data_2P1Q
# 
_entry.id   2P1Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.334 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P1Q         
RCSB  RCSB041857   
WWPDB D_1000041857 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2P1M . unspecified 
PDB 2P1N . unspecified 
PDB 2P1O . unspecified 
PDB 2P1P . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2P1Q 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tan, X.'                     1 
'Calderon-Villalobos, L.I.A.' 2 
'Sharon, M.'                  3 
'Robinson, C.V.'              4 
'Estelle, M.'                 5 
'Zheng, N.'                   6 
# 
_citation.id                        primary 
_citation.title                     'Mechanism of auxin perception by the TIR1 ubiquitin ligase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            446 
_citation.page_first                640 
_citation.page_last                 645 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17410169 
_citation.pdbx_database_id_DOI      10.1038/nature05731 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tan, X.'                   1 ? 
primary 'Calderon-Villalobos, L.I.' 2 ? 
primary 'Sharon, M.'                3 ? 
primary 'Zheng, C.'                 4 ? 
primary 'Robinson, C.V.'            5 ? 
primary 'Estelle, M.'               6 ? 
primary 'Zheng, N.'                 7 ? 
# 
_cell.entry_id           2P1Q 
_cell.length_a           101.207 
_cell.length_b           82.472 
_cell.length_c           125.053 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P1Q 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SKP1-like protein 1A'                   17876.043 1   ? ? ? ? 
2 polymer     man 'TRANSPORT INHIBITOR RESPONSE 1 protein' 66875.438 1   ? ? ? ? 
3 polymer     syn 'Auxin-responsive protein IAA7'          1601.872  1   ? ? ? ? 
4 non-polymer syn 'INOSITOL HEXAKISPHOSPHATE'              660.035   1   ? ? ? ? 
5 non-polymer syn '1H-INDOL-3-YLACETIC ACID'               175.184   1   ? ? ? ? 
6 water       nat water                                    18.015    770 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'SKP1-like 1, UFO-binding protein 1'                     
2 'F-box/LRR-repeat protein 1'                             
3 'Indoleacetic acid-induced protein 7, Auxin resistant 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE
;
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE
;
A ? 
2 'polypeptide(L)' no no 
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
B ? 
3 'polypeptide(L)' no no QVVGWPPVRNYRK QVVGWPPVRNYRK C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   LYS n 
1 6   ILE n 
1 7   VAL n 
1 8   LEU n 
1 9   LYS n 
1 10  SER n 
1 11  SER n 
1 12  ASP n 
1 13  GLY n 
1 14  GLU n 
1 15  SER n 
1 16  PHE n 
1 17  GLU n 
1 18  VAL n 
1 19  GLU n 
1 20  GLU n 
1 21  ALA n 
1 22  VAL n 
1 23  ALA n 
1 24  LEU n 
1 25  GLU n 
1 26  SER n 
1 27  GLN n 
1 28  THR n 
1 29  ILE n 
1 30  ALA n 
1 31  HIS n 
1 32  MET n 
1 33  VAL n 
1 34  GLU n 
1 35  ASP n 
1 36  ASP n 
1 37  CYS n 
1 38  VAL n 
1 39  ASP n 
1 40  ASN n 
1 41  GLY n 
1 42  VAL n 
1 43  PRO n 
1 44  LEU n 
1 45  PRO n 
1 46  ASN n 
1 47  VAL n 
1 48  THR n 
1 49  SER n 
1 50  LYS n 
1 51  ILE n 
1 52  LEU n 
1 53  ALA n 
1 54  LYS n 
1 55  VAL n 
1 56  ILE n 
1 57  GLU n 
1 58  TYR n 
1 59  CYS n 
1 60  LYS n 
1 61  ARG n 
1 62  HIS n 
1 63  VAL n 
1 64  GLU n 
1 65  ALA n 
1 66  ALA n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  ALA n 
1 71  GLU n 
1 72  ALA n 
1 73  VAL n 
1 74  GLU n 
1 75  GLY n 
1 76  ALA n 
1 77  ALA n 
1 78  THR n 
1 79  SER n 
1 80  ASP n 
1 81  ASP n 
1 82  ASP n 
1 83  LEU n 
1 84  LYS n 
1 85  ALA n 
1 86  TRP n 
1 87  ASP n 
1 88  ALA n 
1 89  ASP n 
1 90  PHE n 
1 91  MET n 
1 92  LYS n 
1 93  ILE n 
1 94  ASP n 
1 95  GLN n 
1 96  ALA n 
1 97  THR n 
1 98  LEU n 
1 99  PHE n 
1 100 GLU n 
1 101 LEU n 
1 102 ILE n 
1 103 LEU n 
1 104 ALA n 
1 105 ALA n 
1 106 ASN n 
1 107 TYR n 
1 108 LEU n 
1 109 ASN n 
1 110 ILE n 
1 111 LYS n 
1 112 ASN n 
1 113 LEU n 
1 114 LEU n 
1 115 ASP n 
1 116 LEU n 
1 117 THR n 
1 118 CYS n 
1 119 GLN n 
1 120 THR n 
1 121 VAL n 
1 122 ALA n 
1 123 ASP n 
1 124 MET n 
1 125 ILE n 
1 126 LYS n 
1 127 GLY n 
1 128 LYS n 
1 129 THR n 
1 130 PRO n 
1 131 GLU n 
1 132 GLU n 
1 133 ILE n 
1 134 ARG n 
1 135 THR n 
1 136 THR n 
1 137 PHE n 
1 138 ASN n 
1 139 ILE n 
1 140 LYS n 
1 141 ASN n 
1 142 ASP n 
1 143 PHE n 
1 144 THR n 
1 145 PRO n 
1 146 GLU n 
1 147 GLU n 
1 148 GLU n 
1 149 GLU n 
1 150 GLU n 
1 151 VAL n 
1 152 ARG n 
1 153 ARG n 
1 154 GLU n 
1 155 ASN n 
1 156 GLN n 
1 157 TRP n 
1 158 ALA n 
1 159 PHE n 
1 160 GLU n 
2 1   MET n 
2 2   GLN n 
2 3   LYS n 
2 4   ARG n 
2 5   ILE n 
2 6   ALA n 
2 7   LEU n 
2 8   SER n 
2 9   PHE n 
2 10  PRO n 
2 11  GLU n 
2 12  GLU n 
2 13  VAL n 
2 14  LEU n 
2 15  GLU n 
2 16  HIS n 
2 17  VAL n 
2 18  PHE n 
2 19  SER n 
2 20  PHE n 
2 21  ILE n 
2 22  GLN n 
2 23  LEU n 
2 24  ASP n 
2 25  LYS n 
2 26  ASP n 
2 27  ARG n 
2 28  ASN n 
2 29  SER n 
2 30  VAL n 
2 31  SER n 
2 32  LEU n 
2 33  VAL n 
2 34  CYS n 
2 35  LYS n 
2 36  SER n 
2 37  TRP n 
2 38  TYR n 
2 39  GLU n 
2 40  ILE n 
2 41  GLU n 
2 42  ARG n 
2 43  TRP n 
2 44  CYS n 
2 45  ARG n 
2 46  ARG n 
2 47  LYS n 
2 48  VAL n 
2 49  PHE n 
2 50  ILE n 
2 51  GLY n 
2 52  ASN n 
2 53  CYS n 
2 54  TYR n 
2 55  ALA n 
2 56  VAL n 
2 57  SER n 
2 58  PRO n 
2 59  ALA n 
2 60  THR n 
2 61  VAL n 
2 62  ILE n 
2 63  ARG n 
2 64  ARG n 
2 65  PHE n 
2 66  PRO n 
2 67  LYS n 
2 68  VAL n 
2 69  ARG n 
2 70  SER n 
2 71  VAL n 
2 72  GLU n 
2 73  LEU n 
2 74  LYS n 
2 75  GLY n 
2 76  LYS n 
2 77  PRO n 
2 78  HIS n 
2 79  PHE n 
2 80  ALA n 
2 81  ASP n 
2 82  PHE n 
2 83  ASN n 
2 84  LEU n 
2 85  VAL n 
2 86  PRO n 
2 87  ASP n 
2 88  GLY n 
2 89  TRP n 
2 90  GLY n 
2 91  GLY n 
2 92  TYR n 
2 93  VAL n 
2 94  TYR n 
2 95  PRO n 
2 96  TRP n 
2 97  ILE n 
2 98  GLU n 
2 99  ALA n 
2 100 MET n 
2 101 SER n 
2 102 SER n 
2 103 SER n 
2 104 TYR n 
2 105 THR n 
2 106 TRP n 
2 107 LEU n 
2 108 GLU n 
2 109 GLU n 
2 110 ILE n 
2 111 ARG n 
2 112 LEU n 
2 113 LYS n 
2 114 ARG n 
2 115 MET n 
2 116 VAL n 
2 117 VAL n 
2 118 THR n 
2 119 ASP n 
2 120 ASP n 
2 121 CYS n 
2 122 LEU n 
2 123 GLU n 
2 124 LEU n 
2 125 ILE n 
2 126 ALA n 
2 127 LYS n 
2 128 SER n 
2 129 PHE n 
2 130 LYS n 
2 131 ASN n 
2 132 PHE n 
2 133 LYS n 
2 134 VAL n 
2 135 LEU n 
2 136 VAL n 
2 137 LEU n 
2 138 SER n 
2 139 SER n 
2 140 CYS n 
2 141 GLU n 
2 142 GLY n 
2 143 PHE n 
2 144 SER n 
2 145 THR n 
2 146 ASP n 
2 147 GLY n 
2 148 LEU n 
2 149 ALA n 
2 150 ALA n 
2 151 ILE n 
2 152 ALA n 
2 153 ALA n 
2 154 THR n 
2 155 CYS n 
2 156 ARG n 
2 157 ASN n 
2 158 LEU n 
2 159 LYS n 
2 160 GLU n 
2 161 LEU n 
2 162 ASP n 
2 163 LEU n 
2 164 ARG n 
2 165 GLU n 
2 166 SER n 
2 167 ASP n 
2 168 VAL n 
2 169 ASP n 
2 170 ASP n 
2 171 VAL n 
2 172 SER n 
2 173 GLY n 
2 174 HIS n 
2 175 TRP n 
2 176 LEU n 
2 177 SER n 
2 178 HIS n 
2 179 PHE n 
2 180 PRO n 
2 181 ASP n 
2 182 THR n 
2 183 TYR n 
2 184 THR n 
2 185 SER n 
2 186 LEU n 
2 187 VAL n 
2 188 SER n 
2 189 LEU n 
2 190 ASN n 
2 191 ILE n 
2 192 SER n 
2 193 CYS n 
2 194 LEU n 
2 195 ALA n 
2 196 SER n 
2 197 GLU n 
2 198 VAL n 
2 199 SER n 
2 200 PHE n 
2 201 SER n 
2 202 ALA n 
2 203 LEU n 
2 204 GLU n 
2 205 ARG n 
2 206 LEU n 
2 207 VAL n 
2 208 THR n 
2 209 ARG n 
2 210 CYS n 
2 211 PRO n 
2 212 ASN n 
2 213 LEU n 
2 214 LYS n 
2 215 SER n 
2 216 LEU n 
2 217 LYS n 
2 218 LEU n 
2 219 ASN n 
2 220 ARG n 
2 221 ALA n 
2 222 VAL n 
2 223 PRO n 
2 224 LEU n 
2 225 GLU n 
2 226 LYS n 
2 227 LEU n 
2 228 ALA n 
2 229 THR n 
2 230 LEU n 
2 231 LEU n 
2 232 GLN n 
2 233 ARG n 
2 234 ALA n 
2 235 PRO n 
2 236 GLN n 
2 237 LEU n 
2 238 GLU n 
2 239 GLU n 
2 240 LEU n 
2 241 GLY n 
2 242 THR n 
2 243 GLY n 
2 244 GLY n 
2 245 TYR n 
2 246 THR n 
2 247 ALA n 
2 248 GLU n 
2 249 VAL n 
2 250 ARG n 
2 251 PRO n 
2 252 ASP n 
2 253 VAL n 
2 254 TYR n 
2 255 SER n 
2 256 GLY n 
2 257 LEU n 
2 258 SER n 
2 259 VAL n 
2 260 ALA n 
2 261 LEU n 
2 262 SER n 
2 263 GLY n 
2 264 CYS n 
2 265 LYS n 
2 266 GLU n 
2 267 LEU n 
2 268 ARG n 
2 269 CYS n 
2 270 LEU n 
2 271 SER n 
2 272 GLY n 
2 273 PHE n 
2 274 TRP n 
2 275 ASP n 
2 276 ALA n 
2 277 VAL n 
2 278 PRO n 
2 279 ALA n 
2 280 TYR n 
2 281 LEU n 
2 282 PRO n 
2 283 ALA n 
2 284 VAL n 
2 285 TYR n 
2 286 SER n 
2 287 VAL n 
2 288 CYS n 
2 289 SER n 
2 290 ARG n 
2 291 LEU n 
2 292 THR n 
2 293 THR n 
2 294 LEU n 
2 295 ASN n 
2 296 LEU n 
2 297 SER n 
2 298 TYR n 
2 299 ALA n 
2 300 THR n 
2 301 VAL n 
2 302 GLN n 
2 303 SER n 
2 304 TYR n 
2 305 ASP n 
2 306 LEU n 
2 307 VAL n 
2 308 LYS n 
2 309 LEU n 
2 310 LEU n 
2 311 CYS n 
2 312 GLN n 
2 313 CYS n 
2 314 PRO n 
2 315 LYS n 
2 316 LEU n 
2 317 GLN n 
2 318 ARG n 
2 319 LEU n 
2 320 TRP n 
2 321 VAL n 
2 322 LEU n 
2 323 ASP n 
2 324 TYR n 
2 325 ILE n 
2 326 GLU n 
2 327 ASP n 
2 328 ALA n 
2 329 GLY n 
2 330 LEU n 
2 331 GLU n 
2 332 VAL n 
2 333 LEU n 
2 334 ALA n 
2 335 SER n 
2 336 THR n 
2 337 CYS n 
2 338 LYS n 
2 339 ASP n 
2 340 LEU n 
2 341 ARG n 
2 342 GLU n 
2 343 LEU n 
2 344 ARG n 
2 345 VAL n 
2 346 PHE n 
2 347 PRO n 
2 348 SER n 
2 349 GLU n 
2 350 PRO n 
2 351 PHE n 
2 352 VAL n 
2 353 MET n 
2 354 GLU n 
2 355 PRO n 
2 356 ASN n 
2 357 VAL n 
2 358 ALA n 
2 359 LEU n 
2 360 THR n 
2 361 GLU n 
2 362 GLN n 
2 363 GLY n 
2 364 LEU n 
2 365 VAL n 
2 366 SER n 
2 367 VAL n 
2 368 SER n 
2 369 MET n 
2 370 GLY n 
2 371 CYS n 
2 372 PRO n 
2 373 LYS n 
2 374 LEU n 
2 375 GLU n 
2 376 SER n 
2 377 VAL n 
2 378 LEU n 
2 379 TYR n 
2 380 PHE n 
2 381 CYS n 
2 382 ARG n 
2 383 GLN n 
2 384 MET n 
2 385 THR n 
2 386 ASN n 
2 387 ALA n 
2 388 ALA n 
2 389 LEU n 
2 390 ILE n 
2 391 THR n 
2 392 ILE n 
2 393 ALA n 
2 394 ARG n 
2 395 ASN n 
2 396 ARG n 
2 397 PRO n 
2 398 ASN n 
2 399 MET n 
2 400 THR n 
2 401 ARG n 
2 402 PHE n 
2 403 ARG n 
2 404 LEU n 
2 405 CYS n 
2 406 ILE n 
2 407 ILE n 
2 408 GLU n 
2 409 PRO n 
2 410 LYS n 
2 411 ALA n 
2 412 PRO n 
2 413 ASP n 
2 414 TYR n 
2 415 LEU n 
2 416 THR n 
2 417 LEU n 
2 418 GLU n 
2 419 PRO n 
2 420 LEU n 
2 421 ASP n 
2 422 ILE n 
2 423 GLY n 
2 424 PHE n 
2 425 GLY n 
2 426 ALA n 
2 427 ILE n 
2 428 VAL n 
2 429 GLU n 
2 430 HIS n 
2 431 CYS n 
2 432 LYS n 
2 433 ASP n 
2 434 LEU n 
2 435 ARG n 
2 436 ARG n 
2 437 LEU n 
2 438 SER n 
2 439 LEU n 
2 440 SER n 
2 441 GLY n 
2 442 LEU n 
2 443 LEU n 
2 444 THR n 
2 445 ASP n 
2 446 LYS n 
2 447 VAL n 
2 448 PHE n 
2 449 GLU n 
2 450 TYR n 
2 451 ILE n 
2 452 GLY n 
2 453 THR n 
2 454 TYR n 
2 455 ALA n 
2 456 LYS n 
2 457 LYS n 
2 458 MET n 
2 459 GLU n 
2 460 MET n 
2 461 LEU n 
2 462 SER n 
2 463 VAL n 
2 464 ALA n 
2 465 PHE n 
2 466 ALA n 
2 467 GLY n 
2 468 ASP n 
2 469 SER n 
2 470 ASP n 
2 471 LEU n 
2 472 GLY n 
2 473 MET n 
2 474 HIS n 
2 475 HIS n 
2 476 VAL n 
2 477 LEU n 
2 478 SER n 
2 479 GLY n 
2 480 CYS n 
2 481 ASP n 
2 482 SER n 
2 483 LEU n 
2 484 ARG n 
2 485 LYS n 
2 486 LEU n 
2 487 GLU n 
2 488 ILE n 
2 489 ARG n 
2 490 ASP n 
2 491 CYS n 
2 492 PRO n 
2 493 PHE n 
2 494 GLY n 
2 495 ASP n 
2 496 LYS n 
2 497 ALA n 
2 498 LEU n 
2 499 LEU n 
2 500 ALA n 
2 501 ASN n 
2 502 ALA n 
2 503 SER n 
2 504 LYS n 
2 505 LEU n 
2 506 GLU n 
2 507 THR n 
2 508 MET n 
2 509 ARG n 
2 510 SER n 
2 511 LEU n 
2 512 TRP n 
2 513 MET n 
2 514 SER n 
2 515 SER n 
2 516 CYS n 
2 517 SER n 
2 518 VAL n 
2 519 SER n 
2 520 PHE n 
2 521 GLY n 
2 522 ALA n 
2 523 CYS n 
2 524 LYS n 
2 525 LEU n 
2 526 LEU n 
2 527 GLY n 
2 528 GLN n 
2 529 LYS n 
2 530 MET n 
2 531 PRO n 
2 532 LYS n 
2 533 LEU n 
2 534 ASN n 
2 535 VAL n 
2 536 GLU n 
2 537 VAL n 
2 538 ILE n 
2 539 ASP n 
2 540 GLU n 
2 541 ARG n 
2 542 GLY n 
2 543 ALA n 
2 544 PRO n 
2 545 ASP n 
2 546 SER n 
2 547 ARG n 
2 548 PRO n 
2 549 GLU n 
2 550 SER n 
2 551 CYS n 
2 552 PRO n 
2 553 VAL n 
2 554 GLU n 
2 555 ARG n 
2 556 VAL n 
2 557 PHE n 
2 558 ILE n 
2 559 TYR n 
2 560 ARG n 
2 561 THR n 
2 562 VAL n 
2 563 ALA n 
2 564 GLY n 
2 565 PRO n 
2 566 ARG n 
2 567 PHE n 
2 568 ASP n 
2 569 MET n 
2 570 PRO n 
2 571 GLY n 
2 572 PHE n 
2 573 VAL n 
2 574 TRP n 
2 575 ASN n 
2 576 MET n 
2 577 ASP n 
2 578 GLN n 
2 579 ASP n 
2 580 SER n 
2 581 THR n 
2 582 MET n 
2 583 ARG n 
2 584 PHE n 
2 585 SER n 
2 586 ARG n 
2 587 GLN n 
2 588 ILE n 
2 589 ILE n 
2 590 THR n 
2 591 THR n 
2 592 ASN n 
2 593 GLY n 
2 594 LEU n 
3 1   GLN n 
3 2   VAL n 
3 3   VAL n 
3 4   GLY n 
3 5   TRP n 
3 6   PRO n 
3 7   PRO n 
3 8   VAL n 
3 9   ARG n 
3 10  ASN n 
3 11  TYR n 
3 12  ARG n 
3 13  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'thale cress' Arabidopsis 'SKP1A, ASK1, SKP1, UIP1' ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
2 1 sample ? ? ? 'thale cress' Arabidopsis 'TIR1, FBL1, WEI1'        ? ? ? ? ? ? 'Arabidopsis thaliana' 3702 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108 Spodoptera ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'IAA7 peptide and indole-3-acetic acid are from commercial sources. It naturally occurs in Arabidopsis thaliana' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SKP1A_ARATH Q39255 1 
;MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSD
DDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE

;
1  ? 
2 UNP TIR1_ARATH  Q570C0 2 
;MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFA
DFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKE
LDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEEL
GTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLW
VLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMT
RFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGC
DSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYR
TVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL
;
1  ? 
3 UNP IAA7_ARATH  Q38825 3 QVVGWPPVRNYRK 82 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P1Q A 1 ? 160 ? Q39255 1  ? 160 ? 1 160 
2 2 2P1Q B 1 ? 594 ? Q570C0 1  ? 594 ? 1 594 
3 3 2P1Q C 1 ? 13  ? Q38825 82 ? 94  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                                                                      
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ?                                                                      
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                                                                      
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                                                                      
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ?                                                                      
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                                                                      
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                                                                      
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ?                                                                      
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ?                                                                      
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ?                                                                      
'H2 O'           18.015  
IAC non-polymer         . '1H-INDOL-3-YLACETIC ACID'  'INDOLE ACETIC ACID'                                                   
'C10 H9 N O2'    175.184 
IHP non-polymer         . 'INOSITOL HEXAKISPHOSPHATE' 'MYO-INOSITOL HEXAKISPHOSPHATE; INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE' 
'C6 H18 O24 P6'  660.035 
ILE 'L-peptide linking' y ISOLEUCINE                  ?                                                                      
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                                                                      
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ?                                                                      
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ?                                                                      
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ?                                                                      
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ?                                                                      
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ?                                                                      
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ?                                                                      
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                                                                      
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                                                                      
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ?                                                                      
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2P1Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.02 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    
'100 mM BTP, 10% 14% PEG 20,000, 200 mM NaCl, and 5 mM DTT, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2006-09-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2P1Q 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.91 
_reflns.d_resolution_low             50 
_reflns.number_all                   69793 
_reflns.number_obs                   69793 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.039 
_reflns.pdbx_netI_over_sigmaI        33 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.91 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.249 
_reflns_shell.meanI_over_sigI_obs    4.9 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2P1Q 
_refine.ls_number_reflns_obs                     69793 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.91 
_refine.ls_percent_reflns_obs                    94.44 
_refine.ls_R_factor_obs                          0.17386 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17177 
_refine.ls_R_factor_R_free                       0.21333 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3733 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               27.399 
_refine.aniso_B[1][1]                            0.53 
_refine.aniso_B[2][2]                            1.12 
_refine.aniso_B[3][3]                            -1.47 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.37 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY: 2P1M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.129 
_refine.pdbx_overall_ESU_R_Free                  0.128 
_refine.overall_SU_ML                            0.086 
_refine.overall_SU_B                             5.470 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5582 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             770 
_refine_hist.number_atoms_total               6401 
_refine_hist.d_res_high                       1.91 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 5747 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.634  1.988  ? 7796 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.826  5.000  ? 700  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.843 23.566 ? 244  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.518 15.000 ? 1014 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.329 15.000 ? 42   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.137  0.200  ? 891  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.020  ? 4247 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.211  0.200  ? 2787 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.312  0.200  ? 3909 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.163  0.200  ? 664  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.219  0.200  ? 51   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.168  0.200  ? 31   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.862  1.500  ? 3630 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.258  2.000  ? 5709 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.373  3.000  ? 2416 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.608  4.500  ? 2087 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.91 
_refine_ls_shell.d_res_low                        1.956 
_refine_ls_shell.number_reflns_R_work             4261 
_refine_ls_shell.R_factor_R_work                  0.209 
_refine_ls_shell.percent_reflns_obs               78.69 
_refine_ls_shell.R_factor_R_free                  0.255 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             219 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P1Q 
_struct.title                     'Mechanism of Auxin Perception by the TIR1 ubiquitin ligase' 
_struct.pdbx_descriptor           'SKP1-like protein 1A, TRANSPORT INHIBITOR RESPONSE 1 protein, Auxin-responsive protein IAA7' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P1Q 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'F-box, leucine rich repeat, Signaling protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 19  ? LEU A 24  ? GLU A 19  LEU A 24  1 ? 6  
HELX_P HELX_P2  2  SER A 26  ? VAL A 33  ? SER A 26  VAL A 33  1 ? 8  
HELX_P HELX_P3  3  THR A 48  ? HIS A 62  ? THR A 48  HIS A 62  1 ? 15 
HELX_P HELX_P4  4  ASP A 94  ? ASN A 109 ? ASP A 94  ASN A 109 1 ? 16 
HELX_P HELX_P5  5  ILE A 110 ? MET A 124 ? ILE A 110 MET A 124 1 ? 15 
HELX_P HELX_P6  6  THR A 129 ? PHE A 137 ? THR A 129 PHE A 137 1 ? 9  
HELX_P HELX_P7  7  THR A 144 ? PHE A 159 ? THR A 144 PHE A 159 1 ? 16 
HELX_P HELX_P8  8  PRO B 10  ? SER B 19  ? PRO B 10  SER B 19  1 ? 10 
HELX_P HELX_P9  9  LEU B 23  ? LEU B 32  ? LEU B 23  LEU B 32  1 ? 10 
HELX_P HELX_P10 10 CYS B 34  ? ARG B 45  ? CYS B 34  ARG B 45  1 ? 12 
HELX_P HELX_P11 11 SER B 57  ? PHE B 65  ? SER B 57  PHE B 65  1 ? 9  
HELX_P HELX_P12 12 PRO B 77  ? ASN B 83  ? PRO B 77  ASN B 83  5 ? 7  
HELX_P HELX_P13 13 VAL B 93  ? SER B 102 ? VAL B 93  SER B 102 1 ? 10 
HELX_P HELX_P14 14 THR B 118 ? PHE B 129 ? THR B 118 PHE B 129 1 ? 12 
HELX_P HELX_P15 15 THR B 145 ? CYS B 155 ? THR B 145 CYS B 155 1 ? 11 
HELX_P HELX_P16 16 SER B 172 ? PHE B 179 ? SER B 172 PHE B 179 5 ? 8  
HELX_P HELX_P17 17 SER B 199 ? CYS B 210 ? SER B 199 CYS B 210 1 ? 12 
HELX_P HELX_P18 18 PRO B 223 ? GLU B 225 ? PRO B 223 GLU B 225 5 ? 3  
HELX_P HELX_P19 19 LYS B 226 ? ALA B 234 ? LYS B 226 ALA B 234 1 ? 9  
HELX_P HELX_P20 20 ARG B 250 ? GLY B 263 ? ARG B 250 GLY B 263 1 ? 14 
HELX_P HELX_P21 21 VAL B 277 ? CYS B 288 ? VAL B 277 CYS B 288 5 ? 12 
HELX_P HELX_P22 22 GLN B 302 ? CYS B 311 ? GLN B 302 CYS B 311 1 ? 10 
HELX_P HELX_P23 23 ILE B 325 ? CYS B 337 ? ILE B 325 CYS B 337 1 ? 13 
HELX_P HELX_P24 24 THR B 360 ? CYS B 371 ? THR B 360 CYS B 371 1 ? 12 
HELX_P HELX_P25 25 THR B 385 ? ARG B 396 ? THR B 385 ARG B 396 1 ? 12 
HELX_P HELX_P26 26 LEU B 420 ? CYS B 431 ? LEU B 420 CYS B 431 1 ? 12 
HELX_P HELX_P27 27 THR B 444 ? ALA B 455 ? THR B 444 ALA B 455 1 ? 12 
HELX_P HELX_P28 28 SER B 469 ? CYS B 480 ? SER B 469 CYS B 480 1 ? 12 
HELX_P HELX_P29 29 GLY B 494 ? ASN B 501 ? GLY B 494 ASN B 501 1 ? 8  
HELX_P HELX_P30 30 ALA B 502 ? MET B 508 ? ALA B 502 MET B 508 5 ? 7  
HELX_P HELX_P31 31 SER B 519 ? MET B 530 ? SER B 519 MET B 530 1 ? 12 
HELX_P HELX_P32 32 ALA B 543 ? ARG B 547 ? ALA B 543 ARG B 547 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TRP 
_struct_mon_prot_cis.label_seq_id           5 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TRP 
_struct_mon_prot_cis.auth_seq_id            5 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    6 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     6 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 21 ? 
C ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? parallel      
B 2  3  ? parallel      
B 3  4  ? parallel      
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? parallel      
B 11 12 ? parallel      
B 12 13 ? parallel      
B 13 14 ? parallel      
B 14 15 ? parallel      
B 15 16 ? parallel      
B 16 17 ? parallel      
B 17 18 ? parallel      
B 18 19 ? anti-parallel 
B 19 20 ? anti-parallel 
B 20 21 ? anti-parallel 
C 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  SER A 15  ? VAL A 18  ? SER A 15  VAL A 18  
A 2  ILE A 6   ? LYS A 9   ? ILE A 6   LYS A 9   
A 3  VAL A 42  ? PRO A 43  ? VAL A 42  PRO A 43  
B 1  LYS B 47  ? ILE B 50  ? LYS B 47  ILE B 50  
B 2  SER B 70  ? LYS B 74  ? SER B 70  LYS B 74  
B 3  GLU B 109 ? LYS B 113 ? GLU B 109 LYS B 113 
B 4  VAL B 134 ? SER B 138 ? VAL B 134 SER B 138 
B 5  GLU B 160 ? ASP B 162 ? GLU B 160 ASP B 162 
B 6  SER B 188 ? ASN B 190 ? SER B 188 ASN B 190 
B 7  SER B 215 ? LYS B 217 ? SER B 215 LYS B 217 
B 8  GLU B 239 ? GLY B 241 ? GLU B 239 GLY B 241 
B 9  CYS B 269 ? SER B 271 ? CYS B 269 SER B 271 
B 10 THR B 293 ? ASN B 295 ? THR B 293 ASN B 295 
B 11 ARG B 318 ? LEU B 322 ? ARG B 318 LEU B 322 
B 12 GLU B 342 ? PHE B 346 ? GLU B 342 PHE B 346 
B 13 SER B 376 ? CYS B 381 ? SER B 376 CYS B 381 
B 14 ARG B 401 ? ILE B 406 ? ARG B 401 ILE B 406 
B 15 ARG B 436 ? SER B 438 ? ARG B 436 SER B 438 
B 16 MET B 460 ? ALA B 464 ? MET B 460 ALA B 464 
B 17 LYS B 485 ? ARG B 489 ? LYS B 485 ARG B 489 
B 18 SER B 510 ? SER B 514 ? SER B 510 SER B 514 
B 19 ARG B 555 ? ARG B 560 ? ARG B 555 ARG B 560 
B 20 LEU B 533 ? ILE B 538 ? LEU B 533 ILE B 538 
B 21 VAL B 573 ? ASN B 575 ? VAL B 573 ASN B 575 
C 1  GLU B 141 ? SER B 144 ? GLU B 141 SER B 144 
C 2  ASP B 167 ? ASP B 169 ? ASP B 167 ASP B 169 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O PHE A 16  ? O PHE A 16  N LEU A 8   ? N LEU A 8   
A 2  3  N LYS A 9   ? N LYS A 9   O VAL A 42  ? O VAL A 42  
B 1  2  N ILE B 50  ? N ILE B 50  O GLU B 72  ? O GLU B 72  
B 2  3  N VAL B 71  ? N VAL B 71  O GLU B 109 ? O GLU B 109 
B 3  4  N LEU B 112 ? N LEU B 112 O VAL B 136 ? O VAL B 136 
B 4  5  N LEU B 137 ? N LEU B 137 O ASP B 162 ? O ASP B 162 
B 5  6  N LEU B 161 ? N LEU B 161 O ASN B 190 ? O ASN B 190 
B 6  7  N LEU B 189 ? N LEU B 189 O LYS B 217 ? O LYS B 217 
B 7  8  N LEU B 216 ? N LEU B 216 O GLY B 241 ? O GLY B 241 
B 8  9  N LEU B 240 ? N LEU B 240 O CYS B 269 ? O CYS B 269 
B 9  10 N LEU B 270 ? N LEU B 270 O ASN B 295 ? O ASN B 295 
B 10 11 N LEU B 294 ? N LEU B 294 O ARG B 318 ? O ARG B 318 
B 11 12 N VAL B 321 ? N VAL B 321 O PHE B 346 ? O PHE B 346 
B 12 13 N VAL B 345 ? N VAL B 345 O LEU B 378 ? O LEU B 378 
B 13 14 N TYR B 379 ? N TYR B 379 O CYS B 405 ? O CYS B 405 
B 14 15 N PHE B 402 ? N PHE B 402 O ARG B 436 ? O ARG B 436 
B 15 16 N LEU B 437 ? N LEU B 437 O MET B 460 ? O MET B 460 
B 16 17 N VAL B 463 ? N VAL B 463 O GLU B 487 ? O GLU B 487 
B 17 18 N ILE B 488 ? N ILE B 488 O TRP B 512 ? O TRP B 512 
B 18 19 N LEU B 511 ? N LEU B 511 O ILE B 558 ? O ILE B 558 
B 19 20 O TYR B 559 ? O TYR B 559 N ASN B 534 ? N ASN B 534 
B 20 21 N VAL B 537 ? N VAL B 537 O TRP B 574 ? O TRP B 574 
C 1  2  N PHE B 143 ? N PHE B 143 O ASP B 169 ? O ASP B 169 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B IHP 801 ? 19 'BINDING SITE FOR RESIDUE IHP B 801' 
AC2 Software B IAC 901 ? 8  'BINDING SITE FOR RESIDUE IAC B 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 PHE B 49  ? PHE B 49   . ? 1_555 ? 
