.00 21.93 ? 205 ARG E CG    1 
ATOM   8230  C  CD    . ARG E 2 205 ? 29.155  0.309   -113.239 1.00 19.00 ? 205 ARG E CD    1 
ATOM   8231  N  NE    . ARG E 2 205 ? 29.157  1.744   -113.058 1.00 32.83 ? 205 ARG E NE    1 
ATOM   8232  C  CZ    . ARG E 2 205 ? 29.154  2.356   -111.871 1.00 40.50 ? 205 ARG E CZ    1 
ATOM   8233  N  NH1   . ARG E 2 205 ? 29.175  1.656   -110.708 1.00 2.00  ? 205 ARG E NH1   1 
ATOM   8234  N  NH2   . ARG E 2 205 ? 29.159  3.694   -111.852 1.00 13.07 ? 205 ARG E NH2   1 
ATOM   8235  N  N     . LEU E 2 206 ? 24.081  -0.496  -110.913 1.00 4.50  ? 206 LEU E N     1 
ATOM   8236  C  CA    . LEU E 2 206 ? 23.427  -1.205  -109.829 1.00 10.16 ? 206 LEU E CA    1 
ATOM   8237  C  C     . LEU E 2 206 ? 22.187  -2.038  -110.247 1.00 17.73 ? 206 LEU E C     1 
ATOM   8238  O  O     . LEU E 2 206 ? 22.064  -3.242  -109.908 1.00 3.61  ? 206 LEU E O     1 
ATOM   8239  C  CB    . LEU E 2 206 ? 23.047  -0.167  -108.776 1.00 3.26  ? 206 LEU E CB    1 
ATOM   8240  C  CG    . LEU E 2 206 ? 22.837  -0.679  -107.359 1.00 6.33  ? 206 LEU E CG    1 
ATOM   8241  C  CD1   . LEU E 2 206 ? 21.770  0.183   -106.566 1.00 10.72 ? 206 LEU E CD1   1 
ATOM   8242  C  CD2   . LEU E 2 206 ? 22.453  -2.107  -107.401 1.00 2.00  ? 206 LEU E CD2   1 
ATOM   8243  N  N     . VAL E 2 207 ? 21.275  -1.411  -110.996 1.00 14.49 ? 207 VAL E N     1 
ATOM   8244  C  CA    . VAL E 2 207 ? 20.045  -2.070  -111.407 1.00 3.63  ? 207 VAL E CA    1 
ATOM   8245  C  C     . VAL E 2 207 ? 20.523  -3.176  -112.365 1.00 9.56  ? 207 VAL E C     1 
ATOM   8246  O  O     . VAL E 2 207 ? 19.903  -4.263  -112.508 1.00 7.30  ? 207 VAL E O     1 
ATOM   8247  C  CB    . VAL E 2 207 ? 19.151  -1.044  -112.109 1.00 10.22 ? 207 VAL E CB    1 
ATOM   8248  C  CG1   . VAL E 2 207 ? 18.118  -1.695  -112.908 1.00 2.00  ? 207 VAL E CG1   1 
ATOM   8249  C  CG2   . VAL E 2 207 ? 18.541  -0.007  -111.070 1.00 2.00  ? 207 VAL E CG2   1 
ATOM   8250  N  N     . THR E 2 208 ? 21.644  -2.933  -113.032 1.00 7.33  ? 208 THR E N     1 
ATOM   8251  C  CA    . THR E 2 208 ? 21.898  -3.784  -114.185 1.00 12.02 ? 208 THR E CA    1 
ATOM   8252  C  C     . THR E 2 208 ? 22.371  -5.138  -113.691 1.00 14.63 ? 208 THR E C     1 
ATOM   8253  O  O     . THR E 2 208 ? 21.989  -6.185  -114.228 1.00 6.28  ? 208 THR E O     1 
ATOM   8254  C  CB    . THR E 2 208 ? 22.909  -3.186  -115.119 1.00 11.10 ? 208 THR E CB    1 
ATOM   8255  O  OG1   . THR E 2 208 ? 22.207  -2.402  -116.067 1.00 14.47 ? 208 THR E OG1   1 
ATOM   8256  C  CG2   . THR E 2 208 ? 23.669  -4.298  -115.875 1.00 7.46  ? 208 THR E CG2   1 
ATOM   8257  N  N     . ARG E 2 209 ? 23.182  -5.092  -112.635 1.00 9.28  ? 209 ARG E N     1 
ATOM   8258  C  CA    . ARG E 2 209 ? 23.696  -6.294  -111.973 1.00 6.89  ? 209 ARG E CA    1 
ATOM   8259  C  C     . ARG E 2 209 ? 22.855  -6.810  -110.789 1.00 4.55  ? 209 ARG E C     1 
ATOM   8260  O  O     . ARG E 2 209 ? 23.362  -7.565  -109.981 1.00 11.84 ? 209 ARG E O     1 
ATOM   8261  C  CB    . ARG E 2 209 ? 25.153  -6.058  -111.485 1.00 5.38  ? 209 ARG E CB    1 
ATOM   8262  C  CG    . ARG E 2 209 ? 25.220  -5.233  -110.171 1.00 4.24  ? 209 ARG E CG    1 
ATOM   8263  C  CD    . ARG E 2 209 ? 26.684  -4.932  -109.695 1.00 5.00  ? 209 ARG E CD    1 
ATOM   8264  N  NE    . ARG E 2 209 ? 26.720  -4.173  -108.428 1.00 2.00  ? 209 ARG E NE    1 
ATOM   8265  C  CZ    . ARG E 2 209 ? 26.771  -2.845  -108.367 1.00 9.10  ? 209 ARG E CZ    1 
ATOM   8266  N  NH1   . ARG E 2 209 ? 26.792  -2.126  -109.505 1.00 2.00  ? 209 ARG E NH1   1 
ATOM   8267  N  NH2   . ARG E 2 209 ? 26.781  -2.234  -107.180 1.00 2.00  ? 209 ARG E NH2   1 
ATOM   8268  N  N     . CYS E 2 210 ? 21.575  -6.462  -110.677 1.00 12.67 ? 210 CYS E N     1 
ATOM   8269  C  CA    . CYS E 2 210 ? 20.729  -7.177  -109.718 1.00 6.26  ? 210 CYS E CA    1 
ATOM   8270  C  C     . CYS E 2 210 ? 19.507  -7.872  -110.294 1.00 7.05  ? 210 CYS E C     1 
ATOM   8271  O  O     . CYS E 2 210 ? 18.414  -7.376  -110.146 1.00 17.93 ? 210 CYS E O     1 
ATOM   8272  C  CB    . CYS E 2 210 ? 20.303  -6.297  -108.558 1.00 5.50  ? 210 CYS E CB    1 
ATOM   8273  S  SG    . CYS E 2 210 ? 21.561  -5.257  -107.686 1.00 2.56  ? 210 CYS E SG    1 
ATOM   8274  N  N     . PRO E 2 211 ? 19.691  -9.064  -110.882 1.00 11.21 ? 211 PRO E N     1 
ATOM   8275  C  CA    . PRO E 2 211 ? 18.685  -9.777  -111.672 1.00 9.69  ? 211 PRO E CA    1 
ATOM   8276  C  C     . PRO E 2 211 ? 17.344  -10.024 -110.987 1.00 7.85  ? 211 PRO E C     1 
ATOM   8277  O  O     . PRO E 2 211 ? 16.347  -10.156 -111.683 1.00 11.09 ? 211 PRO E O     1 
ATOM   8278  C  CB    . PRO E 2 211 ? 19.341  -11.135 -111.943 1.00 9.22  ? 211 PRO E CB    1 
ATOM   8279  C  CG    . PRO E 2 211 ? 20.507  -11.223 -110.991 1.00 8.42  ? 211 PRO E CG    1 
ATOM   8280  C  CD    . PRO E 2 211 ? 20.962  -9.817  -110.801 1.00 4.27  ? 211 PRO E CD    1 
ATOM   8281  N  N     . ASN E 2 212 ? 17.306  -10.097 -109.660 1.00 8.39  ? 212 ASN E N     1 
ATOM   8282  C  CA    . ASN E 2 212 ? 16.036  -10.300 -108.918 1.00 9.52  ? 212 ASN E CA    1 
ATOM   8283  C  C     . ASN E 2 212 ? 15.298  -9.031  -108.432 1.00 11.85 ? 212 ASN E C     1 
ATOM   8284  O  O     . ASN E 2 212 ? 14.238  -9.114  -107.763 1.00 2.00  ? 212 ASN E O     1 
ATOM   8285  C  CB    . ASN E 2 212 ? 16.267  -11.192 -107.675 1.00 17.90 ? 212 ASN E CB    1 
ATOM   8286  C  CG    . ASN E 2 212 ? 17.175  -12.368 -107.955 1.00 11.32 ? 212 ASN E CG    1 
ATOM   8287  O  OD1   . ASN E 2 212 ? 16.753  -13.332 -108.534 1.00 2.00  ? 212 ASN E OD1   1 
ATOM   8288  N  ND2   . ASN E 2 212 ? 18.426  -12.276 -107.554 1.00 7.94  ? 212 ASN E ND2   1 
ATOM   8289  N  N     . LEU E 2 213 ? 15.883  -7.874  -108.729 1.00 7.59  ? 213 LEU E N     1 
ATOM   8290  C  CA    . LEU E 2 213 ? 15.182  -6.591  -108.628 1.00 4.80  ? 213 LEU E CA    1 
ATOM   8291  C  C     . LEU E 2 213 ? 13.724  -6.705  -109.082 1.00 2.22  ? 213 LEU E C     1 
ATOM   8292  O  O     . LEU E 2 213 ? 13.469  -7.120  -110.201 1.00 5.15  ? 213 LEU E O     1 
ATOM   8293  C  CB    . LEU E 2 213 ? 15.915  -5.561  -109.502 1.00 2.00  ? 213 LEU E CB    1 
ATOM   8294  C  CG    . LEU E 2 213 ? 15.447  -4.142  -109.154 1.00 2.00  ? 213 LEU E CG    1 
ATOM   8295  C  CD1   . LEU E 2 213 ? 15.647  -3.706  -107.667 1.00 6.04  ? 213 LEU E CD1   1 
ATOM   8296  C  CD2   . LEU E 2 213 ? 15.997  -3.197  -110.108 1.00 3.00  ? 213 LEU E CD2   1 
ATOM   8297  N  N     . LYS E 2 214 ? 12.777  -6.379  -108.205 1.00 2.30  ? 214 LYS E N     1 
ATOM   8298  C  CA    . LYS E 2 214 ? 11.376  -6.523  -108.501 1.00 2.00  ? 214 LYS E CA    1 
ATOM   8299  C  C     . LYS E 2 214 ? 10.630  -5.207  -108.214 1.00 4.15  ? 214 LYS E C     1 
ATOM   8300  O  O     . LYS E 2 214 ? 9.505   -5.020  -108.727 1.00 3.35  ? 214 LYS E O     1 
ATOM   8301  C  CB    . LYS E 2 214 ? 10.743  -7.642  -107.644 1.00 2.00  ? 214 LYS E CB    1 
ATOM   8302  C  CG    . LYS E 2 214 ? 10.884  -9.124  -108.146 1.00 2.94  ? 214 LYS E CG    1 
ATOM   8303  C  CD    . LYS E 2 214 ? 11.340  -9.237  -109.588 1.00 2.00  ? 214 LYS E CD    1 
ATOM   8304  C  CE    . LYS E 2 214 ? 11.477  -10.739 -110.005 1.00 23.71 ? 214 LYS E CE    1 
ATOM   8305  N  NZ    . LYS E 2 214 ? 10.535  -11.640 -109.273 1.00 15.64 ? 214 LYS E NZ    1 
ATOM   8306  N  N     . SER E 2 215 ? 11.174  -4.353  -107.323 1.00 4.57  ? 215 SER E N     1 
ATOM   8307  C  CA    . SER E 2 215 ? 10.542  -3.063  -106.984 1.00 2.85  ? 215 SER E CA    1 
ATOM   8308  C  C     . SER E 2 215 ? 11.559  -1.895  -106.957 1.00 6.89  ? 215 SER E C     1 
ATOM   8309  O  O     . SER E 2 215 ? 12.329  -1.764  -105.997 1.00 9.57  ? 215 SER E O     1 
ATOM   8310  C  CB    . SER E 2 215 ? 9.810   -3.192  -105.659 1.00 5.08  ? 215 SER E CB    1 
ATOM   8311  O  OG    . SER E 2 215 ? 9.121   -1.987  -105.191 1.00 8.21  ? 215 SER E OG    1 
ATOM   8312  N  N     . LEU E 2 216 ? 11.565  -1.075  -108.013 1.00 4.45  ? 216 LEU E N     1 
ATOM   8313  C  CA    . LEU E 2 216 ? 12.350  0.210   -108.112 1.00 5.02  ? 216 LEU E CA    1 
ATOM   8314  C  C     . LEU E 2 216 ? 11.432  1.494   -108.019 1.00 3.03  ? 216 LEU E C     1 
ATOM   8315  O  O     . LEU E 2 216 ? 10.703  1.840   -108.958 1.00 2.00  ? 216 LEU E O     1 
ATOM   8316  C  CB    . LEU E 2 216 ? 13.126  0.237   -109.399 1.00 2.00  ? 216 LEU E CB    1 
ATOM   8317  C  CG    . LEU E 2 216 ? 14.236  1.282   -109.600 1.00 9.40  ? 216 LEU E CG    1 
ATOM   8318  C  CD1   . LEU E 2 216 ? 15.385  1.386   -108.470 1.00 2.00  ? 216 LEU E CD1   1 
ATOM   8319  C  CD2   . LEU E 2 216 ? 14.884  0.983   -110.976 1.00 2.00  ? 216 LEU E CD2   1 
ATOM   8320  N  N     . LYS E 2 217 ? 11.433  2.115   -106.853 1.00 2.00  ? 217 LYS E N     1 
ATOM   8321  C  CA    . LYS E 2 217 ? 10.766  3.386   -106.679 1.00 4.57  ? 217 LYS E CA    1 
ATOM   8322  C  C     . LYS E 2 217 ? 11.745  4.593   -106.586 1.00 5.00  ? 217 LYS E C     1 
ATOM   8323  O  O     . LYS E 2 217 ? 12.428  4.763   -105.568 1.00 6.79  ? 217 LYS E O     1 
ATOM   8324  C  CB    . LYS E 2 217 ? 9.847   3.337   -105.473 1.00 3.47  ? 217 LYS E CB    1 
ATOM   8325  C  CG    . LYS E 2 217 ? 8.764   2.333   -105.716 1.00 6.43  ? 217 LYS E CG    1 
ATOM   8326  C  CD    . LYS E 2 217 ? 7.930   2.253   -104.503 1.00 10.46 ? 217 LYS E CD    1 
ATOM   8327  C  CE    . LYS E 2 217 ? 7.195   0.967   -104.571 1.00 12.05 ? 217 LYS E CE    1 
ATOM   8328  N  NZ    . LYS E 2 217 ? 5.913   0.978   -103.739 1.00 3.19  ? 217 LYS E NZ    1 
ATOM   8329  N  N     . LEU E 2 218 ? 11.795  5.401   -107.640 1.00 2.00  ? 218 LEU E N     1 
ATOM   8330  C  CA    . LEU E 2 218 ? 12.866  6.375   -107.809 1.00 2.60  ? 218 LEU E CA    1 
ATOM   8331  C  C     . LEU E 2 218 ? 12.558  7.668   -107.061 1.00 7.51  ? 218 LEU E C     1 
ATOM   8332  O  O     . LEU E 2 218 ? 11.401  7.964   -106.763 1.00 3.96  ? 218 LEU E O     1 
ATOM   8333  C  CB    . LEU E 2 218 ? 13.095  6.669   -109.293 1.00 2.00  ? 218 LEU E CB    1 
ATOM   8334  C  CG    . LEU E 2 218 ? 13.538  5.486   -110.157 1.00 4.97  ? 218 LEU E CG    1 
ATOM   8335  C  CD1   . LEU E 2 218 ? 13.629  5.893   -111.619 1.00 2.00  ? 218 LEU E CD1   1 
ATOM   8336  C  CD2   . LEU E 2 218 ? 14.867  4.930   -109.667 1.00 2.00  ? 218 LEU E CD2   1 
ATOM   8337  N  N     . ASN E 2 219 ? 13.601  8.435   -106.760 1.00 9.35  ? 219 ASN E N     1 
ATOM   8338  C  CA    . ASN E 2 219 ? 13.434  9.788   -106.243 1.00 4.42  ? 219 ASN E CA    1 
ATOM   8339  C  C     . ASN E 2 219 ? 13.253  10.813  -107.357 1.00 4.60  ? 219 ASN E C     1 
ATOM   8340  O  O     . ASN E 2 219 ? 13.619  10.565  -108.506 1.00 9.09  ? 219 ASN E O     1 
ATOM   8341  C  CB    . ASN E 2 219 ? 14.622  10.175  -105.360 1.00 3.80  ? 219 ASN E CB    1 
ATOM   8342  C  CG    . ASN E 2 219 ? 15.900  10.364  -106.153 1.00 4.72  ? 219 ASN E CG    1 
ATOM   8343  O  OD1   . ASN E 2 219 ? 16.787  11.116  -105.752 1.00 7.36  ? 219 ASN E OD1   1 
ATOM   8344  N  ND2   . ASN E 2 219 ? 16.000  9.679   -107.286 1.00 2.00  ? 219 ASN E ND2   1 
ATOM   8345  N  N     . ARG E 2 220 ? 12.688  11.964  -107.010 1.00 11.29 ? 220 ARG E N     1 
ATOM   8346  C  CA    . ARG E 2 220 ? 12.294  12.955  -108.005 1.00 10.06 ? 220 ARG E CA    1 
ATOM   8347  C  C     . ARG E 2 220 ? 13.400  13.174  -109.032 1.00 2.00  ? 220 ARG E C     1 
ATOM   8348  O  O     . ARG E 2 220 ? 13.129  13.387  -110.214 1.00 2.00  ? 220 ARG E O     1 
ATOM   8349  C  CB    . ARG E 2 220 ? 11.936  14.280  -107.328 1.00 4.00  ? 220 ARG E CB    1 
ATOM   8350  C  CG    . ARG E 2 220 ? 11.445  15.353  -108.287 1.00 18.87 ? 220 ARG E CG    1 
ATOM   8351  C  CD    . ARG E 2 220 ? 11.036  16.651  -107.609 1.00 2.36  ? 220 ARG E CD    1 
ATOM   8352  N  NE    . ARG E 2 220 ? 9.875   17.261  -108.250 1.00 4.47  ? 220 ARG E NE    1 
ATOM   8353  C  CZ    . ARG E 2 220 ? 8.728   17.511  -107.634 1.00 45.95 ? 220 ARG E CZ    1 
ATOM   8354  N  NH1   . ARG E 2 220 ? 8.582   17.204  -106.352 1.00 21.09 ? 220 ARG E NH1   1 
ATOM   8355  N  NH2   . ARG E 2 220 ? 7.725   18.070  -108.297 1.00 48.87 ? 220 ARG E NH2   1 
ATOM   8356  N  N     . ALA E 2 221 ? 14.646  13.119  -108.574 1.00 2.00  ? 221 ALA E N     1 
ATOM   8357  C  CA    . ALA E 2 221 ? 15.749  13.645  -109.325 1.00 2.00  ? 221 ALA E CA    1 
ATOM   8358  C  C     . ALA E 2 221 ? 16.263  12.665  -110.333 1.00 3.19  ? 221 ALA E C     1 
ATOM   8359  O  O     . ALA E 2 221 ? 17.209  13.005  -111.038 1.00 10.59 ? 221 ALA E O     1 
ATOM   8360  C  CB    . ALA E 2 221 ? 16.906  14.081  -108.399 1.00 2.07  ? 221 ALA E CB    1 
ATOM   8361  N  N     . VAL E 2 222 ? 15.663  11.483  -110.472 1.00 2.00  ? 222 VAL E N     1 
ATOM   8362  C  CA    . VAL E 2 222 ? 15.814  10.873  -111.766 1.00 3.55  ? 222 VAL E CA    1 
ATOM   8363  C  C     . VAL E 2 222 ? 14.877  11.375  -112.838 1.00 2.15  ? 222 VAL E C     1 
ATOM   8364  O  O     . VAL E 2 222 ? 13.662  11.141  -112.786 1.00 9.04  ? 222 VAL E O     1 
ATOM   8365  C  CB    . VAL E 2 222 ? 15.789  9.396   -111.782 1.00 3.27  ? 222 VAL E CB    1 
ATOM   8366  C  CG1   . VAL E 2 222 ? 16.402  9.029   -113.065 1.00 2.36  ? 222 VAL E CG1   1 
ATOM   8367  C  CG2   . VAL E 2 222 ? 16.565  8.876   -110.624 1.00 2.00  ? 222 VAL E CG2   1 
ATOM   8368  N  N     . PRO E 2 223 ? 15.431  12.050  -113.826 1.00 4.98  ? 223 PRO E N     1 
ATOM   8369  C  CA    . PRO E 2 223 ? 14.642  12.768  -114.838 1.00 2.40  ? 223 PRO E CA    1 
ATOM   8370  C  C     . PRO E 2 223 ? 14.025  11.777  -115.836 1.00 4.67  ? 223 PRO E C     1 
ATOM   8371  O  O     . PRO E 2 223 ? 14.640  10.801  -116.239 1.00 2.00  ? 223 PRO E O     1 
ATOM   8372  C  CB    . PRO E 2 223 ? 15.655  13.724  -115.515 1.00 2.00  ? 223 PRO E CB    1 
ATOM   8373  C  CG    . PRO E 2 223 ? 16.994  13.083  -115.267 1.00 6.98  ? 223 PRO E CG    1 
ATOM   8374  C  CD    . PRO E 2 223 ? 16.880  12.103  -114.075 1.00 10.85 ? 223 PRO E CD    1 
ATOM   8375  N  N     . LEU E 2 224 ? 12.785  12.056  -116.218 1.00 15.06 ? 224 LEU E N     1 
ATOM   8376  C  CA    . LEU E 2 224 ? 12.101  11.348  -117.263 1.00 2.00  ? 224 LEU E CA    1 
ATOM   8377  C  C     . LEU E 2 224 ? 12.936  10.811  -118.390 1.00 7.16  ? 224 LEU E C     1 
ATOM   8378  O  O     . LEU E 2 224 ? 12.777  9.648   -118.756 1.00 8.23  ? 224 LEU E O     1 
ATOM   8379  C  CB    . LEU E 2 224 ? 11.017  12.216  -117.849 1.00 13.28 ? 224 LEU E CB    1 
ATOM   8380  C  CG    . LEU E 2 224 ? 10.217  11.268  -118.731 1.00 15.97 ? 224 LEU E CG    1 
ATOM   8381  C  CD1   . LEU E 2 224 ? 9.827   10.151  -117.771 1.00 15.78 ? 224 LEU E CD1   1 
ATOM   8382  C  CD2   . LEU E 2 224 ? 8.968   11.934  -119.218 1.00 2.00  ? 224 LEU E CD2   1 
ATOM   8383  N  N     . GLU E 2 225 ? 13.791  11.640  -118.978 1.00 3.36  ? 225 GLU E N     1 
ATOM   8384  C  CA    . GLU E 2 225 ? 14.606  11.212  -120.104 1.00 6.81  ? 225 GLU E CA    1 
ATOM   8385  C  C     . GLU E 2 225 ? 15.559  10.072  -119.743 1.00 14.59 ? 225 GLU E C     1 
ATOM   8386  O  O     . GLU E 2 225 ? 16.055  9.369   -120.622 1.00 11.61 ? 225 GLU E O     1 
ATOM   8387  C  CB    . GLU E 2 225 ? 15.515  12.337  -120.581 1.00 14.59 ? 225 GLU E CB    1 
ATOM   8388  C  CG    . GLU E 2 225 ? 14.799  13.417  -121.360 1.00 19.78 ? 225 GLU E CG    1 
ATOM   8389  C  CD    . GLU E 2 225 ? 14.456  14.630  -120.492 1.00 48.51 ? 225 GLU E CD    1 
ATOM   8390  O  OE1   . GLU E 2 225 ? 14.642  15.749  -121.057 1.00 44.84 ? 225 GLU E OE1   1 
ATOM   8391  O  OE2   . GLU E 2 225 ? 14.009  14.467  -119.283 1.00 20.04 ? 225 GLU E OE2   1 
ATOM   8392  N  N     . LYS E 2 226 ? 15.877  9.909   -118.466 1.00 12.76 ? 226 LYS E N     1 
ATOM   8393  C  CA    . LYS E 2 226 ? 16.752  8.821   -118.120 1.00 6.51  ? 226 LYS E CA    1 
ATOM   8394  C  C     . LYS E 2 226 ? 15.929  7.538   -117.855 1.00 8.19  ? 226 LYS E C     1 
ATOM   8395  O  O     . LYS E 2 226 ? 16.490  6.465   -117.716 1.00 8.66  ? 226 LYS E O     1 
ATOM   8396  C  CB    . LYS E 2 226 ? 17.633  9.211   -116.933 1.00 15.92 ? 226 LYS E CB    1 
ATOM   8397  C  CG    . LYS E 2 226 ? 18.622  10.381  -117.223 1.00 15.77 ? 226 LYS E CG    1 
ATOM   8398  C  CD    . LYS E 2 226 ? 19.527  10.095  -118.428 1.00 20.05 ? 226 LYS E CD    1 
ATOM   8399  C  CE    . LYS E 2 226 ? 21.023  10.449  -118.234 1.00 38.77 ? 226 LYS E CE    1 
ATOM   8400  N  NZ    . LYS E 2 226 ? 21.346  10.889  -116.845 1.00 58.97 ? 226 LYS E NZ    1 
ATOM   8401  N  N     . LEU E 2 227 ? 14.606  7.646   -117.771 1.00 3.81  ? 227 LEU E N     1 
ATOM   8402  C  CA    . LEU E 2 227 ? 13.782  6.557   -117.261 1.00 2.40  ? 227 LEU E CA    1 
ATOM   8403  C  C     . LEU E 2 227 ? 13.939  5.254   -118.115 1.00 14.02 ? 227 LEU E C     1 
ATOM   8404  O  O     . LEU E 2 227 ? 14.204  4.158   -117.576 1.00 10.77 ? 227 LEU E O     1 
ATOM   8405  C  CB    . LEU E 2 227 ? 12.307  7.017   -117.156 1.00 5.11  ? 227 LEU E CB    1 
ATOM   8406  C  CG    . LEU E 2 227 ? 11.361  6.410   -116.101 1.00 16.24 ? 227 LEU E CG    1 
ATOM   8407  C  CD1   . LEU E 2 227 ? 9.901   6.302   -116.446 1.00 2.00  ? 227 LEU E CD1   1 
ATOM   8408  C  CD2   . LEU E 2 227 ? 11.880  5.135   -115.372 1.00 7.98  ? 227 LEU E CD2   1 
ATOM   8409  N  N     . ALA E 2 228 ? 13.791  5.372   -119.441 1.00 9.26  ? 228 ALA E N     1 
ATOM   8410  C  CA    . ALA E 2 228 ? 13.971  4.216   -120.356 1.00 13.04 ? 228 ALA E CA    1 
ATOM   8411  C  C     . ALA E 2 228 ? 15.251  3.413   -120.178 1.00 13.57 ? 228 ALA E C     1 
ATOM   8412  O  O     . ALA E 2 228 ? 15.168  2.207   -120.007 1.00 21.18 ? 228 ALA E O     1 
ATOM   8413  C  CB    . ALA E 2 228 ? 13.818  4.645   -121.872 1.00 2.00  ? 228 ALA E CB    1 
ATOM   8414  N  N     . THR E 2 229 ? 16.422  4.049   -120.309 1.00 2.00  ? 229 THR E N     1 
ATOM   8415  C  CA    . THR E 2 229 ? 17.692  3.474   -119.823 1.00 8.71  ? 229 THR E CA    1 
ATOM   8416  C  C     . THR E 2 229 ? 17.529  2.494   -118.640 1.00 12.41 ? 229 THR E C     1 
ATOM   8417  O  O     . THR E 2 229 ? 17.949  1.340   -118.740 1.00 18.87 ? 229 THR E O     1 
ATOM   8418  C  CB    . THR E 2 229 ? 18.740  4.590   -119.407 1.00 12.11 ? 229 THR E CB    1 
ATOM   8419  O  OG1   . THR E 2 229 ? 19.197  5.262   -120.576 1.00 8.57  ? 229 THR E OG1   1 
ATOM   8420  C  CG2   . THR E 2 229 ? 19.955  3.981   -118.764 1.00 26.55 ? 229 THR E CG2   1 
ATOM   8421  N  N     . LEU E 2 230 ? 16.940  2.946   -117.532 1.00 2.00  ? 230 LEU E N     1 
ATOM   8422  C  CA    . LEU E 2 230 ? 16.844  2.110   -116.339 1.00 11.19 ? 230 LEU E CA    1 
ATOM   8423  C  C     . LEU E 2 230 ? 15.891  0.942   -116.691 1.00 11.30 ? 230 LEU E C     1 
ATOM   8424  O  O     . LEU E 2 230 ? 16.188  -0.192  -116.366 1.00 14.09 ? 230 LEU E O     1 
ATOM   8425  C  CB    . LEU E 2 230 ? 16.344  2.900   -115.039 1.00 2.20  ? 230 LEU E CB    1 
ATOM   8426  C  CG    . LEU E 2 230 ? 17.234  4.017   -114.458 1.00 2.00  ? 230 LEU E CG    1 
ATOM   8427  C  CD1   . LEU E 2 230 ? 16.780  4.374   -113.138 1.00 7.50  ? 230 LEU E CD1   1 
ATOM   8428  C  CD2   . LEU E 2 230 ? 18.699  3.677   -114.347 1.00 2.00  ? 230 LEU E CD2   1 
ATOM   8429  N  N     . LEU E 2 231 ? 14.750  1.236   -117.322 1.00 7.54  ? 231 LEU E N     1 
ATOM   8430  C  CA    . LEU E 2 231 ? 13.776  0.230   -117.653 1.00 8.59  ? 231 LEU E CA    1 
ATOM   8431  C  C     . LEU E 2 231 ? 14.335  -0.886  -118.569 1.00 3.02  ? 231 LEU E C     1 
ATOM   8432  O  O     . LEU E 2 231 ? 14.005  -2.030  -118.357 1.00 4.00  ? 231 LEU E O     1 
ATOM   8433  C  CB    . LEU E 2 231 ? 12.501  0.868   -118.271 1.00 3.52  ? 231 LEU E CB    1 
ATOM   8434  C  CG    . LEU E 2 231 ? 11.580  1.583   -117.290 1.00 2.00  ? 231 LEU E CG    1 
ATOM   8435  C  CD1   . LEU E 2 231 ? 10.286  1.925   -117.825 1.00 2.00  ? 231 LEU E CD1   1 
ATOM   8436  C  CD2   . LEU E 2 231 ? 11.430  0.955   -115.927 1.00 2.00  ? 231 LEU E CD2   1 
ATOM   8437  N  N     . GLN E 2 232 ? 15.183  -0.558  -119.547 1.00 2.72  ? 232 GLN E N     1 
ATOM   8438  C  CA    . GLN E 2 232 ? 15.857  -1.551  -120.414 1.00 3.00  ? 232 GLN E CA    1 
ATOM   8439  C  C     . GLN E 2 232 ? 16.767  -2.501  -119.600 1.00 13.85 ? 232 GLN E C     1 
ATOM   8440  O  O     . GLN E 2 232 ? 17.030  -3.660  -119.995 1.00 8.01  ? 232 GLN E O     1 
ATOM   8441  C  CB    . GLN E 2 232 ? 16.783  -0.834  -121.421 1.00 6.64  ? 232 GLN E CB    1 
ATOM   8442  C  CG    . GLN E 2 232 ? 16.098  0.151   -122.407 1.00 18.58 ? 232 GLN E CG    1 
ATOM   8443  C  CD    . GLN E 2 232 ? 15.296  -0.589  -123.477 1.00 47.81 ? 232 GLN E CD    1 
ATOM   8444  O  OE1   . GLN E 2 232 ? 15.540  -1.771  -123.707 1.00 63.44 ? 232 GLN E OE1   1 
ATOM   8445  N  NE2   . GLN E 2 232 ? 14.318  0.083   -124.107 1.00 11.59 ? 232 GLN E NE2   1 
ATOM   8446  N  N     . ARG E 2 233 ? 17.294  -1.997  -118.487 1.00 4.30  ? 233 ARG E N     1 
ATOM   8447  C  CA    . ARG E 2 233 ? 18.216  -2.784  -117.699 1.00 2.29  ? 233 ARG E CA    1 
ATOM   8448  C  C     . ARG E 2 233 ? 17.386  -3.583  -116.691 1.00 4.03  ? 233 ARG E C     1 
ATOM   8449  O  O     . ARG E 2 233 ? 17.920  -4.350  -115.902 1.00 9.75  ? 233 ARG E O     1 
ATOM   8450  C  CB    . ARG E 2 233 ? 19.216  -1.884  -116.941 1.00 4.59  ? 233 ARG E CB    1 
ATOM   8451  C  CG    . ARG E 2 233 ? 19.976  -0.881  -117.754 1.00 2.00  ? 233 ARG E CG    1 
ATOM   8452  C  CD    . ARG E 2 233 ? 20.817  -1.571  -118.708 1.00 2.00  ? 233 ARG E CD    1 
ATOM   8453  N  NE    . ARG E 2 233 ? 22.098  -0.887  -118.934 1.00 29.02 ? 233 ARG E NE    1 
ATOM   8454  C  CZ    . ARG E 2 233 ? 23.205  -1.482  -119.387 1.00 28.68 ? 233 ARG E CZ    1 
ATOM   8455  N  NH1   . ARG E 2 233 ? 23.215  -2.789  -119.635 1.00 37.76 ? 233 ARG E NH1   1 
ATOM   8456  N  NH2   . ARG E 2 233 ? 24.314  -0.779  -119.587 1.00 26.81 ? 233 ARG E NH2   1 
ATOM   8457  N  N     . ALA E 2 234 ? 16.070  -3.425  -116.667 1.00 5.07  ? 234 ALA E N     1 
ATOM   8458  C  CA    . ALA E 2 234 ? 15.312  -4.117  -115.602 1.00 2.00  ? 234 ALA E CA    1 
ATOM   8459  C  C     . ALA E 2 234 ? 13.902  -4.407  -115.991 1.00 8.10  ? 234 ALA E C     1 
ATOM   8460  O  O     . ALA E 2 234 ? 12.948  -3.955  -115.310 1.00 5.49  ? 234 ALA E O     1 
ATOM   8461  C  CB    . ALA E 2 234 ? 15.349  -3.356  -114.314 1.00 2.00  ? 234 ALA E CB    1 
ATOM   8462  N  N     . PRO E 2 235 ? 13.760  -5.181  -117.086 1.00 6.42  ? 235 PRO E N     1 
ATOM   8463  C  CA    . PRO E 2 235 ? 12.484  -5.517  -117.655 1.00 2.00  ? 235 PRO E CA    1 
ATOM   8464  C  C     . PRO E 2 235 ? 11.614  -6.419  -116.757 1.00 8.79  ? 235 PRO E C     1 
ATOM   8465  O  O     . PRO E 2 235 ? 10.422  -6.555  -117.013 1.00 7.34  ? 235 PRO E O     1 
ATOM   8466  C  CB    . PRO E 2 235 ? 12.849  -6.219  -118.968 1.00 2.00  ? 235 PRO E CB    1 
ATOM   8467  C  CG    . PRO E 2 235 ? 14.254  -6.702  -118.816 1.00 2.00  ? 235 PRO E CG    1 
ATOM   8468  C  CD    . PRO E 2 235 ? 14.908  -5.768  -117.821 1.00 3.94  ? 235 PRO E CD    1 
ATOM   8469  N  N     . GLN E 2 236 ? 12.158  -7.028  -115.704 1.00 3.67  ? 236 GLN E N     1 
ATOM   8470  C  CA    . GLN E 2 236 ? 11.366  -8.010  -114.930 1.00 7.56  ? 236 GLN E CA    1 
ATOM   8471  C  C     . GLN E 2 236 ? 10.509  -7.389  -113.792 1.00 2.00  ? 236 GLN E C     1 
ATOM   8472  O  O     . GLN E 2 236 ? 9.962   -8.111  -112.913 1.00 11.03 ? 236 GLN E O     1 
ATOM   8473  C  CB    . GLN E 2 236 ? 12.293  -9.078  -114.354 1.00 2.60  ? 236 GLN E CB    1 
ATOM   8474  C  CG    . GLN E 2 236 ? 13.067  -8.515  -113.136 1.00 4.56  ? 236 GLN E CG    1 
ATOM   8475  C  CD    . GLN E 2 236 ? 14.236  -7.613  -113.554 1.00 5.03  ? 236 GLN E CD    1 
ATOM   8476  O  OE1   . GLN E 2 236 ? 14.619  -7.570  -114.732 1.00 3.50  ? 236 GLN E OE1   1 
ATOM   8477  N  NE2   . GLN E 2 236 ? 14.805  -6.906  -112.600 1.00 2.00  ? 236 GLN E NE2   1 
ATOM   8478  N  N     . LEU E 2 237 ? 10.347  -6.076  -113.824 1.00 6.06  ? 237 LEU E N     1 
ATOM   8479  C  CA    . LEU E 2 237 ? 9.817   -5.296  -112.675 1.00 3.25  ? 237 LEU E CA    1 
ATOM   8480  C  C     . LEU E 2 237 ? 8.339   -5.487  -112.374 1.00 4.03  ? 237 LEU E C     1 
ATOM   8481  O  O     . LEU E 2 237 ? 7.540   -5.606  -113.244 1.00 2.00  ? 237 LEU E O     1 
ATOM   8482  C  CB    . LEU E 2 237 ? 10.010  -3.824  -112.925 1.00 5.85  ? 237 LEU E CB    1 
ATOM   8483  C  CG    . LEU E 2 237 ? 10.973  -3.115  -112.019 1.00 2.08  ? 237 LEU E CG    1 
ATOM   8484  C  CD1   . LEU E 2 237 ? 12.125  -4.067  -111.942 1.00 20.20 ? 237 LEU E CD1   1 
ATOM   8485  C  CD2   . LEU E 2 237 ? 11.409  -1.876  -112.717 1.00 2.32  ? 237 LEU E CD2   1 
ATOM   8486  N  N     . GLU E 2 238 ? 7.985   -5.496  -111.118 1.00 2.00  ? 238 GLU E N     1 
ATOM   8487  C  CA    . GLU E 2 238 ? 6.615   -5.648  -110.752 1.00 11.41 ? 238 GLU E CA    1 
ATOM   8488  C  C     . GLU E 2 238 ? 6.017   -4.333  -110.171 1.00 13.32 ? 238 GLU E C     1 
ATOM   8489  O  O     . GLU E 2 238 ? 4.814   -4.202  -110.108 1.00 21.52 ? 238 GLU E O     1 
ATOM   8490  C  CB    . GLU E 2 238 ? 6.492   -6.822  -109.732 1.00 9.90  ? 238 GLU E CB    1 
ATOM   8491  C  CG    . GLU E 2 238 ? 6.817   -8.153  -110.356 1.00 3.84  ? 238 GLU E CG    1 
ATOM   8492  C  CD    . GLU E 2 238 ? 6.727   -9.323  -109.389 1.00 14.73 ? 238 GLU E CD    1 
ATOM   8493  O  OE1   . GLU E 2 238 ? 6.365   -9.052  -108.245 1.00 7.66  ? 238 GLU E OE1   1 
ATOM   8494  O  OE2   . GLU E 2 238 ? 7.048   -10.499 -109.764 1.00 18.65 ? 238 GLU E OE2   1 
ATOM   8495  N  N     . GLU E 2 239 ? 6.854   -3.408  -109.703 1.00 6.57  ? 239 GLU E N     1 
ATOM   8496  C  CA    . GLU E 2 239 ? 6.429   -2.167  -109.030 1.00 2.00  ? 239 GLU E CA    1 
ATOM   8497  C  C     . GLU E 2 239 ? 7.439   -1.192  -109.582 1.00 11.28 ? 239 GLU E C     1 
ATOM   8498  O  O     . GLU E 2 239 ? 8.673   -1.413  -109.419 1.00 18.98 ? 239 GLU E O     1 
ATOM   8499  C  CB    . GLU E 2 239 ? 6.648   -2.292  -107.528 1.00 2.00  ? 239 GLU E CB    1 
ATOM   8500  C  CG    . GLU E 2 239 ? 5.690   -3.240  -106.881 1.00 2.00  ? 239 GLU E CG    1 
ATOM   8501  C  CD    . GLU E 2 239 ? 5.770   -3.179  -105.327 1.00 26.63 ? 239 GLU E CD    1 
ATOM   8502  O  OE1   . GLU E 2 239 ? 6.648   -2.408  -104.844 1.00 3.02  ? 239 GLU E OE1   1 
ATOM   8503  O  OE2   . GLU E 2 239 ? 4.990   -3.903  -104.595 1.00 7.78  ? 239 GLU E OE2   1 
ATOM   8504  N  N     . LEU E 2 240 ? 6.982   -0.179  -110.302 1.00 2.70  ? 240 LEU E N     1 