2  AC1 19 LYS B 74  ? LYS B 74   . ? 1_555 ? 
3  AC1 19 LYS B 113 ? LYS B 113  . ? 1_555 ? 
4  AC1 19 ARG B 114 ? ARG B 114  . ? 1_555 ? 
5  AC1 19 ARG B 344 ? ARG B 344  . ? 1_555 ? 
6  AC1 19 ARG B 401 ? ARG B 401  . ? 1_555 ? 
7  AC1 19 ARG B 403 ? ARG B 403  . ? 1_555 ? 
8  AC1 19 ARG B 436 ? ARG B 436  . ? 1_555 ? 
9  AC1 19 MET B 460 ? MET B 460  . ? 1_555 ? 
10 AC1 19 ARG B 484 ? ARG B 484  . ? 1_555 ? 
11 AC1 19 LYS B 485 ? LYS B 485  . ? 1_555 ? 
12 AC1 19 ARG B 509 ? ARG B 509  . ? 1_555 ? 
13 AC1 19 HOH G .   ? HOH B 999  . ? 1_555 ? 
14 AC1 19 HOH G .   ? HOH B 1006 . ? 1_555 ? 
15 AC1 19 HOH G .   ? HOH B 1163 . ? 1_555 ? 
16 AC1 19 HOH G .   ? HOH B 1273 . ? 1_555 ? 
17 AC1 19 HOH G .   ? HOH B 1401 . ? 1_555 ? 
18 AC1 19 HOH G .   ? HOH B 1491 . ? 1_555 ? 
19 AC1 19 HOH G .   ? HOH B 1564 . ? 1_555 ? 
20 AC2 8  PHE B 79  ? PHE B 79   . ? 1_555 ? 
21 AC2 8  ARG B 403 ? ARG B 403  . ? 1_555 ? 
22 AC2 8  LEU B 404 ? LEU B 404  . ? 1_555 ? 
23 AC2 8  SER B 438 ? SER B 438  . ? 1_555 ? 
24 AC2 8  LEU B 439 ? LEU B 439  . ? 1_555 ? 
25 AC2 8  HOH G .   ? HOH B 903  . ? 1_555 ? 
26 AC2 8  HOH G .   ? HOH B 905  . ? 1_555 ? 
27 AC2 8  PRO C 7   ? PRO C 7    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2P1Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2P1Q 
_atom_sites.fract_transf_matrix[1][1]   0.009881 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002472 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012125 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008243 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 5   ? 28.463  -179.347 -37.294 1.00 24.83 ? 5    LYS A N   1 
ATOM   2    C CA  . LYS A 1 5   ? 29.843  -179.865 -37.048 1.00 24.11 ? 5    LYS A CA  1 
ATOM   3    C C   . LYS A 1 5   ? 30.152  -179.809 -35.552 1.00 23.43 ? 5    LYS A C   1 
ATOM   4    O O   . LYS A 1 5   ? 31.104  -180.446 -35.080 1.00 23.83 ? 5    LYS A O   1 
ATOM   5    C CB  . LYS A 1 5   ? 30.910  -179.078 -37.839 1.00 23.96 ? 5    LYS A CB  1 
ATOM   6    C CG  . LYS A 1 5   ? 30.500  -178.619 -39.227 1.00 24.10 ? 5    LYS A CG  1 
ATOM   7    C CD  . LYS A 1 5   ? 31.580  -178.924 -40.273 1.00 23.85 ? 5    LYS A CD  1 
ATOM   8    C CE  . LYS A 1 5   ? 31.025  -178.677 -41.666 1.00 24.47 ? 5    LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 5   ? 31.753  -179.387 -42.768 1.00 26.76 ? 5    LYS A NZ  1 
ATOM   10   N N   . ILE A 1 6   ? 29.354  -179.048 -34.810 1.00 22.46 ? 6    ILE A N   1 
ATOM   11   C CA  . ILE A 1 6   ? 29.559  -178.918 -33.371 1.00 21.62 ? 6    ILE A CA  1 
ATOM   12   C C   . ILE A 1 6   ? 28.338  -179.351 -32.568 1.00 21.49 ? 6    ILE A C   1 
ATOM   13   O O   . ILE A 1 6   ? 27.212  -178.910 -32.840 1.00 21.18 ? 6    ILE A O   1 
ATOM   14   C CB  . ILE A 1 6   ? 29.979  -177.466 -32.968 1.00 21.26 ? 6    ILE A CB  1 
ATOM   15   C CG1 . ILE A 1 6   ? 31.340  -177.122 -33.593 1.00 21.01 ? 6    ILE A CG1 1 
ATOM   16   C CG2 . ILE A 1 6   ? 30.057  -177.307 -31.442 1.00 19.45 ? 6    ILE A CG2 1 
ATOM   17   C CD1 . ILE A 1 6   ? 31.641  -175.659 -33.583 1.00 20.88 ? 6    ILE A CD1 1 
ATOM   18   N N   . VAL A 1 7   ? 28.581  -180.195 -31.567 1.00 21.23 ? 7    VAL A N   1 
ATOM   19   C CA  . VAL A 1 7   ? 27.534  -180.609 -30.634 1.00 21.64 ? 7    VAL A CA  1 
ATOM   20   C C   . VAL A 1 7   ? 27.577  -179.772 -29.358 1.00 22.18 ? 7    VAL A C   1 
ATOM   21   O O   . VAL A 1 7   ? 28.630  -179.673 -28.687 1.00 22.72 ? 7    VAL A O   1 
ATOM   22   C CB  . VAL A 1 7   ? 27.601  -182.135 -30.293 1.00 21.69 ? 7    VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 7   ? 26.499  -182.516 -29.292 1.00 20.72 ? 7    VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 7   ? 27.487  -182.993 -31.572 1.00 20.57 ? 7    VAL A CG2 1 
ATOM   25   N N   . LEU A 1 8   ? 26.431  -179.159 -29.057 1.00 22.39 ? 8    LEU A N   1 
ATOM   26   C CA  . LEU A 1 8   ? 26.219  -178.398 -27.829 1.00 22.57 ? 8    LEU A CA  1 
ATOM   27   C C   . LEU A 1 8   ? 25.351  -179.217 -26.881 1.00 23.45 ? 8    LEU A C   1 
ATOM   28   O O   . LEU A 1 8   ? 24.341  -179.786 -27.305 1.00 23.80 ? 8    LEU A O   1 
ATOM   29   C CB  . LEU A 1 8   ? 25.507  -177.063 -28.131 1.00 21.48 ? 8    LEU A CB  1 
ATOM   30   C CG  . LEU A 1 8   ? 26.203  -176.201 -29.203 1.00 21.14 ? 8    LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 8   ? 25.407  -174.908 -29.509 1.00 18.75 ? 8    LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 8   ? 27.625  -175.895 -28.791 1.00 17.76 ? 8    LEU A CD2 1 
ATOM   33   N N   . LYS A 1 9   ? 25.731  -179.250 -25.606 1.00 23.44 ? 9    LYS A N   1 
ATOM   34   C CA  . LYS A 1 9   ? 24.933  -179.959 -24.595 1.00 23.90 ? 9    LYS A CA  1 
ATOM   35   C C   . LYS A 1 9   ? 24.338  -178.972 -23.615 1.00 22.67 ? 9    LYS A C   1 
ATOM   36   O O   . LYS A 1 9   ? 25.069  -178.195 -22.989 1.00 23.95 ? 9    LYS A O   1 
ATOM   37   C CB  . LYS A 1 9   ? 25.776  -180.992 -23.854 1.00 23.53 ? 9    LYS A CB  1 
ATOM   38   C CG  . LYS A 1 9   ? 25.872  -182.308 -24.562 1.00 26.39 ? 9    LYS A CG  1 
ATOM   39   C CD  . LYS A 1 9   ? 26.997  -183.126 -23.977 1.00 27.79 ? 9    LYS A CD  1 
ATOM   40   C CE  . LYS A 1 9   ? 27.009  -184.515 -24.573 1.00 29.03 ? 9    LYS A CE  1 
ATOM   41   N NZ  . LYS A 1 9   ? 28.169  -185.297 -24.057 1.00 30.57 ? 9    LYS A NZ  1 
ATOM   42   N N   . SER A 1 10  ? 23.012  -178.984 -23.512 1.00 21.89 ? 10   SER A N   1 
ATOM   43   C CA  . SER A 1 10  ? 22.279  -178.099 -22.621 1.00 21.41 ? 10   SER A CA  1 
ATOM   44   C C   . SER A 1 10  ? 22.394  -178.540 -21.148 1.00 21.21 ? 10   SER A C   1 
ATOM   45   O O   . SER A 1 10  ? 22.929  -179.617 -20.839 1.00 20.81 ? 10   SER A O   1 
ATOM   46   C CB  . SER A 1 10  ? 20.808  -178.030 -23.030 1.00 20.81 ? 10   SER A CB  1 
ATOM   47   O OG  . SER A 1 10  ? 20.097  -179.111 -22.443 1.00 20.76 ? 10   SER A OG  1 
ATOM   48   N N   . SER A 1 11  ? 21.898  -177.698 -20.239 1.00 20.42 ? 11   SER A N   1 
ATOM   49   C CA  . SER A 1 11  ? 21.926  -178.053 -18.813 1.00 19.73 ? 11   SER A CA  1 
ATOM   50   C C   . SER A 1 11  ? 20.969  -179.208 -18.519 1.00 19.43 ? 11   SER A C   1 
ATOM   51   O O   . SER A 1 11  ? 21.017  -179.830 -17.448 1.00 19.65 ? 11   SER A O   1 
ATOM   52   C CB  . SER A 1 11  ? 21.572  -176.846 -17.963 1.00 19.58 ? 11   SER A CB  1 
ATOM   53   O OG  . SER A 1 11  ? 20.256  -176.396 -18.229 1.00 19.19 ? 11   SER A OG  1 
ATOM   54   N N   . ASP A 1 12  ? 20.105  -179.503 -19.486 1.00 18.68 ? 12   ASP A N   1 
ATOM   55   C CA  . ASP A 1 12  ? 19.209  -180.664 -19.371 1.00 18.08 ? 12   ASP A CA  1 
ATOM   56   C C   . ASP A 1 12  ? 19.881  -181.940 -19.893 1.00 18.25 ? 12   ASP A C   1 
ATOM   57   O O   . ASP A 1 12  ? 19.281  -183.016 -19.872 1.00 17.92 ? 12   ASP A O   1 
ATOM   58   C CB  . ASP A 1 12  ? 17.926  -180.385 -20.133 1.00 17.51 ? 12   ASP A CB  1 
ATOM   59   C CG  . ASP A 1 12  ? 17.145  -179.244 -19.528 1.00 16.34 ? 12   ASP A CG  1 
ATOM   60   O OD1 . ASP A 1 12  ? 16.842  -179.316 -18.320 1.00 13.14 ? 12   ASP A OD1 1 
ATOM   61   O OD2 . ASP A 1 12  ? 16.852  -178.279 -20.254 1.00 14.67 ? 12   ASP A OD2 1 
ATOM   62   N N   . GLY A 1 13  ? 21.121  -181.793 -20.370 1.00 18.60 ? 13   GLY A N   1 
ATOM   63   C CA  . GLY A 1 13  ? 21.920  -182.933 -20.840 1.00 18.93 ? 13   GLY A CA  1 
ATOM   64   C C   . GLY A 1 13  ? 21.506  -183.452 -22.207 1.00 19.22 ? 13   GLY A C   1 
ATOM   65   O O   . GLY A 1 13  ? 21.782  -184.620 -22.545 1.00 18.94 ? 13   GLY A O   1 
ATOM   66   N N   . GLU A 1 14  ? 20.835  -182.598 -22.981 1.00 18.89 ? 14   GLU A N   1 
ATOM   67   C CA  . GLU A 1 14  ? 20.356  -182.948 -24.328 1.00 19.29 ? 14   GLU A CA  1 
ATOM   68   C C   . GLU A 1 14  ? 21.279  -182.348 -25.358 1.00 20.35 ? 14   GLU A C   1 
ATOM   69   O O   . GLU A 1 14  ? 21.720  -181.210 -25.207 1.00 20.95 ? 14   GLU A O   1 
ATOM   70   C CB  . GLU A 1 14  ? 18.976  -182.392 -24.562 1.00 19.44 ? 14   GLU A CB  1 
ATOM   71   C CG  . GLU A 1 14  ? 17.936  -182.976 -23.650 1.00 16.58 ? 14   GLU A CG  1 
ATOM   72   C CD  . GLU A 1 14  ? 16.564  -182.621 -24.116 1.00 18.09 ? 14   GLU A CD  1 
ATOM   73   O OE1 . GLU A 1 14  ? 15.842  -183.543 -24.531 1.00 13.83 ? 14   GLU A OE1 1 
ATOM   74   O OE2 . GLU A 1 14  ? 16.220  -181.405 -24.077 1.00 18.56 ? 14   GLU A OE2 1 
ATOM   75   N N   . SER A 1 15  ? 21.574  -183.123 -26.399 1.00 21.23 ? 15   SER A N   1 
ATOM   76   C CA  . SER A 1 15  ? 22.555  -182.712 -27.392 1.00 21.00 ? 15   SER A CA  1 
ATOM   77   C C   . SER A 1 15  ? 21.884  -182.058 -28.593 1.00 21.76 ? 15   SER A C   1 
ATOM   78   O O   . SER A 1 15  ? 20.871  -182.574 -29.122 1.00 21.37 ? 15   SER A O   1 
ATOM   79   C CB  . SER A 1 15  ? 23.373  -183.911 -27.867 1.00 21.34 ? 15   SER A CB  1 
ATOM   80   O OG  . SER A 1 15  ? 24.283  -184.322 -26.869 1.00 21.46 ? 15   SER A OG  1 
ATOM   81   N N   . PHE A 1 16  ? 22.503  -180.953 -29.030 1.00 21.81 ? 16   PHE A N   1 
ATOM   82   C CA  . PHE A 1 16  ? 22.102  -180.174 -30.186 1.00 22.09 ? 16   PHE A CA  1 
ATOM   83   C C   . PHE A 1 16  ? 23.251  -180.206 -31.178 1.00 22.53 ? 16   PHE A C   1 
ATOM   84   O O   . PHE A 1 16  ? 24.408  -179.982 -30.795 1.00 22.75 ? 16   PHE A O   1 
ATOM   85   C CB  . PHE A 1 16  ? 21.900  -178.704 -29.757 1.00 21.37 ? 16   PHE A CB  1 
ATOM   86   C CG  . PHE A 1 16  ? 20.657  -178.477 -28.951 1.00 22.67 ? 16   PHE A CG  1 
ATOM   87   C CD1 . PHE A 1 16  ? 20.604  -178.852 -27.594 1.00 24.46 ? 16   PHE A CD1 1 
ATOM   88   C CD2 . PHE A 1 16  ? 19.529  -177.890 -29.541 1.00 21.93 ? 16   PHE A CD2 1 
ATOM   89   C CE1 . PHE A 1 16  ? 19.435  -178.663 -26.850 1.00 23.11 ? 16   PHE A CE1 1 
ATOM   90   C CE2 . PHE A 1 16  ? 18.374  -177.678 -28.813 1.00 23.40 ? 16   PHE A CE2 1 
ATOM   91   C CZ  . PHE A 1 16  ? 18.322  -178.061 -27.463 1.00 24.53 ? 16   PHE A CZ  1 
ATOM   92   N N   . GLU A 1 17  ? 22.943  -180.438 -32.444 1.00 22.12 ? 17   GLU A N   1 
ATOM   93   C CA  . GLU A 1 17  ? 23.975  -180.425 -33.474 1.00 23.22 ? 17   GLU A CA  1 
ATOM   94   C C   . GLU A 1 17  ? 23.802  -179.225 -34.407 1.00 23.03 ? 17   GLU A C   1 
ATOM   95   O O   . GLU A 1 17  ? 22.776  -179.085 -35.087 1.00 22.85 ? 17   GLU A O   1 
ATOM   96   C CB  . GLU A 1 17  ? 23.994  -181.743 -34.261 1.00 23.25 ? 17   GLU A CB  1 
ATOM   97   C CG  . GLU A 1 17  ? 25.357  -182.072 -34.839 1.00 25.22 ? 17   GLU A CG  1 
ATOM   98   C CD  . GLU A 1 17  ? 25.291  -183.204 -35.849 1.00 28.37 ? 17   GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 17  ? 24.283  -183.272 -36.592 1.00 29.13 ? 17   GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 17  ? 26.246  -184.017 -35.902 1.00 28.74 ? 17   GLU A OE2 1 
ATOM   101  N N   . VAL A 1 18  ? 24.821  -178.370 -34.440 1.00 23.18 ? 18   VAL A N   1 
ATOM   102  C CA  . VAL A 1 18  ? 24.755  -177.137 -35.205 1.00 23.00 ? 18   VAL A CA  1 
ATOM   103  C C   . VAL A 1 18  ? 25.977  -176.969 -36.100 1.00 22.91 ? 18   VAL A C   1 
ATOM   104  O O   . VAL A 1 18  ? 27.078  -177.460 -35.779 1.00 22.48 ? 18   VAL A O   1 
ATOM   105  C CB  . VAL A 1 18  ? 24.620  -175.902 -34.273 1.00 22.97 ? 18   VAL A CB  1 
ATOM   106  C CG1 . VAL A 1 18  ? 23.384  -176.050 -33.364 1.00 25.16 ? 18   VAL A CG1 1 
ATOM   107  C CG2 . VAL A 1 18  ? 25.869  -175.728 -33.446 1.00 23.29 ? 18   VAL A CG2 1 
ATOM   108  N N   . GLU A 1 19  ? 25.776  -176.263 -37.212 1.00 22.49 ? 19   GLU A N   1 
ATOM   109  C CA  . GLU A 1 19  ? 26.866  -175.921 -38.112 1.00 22.94 ? 19   GLU A CA  1 
ATOM   110  C C   . GLU A 1 19  ? 27.867  -175.080 -37.347 1.00 22.69 ? 19   GLU A C   1 
ATOM   111  O O   . GLU A 1 19  ? 27.486  -174.260 -36.488 1.00 21.62 ? 19   GLU A O   1 
ATOM   112  C CB  . GLU A 1 19  ? 26.365  -175.120 -39.306 1.00 23.18 ? 19   GLU A CB  1 
ATOM   113  C CG  . GLU A 1 19  ? 25.536  -175.911 -40.296 1.00 25.37 ? 19   GLU A CG  1 
ATOM   114  C CD  . GLU A 1 19  ? 25.093  -175.061 -41.463 1.00 27.93 ? 19   GLU A CD  1 
ATOM   115  O OE1 . GLU A 1 19  ? 25.386  -173.833 -41.451 1.00 29.11 ? 19   GLU A OE1 1 
ATOM   116  O OE2 . GLU A 1 19  ? 24.456  -175.622 -42.392 1.00 29.56 ? 19   GLU A OE2 1 
ATOM   117  N N   . GLU A 1 20  ? 29.144  -175.287 -37.656 1.00 22.75 ? 20   GLU A N   1 
ATOM   118  C CA  . GLU A 1 20  ? 30.210  -174.558 -36.979 1.00 23.16 ? 20   GLU A CA  1 
ATOM   119  C C   . GLU A 1 20  ? 29.947  -173.056 -36.906 1.00 23.18 ? 20   GLU A C   1 
ATOM   120  O O   . GLU A 1 20  ? 30.066  -172.463 -35.828 1.00 23.60 ? 20   GLU A O   1 
ATOM   121  C CB  . GLU A 1 20  ? 31.560  -174.822 -37.634 1.00 23.24 ? 20   GLU A CB  1 
ATOM   122  C CG  . GLU A 1 20  ? 32.681  -174.118 -36.918 1.00 23.73 ? 20   GLU A CG  1 
ATOM   123  C CD  . GLU A 1 20  ? 33.986  -174.260 -37.626 1.00 25.31 ? 20   GLU A CD  1 
ATOM   124  O OE1 . GLU A 1 20  ? 34.219  -173.519 -38.612 1.00 25.70 ? 20   GLU A OE1 1 
ATOM   125  O OE2 . GLU A 1 20  ? 34.784  -175.107 -37.181 1.00 26.03 ? 20   GLU A OE2 1 
ATOM   126  N N   . ALA A 1 21  ? 29.587  -172.447 -38.039 1.00 23.42 ? 21   ALA A N   1 
ATOM   127  C CA  . ALA A 1 21  ? 29.375  -170.989 -38.108 1.00 23.18 ? 21   ALA A CA  1 
ATOM   128  C C   . ALA A 1 21  ? 28.266  -170.521 -37.170 1.00 23.31 ? 21   ALA A C   1 
ATOM   129  O O   . ALA A 1 21  ? 28.325  -169.409 -36.651 1.00 23.06 ? 21   ALA A O   1 
ATOM   130  C CB  . ALA A 1 21  ? 29.094  -170.532 -39.535 1.00 23.19 ? 21   ALA A CB  1 
ATOM   131  N N   . VAL A 1 22  ? 27.256  -171.365 -36.956 1.00 23.08 ? 22   VAL A N   1 
ATOM   132  C CA  . VAL A 1 22  ? 26.196  -171.048 -35.991 1.00 23.50 ? 22   VAL A CA  1 
ATOM   133  C C   . VAL A 1 22  ? 26.747  -171.046 -34.547 1.00 24.19 ? 22   VAL A C   1 
ATOM   134  O O   . VAL A 1 22  ? 26.578  -170.066 -33.806 1.00 24.93 ? 22   VAL A O   1 
ATOM   135  C CB  . VAL A 1 22  ? 24.973  -172.006 -36.131 1.00 23.49 ? 22   VAL A CB  1 
ATOM   136  C CG1 . VAL A 1 22  ? 23.985  -171.788 -34.996 1.00 23.25 ? 22   VAL A CG1 1 
ATOM   137  C CG2 . VAL A 1 22  ? 24.290  -171.811 -37.477 1.00 22.80 ? 22   VAL A CG2 1 
ATOM   138  N N   . ALA A 1 23  ? 27.434  -172.124 -34.165 1.00 24.08 ? 23   ALA A N   1 
ATOM   139  C CA  . ALA A 1 23  ? 28.060  -172.227 -32.842 1.00 23.68 ? 23   ALA A CA  1 
ATOM   140  C C   . ALA A 1 23  ? 29.048  -171.100 -32.545 1.00 23.71 ? 23   ALA A C   1 
ATOM   141  O O   . ALA A 1 23  ? 29.129  -170.622 -31.410 1.00 23.20 ? 23   ALA A O   1 
ATOM   142  C CB  . ALA A 1 23  ? 28.741  -173.583 -32.694 1.00 24.29 ? 23   ALA A CB  1 
ATOM   143  N N   . LEU A 1 24  ? 29.797  -170.681 -33.570 1.00 23.74 ? 24   LEU A N   1 
ATOM   144  C CA  . LEU A 1 24  ? 30.846  -169.660 -33.427 1.00 23.04 ? 24   LEU A CA  1 
ATOM   145  C C   . LEU A 1 24  ? 30.293  -168.240 -33.344 1.00 22.78 ? 24   LEU A C   1 
ATOM   146  O O   . LEU A 1 24  ? 31.051  -167.283 -33.143 1.00 21.86 ? 24   LEU A O   1 
ATOM   147  C CB  . LEU A 1 24  ? 31.889  -169.772 -34.550 1.00 23.29 ? 24   LEU A CB  1 
ATOM   148  C CG  . LEU A 1 24  ? 32.811  -171.002 -34.601 1.00 22.80 ? 24   LEU A CG  1 
ATOM   149  C CD1 . LEU A 1 24  ? 33.959  -170.717 -35.546 1.00 22.67 ? 24   LEU A CD1 1 
ATOM   150  C CD2 . LEU A 1 24  ? 33.343  -171.400 -33.221 1.00 22.51 ? 24   LEU A CD2 1 
ATOM   151  N N   . GLU A 1 25  ? 28.972  -168.107 -33.458 1.00 22.46 ? 25   GLU A N   1 
ATOM   152  C CA  . GLU A 1 25  ? 28.295  -166.841 -33.172 1.00 21.95 ? 25   GLU A CA  1 
ATOM   153  C C   . GLU A 1 25  ? 28.386  -166.481 -31.693 1.00 21.66 ? 25   GLU A C   1 
ATOM   154  O O   . GLU A 1 25  ? 28.262  -165.316 -31.329 1.00 20.07 ? 25   GLU A O   1 
ATOM   155  C CB  . GLU A 1 25  ? 26.830  -166.913 -33.603 1.00 22.78 ? 25   GLU A CB  1 
ATOM   156  C CG  . GLU A 1 25  ? 26.645  -166.773 -35.108 1.00 22.50 ? 25   GLU A CG  1 
ATOM   157  C CD  . GLU A 1 25  ? 27.206  -165.454 -35.607 1.00 25.29 ? 25   GLU A CD  1 
ATOM   158  O OE1 . GLU A 1 25  ? 28.301  -165.459 -36.208 1.00 24.81 ? 25   GLU A OE1 1 
ATOM   159  O OE2 . GLU A 1 25  ? 26.575  -164.403 -35.359 1.00 26.79 ? 25   GLU A OE2 1 
ATOM   160  N N   . SER A 1 26  ? 28.564  -167.506 -30.858 1.00 21.34 ? 26   SER A N   1 
ATOM   161  C CA  . SER A 1 26  ? 28.727  -167.358 -29.414 1.00 21.59 ? 26   SER A CA  1 
ATOM   162  C C   . SER A 1 26  ? 30.201  -167.292 -29.155 1.00 21.42 ? 26   SER A C   1 
ATOM   163  O O   . SER A 1 26  ? 30.926  -168.218 -29.514 1.00 21.45 ? 26   SER A O   1 
ATOM   164  C CB  . SER A 1 26  ? 28.155  -168.579 -28.691 1.00 21.50 ? 26   SER A CB  1 
ATOM   165  O OG  . SER A 1 26  ? 28.618  -168.655 -27.339 1.00 22.31 ? 26   SER A OG  1 
ATOM   166  N N   . GLN A 1 27  ? 30.651  -166.201 -28.551 1.00 21.31 ? 27   GLN A N   1 
ATOM   167  C CA  . GLN A 1 27  ? 32.072  -166.047 -28.249 1.00 21.53 ? 27   GLN A CA  1 
ATOM   168  C C   . GLN A 1 27  ? 32.498  -167.039 -27.167 1.00 21.21 ? 27   GLN A C   1 
ATOM   169  O O   . GLN A 1 27  ? 33.615  -167.561 -27.197 1.00 21.00 ? 27   GLN A O   1 
ATOM   170  C CB  . GLN A 1 27  ? 32.395  -164.603 -27.873 1.00 20.99 ? 27   GLN A CB  1 
ATOM   171  C CG  . GLN A 1 27  ? 32.026  -163.621 -28.984 1.00 21.63 ? 27   GLN A CG  1 
ATOM   172  C CD  . GLN A 1 27  ? 32.487  -162.198 -28.704 1.00 22.45 ? 27   GLN A CD  1 
ATOM   173  O OE1 . GLN A 1 27  ? 33.559  -161.976 -28.132 1.00 23.47 ? 27   GLN A OE1 1 
ATOM   174  N NE2 . GLN A 1 27  ? 31.677  -161.226 -29.115 1.00 24.52 ? 27   GLN A NE2 1 
ATOM   175  N N   . THR A 1 28  ? 31.584  -167.319 -26.239 1.00 20.89 ? 28   THR A N   1 
ATOM   176  C CA  . THR A 1 28  ? 31.810  -168.312 -25.187 1.00 20.78 ? 28   THR A CA  1 
ATOM   177  C C   . THR A 1 28  ? 32.031  -169.724 -25.780 1.00 21.25 ? 28   THR A C   1 
ATOM   178  O O   . THR A 1 28  ? 32.999  -170.406 -25.436 1.00 21.64 ? 28   THR A O   1 
ATOM   179  C CB  . THR A 1 28  ? 30.645  -168.297 -24.161 1.00 21.06 ? 28   THR A CB  1 
ATOM   180  O OG1 . THR A 1 28  ? 30.487  -166.969 -23.628 1.00 20.44 ? 28   THR A OG1 1 
ATOM   181  C CG2 . THR A 1 28  ? 30.893  -169.275 -23.022 1.00 20.37 ? 28   THR A CG2 1 
ATOM   182  N N   . ILE A 1 29  ? 31.144  -170.166 -26.670 1.00 21.48 ? 29   ILE A N   1 
ATOM   183  C CA  . ILE A 1 29  ? 31.382  -171.449 -27.377 1.00 21.06 ? 29   ILE A CA  1 
ATOM   184  C C   . ILE A 1 29  ? 32.673  -171.373 -28.224 1.00 21.36 ? 29   ILE A C   1 
ATOM   185  O O   . ILE A 1 29  ? 33.507  -172.297 -28.199 1.00 21.37 ? 29   ILE A O   1 
ATOM   186  C CB  . ILE A 1 29  ? 30.177  -171.898 -28.196 1.00 21.15 ? 29   ILE A CB  1 
ATOM   187  C CG1 . ILE A 1 29  ? 29.011  -172.184 -27.243 1.00 20.11 ? 29   ILE A CG1 1 
ATOM   188  C CG2 . ILE A 1 29  ? 30.512  -173.179 -29.010 1.00 19.33 ? 29   ILE A CG2 1 
ATOM   189  C CD1 . ILE A 1 29  ? 27.668  -172.104 -27.888 1.00 19.61 ? 29   ILE A CD1 1 
ATOM   190  N N   . ALA A 1 30  ? 32.860  -170.253 -28.920 1.00 20.96 ? 30   ALA A N   1 
ATOM   191  C CA  . ALA A 1 30  ? 34.065  -170.045 -29.723 1.00 20.62 ? 30   ALA A CA  1 
ATOM   192  C C   . ALA A 1 30  ? 35.326  -170.359 -28.928 1.00 20.48 ? 30   ALA A C   1 
ATOM   193  O O   . ALA A 1 30  ? 36.244  -171.034 -29.429 1.00 20.11 ? 30   ALA A O   1 
ATOM   194  C CB  . ALA A 1 30  ? 34.121  -168.618 -30.256 1.00 20.34 ? 30   ALA A CB  1 
ATOM   195  N N   . HIS A 1 31  ? 35.367  -169.869 -27.686 1.00 20.53 ? 31   HIS A N   1 
ATOM   196  C CA  . HIS A 1 31  ? 36.578  -169.979 -26.857 1.00 20.49 ? 31   HIS A CA  1 
ATOM   197  C C   . HIS A 1 31  ? 36.801  -171.413 -26.341 1.00 20.70 ? 31   HIS A C   1 
ATOM   198  O O   . HIS A 1 31  ? 37.942  -171.909 -26.308 1.00 20.58 ? 31   HIS A O   1 
ATOM   199  C CB  . HIS A 1 31  ? 36.539  -168.967 -25.704 1.00 20.17 ? 31   HIS A CB  1 
ATOM   200  C CG  . HIS A 1 31  ? 37.856  -168.790 -25.023 1.00 19.61 ? 31   HIS A CG  1 
ATOM   201  N ND1 . HIS A 1 31  ? 38.118  -169.287 -23.767 1.00 19.73 ? 31   HIS A ND1 1 
ATOM   202  C CD2 . HIS A 1 31  ? 38.994  -168.182 -25.430 1.00 17.54 ? 31   HIS A CD2 1 
ATOM   203  C CE1 . HIS A 1 31  ? 39.359  -168.988 -23.424 1.00 18.27 ? 31   HIS A CE1 1 
ATOM   204  N NE2 . HIS A 1 31  ? 39.915  -168.323 -24.420 1.00 18.93 ? 31   HIS A NE2 1 
ATOM   205  N N   . MET A 1 32  ? 35.700  -172.047 -25.943 1.00 21.03 ? 32   MET A N   1 
ATOM   206  C CA  . MET A 1 32  ? 35.619  -173.474 -25.593 1.00 21.35 ? 32   MET A CA  1 
ATOM   207  C C   . MET A 1 32  ? 35.986  -174.402 -26.773 1.00 21.40 ? 32   MET A C   1 
ATOM   208  O O   . MET A 1 32  ? 36.760  -175.350 -26.600 1.00 21.47 ? 32   MET A O   1 
ATOM   209  C CB  . MET A 1 32  ? 34.206  -173.806 -25.084 1.00 21.18 ? 32   MET A CB  1 
ATOM   210  C CG  . MET A 1 32  ? 33.860  -173.265 -23.680 1.00 21.18 ? 32   MET A CG  1 
ATOM   211  S SD  . MET A 1 32  ? 32.063  -173.259 -23.377 1.00 21.33 ? 32   MET A SD  1 
ATOM   212  C CE  . MET A 1 32  ? 31.997  -173.170 -21.589 1.00 21.20 ? 32   MET A CE  1 
ATOM   213  N N   . VAL A 1 33  ? 35.430  -174.119 -27.955 1.00 21.22 ? 33   VAL A N   1 
ATOM   214  C CA  . VAL A 1 33  ? 35.827  -174.767 -29.222 1.00 21.48 ? 33   VAL A CA  1 
ATOM   215  C C   . VAL A 1 33  ? 37.295  -174.482 -29.556 1.00 21.83 ? 33   VAL A C   1 
ATOM   216  O O   . VAL A 1 33  ? 38.087  -175.404 -29.744 1.00 22.01 ? 33   VAL A O   1 
ATOM   217  C CB  . VAL A 1 33  ? 34.950  -174.289 -30.407 1.00 21.56 ? 33   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 33  ? 35.596  -174.613 -31.754 1.00 21.59 ? 33   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 33  ? 33.557  -174.895 -30.323 1.00 21.12 ? 33   VAL A CG2 1 
ATOM   220  N N   . ASP A 1 39  ? 35.992  -183.348 -29.842 1.00 26.90 ? 39   ASP A N   1 
ATOM   221  C CA  . ASP A 1 39  ? 34.640  -182.878 -29.552 1.00 26.87 ? 39   ASP A CA  1 
ATOM   222  C C   . ASP A 1 39  ? 33.672  -184.011 -29.169 1.00 26.47 ? 39   ASP A C   1 
ATOM   223  O O   . ASP A 1 39  ? 33.070  -184.655 -30.038 1.00 26.41 ? 39   ASP A O   1 
ATOM   224  C CB  . ASP A 1 39  ? 34.090  -182.046 -30.726 1.00 27.16 ? 39   ASP A CB  1 
ATOM   225  C CG  . ASP A 1 39  ? 33.938  -180.562 -30.383 1.00 28.29 ? 39   ASP A CG  1 
ATOM   226  O OD1 . ASP A 1 39  ? 34.684  -179.727 -30.952 1.00 29.49 ? 39   ASP A OD1 1 
ATOM   227  O OD2 . ASP A 1 39  ? 33.071  -180.232 -29.538 1.00 29.32 ? 39   ASP A OD2 1 
ATOM   228  N N   . ASN A 1 40  ? 33.548  -184.255 -27.863 1.00 25.95 ? 40   ASN A N   1 
ATOM   229  C CA  . ASN A 1 40  ? 32.495  -185.118 -27.327 1.00 25.54 ? 40   ASN A CA  1 
ATOM   230  C C   . ASN A 1 40  ? 31.221  -184.312 -27.065 1.00 25.27 ? 40   ASN A C   1 
ATOM   231  O O   . ASN A 1 40  ? 30.143  -184.882 -26.904 1.00 25.15 ? 40   ASN A O   1 
ATOM   232  C CB  . ASN A 1 40  ? 32.958  -185.834 -26.048 1.00 25.52 ? 40   ASN A CB  1 
ATOM   233  C CG  . ASN A 1 40  ? 33.569  -187.222 -26.327 1.00 25.74 ? 40   ASN A CG  1 
ATOM   234  O OD1 . ASN A 1 40  ? 34.337  -187.416 -27.284 1.00 25.81 ? 40   ASN A OD1 1 
ATOM   235  N ND2 . ASN A 1 40  ? 33.230  -188.190 -25.475 1.00 25.64 ? 40   ASN A ND2 1 
ATOM   236  N N   . GLY A 1 41  ? 31.359  -182.985 -27.042 1.00 24.80 ? 41   GLY A N   1 
ATOM   237  C CA  . GLY A 1 41  ? 30.237  -182.059 -26.805 1.00 25.09 ? 41   GLY A CA  1 
ATOM   238  C C   . GLY A 1 41  ? 30.682  -180.892 -25.944 1.00 24.56 ? 41   GLY A C   1 
ATOM   239  O O   . GLY A 1 41  ? 31.526  -181.050 -25.055 1.00 25.19 ? 41   GLY A O   1 
ATOM   240  N N   . VAL A 1 42  ? 30.146  -179.717 -26.236 1.00 23.94 ? 42   VAL A N   1 
ATOM   241  C CA  . VAL A 1 42  ? 30.431  -178.516 -25.468 1.00 23.16 ? 42   VAL A CA  1 
ATOM   242  C C   . VAL A 1 42  ? 29.340  -178.429 -24.393 1.00 22.58 ? 42   VAL A C   1 
ATOM   243  O O   . VAL A 1 42  ? 28.207  -178.105 -24.726 1.00 22.02 ? 42   VAL A O   1 
ATOM   244  C CB  . VAL A 1 42  ? 30.363  -177.248 -26.376 1.00 23.58 ? 42   VAL A CB  1 
ATOM   245  C CG1 . VAL A 1 42  ? 30.790  -175.994 -25.602 1.00 23.29 ? 42   VAL A CG1 1 
ATOM   246  C CG2 . VAL A 1 42  ? 31.193  -177.425 -27.648 1.00 23.16 ? 42   VAL A CG2 1 
ATOM   247  N N   . PRO A 1 43  ? 29.668  -178.733 -23.112 1.00 22.43 ? 43   PRO A N   1 
ATOM   248  C CA  . PRO A 1 43  ? 28.616  -178.633 -22.088 1.00 22.61 ? 43   PRO A CA  1 
ATOM   249  C C   . PRO A 1 43  ? 28.250  -177.171 -21.800 1.00 23.02 ? 43   PRO A C   1 
ATOM   250  O O   . PRO A 1 43  ? 29.140  -176.302 -21.724 1.00 23.12 ? 43   PRO A O   1 
ATOM   251  C CB  . PRO A 1 43  ? 29.237  -179.299 -20.847 1.00 22.82 ? 43   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 43  ? 30.589  -179.815 -21.254 1.00 21.85 ? 43   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 43  ? 30.967  -179.153 -22.540 1.00 22.26 ? 43   PRO A CD  1 
ATOM   254  N N   . LEU A 1 44  ? 26.955  -176.898 -21.662 1.00 23.13 ? 44   LEU A N   1 
ATOM   255  C CA  . LEU A 1 44  ? 26.480  -175.542 -21.361 1.00 23.77 ? 44   LEU A CA  1 
ATOM   256  C C   . LEU A 1 44  ? 25.601  -175.560 -20.094 1.00 23.85 ? 44   LEU A C   1 
ATOM   257  O O   . LEU A 1 44  ? 24.376  -175.561 -20.187 1.00 24.06 ? 44   LEU A O   1 
ATOM   258  C CB  . LEU A 1 44  ? 25.741  -174.944 -22.579 1.00 23.85 ? 44   LEU A CB  1 
ATOM   259  C CG  . LEU A 1 44  ? 26.570  -174.822 -23.870 1.00 23.68 ? 44   LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 44  ? 25.717  -174.441 -25.068 1.00 21.28 ? 44   LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 44  ? 27.779  -173.842 -23.688 1.00 21.89 ? 44   LEU A CD2 1 
ATOM   262  N N   . PRO A 1 45  ? 26.234  -175.599 -18.908 1.00 23.80 ? 45   PRO A N   1 
ATOM   263  C CA  . PRO A 1 45  ? 25.480  -175.783 -17.662 1.00 24.30 ? 45   PRO A CA  1 
ATOM   264  C C   . PRO A 1 45  ? 24.502  -174.652 -17.268 1.00 24.79 ? 45   PRO A C   1 
ATOM   265  O O   . PRO A 1 45  ? 23.625  -174.883 -16.422 1.00 24.77 ? 45   PRO A O   1 
ATOM   266  C CB  . PRO A 1 45  ? 26.584  -175.936 -16.601 1.00 24.13 ? 45   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 45  ? 27.789  -175.286 -17.183 1.00 24.01 ? 45   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 45  ? 27.687  -175.510 -18.669 1.00 24.02 ? 45   PRO A CD  1 
ATOM   269  N N   . ASN A 1 46  ? 24.659  -173.455 -17.848 1.00 24.84 ? 46   ASN A N   1 
ATOM   270  C CA  . ASN A 1 46  ? 23.826  -172.303 -17.486 1.00 25.54 ? 46   ASN A CA  1 
ATOM   271  C C   . ASN A 1 46  ? 22.734  -171.965 -18.514 1.00 26.70 ? 46   ASN A C   1 
ATOM   272  O O   . ASN A 1 46  ? 22.103  -170.870 -18.463 1.00 25.68 ? 46   ASN A O   1 
ATOM   273  C CB  . ASN A 1 46  ? 24.718  -171.082 -17.203 1.00 26.03 ? 46   ASN A CB  1 
ATOM   274  C CG  . ASN A 1 46  ? 25.787  -171.376 -16.161 1.00 26.37 ? 46   ASN A CG  1 
ATOM   275  O OD1 . ASN A 1 46  ? 25.759  -172.415 -15.489 1.00 27.22 ? 46   ASN A OD1 1 
ATOM   276  N ND2 . ASN A 1 46  ? 26.732  -170.463 -16.020 1.00 29.23 ? 46   ASN A ND2 1 
ATOM   277  N N   . VAL A 1 47  ? 22.556  -172.881 -19.461 1.00 25.43 ? 47   VAL A N   1 
ATOM   278  C CA  . VAL A 1 47  ? 21.589  -172.726 -20.545 1.00 27.68 ? 47   VAL A CA  1 
ATOM   279  C C   . VAL A 1 47  ? 20.732  -173.995 -20.719 1.00 25.87 ? 47   VAL A C   1 
ATOM   280  O O   . VAL A 1 47  ? 21.196  -175.093 -21.047 1.00 27.35 ? 47   VAL A O   1 
ATOM   281  C CB  . VAL A 1 47  ? 22.226  -172.393 -21.915 1.00 28.07 ? 47   VAL A CB  1 
ATOM   282  C CG1 . VAL A 1 47  ? 21.122  -172.109 -22.940 1.00 31.48 ? 47   VAL A CG1 1 
ATOM   283  C CG2 . VAL A 1 47  ? 23.093  -171.206 -21.794 1.00 29.11 ? 47   VAL A CG2 1 
ATOM   284  N N   . THR A 1 48  ? 19.456  -173.783 -20.516 1.00 25.53 ? 48   THR A N   1 
ATOM   285  C CA  . THR A 1 48  ? 18.420  -174.791 -20.626 1.00 25.03 ? 48   THR A CA  1 
ATOM   286  C C   . THR A 1 48  ? 18.229  -175.183 -22.109 1.00 25.80 ? 48   THR A C   1 
ATOM   287  O O   . THR A 1 48  ? 18.538  -174.416 -23.025 1.00 24.60 ? 48   THR A O   1 
ATOM   288  C CB  . THR A 1 48  ? 17.167  -174.108 -20.038 1.00 24.63 ? 48   THR A CB  1 
ATOM   289  O OG1 . THR A 1 48  ? 16.627  -174.846 -18.946 1.00 28.41 ? 48   THR A OG1 1 
ATOM   290  C CG2 . THR A 1 48  ? 16.153  -173.743 -21.047 1.00 23.84 ? 48   THR A CG2 1 
ATOM   291  N N   . SER A 1 49  ? 17.696  -176.372 -22.343 1.00 23.61 ? 49   SER A N   1 
ATOM   292  C CA  . SER A 1 49  ? 17.344  -176.765 -23.714 1.00 25.83 ? 49   SER A CA  1 
ATOM   293  C C   . SER A 1 49  ? 16.326  -175.863 -24.388 1.00 24.21 ? 49   SER A C   1 
ATOM   294  O O   . SER A 1 49  ? 16.461  -175.553 -25.576 1.00 23.68 ? 49   SER A O   1 
ATOM   295  C CB  . SER A 1 49  ? 16.752  -178.146 -23.720 1.00 23.29 ? 49   SER A CB  1 
ATOM   296  O OG  . SER A 1 49  ? 17.770  -179.089 -23.382 1.00 30.09 ? 49   SER A OG  1 
ATOM   297  N N   . LYS A 1 50  ? 15.263  -175.513 -23.652 1.00 23.66 ? 50   LYS A N   1 
ATOM   298  C CA  . LYS A 1 50  ? 14.240  -174.648 -24.194 1.00 22.83 ? 50   LYS A CA  1 
ATOM   299  C C   . LYS A 1 50  ? 14.935  -173.415 -24.740 1.00 22.70 ? 50   LYS A C   1 
ATOM   300  O O   . LYS A 1 50  ? 14.725  -173.049 -25.885 1.00 23.15 ? 50   LYS A O   1 
ATOM   301  C CB  . LYS A 1 50  ? 13.216  -174.258 -23.124 1.00 22.93 ? 50   LYS A CB  1 
ATOM   302  C CG  . LYS A 1 50  ? 12.146  -173.289 -23.623 1.00 21.64 ? 50   LYS A CG  1 
ATOM   303  C CD  . LYS A 1 50  ? 11.089  -173.064 -22.561 1.00 23.45 ? 50   LYS A CD  1 
ATOM   304  C CE  . LYS A 1 50  ? 10.676  -171.608 -22.473 1.00 23.99 ? 50   LYS A CE  1 
ATOM   305  N NZ  . LYS A 1 50  ? 9.894   -171.401 -21.194 1.00 25.93 ? 50   LYS A NZ  1 
ATOM   306  N N   . ILE A 1 51  ? 15.802  -172.812 -23.931 1.00 21.73 ? 51   ILE A N   1 
ATOM   307  C CA  . ILE A 1 51  ? 16.404  -171.512 -24.292 1.00 22.19 ? 51   ILE A CA  1 
ATOM   308  C C   . ILE A 1 51  ? 17.566  -171.691 -25.276 1.00 21.98 ? 51   ILE A C   1 
ATOM   309  O O   . ILE A 1 51  ? 17.730  -170.867 -26.175 1.00 22.54 ? 51   ILE A O   1 
ATOM   310  C CB  . ILE A 1 51  ? 16.706  -170.634 -23.051 1.00 21.51 ? 51   ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 51  ? 15.436  -169.893 -22.588 1.00 23.49 ? 51   ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 51  ? 17.604  -169.418 -23.395 1.00 22.23 ? 51   ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 51  ? 14.375  -170.706 -21.979 1.00 29.44 ? 51   ILE A CD1 1 
ATOM   314  N N   . LEU A 1 52  ? 18.349  -172.763 -25.147 1.00 21.31 ? 52   LEU A N   1 
ATOM   315  C CA  . LEU A 1 52  ? 19.331  -173.099 -26.211 1.00 21.13 ? 52   LEU A CA  1 
ATOM   316  C C   . LEU A 1 52  ? 18.653  -173.298 -27.603 1.00 21.51 ? 52   LEU A C   1 
ATOM   317  O O   . LEU A 1 52  ? 19.189  -172.852 -28.620 1.00 20.51 ? 52   LEU A O   1 
ATOM   318  C CB  . LEU A 1 52  ? 20.133  -174.376 -25.861 1.00 21.25 ? 52   LEU A CB  1 
ATOM   319  C CG  . LEU A 1 52  ? 21.397  -174.716 -26.680 1.00 21.48 ? 52   LEU A CG  1 
ATOM   320  C CD1 . LEU A 1 52  ? 22.408  -173.523 -26.620 1.00 22.77 ? 52   LEU A CD1 1 
ATOM   321  C CD2 . LEU A 1 52  ? 22.094  -175.974 -26.207 1.00 20.06 ? 52   LEU A CD2 1 
ATOM   322  N N   . ALA A 1 53  ? 17.515  -173.993 -27.640 1.00 21.01 ? 53   ALA A N   1 
ATOM   323  C CA  . ALA A 1 53  ? 16.720  -174.113 -28.873 1.00 21.68 ? 53   ALA A CA  1 
ATOM   324  C C   . ALA A 1 53  ? 16.456  -172.740 -29.515 1.00 22.09 ? 53   ALA A C   1 
ATOM   325  O O   . ALA A 1 53  ? 16.692  -172.556 -30.716 1.00 22.86 ? 53   ALA A O   1 
ATOM   326  C CB  . ALA A 1 53  ? 15.408  -174.818 -28.609 1.00 21.74 ? 53   ALA A CB  1 
ATOM   327  N N   . LYS A 1 54  ? 15.944  -171.805 -28.712 1.00 21.80 ? 54   LYS A N   1 
ATOM   328  C CA  . LYS A 1 54  ? 15.609  -170.437 -29.155 1.00 21.76 ? 54   LYS A CA  1 
ATOM   329  C C   . LYS A 1 54  ? 16.866  -169.693 -29.642 1.00 22.03 ? 54   LYS A C   1 
ATOM   330  O O   . LYS A 1 54  ? 16.855  -169.060 -30.697 1.00 22.65 ? 54   LYS A O   1 
ATOM   331  C CB  . LYS A 1 54  ? 14.907  -169.687 -28.017 1.00 21.36 ? 54   LYS A CB  1 
ATOM   332  C CG  . LYS A 1 54  ? 14.456  -168.264 -28.342 1.00 21.88 ? 54   LYS A CG  1 
ATOM   333  C CD  . LYS A 1 54  ? 12.940  -168.102 -28.321 1.00 24.26 ? 54   LYS A CD  1 
ATOM   334  C CE  . LYS A 1 54  ? 12.325  -168.190 -29.717 1.00 24.87 ? 54   LYS A CE  1 
ATOM   335  N NZ  . LYS A 1 54  ? 11.163  -167.253 -29.915 1.00 24.78 ? 54   LYS A NZ  1 
ATOM   336  N N   . VAL A 1 55  ? 17.952  -169.778 -28.878 1.00 22.35 ? 55   VAL A N   1 
ATOM   337  C CA  . VAL A 1 55  ? 19.232  -169.180 -29.268 1.00 22.52 ? 55   VAL A CA  1 
ATOM   338  C C   . VAL A 1 55  ? 19.720  -169.690 -30.633 1.00 23.10 ? 55   VAL A C   1 
ATOM   339  O O   . VAL A 1 55  ? 20.175  -168.913 -31.479 1.00 23.93 ? 55   VAL A O   1 
ATOM   340  C CB  . VAL A 1 55  ? 20.350  -169.432 -28.201 1.00 23.03 ? 55   VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 55  ? 21.728  -169.015 -28.763 1.00 20.96 ? 55   VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 55  ? 20.067  -168.643 -26.890 1.00 21.73 ? 55   VAL A CG2 1 
ATOM   343  N N   . ILE A 1 56  ? 19.660  -171.004 -30.822 1.00 23.00 ? 56   ILE A N   1 
ATOM   344  C CA  . ILE A 1 56  ? 20.032  -171.631 -32.089 1.00 22.66 ? 56   ILE A CA  1 
ATOM   345  C C   . ILE A 1 56  ? 19.152  -171.145 -33.251 1.00 23.22 ? 56   ILE A C   1 
ATOM   346  O O   . ILE A 1 56  ? 19.675  -170.816 -34.324 1.00 23.97 ? 56   ILE A O   1 
ATOM   347  C CB  . ILE A 1 56  ? 20.078  -173.185 -31.955 1.00 22.32 ? 56   ILE A CB  1 
ATOM   348  C CG1 . ILE A 1 56  ? 21.236  -173.579 -31.012 1.00 22.26 ? 56   ILE A CG1 1 
ATOM   349  C CG2 . ILE A 1 56  ? 20.222  -173.836 -33.324 1.00 22.11 ? 56   ILE A CG2 1 
ATOM   350  C CD1 . ILE A 1 56  ? 21.308  -175.084 -30.573 1.00 22.95 ? 56   ILE A CD1 1 
ATOM   351  N N   . GLU A 1 57  ? 17.837  -171.054 -33.040 1.00 23.09 ? 57   GLU A N   1 
ATOM   352  C CA  . GLU A 1 57  ? 16.929  -170.515 -34.075 1.00 23.53 ? 57   GLU A CA  1 
ATOM   353  C C   . GLU A 1 57  ? 17.450  -169.167 -34.568 1.00 23.19 ? 57   GLU A C   1 
ATOM   354  O O   . GLU A 1 57  ? 17.523  -168.893 -35.776 1.00 22.59 ? 57   GLU A O   1 
ATOM   355  C CB  . GLU A 1 57  ? 15.535  -170.251 -33.503 1.00 23.69 ? 57   GLU A CB  1 
ATOM   356  C CG  . GLU A 1 57  ? 14.808  -171.434 -32.873 1.00 25.56 ? 57   GLU A CG  1 
ATOM   357  C CD  . GLU A 1 57  ? 13.394  -171.053 -32.401 1.00 26.11 ? 57   GLU A CD  1 
ATOM   358  O OE1 . GLU A 1 57  ? 12.855  -170.021 -32.900 1.00 25.93 ? 57   GLU A OE1 1 
ATOM   359  O OE2 . GLU A 1 57  ? 12.819  -171.798 -31.543 1.00 30.01 ? 57   GLU A OE2 1 
ATOM   360  N N   . TYR A 1 58  ? 17.776  -168.327 -33.594 1.00 22.41 ? 58   TYR A N   1 
ATOM   361  C CA  . TYR A 1 58  ? 18.247  -166.961 -33.840 1.00 22.58 ? 58   TYR A CA  1 
ATOM   362  C C   . TYR A 1 58  ? 19.550  -166.926 -34.619 1.00 22.61 ? 58   TYR A C   1 
ATOM   363  O O   . TYR A 1 58  ? 19.680  -166.196 -35.619 1.00 23.27 ? 58   TYR A O   1 
ATOM   364  C CB  . TYR A 1 58  ? 18.420  -166.222 -32.512 1.00 22.32 ? 58   TYR A CB  1 
ATOM   365  C CG  . TYR A 1 58  ? 18.974  -164.825 -32.691 1.00 21.77 ? 58   TYR A CG  1 
ATOM   366  C CD1 . TYR A 1 58  ? 18.122  -163.722 -32.780 1.00 20.66 ? 58   TYR A CD1 1 
ATOM   367  C CD2 . TYR A 1 58  ? 20.352  -164.615 -32.822 1.00 21.26 ? 58   TYR A CD2 1 
ATOM   368  C CE1 . TYR A 1 58  ? 18.634  -162.432 -32.959 1.00 21.50 ? 58   TYR A CE1 1 
ATOM   369  C CE2 . TYR A 1 58  ? 20.874  -163.338 -33.016 1.00 19.56 ? 58   TYR A CE2 1 
ATOM   370  C CZ  . TYR A 1 58  ? 20.007  -162.253 -33.081 1.00 22.07 ? 58   TYR A CZ  1 
ATOM   371  O OH  . TYR A 1 58  ? 20.518  -160.992 -33.264 1.00 21.30 ? 58   TYR A OH  1 
ATOM   372  N N   . CYS A 1 59  ? 20.526  -167.684 -34.133 1.00 22.18 ? 59   CYS A N   1 
ATOM   373  C CA  . CYS A 1 59  ? 21.833  -167.740 -34.760 1.00 23.07 ? 59   CYS A CA  1 
ATOM   374  C C   . CYS A 1 59  ? 21.801  -168.363 -36.156 1.00 22.64 ? 59   CYS A C   1 
ATOM   375  O O   . CYS A 1 59  ? 22.571  -167.967 -37.020 1.00 22.76 ? 59   CYS A O   1 
ATOM   376  C CB  . CYS A 1 59  ? 22.828  -168.463 -33.858 1.00 22.75 ? 59   CYS A CB  1 
ATOM   377  S SG  . CYS A 1 59  ? 23.173  -167.576 -32.293 1.00 25.36 ? 59   CYS A SG  1 
ATOM   378  N N   . LYS A 1 60  ? 20.922  -169.342 -36.371 1.00 22.64 ? 60   LYS A N   1 
ATOM   379  C CA  . LYS A 1 60  ? 20.759  -169.914 -37.703 1.00 22.69 ? 60   LYS A CA  1 
ATOM   380  C C   . LYS A 1 60  ? 20.217  -168.864 -38.670 1.00 22.59 ? 60   LYS A C   1 
ATOM   381  O O   . LYS A 1 60  ? 20.774  -168.681 -39.755 1.00 22.80 ? 60   LYS A O   1 
ATOM   382  C CB  . LYS A 1 60  ? 19.809  -171.102 -37.676 1.00 22.59 ? 60   LYS A CB  1 
ATOM   383  C CG  . LYS A 1 60  ? 20.274  -172.294 -36.831 1.00 24.11 ? 60   LYS A CG  1 
ATOM   384  C CD  . LYS A 1 60  ? 18.928  -173.194 -36.746 1.00 25.55 ? 60   LYS A CD  1 
ATOM   385  C CE  . LYS A 1 60  ? 19.410  -174.744 -36.785 1.00 27.77 ? 60   LYS A CE  1 
ATOM   386  N NZ  . LYS A 1 60  ? 17.581  -175.367 -36.505 1.00 26.98 ? 60   LYS A NZ  1 
ATOM   387  N N   . ARG A 1 61  ? 19.140  -168.177 -38.269 1.00 22.53 ? 61   ARG A N   1 
ATOM   388  C CA  . ARG A 1 61  ? 18.528  -167.128 -39.093 1.00 22.64 ? 61   ARG A CA  1 
ATOM   389  C C   . ARG A 1 61  ? 19.513  -166.001 -39.384 1.00 22.64 ? 61   ARG A C   1 
ATOM   390  O O   . ARG A 1 61  ? 19.630  -165.554 -40.525 1.00 22.75 ? 61   ARG A O   1 
ATOM   391  C CB  . ARG A 1 61  ? 17.267  -166.560 -38.443 1.00 22.57 ? 61   ARG A CB  1 
ATOM   392  C CG  . ARG A 1 61  ? 16.334  -165.857 -39.432 1.00 22.75 ? 61   ARG A CG  1 
ATOM   393  C CD  . ARG A 1 61  ? 15.341  -164.939 -38.730 1.00 23.88 ? 61   ARG A CD  1 
ATOM   394  N NE  . ARG A 1 61  ? 14.413  -165.655 -37.848 1.00 24.86 ? 61   ARG A NE  1 
ATOM   395  C CZ  . ARG A 1 61  ? 14.481  -165.654 -36.517 1.00 24.36 ? 61   ARG A CZ  1 
ATOM   396  N NH1 . ARG A 1 61  ? 15.429  -164.968 -35.883 1.00 23.32 ? 61   ARG A NH1 1 
ATOM   397  N NH2 . ARG A 1 61  ? 13.591  -166.337 -35.816 1.00 23.88 ? 61   ARG A NH2 1 
ATOM   398  N N   . HIS A 1 62  ? 20.227  -165.548 -38.358 1.00 22.67 ? 62   HIS A N   1 
ATOM   399  C CA  . HIS A 1 62  ? 21.229  -164.508 -38.558 1.00 22.58 ? 62   HIS A CA  1 
ATOM   400  C C   . HIS A 1 62  ? 22.530  -165.050 -39.143 1.00 22.90 ? 62   HIS A C   1 
ATOM   401  O O   . HIS A 1 62  ? 23.202  -164.333 -39.904 1.00 23.58 ? 62   HIS A O   1 
ATOM   402  C CB  . HIS A 1 62  ? 21.469  -163.715 -37.268 1.00 22.18 ? 62   HIS A CB  1 
ATOM   403  C CG  . HIS A 1 62  ? 20.391  -162.717 -36.980 1.00 21.40 ? 62   HIS A CG  1 
ATOM   404  N ND1 . HIS A 1 62  ? 19.184  -163.065 -36.407 1.00 20.32 ? 62   HIS A ND1 1 
ATOM   405  C CD2 . HIS A 1 62  ? 20.323  -161.388 -37.224 1.00 18.80 ? 62   HIS A CD2 1 
ATOM   406  C CE1 . HIS A 1 62  ? 18.423  -161.990 -36.306 1.00 18.95 ? 62   HIS A CE1 1 
ATOM   407  N NE2 . HIS A 1 62  ? 19.091  -160.961 -36.793 1.00 18.57 ? 62   HIS A NE2 1 
ATOM   408  N N   . PHE A 1 90  ? 9.934   -163.129 -33.432 1.00 20.72 ? 90   PHE A N   1 
ATOM   409  C CA  . PHE A 1 90  ? 10.910  -163.855 -32.596 1.00 20.84 ? 90   PHE A CA  1 
ATOM   410  C C   . PHE A 1 90  ? 10.858  -163.392 -31.143 1.00 21.33 ? 90   PHE A C   1 
ATOM   411  O O   . PHE A 1 90  ? 11.032  -164.202 -30.214 1.00 21.18 ? 90   PHE A O   1 
ATOM   412  C CB  . PHE A 1 90  ? 12.345  -163.714 -33.142 1.00 20.15 ? 90   PHE A CB  1 
ATOM   413  C CG  . PHE A 1 90  ? 13.392  -164.451 -32.320 1.00 20.11 ? 90   PHE A CG  1 
ATOM   414  C CD1 . PHE A 1 90  ? 13.519  -165.836 -32.399 1.00 19.49 ? 90   PHE A CD1 1 
ATOM   415  C CD2 . PHE A 1 90  ? 14.249  -163.755 -31.469 1.00 19.19 ? 90   PHE A CD2 1 
ATOM   416  C CE1 . PHE A 1 90  ? 14.482  -166.504 -31.647 1.00 19.19 ? 90   PHE A CE1 1 
ATOM   417  C CE2 . PHE A 1 90  ? 15.203  -164.416 -30.708 1.00 18.86 ? 90   PHE A CE2 1 
ATOM   418  C CZ  . PHE A 1 90  ? 15.320  -165.791 -30.795 1.00 18.98 ? 90   PHE A CZ  1 
ATOM   419  N N   . MET A 1 91  ? 10.632  -162.085 -30.953 1.00 21.98 ? 91   MET A N   1 
ATOM   420  C CA  . MET A 1 91  ? 10.584  -161.495 -29.611 1.00 22.35 ? 91   MET A CA  1 
ATOM   421  C C   . MET A 1 91  ? 9.174   -161.546 -29.041 1.00 22.62 ? 91   MET A C   1 
ATOM   422  O O   . MET A 1 91  ? 8.932   -161.155 -27.895 1.00 22.93 ? 91   MET A O   1 
ATOM   423  C CB  . MET A 1 91  ? 11.149  -160.067 -29.605 1.00 22.79 ? 91   MET A CB  1 
ATOM   424  C CG  . MET A 1 91  ? 12.669  -159.983 -29.736 1.00 22.98 ? 91   MET A CG  1 
ATOM   425  S SD  . MET A 1 91  ? 13.576  -160.584 -28.287 1.00 27.68 ? 91   MET A SD  1 
ATOM   426  C CE  . MET A 1 91  ? 13.722  -162.312 -28.629 1.00 27.43 ? 91   MET A CE  1 
ATOM   427  N N   . LYS A 1 92  ? 8.245   -162.045 -29.845 1.00 22.67 ? 92   LYS A N   1 
ATOM   428  C CA  . LYS A 1 92  ? 6.902   -162.322 -29.372 1.00 22.92 ? 92   LYS A CA  1 
ATOM   429  C C   . LYS A 1 92  ? 6.966   -163.563 -28.470 1.00 22.70 ? 92   LYS A C   1 
ATOM   430  O O   . LYS A 1 92  ? 6.539   -164.656 -28.841 1.00 22.97 ? 92   LYS A O   1 
ATOM   431  C CB  . LYS A 1 92  ? 5.940   -162.496 -30.552 1.00 22.81 ? 92   LYS A CB  1 
ATOM   432  C CG  . LYS A 1 92  ? 4.669   -161.690 -30.408 1.00 23.16 ? 92   LYS A CG  1 
ATOM   433  C CD  . LYS A 1 92  ? 3.673   -161.955 -31.533 1.00 23.33 ? 92   LYS A CD  1 
ATOM   434  C CE  . LYS A 1 92  ? 2.341   -161.268 -31.232 1.00 23.78 ? 92   LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 92  ? 1.231   -161.649 -32.163 1.00 23.60 ? 92   LYS A NZ  1 
ATOM   436  N N   . ILE A 1 93  ? 7.559   -163.366 -27.292 1.00 22.75 ? 93   ILE A N   1 
ATOM   437  C CA  . ILE A 1 93  ? 7.750   -164.394 -26.277 1.00 22.05 ? 93   ILE A CA  1 
ATOM   438  C C   . ILE A 1 93  ? 7.298   -163.763 -24.963 1.00 22.17 ? 93   ILE A C   1 
ATOM   439  O O   . ILE A 1 93  ? 7.154   -162.537 -24.877 1.00 21.94 ? 93   ILE A O   1 
ATOM   440  C CB  . ILE A 1 93  ? 9.240   -164.876 -26.190 1.00 22.51 ? 93   ILE A CB  1 
ATOM   441  C CG1 . ILE A 1 93  ? 10.212  -163.683 -26.107 1.00 22.42 ? 93   ILE A CG1 1 
ATOM   442  C CG2 . ILE A 1 93  ? 9.594   -165.788 -27.366 1.00 21.58 ? 93   ILE A CG2 1 
ATOM   443  C CD1 . ILE A 1 93  ? 11.651  -164.068 -25.883 1.00 21.58 ? 93   ILE A CD1 1 
ATOM   444  N N   . ASP A 1 94  ? 7.055   -164.579 -23.942 1.00 22.14 ? 94   ASP A N   1 
ATOM   445  C CA  . ASP A 1 94  ? 6.594   -164.037 -22.664 1.00 22.37 ? 94   ASP A CA  1 
ATOM   446  C C   . ASP A 1 94  ? 7.757   -163.480 -21.842 1.00 22.32 ? 94   ASP A C   1 
ATOM   447  O O   . ASP A 1 94  ? 8.921   -163.631 -22.213 1.00 22.09 ? 94   ASP A O   1 
ATOM   448  C CB  . ASP A 1 94  ? 5.777   -165.073 -21.872 1.00 22.54 ? 94   ASP A CB  1 