ATOM   8505  C  CA    . LEU E 2 240 ? 7.868   0.907   -110.725 1.00 3.03  ? 240 LEU E CA    1 
ATOM   8506  C  C     . LEU E 2 240 ? 7.396   2.222   -110.082 1.00 15.76 ? 240 LEU E C     1 
ATOM   8507  O  O     . LEU E 2 240 ? 6.162   2.530   -110.081 1.00 10.40 ? 240 LEU E O     1 
ATOM   8508  C  CB    . LEU E 2 240 ? 7.827   1.069   -112.208 1.00 4.94  ? 240 LEU E CB    1 
ATOM   8509  C  CG    . LEU E 2 240 ? 8.273   2.423   -112.754 1.00 5.60  ? 240 LEU E CG    1 
ATOM   8510  C  CD1   . LEU E 2 240 ? 9.772   2.501   -112.469 1.00 3.64  ? 240 LEU E CD1   1 
ATOM   8511  C  CD2   . LEU E 2 240 ? 8.078   2.421   -114.296 1.00 4.35  ? 240 LEU E CD2   1 
ATOM   8512  N  N     . GLY E 2 241 ? 8.347   2.946   -109.475 1.00 8.83  ? 241 GLY E N     1 
ATOM   8513  C  CA    . GLY E 2 241 ? 8.169   4.389   -109.134 1.00 17.61 ? 241 GLY E CA    1 
ATOM   8514  C  C     . GLY E 2 241 ? 8.984   5.305   -110.066 1.00 5.40  ? 241 GLY E C     1 
ATOM   8515  O  O     . GLY E 2 241 ? 10.219  5.331   -109.995 1.00 6.77  ? 241 GLY E O     1 
ATOM   8516  N  N     . THR E 2 242 ? 8.323   6.023   -110.965 1.00 2.00  ? 242 THR E N     1 
ATOM   8517  C  CA    . THR E 2 242 ? 9.063   6.998   -111.803 1.00 11.60 ? 242 THR E CA    1 
ATOM   8518  C  C     . THR E 2 242 ? 9.796   8.014   -110.942 1.00 13.02 ? 242 THR E C     1 
ATOM   8519  O  O     . THR E 2 242 ? 9.449   8.240   -109.732 1.00 2.00  ? 242 THR E O     1 
ATOM   8520  C  CB    . THR E 2 242 ? 8.124   7.826   -112.726 1.00 2.57  ? 242 THR E CB    1 
ATOM   8521  O  OG1   . THR E 2 242 ? 7.204   8.617   -111.910 1.00 3.39  ? 242 THR E OG1   1 
ATOM   8522  C  CG2   . THR E 2 242 ? 7.366   6.843   -113.544 1.00 2.17  ? 242 THR E CG2   1 
ATOM   8523  N  N     . GLY E 2 243 ? 10.764  8.645   -111.584 1.00 2.00  ? 243 GLY E N     1 
ATOM   8524  C  CA    . GLY E 2 243 ? 11.371  9.849   -111.045 1.00 2.00  ? 243 GLY E CA    1 
ATOM   8525  C  C     . GLY E 2 243 ? 10.528  10.942  -111.604 1.00 2.28  ? 243 GLY E C     1 
ATOM   8526  O  O     . GLY E 2 243 ? 9.316   10.807  -111.677 1.00 4.25  ? 243 GLY E O     1 
ATOM   8527  N  N     . GLY E 2 244 ? 11.155  12.028  -112.021 1.00 4.74  ? 244 GLY E N     1 
ATOM   8528  C  CA    . GLY E 2 244 ? 10.382  13.175  -112.440 1.00 2.00  ? 244 GLY E CA    1 
ATOM   8529  C  C     . GLY E 2 244 ? 9.664   12.668  -113.661 1.00 13.89 ? 244 GLY E C     1 
ATOM   8530  O  O     . GLY E 2 244 ? 10.132  11.712  -114.335 1.00 7.84  ? 244 GLY E O     1 
ATOM   8531  N  N     . TYR E 2 245 ? 8.521   13.278  -113.950 1.00 5.54  ? 245 TYR E N     1 
ATOM   8532  C  CA    . TYR E 2 245 ? 7.757   12.899  -115.153 1.00 8.24  ? 245 TYR E CA    1 
ATOM   8533  C  C     . TYR E 2 245 ? 7.617   14.124  -116.077 1.00 7.50  ? 245 TYR E C     1 
ATOM   8534  O  O     . TYR E 2 245 ? 6.516   14.473  -116.494 1.00 8.28  ? 245 TYR E O     1 
ATOM   8535  C  CB    . TYR E 2 245 ? 6.361   12.369  -114.727 1.00 5.03  ? 245 TYR E CB    1 
ATOM   8536  C  CG    . TYR E 2 245 ? 5.937   11.304  -115.655 1.00 3.81  ? 245 TYR E CG    1 
ATOM   8537  C  CD1   . TYR E 2 245 ? 6.539   10.050  -115.635 1.00 5.36  ? 245 TYR E CD1   1 
ATOM   8538  C  CD2   . TYR E 2 245 ? 5.004   11.580  -116.652 1.00 16.84 ? 245 TYR E CD2   1 
ATOM   8539  C  CE1   . TYR E 2 245 ? 6.162   9.047   -116.609 1.00 16.40 ? 245 TYR E CE1   1 
ATOM   8540  C  CE2   . TYR E 2 245 ? 4.636   10.641  -117.628 1.00 2.00  ? 245 TYR E CE2   1 
ATOM   8541  C  CZ    . TYR E 2 245 ? 5.193   9.371   -117.612 1.00 22.17 ? 245 TYR E CZ    1 
ATOM   8542  O  OH    . TYR E 2 245 ? 4.748   8.464   -118.596 1.00 14.06 ? 245 TYR E OH    1 
ATOM   8543  N  N     . THR E 2 246 ? 8.692   14.861  -116.321 1.00 7.01  ? 246 THR E N     1 
ATOM   8544  C  CA    . THR E 2 246 ? 8.513   16.025  -117.187 1.00 4.58  ? 246 THR E CA    1 
ATOM   8545  C  C     . THR E 2 246 ? 9.668   16.162  -118.125 1.00 5.80  ? 246 THR E C     1 
ATOM   8546  O  O     . THR E 2 246 ? 10.747  15.704  -117.799 1.00 2.15  ? 246 THR E O     1 
ATOM   8547  C  CB    . THR E 2 246 ? 8.369   17.393  -116.458 1.00 4.10  ? 246 THR E CB    1 
ATOM   8548  O  OG1   . THR E 2 246 ? 8.572   18.395  -117.477 1.00 8.83  ? 246 THR E OG1   1 
ATOM   8549  C  CG2   . THR E 2 246 ? 9.434   17.583  -115.387 1.00 2.00  ? 246 THR E CG2   1 
ATOM   8550  N  N     . ALA E 2 247 ? 9.447   16.797  -119.271 1.00 2.00  ? 247 ALA E N     1 
ATOM   8551  C  CA    . ALA E 2 247 ? 10.476  16.873  -120.281 1.00 4.22  ? 247 ALA E CA    1 
ATOM   8552  C  C     . ALA E 2 247 ? 10.007  17.743  -121.429 1.00 2.00  ? 247 ALA E C     1 
ATOM   8553  O  O     . ALA E 2 247 ? 8.829   17.911  -121.640 1.00 2.95  ? 247 ALA E O     1 
ATOM   8554  C  CB    . ALA E 2 247 ? 10.827  15.478  -120.783 1.00 2.67  ? 247 ALA E CB    1 
ATOM   8555  N  N     . GLU E 2 248 ? 10.923  18.340  -122.164 1.00 11.39 ? 248 GLU E N     1 
ATOM   8556  C  CA    . GLU E 2 248 ? 10.491  19.039  -123.405 1.00 16.24 ? 248 GLU E CA    1 
ATOM   8557  C  C     . GLU E 2 248 ? 9.719   17.938  -124.159 1.00 3.62  ? 248 GLU E C     1 
ATOM   8558  O  O     . GLU E 2 248 ? 10.169  16.809  -124.170 1.00 9.77  ? 248 GLU E O     1 
ATOM   8559  C  CB    . GLU E 2 248 ? 11.730  19.526  -124.211 1.00 2.29  ? 248 GLU E CB    1 
ATOM   8560  C  CG    . GLU E 2 248 ? 11.443  20.353  -125.513 1.00 31.38 ? 248 GLU E CG    1 
ATOM   8561  C  CD    . GLU E 2 248 ? 12.655  20.339  -126.505 1.00 33.47 ? 248 GLU E CD    1 
ATOM   8562  O  OE1   . GLU E 2 248 ? 13.761  20.699  -126.058 1.00 29.73 ? 248 GLU E OE1   1 
ATOM   8563  O  OE2   . GLU E 2 248 ? 12.529  19.943  -127.701 1.00 27.63 ? 248 GLU E OE2   1 
ATOM   8564  N  N     . VAL E 2 249 ? 8.572   18.245  -124.742 1.00 2.00  ? 249 VAL E N     1 
ATOM   8565  C  CA    . VAL E 2 249 ? 7.851   17.299  -125.564 1.00 2.00  ? 249 VAL E CA    1 
ATOM   8566  C  C     . VAL E 2 249 ? 8.576   16.940  -126.846 1.00 2.00  ? 249 VAL E C     1 
ATOM   8567  O  O     . VAL E 2 249 ? 8.570   17.752  -127.730 1.00 2.00  ? 249 VAL E O     1 
ATOM   8568  C  CB    . VAL E 2 249 ? 6.529   17.962  -125.906 1.00 7.25  ? 249 VAL E CB    1 
ATOM   8569  C  CG1   . VAL E 2 249 ? 5.573   17.012  -126.606 1.00 3.70  ? 249 VAL E CG1   1 
ATOM   8570  C  CG2   . VAL E 2 249 ? 5.930   18.491  -124.608 1.00 2.00  ? 249 VAL E CG2   1 
ATOM   8571  N  N     . ARG E 2 250 ? 9.228   15.764  -126.973 1.00 10.77 ? 250 ARG E N     1 
ATOM   8572  C  CA    . ARG E 2 250 ? 9.843   15.307  -128.323 1.00 2.89  ? 250 ARG E CA    1 
ATOM   8573  C  C     . ARG E 2 250 ? 9.505   13.871  -128.693 1.00 2.00  ? 250 ARG E C     1 
ATOM   8574  O  O     . ARG E 2 250 ? 9.335   13.068  -127.815 1.00 5.43  ? 250 ARG E O     1 
ATOM   8575  C  CB    . ARG E 2 250 ? 11.377  15.471  -128.409 1.00 10.52 ? 250 ARG E CB    1 
ATOM   8576  C  CG    . ARG E 2 250 ? 11.987  16.618  -127.543 1.00 4.92  ? 250 ARG E CG    1 
ATOM   8577  C  CD    . ARG E 2 250 ? 13.401  16.307  -127.070 1.00 6.51  ? 250 ARG E CD    1 
ATOM   8578  N  NE    . ARG E 2 250 ? 14.169  15.697  -128.157 1.00 30.66 ? 250 ARG E NE    1 
ATOM   8579  C  CZ    . ARG E 2 250 ? 14.247  16.186  -129.397 1.00 31.21 ? 250 ARG E CZ    1 
ATOM   8580  N  NH1   . ARG E 2 250 ? 13.628  17.328  -129.727 1.00 23.83 ? 250 ARG E NH1   1 
ATOM   8581  N  NH2   . ARG E 2 250 ? 14.974  15.548  -130.308 1.00 2.00  ? 250 ARG E NH2   1 
ATOM   8582  N  N     . PRO E 2 251 ? 9.349   13.547  -129.997 1.00 9.03  ? 251 PRO E N     1 
ATOM   8583  C  CA    . PRO E 2 251 ? 8.999   12.175  -130.388 1.00 2.75  ? 251 PRO E CA    1 
ATOM   8584  C  C     . PRO E 2 251 ? 10.072  11.106  -130.089 1.00 2.00  ? 251 PRO E C     1 
ATOM   8585  O  O     . PRO E 2 251 ? 9.724   10.058  -129.587 1.00 6.22  ? 251 PRO E O     1 
ATOM   8586  C  CB    . PRO E 2 251 ? 8.768   12.249  -131.902 1.00 2.00  ? 251 PRO E CB    1 
ATOM   8587  C  CG    . PRO E 2 251 ? 8.685   13.680  -132.227 1.00 22.41 ? 251 PRO E CG    1 
ATOM   8588  C  CD    . PRO E 2 251 ? 9.475   14.425  -131.162 1.00 2.18  ? 251 PRO E CD    1 
ATOM   8589  N  N     . ASP E 2 252 ? 11.339  11.313  -130.411 1.00 3.09  ? 252 ASP E N     1 
ATOM   8590  C  CA    . ASP E 2 252 ? 12.321  10.327  -129.920 1.00 9.08  ? 252 ASP E CA    1 
ATOM   8591  C  C     . ASP E 2 252 ? 12.304  10.060  -128.400 1.00 6.75  ? 252 ASP E C     1 
ATOM   8592  O  O     . ASP E 2 252 ? 12.521  8.942   -127.974 1.00 4.36  ? 252 ASP E O     1 
ATOM   8593  C  CB    . ASP E 2 252 ? 13.743  10.520  -130.477 1.00 7.67  ? 252 ASP E CB    1 
ATOM   8594  C  CG    . ASP E 2 252 ? 14.473  11.752  -129.888 1.00 6.08  ? 252 ASP E CG    1 
ATOM   8595  O  OD1   . ASP E 2 252 ? 15.666  11.965  -130.213 1.00 34.32 ? 252 ASP E OD1   1 
ATOM   8596  O  OD2   . ASP E 2 252 ? 13.869  12.509  -129.111 1.00 10.01 ? 252 ASP E OD2   1 
ATOM   8597  N  N     . VAL E 2 253 ? 12.006  11.058  -127.576 1.00 5.40  ? 253 VAL E N     1 
ATOM   8598  C  CA    . VAL E 2 253 ? 11.905  10.807  -126.119 1.00 4.96  ? 253 VAL E CA    1 
ATOM   8599  C  C     . VAL E 2 253 ? 10.678  10.010  -125.774 1.00 9.72  ? 253 VAL E C     1 
ATOM   8600  O  O     . VAL E 2 253 ? 10.702  9.195   -124.855 1.00 8.92  ? 253 VAL E O     1 
ATOM   8601  C  CB    . VAL E 2 253 ? 11.814  12.124  -125.257 1.00 12.82 ? 253 VAL E CB    1 
ATOM   8602  C  CG1   . VAL E 2 253 ? 11.623  11.768  -123.776 1.00 2.00  ? 253 VAL E CG1   1 
ATOM   8603  C  CG2   . VAL E 2 253 ? 12.996  13.027  -125.476 1.00 2.00  ? 253 VAL E CG2   1 
ATOM   8604  N  N     . TYR E 2 254 ? 9.572   10.317  -126.440 1.00 9.88  ? 254 TYR E N     1 
ATOM   8605  C  CA    . TYR E 2 254 ? 8.323   9.644   -126.158 1.00 6.03  ? 254 TYR E CA    1 
ATOM   8606  C  C     . TYR E 2 254 ? 8.447   8.168   -126.585 1.00 6.58  ? 254 TYR E C     1 
ATOM   8607  O  O     . TYR E 2 254 ? 7.986   7.253   -125.904 1.00 2.00  ? 254 TYR E O     1 
ATOM   8608  C  CB    . TYR E 2 254 ? 7.166   10.300  -126.938 1.00 2.43  ? 254 TYR E CB    1 
ATOM   8609  C  CG    . TYR E 2 254 ? 5.899   9.567   -126.628 1.00 2.00  ? 254 TYR E CG    1 
ATOM   8610  C  CD1   . TYR E 2 254 ? 5.159   9.889   -125.520 1.00 3.84  ? 254 TYR E CD1   1 
ATOM   8611  C  CD2   . TYR E 2 254 ? 5.487   8.485   -127.386 1.00 2.00  ? 254 TYR E CD2   1 
ATOM   8612  C  CE1   . TYR E 2 254 ? 3.992   9.207   -125.201 1.00 2.81  ? 254 TYR E CE1   1 
ATOM   8613  C  CE2   . TYR E 2 254 ? 4.346   7.767   -127.060 1.00 3.63  ? 254 TYR E CE2   1 
ATOM   8614  C  CZ    . TYR E 2 254 ? 3.609   8.144   -125.968 1.00 2.00  ? 254 TYR E CZ    1 
ATOM   8615  O  OH    . TYR E 2 254 ? 2.498   7.451   -125.605 1.00 13.68 ? 254 TYR E OH    1 
ATOM   8616  N  N     . SER E 2 255 ? 9.077   7.960   -127.734 1.00 2.00  ? 255 SER E N     1 
ATOM   8617  C  CA    . SER E 2 255 ? 8.989   6.696   -128.417 1.00 2.00  ? 255 SER E CA    1 
ATOM   8618  C  C     . SER E 2 255 ? 9.723   5.621   -127.592 1.00 2.20  ? 255 SER E C     1 
ATOM   8619  O  O     . SER E 2 255 ? 9.152   4.579   -127.263 1.00 2.00  ? 255 SER E O     1 
ATOM   8620  C  CB    . SER E 2 255 ? 9.649   6.794   -129.804 1.00 2.00  ? 255 SER E CB    1 
ATOM   8621  O  OG    . SER E 2 255 ? 9.679   5.519   -130.408 1.00 2.00  ? 255 SER E OG    1 
ATOM   8622  N  N     . GLY E 2 256 ? 11.012  5.890   -127.327 1.00 4.67  ? 256 GLY E N     1 
ATOM   8623  C  CA    . GLY E 2 256 ? 11.875  5.128   -126.405 1.00 2.15  ? 256 GLY E CA    1 
ATOM   8624  C  C     . GLY E 2 256 ? 11.194  4.890   -125.083 1.00 9.37  ? 256 GLY E C     1 
ATOM   8625  O  O     . GLY E 2 256 ? 11.294  3.812   -124.533 1.00 13.63 ? 256 GLY E O     1 
ATOM   8626  N  N     . LEU E 2 257 ? 10.468  5.867   -124.570 1.00 2.00  ? 257 LEU E N     1 
ATOM   8627  C  CA    . LEU E 2 257 ? 9.944   5.663   -123.241 1.00 5.56  ? 257 LEU E CA    1 
ATOM   8628  C  C     . LEU E 2 257 ? 8.932   4.547   -123.480 1.00 3.79  ? 257 LEU E C     1 
ATOM   8629  O  O     . LEU E 2 257 ? 8.787   3.660   -122.665 1.00 5.60  ? 257 LEU E O     1 
ATOM   8630  C  CB    . LEU E 2 257 ? 9.204   6.897   -122.774 1.00 2.00  ? 257 LEU E CB    1 
ATOM   8631  C  CG    . LEU E 2 257 ? 9.182   7.284   -121.332 1.00 9.19  ? 257 LEU E CG    1 
ATOM   8632  C  CD1   . LEU E 2 257 ? 8.070   8.320   -121.056 1.00 6.76  ? 257 LEU E CD1   1 
ATOM   8633  C  CD2   . LEU E 2 257 ? 9.098   6.173   -120.378 1.00 2.00  ? 257 LEU E CD2   1 
ATOM   8634  N  N     . SER E 2 258 ? 8.191   4.630   -124.580 1.00 4.42  ? 258 SER E N     1 
ATOM   8635  C  CA    . SER E 2 258 ? 6.994   3.782   -124.786 1.00 6.70  ? 258 SER E CA    1 
ATOM   8636  C  C     . SER E 2 258 ? 7.469   2.363   -124.941 1.00 2.00  ? 258 SER E C     1 
ATOM   8637  O  O     . SER E 2 258 ? 6.901   1.444   -124.335 1.00 6.04  ? 258 SER E O     1 
ATOM   8638  C  CB    . SER E 2 258 ? 6.271   4.112   -126.111 1.00 12.81 ? 258 SER E CB    1 
ATOM   8639  O  OG    . SER E 2 258 ? 4.958   3.544   -126.117 1.00 13.14 ? 258 SER E OG    1 
ATOM   8640  N  N     . VAL E 2 259 ? 8.500   2.192   -125.754 1.00 2.00  ? 259 VAL E N     1 
ATOM   8641  C  CA    . VAL E 2 259 ? 9.014   0.854   -126.115 1.00 2.04  ? 259 VAL E CA    1 
ATOM   8642  C  C     . VAL E 2 259 ? 9.446   0.167   -124.801 1.00 12.04 ? 259 VAL E C     1 
ATOM   8643  O  O     . VAL E 2 259 ? 9.428   -1.065  -124.673 1.00 22.59 ? 259 VAL E O     1 
ATOM   8644  C  CB    . VAL E 2 259 ? 10.243  0.988   -127.106 1.00 7.51  ? 259 VAL E CB    1 
ATOM   8645  C  CG1   . VAL E 2 259 ? 11.158  -0.248  -127.109 1.00 6.58  ? 259 VAL E CG1   1 
ATOM   8646  C  CG2   . VAL E 2 259 ? 9.785   1.329   -128.527 1.00 2.00  ? 259 VAL E CG2   1 
ATOM   8647  N  N     . ALA E 2 260 ? 9.837   0.969   -123.817 1.00 6.26  ? 260 ALA E N     1 
ATOM   8648  C  CA    . ALA E 2 260 ? 10.661  0.447   -122.756 1.00 9.62  ? 260 ALA E CA    1 
ATOM   8649  C  C     . ALA E 2 260 ? 9.642   0.032   -121.746 1.00 8.69  ? 260 ALA E C     1 
ATOM   8650  O  O     . ALA E 2 260 ? 9.866   -0.890  -120.978 1.00 10.17 ? 260 ALA E O     1 
ATOM   8651  C  CB    . ALA E 2 260 ? 11.552  1.496   -122.189 1.00 2.00  ? 260 ALA E CB    1 
ATOM   8652  N  N     . LEU E 2 261 ? 8.512   0.723   -121.716 1.00 8.23  ? 261 LEU E N     1 
ATOM   8653  C  CA    . LEU E 2 261 ? 7.637   0.520   -120.572 1.00 9.06  ? 261 LEU E CA    1 
ATOM   8654  C  C     . LEU E 2 261 ? 6.956   -0.738  -121.017 1.00 8.75  ? 261 LEU E C     1 
ATOM   8655  O  O     . LEU E 2 261 ? 6.633   -1.606  -120.234 1.00 12.86 ? 261 LEU E O     1 
ATOM   8656  C  CB    . LEU E 2 261 ? 6.627   1.666   -120.405 1.00 4.17  ? 261 LEU E CB    1 
ATOM   8657  C  CG    . LEU E 2 261 ? 7.107   2.699   -119.351 1.00 2.72  ? 261 LEU E CG    1 
ATOM   8658  C  CD1   . LEU E 2 261 ? 6.310   4.017   -119.541 1.00 2.00  ? 261 LEU E CD1   1 
ATOM   8659  C  CD2   . LEU E 2 261 ? 6.768   2.135   -117.974 1.00 2.00  ? 261 LEU E CD2   1 
ATOM   8660  N  N     . SER E 2 262 ? 6.808   -0.846  -122.320 1.00 7.84  ? 262 SER E N     1 
ATOM   8661  C  CA    . SER E 2 262 ? 6.007   -1.879  -122.903 1.00 8.28  ? 262 SER E CA    1 
ATOM   8662  C  C     . SER E 2 262 ? 6.816   -3.189  -123.013 1.00 13.44 ? 262 SER E C     1 
ATOM   8663  O  O     . SER E 2 262 ? 6.218   -4.274  -123.009 1.00 9.70  ? 262 SER E O     1 
ATOM   8664  C  CB    . SER E 2 262 ? 5.520   -1.419  -124.277 1.00 4.18  ? 262 SER E CB    1 
ATOM   8665  O  OG    . SER E 2 262 ? 6.334   -1.975  -125.255 1.00 14.00 ? 262 SER E OG    1 
ATOM   8666  N  N     . GLY E 2 263 ? 8.150   -3.095  -123.065 1.00 2.00  ? 263 GLY E N     1 
ATOM   8667  C  CA    . GLY E 2 263 ? 8.994   -4.171  -122.519 1.00 2.00  ? 263 GLY E CA    1 
ATOM   8668  C  C     . GLY E 2 263 ? 8.768   -4.661  -121.073 1.00 19.45 ? 263 GLY E C     1 
ATOM   8669  O  O     . GLY E 2 263 ? 9.318   -5.716  -120.670 1.00 9.02  ? 263 GLY E O     1 
ATOM   8670  N  N     . CYS E 2 264 ? 8.001   -3.938  -120.249 1.00 2.00  ? 264 CYS E N     1 
ATOM   8671  C  CA    . CYS E 2 264 ? 7.869   -4.436  -118.895 1.00 2.00  ? 264 CYS E CA    1 
ATOM   8672  C  C     . CYS E 2 264 ? 6.670   -5.284  -118.686 1.00 2.00  ? 264 CYS E C     1 
ATOM   8673  O  O     . CYS E 2 264 ? 5.606   -4.798  -118.219 1.00 15.34 ? 264 CYS E O     1 
ATOM   8674  C  CB    . CYS E 2 264 ? 7.930   -3.328  -117.837 1.00 3.40  ? 264 CYS E CB    1 
ATOM   8675  S  SG    . CYS E 2 264 ? 9.530   -2.579  -117.957 1.00 6.88  ? 264 CYS E SG    1 
ATOM   8676  N  N     . LYS E 2 265 ? 6.796   -6.554  -119.018 1.00 3.53  ? 265 LYS E N     1 
ATOM   8677  C  CA    . LYS E 2 265 ? 5.599   -7.408  -118.968 1.00 2.00  ? 265 LYS E CA    1 
ATOM   8678  C  C     . LYS E 2 265 ? 5.153   -7.714  -117.587 1.00 2.00  ? 265 LYS E C     1 
ATOM   8679  O  O     . LYS E 2 265 ? 4.018   -8.085  -117.414 1.00 2.00  ? 265 LYS E O     1 
ATOM   8680  C  CB    . LYS E 2 265 ? 5.768   -8.683  -119.742 1.00 8.06  ? 265 LYS E CB    1 
ATOM   8681  C  CG    . LYS E 2 265 ? 5.759   -8.441  -121.232 1.00 5.07  ? 265 LYS E CG    1 
ATOM   8682  C  CD    . LYS E 2 265 ? 7.044   -8.883  -121.847 1.00 5.44  ? 265 LYS E CD    1 
ATOM   8683  C  CE    . LYS E 2 265 ? 6.986   -8.340  -123.244 1.00 43.25 ? 265 LYS E CE    1 
ATOM   8684  N  NZ    . LYS E 2 265 ? 5.728   -7.485  -123.264 1.00 16.66 ? 265 LYS E NZ    1 
ATOM   8685  N  N     . GLU E 2 266 ? 5.988   -7.542  -116.564 1.00 2.00  ? 266 GLU E N     1 
ATOM   8686  C  CA    . GLU E 2 266 ? 5.417   -7.853  -115.248 1.00 2.01  ? 266 GLU E CA    1 
ATOM   8687  C  C     . GLU E 2 266 ? 4.947   -6.673  -114.356 1.00 6.00  ? 266 GLU E C     1 
ATOM   8688  O  O     . GLU E 2 266 ? 4.732   -6.894  -113.144 1.00 4.60  ? 266 GLU E O     1 
ATOM   8689  C  CB    . GLU E 2 266 ? 6.277   -8.824  -114.432 1.00 2.00  ? 266 GLU E CB    1 
ATOM   8690  C  CG    . GLU E 2 266 ? 7.090   -9.861  -115.259 1.00 3.67  ? 266 GLU E CG    1 
ATOM   8691  C  CD    . GLU E 2 266 ? 6.156   -10.875 -115.981 1.00 17.64 ? 266 GLU E CD    1 
ATOM   8692  O  OE1   . GLU E 2 266 ? 6.493   -11.272 -117.118 1.00 5.15  ? 266 GLU E OE1   1 
ATOM   8693  O  OE2   . GLU E 2 266 ? 5.077   -11.257 -115.425 1.00 5.45  ? 266 GLU E OE2   1 
ATOM   8694  N  N     . LEU E 2 267 ? 4.826   -5.457  -114.888 1.00 2.00  ? 267 LEU E N     1 
ATOM   8695  C  CA    . LEU E 2 267 ? 4.470   -4.315  -114.033 1.00 2.00  ? 267 LEU E CA    1 
ATOM   8696  C  C     . LEU E 2 267 ? 3.079   -4.451  -113.541 1.00 2.00  ? 267 LEU E C     1 
ATOM   8697  O  O     . LEU E 2 267 ? 2.205   -4.643  -114.328 1.00 2.88  ? 267 LEU E O     1 
ATOM   8698  C  CB    . LEU E 2 267 ? 4.539   -3.015  -114.784 1.00 2.00  ? 267 LEU E CB    1 
ATOM   8699  C  CG    . LEU E 2 267 ? 5.972   -2.524  -114.806 1.00 8.52  ? 267 LEU E CG    1 
ATOM   8700  C  CD1   . LEU E 2 267 ? 6.242   -1.562  -115.966 1.00 4.69  ? 267 LEU E CD1   1 
ATOM   8701  C  CD2   . LEU E 2 267 ? 6.137   -1.880  -113.483 1.00 14.37 ? 267 LEU E CD2   1 
ATOM   8702  N  N     . ARG E 2 268 ? 2.866   -4.330  -112.238 1.00 2.15  ? 268 ARG E N     1 
ATOM   8703  C  CA    . ARG E 2 268 ? 1.542   -4.379  -111.682 1.00 2.00  ? 268 ARG E CA    1 
ATOM   8704  C  C     . ARG E 2 268 ? 1.158   -3.049  -110.969 1.00 8.00  ? 268 ARG E C     1 
ATOM   8705  O  O     . ARG E 2 268 ? 0.001   -2.842  -110.645 1.00 4.77  ? 268 ARG E O     1 
ATOM   8706  C  CB    . ARG E 2 268 ? 1.452   -5.546  -110.694 1.00 11.98 ? 268 ARG E CB    1 
ATOM   8707  C  CG    . ARG E 2 268 ? 1.317   -6.967  -111.302 1.00 11.80 ? 268 ARG E CG    1 
ATOM   8708  C  CD    . ARG E 2 268 ? 0.156   -7.149  -112.330 1.00 15.32 ? 268 ARG E CD    1 
ATOM   8709  N  NE    . ARG E 2 268 ? 0.299   -8.474  -112.938 1.00 2.37  ? 268 ARG E NE    1 
ATOM   8710  C  CZ    . ARG E 2 268 ? 1.105   -8.742  -113.971 1.00 20.11 ? 268 ARG E CZ    1 
ATOM   8711  N  NH1   . ARG E 2 268 ? 1.776   -7.767  -114.588 1.00 4.06  ? 268 ARG E NH1   1 
ATOM   8712  N  NH2   . ARG E 2 268 ? 1.236   -9.981  -114.411 1.00 2.00  ? 268 ARG E NH2   1 
ATOM   8713  N  N     . CYS E 2 269 ? 2.150   -2.180  -110.720 1.00 7.15  ? 269 CYS E N     1 
ATOM   8714  C  CA    . CYS E 2 269 ? 2.082   -1.034  -109.788 1.00 2.00  ? 269 CYS E CA    1 
ATOM   8715  C  C     . CYS E 2 269 ? 2.875   0.115   -110.360 1.00 2.00  ? 269 CYS E C     1 
ATOM   8716  O  O     . CYS E 2 269 ? 4.080   0.017   -110.457 1.00 5.95  ? 269 CYS E O     1 
ATOM   8717  C  CB    . CYS E 2 269 ? 2.810   -1.402  -108.538 1.00 2.00  ? 269 CYS E CB    1 
ATOM   8718  S  SG    . CYS E 2 269 ? 1.919   -2.655  -107.631 1.00 16.01 ? 269 CYS E SG    1 
ATOM   8719  N  N     . LEU E 2 270 ? 2.225   1.175   -110.779 1.00 2.00  ? 270 LEU E N     1 
ATOM   8720  C  CA    . LEU E 2 270 ? 2.899   2.459   -111.093 1.00 10.92 ? 270 LEU E CA    1 
ATOM   8721  C  C     . LEU E 2 270 ? 2.691   3.504   -109.955 1.00 3.26  ? 270 LEU E C     1 
ATOM   8722  O  O     . LEU E 2 270 ? 1.629   3.605   -109.364 1.00 2.00  ? 270 LEU E O     1 
ATOM   8723  C  CB    . LEU E 2 270 ? 2.271   3.040   -112.341 1.00 12.25 ? 270 LEU E CB    1 
ATOM   8724  C  CG    . LEU E 2 270 ? 2.914   2.518   -113.558 1.00 15.04 ? 270 LEU E CG    1 
ATOM   8725  C  CD1   . LEU E 2 270 ? 2.472   3.425   -114.734 1.00 7.78  ? 270 LEU E CD1   1 
ATOM   8726  C  CD2   . LEU E 2 270 ? 4.315   2.741   -113.139 1.00 2.00  ? 270 LEU E CD2   1 
ATOM   8727  N  N     . SER E 2 271 ? 3.710   4.307   -109.693 1.00 2.00  ? 271 SER E N     1 
ATOM   8728  C  CA    . SER E 2 271 ? 3.553   5.419   -108.707 1.00 2.77  ? 271 SER E CA    1 
ATOM   8729  C  C     . SER E 2 271 ? 4.579   6.440   -109.148 1.00 2.00  ? 271 SER E C     1 
ATOM   8730  O  O     . SER E 2 271 ? 5.278   6.191   -110.146 1.00 2.00  ? 271 SER E O     1 
ATOM   8731  C  CB    . SER E 2 271 ? 3.870   4.909   -107.295 1.00 2.00  ? 271 SER E CB    1 
ATOM   8732  O  OG    . SER E 2 271 ? 5.222   4.497   -107.301 1.00 4.83  ? 271 SER E OG    1 
ATOM   8733  N  N     . GLY E 2 272 ? 4.720   7.560   -108.441 1.00 2.00  ? 272 GLY E N     1 
ATOM   8734  C  CA    . GLY E 2 272 ? 5.707   8.529   -108.924 1.00 2.00  ? 272 GLY E CA    1 
ATOM   8735  C  C     . GLY E 2 272 ? 5.050   9.689   -109.641 1.00 2.00  ? 272 GLY E C     1 
ATOM   8736  O  O     . GLY E 2 272 ? 4.177   10.310  -109.058 1.00 2.00  ? 272 GLY E O     1 
ATOM   8737  N  N     . PHE E 2 273 ? 5.445   9.991   -110.883 1.00 2.17  ? 273 PHE E N     1 
ATOM   8738  C  CA    . PHE E 2 273 ? 4.743   11.062  -111.622 1.00 5.41  ? 273 PHE E CA    1 
ATOM   8739  C  C     . PHE E 2 273 ? 4.904   12.543  -111.077 1.00 9.65  ? 273 PHE E C     1 
ATOM   8740  O  O     . PHE E 2 273 ? 4.186   13.461  -111.497 1.00 9.54  ? 273 PHE E O     1 
ATOM   8741  C  CB    . PHE E 2 273 ? 3.221   10.721  -111.728 1.00 12.13 ? 273 PHE E CB    1 
ATOM   8742  C  CG    . PHE E 2 273 ? 2.920   9.366   -112.360 1.00 2.33  ? 273 PHE E CG    1 
ATOM   8743  C  CD1   . PHE E 2 273 ? 2.533   8.256   -111.541 1.00 18.31 ? 273 PHE E CD1   1 
ATOM   8744  C  CD2   . PHE E 2 273 ? 3.033   9.176   -113.753 1.00 14.97 ? 273 PHE E CD2   1 
ATOM   8745  C  CE1   . PHE E 2 273 ? 2.238   6.965   -112.100 1.00 2.16  ? 273 PHE E CE1   1 
ATOM   8746  C  CE2   . PHE E 2 273 ? 2.752   7.913   -114.341 1.00 11.01 ? 273 PHE E CE2   1 
ATOM   8747  C  CZ    . PHE E 2 273 ? 2.366   6.799   -113.523 1.00 15.91 ? 273 PHE E CZ    1 
ATOM   8748  N  N     . TRP E 2 274 ? 5.858   12.817  -110.200 1.00 3.29  ? 274 TRP E N     1 
ATOM   8749  C  CA    . TRP E 2 274 ? 6.279   14.223  -110.024 1.00 2.29  ? 274 TRP E CA    1 
ATOM   8750  C  C     . TRP E 2 274 ? 6.165   15.123  -111.295 1.00 3.12  ? 274 TRP E C     1 
ATOM   8751  O  O     . TRP E 2 274 ? 6.872   14.908  -112.298 1.00 2.00  ? 274 TRP E O     1 
ATOM   8752  C  CB    . TRP E 2 274 ? 7.663   14.281  -109.369 1.00 2.00  ? 274 TRP E CB    1 
ATOM   8753  C  CG    . TRP E 2 274 ? 7.607   13.719  -107.929 1.00 3.64  ? 274 TRP E CG    1 
ATOM   8754  C  CD1   . TRP E 2 274 ? 7.090   14.329  -106.766 1.00 2.00  ? 274 TRP E CD1   1 
ATOM   8755  C  CD2   . TRP E 2 274 ? 8.083   12.466  -107.513 1.00 2.23  ? 274 TRP E CD2   1 
ATOM   8756  N  NE1   . TRP E 2 274 ? 7.225   13.510  -105.670 1.00 2.00  ? 274 TRP E NE1   1 
ATOM   8757  C  CE2   . TRP E 2 274 ? 7.824   12.353  -106.094 1.00 24.54 ? 274 TRP E CE2   1 
ATOM   8758  C  CE3   . TRP E 2 274 ? 8.689   11.410  -108.183 1.00 2.00  ? 274 TRP E CE3   1 
ATOM   8759  C  CZ2   . TRP E 2 274 ? 8.148   11.220  -105.372 1.00 11.99 ? 274 TRP E CZ2   1 
ATOM   8760  C  CZ3   . TRP E 2 274 ? 9.038   10.295  -107.447 1.00 10.23 ? 274 TRP E CZ3   1 
ATOM   8761  C  CH2   . TRP E 2 274 ? 8.766   10.200  -106.063 1.00 2.31  ? 274 TRP E CH2   1 
ATOM   8762  N  N     . ASP E 2 275 ? 5.318   16.161  -111.238 1.00 2.00  ? 275 ASP E N     1 
ATOM   8763  C  CA    . ASP E 2 275 ? 5.411   17.237  -112.252 1.00 2.00  ? 275 ASP E CA    1 
ATOM   8764  C  C     . ASP E 2 275 ? 4.987   16.599  -113.531 1.00 3.90  ? 275 ASP E C     1 
ATOM   8765  O  O     . ASP E 2 275 ? 5.487   16.943  -114.609 1.00 3.47  ? 275 ASP E O     1 
ATOM   8766  C  CB    . ASP E 2 275 ? 6.835   17.712  -112.459 1.00 2.00  ? 275 ASP E CB    1 
ATOM   8767  C  CG    . ASP E 2 275 ? 7.501   18.229  -111.156 1.00 20.21 ? 275 ASP E CG    1 
ATOM   8768  O  OD1   . ASP E 2 275 ? 6.838   19.032  -110.477 1.00 3.34  ? 275 ASP E OD1   1 
ATOM   8769  O  OD2   . ASP E 2 275 ? 8.663   17.842  -110.778 1.00 2.42  ? 275 ASP E OD2   1 
ATOM   8770  N  N     . ALA E 2 276 ? 4.058   15.642  -113.416 1.00 8.09  ? 276 ALA E N     1 
ATOM   8771  C  CA    . ALA E 2 276 ? 3.679   14.838  -114.545 1.00 2.00  ? 276 ALA E CA    1 
ATOM   8772  C  C     . ALA E 2 276 ? 3.201   15.770  -115.668 1.00 5.67  ? 276 ALA E C     1 
ATOM   8773  O  O     . ALA E 2 276 ? 2.470   16.723  -115.413 1.00 2.00  ? 276 ALA E O     1 
ATOM   8774  C  CB    . ALA E 2 276 ? 2.601   13.953  -114.093 1.00 2.24  ? 276 ALA E CB    1 
ATOM   8775  N  N     . VAL E 2 277 ? 3.602   15.539  -116.915 1.00 9.48  ? 277 VAL E N     1 
ATOM   8776  C  CA    . VAL E 2 277 ? 2.983   16.299  -118.000 1.00 2.22  ? 277 VAL E CA    1 
ATOM   8777  C  C     . VAL E 2 277 ? 2.026   15.549  -118.939 1.00 7.98  ? 277 VAL E C     1 
ATOM   8778  O  O     . VAL E 2 277 ? 2.421   14.565  -119.554 1.00 3.60  ? 277 VAL E O     1 
ATOM   8779  C  CB    . VAL E 2 277 ? 3.961   17.160  -118.858 1.00 8.05  ? 277 VAL E CB    1 
ATOM   8780  C  CG1   . VAL E 2 277 ? 4.882   17.964  -118.037 1.00 15.60 ? 277 VAL E CG1   1 