ATOM   449  C CG  . ASP A 1 94  ? 6.585   -166.300 -21.482 1.00 23.04 ? 94   ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 94  ? 7.817   -166.294 -21.662 1.00 23.69 ? 94   ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 94  ? 5.981   -167.279 -20.981 1.00 23.83 ? 94   ASP A OD2 1 
ATOM   452  N N   . GLN A 1 95  ? 7.430   -162.846 -20.724 1.00 22.45 ? 95   GLN A N   1 
ATOM   453  C CA  . GLN A 1 95  ? 8.423   -162.173 -19.887 1.00 22.89 ? 95   GLN A CA  1 
ATOM   454  C C   . GLN A 1 95  ? 9.503   -163.117 -19.346 1.00 23.14 ? 95   GLN A C   1 
ATOM   455  O O   . GLN A 1 95  ? 10.696  -162.826 -19.475 1.00 22.52 ? 95   GLN A O   1 
ATOM   456  C CB  . GLN A 1 95  ? 7.728   -161.416 -18.745 1.00 22.89 ? 95   GLN A CB  1 
ATOM   457  C CG  . GLN A 1 95  ? 8.677   -160.835 -17.724 1.00 23.00 ? 95   GLN A CG  1 
ATOM   458  C CD  . GLN A 1 95  ? 8.174   -159.533 -17.160 1.00 23.54 ? 95   GLN A CD  1 
ATOM   459  O OE1 . GLN A 1 95  ? 8.631   -159.194 -15.867 1.00 25.20 ? 95   GLN A OE1 1 
ATOM   460  N NE2 . GLN A 1 95  ? 7.168   -158.814 -17.929 1.00 23.88 ? 95   GLN A NE2 1 
ATOM   461  N N   . ALA A 1 96  ? 9.079   -164.235 -18.747 1.00 23.19 ? 96   ALA A N   1 
ATOM   462  C CA  . ALA A 1 96  ? 10.007  -165.239 -18.217 1.00 23.61 ? 96   ALA A CA  1 
ATOM   463  C C   . ALA A 1 96  ? 10.966  -165.773 -19.302 1.00 23.90 ? 96   ALA A C   1 
ATOM   464  O O   . ALA A 1 96  ? 12.189  -165.785 -19.095 1.00 24.01 ? 96   ALA A O   1 
ATOM   465  C CB  . ALA A 1 96  ? 9.241   -166.395 -17.543 1.00 23.48 ? 96   ALA A CB  1 
ATOM   466  N N   . THR A 1 97  ? 10.405  -166.204 -20.455 1.00 24.19 ? 97   THR A N   1 
ATOM   467  C CA  . THR A 1 97  ? 11.199  -166.697 -21.590 1.00 24.87 ? 97   THR A CA  1 
ATOM   468  C C   . THR A 1 97  ? 12.227  -165.625 -22.052 1.00 24.84 ? 97   THR A C   1 
ATOM   469  O O   . THR A 1 97  ? 13.411  -165.862 -22.323 1.00 24.19 ? 97   THR A O   1 
ATOM   470  C CB  . THR A 1 97  ? 10.297  -167.208 -22.752 1.00 24.53 ? 97   THR A CB  1 
ATOM   471  O OG1 . THR A 1 97  ? 9.604   -168.378 -22.323 1.00 26.23 ? 97   THR A OG1 1 
ATOM   472  C CG2 . THR A 1 97  ? 11.163  -167.534 -24.006 1.00 25.50 ? 97   THR A CG2 1 
ATOM   473  N N   . LEU A 1 98  ? 11.766  -164.368 -22.120 1.00 25.82 ? 98   LEU A N   1 
ATOM   474  C CA  . LEU A 1 98  ? 12.634  -163.261 -22.461 1.00 25.76 ? 98   LEU A CA  1 
ATOM   475  C C   . LEU A 1 98  ? 13.833  -163.103 -21.482 1.00 25.96 ? 98   LEU A C   1 
ATOM   476  O O   . LEU A 1 98  ? 14.996  -162.854 -21.923 1.00 26.46 ? 98   LEU A O   1 
ATOM   477  C CB  . LEU A 1 98  ? 11.816  -161.967 -22.513 1.00 26.52 ? 98   LEU A CB  1 
ATOM   478  C CG  . LEU A 1 98  ? 12.553  -160.644 -22.727 1.00 26.43 ? 98   LEU A CG  1 
ATOM   479  C CD1 . LEU A 1 98  ? 13.135  -160.575 -24.132 1.00 28.43 ? 98   LEU A CD1 1 
ATOM   480  C CD2 . LEU A 1 98  ? 11.637  -159.448 -22.474 1.00 26.54 ? 98   LEU A CD2 1 
ATOM   481  N N   . PHE A 1 99  ? 13.566  -163.221 -20.172 1.00 25.60 ? 99   PHE A N   1 
ATOM   482  C CA  . PHE A 1 99  ? 14.605  -163.073 -19.129 1.00 25.66 ? 99   PHE A CA  1 
ATOM   483  C C   . PHE A 1 99  ? 15.574  -164.248 -19.140 1.00 25.98 ? 99   PHE A C   1 
ATOM   484  O O   . PHE A 1 99  ? 16.767  -164.049 -18.846 1.00 26.08 ? 99   PHE A O   1 
ATOM   485  C CB  . PHE A 1 99  ? 13.927  -162.952 -17.750 1.00 26.06 ? 99   PHE A CB  1 
ATOM   486  C CG  . PHE A 1 99  ? 13.189  -161.637 -17.535 1.00 25.93 ? 99   PHE A CG  1 
ATOM   487  C CD1 . PHE A 1 99  ? 12.823  -160.823 -18.607 1.00 27.13 ? 99   PHE A CD1 1 
ATOM   488  C CD2 . PHE A 1 99  ? 12.834  -161.232 -16.246 1.00 25.84 ? 99   PHE A CD2 1 
ATOM   489  C CE1 . PHE A 1 99  ? 12.139  -159.617 -18.394 1.00 25.10 ? 99   PHE A CE1 1 
ATOM   490  C CE2 . PHE A 1 99  ? 12.150  -160.037 -16.032 1.00 26.35 ? 99   PHE A CE2 1 
ATOM   491  C CZ  . PHE A 1 99  ? 11.800  -159.230 -17.109 1.00 26.86 ? 99   PHE A CZ  1 
ATOM   492  N N   . GLU A 1 100 ? 15.059  -165.444 -19.461 1.00 25.90 ? 100  GLU A N   1 
ATOM   493  C CA  . GLU A 1 100 ? 15.951  -166.571 -19.584 1.00 25.49 ? 100  GLU A CA  1 
ATOM   494  C C   . GLU A 1 100 ? 16.875  -166.305 -20.825 1.00 24.99 ? 100  GLU A C   1 
ATOM   495  O O   . GLU A 1 100 ? 18.124  -166.557 -20.814 1.00 24.68 ? 100  GLU A O   1 
ATOM   496  C CB  . GLU A 1 100 ? 15.163  -167.887 -19.641 1.00 26.75 ? 100  GLU A CB  1 
ATOM   497  C CG  . GLU A 1 100 ? 15.950  -169.029 -18.933 1.00 29.68 ? 100  GLU A CG  1 
ATOM   498  C CD  . GLU A 1 100 ? 15.126  -170.261 -18.709 1.00 35.77 ? 100  GLU A CD  1 
ATOM   499  O OE1 . GLU A 1 100 ? 13.904  -170.155 -18.368 1.00 37.69 ? 100  GLU A OE1 1 
ATOM   500  O OE2 . GLU A 1 100 ? 15.705  -171.363 -18.869 1.00 35.48 ? 100  GLU A OE2 1 
ATOM   501  N N   . LEU A 1 101 ? 16.296  -165.709 -21.878 1.00 24.20 ? 101  LEU A N   1 
ATOM   502  C CA  . LEU A 1 101 ? 16.993  -165.424 -23.160 1.00 23.67 ? 101  LEU A CA  1 
ATOM   503  C C   . LEU A 1 101 ? 18.118  -164.392 -23.065 1.00 23.52 ? 101  LEU A C   1 
ATOM   504  O O   . LEU A 1 101 ? 19.189  -164.622 -23.627 1.00 22.86 ? 101  LEU A O   1 
ATOM   505  C CB  . LEU A 1 101 ? 16.008  -164.970 -24.242 1.00 22.97 ? 101  LEU A CB  1 
ATOM   506  C CG  . LEU A 1 101 ? 15.919  -165.606 -25.624 1.00 22.74 ? 101  LEU A CG  1 
ATOM   507  C CD1 . LEU A 1 101 ? 15.385  -164.564 -26.610 1.00 20.35 ? 101  LEU A CD1 1 
ATOM   508  C CD2 . LEU A 1 101 ? 17.200  -166.309 -26.137 1.00 18.61 ? 101  LEU A CD2 1 
ATOM   509  N N   . ILE A 1 102 ? 17.884  -163.259 -22.380 1.00 24.23 ? 102  ILE A N   1 
ATOM   510  C CA  . ILE A 1 102 ? 18.968  -162.287 -22.143 1.00 24.93 ? 102  ILE A CA  1 
ATOM   511  C C   . ILE A 1 102 ? 20.091  -162.919 -21.344 1.00 24.96 ? 102  ILE A C   1 
ATOM   512  O O   . ILE A 1 102 ? 21.275  -162.669 -21.633 1.00 25.20 ? 102  ILE A O   1 
ATOM   513  C CB  . ILE A 1 102 ? 18.601  -161.012 -21.293 1.00 25.17 ? 102  ILE A CB  1 
ATOM   514  C CG1 . ILE A 1 102 ? 17.111  -160.847 -21.045 1.00 25.43 ? 102  ILE A CG1 1 
ATOM   515  C CG2 . ILE A 1 102 ? 19.333  -159.737 -21.849 1.00 27.12 ? 102  ILE A CG2 1 
ATOM   516  C CD1 . ILE A 1 102 ? 16.391  -160.038 -22.076 1.00 28.99 ? 102  ILE A CD1 1 
ATOM   517  N N   . LEU A 1 103 ? 19.740  -163.688 -20.305 1.00 24.55 ? 103  LEU A N   1 
ATOM   518  C CA  . LEU A 1 103 ? 20.791  -164.307 -19.491 1.00 24.85 ? 103  LEU A CA  1 
ATOM   519  C C   . LEU A 1 103 ? 21.652  -165.230 -20.348 1.00 24.98 ? 103  LEU A C   1 
ATOM   520  O O   . LEU A 1 103 ? 22.877  -165.229 -20.207 1.00 25.73 ? 103  LEU A O   1 
ATOM   521  C CB  . LEU A 1 103 ? 20.261  -165.010 -18.235 1.00 24.85 ? 103  LEU A CB  1 
ATOM   522  C CG  . LEU A 1 103 ? 19.564  -164.188 -17.144 1.00 25.06 ? 103  LEU A CG  1 
ATOM   523  C CD1 . LEU A 1 103 ? 19.244  -165.063 -15.936 1.00 25.40 ? 103  LEU A CD1 1 
ATOM   524  C CD2 . LEU A 1 103 ? 20.415  -163.001 -16.737 1.00 23.60 ? 103  LEU A CD2 1 
ATOM   525  N N   . ALA A 1 104 ? 21.010  -165.987 -21.245 1.00 25.41 ? 104  ALA A N   1 
ATOM   526  C CA  . ALA A 1 104 ? 21.712  -166.914 -22.145 1.00 25.18 ? 104  ALA A CA  1 
ATOM   527  C C   . ALA A 1 104 ? 22.599  -166.160 -23.147 1.00 25.26 ? 104  ALA A C   1 
ATOM   528  O O   . ALA A 1 104 ? 23.744  -166.546 -23.368 1.00 24.80 ? 104  ALA A O   1 
ATOM   529  C CB  . ALA A 1 104 ? 20.729  -167.838 -22.882 1.00 25.08 ? 104  ALA A CB  1 
ATOM   530  N N   . ALA A 1 105 ? 22.061  -165.106 -23.763 1.00 24.86 ? 105  ALA A N   1 
ATOM   531  C CA  . ALA A 1 105 ? 22.834  -164.275 -24.696 1.00 24.47 ? 105  ALA A CA  1 
ATOM   532  C C   . ALA A 1 105 ? 24.066  -163.680 -24.031 1.00 24.43 ? 105  ALA A C   1 
ATOM   533  O O   . ALA A 1 105 ? 25.141  -163.651 -24.635 1.00 24.05 ? 105  ALA A O   1 
ATOM   534  C CB  . ALA A 1 105 ? 21.969  -163.152 -25.250 1.00 24.43 ? 105  ALA A CB  1 
ATOM   535  N N   . ASN A 1 106 ? 23.894  -163.182 -22.802 1.00 23.62 ? 106  ASN A N   1 
ATOM   536  C CA  . ASN A 1 106 ? 25.006  -162.692 -21.988 1.00 22.84 ? 106  ASN A CA  1 
ATOM   537  C C   . ASN A 1 106 ? 26.044  -163.779 -21.652 1.00 23.23 ? 106  ASN A C   1 
ATOM   538  O O   . ASN A 1 106 ? 27.248  -163.598 -21.890 1.00 22.57 ? 106  ASN A O   1 
ATOM   539  C CB  . ASN A 1 106 ? 24.483  -162.047 -20.704 1.00 22.69 ? 106  ASN A CB  1 
ATOM   540  C CG  . ASN A 1 106 ? 25.583  -161.321 -19.945 1.00 23.51 ? 106  ASN A CG  1 
ATOM   541  O OD1 . ASN A 1 106 ? 26.239  -160.438 -20.483 1.00 23.62 ? 106  ASN A OD1 1 
ATOM   542  N ND2 . ASN A 1 106 ? 25.795  -161.710 -18.695 1.00 24.14 ? 106  ASN A ND2 1 
ATOM   543  N N   . TYR A 1 107 ? 25.556  -164.901 -21.112 1.00 22.75 ? 107  TYR A N   1 
ATOM   544  C CA  . TYR A 1 107 ? 26.389  -166.066 -20.780 1.00 23.42 ? 107  TYR A CA  1 
ATOM   545  C C   . TYR A 1 107 ? 27.142  -166.626 -22.001 1.00 22.99 ? 107  TYR A C   1 
ATOM   546  O O   . TYR A 1 107 ? 28.323  -166.971 -21.895 1.00 23.40 ? 107  TYR A O   1 
ATOM   547  C CB  . TYR A 1 107 ? 25.495  -167.166 -20.210 1.00 23.72 ? 107  TYR A CB  1 
ATOM   548  C CG  . TYR A 1 107 ? 26.121  -168.554 -20.118 1.00 24.39 ? 107  TYR A CG  1 
ATOM   549  C CD1 . TYR A 1 107 ? 27.174  -168.822 -19.241 1.00 25.44 ? 107  TYR A CD1 1 
ATOM   550  C CD2 . TYR A 1 107 ? 25.611  -169.602 -20.869 1.00 26.08 ? 107  TYR A CD2 1 
ATOM   551  C CE1 . TYR A 1 107 ? 27.737  -170.121 -19.148 1.00 26.09 ? 107  TYR A CE1 1 
ATOM   552  C CE2 . TYR A 1 107 ? 26.158  -170.897 -20.787 1.00 24.72 ? 107  TYR A CE2 1 
ATOM   553  C CZ  . TYR A 1 107 ? 27.210  -171.149 -19.932 1.00 25.28 ? 107  TYR A CZ  1 
ATOM   554  O OH  . TYR A 1 107 ? 27.716  -172.436 -19.857 1.00 25.65 ? 107  TYR A OH  1 
ATOM   555  N N   . LEU A 1 108 ? 26.445  -166.737 -23.134 1.00 22.22 ? 108  LEU A N   1 
ATOM   556  C CA  . LEU A 1 108 ? 27.036  -167.242 -24.389 1.00 21.90 ? 108  LEU A CA  1 
ATOM   557  C C   . LEU A 1 108 ? 27.791  -166.161 -25.172 1.00 22.06 ? 108  LEU A C   1 
ATOM   558  O O   . LEU A 1 108 ? 28.491  -166.459 -26.152 1.00 22.80 ? 108  LEU A O   1 
ATOM   559  C CB  . LEU A 1 108 ? 25.952  -167.839 -25.284 1.00 21.15 ? 108  LEU A CB  1 
ATOM   560  C CG  . LEU A 1 108 ? 25.267  -169.116 -24.720 1.00 21.54 ? 108  LEU A CG  1 
ATOM   561  C CD1 . LEU A 1 108 ? 24.160  -169.511 -25.643 1.00 21.61 ? 108  LEU A CD1 1 
ATOM   562  C CD2 . LEU A 1 108 ? 26.214  -170.318 -24.525 1.00 18.81 ? 108  LEU A CD2 1 
ATOM   563  N N   . ASN A 1 109 ? 27.633  -164.913 -24.742 1.00 21.43 ? 109  ASN A N   1 
ATOM   564  C CA  . ASN A 1 109 ? 28.246  -163.770 -25.415 1.00 21.76 ? 109  ASN A CA  1 
ATOM   565  C C   . ASN A 1 109 ? 27.945  -163.728 -26.924 1.00 21.61 ? 109  ASN A C   1 
ATOM   566  O O   . ASN A 1 109 ? 28.858  -163.811 -27.772 1.00 20.75 ? 109  ASN A O   1 
ATOM   567  C CB  . ASN A 1 109 ? 29.756  -163.716 -25.147 1.00 21.34 ? 109  ASN A CB  1 
ATOM   568  C CG  . ASN A 1 109 ? 30.345  -162.354 -25.479 1.00 23.41 ? 109  ASN A CG  1 
ATOM   569  O OD1 . ASN A 1 109 ? 29.603  -161.385 -25.686 1.00 24.59 ? 109  ASN A OD1 1 
ATOM   570  N ND2 . ASN A 1 109 ? 31.674  -162.269 -25.529 1.00 22.02 ? 109  ASN A ND2 1 
ATOM   571  N N   . ILE A 1 110 ? 26.652  -163.622 -27.238 1.00 21.95 ? 110  ILE A N   1 
ATOM   572  C CA  . ILE A 1 110 ? 26.181  -163.465 -28.623 1.00 22.28 ? 110  ILE A CA  1 
ATOM   573  C C   . ILE A 1 110 ? 25.724  -161.988 -28.707 1.00 23.05 ? 110  ILE A C   1 
ATOM   574  O O   . ILE A 1 110 ? 24.655  -161.623 -28.207 1.00 23.12 ? 110  ILE A O   1 
ATOM   575  C CB  . ILE A 1 110 ? 25.025  -164.434 -28.946 1.00 22.50 ? 110  ILE A CB  1 
ATOM   576  C CG1 . ILE A 1 110 ? 25.456  -165.892 -28.684 1.00 23.06 ? 110  ILE A CG1 1 
ATOM   577  C CG2 . ILE A 1 110 ? 24.587  -164.285 -30.415 1.00 22.04 ? 110  ILE A CG2 1 
ATOM   578  C CD1 . ILE A 1 110 ? 24.276  -166.861 -28.428 1.00 21.31 ? 110  ILE A CD1 1 
ATOM   579  N N   . LYS A 1 111 ? 26.554  -161.142 -29.305 1.00 22.39 ? 111  LYS A N   1 
ATOM   580  C CA  . LYS A 1 111 ? 26.354  -159.689 -29.203 1.00 23.15 ? 111  LYS A CA  1 
ATOM   581  C C   . LYS A 1 111 ? 25.052  -159.204 -29.864 1.00 22.89 ? 111  LYS A C   1 
ATOM   582  O O   . LYS A 1 111 ? 24.367  -158.340 -29.298 1.00 22.27 ? 111  LYS A O   1 
ATOM   583  C CB  . LYS A 1 111 ? 27.566  -158.943 -29.752 1.00 22.70 ? 111  LYS A CB  1 
ATOM   584  C CG  . LYS A 1 111 ? 27.522  -157.433 -29.528 1.00 25.31 ? 111  LYS A CG  1 
ATOM   585  C CD  . LYS A 1 111 ? 28.051  -156.667 -30.744 1.00 27.28 ? 111  LYS A CD  1 
ATOM   586  C CE  . LYS A 1 111 ? 27.724  -155.191 -30.600 1.00 28.04 ? 111  LYS A CE  1 
ATOM   587  N NZ  . LYS A 1 111 ? 27.538  -154.548 -31.927 1.00 30.31 ? 111  LYS A NZ  1 
ATOM   588  N N   . ASN A 1 112 ? 24.720  -159.751 -31.046 1.00 22.11 ? 112  ASN A N   1 
ATOM   589  C CA  . ASN A 1 112 ? 23.539  -159.290 -31.788 1.00 22.26 ? 112  ASN A CA  1 
ATOM   590  C C   . ASN A 1 112 ? 22.258  -159.706 -31.092 1.00 22.21 ? 112  ASN A C   1 
ATOM   591  O O   . ASN A 1 112 ? 21.283  -158.954 -31.054 1.00 21.61 ? 112  ASN A O   1 
ATOM   592  C CB  . ASN A 1 112 ? 23.555  -159.697 -33.274 1.00 22.22 ? 112  ASN A CB  1 
ATOM   593  C CG  . ASN A 1 112 ? 23.705  -161.205 -33.492 1.00 24.15 ? 112  ASN A CG  1 
ATOM   594  O OD1 . ASN A 1 112 ? 23.764  -161.998 -32.541 1.00 26.90 ? 112  ASN A OD1 1 
ATOM   595  N ND2 . ASN A 1 112 ? 23.767  -161.609 -34.765 1.00 24.25 ? 112  ASN A ND2 1 
ATOM   596  N N   . LEU A 1 113 ? 22.274  -160.919 -30.533 1.00 23.01 ? 113  LEU A N   1 
ATOM   597  C CA  . LEU A 1 113 ? 21.199  -161.373 -29.677 1.00 23.12 ? 113  LEU A CA  1 
ATOM   598  C C   . LEU A 1 113 ? 21.122  -160.532 -28.400 1.00 23.98 ? 113  LEU A C   1 
ATOM   599  O O   . LEU A 1 113 ? 20.020  -160.184 -27.969 1.00 24.62 ? 113  LEU A O   1 
ATOM   600  C CB  . LEU A 1 113 ? 21.343  -162.867 -29.341 1.00 23.21 ? 113  LEU A CB  1 
ATOM   601  C CG  . LEU A 1 113 ? 20.211  -163.498 -28.503 1.00 23.66 ? 113  LEU A CG  1 
ATOM   602  C CD1 . LEU A 1 113 ? 18.819  -163.274 -29.150 1.00 20.82 ? 113  LEU A CD1 1 
ATOM   603  C CD2 . LEU A 1 113 ? 20.456  -164.996 -28.222 1.00 21.73 ? 113  LEU A CD2 1 
ATOM   604  N N   . LEU A 1 114 ? 22.266  -160.210 -27.794 1.00 23.73 ? 114  LEU A N   1 
ATOM   605  C CA  . LEU A 1 114 ? 22.253  -159.401 -26.577 1.00 24.64 ? 114  LEU A CA  1 
ATOM   606  C C   . LEU A 1 114 ? 21.646  -158.025 -26.892 1.00 25.01 ? 114  LEU A C   1 
ATOM   607  O O   . LEU A 1 114 ? 20.919  -157.447 -26.075 1.00 25.74 ? 114  LEU A O   1 
ATOM   608  C CB  . LEU A 1 114 ? 23.670  -159.208 -26.033 1.00 24.91 ? 114  LEU A CB  1 
ATOM   609  C CG  . LEU A 1 114 ? 24.048  -159.406 -24.549 1.00 25.99 ? 114  LEU A CG  1 
ATOM   610  C CD1 . LEU A 1 114 ? 25.162  -158.441 -24.163 1.00 25.30 ? 114  LEU A CD1 1 
ATOM   611  C CD2 . LEU A 1 114 ? 22.875  -159.321 -23.546 1.00 24.94 ? 114  LEU A CD2 1 
ATOM   612  N N   . ASP A 1 115 ? 21.960  -157.491 -28.070 1.00 24.80 ? 115  ASP A N   1 
ATOM   613  C CA  . ASP A 1 115 ? 21.455  -156.172 -28.455 1.00 24.34 ? 115  ASP A CA  1 
ATOM   614  C C   . ASP A 1 115 ? 19.938  -156.179 -28.582 1.00 24.24 ? 115  ASP A C   1 
ATOM   615  O O   . ASP A 1 115 ? 19.259  -155.291 -28.039 1.00 23.88 ? 115  ASP A O   1 
ATOM   616  C CB  . ASP A 1 115 ? 22.062  -155.730 -29.777 1.00 24.69 ? 115  ASP A CB  1 
ATOM   617  C CG  . ASP A 1 115 ? 23.443  -155.183 -29.605 1.00 24.44 ? 115  ASP A CG  1 
ATOM   618  O OD1 . ASP A 1 115 ? 23.666  -154.522 -28.547 1.00 27.71 ? 115  ASP A OD1 1 
ATOM   619  O OD2 . ASP A 1 115 ? 24.297  -155.401 -30.538 1.00 25.48 ? 115  ASP A OD2 1 
ATOM   620  N N   . LEU A 1 116 ? 19.425  -157.165 -29.312 1.00 23.21 ? 116  LEU A N   1 
ATOM   621  C CA  . LEU A 1 116 ? 18.000  -157.290 -29.556 1.00 23.20 ? 116  LEU A CA  1 
ATOM   622  C C   . LEU A 1 116 ? 17.235  -157.494 -28.244 1.00 23.54 ? 116  LEU A C   1 
ATOM   623  O O   . LEU A 1 116 ? 16.206  -156.838 -28.013 1.00 22.90 ? 116  LEU A O   1 
ATOM   624  C CB  . LEU A 1 116 ? 17.713  -158.474 -30.492 1.00 23.58 ? 116  LEU A CB  1 
ATOM   625  C CG  . LEU A 1 116 ? 16.230  -158.758 -30.747 1.00 23.61 ? 116  LEU A CG  1 
ATOM   626  C CD1 . LEU A 1 116 ? 15.605  -157.630 -31.548 1.00 23.59 ? 116  LEU A CD1 1 
ATOM   627  C CD2 . LEU A 1 116 ? 16.047  -160.090 -31.463 1.00 22.38 ? 116  LEU A CD2 1 
ATOM   628  N N   . THR A 1 117 ? 17.698  -158.442 -27.416 1.00 23.02 ? 117  THR A N   1 
ATOM   629  C CA  . THR A 1 117 ? 17.021  -158.709 -26.145 1.00 23.01 ? 117  THR A CA  1 
ATOM   630  C C   . THR A 1 117 ? 17.088  -157.475 -25.212 1.00 23.30 ? 117  THR A C   1 
ATOM   631  O O   . THR A 1 117 ? 16.063  -157.091 -24.619 1.00 22.98 ? 117  THR A O   1 
ATOM   632  C CB  . THR A 1 117 ? 17.535  -159.977 -25.456 1.00 22.80 ? 117  THR A CB  1 
ATOM   633  O OG1 . THR A 1 117 ? 18.943  -159.871 -25.276 1.00 24.45 ? 117  THR A OG1 1 
ATOM   634  C CG2 . THR A 1 117 ? 17.226  -161.214 -26.310 1.00 22.18 ? 117  THR A CG2 1 
ATOM   635  N N   . CYS A 1 118 ? 18.247  -156.811 -25.139 1.00 22.89 ? 118  CYS A N   1 
ATOM   636  C CA  . CYS A 1 118 ? 18.362  -155.589 -24.310 1.00 22.83 ? 118  CYS A CA  1 
ATOM   637  C C   . CYS A 1 118 ? 17.502  -154.425 -24.798 1.00 22.50 ? 118  CYS A C   1 
ATOM   638  O O   . CYS A 1 118 ? 16.954  -153.679 -23.984 1.00 21.89 ? 118  CYS A O   1 
ATOM   639  C CB  . CYS A 1 118 ? 19.823  -155.150 -24.103 1.00 22.93 ? 118  CYS A CB  1 
ATOM   640  S SG  . CYS A 1 118 ? 20.787  -156.326 -23.047 1.00 24.88 ? 118  CYS A SG  1 
ATOM   641  N N   . GLN A 1 119 ? 17.380  -154.282 -26.116 1.00 22.52 ? 119  GLN A N   1 
ATOM   642  C CA  . GLN A 1 119 ? 16.549  -153.236 -26.705 1.00 22.49 ? 119  GLN A CA  1 
ATOM   643  C C   . GLN A 1 119 ? 15.086  -153.508 -26.357 1.00 22.85 ? 119  GLN A C   1 
ATOM   644  O O   . GLN A 1 119 ? 14.322  -152.604 -26.025 1.00 21.71 ? 119  GLN A O   1 
ATOM   645  C CB  . GLN A 1 119 ? 16.743  -153.188 -28.220 1.00 22.63 ? 119  GLN A CB  1 
ATOM   646  C CG  . GLN A 1 119 ? 15.807  -152.211 -28.924 1.00 24.18 ? 119  GLN A CG  1 
ATOM   647  C CD  . GLN A 1 119 ? 16.198  -150.768 -28.663 1.00 28.61 ? 119  GLN A CD  1 
ATOM   648  O OE1 . GLN A 1 119 ? 17.165  -150.274 -29.242 1.00 30.22 ? 119  GLN A OE1 1 
ATOM   649  N NE2 . GLN A 1 119 ? 15.449  -150.081 -27.790 1.00 29.47 ? 119  GLN A NE2 1 
ATOM   650  N N   . THR A 1 120 ? 14.707  -154.782 -26.412 1.00 23.15 ? 120  THR A N   1 
ATOM   651  C CA  . THR A 1 120 ? 13.347  -155.163 -26.079 1.00 23.57 ? 120  THR A CA  1 
ATOM   652  C C   . THR A 1 120 ? 12.985  -154.819 -24.630 1.00 23.68 ? 120  THR A C   1 
ATOM   653  O O   . THR A 1 120 ? 11.907  -154.262 -24.378 1.00 23.53 ? 120  THR A O   1 
ATOM   654  C CB  . THR A 1 120 ? 13.122  -156.632 -26.382 1.00 23.36 ? 120  THR A CB  1 
ATOM   655  O OG1 . THR A 1 120 ? 13.497  -156.863 -27.744 1.00 23.94 ? 120  THR A OG1 1 
ATOM   656  C CG2 . THR A 1 120 ? 11.650  -157.004 -26.188 1.00 23.34 ? 120  THR A CG2 1 
ATOM   657  N N   . VAL A 1 121 ? 13.895  -155.122 -23.700 1.00 23.16 ? 121  VAL A N   1 
ATOM   658  C CA  . VAL A 1 121 ? 13.731  -154.789 -22.275 1.00 23.51 ? 121  VAL A CA  1 
ATOM   659  C C   . VAL A 1 121 ? 13.710  -153.264 -22.051 1.00 24.32 ? 121  VAL A C   1 
ATOM   660  O O   . VAL A 1 121 ? 12.828  -152.748 -21.334 1.00 24.67 ? 121  VAL A O   1 
ATOM   661  C CB  . VAL A 1 121 ? 14.821  -155.508 -21.389 1.00 23.83 ? 121  VAL A CB  1 
ATOM   662  C CG1 . VAL A 1 121 ? 14.833  -155.023 -19.947 1.00 22.94 ? 121  VAL A CG1 1 
ATOM   663  C CG2 . VAL A 1 121 ? 14.657  -157.044 -21.448 1.00 23.07 ? 121  VAL A CG2 1 
ATOM   664  N N   . ALA A 1 122 ? 14.654  -152.543 -22.671 1.00 24.30 ? 122  ALA A N   1 
ATOM   665  C CA  . ALA A 1 122 ? 14.673  -151.066 -22.622 1.00 24.74 ? 122  ALA A CA  1 
ATOM   666  C C   . ALA A 1 122 ? 13.341  -150.482 -23.061 1.00 24.84 ? 122  ALA A C   1 
ATOM   667  O O   . ALA A 1 122 ? 12.836  -149.516 -22.461 1.00 25.16 ? 122  ALA A O   1 
ATOM   668  C CB  . ALA A 1 122 ? 15.801  -150.506 -23.486 1.00 24.46 ? 122  ALA A CB  1 
ATOM   669  N N   . ASP A 1 123 ? 12.792  -151.056 -24.130 1.00 25.08 ? 123  ASP A N   1 
ATOM   670  C CA  . ASP A 1 123 ? 11.509  -150.640 -24.662 1.00 25.54 ? 123  ASP A CA  1 
ATOM   671  C C   . ASP A 1 123 ? 10.348  -150.857 -23.678 1.00 25.48 ? 123  ASP A C   1 
ATOM   672  O O   . ASP A 1 123 ? 9.330   -150.174 -23.757 1.00 25.33 ? 123  ASP A O   1 
ATOM   673  C CB  . ASP A 1 123 ? 11.244  -151.336 -25.994 1.00 25.77 ? 123  ASP A CB  1 
ATOM   674  C CG  . ASP A 1 123 ? 11.969  -150.672 -27.159 1.00 26.08 ? 123  ASP A CG  1 
ATOM   675  O OD1 . ASP A 1 123 ? 12.800  -149.776 -26.922 1.00 25.74 ? 123  ASP A OD1 1 
ATOM   676  O OD2 . ASP A 1 123 ? 11.717  -151.054 -28.321 1.00 28.37 ? 123  ASP A OD2 1 
ATOM   677  N N   . MET A 1 124 ? 10.508  -151.808 -22.759 1.00 24.74 ? 124  MET A N   1 
ATOM   678  C CA  . MET A 1 124 ? 9.556   -151.996 -21.659 1.00 24.23 ? 124  MET A CA  1 
ATOM   679  C C   . MET A 1 124 ? 9.776   -150.983 -20.527 1.00 23.53 ? 124  MET A C   1 
ATOM   680  O O   . MET A 1 124 ? 8.983   -150.915 -19.586 1.00 23.31 ? 124  MET A O   1 
ATOM   681  C CB  . MET A 1 124 ? 9.673   -153.407 -21.088 1.00 23.85 ? 124  MET A CB  1 
ATOM   682  C CG  . MET A 1 124 ? 9.263   -154.508 -22.038 1.00 24.21 ? 124  MET A CG  1 
ATOM   683  S SD  . MET A 1 124 ? 9.937   -156.088 -21.503 1.00 24.61 ? 124  MET A SD  1 
ATOM   684  C CE  . MET A 1 124 ? 9.150   -156.294 -19.896 1.00 25.32 ? 124  MET A CE  1 
ATOM   685  N N   . ILE A 1 125 ? 10.872  -150.233 -20.603 1.00 23.18 ? 125  ILE A N   1 
ATOM   686  C CA  . ILE A 1 125 ? 11.203  -149.223 -19.590 1.00 23.19 ? 125  ILE A CA  1 
ATOM   687  C C   . ILE A 1 125 ? 10.789  -147.815 -20.046 1.00 23.21 ? 125  ILE A C   1 
ATOM   688  O O   . ILE A 1 125 ? 10.256  -147.027 -19.249 1.00 23.16 ? 125  ILE A O   1 
ATOM   689  C CB  . ILE A 1 125 ? 12.730  -149.256 -19.216 1.00 23.39 ? 125  ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 125 ? 13.138  -150.639 -18.691 1.00 23.41 ? 125  ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 125 ? 13.082  -148.177 -18.194 1.00 22.26 ? 125  ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 125 ? 12.399  -151.050 -17.421 1.00 24.07 ? 125  ILE A CD1 1 
ATOM   693  N N   . LYS A 1 126 ? 11.011  -147.527 -21.328 1.00 22.82 ? 126  LYS A N   1 
ATOM   694  C CA  . LYS A 1 126 ? 10.730  -146.211 -21.914 1.00 22.83 ? 126  LYS A CA  1 
ATOM   695  C C   . LYS A 1 126 ? 9.298   -145.740 -21.687 1.00 23.08 ? 126  LYS A C   1 
ATOM   696  O O   . LYS A 1 126 ? 8.346   -146.480 -21.956 1.00 22.48 ? 126  LYS A O   1 
ATOM   697  C CB  . LYS A 1 126 ? 11.014  -146.218 -23.415 1.00 23.01 ? 126  LYS A CB  1 
ATOM   698  C CG  . LYS A 1 126 ? 12.478  -146.382 -23.781 1.00 22.33 ? 126  LYS A CG  1 
ATOM   699  C CD  . LYS A 1 126 ? 12.598  -146.606 -25.258 1.00 21.93 ? 126  LYS A CD  1 
ATOM   700  C CE  . LYS A 1 126 ? 14.022  -146.875 -25.647 1.00 23.01 ? 126  LYS A CE  1 
ATOM   701  N NZ  . LYS A 1 126 ? 14.737  -145.620 -25.975 1.00 24.57 ? 126  LYS A NZ  1 
ATOM   702  N N   . GLY A 1 127 ? 9.171   -144.508 -21.184 1.00 22.61 ? 127  GLY A N   1 
ATOM   703  C CA  . GLY A 1 127 ? 7.879   -143.854 -20.972 1.00 23.19 ? 127  GLY A CA  1 
ATOM   704  C C   . GLY A 1 127 ? 7.163   -144.190 -19.676 1.00 23.20 ? 127  GLY A C   1 
ATOM   705  O O   . GLY A 1 127 ? 6.085   -143.677 -19.428 1.00 23.61 ? 127  GLY A O   1 
ATOM   706  N N   . LYS A 1 128 ? 7.759   -145.039 -18.848 1.00 23.04 ? 128  LYS A N   1 
ATOM   707  C CA  . LYS A 1 128 ? 7.093   -145.560 -17.658 1.00 23.35 ? 128  LYS A CA  1 
ATOM   708  C C   . LYS A 1 128 ? 7.535   -144.839 -16.401 1.00 23.51 ? 128  LYS A C   1 
ATOM   709  O O   . LYS A 1 128 ? 8.667   -144.349 -16.327 1.00 24.17 ? 128  LYS A O   1 
ATOM   710  C CB  . LYS A 1 128 ? 7.382   -147.068 -17.481 1.00 23.17 ? 128  LYS A CB  1 
ATOM   711  C CG  . LYS A 1 128 ? 6.637   -147.979 -18.427 1.00 24.15 ? 128  LYS A CG  1 
ATOM   712  C CD  . LYS A 1 128 ? 6.506   -149.400 -17.849 1.00 26.57 ? 128  LYS A CD  1 
ATOM   713  C CE  . LYS A 1 128 ? 6.108   -150.427 -18.918 1.00 28.03 ? 128  LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 128 ? 5.311   -149.822 -20.032 1.00 28.39 ? 128  LYS A NZ  1 
ATOM   715  N N   . THR A 1 129 ? 6.649   -144.807 -15.409 1.00 23.52 ? 129  THR A N   1 
ATOM   716  C CA  . THR A 1 129 ? 6.983   -144.317 -14.078 1.00 23.72 ? 129  THR A CA  1 
ATOM   717  C C   . THR A 1 129 ? 7.793   -145.395 -13.352 1.00 23.67 ? 129  THR A C   1 
ATOM   718  O O   . THR A 1 129 ? 7.718   -146.577 -13.727 1.00 24.13 ? 129  THR A O   1 
ATOM   719  C CB  . THR A 1 129 ? 5.708   -144.037 -13.261 1.00 23.25 ? 129  THR A CB  1 
ATOM   720  O OG1 . THR A 1 129 ? 4.982   -145.256 -13.086 1.00 23.54 ? 129  THR A OG1 1 
ATOM   721  C CG2 . THR A 1 129 ? 4.820   -143.014 -13.955 1.00 25.15 ? 129  THR A CG2 1 
ATOM   722  N N   . PRO A 1 130 ? 8.547   -145.012 -12.295 1.00 23.61 ? 130  PRO A N   1 
ATOM   723  C CA  . PRO A 1 130 ? 9.277   -146.030 -11.534 1.00 23.52 ? 130  PRO A CA  1 
ATOM   724  C C   . PRO A 1 130 ? 8.332   -147.113 -11.003 1.00 23.67 ? 130  PRO A C   1 
ATOM   725  O O   . PRO A 1 130 ? 8.695   -148.285 -10.984 1.00 23.03 ? 130  PRO A O   1 
ATOM   726  C CB  . PRO A 1 130 ? 9.890   -145.241 -10.378 1.00 23.29 ? 130  PRO A CB  1 
ATOM   727  C CG  . PRO A 1 130 ? 9.972   -143.836 -10.885 1.00 24.01 ? 130  PRO A CG  1 
ATOM   728  C CD  . PRO A 1 130 ? 8.758   -143.663 -11.743 1.00 23.78 ? 130  PRO A CD  1 
ATOM   729  N N   . GLU A 1 131 ? 7.126   -146.716 -10.600 1.00 24.14 ? 131  GLU A N   1 
ATOM   730  C CA  . GLU A 1 131 ? 6.121   -147.651 -10.093 1.00 25.11 ? 131  GLU A CA  1 
ATOM   731  C C   . GLU A 1 131 ? 5.644   -148.657 -11.161 1.00 25.17 ? 131  GLU A C   1 
ATOM   732  O O   . GLU A 1 131 ? 5.506   -149.863 -10.880 1.00 25.82 ? 131  GLU A O   1 
ATOM   733  C CB  . GLU A 1 131 ? 4.929   -146.882 -9.496  1.00 25.46 ? 131  GLU A CB  1 
ATOM   734  C CG  . GLU A 1 131 ? 3.897   -147.767 -8.795  1.00 28.03 ? 131  GLU A CG  1 
ATOM   735  C CD  . GLU A 1 131 ? 4.539   -148.706 -7.782  1.00 31.30 ? 131  GLU A CD  1 
ATOM   736  O OE1 . GLU A 1 131 ? 5.122   -148.198 -6.794  1.00 32.12 ? 131  GLU A OE1 1 
ATOM   737  O OE2 . GLU A 1 131 ? 4.470   -149.946 -7.983  1.00 31.72 ? 131  GLU A OE2 1 
ATOM   738  N N   . GLU A 1 132 ? 5.382   -148.159 -12.372 1.00 25.09 ? 132  GLU A N   1 
ATOM   739  C CA  . GLU A 1 132 ? 5.009   -149.013 -13.506 1.00 24.82 ? 132  GLU A CA  1 
ATOM   740  C C   . GLU A 1 132 ? 6.149   -149.951 -13.881 1.00 24.69 ? 132  GLU A C   1 
ATOM   741  O O   . GLU A 1 132 ? 5.916   -151.103 -14.268 1.00 24.81 ? 132  GLU A O   1 
ATOM   742  C CB  . GLU A 1 132 ? 4.639   -148.177 -14.725 1.00 24.78 ? 132  GLU A CB  1 
ATOM   743  C CG  . GLU A 1 132 ? 3.244   -147.607 -14.702 1.00 25.21 ? 132  GLU A CG  1 
ATOM   744  C CD  . GLU A 1 132 ? 3.098   -146.412 -15.627 1.00 26.49 ? 132  GLU A CD  1 
ATOM   745  O OE1 . GLU A 1 132 ? 1.944   -146.054 -15.941 1.00 25.18 ? 132  GLU A OE1 1 
ATOM   746  O OE2 . GLU A 1 132 ? 4.135   -145.828 -16.039 1.00 26.57 ? 132  GLU A OE2 1 
ATOM   747  N N   . ILE A 1 133 ? 7.378   -149.457 -13.766 1.00 24.09 ? 133  ILE A N   1 
ATOM   748  C CA  . ILE A 1 133 ? 8.559   -150.263 -14.082 1.00 24.19 ? 133  ILE A CA  1 
ATOM   749  C C   . ILE A 1 133 ? 8.700   -151.440 -13.117 1.00 24.04 ? 133  ILE A C   1 
ATOM   750  O O   . ILE A 1 133 ? 8.810   -152.600 -13.543 1.00 23.61 ? 133  ILE A O   1 
ATOM   751  C CB  . ILE A 1 133 ? 9.856   -149.412 -14.111 1.00 23.94 ? 133  ILE A CB  1 
ATOM   752  C CG1 . ILE A 1 133 ? 9.840   -148.485 -15.335 1.00 23.46 ? 133  ILE A CG1 1 
ATOM   753  C CG2 . ILE A 1 133 ? 11.107  -150.328 -14.078 1.00 24.21 ? 133  ILE A CG2 1 
ATOM   754  C CD1 . ILE A 1 133 ? 10.752  -147.291 -15.230 1.00 21.20 ? 133  ILE A CD1 1 
ATOM   755  N N   . ARG A 1 134 ? 8.674   -151.159 -11.820 1.00 23.78 ? 134  ARG A N   1 
ATOM   756  C CA  . ARG A 1 134 ? 8.868   -152.244 -10.866 1.00 24.13 ? 134  ARG A CA  1 
ATOM   757  C C   . ARG A 1 134 ? 7.660   -153.182 -10.734 1.00 23.88 ? 134  ARG A C   1 
ATOM   758  O O   . ARG A 1 134 ? 7.800   -154.301 -10.214 1.00 23.95 ? 134  ARG A O   1 
ATOM   759  C CB  . ARG A 1 134 ? 9.379   -151.730 -9.523  1.00 24.64 ? 134  ARG A CB  1 
ATOM   760  C CG  . ARG A 1 134 ? 8.461   -150.843 -8.787  1.00 24.59 ? 134  ARG A CG  1 
ATOM   761  C CD  . ARG A 1 134 ? 9.136   -150.349 -7.523  1.00 25.91 ? 134  ARG A CD  1 
ATOM   762  N NE  . ARG A 1 134 ? 8.445   -149.161 -7.055  1.00 24.92 ? 134  ARG A NE  1 
ATOM   763  C CZ  . ARG A 1 134 ? 8.977   -147.943 -7.019  1.00 26.12 ? 134  ARG A CZ  1 
ATOM   764  N NH1 . ARG A 1 134 ? 10.237  -147.739 -7.379  1.00 25.90 ? 134  ARG A NH1 1 
ATOM   765  N NH2 . ARG A 1 134 ? 8.248   -146.930 -6.592  1.00 23.86 ? 134  ARG A NH2 1 
ATOM   766  N N   . THR A 1 135 ? 6.496   -152.744 -11.234 1.00 23.60 ? 135  THR A N   1 
ATOM   767  C CA  . THR A 1 135 ? 5.367   -153.661 -11.457 1.00 23.57 ? 135  THR A CA  1 
ATOM   768  C C   . THR A 1 135 ? 5.688   -154.622 -12.602 1.00 23.05 ? 135  THR A C   1 
ATOM   769  O O   . THR A 1 135 ? 5.494   -155.831 -12.461 1.00 23.26 ? 135  THR A O   1 
ATOM   770  C CB  . THR A 1 135 ? 3.995   -152.939 -11.728 1.00 23.62 ? 135  THR A CB  1 
ATOM   771  O OG1 . THR A 1 135 ? 3.369   -152.491 -10.404 1.00 24.63 ? 135  THR A OG1 1 
ATOM   772  C CG2 . THR A 1 135 ? 2.974   -153.977 -12.460 1.00 23.60 ? 135  THR A CG2 1 
ATOM   773  N N   . THR A 1 136 ? 6.168   -154.087 -13.725 1.00 22.49 ? 136  THR A N   1 
ATOM   774  C CA  . THR A 1 136 ? 6.488   -154.916 -14.895 1.00 22.16 ? 136  THR A CA  1 
ATOM   775  C C   . THR A 1 136 ? 7.609   -155.918 -14.600 1.00 21.67 ? 136  THR A C   1 
ATOM   776  O O   . THR A 1 136 ? 7.571   -157.057 -15.065 1.00 21.31 ? 136  THR A O   1 
ATOM   777  C CB  . THR A 1 136 ? 6.836   -154.078 -16.164 1.00 22.14 ? 136  THR A CB  1 
ATOM   778  O OG1 . THR A 1 136 ? 7.230   -152.754 -15.787 1.00 23.40 ? 136  THR A OG1 1 
ATOM   779  C CG2 . THR A 1 136 ? 5.650   -153.978 -17.098 1.00 22.17 ? 136  THR A CG2 1 
ATOM   780  N N   . PHE A 1 137 ? 8.581   -155.486 -13.803 1.00 20.99 ? 137  PHE A N   1 
ATOM   781  C CA  . PHE A 1 137 ? 9.792   -156.264 -13.544 1.00 20.82 ? 137  PHE A CA  1 
ATOM   782  C C   . PHE A 1 137 ? 9.763   -156.963 -12.187 1.00 20.66 ? 137  PHE A C   1 
ATOM   783  O O   . PHE A 1 137 ? 10.706  -157.680 -11.837 1.00 20.49 ? 137  PHE A O   1 
ATOM   784  C CB  . PHE A 1 137 ? 11.034  -155.365 -13.667 1.00 20.63 ? 137  PHE A CB  1 
ATOM   785  C CG  . PHE A 1 137 ? 11.450  -155.101 -15.084 1.00 20.79 ? 137  PHE A CG  1 
ATOM   786  C CD1 . PHE A 1 137 ? 12.754  -155.357 -15.495 1.00 20.11 ? 137  PHE A CD1 1 
ATOM   787  C CD2 . PHE A 1 137 ? 10.535  -154.619 -16.019 1.00 21.07 ? 137  PHE A CD2 1 
ATOM   788  C CE1 . PHE A 1 137 ? 13.135  -155.128 -16.803 1.00 20.82 ? 137  PHE A CE1 1 
ATOM   789  C CE2 . PHE A 1 137 ? 10.907  -154.394 -17.333 1.00 20.75 ? 137  PHE A CE2 1 
ATOM   790  C CZ  . PHE A 1 137 ? 12.207  -154.646 -17.726 1.00 20.94 ? 137  PHE A CZ  1 
ATOM   791  N N   . ASN A 1 138 ? 8.671   -156.758 -11.446 1.00 20.51 ? 138  ASN A N   1 
ATOM   792  C CA  . ASN A 1 138 ? 8.486   -157.312 -10.097 1.00 20.57 ? 138  ASN A CA  1 
ATOM   793  C C   . ASN A 1 138 ? 9.641   -156.963 -9.152  1.00 20.54 ? 138  ASN A C   1 
ATOM   794  O O   . ASN A 1 138 ? 10.206  -157.833 -8.481  1.00 20.33 ? 138  ASN A O   1 
ATOM   795  C CB  . ASN A 1 138 ? 8.232   -158.826 -10.147 1.00 20.79 ? 138  ASN A CB  1 
ATOM   796  C CG  . ASN A 1 138 ? 6.957   -159.181 -10.898 1.00 21.18 ? 138  ASN A CG  1 
ATOM   797  O OD1 . ASN A 1 138 ? 5.852   -158.871 -10.446 1.00 21.93 ? 138  ASN A OD1 1 
ATOM   798  N ND2 . ASN A 1 138 ? 7.106   -159.839 -12.049 1.00 21.34 ? 138  ASN A ND2 1 
ATOM   799  N N   . ILE A 1 139 ? 9.986   -155.676 -9.117  1.00 20.20 ? 139  ILE A N   1 
ATOM   800  C CA  . ILE A 1 139 ? 11.062  -155.183 -8.265  1.00 20.21 ? 139  ILE A CA  1 
ATOM   801  C C   . ILE A 1 139 ? 10.483  -154.454 -7.066  1.00 20.70 ? 139  ILE A C   1 
ATOM   802  O O   . ILE A 1 139 ? 9.544   -153.666 -7.196  1.00 20.97 ? 139  ILE A O   1 
ATOM   803  C CB  . ILE A 1 139 ? 12.022  -154.233 -9.030  1.00 20.18 ? 139  ILE A CB  1 
ATOM   804  C CG1 . ILE A 1 139 ? 12.604  -154.942 -10.260 1.00 19.52 ? 139  ILE A CG1 1 
ATOM   805  C CG2 . ILE A 1 139 ? 13.127  -153.709 -8.094  1.00 19.28 ? 139  ILE A CG2 1 
ATOM   806  C CD1 . ILE A 1 139 ? 13.500  -154.085 -11.129 1.00 20.53 ? 139  ILE A CD1 1 
ATOM   807  N N   . LYS A 1 140 ? 11.043  -154.722 -5.894  1.00 20.81 ? 140  LYS A N   1 
ATOM   808  C CA  . LYS A 1 140 ? 10.624  -154.026 -4.701  1.00 21.35 ? 140  LYS A CA  1 
ATOM   809  C C   . LYS A 1 140 ? 11.385  -152.721 -4.532  1.00 21.58 ? 140  LYS A C   1 
ATOM   810  O O   . LYS A 1 140 ? 12.613  -152.656 -4.653  1.00 21.04 ? 140  LYS A O   1 
ATOM   811  C CB  . LYS A 1 140 ? 10.753  -154.921 -3.468  1.00 21.35 ? 140  LYS A CB  1 
ATOM   812  C CG  . LYS A 1 140 ? 9.964   -156.224 -3.593  1.00 22.73 ? 140  LYS A CG  1 
ATOM   813  C CD  . LYS A 1 140 ? 8.458   -155.969 -3.703  1.00 23.81 ? 140  LYS A CD  1 
ATOM   814  C CE  . LYS A 1 140 ? 7.710   -157.232 -4.087  1.00 24.24 ? 140  LYS A CE  1 
ATOM   815  N NZ  . LYS A 1 140 ? 6.249   -157.077 -3.864  1.00 24.49 ? 140  LYS A NZ  1 
ATOM   816  N N   . ASN A 1 141 ? 10.622  -151.675 -4.264  1.00 22.08 ? 141  ASN A N   1 
ATOM   817  C CA  . ASN A 1 141 ? 11.196  -150.406 -3.888  1.00 22.28 ? 141  ASN A CA  1 
ATOM   818  C C   . ASN A 1 141 ? 11.867  -150.561 -2.530  1.00 22.44 ? 141  ASN A C   1 
ATOM   819  O O   . ASN A 1 141 ? 11.210  -150.932 -1.540  1.00 22.77 ? 141  ASN A O   1 
ATOM   820  C CB  . ASN A 1 141 ? 10.105  -149.341 -3.826  1.00 22.14 ? 141  ASN A CB  1 
ATOM   821  C CG  . ASN A 1 141 ? 10.658  -147.972 -3.545  1.00 21.04 ? 141  ASN A CG  1 
ATOM   822  O OD1 . ASN A 1 141 ? 11.875  -147.785 -3.425  1.00 19.89 ? 141  ASN A OD1 1 
ATOM   823  N ND2 . ASN A 1 141 ? 9.769   -147.001 -3.445  1.00 19.49 ? 141  ASN A ND2 1 
ATOM   824  N N   . ASP A 1 142 ? 13.176  -150.301 -2.502  1.00 22.72 ? 142  ASP A N   1 
ATOM   825  C CA  . ASP A 1 142 ? 13.995  -150.448 -1.291  1.00 23.03 ? 142  ASP A CA  1 
ATOM   826  C C   . ASP A 1 142 ? 14.514  -149.089 -0.794  1.00 23.60 ? 142  ASP A C   1 
ATOM   827  O O   . ASP A 1 142 ? 15.522  -149.008 -0.056  1.00 23.05 ? 142  ASP A O   1 
ATOM   828  C CB  . ASP A 1 142 ? 15.139  -151.447 -1.535  1.00 22.75 ? 142  ASP A CB  1 
ATOM   829  C CG  . ASP A 1 142 ? 16.085  -151.017 -2.657  1.00 23.40 ? 142  ASP A CG  1 
ATOM   830  O OD1 . ASP A 1 142 ? 15.763  -150.073 -3.412  1.00 19.86 ? 142  ASP A OD1 1 
ATOM   831  O OD2 . ASP A 1 142 ? 17.166  -151.652 -2.768  1.00 23.07 ? 142  ASP A OD2 1 
ATOM   832  N N   . PHE A 1 143 ? 13.803  -148.004 -1.231  1.00 24.17 ? 143  PHE A N   1 
ATOM   833  C CA  . PHE A 1 143 ? 14.134  -146.711 -0.738  1.00 25.90 ? 143  PHE A CA  1 
ATOM   834  C C   . PHE A 1 143 ? 13.238  -146.400 0.443   1.00 25.71 ? 143  PHE A C   1 
ATOM   835  O O   . PHE A 1 143 ? 12.059  -146.812 0.497   1.00 24.81 ? 143  PHE A O   1 
ATOM   836  C CB  . PHE A 1 143 ? 13.828  -145.662 -1.819  1.00 26.99 ? 143  PHE A CB  1 
ATOM   837  C CG  . PHE A 1 143 ? 14.712  -145.721 -3.023  1.00 30.40 ? 143  PHE A CG  1 
ATOM   838  C CD1 . PHE A 1 143 ? 14.254  -146.288 -4.242  1.00 29.67 ? 143  PHE A CD1 1 
ATOM   839  C CD2 . PHE A 1 143 ? 15.950  -145.040 -3.055  1.00 36.19 ? 143  PHE A CD2 1 
ATOM   840  C CE1 . PHE A 1 143 ? 15.011  -146.218 -5.359  1.00 32.90 ? 143  PHE A CE1 1 
ATOM   841  C CE2 . PHE A 1 143 ? 16.736  -144.989 -4.219  1.00 36.40 ? 143  PHE A CE2 1 
ATOM   842  C CZ  . PHE A 1 143 ? 16.264  -145.603 -5.370  1.00 37.29 ? 143  PHE A CZ  1 
ATOM   843  N N   . THR A 1 144 ? 13.797  -145.653 1.388   1.00 24.85 ? 144  THR A N   1 
ATOM   844  C CA  . THR A 1 144 ? 12.961  -144.924 2.365   1.00 23.76 ? 144  THR A CA  1 
ATOM   845  C C   . THR A 1 144 ? 12.178  -143.834 1.572   1.00 23.26 ? 144  THR A C   1 
ATOM   846  O O   . THR A 1 144 ? 12.640  -143.388 0.502   1.00 23.37 ? 144  THR A O   1 
ATOM   847  C CB  . THR A 1 144 ? 13.826  -144.285 3.478   1.00 23.89 ? 144  THR A CB  1 
ATOM   848  O OG1 . THR A 1 144 ? 14.633  -143.220 2.921   1.00 23.13 ? 144  THR A OG1 1 
ATOM   849  C CG2 . THR A 1 144 ? 14.740  -145.335 4.106   1.00 23.26 ? 144  THR A CG2 1 
ATOM   850  N N   . PRO A 1 145 ? 10.979  -143.428 2.060   1.00 23.33 ? 145  PRO A N   1 
ATOM   851  C CA  . PRO A 1 145 ? 10.319  -142.272 1.416   1.00 23.03 ? 145  PRO A CA  1 
ATOM   852  C C   . PRO A 1 145 ? 11.259  -141.076 1.311   1.00 22.72 ? 145  PRO A C   1 
ATOM   853  O O   . PRO A 1 145 ? 11.288  -140.429 0.279   1.00 22.99 ? 145  PRO A O   1 
ATOM   854  C CB  . PRO A 1 145 ? 9.144   -141.968 2.352   1.00 23.06 ? 145  PRO A CB  1 
ATOM   855  C CG  . PRO A 1 145 ? 8.842   -143.315 2.986   1.00 23.38 ? 145  PRO A CG  1 
ATOM   856  C CD  . PRO A 1 145 ? 10.166  -143.990 3.161   1.00 22.91 ? 145  PRO A CD  1 
ATOM   857  N N   . GLU A 1 146 ? 12.044  -140.827 2.360   1.00 22.88 ? 146  GLU A N   1 
ATOM   858  C CA  . GLU A 1 146 ? 12.979  -139.698 2.417   1.00 23.13 ? 146  GLU A CA  1 
ATOM   859  C C   . GLU A 1 146 ? 14.117  -139.793 1.383   1.00 23.18 ? 146  GLU A C   1 
ATOM   860  O O   . GLU A 1 146 ? 14.423  -138.799 0.717   1.00 22.23 ? 146  GLU A O   1 
ATOM   861  C CB  . GLU A 1 146 ? 13.527  -139.535 3.839   1.00 23.39 ? 146  GLU A CB  1 
ATOM   862  C CG  . GLU A 1 146 ? 14.520  -138.398 4.007   1.00 24.31 ? 146  GLU A CG  1 
ATOM   863  C CD  . GLU A 1 146 ? 14.774  -138.037 5.460   1.00 25.85 ? 146  GLU A CD  1 
ATOM   864  O OE1 . GLU A 1 146 ? 14.687  -138.932 6.337   1.00 26.93 ? 146  GLU A OE1 1 
ATOM   865  O OE2 . GLU A 1 146 ? 15.072  -136.852 5.724   1.00 25.94 ? 146  GLU A OE2 1 
ATOM   866  N N   . GLU A 1 147 ? 14.742  -140.977 1.270   1.00 23.45 ? 147  GLU A N   1 
ATOM   867  C CA  . GLU A 1 147 ? 15.711  -141.259 0.189   1.00 23.90 ? 147  GLU A CA  1 
ATOM   868  C C   . GLU A 1 147 ? 15.104  -140.950 -1.194  1.00 24.29 ? 147  GLU A C   1 
ATOM   869  O O   . GLU A 1 147 ? 15.733  -140.277 -2.018  1.00 24.21 ? 147  GLU A O   1 
ATOM   870  C CB  . GLU A 1 147 ? 16.247  -142.713 0.243   1.00 24.41 ? 147  GLU A CB  1 
ATOM   871  C CG  . GLU A 1 147 ? 17.374  -142.923 1.269   1.00 23.89 ? 147  GLU A CG  1 
ATOM   872  C CD  . GLU A 1 147 ? 17.726  -144.419 1.541   1.00 27.91 ? 147  GLU A CD  1 
ATOM   873  O OE1 . GLU A 1 147 ? 18.883  -144.657 1.960   1.00 24.51 ? 147  GLU A OE1 1 
ATOM   874  O OE2 . GLU A 1 147 ? 16.869  -145.363 1.392   1.00 27.25 ? 147  GLU A OE2 1 
ATOM   875  N N   . GLU A 1 148 ? 13.882  -141.433 -1.442  1.00 24.11 ? 148  GLU A N   1 
ATOM   876  C CA  . GLU A 1 148 ? 13.237  -141.318 -2.755  1.00 24.39 ? 148  GLU A CA  1 
ATOM   877  C C   . GLU A 1 148 ? 12.784  -139.868 -3.068  1.00 24.59 ? 148  GLU A C   1 
ATOM   878  O O   . GLU A 1 148 ? 12.809  -139.433 -4.223  1.00 24.27 ? 148  GLU A O   1 
ATOM   879  C CB  . GLU A 1 148 ? 12.056  -142.295 -2.828  1.00 24.40 ? 148  GLU A CB  1 
ATOM   880  C CG  . GLU A 1 148 ? 11.157  -142.116 -4.035  1.00 25.14 ? 148  GLU A CG  1 
ATOM   881  C CD  . GLU A 1 148 ? 10.214  -143.272 -4.271  1.00 26.31 ? 148  GLU A CD  1 
ATOM   882  O OE1 . GLU A 1 148 ? 9.789   -143.919 -3.281  1.00 26.62 ? 148  GLU A OE1 1 
ATOM   883  O OE2 . GLU A 1 148 ? 9.892   -143.536 -5.457  1.00 27.16 ? 148  GLU A OE2 1 
ATOM   884  N N   . GLU A 1 149 ? 12.370  -139.136 -2.040  1.00 24.45 ? 149  GLU A N   1 
ATOM   885  C CA  . GLU A 1 149 ? 12.028  -137.725 -2.205  1.00 24.98 ? 149  GLU A CA  1 
ATOM   886  C C   . GLU A 1 149 ? 13.258  -136.907 -2.618  1.00 24.29 ? 149  GLU A C   1 
ATOM   887  O O   . GLU A 1 149 ? 13.153  -136.036 -3.482  1.00 24.63 ? 149  GLU A O   1 
ATOM   888  C CB  . GLU A 1 149 ? 11.436  -137.144 -0.920  1.00 24.91 ? 149  GLU A CB  1 
ATOM   889  C CG  . GLU A 1 149 ? 10.080  -137.742 -0.487  1.00 27.21 ? 149  GLU A CG  1 
ATOM   890  C CD  . GLU A 1 149 ? 9.517   -137.082 0.779   1.00 26.87 ? 149  GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 149 ? 9.664   -135.830 0.892   1.00 31.56 ? 149  GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 149 ? 8.905   -137.799 1.652   1.00 30.19 ? 149  GLU A OE2 1 
ATOM   893  N N   . GLU A 1 150 ? 14.401  -137.161 -1.975  1.00 23.67 ? 150  GLU A N   1 
ATOM   894  C CA  . GLU A 1 150 ? 15.655  -136.449 -2.271  1.00 23.49 ? 150  GLU A CA  1 
ATOM   895  C C   . GLU A 1 150 ? 16.064  -136.677 -3.740  1.00 23.28 ? 150  GLU A C   1 
ATOM   896  O O   . GLU A 1 150 ? 16.394  -135.731 -4.462  1.00 22.67 ? 150  GLU A O   1 
ATOM   897  C CB  . GLU A 1 150 ? 16.782  -136.932 -1.336  1.00 23.13 ? 150  GLU A CB  1 
ATOM   898  C CG  . GLU A 1 150 ? 17.668  -135.824 -0.792  1.00 24.35 ? 150  GLU A CG  1 
ATOM   899  C CD  . GLU A 1 150 ? 19.184  -136.113 -0.882  1.00 26.66 ? 150  GLU A CD  1 
ATOM   900  O OE1 . GLU A 1 150 ? 19.623  -137.278 -0.713  1.00 25.93 ? 150  GLU A OE1 1 
ATOM   901  O OE2 . GLU A 1 150 ? 19.948  -135.146 -1.124  1.00 27.17 ? 150  GLU A OE2 1 
ATOM   902  N N   . VAL A 1 151 ? 16.052  -137.948 -4.159  1.00 23.28 ? 151  VAL A N   1 
ATOM   903  C CA  . VAL A 1 151 ? 16.401  -138.320 -5.542  1.00 23.79 ? 151  VAL A CA  1 
ATOM   904  C C   . VAL A 1 151 ? 15.428  -137.724 -6.572  1.00 24.13 ? 151  VAL A C   1 
ATOM   905  O O   . VAL A 1 151 ? 15.864  -137.149 -7.569  1.00 23.98 ? 151  VAL A O   1 
ATOM   906  C CB  . VAL A 1 151 ? 16.520  -139.864 -5.722  1.00 23.61 ? 151  VAL A CB  1 
ATOM   907  C CG1 . VAL A 1 151 ? 16.625  -140.240 -7.199  1.00 23.18 ? 151  VAL A CG1 1 
ATOM   908  C CG2 . VAL A 1 151 ? 17.711  -140.419 -4.921  1.00 22.26 ? 151  VAL A CG2 1 
ATOM   909  N N   . ARG A 1 152 ? 14.121  -137.858 -6.333  1.00 24.70 ? 152  ARG A N   1 
ATOM   910  C CA  . ARG A 1 152 ? 13.112  -137.297 -7.248  1.00 24.98 ? 152  ARG A CA  1 
ATOM   911  C C   . ARG A 1 152 ? 13.246  -135.787 -7.402  1.00 25.36 ? 152  ARG A C   1 
ATOM   912  O O   . ARG A 1 152 ? 13.230  -135.262 -8.507  1.00 25.31 ? 152  ARG A O   1 
ATOM   913  C CB  . ARG A 1 152 ? 11.704  -137.658 -6.779  1.00 24.96 ? 152  ARG A CB  1 
ATOM   914  C CG  . ARG A 1 152 ? 10.606  -137.194 -7.719  1.00 26.07 ? 152  ARG A CG  1 
ATOM   915  C CD  . ARG A 1 152 ? 9.281   -137.844 -7.379  1.00 29.65 ? 152  ARG A CD  1 
ATOM   916  N NE  . ARG A 1 152 ? 9.152   -139.203 -7.920  1.00 33.01 ? 152  ARG A NE  1 
ATOM   917  C CZ  . ARG A 1 152 ? 8.944   -140.303 -7.190  1.00 33.89 ? 152  ARG A CZ  1 