ATOM   8781  C  CG2   . VAL E 2 277 ? 4.645   16.397  -119.956 1.00 2.00  ? 277 VAL E CG2   1 
ATOM   8782  N  N     . PRO E 2 278 ? 0.780   16.064  -119.115 1.00 9.02  ? 278 PRO E N     1 
ATOM   8783  C  CA    . PRO E 2 278 ? -0.209  15.336  -119.953 1.00 2.97  ? 278 PRO E CA    1 
ATOM   8784  C  C     . PRO E 2 278 ? 0.350   14.602  -121.163 1.00 2.00  ? 278 PRO E C     1 
ATOM   8785  O  O     . PRO E 2 278 ? -0.052  13.483  -121.415 1.00 6.36  ? 278 PRO E O     1 
ATOM   8786  C  CB    . PRO E 2 278 ? -1.233  16.403  -120.353 1.00 2.00  ? 278 PRO E CB    1 
ATOM   8787  C  CG    . PRO E 2 278 ? -1.072  17.534  -119.329 1.00 5.05  ? 278 PRO E CG    1 
ATOM   8788  C  CD    . PRO E 2 278 ? 0.261   17.349  -118.590 1.00 2.00  ? 278 PRO E CD    1 
ATOM   8789  N  N     . ALA E 2 279 ? 1.313   15.173  -121.858 1.00 2.00  ? 279 ALA E N     1 
ATOM   8790  C  CA    . ALA E 2 279 ? 1.731   14.657  -123.175 1.00 2.12  ? 279 ALA E CA    1 
ATOM   8791  C  C     . ALA E 2 279 ? 2.617   13.400  -123.131 1.00 10.42 ? 279 ALA E C     1 
ATOM   8792  O  O     . ALA E 2 279 ? 2.895   12.730  -124.156 1.00 2.00  ? 279 ALA E O     1 
ATOM   8793  C  CB    . ALA E 2 279 ? 2.535   15.747  -123.908 1.00 15.24 ? 279 ALA E CB    1 
ATOM   8794  N  N     . TYR E 2 280 ? 3.156   13.183  -121.954 1.00 2.00  ? 280 TYR E N     1 
ATOM   8795  C  CA    . TYR E 2 280 ? 3.904   12.001  -121.705 1.00 6.21  ? 280 TYR E CA    1 
ATOM   8796  C  C     . TYR E 2 280 ? 3.177   10.812  -120.966 1.00 9.74  ? 280 TYR E C     1 
ATOM   8797  O  O     . TYR E 2 280 ? 3.766   9.717   -120.878 1.00 7.55  ? 280 TYR E O     1 
ATOM   8798  C  CB    . TYR E 2 280 ? 5.208   12.397  -120.996 1.00 3.01  ? 280 TYR E CB    1 
ATOM   8799  C  CG    . TYR E 2 280 ? 6.299   12.851  -121.938 1.00 2.00  ? 280 TYR E CG    1 
ATOM   8800  C  CD1   . TYR E 2 280 ? 6.672   14.185  -122.031 1.00 2.00  ? 280 TYR E CD1   1 
ATOM   8801  C  CD2   . TYR E 2 280 ? 6.964   11.943  -122.728 1.00 2.00  ? 280 TYR E CD2   1 
ATOM   8802  C  CE1   . TYR E 2 280 ? 7.713   14.594  -122.906 1.00 11.35 ? 280 TYR E CE1   1 
ATOM   8803  C  CE2   . TYR E 2 280 ? 8.017   12.344  -123.637 1.00 12.03 ? 280 TYR E CE2   1 
ATOM   8804  C  CZ    . TYR E 2 280 ? 8.379   13.669  -123.715 1.00 2.00  ? 280 TYR E CZ    1 
ATOM   8805  O  OH    . TYR E 2 280 ? 9.368   14.040  -124.585 1.00 2.00  ? 280 TYR E OH    1 
ATOM   8806  N  N     . LEU E 2 281 ? 1.943   10.962  -120.468 1.00 2.00  ? 281 LEU E N     1 
ATOM   8807  C  CA    . LEU E 2 281 ? 1.341   9.800   -119.753 1.00 6.57  ? 281 LEU E CA    1 
ATOM   8808  C  C     . LEU E 2 281 ? 0.947   8.633   -120.596 1.00 2.71  ? 281 LEU E C     1 
ATOM   8809  O  O     . LEU E 2 281 ? 0.850   7.514   -120.128 1.00 8.73  ? 281 LEU E O     1 
ATOM   8810  C  CB    . LEU E 2 281 ? 0.107   10.173  -118.998 1.00 2.00  ? 281 LEU E CB    1 
ATOM   8811  C  CG    . LEU E 2 281 ? 0.445   10.992  -117.774 1.00 17.13 ? 281 LEU E CG    1 
ATOM   8812  C  CD1   . LEU E 2 281 ? -0.618  12.115  -117.658 1.00 5.26  ? 281 LEU E CD1   1 
ATOM   8813  C  CD2   . LEU E 2 281 ? 0.508   10.021  -116.576 1.00 2.00  ? 281 LEU E CD2   1 
ATOM   8814  N  N     . PRO E 2 282 ? 0.622   8.896   -121.839 1.00 6.24  ? 282 PRO E N     1 
ATOM   8815  C  CA    . PRO E 2 282 ? 0.094   7.767   -122.617 1.00 9.33  ? 282 PRO E CA    1 
ATOM   8816  C  C     . PRO E 2 282 ? 1.174   6.670   -122.821 1.00 9.48  ? 282 PRO E C     1 
ATOM   8817  O  O     . PRO E 2 282 ? 0.859   5.530   -123.201 1.00 7.59  ? 282 PRO E O     1 
ATOM   8818  C  CB    . PRO E 2 282 ? -0.312  8.425   -123.971 1.00 2.04  ? 282 PRO E CB    1 
ATOM   8819  C  CG    . PRO E 2 282 ? -0.411  9.929   -123.664 1.00 20.43 ? 282 PRO E CG    1 
ATOM   8820  C  CD    . PRO E 2 282 ? 0.645   10.176  -122.572 1.00 3.67  ? 282 PRO E CD    1 
ATOM   8821  N  N     . ALA E 2 283 ? 2.438   7.038   -122.603 1.00 7.56  ? 283 ALA E N     1 
ATOM   8822  C  CA    . ALA E 2 283 ? 3.556   6.103   -122.707 1.00 2.00  ? 283 ALA E CA    1 
ATOM   8823  C  C     . ALA E 2 283 ? 3.305   5.003   -121.681 1.00 5.11  ? 283 ALA E C     1 
ATOM   8824  O  O     . ALA E 2 283 ? 3.765   3.860   -121.825 1.00 2.69  ? 283 ALA E O     1 
ATOM   8825  C  CB    . ALA E 2 283 ? 4.900   6.795   -122.447 1.00 2.00  ? 283 ALA E CB    1 
ATOM   8826  N  N     . VAL E 2 284 ? 2.558   5.354   -120.648 1.00 2.34  ? 284 VAL E N     1 
ATOM   8827  C  CA    . VAL E 2 284 ? 2.245   4.421   -119.580 1.00 5.70  ? 284 VAL E CA    1 
ATOM   8828  C  C     . VAL E 2 284 ? 1.074   3.432   -119.976 1.00 13.50 ? 284 VAL E C     1 
ATOM   8829  O  O     . VAL E 2 284 ? 0.731   2.537   -119.202 1.00 2.86  ? 284 VAL E O     1 
ATOM   8830  C  CB    . VAL E 2 284 ? 2.020   5.221   -118.297 1.00 2.00  ? 284 VAL E CB    1 
ATOM   8831  C  CG1   . VAL E 2 284 ? 0.944   4.697   -117.518 1.00 2.00  ? 284 VAL E CG1   1 
ATOM   8832  C  CG2   . VAL E 2 284 ? 3.326   5.375   -117.526 1.00 13.78 ? 284 VAL E CG2   1 
ATOM   8833  N  N     . TYR E 2 285 ? 0.531   3.550   -121.207 1.00 7.30  ? 285 TYR E N     1 
ATOM   8834  C  CA    . TYR E 2 285 ? -0.646  2.776   -121.600 1.00 7.77  ? 285 TYR E CA    1 
ATOM   8835  C  C     . TYR E 2 285 ? -0.479  1.272   -121.836 1.00 2.00  ? 285 TYR E C     1 
ATOM   8836  O  O     . TYR E 2 285 ? -1.173  0.496   -121.207 1.00 6.06  ? 285 TYR E O     1 
ATOM   8837  C  CB    . TYR E 2 285 ? -1.529  3.414   -122.718 1.00 22.04 ? 285 TYR E CB    1 
ATOM   8838  C  CG    . TYR E 2 285 ? -2.143  4.819   -122.493 1.00 2.00  ? 285 TYR E CG    1 
ATOM   8839  C  CD1   . TYR E 2 285 ? -2.079  5.477   -121.259 1.00 3.44  ? 285 TYR E CD1   1 
ATOM   8840  C  CD2   . TYR E 2 285 ? -2.770  5.466   -123.547 1.00 2.00  ? 285 TYR E CD2   1 
ATOM   8841  C  CE1   . TYR E 2 285 ? -2.566  6.797   -121.106 1.00 2.03  ? 285 TYR E CE1   1 
ATOM   8842  C  CE2   . TYR E 2 285 ? -3.290  6.743   -123.417 1.00 2.00  ? 285 TYR E CE2   1 
ATOM   8843  C  CZ    . TYR E 2 285 ? -3.193  7.407   -122.202 1.00 20.16 ? 285 TYR E CZ    1 
ATOM   8844  O  OH    . TYR E 2 285 ? -3.741  8.666   -122.126 1.00 7.40  ? 285 TYR E OH    1 
ATOM   8845  N  N     . SER E 2 286 ? 0.382   0.833   -122.744 1.00 3.22  ? 286 SER E N     1 
ATOM   8846  C  CA    . SER E 2 286 ? 0.562   -0.636  -122.906 1.00 6.87  ? 286 SER E CA    1 
ATOM   8847  C  C     . SER E 2 286 ? 0.596   -1.380  -121.542 1.00 2.00  ? 286 SER E C     1 
ATOM   8848  O  O     . SER E 2 286 ? 0.117   -2.478  -121.422 1.00 2.55  ? 286 SER E O     1 
ATOM   8849  C  CB    . SER E 2 286 ? 1.853   -0.940  -123.664 1.00 8.69  ? 286 SER E CB    1 
ATOM   8850  O  OG    . SER E 2 286 ? 2.940   -1.024  -122.727 1.00 25.18 ? 286 SER E OG    1 
ATOM   8851  N  N     . VAL E 2 287 ? 1.150   -0.784  -120.514 1.00 2.00  ? 287 VAL E N     1 
ATOM   8852  C  CA    . VAL E 2 287 ? 1.327   -1.508  -119.276 1.00 7.44  ? 287 VAL E CA    1 
ATOM   8853  C  C     . VAL E 2 287 ? 0.078   -1.528  -118.418 1.00 2.06  ? 287 VAL E C     1 
ATOM   8854  O  O     . VAL E 2 287 ? 0.013   -2.143  -117.346 1.00 9.39  ? 287 VAL E O     1 
ATOM   8855  C  CB    . VAL E 2 287 ? 2.583   -1.005  -118.518 1.00 5.09  ? 287 VAL E CB    1 
ATOM   8856  C  CG1   . VAL E 2 287 ? 2.367   -0.919  -117.056 1.00 15.71 ? 287 VAL E CG1   1 
ATOM   8857  C  CG2   . VAL E 2 287 ? 3.800   -1.919  -118.899 1.00 12.23 ? 287 VAL E CG2   1 
ATOM   8858  N  N     . CYS E 2 288 ? -0.936  -0.827  -118.901 1.00 4.40  ? 288 CYS E N     1 
ATOM   8859  C  CA    . CYS E 2 288 ? -2.009  -0.333  -118.060 1.00 8.25  ? 288 CYS E CA    1 
ATOM   8860  C  C     . CYS E 2 288 ? -3.183  -1.277  -118.141 1.00 12.63 ? 288 CYS E C     1 
ATOM   8861  O  O     . CYS E 2 288 ? -4.198  -1.069  -117.499 1.00 16.42 ? 288 CYS E O     1 
ATOM   8862  C  CB    . CYS E 2 288 ? -2.445  1.064   -118.505 1.00 2.57  ? 288 CYS E CB    1 
ATOM   8863  S  SG    . CYS E 2 288 ? -1.926  2.394   -117.417 1.00 22.87 ? 288 CYS E SG    1 
ATOM   8864  N  N     . SER E 2 289 ? -3.031  -2.316  -118.948 1.00 2.68  ? 289 SER E N     1 
ATOM   8865  C  CA    . SER E 2 289 ? -4.007  -3.386  -119.038 1.00 5.47  ? 289 SER E CA    1 
ATOM   8866  C  C     . SER E 2 289 ? -3.858  -4.320  -117.864 1.00 2.54  ? 289 SER E C     1 
ATOM   8867  O  O     . SER E 2 289 ? -4.756  -5.083  -117.553 1.00 2.00  ? 289 SER E O     1 
ATOM   8868  C  CB    . SER E 2 289 ? -3.790  -4.166  -120.326 1.00 5.21  ? 289 SER E CB    1 
ATOM   8869  O  OG    . SER E 2 289 ? -3.286  -3.314  -121.330 1.00 2.00  ? 289 SER E OG    1 
ATOM   8870  N  N     . ARG E 2 290 ? -2.706  -4.251  -117.218 1.00 2.00  ? 290 ARG E N     1 
ATOM   8871  C  CA    . ARG E 2 290 ? -2.339  -5.235  -116.226 1.00 5.97  ? 290 ARG E CA    1 
ATOM   8872  C  C     . ARG E 2 290 ? -2.260  -4.669  -114.820 1.00 2.57  ? 290 ARG E C     1 
ATOM   8873  O  O     . ARG E 2 290 ? -2.197  -5.420  -113.859 1.00 2.00  ? 290 ARG E O     1 
ATOM   8874  C  CB    . ARG E 2 290 ? -1.019  -5.911  -116.596 1.00 11.91 ? 290 ARG E CB    1 
ATOM   8875  C  CG    . ARG E 2 290 ? -0.536  -5.626  -118.003 1.00 34.92 ? 290 ARG E CG    1 
ATOM   8876  C  CD    . ARG E 2 290 ? 0.699   -6.409  -118.408 1.00 9.55  ? 290 ARG E CD    1 
ATOM   8877  N  NE    . ARG E 2 290 ? 1.660   -5.572  -119.113 1.00 45.85 ? 290 ARG E NE    1 
ATOM   8878  C  CZ    . ARG E 2 290 ? 2.036   -5.767  -120.367 1.00 44.32 ? 290 ARG E CZ    1 
ATOM   8879  N  NH1   . ARG E 2 290 ? 1.534   -6.777  -121.067 1.00 38.85 ? 290 ARG E NH1   1 
ATOM   8880  N  NH2   . ARG E 2 290 ? 2.915   -4.952  -120.930 1.00 17.56 ? 290 ARG E NH2   1 
ATOM   8881  N  N     . LEU E 2 291 ? -2.263  -3.346  -114.703 1.00 2.00  ? 291 LEU E N     1 
ATOM   8882  C  CA    . LEU E 2 291 ? -1.942  -2.702  -113.434 1.00 2.00  ? 291 LEU E CA    1 
ATOM   8883  C  C     . LEU E 2 291 ? -2.949  -3.041  -112.365 1.00 2.00  ? 291 LEU E C     1 
ATOM   8884  O  O     . LEU E 2 291 ? -4.134  -2.884  -112.567 1.00 3.40  ? 291 LEU E O     1 
ATOM   8885  C  CB    . LEU E 2 291 ? -1.876  -1.194  -113.609 1.00 2.00  ? 291 LEU E CB    1 
ATOM   8886  C  CG    . LEU E 2 291 ? -0.580  -0.721  -114.249 1.00 25.39 ? 291 LEU E CG    1 
ATOM   8887  C  CD1   . LEU E 2 291 ? -0.572  0.755   -114.502 1.00 2.00  ? 291 LEU E CD1   1 
ATOM   8888  C  CD2   . LEU E 2 291 ? 0.600   -1.155  -113.426 1.00 5.36  ? 291 LEU E CD2   1 
ATOM   8889  N  N     . THR E 2 292 ? -2.493  -3.495  -111.211 1.00 2.00  ? 292 THR E N     1 
ATOM   8890  C  CA    . THR E 2 292 ? -3.445  -3.576  -110.139 1.00 2.00  ? 292 THR E CA    1 
ATOM   8891  C  C     . THR E 2 292 ? -3.446  -2.433  -109.121 1.00 7.88  ? 292 THR E C     1 
ATOM   8892  O  O     . THR E 2 292 ? -4.483  -2.227  -108.432 1.00 2.00  ? 292 THR E O     1 
ATOM   8893  C  CB    . THR E 2 292 ? -3.309  -4.817  -109.358 1.00 6.10  ? 292 THR E CB    1 
ATOM   8894  O  OG1   . THR E 2 292 ? -1.997  -4.859  -108.864 1.00 2.00  ? 292 THR E OG1   1 
ATOM   8895  C  CG2   . THR E 2 292 ? -3.691  -6.036  -110.165 1.00 2.00  ? 292 THR E CG2   1 
ATOM   8896  N  N     . THR E 2 293 ? -2.293  -1.759  -108.990 1.00 2.00  ? 293 THR E N     1 
ATOM   8897  C  CA    . THR E 2 293 ? -2.158  -0.585  -108.203 1.00 2.00  ? 293 THR E CA    1 
ATOM   8898  C  C     . THR E 2 293 ? -1.688  0.623   -108.978 1.00 3.35  ? 293 THR E C     1 
ATOM   8899  O  O     . THR E 2 293 ? -0.741  0.540   -109.753 1.00 2.27  ? 293 THR E O     1 
ATOM   8900  C  CB    . THR E 2 293 ? -1.224  -0.797  -107.005 1.00 3.92  ? 293 THR E CB    1 
ATOM   8901  O  OG1   . THR E 2 293 ? -1.926  -1.525  -105.994 1.00 4.54  ? 293 THR E OG1   1 
ATOM   8902  C  CG2   . THR E 2 293 ? -0.750  0.559   -106.423 1.00 2.00  ? 293 THR E CG2   1 
ATOM   8903  N  N     . LEU E 2 294 ? -2.351  1.764   -108.780 1.00 2.00  ? 294 LEU E N     1 
ATOM   8904  C  CA    . LEU E 2 294 ? -1.909  2.963   -109.455 1.00 2.00  ? 294 LEU E CA    1 
ATOM   8905  C  C     . LEU E 2 294 ? -1.953  4.174   -108.478 1.00 10.72 ? 294 LEU E C     1 
ATOM   8906  O  O     . LEU E 2 294 ? -2.962  4.369   -107.715 1.00 2.47  ? 294 LEU E O     1 
ATOM   8907  C  CB    . LEU E 2 294 ? -2.770  3.185   -110.663 1.00 2.89  ? 294 LEU E CB    1 
ATOM   8908  C  CG    . LEU E 2 294 ? -2.660  4.451   -111.528 1.00 13.51 ? 294 LEU E CG    1 
ATOM   8909  C  CD1   . LEU E 2 294 ? -1.427  4.295   -112.290 1.00 2.00  ? 294 LEU E CD1   1 
ATOM   8910  C  CD2   . LEU E 2 294 ? -3.886  4.526   -112.535 1.00 3.84  ? 294 LEU E CD2   1 
ATOM   8911  N  N     . ASN E 2 295 ? -0.847  4.941   -108.442 1.00 2.00  ? 295 ASN E N     1 
ATOM   8912  C  CA    . ASN E 2 295 ? -0.678  5.998   -107.439 1.00 2.07  ? 295 ASN E CA    1 
ATOM   8913  C  C     . ASN E 2 295 ? -0.426  7.292   -108.130 1.00 2.00  ? 295 ASN E C     1 
ATOM   8914  O  O     . ASN E 2 295 ? 0.655   7.560   -108.637 1.00 3.03  ? 295 ASN E O     1 
ATOM   8915  C  CB    . ASN E 2 295 ? 0.440   5.746   -106.412 1.00 2.00  ? 295 ASN E CB    1 
ATOM   8916  C  CG    . ASN E 2 295 ? 0.537   6.850   -105.392 1.00 3.54  ? 295 ASN E CG    1 
ATOM   8917  O  OD1   . ASN E 2 295 ? -0.098  7.918   -105.519 1.00 8.89  ? 295 ASN E OD1   1 
ATOM   8918  N  ND2   . ASN E 2 295 ? 1.253   6.588   -104.335 1.00 4.49  ? 295 ASN E ND2   1 
ATOM   8919  N  N     . LEU E 2 296 ? -1.443  8.113   -108.174 1.00 3.02  ? 296 LEU E N     1 
ATOM   8920  C  CA    . LEU E 2 296 ? -1.238  9.360   -108.855 1.00 8.12  ? 296 LEU E CA    1 
ATOM   8921  C  C     . LEU E 2 296 ? -1.262  10.580  -107.915 1.00 2.00  ? 296 LEU E C     1 
ATOM   8922  O  O     . LEU E 2 296 ? -1.315  11.699  -108.410 1.00 10.21 ? 296 LEU E O     1 
ATOM   8923  C  CB    . LEU E 2 296 ? -2.148  9.491   -110.096 1.00 2.00  ? 296 LEU E CB    1 
ATOM   8924  C  CG    . LEU E 2 296 ? -2.063  8.397   -111.204 1.00 6.93  ? 296 LEU E CG    1 
ATOM   8925  C  CD1   . LEU E 2 296 ? -3.398  8.168   -111.886 1.00 12.54 ? 296 LEU E CD1   1 
ATOM   8926  C  CD2   . LEU E 2 296 ? -1.055  8.666   -112.274 1.00 2.00  ? 296 LEU E CD2   1 
ATOM   8927  N  N     . SER E 2 297 ? -1.150  10.368  -106.598 1.00 6.77  ? 297 SER E N     1 
ATOM   8928  C  CA    . SER E 2 297 ? -0.975  11.467  -105.582 1.00 7.24  ? 297 SER E CA    1 
ATOM   8929  C  C     . SER E 2 297 ? -0.193  12.750  -105.959 1.00 2.00  ? 297 SER E C     1 
ATOM   8930  O  O     . SER E 2 297 ? -0.495  13.841  -105.423 1.00 4.54  ? 297 SER E O     1 
ATOM   8931  C  CB    . SER E 2 297 ? -0.340  10.949  -104.286 1.00 2.00  ? 297 SER E CB    1 
ATOM   8932  O  OG    . SER E 2 297 ? -1.116  9.975   -103.679 1.00 13.97 ? 297 SER E OG    1 
ATOM   8933  N  N     . TYR E 2 298 ? 0.830   12.630  -106.797 1.00 2.00  ? 298 TYR E N     1 
ATOM   8934  C  CA    . TYR E 2 298 ? 1.671   13.760  -107.077 1.00 2.00  ? 298 TYR E CA    1 
ATOM   8935  C  C     . TYR E 2 298 ? 1.568   14.178  -108.526 1.00 9.97  ? 298 TYR E C     1 
ATOM   8936  O  O     . TYR E 2 298 ? 2.383   15.018  -108.970 1.00 9.08  ? 298 TYR E O     1 
ATOM   8937  C  CB    . TYR E 2 298 ? 3.151   13.444  -106.847 1.00 4.30  ? 298 TYR E CB    1 
ATOM   8938  C  CG    . TYR E 2 298 ? 3.511   12.743  -105.585 1.00 5.63  ? 298 TYR E CG    1 
ATOM   8939  C  CD1   . TYR E 2 298 ? 4.452   11.696  -105.617 1.00 23.13 ? 298 TYR E CD1   1 
ATOM   8940  C  CD2   . TYR E 2 298 ? 2.955   13.121  -104.372 1.00 9.55  ? 298 TYR E CD2   1 
ATOM   8941  C  CE1   . TYR E 2 298 ? 4.811   11.035  -104.511 1.00 5.98  ? 298 TYR E CE1   1 
ATOM   8942  C  CE2   . TYR E 2 298 ? 3.289   12.443  -103.188 1.00 23.29 ? 298 TYR E CE2   1 
ATOM   8943  C  CZ    . TYR E 2 298 ? 4.223   11.395  -103.277 1.00 37.12 ? 298 TYR E CZ    1 
ATOM   8944  O  OH    . TYR E 2 298 ? 4.591   10.713  -102.135 1.00 36.66 ? 298 TYR E OH    1 
ATOM   8945  N  N     . ALA E 2 299 ? 0.677   13.565  -109.314 1.00 2.00  ? 299 ALA E N     1 
ATOM   8946  C  CA    . ALA E 2 299 ? 0.435   14.139  -110.661 1.00 2.21  ? 299 ALA E CA    1 
ATOM   8947  C  C     . ALA E 2 299 ? -0.506  15.278  -110.475 1.00 2.00  ? 299 ALA E C     1 
ATOM   8948  O  O     . ALA E 2 299 ? -1.439  15.190  -109.731 1.00 2.00  ? 299 ALA E O     1 
ATOM   8949  C  CB    . ALA E 2 299 ? -0.199  13.149  -111.596 1.00 2.13  ? 299 ALA E CB    1 
ATOM   8950  N  N     . THR E 2 300 ? -0.329  16.350  -111.173 1.00 2.05  ? 300 THR E N     1 
ATOM   8951  C  CA    . THR E 2 300 ? -1.367  17.324  -111.004 1.00 15.28 ? 300 THR E CA    1 
ATOM   8952  C  C     . THR E 2 300 ? -2.126  17.577  -112.280 1.00 2.41  ? 300 THR E C     1 
ATOM   8953  O  O     . THR E 2 300 ? -2.826  18.575  -112.380 1.00 15.23 ? 300 THR E O     1 
ATOM   8954  C  CB    . THR E 2 300 ? -0.881  18.645  -110.311 1.00 10.53 ? 300 THR E CB    1 
ATOM   8955  O  OG1   . THR E 2 300 ? 0.134   19.206  -111.132 1.00 7.91  ? 300 THR E OG1   1 
ATOM   8956  C  CG2   . THR E 2 300 ? -0.319  18.362  -108.923 1.00 2.05  ? 300 THR E CG2   1 
ATOM   8957  N  N     . VAL E 2 301 ? -1.970  16.693  -113.243 1.00 2.00  ? 301 VAL E N     1 
ATOM   8958  C  CA    . VAL E 2 301 ? -2.917  16.573  -114.319 1.00 2.00  ? 301 VAL E CA    1 
ATOM   8959  C  C     . VAL E 2 301 ? -4.402  16.661  -114.048 1.00 2.00  ? 301 VAL E C     1 
ATOM   8960  O  O     . VAL E 2 301 ? -4.886  16.357  -112.975 1.00 7.16  ? 301 VAL E O     1 
ATOM   8961  C  CB    . VAL E 2 301 ? -2.681  15.374  -115.175 1.00 2.00  ? 301 VAL E CB    1 
ATOM   8962  C  CG1   . VAL E 2 301 ? -1.315  15.407  -115.696 1.00 2.00  ? 301 VAL E CG1   1 
ATOM   8963  C  CG2   . VAL E 2 301 ? -2.992  14.100  -114.387 1.00 3.55  ? 301 VAL E CG2   1 
ATOM   8964  N  N     . GLN E 2 302 ? -5.112  17.086  -115.081 1.00 2.00  ? 302 GLN E N     1 
ATOM   8965  C  CA    . GLN E 2 302 ? -6.504  17.352  -115.055 1.00 2.00  ? 302 GLN E CA    1 
ATOM   8966  C  C     . GLN E 2 302 ? -7.406  16.111  -115.335 1.00 2.36  ? 302 GLN E C     1 
ATOM   8967  O  O     . GLN E 2 302 ? -7.015  15.118  -115.996 1.00 2.00  ? 302 GLN E O     1 
ATOM   8968  C  CB    . GLN E 2 302 ? -6.708  18.489  -116.046 1.00 2.00  ? 302 GLN E CB    1 
ATOM   8969  C  CG    . GLN E 2 302 ? -6.356  19.892  -115.370 1.00 4.92  ? 302 GLN E CG    1 
ATOM   8970  C  CD    . GLN E 2 302 ? -7.326  20.275  -114.159 1.00 35.63 ? 302 GLN E CD    1 
ATOM   8971  O  OE1   . GLN E 2 302 ? -8.117  19.441  -113.631 1.00 39.36 ? 302 GLN E OE1   1 
ATOM   8972  N  NE2   . GLN E 2 302 ? -7.255  21.527  -113.746 1.00 24.57 ? 302 GLN E NE2   1 
ATOM   8973  N  N     . SER E 2 303 ? -8.615  16.179  -114.797 1.00 2.00  ? 303 SER E N     1 
ATOM   8974  C  CA    . SER E 2 303 ? -9.585  15.110  -114.922 1.00 3.21  ? 303 SER E CA    1 
ATOM   8975  C  C     . SER E 2 303 ? -9.534  14.305  -116.213 1.00 7.31  ? 303 SER E C     1 
ATOM   8976  O  O     . SER E 2 303 ? -9.363  13.066  -116.216 1.00 13.11 ? 303 SER E O     1 
ATOM   8977  C  CB    . SER E 2 303 ? -10.985 15.615  -114.741 1.00 4.25  ? 303 SER E CB    1 
ATOM   8978  O  OG    . SER E 2 303 ? -11.815 14.507  -114.484 1.00 7.44  ? 303 SER E OG    1 
ATOM   8979  N  N     . TYR E 2 304 ? -9.675  14.992  -117.330 1.00 4.56  ? 304 TYR E N     1 
ATOM   8980  C  CA    . TYR E 2 304 ? -9.835  14.266  -118.558 1.00 2.18  ? 304 TYR E CA    1 
ATOM   8981  C  C     . TYR E 2 304 ? -8.556  13.421  -118.825 1.00 7.85  ? 304 TYR E C     1 
ATOM   8982  O  O     . TYR E 2 304 ? -8.589  12.386  -119.422 1.00 6.42  ? 304 TYR E O     1 
ATOM   8983  C  CB    . TYR E 2 304 ? -10.046 15.243  -119.647 1.00 2.00  ? 304 TYR E CB    1 
ATOM   8984  C  CG    . TYR E 2 304 ? -10.298 14.599  -120.974 1.00 17.25 ? 304 TYR E CG    1 
ATOM   8985  C  CD1   . TYR E 2 304 ? -11.544 13.970  -121.273 1.00 2.00  ? 304 TYR E CD1   1 
ATOM   8986  C  CD2   . TYR E 2 304 ? -9.294  14.610  -121.933 1.00 2.00  ? 304 TYR E CD2   1 
ATOM   8987  C  CE1   . TYR E 2 304 ? -11.749 13.413  -122.473 1.00 2.00  ? 304 TYR E CE1   1 
ATOM   8988  C  CE2   . TYR E 2 304 ? -9.495  14.062  -123.144 1.00 2.00  ? 304 TYR E CE2   1 
ATOM   8989  C  CZ    . TYR E 2 304 ? -10.730 13.449  -123.425 1.00 10.31 ? 304 TYR E CZ    1 
ATOM   8990  O  OH    . TYR E 2 304 ? -10.894 12.925  -124.709 1.00 2.00  ? 304 TYR E OH    1 
ATOM   8991  N  N     . ASP E 2 305 ? -7.411  13.903  -118.407 1.00 12.61 ? 305 ASP E N     1 
ATOM   8992  C  CA    . ASP E 2 305 ? -6.184  13.150  -118.613 1.00 8.06  ? 305 ASP E CA    1 
ATOM   8993  C  C     . ASP E 2 305 ? -6.190  11.935  -117.736 1.00 9.09  ? 305 ASP E C     1 
ATOM   8994  O  O     . ASP E 2 305 ? -5.717  10.911  -118.193 1.00 4.64  ? 305 ASP E O     1 
ATOM   8995  C  CB    . ASP E 2 305 ? -4.962  13.968  -118.236 1.00 2.99  ? 305 ASP E CB    1 
ATOM   8996  C  CG    . ASP E 2 305 ? -4.713  15.101  -119.221 1.00 14.14 ? 305 ASP E CG    1 
ATOM   8997  O  OD1   . ASP E 2 305 ? -4.521  14.800  -120.415 1.00 2.55  ? 305 ASP E OD1   1 
ATOM   8998  O  OD2   . ASP E 2 305 ? -4.719  16.279  -118.779 1.00 46.59 ? 305 ASP E OD2   1 
ATOM   8999  N  N     . LEU E 2 306 ? -6.670  12.048  -116.490 1.00 2.00  ? 306 LEU E N     1 
ATOM   9000  C  CA    . LEU E 2 306 ? -6.778  10.907  -115.609 1.00 2.00  ? 306 LEU E CA    1 
ATOM   9001  C  C     . LEU E 2 306 ? -7.734  9.936   -116.288 1.00 9.59  ? 306 LEU E C     1 
ATOM   9002  O  O     . LEU E 2 306 ? -7.402  8.768   -116.422 1.00 15.30 ? 306 LEU E O     1 
ATOM   9003  C  CB    . LEU E 2 306 ? -7.305  11.281  -114.202 1.00 2.00  ? 306 LEU E CB    1 
ATOM   9004  C  CG    . LEU E 2 306 ? -6.371  12.263  -113.405 1.00 11.46 ? 306 LEU E CG    1 
ATOM   9005  C  CD1   . LEU E 2 306 ? -7.046  13.018  -112.183 1.00 2.00  ? 306 LEU E CD1   1 
ATOM   9006  C  CD2   . LEU E 2 306 ? -5.117  11.517  -112.952 1.00 2.00  ? 306 LEU E CD2   1 
ATOM   9007  N  N     . VAL E 2 307 ? -8.895  10.422  -116.742 1.00 11.00 ? 307 VAL E N     1 
ATOM   9008  C  CA    . VAL E 2 307 ? -9.882  9.569   -117.372 1.00 2.00  ? 307 VAL E CA    1 
ATOM   9009  C  C     . VAL E 2 307 ? -9.234  8.763   -118.493 1.00 5.94  ? 307 VAL E C     1 
ATOM   9010  O  O     . VAL E 2 307 ? -9.358  7.548   -118.525 1.00 2.49  ? 307 VAL E O     1 
ATOM   9011  C  CB    . VAL E 2 307 ? -11.145 10.384  -117.832 1.00 4.72  ? 307 VAL E CB    1 
ATOM   9012  C  CG1   . VAL E 2 307 ? -11.841 9.726   -118.955 1.00 5.93  ? 307 VAL E CG1   1 
ATOM   9013  C  CG2   . VAL E 2 307 ? -12.149 10.540  -116.699 1.00 2.00  ? 307 VAL E CG2   1 
ATOM   9014  N  N     . LYS E 2 308 ? -8.494  9.382   -119.382 1.00 2.00  ? 308 LYS E N     1 
ATOM   9015  C  CA    . LYS E 2 308 ? -7.999  8.623   -120.499 1.00 2.00  ? 308 LYS E CA    1 
ATOM   9016  C  C     . LYS E 2 308 ? -7.092  7.446   -119.982 1.00 4.85  ? 308 LYS E C     1 
ATOM   9017  O  O     . LYS E 2 308 ? -6.792  6.448   -120.700 1.00 5.87  ? 308 LYS E O     1 
ATOM   9018  C  CB    . LYS E 2 308 ? -7.203  9.563   -121.444 1.00 2.00  ? 308 LYS E CB    1 
ATOM   9019  C  CG    . LYS E 2 308 ? -8.100  10.390  -122.335 1.00 2.50  ? 308 LYS E CG    1 
ATOM   9020  C  CD    . LYS E 2 308 ? -7.393  11.060  -123.578 1.00 5.73  ? 308 LYS E CD    1 
ATOM   9021  C  CE    . LYS E 2 308 ? -5.976  11.611  -123.261 1.00 33.02 ? 308 LYS E CE    1 
ATOM   9022  N  NZ    . LYS E 2 308 ? -5.813  13.123  -123.300 1.00 7.11  ? 308 LYS E NZ    1 
ATOM   9023  N  N     . LEU E 2 309 ? -6.573  7.614   -118.773 1.00 4.28  ? 309 LEU E N     1 
ATOM   9024  C  CA    . LEU E 2 309 ? -5.555  6.712   -118.251 1.00 3.49  ? 309 LEU E CA    1 
ATOM   9025  C  C     . LEU E 2 309 ? -6.388  5.567   -117.688 1.00 6.11  ? 309 LEU E C     1 
ATOM   9026  O  O     . LEU E 2 309 ? -6.143  4.373   -117.967 1.00 3.29  ? 309 LEU E O     1 
ATOM   9027  C  CB    . LEU E 2 309 ? -4.723  7.378   -117.122 1.00 2.00  ? 309 LEU E CB    1 
ATOM   9028  C  CG    . LEU E 2 309 ? -3.226  7.052   -116.816 1.00 3.16  ? 309 LEU E CG    1 
ATOM   9029  C  CD1   . LEU E 2 309 ? -2.725  7.307   -115.411 1.00 11.43 ? 309 LEU E CD1   1 
ATOM   9030  C  CD2   . LEU E 2 309 ? -2.617  5.747   -117.287 1.00 11.67 ? 309 LEU E CD2   1 
ATOM   9031  N  N     . LEU E 2 310 ? -7.347  5.973   -116.863 1.00 2.00  ? 310 LEU E N     1 
ATOM   9032  C  CA    . LEU E 2 310 ? -8.138  5.095   -116.117 1.00 4.69  ? 310 LEU E CA    1 
ATOM   9033  C  C     . LEU E 2 310 ? -8.867  4.112   -117.052 1.00 15.47 ? 310 LEU E C     1 
ATOM   9034  O  O     . LEU E 2 310 ? -8.914  2.915   -116.777 1.00 4.38  ? 310 LEU E O     1 
ATOM   9035  C  CB    . LEU E 2 310 ? -9.090  5.899   -115.207 1.00 2.10  ? 310 LEU E CB    1 
ATOM   9036  C  CG    . LEU E 2 310 ? -8.233  6.634   -114.105 1.00 10.72 ? 310 LEU E CG    1 
ATOM   9037  C  CD1   . LEU E 2 310 ? -9.072  7.317   -112.971 1.00 2.00  ? 310 LEU E CD1   1 
ATOM   9038  C  CD2   . LEU E 2 310 ? -7.222  5.692   -113.417 1.00 4.74  ? 310 LEU E CD2   1 
ATOM   9039  N  N     . CYS E 2 311 ? -9.413  4.615   -118.157 1.00 2.00  ? 311 CYS E N     1 
ATOM   9040  C  CA    . CYS E 2 311 ? -10.093 3.786   -119.095 1.00 2.33  ? 311 CYS E CA    1 
ATOM   9041  C  C     . CYS E 2 311 ? -9.320  2.546   -119.451 1.00 6.16  ? 311 CYS E C     1 
ATOM   9042  O  O     . CYS E 2 311 ? -9.852  1.658   -120.075 1.00 2.26  ? 311 CYS E O     1 
ATOM   9043  C  CB    . CYS E 2 311 ? -10.360 4.589   -120.396 1.00 2.00  ? 311 CYS E CB    1 
ATOM   9044  S  SG    . CYS E 2 311 ? -11.806 5.520   -120.003 1.00 11.94 ? 311 CYS E SG    1 
ATOM   9045  N  N     . GLN E 2 312 ? -8.038  2.503   -119.134 1.00 8.54  ? 312 GLN E N     1 
ATOM   9046  C  CA    . GLN E 2 312 ? -7.192  1.484   -119.720 1.00 8.90  ? 312 GLN E CA    1 
ATOM   9047  C  C     . GLN E 2 312 ? -6.623  0.613   -118.605 1.00 2.21  ? 312 GLN E C     1 
ATOM   9048  O  O     . GLN E 2 312 ? -5.597  -0.047  -118.792 1.00 11.31 ? 312 GLN E O     1 
ATOM   9049  C  CB    . GLN E 2 312 ? -6.131  2.082   -120.667 1.00 2.00  ? 312 GLN E CB    1 
ATOM   9050  C  CG    . GLN E 2 312 ? -6.227  1.400   -122.088 1.00 26.87 ? 312 GLN E CG    1 
ATOM   9051  C  CD    . GLN E 2 312 ? -5.535  2.214   -123.164 1.00 10.93 ? 312 GLN E CD    1 
ATOM   9052  O  OE1   . GLN E 2 312 ? -4.969  1.672   -124.138 1.00 40.28 ? 312 GLN E OE1   1 
ATOM   9053  N  NE2   . GLN E 2 312 ? -5.550  3.547   -122.977 1.00 28.18 ? 312 GLN E NE2   1 
ATOM   9054  N  N     . CYS E 2 313 ? -7.328  0.605   -117.476 1.00 2.00  ? 313 CYS E N     1 
ATOM   9055  C  CA    . CYS E 2 313 ? -6.902  -0.088  -116.276 1.00 2.00  ? 313 CYS E CA    1 
ATOM   9056  C  C     . CYS E 2 313 ? -8.057  -0.923  -115.744 1.00 10.13 ? 313 CYS E C     1 
ATOM   9057  O  O     . CYS E 2 313 ? -8.564  -0.646  -114.633 1.00 2.15  ? 313 CYS E O     1 
ATOM   9058  C  CB    . CYS E 2 313 ? -6.498  0.906   -115.174 1.00 5.80  ? 313 CYS E CB    1 
ATOM   9059  S  SG    . CYS E 2 313 ? -5.228  2.089   -115.806 1.00 11.51 ? 313 CYS E SG    1 
ATOM   9060  N  N     . PRO E 2 314 ? -8.437  -1.979  -116.485 1.00 2.00  ? 314 PRO E N     1 
ATOM   9061  C  CA    . PRO E 2 314 ? -9.547  -2.792  -116.102 1.00 2.67  ? 314 PRO E CA    1 
ATOM   9062  C  C     . PRO E 2 314 ? -9.235  -3.567  -114.880 1.00 8.18  ? 314 PRO E C     1 
ATOM   9063  O  O     . PRO E 2 314 ? -10.167 -3.997  -114.214 1.00 4.54  ? 314 PRO E O     1 
ATOM   9064  C  CB    . PRO E 2 314 ? -9.686  -3.822  -117.277 1.00 4.40  ? 314 PRO E CB    1 
ATOM   9065  C  CG    . PRO E 2 314 ? -9.009  -3.170  -118.412 1.00 2.00  ? 314 PRO E CG    1 
ATOM   9066  C  CD    . PRO E 2 314 ? -7.863  -2.424  -117.771 1.00 10.68 ? 314 PRO E CD    1 
ATOM   9067  N  N     . LYS E 2 315 ? -7.964  -3.848  -114.606 1.00 5.14  ? 315 LYS E N     1 
ATOM   9068  C  CA    . LYS E 2 315 ? -7.748  -4.746  -113.474 1.00 6.23  ? 315 LYS E CA    1 
ATOM   9069  C  C     . LYS E 2 315 ? -7.519  -4.055  -112.128 1.00 11.05 ? 315 LYS E C     1 
ATOM   9070  O  O     . LYS E 2 315 ? -7.130  -4.703  -111.159 1.00 13.38 ? 315 LYS E O     1 
ATOM   9071  C  CB    . LYS E 2 315 ? -6.726  -5.819  -113.750 1.00 4.14  ? 315 LYS E CB    1 
ATOM   9072  C  CG    . LYS E 2 315 ? -6.853  -6.432  -115.118 1.00 8.92  ? 315 LYS E CG    1 
ATOM   9073  C  CD    . LYS E 2 315 ? -7.216  -7.864  -115.034 1.00 5.17  ? 315 LYS E CD    1 
ATOM   9074  C  CE    . LYS E 2 315 ? -5.978  -8.624  -114.989 1.00 15.39 ? 315 LYS E CE    1 
ATOM   9075  N  NZ    . LYS E 2 315 ? -5.962  -9.640  -116.096 1.00 25.62 ? 315 LYS E NZ    1 
ATOM   9076  N  N     . LEU E 2 316 ? -7.746  -2.748  -112.071 1.00 3.83  ? 316 LEU E N     1 
ATOM   9077  C  CA    . LEU E 2 316 ? -7.148  -1.926  -111.041 1.00 7.66  ? 316 LEU E CA    1 
ATOM   9078  C  C     . LEU E 2 316 ? -7.775  -2.288  -109.697 1.00 2.00  ? 316 LEU E C     1 
ATOM   9079  O  O     . LEU E 2 316 ? -8.934  -2.296  -109.629 1.00 2.00  ? 316 LEU E O     1 
ATOM   9080  C  CB    . LEU E 2 316 ? -7.493  -0.491  -111.375 1.00 14.79 ? 316 LEU E CB    1 
ATOM   9081  C  CG    . LEU E 2 316 ? -6.742  0.654   -110.725 1.00 21.95 ? 316 LEU E CG    1 
ATOM   9082  C  CD1   . LEU E 2 316 ? -5.368  0.286   -111.008 1.00 6.83  ? 316 LEU E CD1   1 
ATOM   9083  C  CD2   . LEU E 2 316 ? -7.103  1.941   -111.472 1.00 6.16  ? 316 LEU E CD2   1 
ATOM   9084  N  N     . GLN E 2 317 ? -7.029  -2.631  -108.641 1.00 2.00  ? 317 GLN E N     1 
ATOM   9085  C  CA    . GLN E 2 317 ? -7.658  -2.883  -107.362 1.00 2.00  ? 317 GLN E CA    1 
ATOM   9086  C  C     . GLN E 2 317 ? -7.543  -1.736  -106.351 1.00 3.34  ? 317 GLN E C     1 
ATOM   9087  O  O     . GLN E 2 317 ? -8.279  -1.688  -105.351 1.00 2.64  ? 317 GLN E O     1 
ATOM   9088  C  CB    . GLN E 2 317 ? -7.215  -4.212  -106.748 1.00 3.61  ? 317 GLN E CB    1 
ATOM   9089  C  CG    . GLN E 2 317 ? -7.011  -5.359  -107.782 1.00 6.83  ? 317 GLN E CG    1 
ATOM   9090  C  CD    . GLN E 2 317 ? -6.621  -6.677  -107.119 1.00 11.69 ? 317 GLN E CD    1 
ATOM   9091  O  OE1   . GLN E 2 317 ? -7.386  -7.632  -107.108 1.00 12.17 ? 317 GLN E OE1   1 
ATOM   9092  N  NE2   . GLN E 2 317 ? -5.433  -6.727  -106.564 1.00 5.51  ? 317 GLN E NE2   1 
ATOM   9093  N  N     . ARG E 2 318 ? -6.648  -0.799  -106.641 1.00 3.55  ? 318 ARG E N     1 
ATOM   9094  C  CA    . ARG E 2 318 ? -6.234  0.272   -105.714 1.00 9.68  ? 318 ARG E CA    1 
ATOM   9095  C  C     . ARG E 2 318 ? -5.860  1.557   -106.483 1.00 13.96 ? 318 ARG E C     1 
ATOM   9096  O  O     . ARG E 2 318 ? -4.893  1.543   -107.310 1.00 10.89 ? 318 ARG E O     1 
ATOM   9097  C  CB    . ARG E 2 318 ? -4.986  -0.121  -104.953 1.00 10.92 ? 318 ARG E CB    1 
ATOM   9098  C  CG    . ARG E 2 318 ? -4.574  1.021   -104.013 1.00 18.91 ? 318 ARG E CG    1 
ATOM   9099  C  CD    . ARG E 2 318 ? -3.291  0.669   -103.282 1.00 52.01 ? 318 ARG E CD    1 
ATOM   9100  N  NE    . ARG E 2 318 ? -3.500  -0.519  -102.472 1.00 40.50 ? 318 ARG E NE    1 
ATOM   9101  C  CZ    . ARG E 2 318 ? -2.589  -1.461  -102.273 1.00 48.91 ? 318 ARG E CZ    1 
ATOM   9102  N  NH1   . ARG E 2 318 ? -1.367  -1.350  -102.847 1.00 7.84  ? 318 ARG E NH1   1 
ATOM   9103  N  NH2   . ARG E 2 318 ? -2.930  -2.511  -101.496 1.00 25.27 ? 318 ARG E NH2   1 
ATOM   9104  N  N     . LEU E 2 319 ? -6.616  2.633   -106.258 1.00 2.00  ? 319 LEU E N     1 
ATOM   9105  C  CA    . LEU E 2 319 ? -6.269  3.890   -106.913 1.00 8.08  ? 319 LEU E CA    1 
ATOM   9106  C  C     . LEU E 2 319 ? -6.057  4.989   -105.829 1.00 2.07  ? 319 LEU E C     1 
ATOM   9107  O  O     . LEU E 2 319 ? -6.873  5.144   -104.920 1.00 2.00  ? 319 LEU E O     1 
ATOM   9108  C  CB    . LEU E 2 319 ? -7.417  4.308   -107.776 1.00 14.74 ? 319 LEU E CB    1 
ATOM   9109  C  CG    . LEU E 2 319 ? -7.221  5.652   -108.472 1.00 8.88  ? 319 LEU E CG    1 
ATOM   9110  C  CD1   . LEU E 2 319 ? -5.925  5.619   -109.225 1.00 2.89  ? 319 LEU E CD1   1 
ATOM   9111  C  CD2   . LEU E 2 319 ? -8.366  5.873   -109.439 1.00 6.23  ? 319 LEU E CD2   1 
ATOM   9112  N  N     . TRP E 2 320 ? -4.925  5.662   -105.905 1.00 2.00  ? 320 TRP E N     1 
ATOM   9113  C  CA    . TRP E 2 320 ? -4.624  6.832   -105.099 1.00 6.06  ? 320 TRP E CA    1 
ATOM   9114  C  C     . TRP E 2 320 ? -4.498  7.957   -106.158 1.00 8.25  ? 320 TRP E C     1 
ATOM   9115  O  O     . TRP E 2 320 ? -3.663  7.815   -107.106 1.00 3.06  ? 320 TRP E O     1 
ATOM   9116  C  CB    . TRP E 2 320 ? -3.244  6.650   -104.434 1.00 2.00  ? 320 TRP E CB    1 
ATOM   9117  C  CG    . TRP E 2 320 ? -3.258  5.737   -103.233 1.00 10.20 ? 320 TRP E CG    1 
ATOM   9118  C  CD1   . TRP E 2 320 ? -4.137  4.793   -103.007 1.00 2.00  ? 320 TRP E CD1   1 
ATOM   9119  C  CD2   . TRP E 2 320 ? -2.337  5.719   -102.096 1.00 2.00  ? 320 TRP E CD2   1 
ATOM   9120  N  NE1   . TRP E 2 320 ? -3.839  4.130   -101.851 1.00 11.55 ? 320 TRP E NE1   1 
ATOM   9121  C  CE2   . TRP E 2 320 ? -2.743  4.674   -101.268 1.00 2.00  ? 320 TRP E CE2   1 
ATOM   9122  C  CE3   . TRP E 2 320 ? -1.210  6.471   -101.733 1.00 2.00  ? 320 TRP E CE3   1 
ATOM   9123  C  CZ2   . TRP E 2 320 ? -2.143  4.400   -100.011 1.00 19.86 ? 320 TRP E CZ2   1 
ATOM   9124  C  CZ3   . TRP E 2 320 ? -0.581  6.177   -100.511 1.00 4.53  ? 320 TRP E CZ3   1 
ATOM   9125  C  CH2   . TRP E 2 320 ? -1.031  5.132   -99.674  1.00 2.00  ? 320 TRP E CH2   1 
ATOM   9126  N  N     . VAL E 2 321 ? -5.272  9.053   -105.999 1.00 5.88  ? 321 VAL E N     1 
ATOM   9127  C  CA    . VAL E 2 321 ? -5.320  10.175  -106.996 1.00 7.39  ? 321 VAL E CA    1 
ATOM   9128  C  C     . VAL E 2 321 ? -5.611  11.494  -106.313 1.00 6.60  ? 321 VAL E C     1 
ATOM   9129  O  O     . VAL E 2 321 ? -6.338  11.499  -105.277 1.00 11.75 ? 321 VAL E O     1 
ATOM   9130  C  CB    . VAL E 2 321 ? -6.604  10.125  -107.828 1.00 7.23  ? 321 VAL E CB    1 
ATOM   9131  C  CG1   . VAL E 2 321 ? -6.381  10.015  -109.298 1.00 2.00  ? 321 VAL E CG1   1 
ATOM   9132  C  CG2   . VAL E 2 321 ? -7.783  9.353   -107.130 1.00 4.61  ? 321 VAL E CG2   1 
ATOM   9133  N  N     . LEU E 2 322 ? -5.156  12.607  -106.913 1.00 5.89  ? 322 LEU E N     1 
ATOM   9134  C  CA    . LEU E 2 322 ? -5.707  13.935  -106.550 1.00 2.00  ? 322 LEU E CA    1 
ATOM   9135  C  C     . LEU E 2 322 ? -7.214  14.053  -106.746 1.00 3.20  ? 322 LEU E C     1 
ATOM   9136  O  O     . LEU E 2 322 ? -7.808  13.503  -107.702 1.00 11.21 ? 322 LEU E O     1 
ATOM   9137  C  CB    . LEU E 2 322 ? -4.926  15.106  -107.185 1.00 2.00  ? 322 LEU E CB    1 
ATOM   9138  C  CG    . LEU E 2 322 ? -3.539  15.111  -106.658 1.00 2.00  ? 322 LEU E CG    1 
ATOM   9139  C  CD1   . LEU E 2 322 ? -2.477  15.904  -107.420 1.00 2.00  ? 322 LEU E CD1   1 
ATOM   9140  C  CD2   . LEU E 2 322 ? -3.683  15.495  -105.158 1.00 2.00  ? 322 LEU E CD2   1 
ATOM   9141  N  N     . ASP E 2 323 ? -7.852  14.864  -105.901 1.00 6.02  ? 323 ASP E N     1 
ATOM   9142  C  CA    . ASP E 2 323 ? -9.186  15.339  -106.211 1.00 2.54  ? 323 ASP E CA    1 
ATOM   9143  C  C     . ASP E 2 323 ? -9.408  15.941  -107.602 1.00 2.00  ? 323 ASP E C     1 
ATOM   9144  O  O     . ASP E 2 323 ? -10.536 16.072  -108.006 1.00 2.00  ? 323 ASP E O     1 
ATOM   9145  C  CB    . ASP E 2 323 ? -9.665  16.290  -105.137 1.00 2.00  ? 323 ASP E CB    1 
ATOM   9146  C  CG    . ASP E 2 323 ? -8.942  17.608  -105.141 1.00 2.00  ? 323 ASP E CG    1 
ATOM   9147  O  OD1   . ASP E 2 323 ? -8.254  18.049  -106.097 1.00 9.54  ? 323 ASP E OD1   1 
ATOM   9148  O  OD2   . ASP E 2 323 ? -9.119  18.289  -104.158 1.00 5.72  ? 323 ASP E OD2   1 
ATOM   9149  N  N     . TYR E 2 324 ? -8.330  16.290  -108.296 1.00 2.00  ? 324 TYR E N     1 
ATOM   9150  C  CA    . TYR E 2 324 ? -8.428  16.805  -109.656 1.00 2.47  ? 324 TYR E CA    1 
ATOM   9151  C  C     . TYR E 2 324 ? -9.290  15.898  -110.529 1.00 6.81  ? 324 TYR E C     1 
ATOM   9152  O  O     . TYR E 2 324 ? -10.100 16.373  -111.324 1.00 5.67  ? 324 TYR E O     1 
ATOM   9153  C  CB    . TYR E 2 324 ? -7.036  16.960  -110.273 1.00 3.38  ? 324 TYR E CB    1 
ATOM   9154  C  CG    . TYR E 2 324 ? -6.296  18.196  -109.813 1.00 7.49  ? 324 TYR E CG    1 
ATOM   9155  C  CD1   . TYR E 2 324 ? -4.971  18.124  -109.405 1.00 2.00  ? 324 TYR E CD1   1 
ATOM   9156  C  CD2   . TYR E 2 324 ? -6.923  19.434  -109.786 1.00 4.63  ? 324 TYR E CD2   1 
ATOM   9157  C  CE1   . TYR E 2 324 ? -4.291  19.251  -108.984 1.00 14.44 ? 324 TYR E CE1   1 
ATOM   9158  C  CE2   . TYR E 2 324 ? -6.251  20.567  -109.367 1.00 6.08  ? 324 TYR E CE2   1 
ATOM   9159  C  CZ    . TYR E 2 324 ? -4.936  20.469  -108.967 1.00 6.49  ? 324 TYR E CZ    1 
ATOM   9160  O  OH    . TYR E 2 324 ? -4.261  21.594  -108.548 1.00 11.97 ? 324 TYR E OH    1 
ATOM   9161  N  N     . ILE E 2 325 ? -9.108  14.591  -110.374 1.00 4.98  ? 325 ILE E N     1 
ATOM   9162  C  CA    . ILE E 2 325 ? -10.213 13.646  -110.484 1.00 2.38  ? 325 ILE E CA    1 
ATOM   9163  C  C     . ILE E 2 325 ? -11.454 14.161  -109.762 1.00 19.16 ? 325 ILE E C     1 
ATOM   9164  O  O     . ILE E 2 325 ? -11.557 14.063  -108.539 1.00 3.04  ? 325 ILE E O     1 
ATOM   9165  C  CB    . ILE E 2 325 ? -9.806  12.272  -109.922 1.00 13.45 ? 325 ILE E CB    1 
ATOM   9166  C  CG1   . ILE E 2 325 ? -10.037 11.178  -110.966 1.00 14.56 ? 325 ILE E CG1   1 
ATOM   9167  C  CG2   . ILE E 2 325 ? -10.576 11.969  -108.646 1.00 2.00  ? 325 ILE E CG2   1 
ATOM   9168  C  CD1   . ILE E 2 325 ? -11.355 10.451  -110.807 1.00 42.03 ? 325 ILE E CD1   1 
ATOM   9169  N  N     . GLU E 2 326 ? -12.392 14.710  -110.526 1.00 7.24  ? 326 GLU E N     1 
ATOM   9170  C  CA    . GLU E 2 326 ? -13.633 15.227  -109.962 1.00 10.80 ? 326 GLU E CA    1 
ATOM   9171  C  C     . GLU E 2 326 ? -14.764 14.212  -110.092 1.00 5.96  ? 326 GLU E C     1 
ATOM   9172  O  O     . GLU E 2 326 ? -14.561 13.103  -110.587 1.00 11.16 ? 326 GLU E O     1 
ATOM   9173  C  CB    . GLU E 2 326 ? -14.025 16.540  -110.643 1.00 6.14  ? 326 GLU E CB    1 
ATOM   9174  C  CG    . GLU E 2 326 ? -12.847 17.434  -110.993 1.00 2.00  ? 326 GLU E CG    1 
ATOM   9175  C  CD    . GLU E 2 326 ? -13.229 18.561  -111.932 1.00 20.35 ? 326 GLU E CD    1 
ATOM   9176  O  OE1   . GLU E 2 326 ? -13.371 18.303  -113.146 1.00 3.53  ? 326 GLU E OE1   1 
ATOM   9177  O  OE2   . GLU E 2 326 ? -13.387 19.705  -111.457 1.00 8.17  ? 326 GLU E OE2   1 
ATOM   9178  N  N     . ASP E 2 327 ? -15.954 14.598  -109.645 1.00 5.52  ? 327 ASP E N     1 
ATOM   9179  C  CA    . ASP E 2 327 ? -17.146 13.798  -109.859 1.00 8.33  ? 327 ASP E CA    1 
ATOM   9180  C  C     . ASP E 2 327 ? -17.170 12.989  -111.226 1.00 9.26  ? 327 ASP E C     1 
ATOM   9181  O  O     . ASP E 2 327 ? -17.285 11.799  -111.219 1.00 7.29  ? 327 ASP E O     1 
ATOM   9182  C  CB    . ASP E 2 327 ? -18.388 14.664  -109.573 1.00 2.00  ? 327 ASP E CB    1 
ATOM   9183  C  CG    . ASP E 2 327 ? -18.544 14.975  -108.055 1.00 18.35 ? 327 ASP E CG    1 
ATOM   9184  O  OD1   . ASP E 2 327 ? -17.721 14.446  -107.252 1.00 5.01  ? 327 ASP E OD1   1 
ATOM   9185  O  OD2   . ASP E 2 327 ? -19.475 15.725  -107.627 1.00 2.00  ? 327 ASP E OD2   1 
ATOM   9186  N  N     . ALA E 2 328 ? -17.059 13.632  -112.376 1.00 4.02  ? 328 ALA E N     1 
ATOM   9187  C  CA    . ALA E 2 328 ? -17.269 12.977  -113.680 1.00 3.74  ? 328 ALA E CA    1 
ATOM   9188  C  C     . ALA E 2 328 ? -16.211 11.887  -113.863 1.00 11.44 ? 328 ALA E C     1 
ATOM   9189  O  O     . ALA E 2 328 ? -16.433 10.837  -114.508 1.00 2.44  ? 328 ALA E O     1 
ATOM   9190  C  CB    . ALA E 2 328 ? -17.089 14.047  -114.802 1.00 2.00  ? 328 ALA E CB    1 
ATOM   9191  N  N     . GLY E 2 329 ? -15.026 12.214  -113.338 1.00 12.42 ? 329 GLY E N     1 
ATOM   9192  C  CA    . GLY E 2 329 ? -13.842 11.388  -113.473 1.00 5.21  ? 329 GLY E CA    1 
ATOM   9193  C  C     . GLY E 2 329 ? -14.144 10.124  -112.677 1.00 13.42 ? 329 GLY E C     1 
ATOM   9194  O  O     . GLY E 2 329 ? -13.830 9.033   -113.121 1.00 9.86  ? 329 GLY E O     1 
ATOM   9195  N  N     . LEU E 2 330 ? -14.740 10.237  -111.486 1.00 5.10  ? 330 LEU E N     1 
ATOM   9196  C  CA    . LEU E 2 330 ? -14.940 9.002   -110.680 1.00 11.80 ? 330 LEU E CA    1 
ATOM   9197  C  C     . LEU E 2 330 ? -16.099 8.200   -111.212 1.00 8.03  ? 330 LEU E C     1 
ATOM   9198  O  O     . LEU E 2 330 ? -16.224 7.056   -110.876 1.00 15.43 ? 330 LEU E O     1 
ATOM   9199  C  CB    . LEU E 2 330 ? -15.277 9.303   -109.230 1.00 2.88  ? 330 LEU E CB    1 
ATOM   9200  C  CG    . LEU E 2 330 ? -14.086 9.747   -108.387 1.00 10.10 ? 330 LEU E CG    1 
ATOM   9201  C  CD1   . LEU E 2 330 ? -14.562 10.509  -107.213 1.00 6.94  ? 330 LEU E CD1   1 
ATOM   9202  C  CD2   . LEU E 2 330 ? -13.034 8.655   -107.991 1.00 2.39  ? 330 LEU E CD2   1 
ATOM   9203  N  N     . GLU E 2 331 ? -16.983 8.820   -111.983 1.00 8.21  ? 331 GLU E N     1 
ATOM   9204  C  CA    . GLU E 2 331 ? -18.118 8.140   -112.536 1.00 9.11  ? 331 GLU E CA    1 
ATOM   9205  C  C     . GLU E 2 331 ? -17.522 7.218   -113.608 1.00 7.50  ? 331 GLU E C     1 
ATOM   9206  O  O     . GLU E 2 331 ? -18.008 6.115   -113.808 1.00 11.19 ? 331 GLU E O     1 
ATOM   9207  C  CB    . GLU E 2 331 ? -18.955 9.158   -113.277 1.00 8.34  ? 331 GLU E CB    1 
ATOM   9208  C  CG    . GLU E 2 331 ? -20.470 8.958   -113.225 1.00 22.69 ? 331 GLU E CG    1 
ATOM   9209  C  CD    . GLU E 2 331 ? -21.153 9.919   -114.216 1.00 45.45 ? 331 GLU E CD    1 
ATOM   9210  O  OE1   . GLU E 2 331 ? -20.620 11.047  -114.466 1.00 39.69 ? 331 GLU E OE1   1 
ATOM   9211  O  OE2   . GLU E 2 331 ? -22.204 9.537   -114.790 1.00 44.90 ? 331 GLU E OE2   1 
ATOM   9212  N  N     . VAL E 2 332 ? -16.454 7.641   -114.277 1.00 6.13  ? 332 VAL E N     1 
ATOM   9213  C  CA    . VAL E 2 332 ? -15.851 6.779   -115.294 1.00 8.14  ? 332 VAL E CA    1 
ATOM   9214  C  C     . VAL E 2 332 ? -15.213 5.623   -114.559 1.00 5.53  ? 332 VAL E C     1 
ATOM   9215  O  O     . VAL E 2 332 ? -15.348 4.452   -114.923 1.00 10.39 ? 332 VAL E O     1 
ATOM   9216  C  CB    . VAL E 2 332 ? -14.815 7.456   -116.109 1.00 4.22  ? 332 VAL E CB    1 
ATOM   9217  C  CG1   . VAL E 2 332 ? -14.182 6.461   -117.016 1.00 3.94  ? 332 VAL E CG1   1 
ATOM   9218  C  CG2   . VAL E 2 332 ? -15.468 8.523   -116.948 1.00 2.00  ? 332 VAL E CG2   1 
ATOM   9219  N  N     . LEU E 2 333 ? -14.559 5.960   -113.491 1.00 2.11  ? 333 LEU E N     1 
ATOM   9220  C  CA    . LEU E 2 333 ? -13.920 4.980   -112.683 1.00 7.63  ? 333 LEU E CA    1 
ATOM   9221  C  C     . LEU E 2 333 ? -14.922 3.861   -112.337 1.00 5.57  ? 333 LEU E C     1 
ATOM   9222  O  O     . LEU E 2 333 ? -14.628 2.646   -112.470 1.00 5.46  ? 333 LEU E O     1 
ATOM   9223  C  CB    . LEU E 2 333 ? -13.431 5.619   -111.392 1.00 3.50  ? 333 LEU E CB    1 
ATOM   9224  C  CG    . LEU E 2 333 ? -12.780 4.553   -110.454 1.00 14.38 ? 333 LEU E CG    1 
ATOM   9225  C  CD1   . LEU E 2 333 ? -11.377 4.256   -110.967 1.00 7.92  ? 333 LEU E CD1   1 
ATOM   9226  C  CD2   . LEU E 2 333 ? -12.608 5.081   -109.097 1.00 4.48  ? 333 LEU E CD2   1 
ATOM   9227  N  N     . ALA E 2 334 ? -16.083 4.290   -111.879 1.00 2.03  ? 334 ALA E N     1 
ATOM   9228  C  CA    . ALA E 2 334 ? -17.029 3.438   -111.209 1.00 2.00  ? 334 ALA E CA    1 
ATOM   9229  C  C     . ALA E 2 334 ? -17.471 2.479   -112.312 1.00 5.22  ? 334 ALA E C     1 
ATOM   9230  O  O     . ALA E 2 334 ? -17.859 1.353   -112.085 1.00 5.90  ? 334 ALA E O     1 
ATOM   9231  C  CB    . ALA E 2 334 ? -18.162 4.255   -110.697 1.00 2.00  ? 334 ALA E CB    1 
ATOM   9232  N  N     . SER E 2 335 ? -17.395 2.937   -113.536 1.00 2.15  ? 335 SER E N     1 
ATOM   9233  C  CA    . SER E 2 335 ? -17.872 2.120   -114.537 1.00 3.81  ? 335 SER E CA    1 
ATOM   9234  C  C     . SER E 2 335 ? -16.840 1.165   -115.230 1.00 6.05  ? 335 SER E C     1 
ATOM   9235  O  O     . SER E 2 335 ? -17.223 0.121   -115.732 1.00 9.96  ? 335 SER E O     1 
ATOM   9236  C  CB    . SER E 2 335 ? -18.597 3.028   -115.524 1.00 2.27  ? 335 SER E CB    1 
ATOM   9237  O  OG    . SER E 2 335 ? -18.005 2.830   -116.775 1.00 3.92  ? 335 SER E OG    1 
ATOM   9238  N  N     . THR E 2 336 ? -15.560 1.524   -115.287 1.00 7.08  ? 336 THR E N     1 
ATOM   9239  C  CA    . THR E 2 336 ? -14.507 0.670   -115.802 1.00 2.25  ? 336 THR E CA    1 
ATOM   9240  C  C     . THR E 2 336 ? -13.753 -0.256  -114.799 1.00 2.00  ? 336 THR E C     1 
ATOM   9241  O  O     . THR E 2 336 ? -13.089 -1.209  -115.214 1.00 9.69  ? 336 THR E O     1 
ATOM   9242  C  CB    . THR E 2 336 ? -13.507 1.503   -116.738 1.00 14.07 ? 336 THR E CB    1 
ATOM   9243  O  OG1   . THR E 2 336 ? -13.464 2.799   -116.208 1.00 2.00  ? 336 THR E OG1   1 
ATOM   9244  C  CG2   . THR E 2 336 ? -14.191 1.813   -118.250 1.00 25.17 ? 336 THR E CG2   1 
ATOM   9245  N  N     . CYS E 2 337 ? -13.781 -0.017  -113.496 1.00 4.70  ? 337 CYS E N     1 
ATOM   9246  C  CA    . CYS E 2 337 ? -12.870 -0.807  -112.644 1.00 2.00  ? 337 CYS E CA    1 
ATOM   9247  C  C     . CYS E 2 337 ? -13.590 -1.658  -111.661 1.00 8.97  ? 337 CYS E C     1 
ATOM   9248  O  O     . CYS E 2 337 ? -13.714 -1.271  -110.486 1.00 6.46  ? 337 CYS E O     1 
ATOM   9249  C  CB    . CYS E 2 337 ? -12.000 0.102   -111.847 1.00 2.62  ? 337 CYS E CB    1 
ATOM   9250  S  SG    . CYS E 2 337 ? -10.813 1.066   -112.889 1.00 8.69  ? 337 CYS E SG    1 
ATOM   9251  N  N     . LYS E 2 338 ? -14.092 -2.818  -112.085 1.00 5.71  ? 338 LYS E N     1 
ATOM   9252  C  CA    . LYS E 2 338 ? -15.128 -3.402  -111.272 1.00 3.73  ? 338 LYS E CA    1 
ATOM   9253  C  C     . LYS E 2 338 ? -14.385 -4.210  -110.250 1.00 5.10  ? 338 LYS E C     1 
ATOM   9254  O  O     . LYS E 2 338 ? -14.984 -4.750  -109.323 1.00 3.67  ? 338 LYS E O     1 
ATOM   9255  C  CB    . LYS E 2 338 ? -16.086 -4.269  -112.082 1.00 2.00  ? 338 LYS E CB    1 
ATOM   9256  C  CG    . LYS E 2 338 ? -16.714 -3.545  -113.258 1.00 14.54 ? 338 LYS E CG    1 
ATOM   9257  C  CD    . LYS E 2 338 ? -18.198 -3.191  -113.003 1.00 13.16 ? 338 LYS E CD    1 
ATOM   9258  C  CE    . LYS E 2 338 ? -18.513 -1.764  -113.389 1.00 2.00  ? 338 LYS E CE    1 
ATOM   9259  N  NZ    . LYS E 2 338 ? -19.194 -1.167  -112.245 1.00 2.19  ? 338 LYS E NZ    1 
ATOM   9260  N  N     . ASP E 2 339 ? -13.064 -4.311  -110.399 1.00 3.17  ? 339 ASP E N     1 
ATOM   9261  C  CA    . ASP E 2 339 ? -12.336 -4.997  -109.347 1.00 6.47  ? 339 ASP E CA    1 
ATOM   9262  C  C     . ASP E 2 339 ? -11.798 -4.111  -108.200 1.00 6.61  ? 339 ASP E C     1 
ATOM   9263  O  O     . ASP E 2 339 ? -11.213 -4.663  -107.261 1.00 2.00  ? 339 ASP E O     1 
ATOM   9264  C  CB    . ASP E 2 339 ? -11.316 -5.964  -109.919 1.00 2.00  ? 339 ASP E CB    1 
ATOM   9265  C  CG    . ASP E 2 339 ? -10.954 -7.135  -108.954 1.00 2.87  ? 339 ASP E CG    1 
ATOM   9266  O  OD1   . ASP E 2 339 ? -11.720 -7.622  -108.052 1.00 2.00  ? 339 ASP E OD1   1 
ATOM   9267  O  OD2   . ASP E 2 339 ? -9.803  -7.567  -109.181 1.00 2.00  ? 339 ASP E OD2   1 
ATOM   9268  N  N     . LEU E 2 340 ? -12.056 -2.776  -108.237 1.00 8.16  ? 340 LEU E N     1 
ATOM   9269  C  CA    . LEU E 2 340 ? -11.619 -1.861  -107.154 1.00 2.00  ? 340 LEU E CA    1 
ATOM   9270  C  C     . LEU E 2 340 ? -11.875 -2.286  -105.763 1.00 2.00  ? 340 LEU E C     1 
ATOM   9271  O  O     . LEU E 2 340 ? -13.036 -2.489  -105.377 1.00 2.00  ? 340 LEU E O     1 
ATOM   9272  C  CB    . LEU E 2 340 ? -12.165 -0.491  -107.326 1.00 2.44  ? 340 LEU E CB    1 
ATOM   9273  C  CG    . LEU E 2 340 ? -11.123 0.609   -106.988 1.00 2.19  ? 340 LEU E CG    1 
ATOM   9274  C  CD1   . LEU E 2 340 ? -10.011 0.652   -107.883 1.00 2.00  ? 340 LEU E CD1   1 
ATOM   9275  C  CD2   . LEU E 2 340 ? -11.812 1.956   -107.129 1.00 3.01  ? 340 LEU E CD2   1 
ATOM   9276  N  N     . ARG E 2 341 ? -10.807 -2.411  -104.970 1.00 2.00  ? 341 ARG E N     1 
ATOM   9277  C  CA    . ARG E 2 341 ? -10.992 -2.552  -103.492 1.00 5.89  ? 341 ARG E CA    1 
ATOM   9278  C  C     . ARG E 2 341 ? -10.804 -1.252  -102.617 1.00 12.61 ? 341 ARG E C     1 
ATOM   9279  O  O     . ARG E 2 341 ? -11.260 -1.151  -101.432 1.00 2.00  ? 341 ARG E O     1 
ATOM   9280  C  CB    . ARG E 2 341 ? -10.024 -3.604  -102.919 1.00 10.04 ? 341 ARG E CB    1 
ATOM   9281  C  CG    . ARG E 2 341 ? -9.635  -4.717  -103.831 1.00 8.51  ? 341 ARG E CG    1 
ATOM   9282  C  CD    . ARG E 2 341 ? -10.883 -5.348  -104.257 1.00 9.80  ? 341 ARG E CD    1 
ATOM   9283  N  NE    . ARG E 2 341 ? -10.707 -6.433  -105.166 1.00 3.57  ? 341 ARG E NE    1 
ATOM   9284  C  CZ    . ARG E 2 341 ? -10.521 -7.695  -104.780 1.00 28.64 ? 341 ARG E CZ    1 
ATOM   9285  N  NH1   . ARG E 2 341 ? -10.384 -7.986  -103.503 1.00 2.00  ? 341 ARG E NH1   1 
ATOM   9286  N  NH2   . ARG E 2 341 ? -10.444 -8.657  -105.674 1.00 2.00  ? 341 ARG E NH2   1 
ATOM   9287  N  N     . GLU E 2 342 ? -10.027 -0.317  -103.160 1.00 2.00  ? 342 GLU E N     1 
ATOM   9288  C  CA    . GLU E 2 342 ? -9.396  0.677   -102.322 1.00 2.63  ? 342 GLU E CA    1 
ATOM   9289  C  C     . GLU E 2 342 ? -9.364  1.931   -103.157 1.00 3.77  ? 342 GLU E C     1 
ATOM   9290  O  O     . GLU E 2 342 ? -8.720  1.949   -104.250 1.00 3.99  ? 342 GLU E O     1 
ATOM   9291  C  CB    . GLU E 2 342 ? -7.950  0.373   -102.012 1.00 2.00  ? 342 GLU E CB    1 
ATOM   9292  C  CG    . GLU E 2 342 ? -7.504  1.309   -100.801 1.00 20.17 ? 342 GLU E CG    1 
ATOM   9293  C  CD    . GLU E 2 342 ? -6.017  1.232   -100.543 1.00 8.28  ? 342 GLU E CD    1 
ATOM   9294  O  OE1   . GLU E 2 342 ? -5.472  0.129   -100.412 1.00 21.09 ? 342 GLU E OE1   1 
ATOM   9295  O  OE2   . GLU E 2 342 ? -5.356  2.249   -100.587 1.00 10.99 ? 342 GLU E OE2   1 
ATOM   9296  N  N     . LEU E 2 343 ? -9.979  2.991   -102.627 1.00 8.36  ? 343 LEU E N     1 
ATOM   9297  C  CA    . LEU E 2 343 ? -9.966  4.320   -103.282 1.00 5.36  ? 343 LEU E CA    1 
ATOM   9298  C  C     . LEU E 2 343 ? -9.458  5.399   -102.351 1.00 10.49 ? 343 LEU E C     1 
ATOM   9299  O  O     . LEU E 2 343 ? -10.037 5.674   -101.230 1.00 2.00  ? 343 LEU E O     1 
ATOM   9300  C  CB    . LEU E 2 343 ? -11.375 4.683   -103.780 1.00 5.28  ? 343 LEU E CB    1 
ATOM   9301  C  CG    . LEU E 2 343 ? -11.486 6.104   -104.346 1.00 14.45 ? 343 LEU E CG    1 
ATOM   9302  C  CD1   . LEU E 2 343 ? -10.498 6.217   -105.487 1.00 2.27  ? 343 LEU E CD1   1 
ATOM   9303  C  CD2   . LEU E 2 343 ? -12.902 6.461   -104.748 1.00 7.15  ? 343 LEU E CD2   1 
ATOM   9304  N  N     . ARG E 2 344 ? -8.371  6.029   -102.787 1.00 2.06  ? 344 ARG E N     1 
ATOM   9305  C  CA    . ARG E 2 344 ? -7.946  7.271   -102.029 1.00 5.98  ? 344 ARG E CA    1 
ATOM   9306  C  C     . ARG E 2 344 ? -7.964  8.537   -102.896 1.00 5.89  ? 344 ARG E C     1 
ATOM   9307  O  O     . ARG E 2 344 ? -7.232  8.647   -103.957 1.00 3.67  ? 344 ARG E O     1 
ATOM   9308  C  CB    . ARG E 2 344 ? -6.593  7.083   -101.329 1.00 4.61  ? 344 ARG E CB    1 
ATOM   9309  C  CG    . ARG E 2 344 ? -6.559  5.849   -100.303 1.00 2.55  ? 344 ARG E CG    1 
ATOM   9310  C  CD    . ARG E 2 344 ? -5.239  5.665   -99.478  1.00 2.00  ? 344 ARG E CD    1 
ATOM   9311  N  NE    . ARG E 2 344 ? -5.328  4.451   -98.676  1.00 2.00  ? 344 ARG E NE    1 
ATOM   9312  C  CZ    . ARG E 2 344 ? -4.620  4.208   -97.581  1.00 10.93 ? 344 ARG E CZ    1 
ATOM   9313  N  NH1   . ARG E 2 344 ? -3.755  5.086   -97.079  1.00 7.97  ? 344 ARG E NH1   1 
ATOM   9314  N  NH2   . ARG E 2 344 ? -4.768  3.071   -96.943  1.00 2.00  ? 344 ARG E NH2   1 
ATOM   9315  N  N     . VAL E 2 345 ? -8.745  9.510   -102.436 1.00 3.56  ? 345 VAL E N     1 
ATOM   9316  C  CA    . VAL E 2 345 ? -8.699  10.906  -103.045 1.00 7.81  ? 345 VAL E CA    1 
ATOM   9317  C  C     . VAL E 2 345 ? -8.138  12.016  -102.153 1.00 2.70  ? 345 VAL E C     1 
ATOM   9318  O  O     . VAL E 2 345 ? -8.705  12.388  -101.103 1.00 2.00  ? 345 VAL E O     1 
ATOM   9319  C  CB    . VAL E 2 345 ? -10.073 11.371  -103.555 1.00 4.27  ? 345 VAL E CB    1 
ATOM   9320  C  CG1   . VAL E 2 345 ? -9.903  12.648  -104.328 1.00 3.27  ? 345 VAL E CG1   1 
ATOM   9321  C  CG2   . VAL E 2 345 ? -10.667 10.262  -104.481 1.00 2.00  ? 345 VAL E CG2   1 
ATOM   9322  N  N     . PHE E 2 346 ? -6.995  12.528  -102.552 1.00 2.00  ? 346 PHE E N     1 
ATOM   9323  C  CA    . PHE E 2 346 ? -6.343  13.553  -101.797 1.00 3.80  ? 346 PHE E CA    1 
ATOM   9324  C  C     . PHE E 2 346 ? -6.665  14.914  -102.348 1.00 4.05  ? 346 PHE E C     1 
ATOM   9325  O  O     . PHE E 2 346 ? -6.939  15.057  -103.515 1.00 2.00  ? 346 PHE E O     1 
ATOM   9326  C  CB    . PHE E 2 346 ? -4.851  13.324  -101.795 1.00 2.00  ? 346 PHE E CB    1 
ATOM   9327  C  CG    . PHE E 2 346 ? -4.463  12.002  -101.283 1.00 4.85  ? 346 PHE E CG    1 
ATOM   9328  C  CD1   . PHE E 2 346 ? -4.347  10.932  -102.131 1.00 8.92  ? 346 PHE E CD1   1 
ATOM   9329  C  CD2   . PHE E 2 346 ? -4.231  11.810  -99.949  1.00 2.00  ? 346 PHE E CD2   1 
ATOM   9330  C  CE1   . PHE E 2 346 ? -3.998  9.717   -101.660 1.00 2.00  ? 346 PHE E CE1   1 
ATOM   9331  C  CE2   . PHE E 2 346 ? -3.880  10.592  -99.484  1.00 7.23  ? 346 PHE E CE2   1 