ATOM   918  N NH1 . ARG A 1 152 ? 8.842   -140.235 -5.864  1.00 34.51 ? 152  ARG A NH1 1 
ATOM   919  N NH2 . ARG A 1 152 ? 8.826   -141.483 -7.793  1.00 33.99 ? 152  ARG A NH2 1 
ATOM   920  N N   . ARG A 1 153 ? 13.391  -135.085 -6.286  1.00 25.44 ? 153  ARG A N   1 
ATOM   921  C CA  . ARG A 1 153 ? 13.590  -133.642 -6.332  1.00 26.07 ? 153  ARG A CA  1 
ATOM   922  C C   . ARG A 1 153 ? 14.852  -133.286 -7.125  1.00 26.33 ? 153  ARG A C   1 
ATOM   923  O O   . ARG A 1 153 ? 14.842  -132.428 -8.016  1.00 27.33 ? 153  ARG A O   1 
ATOM   924  C CB  . ARG A 1 153 ? 13.635  -133.072 -4.915  1.00 25.80 ? 153  ARG A CB  1 
ATOM   925  C CG  . ARG A 1 153 ? 13.833  -131.589 -4.866  1.00 26.33 ? 153  ARG A CG  1 
ATOM   926  C CD  . ARG A 1 153 ? 13.414  -131.035 -3.516  1.00 30.25 ? 153  ARG A CD  1 
ATOM   927  N NE  . ARG A 1 153 ? 14.290  -131.530 -2.471  1.00 34.30 ? 153  ARG A NE  1 
ATOM   928  C CZ  . ARG A 1 153 ? 13.901  -132.277 -1.435  1.00 35.75 ? 153  ARG A CZ  1 
ATOM   929  N NH1 . ARG A 1 153 ? 12.625  -132.607 -1.258  1.00 36.70 ? 153  ARG A NH1 1 
ATOM   930  N NH2 . ARG A 1 153 ? 14.797  -132.678 -0.558  1.00 37.65 ? 153  ARG A NH2 1 
ATOM   931  N N   . GLU A 1 154 ? 15.948  -133.962 -6.845  1.00 26.29 ? 154  GLU A N   1 
ATOM   932  C CA  . GLU A 1 154 ? 17.134  -133.713 -7.614  1.00 25.87 ? 154  GLU A CA  1 
ATOM   933  C C   . GLU A 1 154 ? 16.950  -134.006 -9.113  1.00 25.93 ? 154  GLU A C   1 
ATOM   934  O O   . GLU A 1 154 ? 17.419  -133.232 -9.968  1.00 25.61 ? 154  GLU A O   1 
ATOM   935  C CB  . GLU A 1 154 ? 18.223  -134.591 -7.095  1.00 26.00 ? 154  GLU A CB  1 
ATOM   936  C CG  . GLU A 1 154 ? 19.545  -134.033 -7.406  1.00 29.93 ? 154  GLU A CG  1 
ATOM   937  C CD  . GLU A 1 154 ? 20.589  -134.896 -6.808  1.00 25.14 ? 154  GLU A CD  1 
ATOM   938  O OE1 . GLU A 1 154 ? 21.128  -134.510 -5.768  1.00 29.57 ? 154  GLU A OE1 1 
ATOM   939  O OE2 . GLU A 1 154 ? 20.809  -135.975 -7.358  1.00 29.94 ? 154  GLU A OE2 1 
ATOM   940  N N   . ASN A 1 155 ? 16.347  -135.163 -9.439  1.00 24.85 ? 155  ASN A N   1 
ATOM   941  C CA  . ASN A 1 155 ? 16.110  -135.506 -10.850 1.00 23.58 ? 155  ASN A CA  1 
ATOM   942  C C   . ASN A 1 155 ? 15.345  -134.428 -11.600 1.00 23.52 ? 155  ASN A C   1 
ATOM   943  O O   . ASN A 1 155 ? 15.724  -134.033 -12.706 1.00 22.98 ? 155  ASN A O   1 
ATOM   944  C CB  . ASN A 1 155 ? 15.299  -136.785 -10.992 1.00 22.60 ? 155  ASN A CB  1 
ATOM   945  C CG  . ASN A 1 155 ? 16.096  -138.026 -10.699 1.00 22.03 ? 155  ASN A CG  1 
ATOM   946  O OD1 . ASN A 1 155 ? 17.285  -137.957 -10.396 1.00 20.98 ? 155  ASN A OD1 1 
ATOM   947  N ND2 . ASN A 1 155 ? 15.434  -139.188 -10.769 1.00 20.49 ? 155  ASN A ND2 1 
ATOM   948  N N   . GLN A 1 156 ? 14.227  -134.000 -11.020 1.00 23.51 ? 156  GLN A N   1 
ATOM   949  C CA  . GLN A 1 156 ? 13.334  -133.065 -11.711 1.00 22.43 ? 156  GLN A CA  1 
ATOM   950  C C   . GLN A 1 156 ? 13.860  -131.661 -11.689 1.00 22.63 ? 156  GLN A C   1 
ATOM   951  O O   . GLN A 1 156 ? 13.725  -130.933 -12.679 1.00 22.23 ? 156  GLN A O   1 
ATOM   952  C CB  . GLN A 1 156 ? 11.925  -133.122 -11.131 1.00 22.62 ? 156  GLN A CB  1 
ATOM   953  C CG  . GLN A 1 156 ? 11.247  -134.474 -11.325 1.00 24.36 ? 156  GLN A CG  1 
ATOM   954  C CD  . GLN A 1 156 ? 9.944   -134.596 -10.566 1.00 28.66 ? 156  GLN A CD  1 
ATOM   955  O OE1 . GLN A 1 156 ? 9.731   -133.921 -9.557  1.00 29.45 ? 156  GLN A OE1 1 
ATOM   956  N NE2 . GLN A 1 156 ? 9.052   -135.454 -11.059 1.00 27.71 ? 156  GLN A NE2 1 
ATOM   957  N N   . TRP A 1 157 ? 14.443  -131.260 -10.567 1.00 22.94 ? 157  TRP A N   1 
ATOM   958  C CA  . TRP A 1 157 ? 14.861  -129.864 -10.401 1.00 22.97 ? 157  TRP A CA  1 
ATOM   959  C C   . TRP A 1 157 ? 16.163  -129.533 -11.140 1.00 22.25 ? 157  TRP A C   1 
ATOM   960  O O   . TRP A 1 157 ? 16.330  -128.397 -11.624 1.00 21.79 ? 157  TRP A O   1 
ATOM   961  C CB  . TRP A 1 157 ? 15.037  -129.522 -8.908  1.00 22.85 ? 157  TRP A CB  1 
ATOM   962  C CG  . TRP A 1 157 ? 13.735  -129.445 -8.078  1.00 22.96 ? 157  TRP A CG  1 
ATOM   963  C CD1 . TRP A 1 157 ? 12.528  -130.038 -8.354  1.00 22.61 ? 157  TRP A CD1 1 
ATOM   964  C CD2 . TRP A 1 157 ? 13.568  -128.762 -6.836  1.00 21.03 ? 157  TRP A CD2 1 
ATOM   965  N NE1 . TRP A 1 157 ? 11.617  -129.749 -7.361  1.00 21.89 ? 157  TRP A NE1 1 
ATOM   966  C CE2 . TRP A 1 157 ? 12.231  -128.974 -6.414  1.00 21.53 ? 157  TRP A CE2 1 
ATOM   967  C CE3 . TRP A 1 157 ? 14.427  -128.016 -6.018  1.00 21.82 ? 157  TRP A CE3 1 
ATOM   968  C CZ2 . TRP A 1 157 ? 11.726  -128.444 -5.226  1.00 19.78 ? 157  TRP A CZ2 1 
ATOM   969  C CZ3 . TRP A 1 157 ? 13.908  -127.462 -4.834  1.00 20.35 ? 157  TRP A CZ3 1 
ATOM   970  C CH2 . TRP A 1 157 ? 12.572  -127.679 -4.461  1.00 21.95 ? 157  TRP A CH2 1 
ATOM   971  N N   . ALA A 1 158 ? 17.084  -130.503 -11.175 1.00 23.05 ? 158  ALA A N   1 
ATOM   972  C CA  . ALA A 1 158 ? 18.425  -130.320 -11.724 1.00 23.98 ? 158  ALA A CA  1 
ATOM   973  C C   . ALA A 1 158 ? 18.649  -130.956 -13.108 1.00 24.34 ? 158  ALA A C   1 
ATOM   974  O O   . ALA A 1 158 ? 19.499  -130.462 -13.842 1.00 24.59 ? 158  ALA A O   1 
ATOM   975  C CB  . ALA A 1 158 ? 19.489  -130.913 -10.751 1.00 24.02 ? 158  ALA A CB  1 
ATOM   976  N N   . PHE A 1 159 ? 17.958  -132.064 -13.422 1.00 23.40 ? 159  PHE A N   1 
ATOM   977  C CA  . PHE A 1 159 ? 18.386  -132.957 -14.524 1.00 24.14 ? 159  PHE A CA  1 
ATOM   978  C C   . PHE A 1 159 ? 17.411  -133.275 -15.657 1.00 24.92 ? 159  PHE A C   1 
ATOM   979  O O   . PHE A 1 159 ? 17.633  -134.223 -16.411 1.00 24.71 ? 159  PHE A O   1 
ATOM   980  C CB  . PHE A 1 159 ? 18.939  -134.282 -13.978 1.00 23.59 ? 159  PHE A CB  1 
ATOM   981  C CG  . PHE A 1 159 ? 20.099  -134.108 -13.072 1.00 24.25 ? 159  PHE A CG  1 
ATOM   982  C CD1 . PHE A 1 159 ? 20.067  -134.612 -11.769 1.00 24.77 ? 159  PHE A CD1 1 
ATOM   983  C CD2 . PHE A 1 159 ? 21.257  -133.451 -13.511 1.00 23.09 ? 159  PHE A CD2 1 
ATOM   984  C CE1 . PHE A 1 159 ? 21.195  -134.475 -10.922 1.00 23.54 ? 159  PHE A CE1 1 
ATOM   985  C CE2 . PHE A 1 159 ? 22.391  -133.295 -12.655 1.00 23.82 ? 159  PHE A CE2 1 
ATOM   986  C CZ  . PHE A 1 159 ? 22.356  -133.794 -11.363 1.00 23.25 ? 159  PHE A CZ  1 
ATOM   987  N N   . GLU A 1 160 ? 16.401  -132.440 -15.822 1.00 25.49 ? 160  GLU A N   1 
ATOM   988  C CA  . GLU A 1 160 ? 15.304  -132.732 -16.717 1.00 27.22 ? 160  GLU A CA  1 
ATOM   989  C C   . GLU A 1 160 ? 14.828  -131.425 -17.335 1.00 26.88 ? 160  GLU A C   1 
ATOM   990  O O   . GLU A 1 160 ? 14.322  -131.388 -18.464 1.00 27.12 ? 160  GLU A O   1 
ATOM   991  C CB  . GLU A 1 160 ? 14.176  -133.301 -15.866 1.00 27.90 ? 160  GLU A CB  1 
ATOM   992  C CG  . GLU A 1 160 ? 13.318  -134.283 -16.509 1.00 29.41 ? 160  GLU A CG  1 
ATOM   993  C CD  . GLU A 1 160 ? 12.531  -135.025 -15.458 1.00 31.68 ? 160  GLU A CD  1 
ATOM   994  O OE1 . GLU A 1 160 ? 11.511  -134.468 -14.983 1.00 31.72 ? 160  GLU A OE1 1 
ATOM   995  O OE2 . GLU A 1 160 ? 12.950  -136.147 -15.094 1.00 28.41 ? 160  GLU A OE2 1 
ATOM   996  O OXT . GLU A 1 160 ? 14.962  -130.379 -16.701 1.00 26.94 ? 160  GLU A OXT 1 
ATOM   997  N N   . PHE B 2 9   ? 18.937  -159.292 -13.075 1.00 30.49 ? 9    PHE B N   1 
ATOM   998  C CA  . PHE B 2 9   ? 20.003  -159.390 -14.133 1.00 30.19 ? 9    PHE B CA  1 
ATOM   999  C C   . PHE B 2 9   ? 21.399  -159.052 -13.596 1.00 29.80 ? 9    PHE B C   1 
ATOM   1000 O O   . PHE B 2 9   ? 21.525  -158.193 -12.717 1.00 29.68 ? 9    PHE B O   1 
ATOM   1001 C CB  . PHE B 2 9   ? 19.694  -158.443 -15.311 1.00 30.50 ? 9    PHE B CB  1 
ATOM   1002 C CG  . PHE B 2 9   ? 18.395  -158.738 -16.010 1.00 30.95 ? 9    PHE B CG  1 
ATOM   1003 C CD1 . PHE B 2 9   ? 17.566  -157.696 -16.415 1.00 32.41 ? 9    PHE B CD1 1 
ATOM   1004 C CD2 . PHE B 2 9   ? 17.992  -160.050 -16.259 1.00 31.59 ? 9    PHE B CD2 1 
ATOM   1005 C CE1 . PHE B 2 9   ? 16.361  -157.955 -17.065 1.00 32.05 ? 9    PHE B CE1 1 
ATOM   1006 C CE2 . PHE B 2 9   ? 16.791  -160.312 -16.903 1.00 31.44 ? 9    PHE B CE2 1 
ATOM   1007 C CZ  . PHE B 2 9   ? 15.974  -159.265 -17.310 1.00 31.19 ? 9    PHE B CZ  1 
ATOM   1008 N N   . PRO B 2 10  ? 22.453  -159.703 -14.144 1.00 29.04 ? 10   PRO B N   1 
ATOM   1009 C CA  . PRO B 2 10  ? 23.839  -159.278 -13.909 1.00 28.59 ? 10   PRO B CA  1 
ATOM   1010 C C   . PRO B 2 10  ? 23.996  -157.788 -14.249 1.00 28.32 ? 10   PRO B C   1 
ATOM   1011 O O   . PRO B 2 10  ? 23.331  -157.294 -15.158 1.00 27.98 ? 10   PRO B O   1 
ATOM   1012 C CB  . PRO B 2 10  ? 24.633  -160.096 -14.925 1.00 28.25 ? 10   PRO B CB  1 
ATOM   1013 C CG  . PRO B 2 10  ? 23.790  -161.283 -15.201 1.00 28.91 ? 10   PRO B CG  1 
ATOM   1014 C CD  . PRO B 2 10  ? 22.373  -160.858 -15.053 1.00 28.77 ? 10   PRO B CD  1 
ATOM   1015 N N   . GLU B 2 11  ? 24.879  -157.094 -13.535 1.00 28.55 ? 11   GLU B N   1 
ATOM   1016 C CA  . GLU B 2 11  ? 25.044  -155.635 -13.678 1.00 28.84 ? 11   GLU B CA  1 
ATOM   1017 C C   . GLU B 2 11  ? 25.411  -155.199 -15.097 1.00 28.20 ? 11   GLU B C   1 
ATOM   1018 O O   . GLU B 2 11  ? 24.979  -154.138 -15.550 1.00 27.43 ? 11   GLU B O   1 
ATOM   1019 C CB  . GLU B 2 11  ? 26.102  -155.085 -12.704 1.00 29.39 ? 11   GLU B CB  1 
ATOM   1020 C CG  . GLU B 2 11  ? 26.020  -155.578 -11.259 1.00 32.89 ? 11   GLU B CG  1 
ATOM   1021 C CD  . GLU B 2 11  ? 24.692  -155.272 -10.556 1.00 36.41 ? 11   GLU B CD  1 
ATOM   1022 O OE1 . GLU B 2 11  ? 24.010  -154.300 -10.942 1.00 38.95 ? 11   GLU B OE1 1 
ATOM   1023 O OE2 . GLU B 2 11  ? 24.341  -156.014 -9.602  1.00 38.60 ? 11   GLU B OE2 1 
ATOM   1024 N N   . GLU B 2 12  ? 26.227  -156.014 -15.775 1.00 27.75 ? 12   GLU B N   1 
ATOM   1025 C CA  . GLU B 2 12  ? 26.622  -155.751 -17.172 1.00 27.55 ? 12   GLU B CA  1 
ATOM   1026 C C   . GLU B 2 12  ? 25.402  -155.781 -18.105 1.00 26.56 ? 12   GLU B C   1 
ATOM   1027 O O   . GLU B 2 12  ? 25.260  -154.891 -18.967 1.00 25.78 ? 12   GLU B O   1 
ATOM   1028 C CB  . GLU B 2 12  ? 27.671  -156.769 -17.642 1.00 27.96 ? 12   GLU B CB  1 
ATOM   1029 C CG  . GLU B 2 12  ? 27.234  -158.215 -17.470 1.00 31.05 ? 12   GLU B CG  1 
ATOM   1030 C CD  . GLU B 2 12  ? 28.282  -159.198 -17.899 1.00 35.13 ? 12   GLU B CD  1 
ATOM   1031 O OE1 . GLU B 2 12  ? 29.292  -158.773 -18.519 1.00 37.88 ? 12   GLU B OE1 1 
ATOM   1032 O OE2 . GLU B 2 12  ? 28.099  -160.405 -17.607 1.00 37.50 ? 12   GLU B OE2 1 
ATOM   1033 N N   . VAL B 2 13  ? 24.546  -156.824 -17.934 1.00 25.01 ? 13   VAL B N   1 
ATOM   1034 C CA  . VAL B 2 13  ? 23.253  -156.894 -18.640 1.00 24.45 ? 13   VAL B CA  1 
ATOM   1035 C C   . VAL B 2 13  ? 22.408  -155.606 -18.442 1.00 23.10 ? 13   VAL B C   1 
ATOM   1036 O O   . VAL B 2 13  ? 21.960  -154.998 -19.414 1.00 23.41 ? 13   VAL B O   1 
ATOM   1037 C CB  . VAL B 2 13  ? 22.433  -158.168 -18.248 1.00 23.38 ? 13   VAL B CB  1 
ATOM   1038 C CG1 . VAL B 2 13  ? 21.036  -158.106 -18.810 1.00 23.76 ? 13   VAL B CG1 1 
ATOM   1039 C CG2 . VAL B 2 13  ? 23.127  -159.431 -18.743 1.00 24.86 ? 13   VAL B CG2 1 
ATOM   1040 N N   . LEU B 2 14  ? 22.190  -155.189 -17.194 1.00 23.35 ? 14   LEU B N   1 
ATOM   1041 C CA  . LEU B 2 14  ? 21.418  -153.940 -16.920 1.00 23.36 ? 14   LEU B CA  1 
ATOM   1042 C C   . LEU B 2 14  ? 22.055  -152.661 -17.479 1.00 23.25 ? 14   LEU B C   1 
ATOM   1043 O O   . LEU B 2 14  ? 21.360  -151.728 -17.944 1.00 23.00 ? 14   LEU B O   1 
ATOM   1044 C CB  . LEU B 2 14  ? 21.183  -153.736 -15.409 1.00 24.42 ? 14   LEU B CB  1 
ATOM   1045 C CG  . LEU B 2 14  ? 19.970  -154.449 -14.785 1.00 26.12 ? 14   LEU B CG  1 
ATOM   1046 C CD1 . LEU B 2 14  ? 20.087  -154.536 -13.255 1.00 27.98 ? 14   LEU B CD1 1 
ATOM   1047 C CD2 . LEU B 2 14  ? 18.639  -153.771 -15.200 1.00 28.57 ? 14   LEU B CD2 1 
ATOM   1048 N N   . GLU B 2 15  ? 23.381  -152.585 -17.402 1.00 22.96 ? 15   GLU B N   1 
ATOM   1049 C CA  . GLU B 2 15  ? 24.105  -151.460 -18.014 1.00 23.05 ? 15   GLU B CA  1 
ATOM   1050 C C   . GLU B 2 15  ? 23.854  -151.443 -19.526 1.00 22.18 ? 15   GLU B C   1 
ATOM   1051 O O   . GLU B 2 15  ? 23.686  -150.380 -20.127 1.00 22.56 ? 15   GLU B O   1 
ATOM   1052 C CB  . GLU B 2 15  ? 25.595  -151.567 -17.715 1.00 23.23 ? 15   GLU B CB  1 
ATOM   1053 C CG  . GLU B 2 15  ? 26.459  -150.432 -18.266 1.00 24.18 ? 15   GLU B CG  1 
ATOM   1054 C CD  . GLU B 2 15  ? 27.835  -150.370 -17.597 1.00 24.97 ? 15   GLU B CD  1 
ATOM   1055 O OE1 . GLU B 2 15  ? 28.444  -151.436 -17.376 1.00 29.80 ? 15   GLU B OE1 1 
ATOM   1056 O OE2 . GLU B 2 15  ? 28.314  -149.266 -17.274 1.00 26.77 ? 15   GLU B OE2 1 
ATOM   1057 N N   . HIS B 2 16  ? 23.784  -152.616 -20.136 1.00 21.05 ? 16   HIS B N   1 
ATOM   1058 C CA  . HIS B 2 16  ? 23.536  -152.698 -21.566 1.00 20.55 ? 16   HIS B CA  1 
ATOM   1059 C C   . HIS B 2 16  ? 22.108  -152.321 -21.943 1.00 20.36 ? 16   HIS B C   1 
ATOM   1060 O O   . HIS B 2 16  ? 21.898  -151.666 -22.966 1.00 20.55 ? 16   HIS B O   1 
ATOM   1061 C CB  . HIS B 2 16  ? 23.872  -154.071 -22.133 1.00 20.61 ? 16   HIS B CB  1 
ATOM   1062 C CG  . HIS B 2 16  ? 24.042  -154.063 -23.620 1.00 21.43 ? 16   HIS B CG  1 
ATOM   1063 N ND1 . HIS B 2 16  ? 24.869  -153.167 -24.266 1.00 23.20 ? 16   HIS B ND1 1 
ATOM   1064 C CD2 . HIS B 2 16  ? 23.492  -154.831 -24.589 1.00 22.29 ? 16   HIS B CD2 1 
ATOM   1065 C CE1 . HIS B 2 16  ? 24.831  -153.396 -25.568 1.00 22.94 ? 16   HIS B CE1 1 
ATOM   1066 N NE2 . HIS B 2 16  ? 23.992  -154.390 -25.792 1.00 22.12 ? 16   HIS B NE2 1 
ATOM   1067 N N   . VAL B 2 17  ? 21.133  -152.748 -21.143 1.00 19.39 ? 17   VAL B N   1 
ATOM   1068 C CA  . VAL B 2 17  ? 19.752  -152.284 -21.343 1.00 19.90 ? 17   VAL B CA  1 
ATOM   1069 C C   . VAL B 2 17  ? 19.688  -150.754 -21.341 1.00 20.50 ? 17   VAL B C   1 
ATOM   1070 O O   . VAL B 2 17  ? 19.080  -150.141 -22.221 1.00 20.61 ? 17   VAL B O   1 
ATOM   1071 C CB  . VAL B 2 17  ? 18.787  -152.802 -20.260 1.00 19.47 ? 17   VAL B CB  1 
ATOM   1072 C CG1 . VAL B 2 17  ? 17.401  -152.146 -20.408 1.00 18.70 ? 17   VAL B CG1 1 
ATOM   1073 C CG2 . VAL B 2 17  ? 18.665  -154.346 -20.328 1.00 17.61 ? 17   VAL B CG2 1 
ATOM   1074 N N   . PHE B 2 18  ? 20.325  -150.157 -20.340 1.00 21.68 ? 18   PHE B N   1 
ATOM   1075 C CA  . PHE B 2 18  ? 20.256  -148.730 -20.138 1.00 22.00 ? 18   PHE B CA  1 
ATOM   1076 C C   . PHE B 2 18  ? 20.944  -147.944 -21.262 1.00 22.55 ? 18   PHE B C   1 
ATOM   1077 O O   . PHE B 2 18  ? 20.691  -146.734 -21.432 1.00 21.45 ? 18   PHE B O   1 
ATOM   1078 C CB  . PHE B 2 18  ? 20.899  -148.361 -18.798 1.00 23.79 ? 18   PHE B CB  1 
ATOM   1079 C CG  . PHE B 2 18  ? 20.152  -148.865 -17.578 1.00 24.58 ? 18   PHE B CG  1 
ATOM   1080 C CD1 . PHE B 2 18  ? 20.739  -148.744 -16.309 1.00 28.82 ? 18   PHE B CD1 1 
ATOM   1081 C CD2 . PHE B 2 18  ? 18.885  -149.445 -17.685 1.00 23.98 ? 18   PHE B CD2 1 
ATOM   1082 C CE1 . PHE B 2 18  ? 20.062  -149.183 -15.162 1.00 29.79 ? 18   PHE B CE1 1 
ATOM   1083 C CE2 . PHE B 2 18  ? 18.209  -149.904 -16.566 1.00 27.37 ? 18   PHE B CE2 1 
ATOM   1084 C CZ  . PHE B 2 18  ? 18.797  -149.786 -15.294 1.00 28.91 ? 18   PHE B CZ  1 
ATOM   1085 N N   . SER B 2 19  ? 21.838  -148.600 -22.001 1.00 21.67 ? 19   SER B N   1 
ATOM   1086 C CA  . SER B 2 19  ? 22.509  -147.959 -23.141 1.00 21.58 ? 19   SER B CA  1 
ATOM   1087 C C   . SER B 2 19  ? 21.530  -147.580 -24.261 1.00 22.18 ? 19   SER B C   1 
ATOM   1088 O O   . SER B 2 19  ? 21.816  -146.705 -25.088 1.00 22.97 ? 19   SER B O   1 
ATOM   1089 C CB  . SER B 2 19  ? 23.625  -148.847 -23.678 1.00 21.23 ? 19   SER B CB  1 
ATOM   1090 O OG  . SER B 2 19  ? 23.086  -149.873 -24.499 1.00 20.02 ? 19   SER B OG  1 
ATOM   1091 N N   . PHE B 2 20  ? 20.367  -148.221 -24.272 1.00 22.22 ? 20   PHE B N   1 
ATOM   1092 C CA  . PHE B 2 20  ? 19.321  -147.917 -25.247 1.00 22.65 ? 20   PHE B CA  1 
ATOM   1093 C C   . PHE B 2 20  ? 18.321  -146.886 -24.711 1.00 23.04 ? 20   PHE B C   1 
ATOM   1094 O O   . PHE B 2 20  ? 17.302  -146.622 -25.343 1.00 22.84 ? 20   PHE B O   1 
ATOM   1095 C CB  . PHE B 2 20  ? 18.578  -149.193 -25.633 1.00 22.59 ? 20   PHE B CB  1 
ATOM   1096 C CG  . PHE B 2 20  ? 19.458  -150.236 -26.253 1.00 22.95 ? 20   PHE B CG  1 
ATOM   1097 C CD1 . PHE B 2 20  ? 19.972  -151.281 -25.482 1.00 23.34 ? 20   PHE B CD1 1 
ATOM   1098 C CD2 . PHE B 2 20  ? 19.777  -150.173 -27.607 1.00 22.96 ? 20   PHE B CD2 1 
ATOM   1099 C CE1 . PHE B 2 20  ? 20.786  -152.254 -26.059 1.00 24.50 ? 20   PHE B CE1 1 
ATOM   1100 C CE2 . PHE B 2 20  ? 20.596  -151.137 -28.203 1.00 25.14 ? 20   PHE B CE2 1 
ATOM   1101 C CZ  . PHE B 2 20  ? 21.098  -152.192 -27.423 1.00 24.53 ? 20   PHE B CZ  1 
ATOM   1102 N N   . ILE B 2 21  ? 18.605  -146.335 -23.533 1.00 23.32 ? 21   ILE B N   1 
ATOM   1103 C CA  . ILE B 2 21  ? 17.687  -145.405 -22.885 1.00 23.72 ? 21   ILE B CA  1 
ATOM   1104 C C   . ILE B 2 21  ? 18.410  -144.071 -22.716 1.00 24.04 ? 21   ILE B C   1 
ATOM   1105 O O   . ILE B 2 21  ? 19.261  -143.934 -21.827 1.00 24.38 ? 21   ILE B O   1 
ATOM   1106 C CB  . ILE B 2 21  ? 17.186  -145.952 -21.532 1.00 23.73 ? 21   ILE B CB  1 
ATOM   1107 C CG1 . ILE B 2 21  ? 16.499  -147.318 -21.728 1.00 23.54 ? 21   ILE B CG1 1 
ATOM   1108 C CG2 . ILE B 2 21  ? 16.226  -144.951 -20.882 1.00 22.51 ? 21   ILE B CG2 1 
ATOM   1109 C CD1 . ILE B 2 21  ? 16.211  -148.048 -20.425 1.00 24.51 ? 21   ILE B CD1 1 
ATOM   1110 N N   . GLN B 2 22  ? 18.079  -143.114 -23.581 1.00 24.13 ? 22   GLN B N   1 
ATOM   1111 C CA  . GLN B 2 22  ? 18.831  -141.856 -23.658 1.00 24.63 ? 22   GLN B CA  1 
ATOM   1112 C C   . GLN B 2 22  ? 18.053  -140.560 -23.334 1.00 24.82 ? 22   GLN B C   1 
ATOM   1113 O O   . GLN B 2 22  ? 18.663  -139.494 -23.216 1.00 24.44 ? 22   GLN B O   1 
ATOM   1114 C CB  . GLN B 2 22  ? 19.641  -141.757 -24.979 1.00 24.94 ? 22   GLN B CB  1 
ATOM   1115 C CG  . GLN B 2 22  ? 20.762  -142.879 -25.138 1.00 28.19 ? 22   GLN B CG  1 
ATOM   1116 C CD  . GLN B 2 22  ? 21.755  -143.014 -23.918 1.00 31.10 ? 22   GLN B CD  1 
ATOM   1117 O OE1 . GLN B 2 22  ? 22.176  -144.125 -23.555 1.00 30.73 ? 22   GLN B OE1 1 
ATOM   1118 N NE2 . GLN B 2 22  ? 22.133  -141.879 -23.315 1.00 29.37 ? 22   GLN B NE2 1 
ATOM   1119 N N   . LEU B 2 23  ? 16.734  -140.648 -23.143 1.00 24.45 ? 23   LEU B N   1 
ATOM   1120 C CA  . LEU B 2 23  ? 15.938  -139.467 -22.784 1.00 24.54 ? 23   LEU B CA  1 
ATOM   1121 C C   . LEU B 2 23  ? 16.118  -139.168 -21.317 1.00 23.92 ? 23   LEU B C   1 
ATOM   1122 O O   . LEU B 2 23  ? 16.042  -140.075 -20.503 1.00 23.40 ? 23   LEU B O   1 
ATOM   1123 C CB  . LEU B 2 23  ? 14.458  -139.720 -23.054 1.00 25.06 ? 23   LEU B CB  1 
ATOM   1124 C CG  . LEU B 2 23  ? 13.832  -139.232 -24.359 1.00 26.50 ? 23   LEU B CG  1 
ATOM   1125 C CD1 . LEU B 2 23  ? 14.604  -139.718 -25.577 1.00 29.22 ? 23   LEU B CD1 1 
ATOM   1126 C CD2 . LEU B 2 23  ? 12.378  -139.689 -24.418 1.00 25.74 ? 23   LEU B CD2 1 
ATOM   1127 N N   . ASP B 2 24  ? 16.321  -137.895 -20.974 1.00 23.31 ? 24   ASP B N   1 
ATOM   1128 C CA  . ASP B 2 24  ? 16.562  -137.516 -19.595 1.00 23.40 ? 24   ASP B CA  1 
ATOM   1129 C C   . ASP B 2 24  ? 15.484  -138.069 -18.659 1.00 22.96 ? 24   ASP B C   1 
ATOM   1130 O O   . ASP B 2 24  ? 15.808  -138.630 -17.596 1.00 22.90 ? 24   ASP B O   1 
ATOM   1131 C CB  . ASP B 2 24  ? 16.631  -135.997 -19.461 1.00 24.10 ? 24   ASP B CB  1 
ATOM   1132 C CG  . ASP B 2 24  ? 17.821  -135.398 -20.179 1.00 25.53 ? 24   ASP B CG  1 
ATOM   1133 O OD1 . ASP B 2 24  ? 18.858  -136.073 -20.314 1.00 26.78 ? 24   ASP B OD1 1 
ATOM   1134 O OD2 . ASP B 2 24  ? 17.710  -134.235 -20.599 1.00 26.66 ? 24   ASP B OD2 1 
ATOM   1135 N N   . LYS B 2 25  ? 14.216  -137.878 -19.053 1.00 21.96 ? 25   LYS B N   1 
ATOM   1136 C CA  . LYS B 2 25  ? 13.058  -138.274 -18.254 1.00 22.50 ? 25   LYS B CA  1 
ATOM   1137 C C   . LYS B 2 25  ? 13.046  -139.786 -17.995 1.00 22.38 ? 25   LYS B C   1 
ATOM   1138 O O   . LYS B 2 25  ? 12.631  -140.224 -16.918 1.00 21.93 ? 25   LYS B O   1 
ATOM   1139 C CB  . LYS B 2 25  ? 11.739  -137.872 -18.931 1.00 21.73 ? 25   LYS B CB  1 
ATOM   1140 C CG  . LYS B 2 25  ? 11.474  -136.358 -18.979 1.00 23.62 ? 25   LYS B CG  1 
ATOM   1141 C CD  . LYS B 2 25  ? 10.143  -136.069 -19.708 1.00 23.80 ? 25   LYS B CD  1 
ATOM   1142 C CE  . LYS B 2 25  ? 9.945   -134.592 -20.062 1.00 27.47 ? 25   LYS B CE  1 
ATOM   1143 N NZ  . LYS B 2 25  ? 10.029  -133.737 -18.842 1.00 27.48 ? 25   LYS B NZ  1 
ATOM   1144 N N   . ASP B 2 26  ? 13.486  -140.571 -18.976 1.00 22.20 ? 26   ASP B N   1 
ATOM   1145 C CA  . ASP B 2 26  ? 13.567  -142.030 -18.780 1.00 23.10 ? 26   ASP B CA  1 
ATOM   1146 C C   . ASP B 2 26  ? 14.729  -142.428 -17.855 1.00 23.62 ? 26   ASP B C   1 
ATOM   1147 O O   . ASP B 2 26  ? 14.573  -143.322 -17.018 1.00 24.75 ? 26   ASP B O   1 
ATOM   1148 C CB  . ASP B 2 26  ? 13.693  -142.768 -20.112 1.00 22.96 ? 26   ASP B CB  1 
ATOM   1149 C CG  . ASP B 2 26  ? 12.430  -142.705 -20.959 1.00 22.95 ? 26   ASP B CG  1 
ATOM   1150 O OD1 . ASP B 2 26  ? 11.300  -142.542 -20.431 1.00 22.28 ? 26   ASP B OD1 1 
ATOM   1151 O OD2 . ASP B 2 26  ? 12.572  -142.854 -22.190 1.00 22.80 ? 26   ASP B OD2 1 
ATOM   1152 N N   . ARG B 2 27  ? 15.888  -141.795 -18.017 1.00 23.03 ? 27   ARG B N   1 