ATOM   9332  C  CZ    . PHE E 2 346 ? -3.763  9.546   -100.341 1.00 6.46  ? 346 PHE E CZ    1 
ATOM   9333  N  N     . PRO E 2 347 ? -6.619  15.913  -101.482 1.00 5.74  ? 347 PRO E N     1 
ATOM   9334  C  CA    . PRO E 2 347 ? -6.906  17.295  -101.857 1.00 4.60  ? 347 PRO E CA    1 
ATOM   9335  C  C     . PRO E 2 347 ? -5.729  18.006  -102.513 1.00 4.80  ? 347 PRO E C     1 
ATOM   9336  O  O     . PRO E 2 347 ? -4.621  17.982  -102.016 1.00 14.44 ? 347 PRO E O     1 
ATOM   9337  C  CB    . PRO E 2 347 ? -7.231  17.942  -100.518 1.00 2.00  ? 347 PRO E CB    1 
ATOM   9338  C  CG    . PRO E 2 347 ? -6.465  17.191  -99.552  1.00 13.05 ? 347 PRO E CG    1 
ATOM   9339  C  CD    . PRO E 2 347 ? -6.320  15.791  -100.052 1.00 2.11  ? 347 PRO E CD    1 
ATOM   9340  N  N     . SER E 2 348 ? -5.978  18.629  -103.645 1.00 2.00  ? 348 SER E N     1 
ATOM   9341  C  CA    . SER E 2 348 ? -4.952  19.399  -104.315 1.00 12.57 ? 348 SER E CA    1 
ATOM   9342  C  C     . SER E 2 348 ? -4.569  20.665  -103.573 1.00 4.13  ? 348 SER E C     1 
ATOM   9343  O  O     . SER E 2 348 ? -3.406  21.008  -103.474 1.00 10.64 ? 348 SER E O     1 
ATOM   9344  C  CB    . SER E 2 348 ? -5.366  19.712  -105.746 1.00 9.71  ? 348 SER E CB    1 
ATOM   9345  O  OG    . SER E 2 348 ? -6.552  20.456  -105.792 1.00 2.01  ? 348 SER E OG    1 
ATOM   9346  N  N     . GLU E 2 349 ? -5.558  21.359  -103.051 1.00 2.00  ? 349 GLU E N     1 
ATOM   9347  C  CA    . GLU E 2 349 ? -5.292  22.486  -102.198 1.00 2.00  ? 349 GLU E CA    1 
ATOM   9348  C  C     . GLU E 2 349 ? -5.996  22.323  -100.872 1.00 6.57  ? 349 GLU E C     1 
ATOM   9349  O  O     . GLU E 2 349 ? -7.026  22.950  -100.660 1.00 2.26  ? 349 GLU E O     1 
ATOM   9350  C  CB    . GLU E 2 349 ? -5.801  23.765  -102.851 1.00 2.00  ? 349 GLU E CB    1 
ATOM   9351  C  CG    . GLU E 2 349 ? -5.769  23.768  -104.358 1.00 2.17  ? 349 GLU E CG    1 
ATOM   9352  C  CD    . GLU E 2 349 ? -4.749  24.722  -104.905 1.00 18.55 ? 349 GLU E CD    1 
ATOM   9353  O  OE1   . GLU E 2 349 ? -3.553  24.509  -104.659 1.00 14.40 ? 349 GLU E OE1   1 
ATOM   9354  O  OE2   . GLU E 2 349 ? -5.148  25.685  -105.585 1.00 26.57 ? 349 GLU E OE2   1 
ATOM   9355  N  N     . PRO E 2 350 ? -5.461  21.506  -99.968  1.00 2.00  ? 350 PRO E N     1 
ATOM   9356  C  CA    . PRO E 2 350 ? -6.158  21.406  -98.692  1.00 2.00  ? 350 PRO E CA    1 
ATOM   9357  C  C     . PRO E 2 350 ? -6.193  22.735  -97.888  1.00 5.14  ? 350 PRO E C     1 
ATOM   9358  O  O     . PRO E 2 350 ? -6.885  22.866  -96.864  1.00 2.00  ? 350 PRO E O     1 
ATOM   9359  C  CB    . PRO E 2 350 ? -5.281  20.396  -97.945  1.00 2.00  ? 350 PRO E CB    1 
ATOM   9360  C  CG    . PRO E 2 350 ? -3.921  20.671  -98.462  1.00 2.00  ? 350 PRO E CG    1 
ATOM   9361  C  CD    . PRO E 2 350 ? -4.218  20.735  -99.934  1.00 2.00  ? 350 PRO E CD    1 
ATOM   9362  N  N     . PHE E 2 351 ? -5.419  23.734  -98.271  1.00 2.00  ? 351 PHE E N     1 
ATOM   9363  C  CA    . PHE E 2 351 ? -5.334  24.916  -97.421  1.00 2.00  ? 351 PHE E CA    1 
ATOM   9364  C  C     . PHE E 2 351 ? -6.112  26.123  -97.925  1.00 2.00  ? 351 PHE E C     1 
ATOM   9365  O  O     . PHE E 2 351 ? -6.001  27.213  -97.398  1.00 2.00  ? 351 PHE E O     1 
ATOM   9366  C  CB    . PHE E 2 351 ? -3.897  25.275  -97.098  1.00 2.00  ? 351 PHE E CB    1 
ATOM   9367  C  CG    . PHE E 2 351 ? -3.125  24.169  -96.479  1.00 2.00  ? 351 PHE E CG    1 
ATOM   9368  C  CD1   . PHE E 2 351 ? -2.014  23.666  -97.096  1.00 2.00  ? 351 PHE E CD1   1 
ATOM   9369  C  CD2   . PHE E 2 351 ? -3.503  23.636  -95.275  1.00 11.97 ? 351 PHE E CD2   1 
ATOM   9370  C  CE1   . PHE E 2 351 ? -1.301  22.654  -96.529  1.00 2.00  ? 351 PHE E CE1   1 
ATOM   9371  C  CE2   . PHE E 2 351 ? -2.789  22.627  -94.712  1.00 2.00  ? 351 PHE E CE2   1 
ATOM   9372  C  CZ    . PHE E 2 351 ? -1.688  22.139  -95.341  1.00 2.00  ? 351 PHE E CZ    1 
ATOM   9373  N  N     . VAL E 2 352 ? -6.920  25.895  -98.943  1.00 7.27  ? 352 VAL E N     1 
ATOM   9374  C  CA    . VAL E 2 352 ? -7.792  26.903  -99.501  1.00 2.00  ? 352 VAL E CA    1 
ATOM   9375  C  C     . VAL E 2 352 ? -9.229  26.529  -99.184  1.00 7.54  ? 352 VAL E C     1 
ATOM   9376  O  O     . VAL E 2 352 ? -9.645  25.408  -99.427  1.00 6.51  ? 352 VAL E O     1 
ATOM   9377  C  CB    . VAL E 2 352 ? -7.640  26.934  -101.020 1.00 5.55  ? 352 VAL E CB    1 
ATOM   9378  C  CG1   . VAL E 2 352 ? -8.662  27.809  -101.635 1.00 8.13  ? 352 VAL E CG1   1 
ATOM   9379  C  CG2   . VAL E 2 352 ? -6.262  27.352  -101.414 1.00 2.00  ? 352 VAL E CG2   1 
ATOM   9380  N  N     . MET E 2 353 ? -9.998  27.457  -98.639  1.00 5.72  ? 353 MET E N     1 
ATOM   9381  C  CA    . MET E 2 353 ? -11.341 27.116  -98.195  1.00 22.19 ? 353 MET E CA    1 
ATOM   9382  C  C     . MET E 2 353 ? -12.295 26.776  -99.336  1.00 19.43 ? 353 MET E C     1 
ATOM   9383  O  O     . MET E 2 353 ? -13.106 25.864  -99.227  1.00 17.06 ? 353 MET E O     1 
ATOM   9384  C  CB    . MET E 2 353 ? -11.925 28.205  -97.301  1.00 2.00  ? 353 MET E CB    1 
ATOM   9385  C  CG    . MET E 2 353 ? -13.431 28.176  -97.196  1.00 2.53  ? 353 MET E CG    1 
ATOM   9386  S  SD    . MET E 2 353 ? -14.059 28.635  -95.573  1.00 43.94 ? 353 MET E SD    1 
ATOM   9387  C  CE    . MET E 2 353 ? -13.553 30.342  -95.480  1.00 2.00  ? 353 MET E CE    1 
ATOM   9388  N  N     . GLU E 2 354 ? -12.189 27.507  -100.435 1.00 13.24 ? 354 GLU E N     1 
ATOM   9389  C  CA    . GLU E 2 354 ? -13.120 27.358  -101.536 1.00 10.01 ? 354 GLU E CA    1 
ATOM   9390  C  C     . GLU E 2 354 ? -12.642 26.375  -102.577 1.00 2.18  ? 354 GLU E C     1 
ATOM   9391  O  O     . GLU E 2 354 ? -11.502 26.412  -103.009 1.00 2.00  ? 354 GLU E O     1 
ATOM   9392  C  CB    . GLU E 2 354 ? -13.397 28.701  -102.193 1.00 5.55  ? 354 GLU E CB    1 
ATOM   9393  C  CG    . GLU E 2 354 ? -13.243 29.876  -101.258 1.00 35.18 ? 354 GLU E CG    1 
ATOM   9394  C  CD    . GLU E 2 354 ? -11.988 29.797  -100.420 1.00 54.58 ? 354 GLU E CD    1 
ATOM   9395  O  OE1   . GLU E 2 354 ? -10.904 30.101  -100.949 1.00 52.78 ? 354 GLU E OE1   1 
ATOM   9396  O  OE2   . GLU E 2 354 ? -12.088 29.453  -99.225  1.00 30.54 ? 354 GLU E OE2   1 
ATOM   9397  N  N     . PRO E 2 355 ? -13.556 25.513  -102.985 1.00 10.29 ? 355 PRO E N     1 
ATOM   9398  C  CA    . PRO E 2 355 ? -13.293 24.392  -103.899 1.00 12.73 ? 355 PRO E CA    1 
ATOM   9399  C  C     . PRO E 2 355 ? -12.667 24.912  -105.160 1.00 2.00  ? 355 PRO E C     1 
ATOM   9400  O  O     . PRO E 2 355 ? -13.288 25.690  -105.856 1.00 15.64 ? 355 PRO E O     1 
ATOM   9401  C  CB    . PRO E 2 355 ? -14.698 23.837  -104.215 1.00 12.52 ? 355 PRO E CB    1 
ATOM   9402  C  CG    . PRO E 2 355 ? -15.671 24.942  -103.784 1.00 25.92 ? 355 PRO E CG    1 
ATOM   9403  C  CD    . PRO E 2 355 ? -14.981 25.628  -102.607 1.00 8.02  ? 355 PRO E CD    1 
ATOM   9404  N  N     . ASN E 2 356 ? -11.451 24.458  -105.459 1.00 10.53 ? 356 ASN E N     1 
ATOM   9405  C  CA    . ASN E 2 356 ? -10.745 24.742  -106.730 1.00 2.00  ? 356 ASN E CA    1 
ATOM   9406  C  C     . ASN E 2 356 ? -11.197 23.695  -107.694 1.00 5.53  ? 356 ASN E C     1 
ATOM   9407  O  O     . ASN E 2 356 ? -10.654 23.607  -108.790 1.00 3.70  ? 356 ASN E O     1 
ATOM   9408  C  CB    . ASN E 2 356 ? -9.221  24.538  -106.585 1.00 2.00  ? 356 ASN E CB    1 
ATOM   9409  C  CG    . ASN E 2 356 ? -8.852  23.072  -106.112 1.00 6.90  ? 356 ASN E CG    1 
ATOM   9410  O  OD1   . ASN E 2 356 ? -9.485  22.534  -105.215 1.00 9.46  ? 356 ASN E OD1   1 
ATOM   9411  N  ND2   . ASN E 2 356 ? -7.814  22.486  -106.676 1.00 15.41 ? 356 ASN E ND2   1 
ATOM   9412  N  N     . VAL E 2 357 ? -12.151 22.850  -107.326 1.00 2.61  ? 357 VAL E N     1 
ATOM   9413  C  CA    . VAL E 2 357 ? -12.296 21.618  -108.143 1.00 3.52  ? 357 VAL E CA    1 
ATOM   9414  C  C     . VAL E 2 357 ? -13.733 21.058  -108.028 1.00 2.00  ? 357 VAL E C     1 
ATOM   9415  O  O     . VAL E 2 357 ? -14.317 21.091  -106.948 1.00 5.15  ? 357 VAL E O     1 
ATOM   9416  C  CB    . VAL E 2 357 ? -11.190 20.607  -107.641 1.00 6.62  ? 357 VAL E CB    1 
ATOM   9417  C  CG1   . VAL E 2 357 ? -11.672 19.624  -106.543 1.00 5.70  ? 357 VAL E CG1   1 
ATOM   9418  C  CG2   . VAL E 2 357 ? -10.389 20.062  -108.689 1.00 2.00  ? 357 VAL E CG2   1 
ATOM   9419  N  N     . ALA E 2 358 ? -14.335 20.547  -109.101 1.00 2.00  ? 358 ALA E N     1 
ATOM   9420  C  CA    . ALA E 2 358 ? -15.683 19.904  -108.965 1.00 2.00  ? 358 ALA E CA    1 
ATOM   9421  C  C     . ALA E 2 358 ? -15.671 18.473  -108.311 1.00 2.22  ? 358 ALA E C     1 
ATOM   9422  O  O     . ALA E 2 358 ? -15.897 17.468  -108.995 1.00 4.99  ? 358 ALA E O     1 
ATOM   9423  C  CB    . ALA E 2 358 ? -16.370 19.844  -110.369 1.00 2.00  ? 358 ALA E CB    1 
ATOM   9424  N  N     . LEU E 2 359 ? -15.404 18.352  -107.013 1.00 12.94 ? 359 LEU E N     1 
ATOM   9425  C  CA    . LEU E 2 359 ? -15.327 17.024  -106.460 1.00 12.84 ? 359 LEU E CA    1 
ATOM   9426  C  C     . LEU E 2 359 ? -16.104 17.011  -105.183 1.00 17.50 ? 359 LEU E C     1 
ATOM   9427  O  O     . LEU E 2 359 ? -15.716 17.713  -104.257 1.00 15.64 ? 359 LEU E O     1 
ATOM   9428  C  CB    . LEU E 2 359 ? -13.866 16.646  -106.170 1.00 7.78  ? 359 LEU E CB    1 
ATOM   9429  C  CG    . LEU E 2 359 ? -13.888 15.285  -105.464 1.00 2.56  ? 359 LEU E CG    1 
ATOM   9430  C  CD1   . LEU E 2 359 ? -13.747 14.094  -106.315 1.00 6.02  ? 359 LEU E CD1   1 
ATOM   9431  C  CD2   . LEU E 2 359 ? -13.633 15.046  -104.014 1.00 2.00  ? 359 LEU E CD2   1 
ATOM   9432  N  N     . THR E 2 360 ? -17.157 16.193  -105.091 1.00 11.33 ? 360 THR E N     1 
ATOM   9433  C  CA    . THR E 2 360 ? -18.195 16.382  -104.022 1.00 11.38 ? 360 THR E CA    1 
ATOM   9434  C  C     . THR E 2 360 ? -18.674 15.030  -103.448 1.00 8.47  ? 360 THR E C     1 
ATOM   9435  O  O     . THR E 2 360 ? -18.051 14.014  -103.792 1.00 3.93  ? 360 THR E O     1 
ATOM   9436  C  CB    . THR E 2 360 ? -19.341 17.324  -104.533 1.00 2.86  ? 360 THR E CB    1 
ATOM   9437  O  OG1   . THR E 2 360 ? -20.299 16.571  -105.291 1.00 7.30  ? 360 THR E OG1   1 
ATOM   9438  C  CG2   . THR E 2 360 ? -18.740 18.303  -105.469 1.00 2.00  ? 360 THR E CG2   1 
ATOM   9439  N  N     . GLU E 2 361 ? -19.698 14.989  -102.587 1.00 2.00  ? 361 GLU E N     1 
ATOM   9440  C  CA    . GLU E 2 361 ? -20.353 13.671  -102.257 1.00 4.39  ? 361 GLU E CA    1 
ATOM   9441  C  C     . GLU E 2 361 ? -20.511 12.786  -103.436 1.00 5.85  ? 361 GLU E C     1 
ATOM   9442  O  O     . GLU E 2 361 ? -20.453 11.580  -103.237 1.00 9.22  ? 361 GLU E O     1 
ATOM   9443  C  CB    . GLU E 2 361 ? -21.812 13.665  -101.695 1.00 2.00  ? 361 GLU E CB    1 
ATOM   9444  C  CG    . GLU E 2 361 ? -22.300 14.954  -101.203 1.00 33.18 ? 361 GLU E CG    1 
ATOM   9445  C  CD    . GLU E 2 361 ? -22.580 15.987  -102.287 1.00 2.00  ? 361 GLU E CD    1 
ATOM   9446  O  OE1   . GLU E 2 361 ? -23.777 16.185  -102.685 1.00 15.72 ? 361 GLU E OE1   1 
ATOM   9447  O  OE2   . GLU E 2 361 ? -21.596 16.647  -102.653 1.00 10.02 ? 361 GLU E OE2   1 
ATOM   9448  N  N     . GLN E 2 362 ? -20.758 13.329  -104.623 1.00 2.00  ? 362 GLN E N     1 
ATOM   9449  C  CA    . GLN E 2 362 ? -21.316 12.521  -105.673 1.00 2.64  ? 362 GLN E CA    1 
ATOM   9450  C  C     . GLN E 2 362 ? -20.299 11.481  -106.239 1.00 3.57  ? 362 GLN E C     1 
ATOM   9451  O  O     . GLN E 2 362 ? -20.669 10.302  -106.444 1.00 11.84 ? 362 GLN E O     1 
ATOM   9452  C  CB    . GLN E 2 362 ? -21.865 13.446  -106.838 1.00 7.39  ? 362 GLN E CB    1 
ATOM   9453  C  CG    . GLN E 2 362 ? -22.682 12.752  -107.933 1.00 29.63 ? 362 GLN E CG    1 
ATOM   9454  C  CD    . GLN E 2 362 ? -23.716 11.730  -107.372 1.00 52.10 ? 362 GLN E CD    1 
ATOM   9455  O  OE1   . GLN E 2 362 ? -24.641 12.100  -106.604 1.00 21.11 ? 362 GLN E OE1   1 
ATOM   9456  N  NE2   . GLN E 2 362 ? -23.554 10.437  -107.755 1.00 27.99 ? 362 GLN E NE2   1 
ATOM   9457  N  N     . GLY E 2 363 ? -19.060 11.898  -106.545 1.00 5.06  ? 363 GLY E N     1 
ATOM   9458  C  CA    . GLY E 2 363 ? -17.926 10.958  -106.807 1.00 2.00  ? 363 GLY E CA    1 
ATOM   9459  C  C     . GLY E 2 363 ? -17.996 9.708   -105.925 1.00 11.16 ? 363 GLY E C     1 
ATOM   9460  O  O     . GLY E 2 363 ? -18.027 8.584   -106.428 1.00 2.00  ? 363 GLY E O     1 
ATOM   9461  N  N     . LEU E 2 364 ? -18.076 9.898   -104.609 1.00 2.00  ? 364 LEU E N     1 
ATOM   9462  C  CA    . LEU E 2 364 ? -17.997 8.765   -103.756 1.00 6.50  ? 364 LEU E CA    1 
ATOM   9463  C  C     . LEU E 2 364 ? -19.254 7.883   -103.818 1.00 3.89  ? 364 LEU E C     1 
ATOM   9464  O  O     . LEU E 2 364 ? -19.145 6.669   -103.928 1.00 9.22  ? 364 LEU E O     1 
ATOM   9465  C  CB    . LEU E 2 364 ? -17.669 9.206   -102.305 1.00 9.48  ? 364 LEU E CB    1 
ATOM   9466  C  CG    . LEU E 2 364 ? -17.529 8.205   -101.136 1.00 2.04  ? 364 LEU E CG    1 
ATOM   9467  C  CD1   . LEU E 2 364 ? -16.648 6.992   -101.446 1.00 2.00  ? 364 LEU E CD1   1 
ATOM   9468  C  CD2   . LEU E 2 364 ? -17.052 8.930   -99.862  1.00 4.22  ? 364 LEU E CD2   1 
ATOM   9469  N  N     . VAL E 2 365 ? -20.450 8.476   -103.736 1.00 9.16  ? 365 VAL E N     1 
ATOM   9470  C  CA    . VAL E 2 365 ? -21.693 7.802   -104.205 1.00 4.40  ? 365 VAL E CA    1 
ATOM   9471  C  C     . VAL E 2 365 ? -21.502 6.951   -105.487 1.00 4.75  ? 365 VAL E C     1 
ATOM   9472  O  O     . VAL E 2 365 ? -21.725 5.749   -105.481 1.00 2.01  ? 365 VAL E O     1 
ATOM   9473  C  CB    . VAL E 2 365 ? -22.832 8.807   -104.325 1.00 10.29 ? 365 VAL E CB    1 
ATOM   9474  C  CG1   . VAL E 2 365 ? -24.095 8.119   -104.810 1.00 7.45  ? 365 VAL E CG1   1 
ATOM   9475  C  CG2   . VAL E 2 365 ? -23.095 9.522   -102.954 1.00 2.67  ? 365 VAL E CG2   1 
ATOM   9476  N  N     . SER E 2 366 ? -21.046 7.557   -106.573 1.00 2.00  ? 366 SER E N     1 
ATOM   9477  C  CA    . SER E 2 366 ? -20.898 6.787   -107.809 1.00 9.16  ? 366 SER E CA    1 
ATOM   9478  C  C     . SER E 2 366 ? -20.095 5.532   -107.587 1.00 10.17 ? 366 SER E C     1 
ATOM   9479  O  O     . SER E 2 366 ? -20.514 4.432   -107.964 1.00 14.87 ? 366 SER E O     1 
ATOM   9480  C  CB    . SER E 2 366 ? -20.180 7.576   -108.893 1.00 3.85  ? 366 SER E CB    1 
ATOM   9481  O  OG    . SER E 2 366 ? -20.955 8.718   -109.242 1.00 10.30 ? 366 SER E OG    1 
ATOM   9482  N  N     . VAL E 2 367 ? -18.922 5.711   -107.007 1.00 7.39  ? 367 VAL E N     1 
ATOM   9483  C  CA    . VAL E 2 367 ? -17.953 4.674   -106.947 1.00 10.55 ? 367 VAL E CA    1 
ATOM   9484  C  C     . VAL E 2 367 ? -18.489 3.603   -105.954 1.00 13.64 ? 367 VAL E C     1 
ATOM   9485  O  O     . VAL E 2 367 ? -18.246 2.408   -106.089 1.00 3.30  ? 367 VAL E O     1 
ATOM   9486  C  CB    . VAL E 2 367 ? -16.653 5.288   -106.546 1.00 11.56 ? 367 VAL E CB    1 
ATOM   9487  C  CG1   . VAL E 2 367 ? -15.923 4.399   -105.644 1.00 6.08  ? 367 VAL E CG1   1 
ATOM   9488  C  CG2   . VAL E 2 367 ? -15.817 5.519   -107.811 1.00 14.60 ? 367 VAL E CG2   1 
ATOM   9489  N  N     . SER E 2 368 ? -19.279 4.060   -105.009 1.00 2.00  ? 368 SER E N     1 
ATOM   9490  C  CA    . SER E 2 368 ? -20.008 3.212   -104.064 1.00 10.06 ? 368 SER E CA    1 
ATOM   9491  C  C     . SER E 2 368 ? -20.895 2.227   -104.776 1.00 20.08 ? 368 SER E C     1 
ATOM   9492  O  O     . SER E 2 368 ? -21.132 1.133   -104.229 1.00 3.31  ? 368 SER E O     1 
ATOM   9493  C  CB    . SER E 2 368 ? -21.077 4.069   -103.342 1.00 2.41  ? 368 SER E CB    1 
ATOM   9494  O  OG    . SER E 2 368 ? -20.765 4.034   -101.999 1.00 25.94 ? 368 SER E OG    1 
ATOM   9495  N  N     . MET E 2 369 ? -21.572 2.673   -105.848 1.00 6.66  ? 369 MET E N     1 
ATOM   9496  C  CA    . MET E 2 369 ? -22.627 1.812   -106.363 1.00 16.46 ? 369 MET E CA    1 
ATOM   9497  C  C     . MET E 2 369 ? -22.035 1.173   -107.563 1.00 10.51 ? 369 MET E C     1 
ATOM   9498  O  O     . MET E 2 369 ? -22.556 0.238   -107.984 1.00 6.98  ? 369 MET E O     1 
ATOM   9499  C  CB    . MET E 2 369 ? -23.957 2.464   -106.788 1.00 20.20 ? 369 MET E CB    1 
ATOM   9500  C  CG    . MET E 2 369 ? -24.069 3.996   -106.657 1.00 45.58 ? 369 MET E CG    1 
ATOM   9501  S  SD    . MET E 2 369 ? -25.713 4.595   -106.040 1.00 39.58 ? 369 MET E SD    1 
ATOM   9502  C  CE    . MET E 2 369 ? -26.760 3.089   -106.251 1.00 49.52 ? 369 MET E CE    1 
ATOM   9503  N  N     . GLY E 2 370 ? -20.932 1.655   -108.106 1.00 2.00  ? 370 GLY E N     1 
ATOM   9504  C  CA    . GLY E 2 370 ? -20.380 1.021   -109.293 1.00 2.00  ? 370 GLY E CA    1 
ATOM   9505  C  C     . GLY E 2 370 ? -19.316 -0.017  -108.970 1.00 3.20  ? 370 GLY E C     1 
ATOM   9506  O  O     . GLY E 2 370 ? -18.951 -0.839  -109.827 1.00 2.00  ? 370 GLY E O     1 
ATOM   9507  N  N     . CYS E 2 371 ? -18.864 -0.053  -107.712 1.00 2.00  ? 371 CYS E N     1 
ATOM   9508  C  CA    . CYS E 2 371 ? -17.714 -0.924  -107.387 1.00 3.04  ? 371 CYS E CA    1 
ATOM   9509  C  C     . CYS E 2 371 ? -18.010 -2.026  -106.366 1.00 2.00  ? 371 CYS E C     1 
ATOM   9510  O  O     . CYS E 2 371 ? -17.907 -1.795  -105.170 1.00 6.68  ? 371 CYS E O     1 
ATOM   9511  C  CB    . CYS E 2 371 ? -16.528 -0.039  -106.990 1.00 2.00  ? 371 CYS E CB    1 
ATOM   9512  S  SG    . CYS E 2 371 ? -16.033 0.965   -108.453 1.00 3.25  ? 371 CYS E SG    1 
ATOM   9513  N  N     . PRO E 2 372 ? -18.432 -3.218  -106.817 1.00 2.08  ? 372 PRO E N     1 
ATOM   9514  C  CA    . PRO E 2 372 ? -19.003 -4.125  -105.781 1.00 10.80 ? 372 PRO E CA    1 
ATOM   9515  C  C     . PRO E 2 372 ? -17.982 -4.575  -104.749 1.00 4.79  ? 372 PRO E C     1 
ATOM   9516  O  O     . PRO E 2 372 ? -18.405 -4.983  -103.671 1.00 2.00  ? 372 PRO E O     1 
ATOM   9517  C  CB    . PRO E 2 372 ? -19.536 -5.353  -106.549 1.00 2.00  ? 372 PRO E CB    1 
ATOM   9518  C  CG    . PRO E 2 372 ? -19.424 -4.994  -108.048 1.00 2.00  ? 372 PRO E CG    1 
ATOM   9519  C  CD    . PRO E 2 372 ? -18.478 -3.806  -108.173 1.00 7.43  ? 372 PRO E CD    1 
ATOM   9520  N  N     . LYS E 2 373 ? -16.675 -4.455  -105.034 1.00 5.37  ? 373 LYS E N     1 
ATOM   9521  C  CA    . LYS E 2 373 ? -15.703 -4.673  -103.957 1.00 3.23  ? 373 LYS E CA    1 
ATOM   9522  C  C     . LYS E 2 373 ? -14.965 -3.527  -103.323 1.00 9.45  ? 373 LYS E C     1 
ATOM   9523  O  O     . LYS E 2 373 ? -13.998 -3.846  -102.613 1.00 11.62 ? 373 LYS E O     1 
ATOM   9524  C  CB    . LYS E 2 373 ? -14.629 -5.668  -104.344 1.00 15.76 ? 373 LYS E CB    1 
ATOM   9525  C  CG    . LYS E 2 373 ? -14.751 -6.188  -105.755 1.00 6.93  ? 373 LYS E CG    1 
ATOM   9526  C  CD    . LYS E 2 373 ? -15.254 -7.578  -105.592 1.00 16.05 ? 373 LYS E CD    1 
ATOM   9527  C  CE    . LYS E 2 373 ? -14.425 -8.580  -106.375 1.00 44.08 ? 373 LYS E CE    1 
ATOM   9528  N  NZ    . LYS E 2 373 ? -14.825 -9.938  -105.865 1.00 20.60 ? 373 LYS E NZ    1 
ATOM   9529  N  N     . LEU E 2 374 ? -15.370 -2.238  -103.507 1.00 9.73  ? 374 LEU E N     1 
ATOM   9530  C  CA    . LEU E 2 374 ? -14.860 -1.159  -102.589 1.00 7.25  ? 374 LEU E CA    1 
ATOM   9531  C  C     . LEU E 2 374 ? -15.047 -1.599  -101.161 1.00 8.82  ? 374 LEU E C     1 
ATOM   9532  O  O     . LEU E 2 374 ? -16.235 -1.805  -100.692 1.00 4.87  ? 374 LEU E O     1 
ATOM   9533  C  CB    . LEU E 2 374 ? -15.631 0.103   -102.669 1.00 3.00  ? 374 LEU E CB    1 
ATOM   9534  C  CG    . LEU E 2 374 ? -14.927 1.329   -103.170 1.00 9.53  ? 374 LEU E CG    1 
ATOM   9535  C  CD1   . LEU E 2 374 ? -15.804 2.490   -102.893 1.00 2.00  ? 374 LEU E CD1   1 
ATOM   9536  C  CD2   . LEU E 2 374 ? -13.473 1.508   -102.888 1.00 2.00  ? 374 LEU E CD2   1 
ATOM   9537  N  N     . GLU E 2 375 ? -13.920 -1.754  -100.466 1.00 3.22  ? 375 GLU E N     1 
ATOM   9538  C  CA    . GLU E 2 375 ? -14.000 -2.031  -99.026  1.00 8.91  ? 375 GLU E CA    1 
ATOM   9539  C  C     . GLU E 2 375 ? -13.272 -0.946  -98.232  1.00 6.15  ? 375 GLU E C     1 
ATOM   9540  O  O     . GLU E 2 375 ? -13.492 -0.773  -97.020  1.00 6.83  ? 375 GLU E O     1 
ATOM   9541  C  CB    . GLU E 2 375 ? -13.562 -3.465  -98.696  1.00 2.00  ? 375 GLU E CB    1 
ATOM   9542  C  CG    . GLU E 2 375 ? -12.149 -3.763  -98.953  1.00 2.00  ? 375 GLU E CG    1 
ATOM   9543  C  CD    . GLU E 2 375 ? -11.731 -5.077  -98.260  1.00 8.43  ? 375 GLU E CD    1 
ATOM   9544  O  OE1   . GLU E 2 375 ? -11.668 -5.134  -96.994  1.00 11.96 ? 375 GLU E OE1   1 
ATOM   9545  O  OE2   . GLU E 2 375 ? -11.507 -6.080  -98.984  1.00 6.07  ? 375 GLU E OE2   1 
ATOM   9546  N  N     . SER E 2 376 ? -12.422 -0.206  -98.948  1.00 7.28  ? 376 SER E N     1 
ATOM   9547  C  CA    . SER E 2 376 ? -11.474 0.770   -98.351  1.00 8.02  ? 376 SER E CA    1 
ATOM   9548  C  C     . SER E 2 376 ? -11.526 2.192   -98.956  1.00 8.05  ? 376 SER E C     1 
ATOM   9549  O  O     . SER E 2 376 ? -11.199 2.392   -100.156 1.00 2.00  ? 376 SER E O     1 
ATOM   9550  C  CB    . SER E 2 376 ? -10.029 0.229   -98.466  1.00 7.16  ? 376 SER E CB    1 
ATOM   9551  O  OG    . SER E 2 376 ? -9.092  1.048   -97.794  1.00 3.05  ? 376 SER E OG    1 
ATOM   9552  N  N     . VAL E 2 377 ? -11.947 3.159   -98.135  1.00 2.00  ? 377 VAL E N     1 
ATOM   9553  C  CA    . VAL E 2 377 ? -12.087 4.531   -98.662  1.00 11.36 ? 377 VAL E CA    1 
ATOM   9554  C  C     . VAL E 2 377 ? -11.330 5.580   -97.864  1.00 2.70  ? 377 VAL E C     1 
ATOM   9555  O  O     . VAL E 2 377 ? -11.505 5.652   -96.647  1.00 2.00  ? 377 VAL E O     1 
ATOM   9556  C  CB    . VAL E 2 377 ? -13.579 4.951   -98.735  1.00 14.10 ? 377 VAL E CB    1 
ATOM   9557  C  CG1   . VAL E 2 377 ? -13.758 6.563   -98.656  1.00 2.00  ? 377 VAL E CG1   1 
ATOM   9558  C  CG2   . VAL E 2 377 ? -14.148 4.313   -99.968  1.00 3.31  ? 377 VAL E CG2   1 
ATOM   9559  N  N     . LEU E 2 378 ? -10.505 6.356   -98.532  1.00 2.00  ? 378 LEU E N     1 
ATOM   9560  C  CA    . LEU E 2 378 ? -10.037 7.590   -97.901  1.00 3.41  ? 378 LEU E CA    1 
ATOM   9561  C  C     . LEU E 2 378 ? -10.393 8.742   -98.830  1.00 2.00  ? 378 LEU E C     1 
ATOM   9562  O  O     . LEU E 2 378 ? -9.937  8.753   -99.987  1.00 3.06  ? 378 LEU E O     1 
ATOM   9563  C  CB    . LEU E 2 378 ? -8.508  7.575   -97.558  1.00 4.34  ? 378 LEU E CB    1 
ATOM   9564  C  CG    . LEU E 2 378 ? -7.879  8.915   -97.025  1.00 2.16  ? 378 LEU E CG    1 
ATOM   9565  C  CD1   . LEU E 2 378 ? -8.346  9.490   -95.677  1.00 2.00  ? 378 LEU E CD1   1 
ATOM   9566  C  CD2   . LEU E 2 378 ? -6.419  8.921   -97.194  1.00 2.00  ? 378 LEU E CD2   1 
ATOM   9567  N  N     . TYR E 2 379 ? -11.197 9.671   -98.362  1.00 2.00  ? 379 TYR E N     1 
ATOM   9568  C  CA    . TYR E 2 379 ? -11.751 10.690  -99.291  1.00 4.51  ? 379 TYR E CA    1 
ATOM   9569  C  C     . TYR E 2 379 ? -11.714 12.132  -98.643  1.00 2.33  ? 379 TYR E C     1 
ATOM   9570  O  O     . TYR E 2 379 ? -12.291 12.381  -97.543  1.00 2.80  ? 379 TYR E O     1 
ATOM   9571  C  CB    . TYR E 2 379 ? -13.177 10.302  -99.660  1.00 2.00  ? 379 TYR E CB    1 
ATOM   9572  C  CG    . TYR E 2 379 ? -13.805 10.879  -100.859 1.00 2.00  ? 379 TYR E CG    1 
ATOM   9573  C  CD1   . TYR E 2 379 ? -13.653 10.298  -102.108 1.00 2.00  ? 379 TYR E CD1   1 
ATOM   9574  C  CD2   . TYR E 2 379 ? -14.688 11.945  -100.719 1.00 14.28 ? 379 TYR E CD2   1 
ATOM   9575  C  CE1   . TYR E 2 379 ? -14.301 10.821  -103.236 1.00 2.01  ? 379 TYR E CE1   1 
ATOM   9576  C  CE2   . TYR E 2 379 ? -15.379 12.493  -101.821 1.00 3.83  ? 379 TYR E CE2   1 
ATOM   9577  C  CZ    . TYR E 2 379 ? -15.178 11.930  -103.073 1.00 2.00  ? 379 TYR E CZ    1 
ATOM   9578  O  OH    . TYR E 2 379 ? -15.864 12.507  -104.106 1.00 9.94  ? 379 TYR E OH    1 
ATOM   9579  N  N     . PHE E 2 380 ? -11.042 13.058  -99.291  1.00 2.43  ? 380 PHE E N     1 
ATOM   9580  C  CA    . PHE E 2 380 ? -11.086 14.509  -98.816  1.00 9.97  ? 380 PHE E CA    1 
ATOM   9581  C  C     . PHE E 2 380 ? -12.006 15.278  -99.744  1.00 9.97  ? 380 PHE E C     1 
ATOM   9582  O  O     . PHE E 2 380 ? -11.660 15.363  -100.925 1.00 2.70  ? 380 PHE E O     1 
ATOM   9583  C  CB    . PHE E 2 380 ? -9.648  15.151  -98.891  1.00 2.00  ? 380 PHE E CB    1 
ATOM   9584  C  CG    . PHE E 2 380 ? -8.679  14.607  -97.797  1.00 2.19  ? 380 PHE E CG    1 
ATOM   9585  C  CD1   . PHE E 2 380 ? -7.990  13.385  -97.980  1.00 10.61 ? 380 PHE E CD1   1 
ATOM   9586  C  CD2   . PHE E 2 380 ? -8.489  15.261  -96.573  1.00 10.97 ? 380 PHE E CD2   1 
ATOM   9587  C  CE1   . PHE E 2 380 ? -7.128  12.834  -96.988  1.00 2.00  ? 380 PHE E CE1   1 
ATOM   9588  C  CE2   . PHE E 2 380 ? -7.580  14.716  -95.555  1.00 3.45  ? 380 PHE E CE2   1 
ATOM   9589  C  CZ    . PHE E 2 380 ? -6.920  13.468  -95.805  1.00 3.15  ? 380 PHE E CZ    1 
ATOM   9590  N  N     . CYS E 2 381 ? -13.110 15.846  -99.248  1.00 2.00  ? 381 CYS E N     1 
ATOM   9591  C  CA    . CYS E 2 381 ? -13.896 16.822  -100.019 1.00 2.00  ? 381 CYS E CA    1 
ATOM   9592  C  C     . CYS E 2 381 ? -14.352 18.064  -99.132  1.00 2.00  ? 381 CYS E C     1 
ATOM   9593  O  O     . CYS E 2 381 ? -14.152 18.151  -97.887  1.00 5.08  ? 381 CYS E O     1 
ATOM   9594  C  CB    . CYS E 2 381 ? -15.148 16.146  -100.459 1.00 2.00  ? 381 CYS E CB    1 
ATOM   9595  S  SG    . CYS E 2 381 ? -16.000 15.413  -98.971  1.00 2.22  ? 381 CYS E SG    1 
ATOM   9596  N  N     . ARG E 2 382 ? -15.066 18.978  -99.742  1.00 2.00  ? 382 ARG E N     1 
ATOM   9597  C  CA    . ARG E 2 382 ? -15.558 20.151  -99.013  1.00 8.54  ? 382 ARG E CA    1 
ATOM   9598  C  C     . ARG E 2 382 ? -16.991 20.145  -98.595  1.00 11.95 ? 382 ARG E C     1 
ATOM   9599  O  O     . ARG E 2 382 ? -17.413 21.065  -97.914  1.00 2.00  ? 382 ARG E O     1 
ATOM   9600  C  CB    . ARG E 2 382 ? -15.238 21.455  -99.694  1.00 2.00  ? 382 ARG E CB    1 
ATOM   9601  C  CG    . ARG E 2 382 ? -13.760 21.581  -99.754  1.00 5.20  ? 382 ARG E CG    1 
ATOM   9602  C  CD    . ARG E 2 382 ? -13.388 22.549  -100.722 1.00 2.00  ? 382 ARG E CD    1 
ATOM   9603  N  NE    . ARG E 2 382 ? -12.231 23.285  -100.301 1.00 6.89  ? 382 ARG E NE    1 
ATOM   9604  C  CZ    . ARG E 2 382 ? -11.056 23.100  -100.842 1.00 7.74  ? 382 ARG E CZ    1 
ATOM   9605  N  NH1   . ARG E 2 382 ? -10.918 22.149  -101.748 1.00 3.44  ? 382 ARG E NH1   1 
ATOM   9606  N  NH2   . ARG E 2 382 ? -10.048 23.855  -100.449 1.00 17.87 ? 382 ARG E NH2   1 
ATOM   9607  N  N     . GLN E 2 383 ? -17.737 19.097  -98.981  1.00 2.07  ? 383 GLN E N     1 