ATOM   1153 C CA  . ARG B 2 27  ? 17.038  -142.020 -17.106 1.00 23.00 ? 27   ARG B CA  1 
ATOM   1154 C C   . ARG B 2 27  ? 16.632  -141.750 -15.652 1.00 22.05 ? 27   ARG B C   1 
ATOM   1155 O O   . ARG B 2 27  ? 16.947  -142.512 -14.741 1.00 21.19 ? 27   ARG B O   1 
ATOM   1156 C CB  . ARG B 2 27  ? 18.164  -141.039 -17.442 1.00 23.27 ? 27   ARG B CB  1 
ATOM   1157 C CG  . ARG B 2 27  ? 18.997  -141.390 -18.619 1.00 26.48 ? 27   ARG B CG  1 
ATOM   1158 C CD  . ARG B 2 27  ? 20.053  -142.373 -18.113 1.00 29.53 ? 27   ARG B CD  1 
ATOM   1159 N NE  . ARG B 2 27  ? 20.371  -143.265 -19.156 1.00 32.35 ? 27   ARG B NE  1 
ATOM   1160 C CZ  . ARG B 2 27  ? 21.353  -144.142 -19.134 1.00 24.52 ? 27   ARG B CZ  1 
ATOM   1161 N NH1 . ARG B 2 27  ? 22.191  -144.273 -18.094 1.00 22.75 ? 27   ARG B NH1 1 
ATOM   1162 N NH2 . ARG B 2 27  ? 21.477  -144.854 -20.198 1.00 25.14 ? 27   ARG B NH2 1 
ATOM   1163 N N   . ASN B 2 28  ? 15.931  -140.635 -15.442 1.00 20.31 ? 28   ASN B N   1 
ATOM   1164 C CA  . ASN B 2 28  ? 15.406  -140.263 -14.130 1.00 19.87 ? 28   ASN B CA  1 
ATOM   1165 C C   . ASN B 2 28  ? 14.442  -141.293 -13.497 1.00 20.64 ? 28   ASN B C   1 
ATOM   1166 O O   . ASN B 2 28  ? 14.594  -141.655 -12.306 1.00 20.54 ? 28   ASN B O   1 
ATOM   1167 C CB  . ASN B 2 28  ? 14.796  -138.849 -14.207 1.00 19.99 ? 28   ASN B CB  1 
ATOM   1168 C CG  . ASN B 2 28  ? 15.860  -137.806 -14.440 1.00 19.91 ? 28   ASN B CG  1 
ATOM   1169 O OD1 . ASN B 2 28  ? 17.045  -138.116 -14.315 1.00 20.99 ? 28   ASN B OD1 1 
ATOM   1170 N ND2 . ASN B 2 28  ? 15.467  -136.586 -14.801 1.00 13.82 ? 28   ASN B ND2 1 
ATOM   1171 N N   . SER B 2 29  ? 13.502  -141.807 -14.286 1.00 19.24 ? 29   SER B N   1 
ATOM   1172 C CA  . SER B 2 29  ? 12.563  -142.802 -13.766 1.00 20.22 ? 29   SER B CA  1 
ATOM   1173 C C   . SER B 2 29  ? 13.341  -144.082 -13.391 1.00 19.99 ? 29   SER B C   1 
ATOM   1174 O O   . SER B 2 29  ? 13.102  -144.669 -12.339 1.00 19.92 ? 29   SER B O   1 
ATOM   1175 C CB  . SER B 2 29  ? 11.480  -143.151 -14.791 1.00 20.41 ? 29   SER B CB  1 
ATOM   1176 O OG  . SER B 2 29  ? 10.765  -141.997 -15.225 1.00 23.93 ? 29   SER B OG  1 
ATOM   1177 N N   . VAL B 2 30  ? 14.267  -144.471 -14.264 1.00 19.73 ? 30   VAL B N   1 
ATOM   1178 C CA  . VAL B 2 30  ? 15.168  -145.614 -14.032 1.00 20.52 ? 30   VAL B CA  1 
ATOM   1179 C C   . VAL B 2 30  ? 15.906  -145.486 -12.693 1.00 21.42 ? 30   VAL B C   1 
ATOM   1180 O O   . VAL B 2 30  ? 15.942  -146.452 -11.898 1.00 21.72 ? 30   VAL B O   1 
ATOM   1181 C CB  . VAL B 2 30  ? 16.152  -145.794 -15.216 1.00 20.06 ? 30   VAL B CB  1 
ATOM   1182 C CG1 . VAL B 2 30  ? 17.348  -146.684 -14.837 1.00 20.21 ? 30   VAL B CG1 1 
ATOM   1183 C CG2 . VAL B 2 30  ? 15.420  -146.387 -16.418 1.00 19.03 ? 30   VAL B CG2 1 
ATOM   1184 N N   . SER B 2 31  ? 16.479  -144.313 -12.433 1.00 21.45 ? 31   SER B N   1 
ATOM   1185 C CA  . SER B 2 31  ? 17.248  -144.105 -11.204 1.00 22.54 ? 31   SER B CA  1 
ATOM   1186 C C   . SER B 2 31  ? 16.398  -144.267 -9.937  1.00 22.76 ? 31   SER B C   1 
ATOM   1187 O O   . SER B 2 31  ? 16.936  -144.393 -8.830  1.00 23.71 ? 31   SER B O   1 
ATOM   1188 C CB  . SER B 2 31  ? 17.870  -142.721 -11.217 1.00 22.50 ? 31   SER B CB  1 
ATOM   1189 O OG  . SER B 2 31  ? 16.849  -141.756 -11.073 1.00 23.40 ? 31   SER B OG  1 
ATOM   1190 N N   . LEU B 2 32  ? 15.074  -144.226 -10.105 1.00 22.95 ? 32   LEU B N   1 
ATOM   1191 C CA  . LEU B 2 32  ? 14.129  -144.319 -8.990  1.00 22.85 ? 32   LEU B CA  1 
ATOM   1192 C C   . LEU B 2 32  ? 13.421  -145.658 -8.846  1.00 22.70 ? 32   LEU B C   1 
ATOM   1193 O O   . LEU B 2 32  ? 12.537  -145.799 -7.982  1.00 22.47 ? 32   LEU B O   1 
ATOM   1194 C CB  . LEU B 2 32  ? 13.064  -143.204 -9.092  1.00 22.91 ? 32   LEU B CB  1 
ATOM   1195 C CG  . LEU B 2 32  ? 13.454  -141.808 -8.582  1.00 24.21 ? 32   LEU B CG  1 
ATOM   1196 C CD1 . LEU B 2 32  ? 12.452  -140.812 -9.093  1.00 22.19 ? 32   LEU B CD1 1 
ATOM   1197 C CD2 . LEU B 2 32  ? 13.474  -141.814 -7.049  1.00 25.56 ? 32   LEU B CD2 1 
ATOM   1198 N N   . VAL B 2 33  ? 13.761  -146.658 -9.657  1.00 23.32 ? 33   VAL B N   1 
ATOM   1199 C CA  . VAL B 2 33  ? 13.043  -147.927 -9.458  1.00 22.58 ? 33   VAL B CA  1 
ATOM   1200 C C   . VAL B 2 33  ? 13.506  -148.660 -8.188  1.00 23.19 ? 33   VAL B C   1 
ATOM   1201 O O   . VAL B 2 33  ? 12.669  -149.143 -7.421  1.00 23.14 ? 33   VAL B O   1 
ATOM   1202 C CB  . VAL B 2 33  ? 12.895  -148.904 -10.708 1.00 23.79 ? 33   VAL B CB  1 
ATOM   1203 C CG1 . VAL B 2 33  ? 13.182  -148.240 -12.025 1.00 21.41 ? 33   VAL B CG1 1 
ATOM   1204 C CG2 . VAL B 2 33  ? 13.646  -150.232 -10.510 1.00 20.64 ? 33   VAL B CG2 1 
ATOM   1205 N N   . CYS B 2 34  ? 14.822  -148.732 -7.983  1.00 23.13 ? 34   CYS B N   1 
ATOM   1206 C CA  . CYS B 2 34  ? 15.391  -149.265 -6.743  1.00 22.97 ? 34   CYS B CA  1 
ATOM   1207 C C   . CYS B 2 34  ? 16.826  -148.766 -6.537  1.00 22.69 ? 34   CYS B C   1 
ATOM   1208 O O   . CYS B 2 34  ? 17.404  -148.132 -7.424  1.00 21.96 ? 34   CYS B O   1 
ATOM   1209 C CB  . CYS B 2 34  ? 15.345  -150.789 -6.739  1.00 23.65 ? 34   CYS B CB  1 
ATOM   1210 S SG  . CYS B 2 34  ? 16.426  -151.494 -7.955  1.00 25.58 ? 34   CYS B SG  1 
ATOM   1211 N N   . LYS B 2 35  ? 17.391  -149.050 -5.364  1.00 22.50 ? 35   LYS B N   1 
ATOM   1212 C CA  . LYS B 2 35  ? 18.731  -148.590 -5.005  1.00 21.99 ? 35   LYS B CA  1 
ATOM   1213 C C   . LYS B 2 35  ? 19.793  -149.101 -5.998  1.00 21.40 ? 35   LYS B C   1 
ATOM   1214 O O   . LYS B 2 35  ? 20.697  -148.360 -6.401  1.00 19.54 ? 35   LYS B O   1 
ATOM   1215 C CB  . LYS B 2 35  ? 19.055  -149.002 -3.567  1.00 22.78 ? 35   LYS B CB  1 
ATOM   1216 C CG  . LYS B 2 35  ? 19.896  -148.007 -2.775  1.00 25.17 ? 35   LYS B CG  1 
ATOM   1217 C CD  . LYS B 2 35  ? 19.135  -146.741 -2.413  1.00 27.37 ? 35   LYS B CD  1 
ATOM   1218 C CE  . LYS B 2 35  ? 20.070  -145.517 -2.316  1.00 28.96 ? 35   LYS B CE  1 
ATOM   1219 N NZ  . LYS B 2 35  ? 20.127  -144.613 -3.511  1.00 28.13 ? 35   LYS B NZ  1 
ATOM   1220 N N   . SER B 2 36  ? 19.661  -150.359 -6.413  1.00 20.28 ? 36   SER B N   1 
ATOM   1221 C CA  . SER B 2 36  ? 20.566  -150.932 -7.408  1.00 20.60 ? 36   SER B CA  1 
ATOM   1222 C C   . SER B 2 36  ? 20.579  -150.178 -8.750  1.00 20.29 ? 36   SER B C   1 
ATOM   1223 O O   . SER B 2 36  ? 21.663  -149.842 -9.272  1.00 19.12 ? 36   SER B O   1 
ATOM   1224 C CB  . SER B 2 36  ? 20.239  -152.407 -7.653  1.00 20.05 ? 36   SER B CB  1 
ATOM   1225 O OG  . SER B 2 36  ? 21.285  -152.976 -8.410  1.00 23.83 ? 36   SER B OG  1 
ATOM   1226 N N   . TRP B 2 37  ? 19.399  -149.918 -9.286  1.00 20.52 ? 37   TRP B N   1 
ATOM   1227 C CA  . TRP B 2 37  ? 19.261  -149.179 -10.529 1.00 21.42 ? 37   TRP B CA  1 
ATOM   1228 C C   . TRP B 2 37  ? 19.805  -147.757 -10.434 1.00 21.87 ? 37   TRP B C   1 
ATOM   1229 O O   . TRP B 2 37  ? 20.431  -147.264 -11.354 1.00 22.11 ? 37   TRP B O   1 
ATOM   1230 C CB  . TRP B 2 37  ? 17.809  -149.167 -10.985 1.00 21.58 ? 37   TRP B CB  1 
ATOM   1231 C CG  . TRP B 2 37  ? 17.356  -150.499 -11.469 1.00 20.50 ? 37   TRP B CG  1 
ATOM   1232 C CD1 . TRP B 2 37  ? 17.735  -151.707 -10.981 1.00 22.50 ? 37   TRP B CD1 1 
ATOM   1233 C CD2 . TRP B 2 37  ? 16.451  -150.766 -12.541 1.00 20.80 ? 37   TRP B CD2 1 
ATOM   1234 N NE1 . TRP B 2 37  ? 17.114  -152.715 -11.675 1.00 21.66 ? 37   TRP B NE1 1 
ATOM   1235 C CE2 . TRP B 2 37  ? 16.320  -152.162 -12.642 1.00 22.72 ? 37   TRP B CE2 1 
ATOM   1236 C CE3 . TRP B 2 37  ? 15.733  -149.970 -13.428 1.00 21.05 ? 37   TRP B CE3 1 
ATOM   1237 C CZ2 . TRP B 2 37  ? 15.512  -152.765 -13.592 1.00 22.89 ? 37   TRP B CZ2 1 
ATOM   1238 C CZ3 . TRP B 2 37  ? 14.937  -150.574 -14.366 1.00 21.64 ? 37   TRP B CZ3 1 
ATOM   1239 C CH2 . TRP B 2 37  ? 14.830  -151.958 -14.442 1.00 21.91 ? 37   TRP B CH2 1 
ATOM   1240 N N   . TYR B 2 38  ? 19.576  -147.121 -9.299  1.00 22.06 ? 38   TYR B N   1 
ATOM   1241 C CA  . TYR B 2 38  ? 20.152  -145.822 -9.047  1.00 22.50 ? 38   TYR B CA  1 
ATOM   1242 C C   . TYR B 2 38  ? 21.651  -145.804 -9.271  1.00 22.96 ? 38   TYR B C   1 
ATOM   1243 O O   . TYR B 2 38  ? 22.162  -144.930 -9.954  1.00 26.69 ? 38   TYR B O   1 
ATOM   1244 C CB  . TYR B 2 38  ? 19.841  -145.345 -7.649  1.00 20.59 ? 38   TYR B CB  1 
ATOM   1245 C CG  . TYR B 2 38  ? 20.533  -144.057 -7.300  1.00 19.09 ? 38   TYR B CG  1 
ATOM   1246 C CD1 . TYR B 2 38  ? 21.777  -144.055 -6.708  1.00 18.16 ? 38   TYR B CD1 1 
ATOM   1247 C CD2 . TYR B 2 38  ? 19.946  -142.839 -7.577  1.00 16.08 ? 38   TYR B CD2 1 
ATOM   1248 C CE1 . TYR B 2 38  ? 22.405  -142.891 -6.393  1.00 18.18 ? 38   TYR B CE1 1 
ATOM   1249 C CE2 . TYR B 2 38  ? 20.569  -141.678 -7.264  1.00 15.79 ? 38   TYR B CE2 1 
ATOM   1250 C CZ  . TYR B 2 38  ? 21.791  -141.697 -6.672  1.00 17.63 ? 38   TYR B CZ  1 
ATOM   1251 O OH  . TYR B 2 38  ? 22.419  -140.529 -6.358  1.00 15.98 ? 38   TYR B OH  1 
ATOM   1252 N N   . GLU B 2 39  ? 22.356  -146.774 -8.707  1.00 23.46 ? 39   GLU B N   1 
ATOM   1253 C CA  . GLU B 2 39  ? 23.804  -146.802 -8.824  1.00 20.41 ? 39   GLU B CA  1 
ATOM   1254 C C   . GLU B 2 39  ? 24.287  -147.190 -10.216 1.00 19.44 ? 39   GLU B C   1 
ATOM   1255 O O   . GLU B 2 39  ? 25.260  -146.653 -10.710 1.00 18.82 ? 39   GLU B O   1 
ATOM   1256 C CB  . GLU B 2 39  ? 24.405  -147.718 -7.771  1.00 20.58 ? 39   GLU B CB  1 
ATOM   1257 C CG  . GLU B 2 39  ? 24.184  -147.231 -6.358  1.00 20.95 ? 39   GLU B CG  1 
ATOM   1258 C CD  . GLU B 2 39  ? 25.034  -146.025 -6.014  1.00 21.15 ? 39   GLU B CD  1 
ATOM   1259 O OE1 . GLU B 2 39  ? 24.591  -145.216 -5.191  1.00 21.92 ? 39   GLU B OE1 1 
ATOM   1260 O OE2 . GLU B 2 39  ? 26.143  -145.895 -6.555  1.00 21.03 ? 39   GLU B OE2 1 
ATOM   1261 N N   . ILE B 2 40  ? 23.602  -148.124 -10.845 1.00 18.55 ? 40   ILE B N   1 
ATOM   1262 C CA  . ILE B 2 40  ? 23.994  -148.542 -12.168 1.00 18.65 ? 40   ILE B CA  1 
ATOM   1263 C C   . ILE B 2 40  ? 23.740  -147.432 -13.186 1.00 19.67 ? 40   ILE B C   1 
ATOM   1264 O O   . ILE B 2 40  ? 24.605  -147.094 -13.976 1.00 20.44 ? 40   ILE B O   1 
ATOM   1265 C CB  . ILE B 2 40  ? 23.286  -149.854 -12.556 1.00 18.29 ? 40   ILE B CB  1 
ATOM   1266 C CG1 . ILE B 2 40  ? 23.765  -150.997 -11.652 1.00 17.58 ? 40   ILE B CG1 1 
ATOM   1267 C CG2 . ILE B 2 40  ? 23.545  -150.194 -13.990 1.00 16.23 ? 40   ILE B CG2 1 
ATOM   1268 C CD1 . ILE B 2 40  ? 22.918  -152.230 -11.730 1.00 19.97 ? 40   ILE B CD1 1 
ATOM   1269 N N   . GLU B 2 41  ? 22.546  -146.858 -13.140 1.00 20.01 ? 41   GLU B N   1 
ATOM   1270 C CA  . GLU B 2 41  ? 22.189  -145.723 -14.026 1.00 20.94 ? 41   GLU B CA  1 
ATOM   1271 C C   . GLU B 2 41  ? 23.187  -144.562 -13.875 1.00 21.23 ? 41   GLU B C   1 
ATOM   1272 O O   . GLU B 2 41  ? 23.740  -144.077 -14.877 1.00 21.88 ? 41   GLU B O   1 
ATOM   1273 C CB  . GLU B 2 41  ? 20.725  -145.316 -13.760 1.00 20.71 ? 41   GLU B CB  1 
ATOM   1274 C CG  . GLU B 2 41  ? 20.127  -144.262 -14.736 1.00 21.58 ? 41   GLU B CG  1 
ATOM   1275 C CD  . GLU B 2 41  ? 20.718  -142.921 -14.558 1.00 20.42 ? 41   GLU B CD  1 
ATOM   1276 O OE1 . GLU B 2 41  ? 20.754  -142.390 -13.418 1.00 19.07 ? 41   GLU B OE1 1 
ATOM   1277 O OE2 . GLU B 2 41  ? 21.137  -142.371 -15.585 1.00 24.97 ? 41   GLU B OE2 1 
ATOM   1278 N N   . ARG B 2 42  ? 23.477  -144.140 -12.640 1.00 21.39 ? 42   ARG B N   1 
ATOM   1279 C CA  . ARG B 2 42  ? 24.354  -142.983 -12.470 1.00 23.52 ? 42   ARG B CA  1 
ATOM   1280 C C   . ARG B 2 42  ? 25.713  -143.244 -13.138 1.00 23.06 ? 42   ARG B C   1 
ATOM   1281 O O   . ARG B 2 42  ? 26.295  -142.354 -13.722 1.00 21.40 ? 42   ARG B O   1 
ATOM   1282 C CB  . ARG B 2 42  ? 24.531  -142.564 -10.997 1.00 22.98 ? 42   ARG B CB  1 
ATOM   1283 C CG  . ARG B 2 42  ? 25.185  -143.653 -10.128 1.00 25.04 ? 42   ARG B CG  1 
ATOM   1284 C CD  . ARG B 2 42  ? 25.304  -143.306 -8.655  1.00 26.64 ? 42   ARG B CD  1 
ATOM   1285 N NE  . ARG B 2 42  ? 26.412  -142.386 -8.466  1.00 34.18 ? 42   ARG B NE  1 
ATOM   1286 C CZ  . ARG B 2 42  ? 27.488  -142.611 -7.730  1.00 32.62 ? 42   ARG B CZ  1 
ATOM   1287 N NH1 . ARG B 2 42  ? 27.630  -143.731 -7.035  1.00 32.47 ? 42   ARG B NH1 1 
ATOM   1288 N NH2 . ARG B 2 42  ? 28.416  -141.671 -7.675  1.00 34.57 ? 42   ARG B NH2 1 
ATOM   1289 N N   . TRP B 2 43  ? 26.209  -144.479 -13.048 1.00 24.81 ? 43   TRP B N   1 
ATOM   1290 C CA  . TRP B 2 43  ? 27.561  -144.765 -13.534 1.00 27.03 ? 43   TRP B CA  1 
ATOM   1291 C C   . TRP B 2 43  ? 27.690  -144.946 -15.045 1.00 25.66 ? 43   TRP B C   1 
ATOM   1292 O O   . TRP B 2 43  ? 28.811  -145.006 -15.565 1.00 26.32 ? 43   TRP B O   1 
ATOM   1293 C CB  . TRP B 2 43  ? 28.077  -145.997 -12.862 1.00 31.18 ? 43   TRP B CB  1 
ATOM   1294 C CG  . TRP B 2 43  ? 28.713  -145.717 -11.514 1.00 38.87 ? 43   TRP B CG  1 
ATOM   1295 C CD1 . TRP B 2 43  ? 28.152  -145.918 -10.241 1.00 42.10 ? 43   TRP B CD1 1 
ATOM   1296 C CD2 . TRP B 2 43  ? 30.070  -145.267 -11.255 1.00 41.32 ? 43   TRP B CD2 1 
ATOM   1297 N NE1 . TRP B 2 43  ? 29.085  -145.620 -9.214  1.00 42.82 ? 43   TRP B NE1 1 
ATOM   1298 C CE2 . TRP B 2 43  ? 30.263  -145.217 -9.806  1.00 42.37 ? 43   TRP B CE2 1 
ATOM   1299 C CE3 . TRP B 2 43  ? 31.138  -144.905 -12.103 1.00 41.93 ? 43   TRP B CE3 1 
ATOM   1300 C CZ2 . TRP B 2 43  ? 31.490  -144.816 -9.198  1.00 41.87 ? 43   TRP B CZ2 1 
ATOM   1301 C CZ3 . TRP B 2 43  ? 32.360  -144.501 -11.493 1.00 42.19 ? 43   TRP B CZ3 1 
ATOM   1302 C CH2 . TRP B 2 43  ? 32.516  -144.451 -10.047 1.00 40.96 ? 43   TRP B CH2 1 
ATOM   1303 N N   . CYS B 2 44  ? 26.525  -145.132 -15.762 1.00 24.37 ? 44   CYS B N   1 
ATOM   1304 C CA  . CYS B 2 44  ? 26.668  -145.125 -17.208 1.00 24.73 ? 44   CYS B CA  1 
ATOM   1305 C C   . CYS B 2 44  ? 25.810  -144.049 -17.874 1.00 21.84 ? 44   CYS B C   1 
ATOM   1306 O O   . CYS B 2 44  ? 25.483  -144.196 -19.053 1.00 22.20 ? 44   CYS B O   1 
ATOM   1307 C CB  . CYS B 2 44  ? 26.195  -146.463 -17.759 1.00 22.51 ? 44   CYS B CB  1 
ATOM   1308 S SG  . CYS B 2 44  ? 24.352  -146.654 -17.515 1.00 25.76 ? 44   CYS B SG  1 
ATOM   1309 N N   . ARG B 2 45  ? 25.412  -142.998 -17.142 1.00 23.06 ? 45   ARG B N   1 
ATOM   1310 C CA  . ARG B 2 45  ? 24.674  -141.898 -17.765 1.00 20.70 ? 45   ARG B CA  1 
ATOM   1311 C C   . ARG B 2 45  ? 25.666  -141.066 -18.596 1.00 21.72 ? 45   ARG B C   1 
ATOM   1312 O O   . ARG B 2 45  ? 26.732  -140.725 -18.080 1.00 21.32 ? 45   ARG B O   1 
ATOM   1313 C CB  . ARG B 2 45  ? 24.014  -140.938 -16.737 1.00 22.68 ? 45   ARG B CB  1 
ATOM   1314 C CG  . ARG B 2 45  ? 23.195  -139.856 -17.440 1.00 17.80 ? 45   ARG B CG  1 
ATOM   1315 C CD  . ARG B 2 45  ? 22.333  -138.917 -16.538 1.00 20.50 ? 45   ARG B CD  1 
ATOM   1316 N NE  . ARG B 2 45  ? 21.346  -139.614 -15.697 1.00 21.46 ? 45   ARG B NE  1 
ATOM   1317 C CZ  . ARG B 2 45  ? 20.208  -139.088 -15.235 1.00 19.21 ? 45   ARG B CZ  1 
ATOM   1318 N NH1 . ARG B 2 45  ? 19.802  -137.867 -15.585 1.00 21.94 ? 45   ARG B NH1 1 
ATOM   1319 N NH2 . ARG B 2 45  ? 19.438  -139.829 -14.458 1.00 22.68 ? 45   ARG B NH2 1 
ATOM   1320 N N   . ARG B 2 46  ? 25.300  -140.721 -19.873 1.00 21.52 ? 46   ARG B N   1 
ATOM   1321 C CA  . ARG B 2 46  ? 26.226  -140.145 -20.864 1.00 22.10 ? 46   ARG B CA  1 
ATOM   1322 C C   . ARG B 2 46  ? 26.097  -138.632 -21.008 1.00 21.68 ? 46   ARG B C   1 
ATOM   1323 O O   . ARG B 2 46  ? 27.055  -137.940 -21.378 1.00 20.33 ? 46   ARG B O   1 
ATOM   1324 C CB  . ARG B 2 46  ? 25.973  -140.780 -22.239 1.00 21.38 ? 46   ARG B CB  1 
ATOM   1325 C CG  . ARG B 2 46  ? 26.325  -142.274 -22.314 1.00 25.23 ? 46   ARG B CG  1 
ATOM   1326 C CD  . ARG B 2 46  ? 25.770  -142.922 -23.607 1.00 24.61 ? 46   ARG B CD  1 
ATOM   1327 N NE  . ARG B 2 46  ? 26.032  -144.367 -23.675 1.00 29.41 ? 46   ARG B NE  1 
ATOM   1328 C CZ  . ARG B 2 46  ? 25.547  -145.201 -24.604 1.00 31.62 ? 46   ARG B CZ  1 
ATOM   1329 N NH1 . ARG B 2 46  ? 24.739  -144.764 -25.571 1.00 33.54 ? 46   ARG B NH1 1 
ATOM   1330 N NH2 . ARG B 2 46  ? 25.866  -146.490 -24.560 1.00 32.25 ? 46   ARG B NH2 1 
ATOM   1331 N N   . LYS B 2 47  ? 24.909  -138.129 -20.725 1.00 22.46 ? 47   LYS B N   1 
ATOM   1332 C CA  . LYS B 2 47  ? 24.633  -136.706 -20.900 1.00 24.48 ? 47   LYS B CA  1 
ATOM   1333 C C   . LYS B 2 47  ? 23.779  -136.187 -19.773 1.00 24.77 ? 47   LYS B C   1 
ATOM   1334 O O   . LYS B 2 47  ? 22.962  -136.901 -19.213 1.00 24.10 ? 47   LYS B O   1 
ATOM   1335 C CB  . LYS B 2 47  ? 23.998  -136.441 -22.257 1.00 25.58 ? 47   LYS B CB  1 
ATOM   1336 C CG  . LYS B 2 47  ? 22.520  -136.661 -22.349 1.00 29.13 ? 47   LYS B CG  1 
ATOM   1337 C CD  . LYS B 2 47  ? 21.898  -135.640 -23.311 1.00 34.17 ? 47   LYS B CD  1 
ATOM   1338 C CE  . LYS B 2 47  ? 20.363  -135.693 -23.274 1.00 37.26 ? 47   LYS B CE  1 
ATOM   1339 N NZ  . LYS B 2 47  ? 19.845  -137.042 -23.734 1.00 37.83 ? 47   LYS B NZ  1 
ATOM   1340 N N   . VAL B 2 48  ? 24.032  -134.942 -19.390 1.00 26.05 ? 48   VAL B N   1 
ATOM   1341 C CA  . VAL B 2 48  ? 23.205  -134.277 -18.406 1.00 26.74 ? 48   VAL B CA  1 
ATOM   1342 C C   . VAL B 2 48  ? 22.749  -132.955 -19.006 1.00 25.84 ? 48   VAL B C   1 
ATOM   1343 O O   . VAL B 2 48  ? 23.482  -132.279 -19.732 1.00 24.96 ? 48   VAL B O   1 
ATOM   1344 C CB  . VAL B 2 48  ? 23.919  -134.064 -17.034 1.00 26.99 ? 48   VAL B CB  1 
ATOM   1345 C CG1 . VAL B 2 48  ? 24.119  -135.388 -16.306 1.00 29.79 ? 48   VAL B CG1 1 
ATOM   1346 C CG2 . VAL B 2 48  ? 25.263  -133.335 -17.193 1.00 30.55 ? 48   VAL B CG2 1 
ATOM   1347 N N   . PHE B 2 49  ? 21.518  -132.615 -18.706 1.00 25.58 ? 49   PHE B N   1 
ATOM   1348 C CA  . PHE B 2 49  ? 20.926  -131.372 -19.177 1.00 26.02 ? 49   PHE B CA  1 
ATOM   1349 C C   . PHE B 2 49  ? 20.527  -130.598 -17.941 1.00 25.89 ? 49   PHE B C   1 
ATOM   1350 O O   . PHE B 2 49  ? 19.710  -131.064 -17.157 1.00 26.32 ? 49   PHE B O   1 
ATOM   1351 C CB  . PHE B 2 49  ? 19.709  -131.672 -20.061 1.00 27.63 ? 49   PHE B CB  1 
ATOM   1352 C CG  . PHE B 2 49  ? 18.879  -130.475 -20.350 1.00 29.81 ? 49   PHE B CG  1 
ATOM   1353 C CD1 . PHE B 2 49  ? 19.310  -129.527 -21.282 1.00 33.18 ? 49   PHE B CD1 1 
ATOM   1354 C CD2 . PHE B 2 49  ? 17.658  -130.270 -19.674 1.00 32.17 ? 49   PHE B CD2 1 
ATOM   1355 C CE1 . PHE B 2 49  ? 18.527  -128.371 -21.547 1.00 31.13 ? 49   PHE B CE1 1 
ATOM   1356 C CE2 . PHE B 2 49  ? 16.879  -129.104 -19.918 1.00 33.43 ? 49   PHE B CE2 1 
ATOM   1357 C CZ  . PHE B 2 49  ? 17.324  -128.158 -20.862 1.00 31.92 ? 49   PHE B CZ  1 
ATOM   1358 N N   . ILE B 2 50  ? 21.125  -129.423 -17.769 1.00 25.12 ? 50   ILE B N   1 
ATOM   1359 C CA  . ILE B 2 50  ? 20.939  -128.618 -16.584 1.00 25.37 ? 50   ILE B CA  1 
ATOM   1360 C C   . ILE B 2 50  ? 20.376  -127.282 -17.111 1.00 23.53 ? 50   ILE B C   1 
ATOM   1361 O O   . ILE B 2 50  ? 21.139  -126.401 -17.534 1.00 23.83 ? 50   ILE B O   1 
ATOM   1362 C CB  . ILE B 2 50  ? 22.281  -128.414 -15.780 1.00 25.22 ? 50   ILE B CB  1 
ATOM   1363 C CG1 . ILE B 2 50  ? 23.056  -129.725 -15.519 1.00 29.07 ? 50   ILE B CG1 1 
ATOM   1364 C CG2 . ILE B 2 50  ? 22.064  -127.629 -14.451 1.00 25.43 ? 50   ILE B CG2 1 
ATOM   1365 C CD1 . ILE B 2 50  ? 22.248  -130.813 -15.001 1.00 34.06 ? 50   ILE B CD1 1 
ATOM   1366 N N   . GLY B 2 51  ? 19.054  -127.177 -17.117 1.00 23.39 ? 51   GLY B N   1 
ATOM   1367 C CA  . GLY B 2 51  ? 18.333  -125.978 -17.639 1.00 23.31 ? 51   GLY B CA  1 
ATOM   1368 C C   . GLY B 2 51  ? 18.473  -124.724 -16.818 1.00 23.50 ? 51   GLY B C   1 
ATOM   1369 O O   . GLY B 2 51  ? 18.126  -123.640 -17.273 1.00 22.79 ? 51   GLY B O   1 
ATOM   1370 N N   . ASN B 2 52  ? 18.928  -124.861 -15.577 1.00 24.01 ? 52   ASN B N   1 
ATOM   1371 C CA  . ASN B 2 52  ? 19.197  -123.698 -14.721 1.00 24.04 ? 52   ASN B CA  1 
ATOM   1372 C C   . ASN B 2 52  ? 20.471  -124.043 -13.970 1.00 24.34 ? 52   ASN B C   1 
ATOM   1373 O O   . ASN B 2 52  ? 20.454  -124.877 -13.057 1.00 24.98 ? 52   ASN B O   1 
ATOM   1374 C CB  . ASN B 2 52  ? 17.998  -123.414 -13.777 1.00 24.16 ? 52   ASN B CB  1 
ATOM   1375 C CG  . ASN B 2 52  ? 18.317  -122.362 -12.728 1.00 24.49 ? 52   ASN B CG  1 
ATOM   1376 O OD1 . ASN B 2 52  ? 19.340  -121.716 -12.808 1.00 21.61 ? 52   ASN B OD1 1 
ATOM   1377 N ND2 . ASN B 2 52  ? 17.416  -122.158 -11.768 1.00 21.87 ? 52   ASN B ND2 1 
ATOM   1378 N N   . CYS B 2 53  ? 21.592  -123.434 -14.374 1.00 24.92 ? 53   CYS B N   1 
ATOM   1379 C CA  . CYS B 2 53  ? 22.908  -123.692 -13.774 1.00 24.85 ? 53   CYS B CA  1 
ATOM   1380 C C   . CYS B 2 53  ? 22.963  -123.562 -12.236 1.00 24.90 ? 53   CYS B C   1 
ATOM   1381 O O   . CYS B 2 53  ? 23.849  -124.137 -11.614 1.00 26.11 ? 53   CYS B O   1 
ATOM   1382 C CB  . CYS B 2 53  ? 24.004  -122.813 -14.406 1.00 24.00 ? 53   CYS B CB  1 
ATOM   1383 S SG  . CYS B 2 53  ? 23.823  -121.038 -14.150 1.00 26.33 ? 53   CYS B SG  1 
ATOM   1384 N N   . TYR B 2 54  ? 22.022  -122.822 -11.647 1.00 23.75 ? 54   TYR B N   1 
ATOM   1385 C CA  . TYR B 2 54  ? 21.996  -122.578 -10.172 1.00 22.24 ? 54   TYR B CA  1 
ATOM   1386 C C   . TYR B 2 54  ? 21.019  -123.489 -9.432  1.00 22.08 ? 54   TYR B C   1 
ATOM   1387 O O   . TYR B 2 54  ? 20.865  -123.395 -8.213  1.00 21.40 ? 54   TYR B O   1 