ATOM   9608  C  CA    . GLN E 2 383 ? -19.187 19.105  -98.670  1.00 4.72  ? 383 GLN E CA    1 
ATOM   9609  C  C     . GLN E 2 383 ? -19.658 17.630  -98.581  1.00 2.00  ? 383 GLN E C     1 
ATOM   9610  O  O     . GLN E 2 383 ? -19.067 16.762  -99.181  1.00 2.00  ? 383 GLN E O     1 
ATOM   9611  C  CB    . GLN E 2 383 ? -19.983 19.959  -99.720  1.00 2.00  ? 383 GLN E CB    1 
ATOM   9612  C  CG    . GLN E 2 383 ? -20.220 19.236  -101.102 1.00 5.70  ? 383 GLN E CG    1 
ATOM   9613  C  CD    . GLN E 2 383 ? -20.853 20.111  -102.236 1.00 7.60  ? 383 GLN E CD    1 
ATOM   9614  O  OE1   . GLN E 2 383 ? -21.631 19.602  -103.035 1.00 2.21  ? 383 GLN E OE1   1 
ATOM   9615  N  NE2   . GLN E 2 383 ? -20.461 21.388  -102.331 1.00 6.44  ? 383 GLN E NE2   1 
ATOM   9616  N  N     . MET E 2 384 ? -20.742 17.385  -97.863  1.00 4.27  ? 384 MET E N     1 
ATOM   9617  C  CA    . MET E 2 384 ? -21.246 16.061  -97.694  1.00 3.36  ? 384 MET E CA    1 
ATOM   9618  C  C     . MET E 2 384 ? -22.696 16.139  -97.234  1.00 6.38  ? 384 MET E C     1 
ATOM   9619  O  O     . MET E 2 384 ? -23.095 17.169  -96.681  1.00 6.40  ? 384 MET E O     1 
ATOM   9620  C  CB    . MET E 2 384 ? -20.374 15.324  -96.712  1.00 2.90  ? 384 MET E CB    1 
ATOM   9621  C  CG    . MET E 2 384 ? -20.808 13.967  -96.384  1.00 2.00  ? 384 MET E CG    1 
ATOM   9622  S  SD    . MET E 2 384 ? -20.748 12.954  -97.822  1.00 6.52  ? 384 MET E SD    1 
ATOM   9623  C  CE    . MET E 2 384 ? -19.104 13.417  -98.431  1.00 2.00  ? 384 MET E CE    1 
ATOM   9624  N  N     . THR E 2 385 ? -23.499 15.086  -97.494  1.00 11.41 ? 385 THR E N     1 
ATOM   9625  C  CA    . THR E 2 385 ? -24.898 14.982  -96.950  1.00 3.48  ? 385 THR E CA    1 
ATOM   9626  C  C     . THR E 2 385 ? -25.171 13.638  -96.271  1.00 6.69  ? 385 THR E C     1 
ATOM   9627  O  O     . THR E 2 385 ? -24.553 12.604  -96.603  1.00 4.63  ? 385 THR E O     1 
ATOM   9628  C  CB    . THR E 2 385 ? -25.885 15.112  -98.079  1.00 8.74  ? 385 THR E CB    1 
ATOM   9629  O  OG1   . THR E 2 385 ? -25.644 14.017  -98.946  1.00 2.66  ? 385 THR E OG1   1 
ATOM   9630  C  CG2   . THR E 2 385 ? -25.508 16.366  -98.900  1.00 5.98  ? 385 THR E CG2   1 
ATOM   9631  N  N     . ASN E 2 386 ? -26.066 13.665  -95.299  1.00 4.57  ? 386 ASN E N     1 
ATOM   9632  C  CA    . ASN E 2 386 ? -26.651 12.468  -94.754  1.00 9.45  ? 386 ASN E CA    1 
ATOM   9633  C  C     . ASN E 2 386 ? -27.193 11.574  -95.849  1.00 5.92  ? 386 ASN E C     1 
ATOM   9634  O  O     . ASN E 2 386 ? -26.915 10.427  -95.846  1.00 8.82  ? 386 ASN E O     1 
ATOM   9635  C  CB    . ASN E 2 386 ? -27.716 12.789  -93.692  1.00 2.00  ? 386 ASN E CB    1 
ATOM   9636  C  CG    . ASN E 2 386 ? -27.097 13.414  -92.445  1.00 9.96  ? 386 ASN E CG    1 
ATOM   9637  O  OD1   . ASN E 2 386 ? -25.971 13.097  -92.065  1.00 10.07 ? 386 ASN E OD1   1 
ATOM   9638  N  ND2   . ASN E 2 386 ? -27.779 14.386  -91.872  1.00 4.76  ? 386 ASN E ND2   1 
ATOM   9639  N  N     . ALA E 2 387 ? -27.894 12.110  -96.834  1.00 2.81  ? 387 ALA E N     1 
ATOM   9640  C  CA    . ALA E 2 387 ? -28.362 11.250  -97.921  1.00 16.32 ? 387 ALA E CA    1 
ATOM   9641  C  C     . ALA E 2 387 ? -27.223 10.528  -98.652  1.00 2.16  ? 387 ALA E C     1 
ATOM   9642  O  O     . ALA E 2 387 ? -27.406 9.432   -98.990  1.00 10.64 ? 387 ALA E O     1 
ATOM   9643  C  CB    . ALA E 2 387 ? -29.324 11.974  -98.916  1.00 2.00  ? 387 ALA E CB    1 
ATOM   9644  N  N     . ALA E 2 388 ? -26.086 11.145  -98.922  1.00 2.00  ? 388 ALA E N     1 
ATOM   9645  C  CA    . ALA E 2 388 ? -25.023 10.477  -99.629  1.00 2.04  ? 388 ALA E CA    1 
ATOM   9646  C  C     . ALA E 2 388 ? -24.378 9.448   -98.706  1.00 8.95  ? 388 ALA E C     1 
ATOM   9647  O  O     . ALA E 2 388 ? -24.008 8.354   -99.171  1.00 6.46  ? 388 ALA E O     1 
ATOM   9648  C  CB    . ALA E 2 388 ? -23.971 11.463  -100.126 1.00 2.00  ? 388 ALA E CB    1 
ATOM   9649  N  N     . LEU E 2 389 ? -24.257 9.759   -97.428  1.00 2.41  ? 389 LEU E N     1 
ATOM   9650  C  CA    . LEU E 2 389 ? -23.742 8.784   -96.489  1.00 8.05  ? 389 LEU E CA    1 
ATOM   9651  C  C     . LEU E 2 389 ? -24.579 7.522   -96.362  1.00 11.34 ? 389 LEU E C     1 
ATOM   9652  O  O     . LEU E 2 389 ? -24.043 6.432   -96.398  1.00 2.00  ? 389 LEU E O     1 
ATOM   9653  C  CB    . LEU E 2 389 ? -23.426 9.398   -95.132  1.00 2.00  ? 389 LEU E CB    1 
ATOM   9654  C  CG    . LEU E 2 389 ? -22.218 10.321  -95.030  1.00 9.42  ? 389 LEU E CG    1 
ATOM   9655  C  CD1   . LEU E 2 389 ? -22.344 11.261  -93.870  1.00 2.00  ? 389 LEU E CD1   1 
ATOM   9656  C  CD2   . LEU E 2 389 ? -20.923 9.592   -94.955  1.00 2.00  ? 389 LEU E CD2   1 
ATOM   9657  N  N     . ILE E 2 390 ? -25.890 7.656   -96.231  1.00 2.64  ? 390 ILE E N     1 
ATOM   9658  C  CA    . ILE E 2 390 ? -26.723 6.477   -96.157  1.00 2.00  ? 390 ILE E CA    1 
ATOM   9659  C  C     . ILE E 2 390 ? -26.878 5.706   -97.447  1.00 2.83  ? 390 ILE E C     1 
ATOM   9660  O  O     . ILE E 2 390 ? -27.122 4.522   -97.423  1.00 5.33  ? 390 ILE E O     1 
ATOM   9661  C  CB    . ILE E 2 390 ? -28.073 6.730   -95.475  1.00 6.99  ? 390 ILE E CB    1 
ATOM   9662  C  CG1   . ILE E 2 390 ? -28.218 8.169   -95.023  1.00 2.02  ? 390 ILE E CG1   1 
ATOM   9663  C  CG2   . ILE E 2 390 ? -29.213 6.267   -96.324  1.00 2.00  ? 390 ILE E CG2   1 
ATOM   9664  C  CD1   . ILE E 2 390 ? -29.260 8.349   -93.982  1.00 66.22 ? 390 ILE E CD1   1 
ATOM   9665  N  N     . THR E 2 391 ? -26.706 6.377   -98.572  1.00 2.00  ? 391 THR E N     1 
ATOM   9666  C  CA    . THR E 2 391 ? -26.587 5.693   -99.845  1.00 3.66  ? 391 THR E CA    1 
ATOM   9667  C  C     . THR E 2 391 ? -25.286 4.911   -100.005 1.00 4.24  ? 391 THR E C     1 
ATOM   9668  O  O     . THR E 2 391 ? -25.311 3.763   -100.387 1.00 8.50  ? 391 THR E O     1 
ATOM   9669  C  CB    . THR E 2 391 ? -26.842 6.656   -101.022 1.00 2.00  ? 391 THR E CB    1 
ATOM   9670  O  OG1   . THR E 2 391 ? -28.228 6.966   -101.092 1.00 2.75  ? 391 THR E OG1   1 
ATOM   9671  C  CG2   . THR E 2 391 ? -26.598 5.985   -102.324 1.00 2.00  ? 391 THR E CG2   1 
ATOM   9672  N  N     . ILE E 2 392 ? -24.158 5.523   -99.679  1.00 2.00  ? 392 ILE E N     1 
ATOM   9673  C  CA    . ILE E 2 392 ? -22.928 4.800   -99.573  1.00 2.00  ? 392 ILE E CA    1 
ATOM   9674  C  C     . ILE E 2 392 ? -23.066 3.549   -98.629  1.00 4.74  ? 392 ILE E C     1 
ATOM   9675  O  O     . ILE E 2 392 ? -22.535 2.469   -98.954  1.00 2.07  ? 392 ILE E O     1 
ATOM   9676  C  CB    . ILE E 2 392 ? -21.796 5.759   -99.153  1.00 2.58  ? 392 ILE E CB    1 
ATOM   9677  C  CG1   . ILE E 2 392 ? -21.629 6.893   -100.168 1.00 2.49  ? 392 ILE E CG1   1 
ATOM   9678  C  CG2   . ILE E 2 392 ? -20.494 5.083   -98.996  1.00 2.50  ? 392 ILE E CG2   1 
ATOM   9679  C  CD1   . ILE E 2 392 ? -20.616 7.910   -99.742  1.00 2.00  ? 392 ILE E CD1   1 
ATOM   9680  N  N     . ALA E 2 393 ? -23.763 3.673   -97.504  1.00 2.00  ? 393 ALA E N     1 
ATOM   9681  C  CA    . ALA E 2 393 ? -23.751 2.652   -96.497  1.00 2.00  ? 393 ALA E CA    1 
ATOM   9682  C  C     . ALA E 2 393 ? -24.627 1.506   -96.974  1.00 8.93  ? 393 ALA E C     1 
ATOM   9683  O  O     . ALA E 2 393 ? -24.228 0.311   -96.847  1.00 9.66  ? 393 ALA E O     1 
ATOM   9684  C  CB    . ALA E 2 393 ? -24.278 3.140   -95.237  1.00 2.00  ? 393 ALA E CB    1 
ATOM   9685  N  N     . ARG E 2 394 ? -25.818 1.824   -97.501  1.00 3.66  ? 394 ARG E N     1 
ATOM   9686  C  CA    . ARG E 2 394 ? -26.668 0.803   -98.136  1.00 13.73 ? 394 ARG E CA    1 
ATOM   9687  C  C     . ARG E 2 394 ? -26.024 0.012   -99.294  1.00 7.06  ? 394 ARG E C     1 
ATOM   9688  O  O     . ARG E 2 394 ? -26.084 -1.197  -99.299  1.00 23.53 ? 394 ARG E O     1 
ATOM   9689  C  CB    . ARG E 2 394 ? -28.064 1.311   -98.523  1.00 8.62  ? 394 ARG E CB    1 
ATOM   9690  C  CG    . ARG E 2 394 ? -28.907 1.853   -97.350  1.00 13.04 ? 394 ARG E CG    1 
ATOM   9691  C  CD    . ARG E 2 394 ? -30.385 2.293   -97.776  1.00 21.03 ? 394 ARG E CD    1 
ATOM   9692  N  NE    . ARG E 2 394 ? -31.438 1.509   -97.099  1.00 54.46 ? 394 ARG E NE    1 
ATOM   9693  C  CZ    . ARG E 2 394 ? -31.767 1.574   -95.798  1.00 61.18 ? 394 ARG E CZ    1 
ATOM   9694  N  NH1   . ARG E 2 394 ? -31.166 2.420   -94.957  1.00 49.41 ? 394 ARG E NH1   1 
ATOM   9695  N  NH2   . ARG E 2 394 ? -32.725 0.773   -95.324  1.00 77.02 ? 394 ARG E NH2   1 
ATOM   9696  N  N     . ASN E 2 395 ? -25.420 0.678   -100.260 1.00 4.56  ? 395 ASN E N     1 
ATOM   9697  C  CA    . ASN E 2 395 ? -24.674 0.011   -101.307 1.00 5.68  ? 395 ASN E CA    1 
ATOM   9698  C  C     . ASN E 2 395 ? -23.439 -0.828  -100.944 1.00 6.91  ? 395 ASN E C     1 
ATOM   9699  O  O     . ASN E 2 395 ? -23.055 -1.703  -101.714 1.00 6.04  ? 395 ASN E O     1 
ATOM   9700  C  CB    . ASN E 2 395 ? -24.117 1.068   -102.241 1.00 17.00 ? 395 ASN E CB    1 
ATOM   9701  C  CG    . ASN E 2 395 ? -25.189 1.815   -102.986 1.00 11.88 ? 395 ASN E CG    1 
ATOM   9702  O  OD1   . ASN E 2 395 ? -26.303 1.383   -103.023 1.00 12.16 ? 395 ASN E OD1   1 
ATOM   9703  N  ND2   . ASN E 2 395 ? -24.836 2.944   -103.596 1.00 30.33 ? 395 ASN E ND2   1 
ATOM   9704  N  N     . ARG E 2 396 ? -22.743 -0.476  -99.867  1.00 2.90  ? 396 ARG E N     1 
ATOM   9705  C  CA    . ARG E 2 396 ? -21.417 -1.062  -99.585  1.00 9.74  ? 396 ARG E CA    1 
ATOM   9706  C  C     . ARG E 2 396 ? -21.284 -1.678  -98.137  1.00 7.09  ? 396 ARG E C     1 
ATOM   9707  O  O     . ARG E 2 396 ? -20.474 -1.283  -97.272  1.00 5.46  ? 396 ARG E O     1 
ATOM   9708  C  CB    . ARG E 2 396 ? -20.306 -0.085  -99.949  1.00 8.56  ? 396 ARG E CB    1 
ATOM   9709  C  CG    . ARG E 2 396 ? -20.096 0.151   -101.442 1.00 2.07  ? 396 ARG E CG    1 
ATOM   9710  C  CD    . ARG E 2 396 ? -19.221 -1.006  -102.031 1.00 4.32  ? 396 ARG E CD    1 
ATOM   9711  N  NE    . ARG E 2 396 ? -20.009 -2.268  -102.060 1.00 15.76 ? 396 ARG E NE    1 
ATOM   9712  C  CZ    . ARG E 2 396 ? -20.877 -2.637  -103.030 1.00 2.09  ? 396 ARG E CZ    1 
ATOM   9713  N  NH1   . ARG E 2 396 ? -21.077 -1.872  -104.088 1.00 2.00  ? 396 ARG E NH1   1 
ATOM   9714  N  NH2   . ARG E 2 396 ? -21.525 -3.809  -102.979 1.00 7.42  ? 396 ARG E NH2   1 
ATOM   9715  N  N     . PRO E 2 397 ? -22.166 -2.601  -97.837  1.00 3.64  ? 397 PRO E N     1 
ATOM   9716  C  CA    . PRO E 2 397 ? -22.235 -2.970  -96.436  1.00 3.02  ? 397 PRO E CA    1 
ATOM   9717  C  C     . PRO E 2 397 ? -21.061 -3.869  -96.173  1.00 12.99 ? 397 PRO E C     1 
ATOM   9718  O  O     . PRO E 2 397 ? -20.907 -4.376  -95.022  1.00 5.62  ? 397 PRO E O     1 
ATOM   9719  C  CB    . PRO E 2 397 ? -23.531 -3.792  -96.346  1.00 2.82  ? 397 PRO E CB    1 
ATOM   9720  C  CG    . PRO E 2 397 ? -23.730 -4.344  -97.766  1.00 4.39  ? 397 PRO E CG    1 
ATOM   9721  C  CD    . PRO E 2 397 ? -23.158 -3.281  -98.687  1.00 3.94  ? 397 PRO E CD    1 
ATOM   9722  N  N     . ASN E 2 398 ? -20.268 -4.083  -97.232  1.00 2.00  ? 398 ASN E N     1 
ATOM   9723  C  CA    . ASN E 2 398 ? -19.012 -4.788  -97.080  1.00 4.15  ? 398 ASN E CA    1 
ATOM   9724  C  C     . ASN E 2 398 ? -17.831 -3.867  -96.735  1.00 3.56  ? 398 ASN E C     1 
ATOM   9725  O  O     . ASN E 2 398 ? -16.705 -4.349  -96.555  1.00 10.68 ? 398 ASN E O     1 
ATOM   9726  C  CB    . ASN E 2 398 ? -18.677 -5.474  -98.384  1.00 2.00  ? 398 ASN E CB    1 
ATOM   9727  C  CG    . ASN E 2 398 ? -18.547 -4.479  -99.529  1.00 10.55 ? 398 ASN E CG    1 
ATOM   9728  O  OD1   . ASN E 2 398 ? -19.435 -3.630  -99.780  1.00 3.04  ? 398 ASN E OD1   1 
ATOM   9729  N  ND2   . ASN E 2 398 ? -17.438 -4.571  -100.228 1.00 8.57  ? 398 ASN E ND2   1 
ATOM   9730  N  N     . MET E 2 399 ? -18.048 -2.542  -96.658  1.00 11.54 ? 399 MET E N     1 
ATOM   9731  C  CA    . MET E 2 399 ? -16.943 -1.592  -96.255  1.00 2.46  ? 399 MET E CA    1 
ATOM   9732  C  C     . MET E 2 399 ? -16.186 -1.969  -94.951  1.00 2.19  ? 399 MET E C     1 
ATOM   9733  O  O     . MET E 2 399 ? -16.770 -2.269  -93.905  1.00 2.00  ? 399 MET E O     1 
ATOM   9734  C  CB    . MET E 2 399 ? -17.482 -0.184  -96.174  1.00 3.59  ? 399 MET E CB    1 
ATOM   9735  C  CG    . MET E 2 399 ? -16.464 0.998   -96.227  1.00 2.00  ? 399 MET E CG    1 
ATOM   9736  S  SD    . MET E 2 399 ? -15.836 1.335   -97.879  1.00 3.30  ? 399 MET E SD    1 
ATOM   9737  C  CE    . MET E 2 399 ? -17.355 1.934   -98.737  1.00 5.19  ? 399 MET E CE    1 
ATOM   9738  N  N     . THR E 2 400 ? -14.872 -1.861  -95.019  1.00 2.24  ? 400 THR E N     1 
ATOM   9739  C  CA    . THR E 2 400 ? -13.978 -2.255  -93.904  1.00 2.00  ? 400 THR E CA    1 
ATOM   9740  C  C     . THR E 2 400 ? -13.275 -1.124  -93.148  1.00 2.63  ? 400 THR E C     1 
ATOM   9741  O  O     . THR E 2 400 ? -13.137 -1.134  -91.874  1.00 2.94  ? 400 THR E O     1 
ATOM   9742  C  CB    . THR E 2 400 ? -12.909 -3.125  -94.577  1.00 10.10 ? 400 THR E CB    1 
ATOM   9743  O  OG1   . THR E 2 400 ? -13.355 -4.450  -94.407  1.00 17.67 ? 400 THR E OG1   1 
ATOM   9744  C  CG2   . THR E 2 400 ? -11.573 -2.991  -93.911  1.00 36.84 ? 400 THR E CG2   1 
ATOM   9745  N  N     . ARG E 2 401 ? -12.754 -0.218  -93.956  1.00 2.00  ? 401 ARG E N     1 
ATOM   9746  C  CA    . ARG E 2 401 ? -12.003 0.988   -93.582  1.00 2.30  ? 401 ARG E CA    1 
ATOM   9747  C  C     . ARG E 2 401 ? -12.693 2.216   -94.289  1.00 2.00  ? 401 ARG E C     1 
ATOM   9748  O  O     . ARG E 2 401 ? -12.725 2.354   -95.534  1.00 5.62  ? 401 ARG E O     1 
ATOM   9749  C  CB    . ARG E 2 401 ? -10.549 0.822   -94.037  1.00 2.00  ? 401 ARG E CB    1 
ATOM   9750  C  CG    . ARG E 2 401 ? -9.868  -0.256  -93.152  1.00 2.00  ? 401 ARG E CG    1 
ATOM   9751  C  CD    . ARG E 2 401 ? -8.712  -0.974  -93.867  1.00 5.72  ? 401 ARG E CD    1 
ATOM   9752  N  NE    . ARG E 2 401 ? -9.213  -1.823  -94.923  1.00 14.91 ? 401 ARG E NE    1 
ATOM   9753  C  CZ    . ARG E 2 401 ? -8.488  -2.537  -95.764  1.00 23.79 ? 401 ARG E CZ    1 
ATOM   9754  N  NH1   . ARG E 2 401 ? -7.166  -2.567  -95.670  1.00 9.91  ? 401 ARG E NH1   1 
ATOM   9755  N  NH2   . ARG E 2 401 ? -9.104  -3.228  -96.730  1.00 36.96 ? 401 ARG E NH2   1 
ATOM   9756  N  N     . PHE E 2 402 ? -13.321 3.074   -93.509  1.00 2.00  ? 402 PHE E N     1 
ATOM   9757  C  CA    . PHE E 2 402 ? -13.984 4.228   -94.111  1.00 3.57  ? 402 PHE E CA    1 
ATOM   9758  C  C     . PHE E 2 402 ? -13.431 5.570   -93.519  1.00 4.78  ? 402 PHE E C     1 
ATOM   9759  O  O     . PHE E 2 402 ? -13.680 5.933   -92.343  1.00 2.00  ? 402 PHE E O     1 
ATOM   9760  C  CB    . PHE E 2 402 ? -15.514 4.184   -93.869  1.00 2.67  ? 402 PHE E CB    1 
ATOM   9761  C  CG    . PHE E 2 402 ? -16.314 5.247   -94.675  1.00 2.80  ? 402 PHE E CG    1 
ATOM   9762  C  CD1   . PHE E 2 402 ? -16.492 5.125   -96.070  1.00 2.09  ? 402 PHE E CD1   1 
ATOM   9763  C  CD2   . PHE E 2 402 ? -16.895 6.319   -94.040  1.00 2.00  ? 402 PHE E CD2   1 
ATOM   9764  C  CE1   . PHE E 2 402 ? -17.251 6.091   -96.842  1.00 4.08  ? 402 PHE E CE1   1 
ATOM   9765  C  CE2   . PHE E 2 402 ? -17.640 7.296   -94.793  1.00 7.87  ? 402 PHE E CE2   1 
ATOM   9766  C  CZ    . PHE E 2 402 ? -17.824 7.191   -96.162  1.00 3.88  ? 402 PHE E CZ    1 
ATOM   9767  N  N     . ARG E 2 403 ? -12.723 6.324   -94.330  1.00 2.00  ? 403 ARG E N     1 
ATOM   9768  C  CA    . ARG E 2 403 ? -12.092 7.570   -93.807  1.00 2.67  ? 403 ARG E CA    1 
ATOM   9769  C  C     . ARG E 2 403 ? -12.586 8.811   -94.598  1.00 5.30  ? 403 ARG E C     1 
ATOM   9770  O  O     . ARG E 2 403 ? -12.275 8.977   -95.808  1.00 5.28  ? 403 ARG E O     1 
ATOM   9771  C  CB    . ARG E 2 403 ? -10.525 7.481   -93.744  1.00 2.00  ? 403 ARG E CB    1 
ATOM   9772  C  CG    . ARG E 2 403 ? -10.090 6.415   -92.673  1.00 2.00  ? 403 ARG E CG    1 
ATOM   9773  C  CD    . ARG E 2 403 ? -8.801  5.768   -93.005  1.00 2.00  ? 403 ARG E CD    1 
ATOM   9774  N  NE    . ARG E 2 403 ? -7.714  6.743   -92.983  1.00 2.63  ? 403 ARG E NE    1 
ATOM   9775  C  CZ    . ARG E 2 403 ? -6.438  6.494   -93.295  1.00 6.03  ? 403 ARG E CZ    1 
ATOM   9776  N  NH1   . ARG E 2 403 ? -6.016  5.256   -93.622  1.00 6.61  ? 403 ARG E NH1   1 
ATOM   9777  N  NH2   . ARG E 2 403 ? -5.554  7.479   -93.327  1.00 2.67  ? 403 ARG E NH2   1 
ATOM   9778  N  N     . LEU E 2 404 ? -13.333 9.684   -93.941  1.00 2.00  ? 404 LEU E N     1 
ATOM   9779  C  CA    . LEU E 2 404 ? -13.918 10.762  -94.723  1.00 2.86  ? 404 LEU E CA    1 
ATOM   9780  C  C     . LEU E 2 404 ? -13.674 12.156  -94.141  1.00 6.69  ? 404 LEU E C     1 
ATOM   9781  O  O     . LEU E 2 404 ? -14.111 12.495  -93.016  1.00 2.72  ? 404 LEU E O     1 
ATOM   9782  C  CB    . LEU E 2 404 ? -15.387 10.552  -94.862  1.00 9.30  ? 404 LEU E CB    1 
ATOM   9783  C  CG    . LEU E 2 404 ? -16.011 11.637  -95.716  1.00 6.35  ? 404 LEU E CG    1 
ATOM   9784  C  CD1   . LEU E 2 404 ? -16.443 11.032  -96.996  1.00 23.25 ? 404 LEU E CD1   1 
ATOM   9785  C  CD2   . LEU E 2 404 ? -17.160 12.046  -94.973  1.00 14.76 ? 404 LEU E CD2   1 
ATOM   9786  N  N     . CYS E 2 405 ? -12.901 12.966  -94.824  1.00 2.00  ? 405 CYS E N     1 
ATOM   9787  C  CA    . CYS E 2 405 ? -12.395 14.112  -94.091  1.00 2.10  ? 405 CYS E CA    1 
ATOM   9788  C  C     . CYS E 2 405 ? -12.921 15.404  -94.839  1.00 2.00  ? 405 CYS E C     1 
ATOM   9789  O  O     . CYS E 2 405 ? -12.533 15.653  -95.985  1.00 2.00  ? 405 CYS E O     1 
ATOM   9790  C  CB    . CYS E 2 405 ? -10.885 14.080  -94.090  1.00 7.02  ? 405 CYS E CB    1 
ATOM   9791  S  SG    . CYS E 2 405 ? -10.314 15.818  -93.554  1.00 9.68  ? 405 CYS E SG    1 
ATOM   9792  N  N     . ILE E 2 406 ? -13.903 16.085  -94.226  1.00 2.00  ? 406 ILE E N     1 
ATOM   9793  C  CA    . ILE E 2 406 ? -14.526 17.255  -94.803  1.00 2.00  ? 406 ILE E CA    1 
ATOM   9794  C  C     . ILE E 2 406 ? -13.692 18.387  -94.294  1.00 2.00  ? 406 ILE E C     1 
ATOM   9795  O  O     . ILE E 2 406 ? -13.494 18.513  -93.069  1.00 6.96  ? 406 ILE E O     1 
ATOM   9796  C  CB    . ILE E 2 406 ? -15.935 17.558  -94.282  1.00 7.44  ? 406 ILE E CB    1 
ATOM   9797  C  CG1   . ILE E 2 406 ? -17.006 16.521  -94.710  1.00 2.22  ? 406 ILE E CG1   1 
ATOM   9798  C  CG2   . ILE E 2 406 ? -16.324 19.003  -94.677  1.00 2.37  ? 406 ILE E CG2   1 
ATOM   9799  C  CD1   . ILE E 2 406 ? -18.268 16.627  -93.614  1.00 3.63  ? 406 ILE E CD1   1 
ATOM   9800  N  N     . ILE E 2 407 ? -13.179 19.173  -95.229  1.00 2.00  ? 407 ILE E N     1 
ATOM   9801  C  CA    . ILE E 2 407 ? -12.142 20.145  -94.985  1.00 7.15  ? 407 ILE E CA    1 
ATOM   9802  C  C     . ILE E 2 407 ? -12.525 21.283  -94.051  1.00 7.80  ? 407 ILE E C     1 
ATOM   9803  O  O     . ILE E 2 407 ? -11.659 21.756  -93.338  1.00 8.23  ? 407 ILE E O     1 
ATOM   9804  C  CB    . ILE E 2 407 ? -11.770 20.844  -96.287  1.00 3.88  ? 407 ILE E CB    1 
ATOM   9805  C  CG1   . ILE E 2 407 ? -11.200 19.819  -97.242  1.00 12.69 ? 407 ILE E CG1   1 
ATOM   9806  C  CG2   . ILE E 2 407 ? -10.985 22.072  -95.998  1.00 2.00  ? 407 ILE E CG2   1 
ATOM   9807  C  CD1   . ILE E 2 407 ? -9.677  19.683  -97.266  1.00 22.31 ? 407 ILE E CD1   1 
ATOM   9808  N  N     . GLU E 2 408 ? -13.777 21.723  -94.001  1.00 2.38  ? 408 GLU E N     1 
ATOM   9809  C  CA    . GLU E 2 408 ? -14.105 22.840  -92.998  1.00 6.60  ? 408 GLU E CA    1 
ATOM   9810  C  C     . GLU E 2 408 ? -14.553 22.100  -91.764  1.00 2.00  ? 408 GLU E C     1 
ATOM   9811  O  O     . GLU E 2 408 ? -15.446 21.242  -91.840  1.00 12.89 ? 408 GLU E O     1 
ATOM   9812  C  CB    . GLU E 2 408 ? -15.245 23.807  -93.510  1.00 2.01  ? 408 GLU E CB    1 
ATOM   9813  C  CG    . GLU E 2 408 ? -15.821 25.059  -92.594  1.00 5.20  ? 408 GLU E CG    1 
ATOM   9814  C  CD    . GLU E 2 408 ? -14.690 26.117  -92.292  1.00 59.10 ? 408 GLU E CD    1 
ATOM   9815  O  OE1   . GLU E 2 408 ? -14.650 26.752  -91.170  1.00 22.08 ? 408 GLU E OE1   1 
ATOM   9816  O  OE2   . GLU E 2 408 ? -13.796 26.275  -93.183  1.00 35.03 ? 408 GLU E OE2   1 
ATOM   9817  N  N     . PRO E 2 409 ? -13.947 22.411  -90.607  1.00 11.38 ? 409 PRO E N     1 
ATOM   9818  C  CA    . PRO E 2 409 ? -14.332 21.805  -89.303  1.00 2.00  ? 409 PRO E CA    1 
ATOM   9819  C  C     . PRO E 2 409 ? -15.678 21.245  -88.839  1.00 20.35 ? 409 PRO E C     1 
ATOM   9820  O  O     . PRO E 2 409 ? -15.789 20.011  -88.406  1.00 35.02 ? 409 PRO E O     1 
ATOM   9821  C  CB    . PRO E 2 409 ? -13.390 22.417  -88.244  1.00 2.00  ? 409 PRO E CB    1 
ATOM   9822  C  CG    . PRO E 2 409 ? -12.167 22.896  -89.036  1.00 2.00  ? 409 PRO E CG    1 
ATOM   9823  C  CD    . PRO E 2 409 ? -12.769 23.299  -90.459  1.00 6.30  ? 409 PRO E CD    1 
ATOM   9824  N  N     . LYS E 2 410 ? -16.696 22.062  -88.847  1.00 2.00  ? 410 LYS E N     1 
ATOM   9825  C  CA    . LYS E 2 410 ? -17.929 21.536  -88.297  1.00 2.00  ? 410 LYS E CA    1 
ATOM   9826  C  C     . LYS E 2 410 ? -18.997 21.795  -89.366  1.00 3.98  ? 410 LYS E C     1 
ATOM   9827  O  O     . LYS E 2 410 ? -20.091 22.225  -89.043  1.00 3.56  ? 410 LYS E O     1 
ATOM   9828  C  CB    . LYS E 2 410 ? -18.231 22.244  -87.009  1.00 2.00  ? 410 LYS E CB    1 
ATOM   9829  C  CG    . LYS E 2 410 ? -16.982 22.454  -86.172  1.00 2.00  ? 410 LYS E CG    1 
ATOM   9830  C  CD    . LYS E 2 410 ? -17.275 23.182  -84.874  1.00 2.00  ? 410 LYS E CD    1 
ATOM   9831  C  CE    . LYS E 2 410 ? -16.360 22.736  -83.777  1.00 12.27 ? 410 LYS E CE    1 
ATOM   9832  N  NZ    . LYS E 2 410 ? -16.313 23.655  -82.533  1.00 6.53  ? 410 LYS E NZ    1 
ATOM   9833  N  N     . ALA E 2 411 ? -18.616 21.637  -90.628  1.00 2.00  ? 411 ALA E N     1 
ATOM   9834  C  CA    . ALA E 2 411 ? -19.523 21.793  -91.732  1.00 2.00  ? 411 ALA E CA    1 
ATOM   9835  C  C     . ALA E 2 411 ? -20.756 20.936  -91.528  1.00 2.00  ? 411 ALA E C     1 
ATOM   9836  O  O     . ALA E 2 411 ? -20.638 19.786  -91.283  1.00 2.00  ? 411 ALA E O     1 
ATOM   9837  C  CB    . ALA E 2 411 ? -18.830 21.373  -93.001  1.00 2.00  ? 411 ALA E CB    1 
ATOM   9838  N  N     . PRO E 2 412 ? -21.969 21.524  -91.578  1.00 10.51 ? 412 PRO E N     1 
ATOM   9839  C  CA    . PRO E 2 412 ? -23.171 20.683  -91.641  1.00 2.18  ? 412 PRO E CA    1 
ATOM   9840  C  C     . PRO E 2 412 ? -23.448 20.027  -93.000  1.00 8.78  ? 412 PRO E C     1 
ATOM   9841  O  O     . PRO E 2 412 ? -22.737 20.281  -93.960  1.00 4.43  ? 412 PRO E O     1 
ATOM   9842  C  CB    . PRO E 2 412 ? -24.303 21.618  -91.170  1.00 2.74  ? 412 PRO E CB    1 
ATOM   9843  C  CG    . PRO E 2 412 ? -23.819 22.977  -91.580  1.00 11.11 ? 412 PRO E CG    1 
ATOM   9844  C  CD    . PRO E 2 412 ? -22.298 22.953  -91.438  1.00 2.00  ? 412 PRO E CD    1 
ATOM   9845  N  N     . ASP E 2 413 ? -24.449 19.141  -93.053  1.00 6.12  ? 413 ASP E N     1 
ATOM   9846  C  CA    . ASP E 2 413 ? -25.084 18.756  -94.329  1.00 2.39  ? 413 ASP E CA    1 
ATOM   9847  C  C     . ASP E 2 413 ? -25.375 20.071  -95.047  1.00 7.02  ? 413 ASP E C     1 
ATOM   9848  O  O     . ASP E 2 413 ? -26.094 20.926  -94.540  1.00 2.00  ? 413 ASP E O     1 
ATOM   9849  C  CB    . ASP E 2 413 ? -26.397 18.054  -93.973  1.00 12.84 ? 413 ASP E CB    1 
ATOM   9850  C  CG    . ASP E 2 413 ? -27.156 17.501  -95.178  1.00 17.47 ? 413 ASP E CG    1 
ATOM   9851  O  OD1   . ASP E 2 413 ? -27.314 18.206  -96.198  1.00 2.00  ? 413 ASP E OD1   1 
ATOM   9852  O  OD2   . ASP E 2 413 ? -27.640 16.333  -95.044  1.00 5.91  ? 413 ASP E OD2   1 
ATOM   9853  N  N     . TYR E 2 414 ? -24.825 20.239  -96.234  1.00 3.78  ? 414 TYR E N     1 
ATOM   9854  C  CA    . TYR E 2 414 ? -25.022 21.482  -96.887  1.00 5.78  ? 414 TYR E CA    1 
ATOM   9855  C  C     . TYR E 2 414 ? -26.391 21.723  -97.567  1.00 8.49  ? 414 TYR E C     1 
ATOM   9856  O  O     . TYR E 2 414 ? -26.717 22.887  -97.909  1.00 7.03  ? 414 TYR E O     1 
ATOM   9857  C  CB    . TYR E 2 414 ? -23.867 21.772  -97.824  1.00 5.50  ? 414 TYR E CB    1 
ATOM   9858  C  CG    . TYR E 2 414 ? -24.080 21.129  -99.104  1.00 8.86  ? 414 TYR E CG    1 
ATOM   9859  C  CD1   . TYR E 2 414 ? -24.706 21.806  -100.150 1.00 17.22 ? 414 TYR E CD1   1 
ATOM   9860  C  CD2   . TYR E 2 414 ? -23.760 19.777  -99.258  1.00 11.08 ? 414 TYR E CD2   1 
ATOM   9861  C  CE1   . TYR E 2 414 ? -24.922 21.156  -101.392 1.00 6.16  ? 414 TYR E CE1   1 
ATOM   9862  C  CE2   . TYR E 2 414 ? -23.974 19.114  -100.447 1.00 2.00  ? 414 TYR E CE2   1 
ATOM   9863  C  CZ    . TYR E 2 414 ? -24.532 19.808  -101.520 1.00 28.20 ? 414 TYR E CZ    1 
ATOM   9864  O  OH    . TYR E 2 414 ? -24.716 19.115  -102.691 1.00 2.00  ? 414 TYR E OH    1 
ATOM   9865  N  N     . LEU E 2 415 ? -27.192 20.665  -97.740  1.00 6.55  ? 415 LEU E N     1 
ATOM   9866  C  CA    . LEU E 2 415 ? -28.594 20.796  -98.245  1.00 6.76  ? 415 LEU E CA    1 
ATOM   9867  C  C     . LEU E 2 415 ? -29.535 21.020  -97.077  1.00 2.70  ? 415 LEU E C     1 
ATOM   9868  O  O     . LEU E 2 415 ? -30.580 21.647  -97.193  1.00 18.98 ? 415 LEU E O     1 
ATOM   9869  C  CB    . LEU E 2 415 ? -29.022 19.548  -99.064  1.00 2.00  ? 415 LEU E CB    1 
ATOM   9870  C  CG    . LEU E 2 415 ? -28.287 19.228  -100.381 1.00 7.26  ? 415 LEU E CG    1 
ATOM   9871  C  CD1   . LEU E 2 415 ? -28.695 17.866  -101.011 1.00 2.00  ? 415 LEU E CD1   1 
ATOM   9872  C  CD2   . LEU E 2 415 ? -28.592 20.425  -101.353 1.00 2.00  ? 415 LEU E CD2   1 
ATOM   9873  N  N     . THR E 2 416 ? -29.164 20.520  -95.926  1.00 10.69 ? 416 THR E N     1 
ATOM   9874  C  CA    . THR E 2 416 ? -30.142 20.238  -94.909  1.00 2.00  ? 416 THR E CA    1 
ATOM   9875  C  C     . THR E 2 416 ? -29.752 20.971  -93.642  1.00 10.54 ? 416 THR E C     1 
ATOM   9876  O  O     . THR E 2 416 ? -30.613 21.256  -92.841  1.00 2.00  ? 416 THR E O     1 
ATOM   9877  C  CB    . THR E 2 416 ? -30.007 18.770  -94.673  1.00 23.29 ? 416 THR E CB    1 
ATOM   9878  O  OG1   . THR E 2 416 ? -31.196 18.100  -95.119  1.00 2.06  ? 416 THR E OG1   1 
ATOM   9879  C  CG2   . THR E 2 416 ? -29.465 18.399  -93.266  1.00 2.00  ? 416 THR E CG2   1 
ATOM   9880  N  N     . LEU E 2 417 ? -28.436 21.232  -93.468  1.00 4.32  ? 417 LEU E N     1 
ATOM   9881  C  CA    . LEU E 2 417 ? -27.903 22.096  -92.407  1.00 5.52  ? 417 LEU E CA    1 
ATOM   9882  C  C     . LEU E 2 417 ? -27.992 21.328  -91.123  1.00 3.32  ? 417 LEU E C     1 
ATOM   9883  O  O     . LEU E 2 417 ? -27.685 21.828  -90.026  1.00 9.91  ? 417 LEU E O     1 
ATOM   9884  C  CB    . LEU E 2 417 ? -28.704 23.418  -92.286  1.00 2.00  ? 417 LEU E CB    1 
ATOM   9885  C  CG    . LEU E 2 417 ? -28.623 24.354  -93.530  1.00 2.43  ? 417 LEU E CG    1 
ATOM   9886  C  CD1   . LEU E 2 417 ? -29.340 25.715  -93.112  1.00 2.00  ? 417 LEU E CD1   1 
ATOM   9887  C  CD2   . LEU E 2 417 ? -27.210 24.623  -94.067  1.00 2.00  ? 417 LEU E CD2   1 
ATOM   9888  N  N     . GLU E 2 418 ? -28.422 20.091  -91.236  1.00 2.34  ? 418 GLU E N     1 
ATOM   9889  C  CA    . GLU E 2 418 ? -28.236 19.198  -90.095  1.00 15.00 ? 418 GLU E CA    1 
ATOM   9890  C  C     . GLU E 2 418 ? -26.850 18.615  -89.740  1.00 2.00  ? 418 GLU E C     1 
ATOM   9891  O  O     . GLU E 2 418 ? -25.938 18.676  -90.534  1.00 3.52  ? 418 GLU E O     1 
ATOM   9892  C  CB    . GLU E 2 418 ? -29.333 18.191  -90.030  1.00 9.30  ? 418 GLU E CB    1 
ATOM   9893  C  CG    . GLU E 2 418 ? -30.414 18.622  -89.076  1.00 29.26 ? 418 GLU E CG    1 
ATOM   9894  C  CD    . GLU E 2 418 ? -31.667 18.408  -89.776  1.00 49.52 ? 418 GLU E CD    1 
ATOM   9895  O  OE1   . GLU E 2 418 ? -32.634 19.217  -89.619  1.00 57.89 ? 418 GLU E OE1   1 
ATOM   9896  O  OE2   . GLU E 2 418 ? -31.602 17.431  -90.572  1.00 24.56 ? 418 GLU E OE2   1 
ATOM   9897  N  N     . PRO E 2 419 ? -26.668 18.155  -88.523  1.00 2.00  ? 419 PRO E N     1 
ATOM   9898  C  CA    . PRO E 2 419 ? -25.406 17.450  -88.253  1.00 2.00  ? 419 PRO E CA    1 
ATOM   9899  C  C     . PRO E 2 419 ? -25.418 16.206  -89.085  1.00 8.06  ? 419 PRO E C     1 
ATOM   9900  O  O     . PRO E 2 419 ? -26.479 15.695  -89.390  1.00 7.49  ? 419 PRO E O     1 
ATOM   9901  C  CB    . PRO E 2 419 ? -25.586 16.915  -86.821  1.00 2.19  ? 419 PRO E CB    1 
ATOM   9902  C  CG    . PRO E 2 419 ? -26.513 17.860  -86.171  1.00 2.00  ? 419 PRO E CG    1 
ATOM   9903  C  CD    . PRO E 2 419 ? -27.532 18.211  -87.335  1.00 2.00  ? 419 PRO E CD    1 
ATOM   9904  N  N     . LEU E 2 420 ? -24.233 15.679  -89.381  1.00 5.68  ? 420 LEU E N     1 
ATOM   9905  C  CA    . LEU E 2 420 ? -24.076 14.453  -90.129  1.00 3.80  ? 420 LEU E CA    1 
ATOM   9906  C  C     . LEU E 2 420 ? -24.243 13.152  -89.263  1.00 2.07  ? 420 LEU E C     1 
ATOM   9907  O  O     . LEU E 2 420 ? -23.824 12.055  -89.680  1.00 2.52  ? 420 LEU E O     1 
ATOM   9908  C  CB    . LEU E 2 420 ? -22.685 14.499  -90.727  1.00 2.00  ? 420 LEU E CB    1 
ATOM   9909  C  CG    . LEU E 2 420 ? -22.484 15.501  -91.853  1.00 3.04  ? 420 LEU E CG    1 
ATOM   9910  C  CD1   . LEU E 2 420 ? -21.007 15.325  -92.390  1.00 2.00  ? 420 LEU E CD1   1 
ATOM   9911  C  CD2   . LEU E 2 420 ? -23.558 15.213  -92.986  1.00 2.00  ? 420 LEU E CD2   1 
ATOM   9912  N  N     . ASP E 2 421 ? -24.852 13.293  -88.098  1.00 2.00  ? 421 ASP E N     1 
ATOM   9913  C  CA    . ASP E 2 421 ? -25.037 12.183  -87.190  1.00 2.77  ? 421 ASP E CA    1 
ATOM   9914  C  C     . ASP E 2 421 ? -25.659 10.962  -87.856  1.00 17.21 ? 421 ASP E C     1 
ATOM   9915  O  O     . ASP E 2 421 ? -25.164 9.859   -87.705  1.00 11.65 ? 421 ASP E O     1 
ATOM   9916  C  CB    . ASP E 2 421 ? -25.856 12.591  -85.973  1.00 2.00  ? 421 ASP E CB    1 
ATOM   9917  C  CG    . ASP E 2 421 ? -25.162 13.620  -85.113  1.00 3.86  ? 421 ASP E CG    1 
ATOM   9918  O  OD1   . ASP E 2 421 ? -23.974 13.894  -85.305  1.00 3.05  ? 421 ASP E OD1   1 
ATOM   9919  O  OD2   . ASP E 2 421 ? -25.742 14.216  -84.207  1.00 3.68  ? 421 ASP E OD2   1 
ATOM   9920  N  N     . ILE E 2 422 ? -26.751 11.147  -88.584  1.00 8.16  ? 422 ILE E N     1 
ATOM   9921  C  CA    . ILE E 2 422 ? -27.489 10.001  -89.073  1.00 3.54  ? 422 ILE E CA    1 
ATOM   9922  C  C     . ILE E 2 422 ? -26.725 9.368   -90.198  1.00 13.70 ? 422 ILE E C     1 
ATOM   9923  O  O     . ILE E 2 422 ? -26.790 8.166   -90.411  1.00 2.95  ? 422 ILE E O     1 
ATOM   9924  C  CB    . ILE E 2 422 ? -28.888 10.374  -89.548  1.00 4.21  ? 422 ILE E CB    1 
ATOM   9925  C  CG1   . ILE E 2 422 ? -28.878 11.695  -90.269  1.00 49.95 ? 422 ILE E CG1   1 
ATOM   9926  C  CG2   . ILE E 2 422 ? -29.868 10.380  -88.425  1.00 2.00  ? 422 ILE E CG2   1 
ATOM   9927  C  CD1   . ILE E 2 422 ? -30.072 11.868  -91.149  1.00 33.90 ? 422 ILE E CD1   1 
ATOM   9928  N  N     . GLY E 2 423 ? -25.992 10.202  -90.908  1.00 2.00  ? 423 GLY E N     1 
ATOM   9929  C  CA    . GLY E 2 423 ? -25.197 9.768   -92.023  1.00 2.00  ? 423 GLY E CA    1 
ATOM   9930  C  C     . GLY E 2 423 ? -24.085 8.826   -91.639  1.00 13.06 ? 423 GLY E C     1 
ATOM   9931  O  O     . GLY E 2 423 ? -23.811 7.884   -92.362  1.00 3.70  ? 423 GLY E O     1 
ATOM   9932  N  N     . PHE E 2 424 ? -23.432 9.075   -90.512  1.00 2.00  ? 424 PHE E N     1 
ATOM   9933  C  CA    . PHE E 2 424 ? -22.282 8.297   -90.210  1.00 4.28  ? 424 PHE E CA    1 
ATOM   9934  C  C     . PHE E 2 424 ? -22.952 7.263   -89.354  1.00 2.23  ? 424 PHE E C     1 
ATOM   9935  O  O     . PHE E 2 424 ? -22.612 6.109   -89.420  1.00 7.48  ? 424 PHE E O     1 
ATOM   9936  C  CB    . PHE E 2 424 ? -21.242 9.083   -89.394  1.00 5.64  ? 424 PHE E CB    1 
ATOM   9937  C  CG    . PHE E 2 424 ? -20.286 9.847   -90.229  1.00 2.00  ? 424 PHE E CG    1 
ATOM   9938  C  CD1   . PHE E 2 424 ? -20.382 11.255  -90.323  1.00 2.00  ? 424 PHE E CD1   1 
ATOM   9939  C  CD2   . PHE E 2 424 ? -19.290 9.189   -90.927  1.00 2.42  ? 424 PHE E CD2   1 
ATOM   9940  C  CE1   . PHE E 2 424 ? -19.510 12.002  -91.115  1.00 2.00  ? 424 PHE E CE1   1 
ATOM   9941  C  CE2   . PHE E 2 424 ? -18.369 9.879   -91.754  1.00 2.00  ? 424 PHE E CE2   1 
ATOM   9942  C  CZ    . PHE E 2 424 ? -18.474 11.289  -91.840  1.00 9.04  ? 424 PHE E CZ    1 
ATOM   9943  N  N     . GLY E 2 425 ? -23.958 7.625   -88.607  1.00 2.00  ? 425 GLY E N     1 
ATOM   9944  C  CA    . GLY E 2 425 ? -24.789 6.545   -88.010  1.00 2.00  ? 425 GLY E CA    1 
ATOM   9945  C  C     . GLY E 2 425 ? -25.074 5.406   -89.017  1.00 10.31 ? 425 GLY E C     1 
ATOM   9946  O  O     . GLY E 2 425 ? -25.069 4.229   -88.674  1.00 11.34 ? 425 GLY E O     1 
ATOM   9947  N  N     . ALA E 2 426 ? -25.307 5.731   -90.279  1.00 2.53  ? 426 ALA E N     1 
ATOM   9948  C  CA    . ALA E 2 426 ? -25.771 4.704   -91.171  1.00 8.26  ? 426 ALA E CA    1 
ATOM   9949  C  C     . ALA E 2 426 ? -24.495 3.849   -91.576  1.00 6.10  ? 426 ALA E C     1 
ATOM   9950  O  O     . ALA E 2 426 ? -24.538 2.646   -91.747  1.00 6.64  ? 426 ALA E O     1 
ATOM   9951  C  CB    . ALA E 2 426 ? -26.406 5.365   -92.409  1.00 2.00  ? 426 ALA E CB    1 
ATOM   9952  N  N     . ILE E 2 427 ? -23.370 4.504   -91.758  1.00 2.00  ? 427 ILE E N     1 
ATOM   9953  C  CA    . ILE E 2 427 ? -22.226 3.811   -92.125  1.00 2.00  ? 427 ILE E CA    1 
ATOM   9954  C  C     . ILE E 2 427 ? -21.920 2.721   -91.110  1.00 4.69  ? 427 ILE E C     1 
ATOM   9955  O  O     . ILE E 2 427 ? -21.516 1.626   -91.492  1.00 10.81 ? 427 ILE E O     1 
ATOM   9956  C  CB    . ILE E 2 427 ? -21.071 4.767   -92.429  1.00 4.77  ? 427 ILE E CB    1 
ATOM   9957  C  CG1   . ILE E 2 427 ? -21.023 5.027   -93.946  1.00 11.26 ? 427 ILE E CG1   1 
ATOM   9958  C  CG2   . ILE E 2 427 ? -19.690 4.171   -92.024  1.00 2.00  ? 427 ILE E CG2   1 
ATOM   9959  C  CD1   . ILE E 2 427 ? -20.981 6.385   -94.137  1.00 18.45 ? 427 ILE E CD1   1 
ATOM   9960  N  N     . VAL E 2 428 ? -22.156 2.970   -89.830  1.00 9.50  ? 428 VAL E N     1 
ATOM   9961  C  CA    . VAL E 2 428 ? -21.609 2.077   -88.785  1.00 10.35 ? 428 VAL E CA    1 
ATOM   9962  C  C     . VAL E 2 428 ? -22.751 1.039   -88.532  1.00 26.74 ? 428 VAL E C     1 
ATOM   9963  O  O     . VAL E 2 428 ? -22.513 -0.142  -88.129  1.00 4.61  ? 428 VAL E O     1 
ATOM   9964  C  CB    . VAL E 2 428 ? -21.299 2.930   -87.551  1.00 2.24  ? 428 VAL E CB    1 
ATOM   9965  C  CG1   . VAL E 2 428 ? -22.257 2.917   -86.508  1.00 2.00  ? 428 VAL E CG1   1 
ATOM   9966  C  CG2   . VAL E 2 428 ? -19.862 3.069   -87.203  1.00 2.26  ? 428 VAL E CG2   1 
ATOM   9967  N  N     . GLU E 2 429 ? -24.000 1.447   -88.809  1.00 17.00 ? 429 GLU E N     1 
ATOM   9968  C  CA    . GLU E 2 429 ? -25.106 0.480   -88.675  1.00 11.33 ? 429 GLU E CA    1 
ATOM   9969  C  C     . GLU E 2 429 ? -24.975 -0.545  -89.810  1.00 20.46 ? 429 GLU E C     1 
ATOM   9970  O  O     . GLU E 2 429 ? -25.128 -1.779  -89.578  1.00 8.35  ? 429 GLU E O     1 
ATOM   9971  C  CB    . GLU E 2 429 ? -26.486 1.134   -88.813  1.00 11.28 ? 429 GLU E CB    1 
ATOM   9972  C  CG    . GLU E 2 429 ? -27.646 0.132   -88.612  1.00 15.14 ? 429 GLU E CG    1 
ATOM   9973  C  CD    . GLU E 2 429 ? -29.046 0.795   -88.545  1.00 19.29 ? 429 GLU E CD    1 
ATOM   9974  O  OE1   . GLU E 2 429 ? -29.177 1.987   -88.864  1.00 12.32 ? 429 GLU E OE1   1 
ATOM   9975  O  OE2   . GLU E 2 429 ? -30.038 0.126   -88.150  1.00 39.51 ? 429 GLU E OE2   1 
ATOM   9976  N  N     . HIS E 2 430 ? -24.696 -0.059  -91.020  1.00 2.00  ? 430 HIS E N     1 
ATOM   9977  C  CA    . HIS E 2 430 ? -24.774 -0.948  -92.167  1.00 4.75  ? 430 HIS E CA    1 
ATOM   9978  C  C     . HIS E 2 430 ? -23.468 -1.761  -92.414  1.00 12.85 ? 430 HIS E C     1 
ATOM   9979  O  O     . HIS E 2 430 ? -23.571 -2.844  -92.933  1.00 16.29 ? 430 HIS E O     1 
ATOM   9980  C  CB    . HIS E 2 430 ? -25.324 -0.277  -93.474  1.00 2.00  ? 430 HIS E CB    1 
ATOM   9981  C  CG    . HIS E 2 430 ? -26.795 0.058   -93.411  1.00 20.48 ? 430 HIS E CG    1 
ATOM   9982  N  ND1   . HIS E 2 430 ? -27.757 -0.666  -94.080  1.00 16.46 ? 430 HIS E ND1   1 
ATOM   9983  C  CD2   . HIS E 2 430 ? -27.469 1.044   -92.751  1.00 5.43  ? 430 HIS E CD2   1 
ATOM   9984  C  CE1   . HIS E 2 430 ? -28.960 -0.187  -93.784  1.00 12.27 ? 430 HIS E CE1   1 
ATOM   9985  N  NE2   . HIS E 2 430 ? -28.810 0.836   -92.961  1.00 15.82 ? 430 HIS E NE2   1 
ATOM   9986  N  N     . CYS E 2 431 ? -22.270 -1.266  -92.058  1.00 4.24  ? 431 CYS E N     1 
ATOM   9987  C  CA    . CYS E 2 431 ? -21.030 -1.957  -92.413  1.00 2.00  ? 431 CYS E CA    1 
ATOM   9988  C  C     . CYS E 2 431 ? -20.527 -2.667  -91.196  1.00 3.57  ? 431 CYS E C     1 
ATOM   9989  O  O     . CYS E 2 431 ? -19.715 -2.119  -90.457  1.00 2.00  ? 431 CYS E O     1 
ATOM   9990  C  CB    . CYS E 2 431 ? -20.030 -0.929  -92.751  1.00 2.00  ? 431 CYS E CB    1 
ATOM   9991  S  SG    . CYS E 2 431 ? -20.692 0.202   -94.015  1.00 5.96  ? 431 CYS E SG    1 
ATOM   9992  N  N     . LYS E 2 432 ? -21.043 -3.850  -90.958  1.00 2.00  ? 432 LYS E N     1 
ATOM   9993  C  CA    . LYS E 2 432 ? -20.958 -4.528  -89.675  1.00 2.00  ? 432 LYS E CA    1 
ATOM   9994  C  C     . LYS E 2 432 ? -19.537 -4.929  -89.460  1.00 7.67  ? 432 LYS E C     1 
ATOM   9995  O  O     . LYS E 2 432 ? -19.103 -5.105  -88.254  1.00 2.00  ? 432 LYS E O     1 
ATOM   9996  C  CB    . LYS E 2 432 ? -21.717 -5.871  -89.689  1.00 2.00  ? 432 LYS E CB    1 
ATOM   9997  C  CG    . LYS E 2 432 ? -23.084 -5.811  -90.243  1.00 25.70 ? 432 LYS E CG    1 
ATOM   9998  C  CD    . LYS E 2 432 ? -24.074 -5.113  -89.307  1.00 23.20 ? 432 LYS E CD    1 
ATOM   9999  C  CE    . LYS E 2 432 ? -25.477 -5.030  -89.987  1.00 70.42 ? 432 LYS E CE    1 
ATOM   10000 N  NZ    . LYS E 2 432 ? -26.292 -6.333  -90.104  1.00 63.23 ? 432 LYS E NZ    1 
ATOM   10001 N  N     . ASP E 2 433 ? -18.820 -5.075  -90.578  1.00 2.00  ? 433 ASP E N     1 
ATOM   10002 C  CA    . ASP E 2 433 ? -17.414 -5.344  -90.457  1.00 3.60  ? 433 ASP E CA    1 
ATOM   10003 C  C     . ASP E 2 433 ? -16.497 -4.111  -90.532  1.00 2.69  ? 433 ASP E C     1 
ATOM   10004 O  O     . ASP E 2 433 ? -15.290 -4.217  -90.827  1.00 3.17  ? 433 ASP E O     1 
ATOM   10005 C  CB    . ASP E 2 433 ? -16.946 -6.471  -91.427  1.00 5.96  ? 433 ASP E CB    1 
ATOM   10006 C  CG    . ASP E 2 433 ? -17.728 -7.843  -91.218  1.00 11.44 ? 433 ASP E CG    1 
ATOM   10007 O  OD1   . ASP E 2 433 ? -17.955 -8.491  -92.241  1.00 11.08 ? 433 ASP E OD1   1 
ATOM   10008 O  OD2   . ASP E 2 433 ? -18.154 -8.266  -90.097  1.00 2.98  ? 433 ASP E OD2   1 
ATOM   10009 N  N     . LEU E 2 434 ? -17.021 -2.932  -90.288  1.00 2.00  ? 434 LEU E N     1 
ATOM   10010 C  CA    . LEU E 2 434 ? -16.102 -1.788  -90.339  1.00 6.74  ? 434 LEU E CA    1 
ATOM   10011 C  C     . LEU E 2 434 ? -15.042 -1.911  -89.235  1.00 2.00  ? 434 LEU E C     1 
ATOM   10012 O  O     . LEU E 2 434 ? -15.356 -1.931  -88.026  1.00 2.00  ? 434 LEU E O     1 
ATOM   10013 C  CB    . LEU E 2 434 ? -16.858 -0.463  -90.181  1.00 2.00  ? 434 LEU E CB    1 
ATOM   10014 C  CG    . LEU E 2 434 ? -16.144 0.807   -90.466  1.00 2.00  ? 434 LEU E CG    1 
ATOM   10015 C  CD1   . LEU E 2 434 ? -15.667 1.008   -91.899  1.00 2.00  ? 434 LEU E CD1   1 
ATOM   10016 C  CD2   . LEU E 2 434 ? -17.099 1.919   -90.076  1.00 4.59  ? 434 LEU E CD2   1 
ATOM   10017 N  N     . ARG E 2 435 ? -13.775 -1.909  -89.621  1.00 2.45  ? 435 ARG E N     1 
ATOM   10018 C  CA    . ARG E 2 435 ? -12.776 -1.973  -88.539  1.00 9.40  ? 435 ARG E CA    1 
ATOM   10019 C  C     . ARG E 2 435 ? -12.040 -0.593  -88.283  1.00 7.77  ? 435 ARG E C     1 
ATOM   10020 O  O     . ARG E 2 435 ? -11.382 -0.370  -87.268  1.00 6.31  ? 435 ARG E O     1 
ATOM   10021 C  CB    . ARG E 2 435 ? -11.886 -3.216  -88.824  1.00 2.00  ? 435 ARG E CB    1 
ATOM   10022 C  CG    . ARG E 2 435 ? -10.987 -2.966  -89.879  1.00 2.84  ? 435 ARG E CG    1 
ATOM   10023 C  CD    . ARG E 2 435 ? -9.881  -4.086  -89.904  1.00 20.45 ? 435 ARG E CD    1 
ATOM   10024 N  NE    . ARG E 2 435 ? -10.274 -4.979  -90.975  1.00 7.04  ? 435 ARG E NE    1 
ATOM   10025 C  CZ    . ARG E 2 435 ? -9.722  -5.014  -92.165  1.00 20.76 ? 435 ARG E CZ    1 
ATOM   10026 N  NH1   . ARG E 2 435 ? -8.590  -4.310  -92.491  1.00 12.94 ? 435 ARG E NH1   1 
ATOM   10027 N  NH2   . ARG E 2 435 ? -10.352 -5.782  -93.020  1.00 2.69  ? 435 ARG E NH2   1 
ATOM   10028 N  N     . ARG E 2 436 ? -12.176 0.327   -89.246  1.00 9.22  ? 436 ARG E N     1 
ATOM   10029 C  CA    . ARG E 2 436 ? -11.622 1.680   -89.200  1.00 4.26  ? 436 ARG E CA    1 
ATOM   10030 C  C     . ARG E 2 436 ? -12.524 2.793   -89.671  1.00 3.32  ? 436 ARG E C     1 
ATOM   10031 O  O     . ARG E 2 436 ? -13.060 2.712   -90.784  1.00 2.11  ? 436 ARG E O     1 
ATOM   10032 C  CB    . ARG E 2 436 ? -10.365 1.839   -90.022  1.00 3.90  ? 436 ARG E CB    1 
ATOM   10033 C  CG    . ARG E 2 436 ? -9.620  3.131   -89.553  1.00 2.00  ? 436 ARG E CG    1 
ATOM   10034 C  CD    . ARG E 2 436 ? -8.286  3.258   -90.167  1.00 2.00  ? 436 ARG E CD    1 
ATOM   10035 N  NE    . ARG E 2 436 ? -7.612  4.520   -89.887  1.00 2.26  ? 436 ARG E NE    1 
ATOM   10036 C  CZ    . ARG E 2 436 ? -6.345  4.723   -90.246  1.00 4.43  ? 436 ARG E CZ    1 
ATOM   10037 N  NH1   . ARG E 2 436 ? -5.685  3.762   -90.887  1.00 2.00  ? 436 ARG E NH1   1 
ATOM   10038 N  NH2   . ARG E 2 436 ? -5.747  5.896   -90.011  1.00 2.01  ? 436 ARG E NH2   1 
ATOM   10039 N  N     . LEU E 2 437 ? -12.631 3.818   -88.841  1.00 2.00  ? 437 LEU E N     1 
ATOM   10040 C  CA    . LEU E 2 437 ? -13.496 4.982   -89.065  1.00 10.05 ? 437 LEU E CA    1 
ATOM   10041 C  C     . LEU E 2 437 ? -12.696 6.295   -88.676  1.00 15.85 ? 437 LEU E C     1 
ATOM   10042 O  O     . LEU E 2 437 ? -12.141 6.447   -87.532  1.00 2.00  ? 437 LEU E O     1 
ATOM   10043 C  CB    . LEU E 2 437 ? -14.805 4.828   -88.251  1.00 5.32  ? 437 LEU E CB    1 
ATOM   10044 C  CG    . LEU E 2 437 ? -15.852 5.962   -88.475  1.00 6.12  ? 437 LEU E CG    1 
ATOM   10045 C  CD1   . LEU E 2 437 ? -16.299 6.181   -89.803  1.00 2.00  ? 437 LEU E CD1   1 
ATOM   10046 C  CD2   . LEU E 2 437 ? -17.052 6.021   -87.548  1.00 2.00  ? 437 LEU E CD2   1 
ATOM   10047 N  N     . SER E 2 438 ? -12.600 7.213   -89.652  1.00 5.76  ? 438 SER E N     1 
ATOM   10048 C  CA    . SER E 2 438 ? -12.309 8.680   -89.376  1.00 4.12  ? 438 SER E CA    1 
ATOM   10049 C  C     . SER E 2 438 ? -13.522 9.427   -89.880  1.00 5.40  ? 438 SER E C     1 
ATOM   10050 O  O     . SER E 2 438 ? -13.937 9.166   -91.053  1.00 9.25  ? 438 SER E O     1 
ATOM   10051 C  CB    . SER E 2 438 ? -11.005 9.086   -90.017  1.00 2.00  ? 438 SER E CB    1 
ATOM   10052 O  OG    . SER E 2 438 ? -11.035 9.323   -91.420  1.00 5.77  ? 438 SER E OG    1 
ATOM   10053 N  N     . LEU E 2 439 ? -14.220 10.169  -88.989  1.00 6.18  ? 439 LEU E N     1 
ATOM   10054 C  CA    . LEU E 2 439 ? -15.287 11.130  -89.389  1.00 5.53  ? 439 LEU E CA    1 
ATOM   10055 C  C     . LEU E 2 439 ? -15.020 12.585  -88.990  1.00 19.34 ? 439 LEU E C     1 
ATOM   10056 O  O     . LEU E 2 439 ? -13.949 12.890  -88.404  1.00 9.33  ? 439 LEU E O     1 
ATOM   10057 C  CB    . LEU E 2 439 ? -16.657 10.726  -88.923  1.00 7.32  ? 439 LEU E CB    1 
ATOM   10058 C  CG    . LEU E 2 439 ? -16.868 10.122  -87.540  1.00 9.90  ? 439 LEU E CG    1 
ATOM   10059 C  CD1   . LEU E 2 439 ? -15.969 10.673  -86.580  1.00 6.11  ? 439 LEU E CD1   1 
ATOM   10060 C  CD2   . LEU E 2 439 ? -18.315 10.258  -87.089  1.00 4.05  ? 439 LEU E CD2   1 
ATOM   10061 N  N     . SER E 2 440 ? -15.982 13.475  -89.313  1.00 7.09  ? 440 SER E N     1 
ATOM   10062 C  CA    . SER E 2 440 ? -15.705 14.816  -89.911  1.00 2.30  ? 440 SER E CA    1 
ATOM   10063 C  C     . SER E 2 440 ? -17.065 15.542  -90.031  1.00 6.22  ? 440 SER E C     1 
ATOM   10064 O  O     . SER E 2 440 ? -18.086 14.870  -90.134  1.00 2.11  ? 440 SER E O     1 
ATOM   10065 C  CB    . SER E 2 440 ? -15.295 14.575  -91.324  1.00 14.41 ? 440 SER E CB    1 
ATOM   10066 O  OG    . SER E 2 440 ? -14.285 15.401  -91.465  1.00 10.95 ? 440 SER E OG    1 
ATOM   10067 N  N     . GLY E 2 441 ? -17.088 16.882  -90.091  1.00 6.26  ? 441 GLY E N     1 
ATOM   10068 C  CA    . GLY E 2 441 ? -18.366 17.656  -90.153  1.00 2.00  ? 441 GLY E CA    1 
ATOM   10069 C  C     . GLY E 2 441 ? -19.115 17.907  -88.845  1.00 4.16  ? 441 GLY E C     1 
ATOM   10070 O  O     . GLY E 2 441 ? -18.712 17.461  -87.763  1.00 3.91  ? 441 GLY E O     1 
ATOM   10071 N  N     . LEU E 2 442 ? -20.221 18.623  -88.905  1.00 3.55  ? 442 LEU E N     1 
ATOM   10072 C  CA    . LEU E 2 442 ? -20.912 18.926  -87.673  1.00 2.00  ? 442 LEU E CA    1 
ATOM   10073 C  C     . LEU E 2 442 ? -21.343 17.574  -87.004  1.00 11.08 ? 442 LEU E C     1 
ATOM   10074 O  O     . LEU E 2 442 ? -22.001 16.705  -87.646  1.00 3.70  ? 442 LEU E O     1 
ATOM   10075 C  CB    . LEU E 2 442 ? -22.096 19.780  -88.027  1.00 2.00  ? 442 LEU E CB    1 
ATOM   10076 C  CG    . LEU E 2 442 ? -22.918 20.125  -86.813  1.00 5.55  ? 442 LEU E CG    1 
ATOM   10077 C  CD1   . LEU E 2 442 ? -22.044 20.918  -85.786  1.00 2.00  ? 442 LEU E CD1   1 
ATOM   10078 C  CD2   . LEU E 2 442 ? -24.068 21.026  -87.322  1.00 2.00  ? 442 LEU E CD2   1 
ATOM   10079 N  N     . LEU E 2 443 ? -21.026 17.351  -85.720  1.00 9.02  ? 443 LEU E N     1 
ATOM   10080 C  CA    . LEU E 2 443 ? -21.439 16.079  -85.157  1.00 2.00  ? 443 LEU E CA    1 
ATOM   10081 C  C     . LEU E 2 443 ? -21.705 16.210  -83.713  1.00 3.72  ? 443 LEU E C     1 
ATOM   10082 O  O     . LEU E 2 443 ? -20.883 16.784  -83.007  1.00 4.49  ? 443 LEU E O     1 
ATOM   10083 C  CB    . LEU E 2 443 ? -20.392 15.013  -85.387  1.00 2.00  ? 443 LEU E CB    1 
ATOM   10084 C  CG    . LEU E 2 443 ? -19.915 14.592  -86.768  1.00 2.00  ? 443 LEU E CG    1 
ATOM   10085 C  CD1   . LEU E 2 443 ? -18.491 14.048  -86.693  1.00 2.00  ? 443 LEU E CD1   1 
ATOM   10086 C  CD2   . LEU E 2 443 ? -20.841 13.592  -87.371  1.00 2.00  ? 443 LEU E CD2   1 
ATOM   10087 N  N     . THR E 2 444 ? -22.849 15.672  -83.258  1.00 5.48  ? 444 THR E N     1 
ATOM   10088 C  CA    . THR E 2 444 ? -23.259 15.817  -81.871  1.00 3.13  ? 444 THR E CA    1 
ATOM   10089 C  C     . THR E 2 444 ? -23.090 14.497  -81.091  1.00 6.46  ? 444 THR E C     1 
ATOM   10090 O  O     . THR E 2 444 ? -22.718 13.464  -81.658  1.00 9.07  ? 444 THR E O     1 
ATOM   10091 C  CB    . THR E 2 444 ? -24.724 16.312  -81.778  1.00 11.94 ? 444 THR E CB    1 
ATOM   10092 O  OG1   . THR E 2 444 ? -25.605 15.201  -81.928  1.00 2.00  ? 444 THR E OG1   1 
ATOM   10093 C  CG2   . THR E 2 444 ? -25.076 17.351  -82.895  1.00 2.06  ? 444 THR E CG2   1 
ATOM   10094 N  N     . ASP E 2 445 ? -23.312 14.526  -79.778  1.00 10.85 ? 445 ASP E N     1 
ATOM   10095 C  CA    . ASP E 2 445 ? -23.147 13.331  -78.991  1.00 7.04  ? 445 ASP E CA    1 
ATOM   10096 C  C     . ASP E 2 445 ? -23.868 12.185  -79.741  1.00 9.74  ? 445 ASP E C     1 
ATOM   10097 O  O     . ASP E 2 445 ? -23.428 11.050  -79.722  1.00 9.97  ? 445 ASP E O     1 
ATOM   10098 C  CB    . ASP E 2 445 ? -23.721 13.536  -77.612  1.00 6.95  ? 445 ASP E CB    1 
ATOM   10099 C  CG    . ASP E 2 445 ? -22.768 14.306  -76.672  1.00 10.27 ? 445 ASP E CG    1 
ATOM   10100 O  OD1   . ASP E 2 445 ? -23.171 14.616  -75.519  1.00 2.00  ? 445 ASP E OD1   1 
ATOM   10101 O  OD2   . ASP E 2 445 ? -21.645 14.616  -77.103  1.00 2.00  ? 445 ASP E OD2   1 
ATOM   10102 N  N     . LYS E 2 446 ? -24.912 12.462  -80.494  1.00 9.83  ? 446 LYS E N     1 
ATOM   10103 C  CA    . LYS E 2 446 ? -25.601 11.354  -81.153  1.00 6.20  ? 446 LYS E CA    1 
ATOM   10104 C  C     . LYS E 2 446 ? -24.720 10.399  -81.972  1.00 7.24  ? 446 LYS E C     1 
ATOM   10105 O  O     . LYS E 2 446 ? -24.853 9.151   -81.916  1.00 4.38  ? 446 LYS E O     1 
ATOM   10106 C  CB    . LYS E 2 446 ? -26.692 11.885  -82.097  1.00 16.08 ? 446 LYS E CB    1 
ATOM   10107 C  CG    . LYS E 2 446 ? -27.858 10.883  -82.342  1.00 3.69  ? 446 LYS E CG    1 
ATOM   10108 C  CD    . LYS E 2 446 ? -28.615 10.874  -80.976  1.00 6.76  ? 446 LYS E CD    1 
ATOM   10109 C  CE    . LYS E 2 446 ? -29.591 9.740   -80.867  1.00 16.32 ? 446 LYS E CE    1 
ATOM   10110 N  NZ    . LYS E 2 446 ? -30.101 9.662   -79.464  1.00 7.68  ? 446 LYS E NZ    1 
ATOM   10111 N  N     . VAL E 2 447 ? -23.875 10.950  -82.826  1.00 5.84  ? 447 VAL E N     1 
ATOM   10112 C  CA    . VAL E 2 447 ? -23.075 10.058  -83.646  1.00 8.61  ? 447 VAL E CA    1 
ATOM   10113 C  C     . VAL E 2 447 ? -22.316 9.018   -82.835  1.00 4.45  ? 447 VAL E C     1 
ATOM   10114 O  O     . VAL E 2 447 ? -22.117 7.854   -83.266  1.00 20.10 ? 447 VAL E O     1 
ATOM   10115 C  CB    . VAL E 2 447 ? -22.153 10.803  -84.581  1.00 5.54  ? 447 VAL E CB    1 
ATOM   10116 C  CG1   . VAL E 2 447 ? -20.997 11.539  -83.951  1.00 5.81  ? 447 VAL E CG1   1 
ATOM   10117 C  CG2   . VAL E 2 447 ? -21.899 10.068  -85.804  1.00 3.23  ? 447 VAL E CG2   1 
ATOM   10118 N  N     . PHE E 2 448 ? -21.940 9.442   -81.644  1.00 5.46  ? 448 PHE E N     1 
ATOM   10119 C  CA    . PHE E 2 448 ? -21.032 8.700   -80.812  1.00 2.39  ? 448 PHE E CA    1 
ATOM   10120 C  C     . PHE E 2 448 ? -21.922 7.605   -80.230  1.00 2.73  ? 448 PHE E C     1 
ATOM   10121 O  O     . PHE E 2 448 ? -21.527 6.455   -80.100  1.00 5.07  ? 448 PHE E O     1 
ATOM   10122 C  CB    . PHE E 2 448 ? -20.390 9.640   -79.749  1.00 2.00  ? 448 PHE E CB    1 
ATOM   10123 C  CG    . PHE E 2 448 ? -19.333 10.530  -80.340  1.00 2.00  ? 448 PHE E CG    1 
ATOM   10124 C  CD1   . PHE E 2 448 ? -19.600 11.874  -80.632  1.00 5.08  ? 448 PHE E CD1   1 
ATOM   10125 C  CD2   . PHE E 2 448 ? -18.116 9.991   -80.732  1.00 2.93  ? 448 PHE E CD2   1 
ATOM   10126 C  CE1   . PHE E 2 448 ? -18.583 12.718  -81.279  1.00 6.49  ? 448 PHE E CE1   1 
ATOM   10127 C  CE2   . PHE E 2 448 ? -17.113 10.742  -81.380  1.00 6.24  ? 448 PHE E CE2   1 
ATOM   10128 C  CZ    . PHE E 2 448 ? -17.332 12.117  -81.686  1.00 3.32  ? 448 PHE E CZ    1 
ATOM   10129 N  N     . GLU E 2 449 ? -23.152 7.957   -79.905  1.00 2.13  ? 449 GLU E N     1 
ATOM   10130 C  CA    . GLU E 2 449 ? -24.094 6.988   -79.467  1.00 2.00  ? 449 GLU E CA    1 
ATOM   10131 C  C     . GLU E 2 449 ? -24.260 5.822   -80.457  1.00 7.62  ? 449 GLU E C     1 
ATOM   10132 O  O     . GLU E 2 449 ? -24.379 4.655   -80.003  1.00 5.92  ? 449 GLU E O     1 
ATOM   10133 C  CB    . GLU E 2 449 ? -25.402 7.616   -79.244  1.00 2.00  ? 449 GLU E CB    1 
ATOM   10134 C  CG    . GLU E 2 449 ? -26.263 6.710   -78.515  1.00 2.00  ? 449 GLU E CG    1 
ATOM   10135 C  CD    . GLU E 2 449 ? -27.670 7.279   -78.369  1.00 5.53  ? 449 GLU E CD    1 
ATOM   10136 O  OE1   . GLU E 2 449 ? -27.831 8.468   -78.014  1.00 9.41  ? 449 GLU E OE1   1 
ATOM   10137 O  OE2   . GLU E 2 449 ? -28.627 6.544   -78.598  1.00 17.69 ? 449 GLU E OE2   1 
ATOM   10138 N  N     . TYR E 2 450 ? -24.302 6.144   -81.751  1.00 2.00  ? 450 TYR E N     1 
ATOM   10139 C  CA    . TYR E 2 450 ? -24.473 5.145   -82.776  1.00 7.44  ? 450 TYR E CA    1 
ATOM   10140 C  C     . TYR E 2 450 ? -23.175 4.437   -82.861  1.00 6.54  ? 450 TYR E C     1 
ATOM   10141 O  O     . TYR E 2 450 ? -23.157 3.262   -83.046  1.00 7.18  ? 450 TYR E O     1 
ATOM   10142 C  CB    . TYR E 2 450 ? -24.684 5.757   -84.187  1.00 8.97  ? 450 TYR E CB    1 
ATOM   10143 C  CG    . TYR E 2 450 ? -25.902 6.606   -84.337  1.00 2.00  ? 450 TYR E CG    1 
ATOM   10144 C  CD1   . TYR E 2 450 ? -25.905 7.691   -85.173  1.00 10.51 ? 450 TYR E CD1   1 
ATOM   10145 C  CD2   . TYR E 2 450 ? -27.027 6.374   -83.582  1.00 8.09  ? 450 TYR E CD2   1 
ATOM   10146 C  CE1   . TYR E 2 450 ? -27.051 8.525   -85.296  1.00 2.00  ? 450 TYR E CE1   1 
ATOM   10147 C  CE2   . TYR E 2 450 ? -28.223 7.193   -83.699  1.00 8.77  ? 450 TYR E CE2   1 
ATOM   10148 C  CZ    . TYR E 2 450 ? -28.203 8.274   -84.576  1.00 28.12 ? 450 TYR E CZ    1 
ATOM   10149 O  OH    . TYR E 2 450 ? -29.310 9.115   -84.783  1.00 7.13  ? 450 TYR E OH    1 
ATOM   10150 N  N     . ILE E 2 451 ? -22.069 5.143   -82.888  1.00 5.88  ? 451 ILE E N     1 
ATOM   10151 C  CA    . ILE E 2 451 ? -20.830 4.403   -82.962  1.00 2.42  ? 451 ILE E CA    1 
ATOM   10152 C  C     . ILE E 2 451 ? -20.809 3.357   -81.840  1.00 6.40  ? 451 ILE E C     1 
ATOM   10153 O  O     . ILE E 2 451 ? -20.489 2.206   -82.042  1.00 6.72  ? 451 ILE E O     1 
ATOM   10154 C  CB    . ILE E 2 451 ? -19.637 5.357   -82.914  1.00 4.70  ? 451 ILE E CB    1 
ATOM   10155 C  CG1   . ILE E 2 451 ? -19.569 6.058   -84.265  1.00 2.00  ? 451 ILE E CG1   1 
ATOM   10156 C  CG2   . ILE E 2 451 ? -18.297 4.594   -82.725  1.00 2.00  ? 451 ILE E CG2   1 
ATOM   10157 C  CD1   . ILE E 2 451 ? -18.869 7.388   -84.319  1.00 2.00  ? 451 ILE E CD1   1 
ATOM   10158 N  N     . GLY E 2 452 ? -21.296 3.723   -80.674  1.00 10.17 ? 452 GLY E N     1 
ATOM   10159 C  CA    . GLY E 2 452 ? -21.187 2.847   -79.513  1.00 5.93  ? 452 GLY E CA    1 
ATOM   10160 C  C     . GLY E 2 452 ? -22.087 1.616   -79.611  1.00 12.33 ? 452 GLY E C     1 
ATOM   10161 O  O     . GLY E 2 452 ? -21.727 0.515   -79.121  1.00 7.12  ? 452 GLY E O     1 
ATOM   10162 N  N     . THR E 2 453 ? -23.297 1.819   -80.142  1.00 8.27  ? 453 THR E N     1 
ATOM   10163 C  CA    . THR E 2 453 ? -24.183 0.707   -80.372  1.00 8.81  ? 453 THR E CA    1 
ATOM   10164 C  C     . THR E 2 453 ? -23.988 -0.103  -81.661  1.00 2.03  ? 453 THR E C     1 
ATOM   10165 O  O     . THR E 2 453 ? -24.299 -1.224  -81.666  1.00 13.14 ? 453 THR E O     1 
ATOM   10166 C  CB    . THR E 2 453 ? -25.673 0.940   -80.077  1.00 22.15 ? 453 THR E CB    1 
ATOM   10167 O  OG1   . THR E 2 453 ? -26.442 0.679   -81.283  1.00 12.84 ? 453 THR E OG1   1 
ATOM   10168 C  CG2   . THR E 2 453 ? -25.940 2.305   -79.484  1.00 2.00  ? 453 THR E CG2   1 
ATOM   10169 N  N     . TYR E 2 454 ? -23.372 0.392   -82.687  1.00 2.00  ? 454 TYR E N     1 
ATOM   10170 C  CA    . TYR E 2 454 ? -23.288 -0.373  -83.876  1.00 2.00  ? 454 TYR E CA    1 
ATOM   10171 C  C     . TYR E 2 454 ? -21.907 -0.701  -84.312  1.00 7.48  ? 454 TYR E C     1 
ATOM   10172 O  O     . TYR E 2 454 ? -21.771 -1.585  -85.178  1.00 4.82  ? 454 TYR E O     1 
ATOM   10173 C  CB    . TYR E 2 454 ? -23.903 0.347   -85.061  1.00 2.00  ? 454 TYR E CB    1 
ATOM   10174 C  CG    . TYR E 2 454 ? -25.366 0.488   -84.902  1.00 10.77 ? 454 TYR E CG    1 
ATOM   10175 C  CD1   . TYR E 2 454 ? -25.928 1.730   -84.611  1.00 2.00  ? 454 TYR E CD1   1 
ATOM   10176 C  CD2   . TYR E 2 454 ? -26.229 -0.612  -85.074  1.00 31.50 ? 454 TYR E CD2   1 
ATOM   10177 C  CE1   . TYR E 2 454 ? -27.259 1.889   -84.457  1.00 2.00  ? 454 TYR E CE1   1 
ATOM   10178 C  CE2   . TYR E 2 454 ? -27.631 -0.443  -84.984  1.00 11.51 ? 454 TYR E CE2   1 
ATOM   10179 C  CZ    . TYR E 2 454 ? -28.108 0.807   -84.630  1.00 21.99 ? 454 TYR E CZ    1 
ATOM   10180 O  OH    . TYR E 2 454 ? -29.426 1.029   -84.462  1.00 18.94 ? 454 TYR E OH    1 
ATOM   10181 N  N     . ALA E 2 455 ? -20.865 0.036   -83.876  1.00 4.26  ? 455 ALA E N     1 
ATOM   10182 C  CA    . ALA E 2 455 ? -19.536 -0.269  -84.477  1.00 10.97 ? 455 ALA E CA    1 
ATOM   10183 C  C     . ALA E 2 455 ? -18.738 -1.300  -83.619  1.00 13.01 ? 455 ALA E C     1 
ATOM   10184 O  O     . ALA E 2 455 ? -17.663 -0.992  -83.084  1.00 8.48  ? 455 ALA E O     1 
ATOM   10185 C  CB    . ALA E 2 455 ? -18.746 1.023   -84.735  1.00 7.99  ? 455 ALA E CB    1 
ATOM   10186 N  N     . LYS E 2 456 ? -19.308 -2.499  -83.457  1.00 9.12  ? 456 LYS E N     1 
ATOM   10187 C  CA    . LYS E 2 456 ? -18.701 -3.615  -82.645  1.00 5.76  ? 456 LYS E CA    1 
ATOM   10188 C  C     . LYS E 2 456 ? -17.390 -4.157  -83.195  1.00 2.00  ? 456 LYS E C     1 
ATOM   10189 O  O     . LYS E 2 456 ? -16.715 -4.858  -82.531  1.00 4.28  ? 456 LYS E O     1 
ATOM   10190 C  CB    . LYS E 2 456 ? -19.687 -4.752  -82.394  1.00 2.00  ? 456 LYS E CB    1 
ATOM   10191 C  CG    . LYS E 2 456 ? -20.702 -4.589  -81.247  1.00 2.00  ? 456 LYS E CG    1 
ATOM   10192 C  CD    . LYS E 2 456 ? -21.021 -3.253  -80.689  1.00 12.47 ? 456 LYS E CD    1 
ATOM   10193 C  CE    . LYS E 2 456 ? -22.002 -3.372  -79.539  1.00 2.85  ? 456 LYS E CE    1 
ATOM   10194 N  NZ    . LYS E 2 456 ? -21.799 -2.350  -78.430  1.00 3.90  ? 456 LYS E NZ    1 
ATOM   10195 N  N     . LYS E 2 457 ? -16.970 -3.781  -84.366  1.00 2.00  ? 457 LYS E N     1 
ATOM   10196 C  CA    . LYS E 2 457 ? -15.945 -4.561  -84.949  1.00 2.00  ? 457 LYS E CA    1 
ATOM   10197 C  C     . LYS E 2 457 ? -14.891 -3.586  -85.117  1.00 2.42  ? 457 LYS E C     1 
ATOM   10198 O  O     . LYS E 2 457 ? -13.823 -3.834  -85.727  1.00 2.00  ? 457 LYS E O     1 
ATOM   10199 C  CB    . LYS E 2 457 ? -16.357 -5.050  -86.360  1.00 5.56  ? 457 LYS E CB    1 
ATOM   10200 C  CG    . LYS E 2 457 ? -16.820 -6.484  -86.394  1.00 11.07 ? 457 LYS E CG    1 
ATOM   10201 C  CD    . LYS E 2 457 ? -16.702 -7.155  -85.036  1.00 18.82 ? 457 LYS E CD    1 
ATOM   10202 C  CE    . LYS E 2 457 ? -17.386 -8.560  -85.057  1.00 8.68  ? 457 LYS E CE    1 
ATOM   10203 N  NZ    . LYS E 2 457 ? -17.183 -8.971  -86.490  1.00 19.29 ? 457 LYS E NZ    1 
ATOM   10204 N  N     . MET E 2 458 ? -15.238 -2.379  -84.690  1.00 12.17 ? 458 MET E N     1 
ATOM   10205 C  CA    . MET E 2 458 ? -14.362 -1.279  -85.022  1.00 5.65  ? 458 MET E CA    1 
ATOM   10206 C  C     . MET E 2 458 ? -13.068 -1.160  -84.136  1.00 8.30  ? 458 MET E C     1 
ATOM   10207 O  O     . MET E 2 458 ? -13.125 -1.150  -82.871  1.00 2.00  ? 458 MET E O     1 
ATOM   10208 C  CB    . MET E 2 458 ? -15.123 0.024   -84.996  1.00 6.53  ? 458 MET E CB    1 
ATOM   10209 C  CG    . MET E 2 458 ? -14.263 1.059   -85.703  1.00 18.29 ? 458 MET E CG    1 
ATOM   10210 S  SD    . MET E 2 458 ? -14.787 2.677   -85.280  1.00 22.33 ? 458 MET E SD    1 
ATOM   10211 C  CE    . MET E 2 458 ? -15.358 2.606   -83.595  1.00 18.61 ? 458 MET E CE    1 
ATOM   10212 N  N     . GLU E 2 459 ? -11.948 -1.001  -84.805  1.00 2.00  ? 459 GLU E N     1 
ATOM   10213 C  CA    . GLU E 2 459 ? -10.689 -0.980  -84.130  1.00 2.04  ? 459 GLU E CA    1 
ATOM   10214 C  C     . GLU E 2 459 ? -9.963  0.375   -83.908  1.00 13.35 ? 459 GLU E C     1 
ATOM   10215 O  O     . GLU E 2 459 ? -9.324  0.593   -82.832  1.00 7.16  ? 459 GLU E O     1 
ATOM   10216 C  CB    . GLU E 2 459 ? -9.694  -1.962  -84.811  1.00 2.00  ? 459 GLU E CB    1 
ATOM   10217 C  CG    . GLU E 2 459 ? -9.979  -3.472  -84.459  1.00 3.43  ? 459 GLU E CG    1 
ATOM   10218 C  CD    . GLU E 2 459 ? -9.362  -4.486  -85.473  1.00 14.88 ? 459 GLU E CD    1 
ATOM   10219 O  OE1   . GLU E 2 459 ? -8.145  -4.351  -85.724  1.00 2.27  ? 459 GLU E OE1   1 
ATOM   10220 O  OE2   . GLU E 2 459 ? -10.086 -5.416  -86.023  1.00 8.00  ? 459 GLU E OE2   1 
ATOM   10221 N  N     . MET E 2 460 ? -9.933  1.205   -84.951  1.00 3.23  ? 460 MET E N     1 
ATOM   10222 C  CA    . MET E 2 460 ? -9.261  2.483   -84.888  1.00 10.30 ? 460 MET E CA    1 
ATOM   10223 C  C     . MET E 2 460 ? -10.340 3.526   -85.257  1.00 9.62  ? 460 MET E C     1 
ATOM   10224 O  O     . MET E 2 460 ? -10.933 3.428   -86.314  1.00 2.00  ? 460 MET E O     1 
ATOM   10225 C  CB    . MET E 2 460 ? -8.121  2.502   -85.915  1.00 2.28  ? 460 MET E CB    1 
ATOM   10226 C  CG    . MET E 2 460 ? -7.365  3.744   -85.896  1.00 8.04  ? 460 MET E CG    1 
ATOM   10227 S  SD    . MET E 2 460 ? -5.775  3.757   -86.844  1.00 8.17  ? 460 MET E SD    1 
ATOM   10228 C  CE    . MET E 2 460 ? -6.181  2.763   -88.237  1.00 34.35 ? 460 MET E CE    1 
ATOM   10229 N  N     . LEU E 2 461 ? -10.603 4.469   -84.360  1.00 2.01  ? 461 LEU E N     1 
ATOM   10230 C  CA    . LEU E 2 461 ? -11.527 5.564   -84.533  1.00 2.00  ? 461 LEU E CA    1 
ATOM   10231 C  C     . LEU E 2 461 ? -10.654 6.916   -84.345  1.00 11.63 ? 461 LEU E C     1 
ATOM   10232 O  O     . LEU E 2 461 ? -9.941  7.101   -83.322  1.00 6.46  ? 461 LEU E O     1 
ATOM   10233 C  CB    . LEU E 2 461 ? -12.602 5.458   -83.482  1.00 2.00  ? 461 LEU E CB    1 
ATOM   10234 C  CG    . LEU E 2 461 ? -13.444 6.713   -83.497  1.00 9.11  ? 461 LEU E CG    1 
ATOM   10235 C  CD1   . LEU E 2 461 ? -13.926 6.989   -84.871  1.00 2.00  ? 461 LEU E CD1   1 
ATOM   10236 C  CD2   . LEU E 2 461 ? -14.632 6.482   -82.621  1.00 2.00  ? 461 LEU E CD2   1 
ATOM   10237 N  N     . SER E 2 462 ? -10.658 7.776   -85.380  1.00 9.06  ? 462 SER E N     1 
ATOM   10238 C  CA    . SER E 2 462 ? -10.177 9.172   -85.378  1.00 2.20  ? 462 SER E CA    1 
ATOM   10239 C  C     . SER E 2 462 ? -11.244 10.193  -85.433  1.00 16.64 ? 462 SER E C     1 
ATOM   10240 O  O     . SER E 2 462 ? -12.145 10.153  -86.339  1.00 9.61  ? 462 SER E O     1 
ATOM   10241 C  CB    . SER E 2 462 ? -9.448  9.409   -86.665  1.00 4.86  ? 462 SER E CB    1 
ATOM   10242 O  OG    . SER E 2 462 ? -8.218  8.706   -86.605  1.00 4.29  ? 462 SER E OG    1 
ATOM   10243 N  N     . VAL E 2 463 ? -11.126 11.168  -84.542  1.00 8.89  ? 463 VAL E N     1 
ATOM   10244 C  CA    . VAL E 2 463 ? -12.118 12.189  -84.504  1.00 3.60  ? 463 VAL E CA    1 
ATOM   10245 C  C     . VAL E 2 463 ? -11.645 13.612  -84.084  1.00 12.58 ? 463 VAL E C     1 
ATOM   10246 O  O     . VAL E 2 463 ? -10.705 13.695  -83.294  1.00 8.91  ? 463 VAL E O     1 
ATOM   10247 C  CB    . VAL E 2 463 ? -13.362 11.743  -83.761  1.00 13.65 ? 463 VAL E CB    1 
ATOM   10248 C  CG1   . VAL E 2 463 ? -13.265 12.110  -82.358  1.00 2.00  ? 463 VAL E CG1   1 
ATOM   10249 C  CG2   . VAL E 2 463 ? -14.609 12.501  -84.418  1.00 4.86  ? 463 VAL E CG2   1 
ATOM   10250 N  N     . ALA E 2 464 ? -12.293 14.704  -84.608  1.00 5.26  ? 464 ALA E N     1 
ATOM   10251 C  CA    . ALA E 2 464 ? -11.856 16.137  -84.450  1.00 2.00  ? 464 ALA E CA    1 
ATOM   10252 C  C     . ALA E 2 464 ? -13.085 17.056  -84.369  1.00 2.00  ? 464 ALA E C     1 
ATOM   10253 O  O     . ALA E 2 464 ? -14.019 16.792  -84.980  1.00 4.06  ? 464 ALA E O     1 
ATOM   10254 C  CB    . ALA E 2 464 ? -10.937 16.523  -85.501  1.00 2.00  ? 464 ALA E CB    1 
ATOM   10255 N  N     . PHE E 2 465 ? -13.166 18.014  -83.444  1.00 9.58  ? 465 PHE E N     1 
ATOM   10256 C  CA    . PHE E 2 465 ? -14.119 19.095  -83.575  1.00 2.00  ? 465 PHE E CA    1 
ATOM   10257 C  C     . PHE E 2 465 ? -15.490 18.519  -83.546  1.00 10.95 ? 465 PHE E C     1 
ATOM   10258 O  O     . PHE E 2 465 ? -16.353 18.821  -84.434  1.00 2.00  ? 465 PHE E O     1 
ATOM   10259 C  CB    . PHE E 2 465 ? -13.906 19.891  -84.901  1.00 4.61  ? 465 PHE E CB    1 
ATOM   10260 C  CG    . PHE E 2 465 ? -12.560 20.644  -84.934  1.00 2.00  ? 465 PHE E CG    1 
ATOM   10261 C  CD1   . PHE E 2 465 ? -11.557 20.283  -85.834  1.00 2.20  ? 465 PHE E CD1   1 
ATOM   10262 C  CD2   . PHE E 2 465 ? -12.311 21.670  -84.015  1.00 2.00  ? 465 PHE E CD2   1 
ATOM   10263 C  CE1   . PHE E 2 465 ? -10.312 20.921  -85.826  1.00 6.85  ? 465 PHE E CE1   1 
ATOM   10264 C  CE2   . PHE E 2 465 ? -11.105 22.300  -83.999  1.00 2.04  ? 465 PHE E CE2   1 
ATOM   10265 C  CZ    . PHE E 2 465 ? -10.066 21.901  -84.896  1.00 2.31  ? 465 PHE E CZ    1 
ATOM   10266 N  N     . ALA E 2 466 ? -15.765 17.727  -82.522  1.00 2.00  ? 466 ALA E N     1 
ATOM   10267 C  CA    . ALA E 2 466 ? -16.980 16.963  -82.656  1.00 2.84  ? 466 ALA E CA    1 
ATOM   10268 C  C     . ALA E 2 466 ? -17.513 16.605  -81.286  1.00 2.96  ? 466 ALA E C     1 
ATOM   10269 O  O     . ALA E 2 466 ? -16.709 16.530  -80.313  1.00 8.69  ? 466 ALA E O     1 
ATOM   10270 C  CB    . ALA E 2 466 ? -16.694 15.723  -83.593  1.00 2.00  ? 466 ALA E CB    1 
ATOM   10271 N  N     . GLY E 2 467 ? -18.843 16.420  -81.175  1.00 6.99  ? 467 GLY E N     1 
ATOM   10272 C  CA    . GLY E 2 467 ? -19.501 15.908  -79.930  1.00 2.00  ? 467 GLY E CA    1 
ATOM   10273 C  C     . GLY E 2 467 ? -19.898 17.100  -79.061  1.00 13.54 ? 467 GLY E C     1 
ATOM   10274 O  O     . GLY E 2 467 ? -19.518 18.261  -79.399  1.00 2.33  ? 467 GLY E O     1 
ATOM   10275 N  N     . ASP E 2 468 ? -20.606 16.858  -77.958  1.00 2.00  ? 468 ASP E N     1 
ATOM   10276 C  CA    . ASP E 2 468 ? -21.092 17.912  -77.099  1.00 2.74  ? 468 ASP E CA    1 
ATOM   10277 C  C     . ASP E 2 468 ? -20.745 17.737  -75.652  1.00 6.38  ? 468 ASP E C     1 
ATOM   10278 O  O     . ASP E 2 468 ? -20.878 18.703  -74.868  1.00 4.33  ? 468 ASP E O     1 
ATOM   10279 C  CB    . ASP E 2 468 ? -22.628 17.996  -77.102  1.00 2.00  ? 468 ASP E CB    1 
ATOM   10280 C  CG    . ASP E 2 468 ? -23.149 18.228  -78.470  1.00 14.52 ? 468 ASP E CG    1 
ATOM   10281 O  OD1   . ASP E 2 468 ? -22.505 19.065  -79.201  1.00 13.34 ? 468 ASP E OD1   1 
ATOM   10282 O  OD2   . ASP E 2 468 ? -24.159 17.557  -78.843  1.00 5.62  ? 468 ASP E OD2   1 
ATOM   10283 N  N     . SER E 2 469 ? -20.386 16.528  -75.229  1.00 7.23  ? 469 SER E N     1 
ATOM   10284 C  CA    . SER E 2 469 ? -20.016 16.377  -73.797  1.00 2.31  ? 469 SER E CA    1 
ATOM   10285 C  C     . SER E 2 469 ? -19.327 15.048  -73.523  1.00 2.00  ? 469 SER E C     1 
ATOM   10286 O  O     . SER E 2 469 ? -19.033 14.300  -74.462  1.00 3.21  ? 469 SER E O     1 
ATOM   10287 C  CB    . SER E 2 469 ? -21.239 16.516  -72.919  1.00 2.00  ? 469 SER E CB    1 
ATOM   10288 O  OG    . SER E 2 469 ? -22.147 15.437  -73.119  1.00 4.37  ? 469 SER E OG    1 
ATOM   10289 N  N     . ASP E 2 470 ? -19.065 14.740  -72.236  1.00 4.21  ? 470 ASP E N     1 
ATOM   10290 C  CA    . ASP E 2 470 ? -18.381 13.461  -71.920  1.00 7.08  ? 470 ASP E CA    1 
ATOM   10291 C  C     . ASP E 2 470 ? -19.300 12.256  -72.405  1.00 11.40 ? 470 ASP E C     1 
ATOM   10292 O  O     . ASP E 2 470 ? -18.795 11.211  -72.808  1.00 6.91  ? 470 ASP E O     1 
ATOM   10293 C  CB    . ASP E 2 470 ? -17.955 13.358  -70.428  1.00 4.97  ? 470 ASP E CB    1 
ATOM   10294 C  CG    . ASP E 2 470 ? -16.853 14.374  -70.050  1.00 10.50 ? 470 ASP E CG    1 
ATOM   10295 O  OD1   . ASP E 2 470 ? -15.668 14.157  -70.351  1.00 3.32  ? 470 ASP E OD1   1 
ATOM   10296 O  OD2   . ASP E 2 470 ? -17.180 15.437  -69.460  1.00 26.33 ? 470 ASP E OD2   1 
ATOM   10297 N  N     . LEU E 2 471 ? -20.626 12.420  -72.381  1.00 2.46  ? 471 LEU E N     1 
ATOM   10298 C  CA    . LEU E 2 471 ? -21.531 11.388  -72.901  1.00 5.85  ? 471 LEU E CA    1 
ATOM   10299 C  C     . LEU E 2 471 ? -20.978 10.766  -74.229  1.00 12.64 ? 471 LEU E C     1 
ATOM   10300 O  O     . LEU E 2 471 ? -20.890 9.522   -74.440  1.00 2.75  ? 471 LEU E O     1 
ATOM   10301 C  CB    . LEU E 2 471 ? -22.915 12.037  -73.046  1.00 9.37  ? 471 LEU E CB    1 
ATOM   10302 C  CG    . LEU E 2 471 ? -23.979 11.061  -72.530  1.00 45.34 ? 471 LEU E CG    1 
ATOM   10303 C  CD1   . LEU E 2 471 ? -25.432 11.086  -73.179  1.00 10.10 ? 471 LEU E CD1   1 
ATOM   10304 C  CD2   . LEU E 2 471 ? -23.284 9.793   -72.876  1.00 14.50 ? 471 LEU E CD2   1 
ATOM   10305 N  N     . GLY E 2 472 ? -20.486 11.620  -75.116  1.00 3.38  ? 472 GLY E N     1 
ATOM   10306 C  CA    . GLY E 2 472 ? -20.014 11.077  -76.356  1.00 4.58  ? 472 GLY E CA    1 
ATOM   10307 C  C     . GLY E 2 472 ? -18.854 10.125  -76.231  1.00 19.33 ? 472 GLY E C     1 
ATOM   10308 O  O     . GLY E 2 472 ? -18.840 9.080   -76.906  1.00 17.76 ? 472 GLY E O     1 
ATOM   10309 N  N     . MET E 2 473 ? -17.836 10.478  -75.440  1.00 12.03 ? 473 MET E N     1 
ATOM   10310 C  CA    . MET E 2 473 ? -16.665 9.640   -75.500  1.00 5.28  ? 473 MET E CA    1 
ATOM   10311 C  C     . MET E 2 473 ? -17.089 8.432   -74.669  1.00 8.56  ? 473 MET E C     1 
ATOM   10312 O  O     . MET E 2 473 ? -16.596 7.294   -74.811  1.00 4.15  ? 473 MET E O     1 
ATOM   10313 C  CB    . MET E 2 473 ? -15.469 10.304  -74.879  1.00 4.63  ? 473 MET E CB    1 
ATOM   10314 C  CG    . MET E 2 473 ? -14.313 9.358   -74.872  1.00 3.33  ? 473 MET E CG    1 
ATOM   10315 S  SD    . MET E 2 473 ? -12.658 10.038  -74.423  1.00 11.57 ? 473 MET E SD    1 
ATOM   10316 C  CE    . MET E 2 473 ? -12.936 10.294  -72.681  1.00 2.00  ? 473 MET E CE    1 
ATOM   10317 N  N     . HIS E 2 474 ? -18.044 8.646   -73.813  1.00 2.00  ? 474 HIS E N     1 
ATOM   10318 C  CA    . HIS E 2 474 ? -18.467 7.510   -72.995  1.00 3.82  ? 474 HIS E CA    1 
ATOM   10319 C  C     . HIS E 2 474 ? -19.069 6.378   -73.806  1.00 13.93 ? 474 HIS E C     1 
ATOM   10320 O  O     . HIS E 2 474 ? -18.566 5.252   -73.691  1.00 16.46 ? 474 HIS E O     1 
ATOM   10321 C  CB    . HIS E 2 474 ? -19.446 7.947   -71.955  1.00 2.00  ? 474 HIS E CB    1 
ATOM   10322 C  CG    . HIS E 2 474 ? -20.085 6.839   -71.207  1.00 15.97 ? 474 HIS E CG    1 
ATOM   10323 N  ND1   . HIS E 2 474 ? -19.401 6.076   -70.280  1.00 12.50 ? 474 HIS E ND1   1 
ATOM   10324 C  CD2   . HIS E 2 474 ? -21.378 6.426   -71.159  1.00 8.40  ? 474 HIS E CD2   1 
ATOM   10325 C  CE1   . HIS E 2 474 ? -20.241 5.222   -69.716  1.00 2.42  ? 474 HIS E CE1   1 
ATOM   10326 N  NE2   . HIS E 2 474 ? -21.443 5.413   -70.229  1.00 2.00  ? 474 HIS E NE2   1 
ATOM   10327 N  N     . HIS E 2 475 ? -20.122 6.642   -74.617  1.00 7.19  ? 475 HIS E N     1 
ATOM   10328 C  CA    . HIS E 2 475 ? -20.686 5.609   -75.517  1.00 2.00  ? 475 HIS E CA    1 
ATOM   10329 C  C     . HIS E 2 475 ? -19.599 4.914   -76.312  1.00 6.25  ? 475 HIS E C     1 
ATOM   10330 O  O     . HIS E 2 475 ? -19.776 3.773   -76.700  1.00 4.14  ? 475 HIS E O     1 
ATOM   10331 C  CB    . HIS E 2 475 ? -21.614 6.222   -76.585  1.00 2.15  ? 475 HIS E CB    1 
ATOM   10332 C  CG    . HIS E 2 475 ? -22.786 6.933   -76.024  1.00 5.40  ? 475 HIS E CG    1 
ATOM   10333 N  ND1   . HIS E 2 475 ? -23.477 6.478   -74.917  1.00 2.00  ? 475 HIS E ND1   1 
ATOM   10334 C  CD2   . HIS E 2 475 ? -23.375 8.097   -76.401  1.00 16.08 ? 475 HIS E CD2   1 
ATOM   10335 C  CE1   . HIS E 2 475 ? -24.448 7.330   -74.643  1.00 7.65  ? 475 HIS E CE1   1 
ATOM   10336 N  NE2   . HIS E 2 475 ? -24.420 8.314   -75.540  1.00 5.71  ? 475 HIS E NE2   1 
ATOM   10337 N  N     . VAL E 2 476 ? -18.520 5.594   -76.634  1.00 2.00  ? 476 VAL E N     1 
ATOM   10338 C  CA    . VAL E 2 476 ? -17.570 4.920   -77.410  1.00 3.48  ? 476 VAL E CA    1 
ATOM   10339 C  C     . VAL E 2 476 ? -16.752 3.914   -76.583  1.00 2.00  ? 476 VAL E C     1 
ATOM   10340 O  O     . VAL E 2 476 ? -16.556 2.807   -76.998  1.00 8.48  ? 476 VAL E O     1 
ATOM   10341 C  CB    . VAL E 2 476 ? -16.576 5.878   -78.124  1.00 2.52  ? 476 VAL E CB    1 
ATOM   10342 C  CG1   . VAL E 2 476 ? -15.446 5.110   -78.774  1.00 2.00  ? 476 VAL E CG1   1 
ATOM   10343 C  CG2   . VAL E 2 476 ? -17.289 6.660   -79.175  1.00 4.61  ? 476 VAL E CG2   1 
ATOM   10344 N  N     . LEU E 2 477 ? -16.207 4.338   -75.470  1.00 5.26  ? 477 LEU E N     1 
ATOM   10345 C  CA    . LEU E 2 477 ? -15.425 3.460   -74.626  1.00 10.43 ? 477 LEU E CA    1 
ATOM   10346 C  C     . LEU E 2 477 ? -16.352 2.336   -74.122  1.00 2.00  ? 477 LEU E C     1 
ATOM   10347 O  O     . LEU E 2 477 ? -15.955 1.247   -73.985  1.00 2.24  ? 477 LEU E O     1 
ATOM   10348 C  CB    . LEU E 2 477 ? -14.748 4.252   -73.427  1.00 2.00  ? 477 LEU E CB    1 
ATOM   10349 C  CG    . LEU E 2 477 ? -13.669 5.185   -73.908  1.00 3.73  ? 477 LEU E CG    1 
ATOM   10350 C  CD1   . LEU E 2 477 ? -13.111 6.222   -72.885  1.00 2.67  ? 477 LEU E CD1   1 
ATOM   10351 C  CD2   . LEU E 2 477 ? -12.529 4.529   -74.644  1.00 2.00  ? 477 LEU E CD2   1 
ATOM   10352 N  N     . SER E 2 478 ? -17.590 2.614   -73.800  1.00 2.93  ? 478 SER E N     1 
ATOM   10353 C  CA    . SER E 2 478 ? -18.381 1.557   -73.361  1.00 2.00  ? 478 SER E CA    1 
ATOM   10354 C  C     . SER E 2 478 ? -19.019 0.589   -74.425  1.00 13.56 ? 478 SER E C     1 
ATOM   10355 O  O     . SER E 2 478 ? -19.347 -0.565  -74.086  1.00 14.22 ? 478 SER E O     1 
ATOM   10356 C  CB    . SER E 2 478 ? -19.311 2.001   -72.256  1.00 3.65  ? 478 SER E CB    1 
ATOM   10357 O  OG    . SER E 2 478 ? -20.588 2.278   -72.748  1.00 5.64  ? 478 SER E OG    1 
ATOM   10358 N  N     . GLY E 2 479 ? -19.215 1.013   -75.668  1.00 2.00  ? 479 GLY E N     1 
ATOM   10359 C  CA    . GLY E 2 479 ? -19.944 0.180   -76.629  1.00 2.00  ? 479 GLY E CA    1 
ATOM   10360 C  C     . GLY E 2 479 ? -18.988 -0.536  -77.573  1.00 2.14  ? 479 GLY E C     1 
ATOM   10361 O  O     . GLY E 2 479 ? -19.320 -1.550  -78.122  1.00 4.71  ? 479 GLY E O     1 
ATOM   10362 N  N     . CYS E 2 480 ? -17.769 -0.039  -77.711  1.00 2.00  ? 480 CYS E N     1 
ATOM   10363 C  CA    . CYS E 2 480 ? -16.914 -0.461  -78.724  1.00 2.00  ? 480 CYS E CA    1 
ATOM   10364 C  C     . CYS E 2 480 ? -16.068 -1.622  -78.499  1.00 4.79  ? 480 CYS E C     1 
ATOM   10365 O  O     . CYS E 2 480 ? -14.829 -1.484  -78.461  1.00 8.78  ? 480 CYS E O     1 
ATOM   10366 C  CB    . CYS E 2 480 ? -16.039 0.688   -79.134  1.00 9.24  ? 480 CYS E CB    1 
ATOM   10367 S  SG    . CYS E 2 480 ? -16.955 1.802   -80.316  1.00 4.47  ? 480 CYS E SG    1 
ATOM   10368 N  N     . ASP E 2 481 ? -16.691 -2.782  -78.351  1.00 8.11  ? 481 ASP E N     1 
ATOM   10369 C  CA    . ASP E 2 481 ? -15.963 -4.050  -78.055  1.00 2.00  ? 481 ASP E CA    1 
ATOM   10370 C  C     . ASP E 2 481 ? -14.601 -4.194  -78.733  1.00 2.00  ? 481 ASP E C     1 
ATOM   10371 O  O     . ASP E 2 481 ? -13.674 -4.692  -78.205  1.00 2.00  ? 481 ASP E O     1 
ATOM   10372 C  CB    . ASP E 2 481 ? -16.827 -5.215  -78.537  1.00 3.36  ? 481 ASP E CB    1 
ATOM   10373 C  CG    . ASP E 2 481 ? -18.168 -5.250  -77.823  1.00 11.61 ? 481 ASP E CG    1 
ATOM   10374 O  OD1   . ASP E 2 481 ? -18.259 -4.597  -76.751  1.00 6.99  ? 481 ASP E OD1   1 
ATOM   10375 O  OD2   . ASP E 2 481 ? -19.141 -5.859  -78.343  1.00 3.14  ? 481 ASP E OD2   1 
ATOM   10376 N  N     . SER E 2 482 ? -14.410 -3.786  -79.922  1.00 2.00  ? 482 SER E N     1 
ATOM   10377 C  CA    . SER E 2 482 ? -13.099 -4.113  -80.450  1.00 3.55  ? 482 SER E CA    1 
ATOM   10378 C  C     . SER E 2 482 ? -12.086 -2.959  -80.537  1.00 5.60  ? 482 SER E C     1 
ATOM   10379 O  O     . SER E 2 482 ? -11.061 -3.106  -81.309  1.00 10.09 ? 482 SER E O     1 
ATOM   10380 C  CB    . SER E 2 482 ? -13.182 -4.811  -81.854  1.00 5.60  ? 482 SER E CB    1 
ATOM   10381 O  OG    . SER E 2 482 ? -14.326 -5.699  -81.942  1.00 6.59  ? 482 SER E OG    1 
ATOM   10382 N  N     . LEU E 2 483 ? -12.333 -1.851  -79.836  1.00 2.00  ? 483 LEU E N     1 
ATOM   10383 C  CA    . LEU E 2 483 ? -11.447 -0.667  -79.992  1.00 3.83  ? 483 LEU E CA    1 
ATOM   10384 C  C     . LEU E 2 483 ? -10.034 -1.014  -79.642  1.00 5.60  ? 483 LEU E C     1 
ATOM   10385 O  O     . LEU E 2 483 ? -9.776  -1.563  -78.548  1.00 2.00  ? 483 LEU E O     1 
ATOM   10386 C  CB    . LEU E 2 483 ? -11.801 0.416   -78.977  1.00 4.64  ? 483 LEU E CB    1 
ATOM   10387 C  CG    . LEU E 2 483 ? -12.156 1.829   -79.440  1.00 8.23  ? 483 LEU E CG    1 
ATOM   10388 C  CD1   . LEU E 2 483 ? -12.084 2.844   -78.290  1.00 3.97  ? 483 LEU E CD1   1 
ATOM   10389 C  CD2   . LEU E 2 483 ? -11.553 2.302   -80.759  1.00 2.00  ? 483 LEU E CD2   1 
ATOM   10390 N  N     . ARG E 2 484 ? -9.103  -0.625  -80.505  1.00 2.00  ? 484 ARG E N     1 
ATOM   10391 C  CA    . ARG E 2 484 ? -7.678  -0.842  -80.158  1.00 6.01  ? 484 ARG E CA    1 
ATOM   10392 C  C     . ARG E 2 484 ? -6.970  0.543   -80.036  1.00 15.83 ? 484 ARG E C     1 
ATOM   10393 O  O     . ARG E 2 484 ? -6.083  0.728   -79.210  1.00 18.22 ? 484 ARG E O     1 
ATOM   10394 C  CB    . ARG E 2 484 ? -6.989  -1.725  -81.231  1.00 2.68  ? 484 ARG E CB    1 
ATOM   10395 C  CG    . ARG E 2 484 ? -7.466  -3.236  -81.180  1.00 10.69 ? 484 ARG E CG    1 
ATOM   10396 C  CD    . ARG E 2 484 ? -6.910  -4.021  -82.442  1.00 6.37  ? 484 ARG E CD    1 
ATOM   10397 N  NE    . ARG E 2 484 ? -5.597  -3.505  -82.675  1.00 16.59 ? 484 ARG E NE    1 
ATOM   10398 C  CZ    . ARG E 2 484 ? -5.165  -3.028  -83.838  1.00 33.97 ? 484 ARG E CZ    1 
ATOM   10399 N  NH1   . ARG E 2 484 ? -5.998  -3.021  -84.884  1.00 9.77  ? 484 ARG E NH1   1 
ATOM   10400 N  NH2   . ARG E 2 484 ? -3.887  -2.556  -83.946  1.00 5.56  ? 484 ARG E NH2   1 
ATOM   10401 N  N     . LYS E 2 485 ? -7.342  1.488   -80.891  1.00 2.00  ? 485 LYS E N     1 
ATOM   10402 C  CA    . LYS E 2 485 ? -6.702  2.821   -80.909  1.00 10.07 ? 485 LYS E CA    1 
ATOM   10403 C  C     . LYS E 2 485 ? -7.790  3.923   -81.021  1.00 6.37  ? 485 LYS E C     1 
ATOM   10404 O  O     . LYS E 2 485 ? -8.658  3.895   -81.948  1.00 7.92  ? 485 LYS E O     1 
ATOM   10405 C  CB    . LYS E 2 485 ? -5.792  2.867   -82.071  1.00 2.00  ? 485 LYS E CB    1 
ATOM   10406 C  CG    . LYS E 2 485 ? -4.581  2.217   -81.800  1.00 2.00  ? 485 LYS E CG    1 
ATOM   10407 C  CD    . LYS E 2 485 ? -3.665  2.185   -83.091  1.00 9.32  ? 485 LYS E CD    1 
ATOM   10408 C  CE    . LYS E 2 485 ? -4.294  1.411   -84.353  1.00 8.63  ? 485 LYS E CE    1 
ATOM   10409 N  NZ    . LYS E 2 485 ? -3.290  1.410   -85.555  1.00 11.07 ? 485 LYS E NZ    1 
ATOM   10410 N  N     . LEU E 2 486 ? -7.827  4.824   -80.049  1.00 3.88  ? 486 LEU E N     1 
ATOM   10411 C  CA    . LEU E 2 486 ? -8.801  5.963   -80.027  1.00 3.19  ? 486 LEU E CA    1 
ATOM   10412 C  C     . LEU E 2 486 ? -7.917  7.218   -80.133  1.00 12.51 ? 486 LEU E C     1 
ATOM   10413 O  O     . LEU E 2 486 ? -6.943  7.363   -79.327  1.00 11.10 ? 486 LEU E O     1 
ATOM   10414 C  CB    . LEU E 2 486 ? -9.650  6.019   -78.713  1.00 2.00  ? 486 LEU E CB    1 
ATOM   10415 C  CG    . LEU E 2 486 ? -10.697 7.136   -78.817  1.00 2.16  ? 486 LEU E CG    1 
ATOM   10416 C  CD1   . LEU E 2 486 ? -11.241 7.153   -80.297  1.00 2.00  ? 486 LEU E CD1   1 
ATOM   10417 C  CD2   . LEU E 2 486 ? -11.813 6.733   -77.824  1.00 2.00  ? 486 LEU E CD2   1 
ATOM   10418 N  N     . GLU E 2 487 ? -8.227  8.108   -81.070  1.00 2.00  ? 487 GLU E N     1 
ATOM   10419 C  CA    . GLU E 2 487 ? -7.445  9.331   -81.227  1.00 2.31  ? 487 GLU E CA    1 
ATOM   10420 C  C     . GLU E 2 487 ? -8.337  10.552  -81.536  1.00 13.16 ? 487 GLU E C     1 
ATOM   10421 O  O     . GLU E 2 487 ? -9.073  10.562  -82.565  1.00 4.96  ? 487 GLU E O     1 
ATOM   10422 C  CB    . GLU E 2 487 ? -6.334  9.226   -82.300  1.00 2.00  ? 487 GLU E CB    1 
ATOM   10423 C  CG    . GLU E 2 487 ? -6.829  8.770   -83.631  1.00 2.00  ? 487 GLU E CG    1 
ATOM   10424 C  CD    . GLU E 2 487 ? -5.713  8.574   -84.583  1.00 2.00  ? 487 GLU E CD    1 
ATOM   10425 O  OE1   . GLU E 2 487 ? -5.817  8.703   -85.831  1.00 6.15  ? 487 GLU E OE1   1 
ATOM   10426 O  OE2   . GLU E 2 487 ? -4.624  8.284   -84.127  1.00 4.45  ? 487 GLU E OE2   1 
ATOM   10427 N  N     . ILE E 2 488 ? -8.256  11.567  -80.656  1.00 8.80  ? 488 ILE E N     1 
ATOM   10428 C  CA    . ILE E 2 488 ? -9.300  12.541  -80.487  1.00 2.00  ? 488 ILE E CA    1 
ATOM   10429 C  C     . ILE E 2 488 ? -8.617  13.853  -80.303  1.00 3.37  ? 488 ILE E C     1 
ATOM   10430 O  O     . ILE E 2 488 ? -7.735  14.003  -79.448  1.00 2.04  ? 488 ILE E O     1 
ATOM   10431 C  CB    . ILE E 2 488 ? -10.154 12.266  -79.278  1.00 3.53  ? 488 ILE E CB    1 
ATOM   10432 C  CG1   . ILE E 2 488 ? -10.885 10.922  -79.417  1.00 2.00  ? 488 ILE E CG1   1 
ATOM   10433 C  CG2   . ILE E 2 488 ? -11.316 13.342  -79.197  1.00 2.00  ? 488 ILE E CG2   1 
ATOM   10434 C  CD1   . ILE E 2 488 ? -11.655 10.625  -78.217  1.00 4.32  ? 488 ILE E CD1   1 
ATOM   10435