ATOM   1388 C CB  . TYR B 2 54  ? 21.687  -121.112 -9.892  1.00 22.48 ? 54   TYR B CB  1 
ATOM   1389 C CG  . TYR B 2 54  ? 22.783  -120.151 -10.346 1.00 23.39 ? 54   TYR B CG  1 
ATOM   1390 C CD1 . TYR B 2 54  ? 22.495  -119.111 -11.249 1.00 24.86 ? 54   TYR B CD1 1 
ATOM   1391 C CD2 . TYR B 2 54  ? 24.074  -120.247 -9.836  1.00 23.12 ? 54   TYR B CD2 1 
ATOM   1392 C CE1 . TYR B 2 54  ? 23.487  -118.207 -11.660 1.00 24.84 ? 54   TYR B CE1 1 
ATOM   1393 C CE2 . TYR B 2 54  ? 25.095  -119.351 -10.260 1.00 23.87 ? 54   TYR B CE2 1 
ATOM   1394 C CZ  . TYR B 2 54  ? 24.774  -118.326 -11.169 1.00 22.69 ? 54   TYR B CZ  1 
ATOM   1395 O OH  . TYR B 2 54  ? 25.739  -117.384 -11.563 1.00 22.80 ? 54   TYR B OH  1 
ATOM   1396 N N   . ALA B 2 55  ? 20.400  -124.405 -10.172 1.00 20.75 ? 55   ALA B N   1 
ATOM   1397 C CA  . ALA B 2 55  ? 19.466  -125.373 -9.580  1.00 21.60 ? 55   ALA B CA  1 
ATOM   1398 C C   . ALA B 2 55  ? 20.237  -126.505 -8.885  1.00 22.14 ? 55   ALA B C   1 
ATOM   1399 O O   . ALA B 2 55  ? 19.657  -127.295 -8.136  1.00 22.07 ? 55   ALA B O   1 
ATOM   1400 C CB  . ALA B 2 55  ? 18.539  -125.923 -10.659 1.00 20.64 ? 55   ALA B CB  1 
ATOM   1401 N N   . VAL B 2 56  ? 21.544  -126.564 -9.138  1.00 22.51 ? 56   VAL B N   1 
ATOM   1402 C CA  . VAL B 2 56  ? 22.391  -127.629 -8.575  1.00 22.63 ? 56   VAL B CA  1 
ATOM   1403 C C   . VAL B 2 56  ? 23.839  -127.185 -8.648  1.00 23.65 ? 56   VAL B C   1 
ATOM   1404 O O   . VAL B 2 56  ? 24.190  -126.352 -9.475  1.00 22.92 ? 56   VAL B O   1 
ATOM   1405 C CB  . VAL B 2 56  ? 22.208  -128.977 -9.342  1.00 21.84 ? 56   VAL B CB  1 
ATOM   1406 C CG1 . VAL B 2 56  ? 22.611  -128.833 -10.837 1.00 22.99 ? 56   VAL B CG1 1 
ATOM   1407 C CG2 . VAL B 2 56  ? 23.045  -130.139 -8.678  1.00 23.76 ? 56   VAL B CG2 1 
ATOM   1408 N N   . SER B 2 57  ? 24.692  -127.759 -7.795  1.00 23.12 ? 57   SER B N   1 
ATOM   1409 C CA  . SER B 2 57  ? 26.111  -127.414 -7.825  1.00 24.14 ? 57   SER B CA  1 
ATOM   1410 C C   . SER B 2 57  ? 26.919  -128.352 -8.756  1.00 24.33 ? 57   SER B C   1 
ATOM   1411 O O   . SER B 2 57  ? 26.522  -129.503 -8.974  1.00 23.94 ? 57   SER B O   1 
ATOM   1412 C CB  . SER B 2 57  ? 26.670  -127.457 -6.400  1.00 24.07 ? 57   SER B CB  1 
ATOM   1413 O OG  . SER B 2 57  ? 26.854  -128.807 -6.000  1.00 25.72 ? 57   SER B OG  1 
ATOM   1414 N N   . PRO B 2 58  ? 28.061  -127.865 -9.304  1.00 24.30 ? 58   PRO B N   1 
ATOM   1415 C CA  . PRO B 2 58  ? 28.922  -128.754 -10.067 1.00 24.13 ? 58   PRO B CA  1 
ATOM   1416 C C   . PRO B 2 58  ? 29.324  -129.998 -9.262  1.00 23.85 ? 58   PRO B C   1 
ATOM   1417 O O   . PRO B 2 58  ? 29.214  -131.105 -9.799  1.00 25.24 ? 58   PRO B O   1 
ATOM   1418 C CB  . PRO B 2 58  ? 30.138  -127.887 -10.390 1.00 23.93 ? 58   PRO B CB  1 
ATOM   1419 C CG  . PRO B 2 58  ? 29.572  -126.471 -10.452 1.00 24.18 ? 58   PRO B CG  1 
ATOM   1420 C CD  . PRO B 2 58  ? 28.570  -126.478 -9.301  1.00 25.44 ? 58   PRO B CD  1 
ATOM   1421 N N   . ALA B 2 59  ? 29.717  -129.848 -7.990  1.00 22.07 ? 59   ALA B N   1 
ATOM   1422 C CA  . ALA B 2 59  ? 30.205  -131.024 -7.233  1.00 22.55 ? 59   ALA B CA  1 
ATOM   1423 C C   . ALA B 2 59  ? 29.145  -132.112 -7.190  1.00 22.16 ? 59   ALA B C   1 
ATOM   1424 O O   . ALA B 2 59  ? 29.448  -133.288 -7.277  1.00 20.73 ? 59   ALA B O   1 
ATOM   1425 C CB  . ALA B 2 59  ? 30.661  -130.647 -5.820  1.00 22.33 ? 59   ALA B CB  1 
ATOM   1426 N N   . THR B 2 60  ? 27.886  -131.700 -7.061  1.00 21.67 ? 60   THR B N   1 
ATOM   1427 C CA  . THR B 2 60  ? 26.770  -132.639 -6.939  1.00 22.60 ? 60   THR B CA  1 
ATOM   1428 C C   . THR B 2 60  ? 26.569  -133.452 -8.211  1.00 22.78 ? 60   THR B C   1 
ATOM   1429 O O   . THR B 2 60  ? 26.338  -134.663 -8.150  1.00 24.12 ? 60   THR B O   1 
ATOM   1430 C CB  . THR B 2 60  ? 25.445  -131.896 -6.582  1.00 22.49 ? 60   THR B CB  1 
ATOM   1431 O OG1 . THR B 2 60  ? 25.525  -131.437 -5.226  1.00 24.02 ? 60   THR B OG1 1 
ATOM   1432 C CG2 . THR B 2 60  ? 24.250  -132.834 -6.712  1.00 23.40 ? 60   THR B CG2 1 
ATOM   1433 N N   . VAL B 2 61  ? 26.644  -132.783 -9.355  1.00 23.40 ? 61   VAL B N   1 
ATOM   1434 C CA  . VAL B 2 61  ? 26.496  -133.426 -10.667 1.00 23.58 ? 61   VAL B CA  1 
ATOM   1435 C C   . VAL B 2 61  ? 27.663  -134.397 -10.905 1.00 23.48 ? 61   VAL B C   1 
ATOM   1436 O O   . VAL B 2 61  ? 27.453  -135.555 -11.308 1.00 22.84 ? 61   VAL B O   1 
ATOM   1437 C CB  . VAL B 2 61  ? 26.465  -132.350 -11.812 1.00 23.15 ? 61   VAL B CB  1 
ATOM   1438 C CG1 . VAL B 2 61  ? 26.447  -133.016 -13.219 1.00 22.62 ? 61   VAL B CG1 1 
ATOM   1439 C CG2 . VAL B 2 61  ? 25.265  -131.438 -11.649 1.00 25.72 ? 61   VAL B CG2 1 
ATOM   1440 N N   . ILE B 2 62  ? 28.889  -133.933 -10.641 1.00 23.74 ? 62   ILE B N   1 
ATOM   1441 C CA  . ILE B 2 62  ? 30.081  -134.755 -10.907 1.00 24.72 ? 62   ILE B CA  1 
ATOM   1442 C C   . ILE B 2 62  ? 30.181  -135.965 -9.996  1.00 25.65 ? 62   ILE B C   1 
ATOM   1443 O O   . ILE B 2 62  ? 30.612  -137.022 -10.449 1.00 25.61 ? 62   ILE B O   1 
ATOM   1444 C CB  . ILE B 2 62  ? 31.388  -133.925 -10.867 1.00 25.00 ? 62   ILE B CB  1 
ATOM   1445 C CG1 . ILE B 2 62  ? 31.346  -132.819 -11.930 1.00 27.04 ? 62   ILE B CG1 1 
ATOM   1446 C CG2 . ILE B 2 62  ? 32.604  -134.811 -11.065 1.00 26.21 ? 62   ILE B CG2 1 
ATOM   1447 C CD1 . ILE B 2 62  ? 32.442  -131.807 -11.788 1.00 30.88 ? 62   ILE B CD1 1 
ATOM   1448 N N   . ARG B 2 63  ? 29.813  -135.801 -8.712  1.00 25.28 ? 63   ARG B N   1 
ATOM   1449 C CA  . ARG B 2 63  ? 29.760  -136.901 -7.776  1.00 25.71 ? 63   ARG B CA  1 
ATOM   1450 C C   . ARG B 2 63  ? 28.703  -137.952 -8.165  1.00 24.97 ? 63   ARG B C   1 
ATOM   1451 O O   . ARG B 2 63  ? 28.981  -139.145 -8.152  1.00 23.17 ? 63   ARG B O   1 
ATOM   1452 C CB  . ARG B 2 63  ? 29.581  -136.398 -6.328  1.00 25.42 ? 63   ARG B CB  1 
ATOM   1453 C CG  . ARG B 2 63  ? 29.794  -137.473 -5.244  1.00 30.81 ? 63   ARG B CG  1 
ATOM   1454 C CD  . ARG B 2 63  ? 30.481  -136.930 -3.963  1.00 36.10 ? 63   ARG B CD  1 
ATOM   1455 N NE  . ARG B 2 63  ? 29.888  -135.660 -3.528  1.00 43.16 ? 63   ARG B NE  1 
ATOM   1456 C CZ  . ARG B 2 63  ? 30.478  -134.459 -3.590  1.00 44.46 ? 63   ARG B CZ  1 
ATOM   1457 N NH1 . ARG B 2 63  ? 31.726  -134.320 -4.042  1.00 44.81 ? 63   ARG B NH1 1 
ATOM   1458 N NH2 . ARG B 2 63  ? 29.810  -133.387 -3.171  1.00 44.57 ? 63   ARG B NH2 1 
ATOM   1459 N N   . ARG B 2 64  ? 27.507  -137.515 -8.529  1.00 24.38 ? 64   ARG B N   1 
ATOM   1460 C CA  . ARG B 2 64  ? 26.439  -138.455 -8.914  1.00 24.02 ? 64   ARG B CA  1 
ATOM   1461 C C   . ARG B 2 64  ? 26.696  -139.147 -10.252 1.00 24.24 ? 64   ARG B C   1 
ATOM   1462 O O   . ARG B 2 64  ? 26.494  -140.350 -10.367 1.00 22.61 ? 64   ARG B O   1 
ATOM   1463 C CB  . ARG B 2 64  ? 25.074  -137.749 -9.013  1.00 24.70 ? 64   ARG B CB  1 
ATOM   1464 C CG  . ARG B 2 64  ? 23.979  -138.755 -9.375  1.00 25.27 ? 64   ARG B CG  1 
ATOM   1465 C CD  . ARG B 2 64  ? 22.566  -138.257 -9.127  1.00 24.88 ? 64   ARG B CD  1 
ATOM   1466 N NE  . ARG B 2 64  ? 21.560  -139.196 -9.642  1.00 23.76 ? 64   ARG B NE  1 
ATOM   1467 C CZ  . ARG B 2 64  ? 20.278  -138.877 -9.807  1.00 23.61 ? 64   ARG B CZ  1 
ATOM   1468 N NH1 . ARG B 2 64  ? 19.841  -137.664 -9.444  1.00 18.73 ? 64   ARG B NH1 1 
ATOM   1469 N NH2 . ARG B 2 64  ? 19.438  -139.769 -10.308 1.00 21.62 ? 64   ARG B NH2 1 
ATOM   1470 N N   . PHE B 2 65  ? 27.079  -138.362 -11.273 1.00 23.55 ? 65   PHE B N   1 
ATOM   1471 C CA  . PHE B 2 65  ? 27.244  -138.870 -12.634 1.00 23.83 ? 65   PHE B CA  1 
ATOM   1472 C C   . PHE B 2 65  ? 28.710  -138.806 -13.055 1.00 25.07 ? 65   PHE B C   1 
ATOM   1473 O O   . PHE B 2 65  ? 29.135  -137.866 -13.727 1.00 24.21 ? 65   PHE B O   1 
ATOM   1474 C CB  . PHE B 2 65  ? 26.365  -138.091 -13.611 1.00 23.97 ? 65   PHE B CB  1 
ATOM   1475 C CG  . PHE B 2 65  ? 24.902  -138.173 -13.311 1.00 23.46 ? 65   PHE B CG  1 
ATOM   1476 C CD1 . PHE B 2 65  ? 24.151  -137.011 -13.085 1.00 23.65 ? 65   PHE B CD1 1 
ATOM   1477 C CD2 . PHE B 2 65  ? 24.263  -139.424 -13.242 1.00 23.30 ? 65   PHE B CD2 1 
ATOM   1478 C CE1 . PHE B 2 65  ? 22.789  -137.077 -12.817 1.00 21.51 ? 65   PHE B CE1 1 
ATOM   1479 C CE2 . PHE B 2 65  ? 22.899  -139.503 -12.956 1.00 20.89 ? 65   PHE B CE2 1 
ATOM   1480 C CZ  . PHE B 2 65  ? 22.152  -138.295 -12.766 1.00 22.16 ? 65   PHE B CZ  1 
ATOM   1481 N N   . PRO B 2 66  ? 29.507  -139.816 -12.655 1.00 24.31 ? 66   PRO B N   1 
ATOM   1482 C CA  . PRO B 2 66  ? 30.939  -139.695 -12.912 1.00 24.89 ? 66   PRO B CA  1 
ATOM   1483 C C   . PRO B 2 66  ? 31.443  -139.881 -14.351 1.00 25.96 ? 66   PRO B C   1 
ATOM   1484 O O   . PRO B 2 66  ? 32.613  -139.530 -14.635 1.00 27.11 ? 66   PRO B O   1 
ATOM   1485 C CB  . PRO B 2 66  ? 31.533  -140.806 -12.016 1.00 23.73 ? 66   PRO B CB  1 
ATOM   1486 C CG  . PRO B 2 66  ? 30.457  -141.176 -11.079 1.00 23.33 ? 66   PRO B CG  1 
ATOM   1487 C CD  . PRO B 2 66  ? 29.223  -141.046 -11.886 1.00 25.78 ? 66   PRO B CD  1 
ATOM   1488 N N   . LYS B 2 67  ? 30.633  -140.472 -15.233 1.00 25.64 ? 67   LYS B N   1 
ATOM   1489 C CA  . LYS B 2 67  ? 31.123  -140.864 -16.561 1.00 24.37 ? 67   LYS B CA  1 
ATOM   1490 C C   . LYS B 2 67  ? 30.504  -140.065 -17.703 1.00 23.76 ? 67   LYS B C   1 
ATOM   1491 O O   . LYS B 2 67  ? 30.501  -140.527 -18.843 1.00 22.84 ? 67   LYS B O   1 
ATOM   1492 C CB  . LYS B 2 67  ? 30.967  -142.386 -16.797 1.00 24.77 ? 67   LYS B CB  1 
ATOM   1493 C CG  . LYS B 2 67  ? 31.853  -143.243 -15.899 1.00 27.28 ? 67   LYS B CG  1 
ATOM   1494 C CD  . LYS B 2 67  ? 31.936  -144.669 -16.397 1.00 30.80 ? 67   LYS B CD  1 
ATOM   1495 C CE  . LYS B 2 67  ? 33.131  -145.370 -15.792 1.00 33.11 ? 67   LYS B CE  1 
ATOM   1496 N NZ  . LYS B 2 67  ? 33.159  -146.824 -16.152 1.00 36.08 ? 67   LYS B NZ  1 
ATOM   1497 N N   . VAL B 2 68  ? 29.985  -138.871 -17.388 1.00 21.80 ? 68   VAL B N   1 
ATOM   1498 C CA  . VAL B 2 68  ? 29.354  -137.984 -18.356 1.00 23.07 ? 68   VAL B CA  1 
ATOM   1499 C C   . VAL B 2 68  ? 30.298  -137.589 -19.494 1.00 22.28 ? 68   VAL B C   1 
ATOM   1500 O O   . VAL B 2 68  ? 31.479  -137.284 -19.261 1.00 22.05 ? 68   VAL B O   1 
ATOM   1501 C CB  . VAL B 2 68  ? 28.760  -136.737 -17.620 1.00 22.67 ? 68   VAL B CB  1 
ATOM   1502 C CG1 . VAL B 2 68  ? 28.377  -135.563 -18.555 1.00 24.52 ? 68   VAL B CG1 1 
ATOM   1503 C CG2 . VAL B 2 68  ? 27.502  -137.164 -16.813 1.00 23.11 ? 68   VAL B CG2 1 
ATOM   1504 N N   . ARG B 2 69  ? 29.788  -137.656 -20.720 1.00 20.82 ? 69   ARG B N   1 
ATOM   1505 C CA  . ARG B 2 69  ? 30.528  -137.146 -21.872 1.00 20.66 ? 69   ARG B CA  1 
ATOM   1506 C C   . ARG B 2 69  ? 29.917  -135.922 -22.505 1.00 20.95 ? 69   ARG B C   1 
ATOM   1507 O O   . ARG B 2 69  ? 30.551  -135.307 -23.350 1.00 19.78 ? 69   ARG B O   1 
ATOM   1508 C CB  . ARG B 2 69  ? 30.647  -138.200 -22.931 1.00 21.80 ? 69   ARG B CB  1 
ATOM   1509 C CG  . ARG B 2 69  ? 31.644  -139.240 -22.503 1.00 23.12 ? 69   ARG B CG  1 
ATOM   1510 C CD  . ARG B 2 69  ? 31.462  -140.497 -23.254 1.00 31.79 ? 69   ARG B CD  1 
ATOM   1511 N NE  . ARG B 2 69  ? 32.432  -141.495 -22.806 1.00 32.21 ? 69   ARG B NE  1 
ATOM   1512 C CZ  . ARG B 2 69  ? 33.373  -142.041 -23.586 1.00 36.98 ? 69   ARG B CZ  1 
ATOM   1513 N NH1 . ARG B 2 69  ? 33.483  -141.705 -24.876 1.00 38.18 ? 69   ARG B NH1 1 
ATOM   1514 N NH2 . ARG B 2 69  ? 34.202  -142.941 -23.082 1.00 36.47 ? 69   ARG B NH2 1 
ATOM   1515 N N   . SER B 2 70  ? 28.683  -135.602 -22.137 1.00 19.70 ? 70   SER B N   1 
ATOM   1516 C CA  . SER B 2 70  ? 28.048  -134.428 -22.734 1.00 21.12 ? 70   SER B CA  1 
ATOM   1517 C C   . SER B 2 70  ? 27.325  -133.618 -21.670 1.00 21.61 ? 70   SER B C   1 
ATOM   1518 O O   . SER B 2 70  ? 26.541  -134.163 -20.897 1.00 21.56 ? 70   SER B O   1 
ATOM   1519 C CB  . SER B 2 70  ? 27.118  -134.871 -23.884 1.00 20.48 ? 70   SER B CB  1 
ATOM   1520 O OG  . SER B 2 70  ? 26.282  -133.803 -24.302 1.00 22.31 ? 70   SER B OG  1 
ATOM   1521 N N   . VAL B 2 71  ? 27.568  -132.302 -21.627 1.00 23.07 ? 71   VAL B N   1 
ATOM   1522 C CA  . VAL B 2 71  ? 26.946  -131.419 -20.623 1.00 23.07 ? 71   VAL B CA  1 
ATOM   1523 C C   . VAL B 2 71  ? 26.289  -130.243 -21.337 1.00 23.02 ? 71   VAL B C   1 
ATOM   1524 O O   . VAL B 2 71  ? 26.844  -129.682 -22.273 1.00 21.96 ? 71   VAL B O   1 
ATOM   1525 C CB  . VAL B 2 71  ? 27.996  -130.934 -19.574 1.00 24.95 ? 71   VAL B CB  1 
ATOM   1526 C CG1 . VAL B 2 71  ? 27.396  -129.874 -18.576 1.00 24.99 ? 71   VAL B CG1 1 
ATOM   1527 C CG2 . VAL B 2 71  ? 28.547  -132.152 -18.802 1.00 26.25 ? 71   VAL B CG2 1 
ATOM   1528 N N   . GLU B 2 72  ? 25.054  -129.976 -20.968 1.00 22.60 ? 72   GLU B N   1 
ATOM   1529 C CA  . GLU B 2 72  ? 24.393  -128.752 -21.452 1.00 23.21 ? 72   GLU B CA  1 
ATOM   1530 C C   . GLU B 2 72  ? 23.967  -127.947 -20.233 1.00 22.95 ? 72   GLU B C   1 
ATOM   1531 O O   . GLU B 2 72  ? 23.342  -128.489 -19.313 1.00 22.70 ? 72   GLU B O   1 
ATOM   1532 C CB  . GLU B 2 72  ? 23.211  -129.131 -22.342 1.00 23.51 ? 72   GLU B CB  1 
ATOM   1533 C CG  . GLU B 2 72  ? 22.378  -127.905 -22.776 1.00 24.01 ? 72   GLU B CG  1 
ATOM   1534 C CD  . GLU B 2 72  ? 21.465  -128.181 -23.962 1.00 26.02 ? 72   GLU B CD  1 
ATOM   1535 O OE1 . GLU B 2 72  ? 21.363  -129.346 -24.433 1.00 28.79 ? 72   GLU B OE1 1 
ATOM   1536 O OE2 . GLU B 2 72  ? 20.825  -127.205 -24.399 1.00 29.46 ? 72   GLU B OE2 1 
ATOM   1537 N N   . LEU B 2 73  ? 24.288  -126.645 -20.231 1.00 23.14 ? 73   LEU B N   1 
ATOM   1538 C CA  . LEU B 2 73  ? 23.988  -125.748 -19.120 1.00 23.56 ? 73   LEU B CA  1 
ATOM   1539 C C   . LEU B 2 73  ? 23.353  -124.498 -19.676 1.00 22.46 ? 73   LEU B C   1 
ATOM   1540 O O   . LEU B 2 73  ? 23.754  -124.051 -20.744 1.00 21.85 ? 73   LEU B O   1 
ATOM   1541 C CB  . LEU B 2 73  ? 25.311  -125.320 -18.434 1.00 24.74 ? 73   LEU B CB  1 
ATOM   1542 C CG  . LEU B 2 73  ? 25.906  -126.350 -17.487 1.00 25.56 ? 73   LEU B CG  1 
ATOM   1543 C CD1 . LEU B 2 73  ? 27.425  -126.118 -17.398 1.00 25.04 ? 73   LEU B CD1 1 
ATOM   1544 C CD2 . LEU B 2 73  ? 25.223  -126.164 -16.107 1.00 27.07 ? 73   LEU B CD2 1 
ATOM   1545 N N   . LYS B 2 74  ? 22.372  -123.970 -18.967 1.00 23.45 ? 74   LYS B N   1 
ATOM   1546 C CA  . LYS B 2 74  ? 21.734  -122.692 -19.329 1.00 23.04 ? 74   LYS B CA  1 
ATOM   1547 C C   . LYS B 2 74  ? 21.826  -121.769 -18.121 1.00 23.20 ? 74   LYS B C   1 
ATOM   1548 O O   . LYS B 2 74  ? 21.687  -122.219 -16.967 1.00 22.97 ? 74   LYS B O   1 
ATOM   1549 C CB  . LYS B 2 74  ? 20.285  -122.908 -19.756 1.00 24.89 ? 74   LYS B CB  1 
ATOM   1550 C CG  . LYS B 2 74  ? 20.118  -123.880 -20.963 1.00 25.30 ? 74   LYS B CG  1 
ATOM   1551 C CD  . LYS B 2 74  ? 18.665  -123.813 -21.442 1.00 28.66 ? 74   LYS B CD  1 
ATOM   1552 C CE  . LYS B 2 74  ? 18.474  -124.515 -22.768 1.00 29.88 ? 74   LYS B CE  1 
ATOM   1553 N NZ  . LYS B 2 74  ? 17.029  -124.366 -23.172 1.00 26.58 ? 74   LYS B NZ  1 
ATOM   1554 N N   . GLY B 2 75  ? 22.089  -120.482 -18.370 1.00 22.46 ? 75   GLY B N   1 
ATOM   1555 C CA  . GLY B 2 75  ? 22.358  -119.528 -17.275 1.00 22.88 ? 75   GLY B CA  1 
ATOM   1556 C C   . GLY B 2 75  ? 21.257  -118.509 -17.074 1.00 23.43 ? 75   GLY B C   1 
ATOM   1557 O O   . GLY B 2 75  ? 20.226  -118.777 -16.422 1.00 24.68 ? 75   GLY B O   1 
ATOM   1558 N N   . LYS B 2 76  ? 21.465  -117.321 -17.633 1.00 23.40 ? 76   LYS B N   1 
ATOM   1559 C CA  . LYS B 2 76  ? 20.513  -116.204 -17.472 1.00 21.49 ? 76   LYS B CA  1 
ATOM   1560 C C   . LYS B 2 76  ? 19.128  -116.546 -18.029 1.00 23.60 ? 76   LYS B C   1 
ATOM   1561 O O   . LYS B 2 76  ? 19.043  -117.263 -19.042 1.00 22.97 ? 76   LYS B O   1 
ATOM   1562 C CB  . LYS B 2 76  ? 21.016  -114.947 -18.175 1.00 22.56 ? 76   LYS B CB  1 
ATOM   1563 C CG  . LYS B 2 76  ? 22.465  -114.654 -17.900 1.00 22.10 ? 76   LYS B CG  1 
ATOM   1564 C CD  . LYS B 2 76  ? 22.865  -113.309 -18.524 1.00 26.47 ? 76   LYS B CD  1 
ATOM   1565 C CE  . LYS B 2 76  ? 24.299  -112.990 -18.166 1.00 28.92 ? 76   LYS B CE  1 
ATOM   1566 N NZ  . LYS B 2 76  ? 24.685  -111.539 -18.455 1.00 30.98 ? 76   LYS B NZ  1 
ATOM   1567 N N   . PRO B 2 77  ? 18.062  -115.992 -17.400 1.00 24.64 ? 77   PRO B N   1 
ATOM   1568 C CA  . PRO B 2 77  ? 16.693  -116.138 -17.922 1.00 25.15 ? 77   PRO B CA  1 
ATOM   1569 C C   . PRO B 2 77  ? 16.534  -115.479 -19.301 1.00 24.00 ? 77   PRO B C   1 
ATOM   1570 O O   . PRO B 2 77  ? 17.320  -114.591 -19.661 1.00 22.39 ? 77   PRO B O   1 
ATOM   1571 C CB  . PRO B 2 77  ? 15.839  -115.384 -16.914 1.00 26.34 ? 77   PRO B CB  1 
ATOM   1572 C CG  . PRO B 2 77  ? 16.768  -114.545 -16.103 1.00 26.09 ? 77   PRO B CG  1 
ATOM   1573 C CD  . PRO B 2 77  ? 18.101  -115.200 -16.146 1.00 24.27 ? 77   PRO B CD  1 
ATOM   1574 N N   . HIS B 2 78  ? 15.500  -115.894 -20.033 1.00 24.07 ? 78   HIS B N   1 
ATOM   1575 C CA  . HIS B 2 78  ? 15.176  -115.358 -21.366 1.00 24.24 ? 78   HIS B CA  1 
ATOM   1576 C C   . HIS B 2 78  ? 15.149  -113.823 -21.476 1.00 24.03 ? 78   HIS B C   1 
ATOM   1577 O O   . HIS B 2 78  ? 15.555  -113.244 -22.509 1.00 25.11 ? 78   HIS B O   1 
ATOM   1578 C CB  . HIS B 2 78  ? 13.817  -115.940 -21.785 1.00 23.88 ? 78   HIS B CB  1 
ATOM   1579 C CG  . HIS B 2 78  ? 13.304  -115.438 -23.103 1.00 22.61 ? 78   HIS B CG  1 
ATOM   1580 N ND1 . HIS B 2 78  ? 11.961  -115.295 -23.366 1.00 21.27 ? 78   HIS B ND1 1 
ATOM   1581 C CD2 . HIS B 2 78  ? 13.948  -115.081 -24.243 1.00 22.33 ? 78   HIS B CD2 1 
ATOM   1582 C CE1 . HIS B 2 78  ? 11.796  -114.866 -24.604 1.00 23.25 ? 78   HIS B CE1 1 
ATOM   1583 N NE2 . HIS B 2 78  ? 12.991  -114.713 -25.152 1.00 22.58 ? 78   HIS B NE2 1 
ATOM   1584 N N   . PHE B 2 79  ? 14.651  -113.150 -20.440 1.00 24.22 ? 79   PHE B N   1 
ATOM   1585 C CA  . PHE B 2 79  ? 14.487  -111.672 -20.502 1.00 23.62 ? 79   PHE B CA  1 
ATOM   1586 C C   . PHE B 2 79  ? 15.847  -110.936 -20.481 1.00 23.78 ? 79   PHE B C   1 
ATOM   1587 O O   . PHE B 2 79  ? 15.922  -109.719 -20.700 1.00 24.36 ? 79   PHE B O   1 
ATOM   1588 C CB  . PHE B 2 79  ? 13.560  -111.183 -19.365 1.00 22.51 ? 79   PHE B CB  1 
ATOM   1589 C CG  . PHE B 2 79  ? 12.049  -111.230 -19.697 1.00 21.75 ? 79   PHE B CG  1 
ATOM   1590 C CD1 . PHE B 2 79  ? 11.555  -111.990 -20.766 1.00 22.36 ? 79   PHE B CD1 1 
ATOM   1591 C CD2 . PHE B 2 79  ? 11.133  -110.566 -18.896 1.00 22.53 ? 79   PHE B CD2 1 
ATOM   1592 C CE1 . PHE B 2 79  ? 10.182  -112.043 -21.045 1.00 19.98 ? 79   PHE B CE1 1 
ATOM   1593 C CE2 . PHE B 2 79  ? 9.788   -110.622 -19.160 1.00 22.64 ? 79   PHE B CE2 1 
ATOM   1594 C CZ  . PHE B 2 79  ? 9.299   -111.356 -20.230 1.00 20.85 ? 79   PHE B CZ  1 
ATOM   1595 N N   . ALA B 2 80  ? 16.938  -111.666 -20.226 1.00 23.05 ? 80   ALA B N   1 
ATOM   1596 C CA  . ALA B 2 80  ? 18.281  -111.086 -20.405 1.00 23.47 ? 80   ALA B CA  1 
ATOM   1597 C C   . ALA B 2 80  ? 18.471  -110.650 -21.855 1.00 23.70 ? 80   ALA B C   1 
ATOM   1598 O O   . ALA B 2 80  ? 19.253  -109.727 -22.130 1.00 24.35 ? 80   ALA B O   1 
ATOM   1599 C CB  . ALA B 2 80  ? 19.385  -112.136 -20.033 1.00 23.34 ? 80   ALA B CB  1 
ATOM   1600 N N   . ASP B 2 81  ? 17.790  -111.333 -22.793 1.00 23.23 ? 81   ASP B N   1 
ATOM   1601 C CA  . ASP B 2 81  ? 17.861  -110.944 -24.224 1.00 23.12 ? 81   ASP B CA  1 
ATOM   1602 C C   . ASP B 2 81  ? 17.328  -109.544 -24.497 1.00 22.68 ? 81   ASP B C   1 
ATOM   1603 O O   . ASP B 2 81  ? 17.619  -108.939 -25.546 1.00 22.23 ? 81   ASP B O   1 
ATOM   1604 C CB  . ASP B 2 81  ? 17.042  -111.893 -25.063 1.00 23.47 ? 81   ASP B CB  1 
ATOM   1605 C CG  . ASP B 2 81  ? 17.659  -113.265 -25.171 1.00 24.57 ? 81   ASP B CG  1 
ATOM   1606 O OD1 . ASP B 2 81  ? 18.680  -113.551 -24.533 1.00 27.93 ? 81   ASP B OD1 1 
ATOM   1607 O OD2 . ASP B 2 81  ? 17.082  -114.072 -25.899 1.00 28.81 ? 81   ASP B OD2 1 
ATOM   1608 N N   . PHE B 2 82  ? 16.498  -109.044 -23.583 1.00 22.00 ? 82   PHE B N   1 
ATOM   1609 C CA  . PHE B 2 82  ? 15.878  -107.745 -23.746 1.00 22.05 ? 82   PHE B CA  1 
ATOM   1610 C C   . PHE B 2 82  ? 16.450  -106.667 -22.802 1.00 22.00 ? 82   PHE B C   1 
ATOM   1611 O O   . PHE B 2 82  ? 15.817  -105.679 -22.551 1.00 21.68 ? 82   PHE B O   1 
ATOM   1612 C CB  . PHE B 2 82  ? 14.350  -107.843 -23.596 1.00 21.70 ? 82   PHE B CB  1 
ATOM   1613 C CG  . PHE B 2 82  ? 13.756  -109.027 -24.316 1.00 23.89 ? 82   PHE B CG  1 
ATOM   1614 C CD1 . PHE B 2 82  ? 14.068  -109.280 -25.647 1.00 25.32 ? 82   PHE B CD1 1 
ATOM   1615 C CD2 . PHE B 2 82  ? 12.893  -109.881 -23.655 1.00 26.35 ? 82   PHE B CD2 1 
ATOM   1616 C CE1 . PHE B 2 82  ? 13.540  -110.401 -26.341 1.00 25.82 ? 82   PHE B CE1 1 
ATOM   1617 C CE2 . PHE B 2 82  ? 12.339  -111.006 -24.317 1.00 24.44 ? 82   PHE B CE2 1 
ATOM   1618 C CZ  . PHE B 2 82  ? 12.661  -111.261 -25.673 1.00 25.11 ? 82   PHE B CZ  1 
ATOM   1619 N N   . ASN B 2 83  ? 17.643  -106.902 -22.291 1.00 23.43 ? 83   ASN B N   1 
ATOM   1620 C CA  . ASN B 2 83  ? 18.338  -105.950 -21.456 1.00 23.36 ? 83   ASN B CA  1 
ATOM   1621 C C   . ASN B 2 83  ? 17.681  -105.734 -20.094 1.00 24.35 ? 83   ASN B C   1 
ATOM   1622 O O   . ASN B 2 83  ? 17.891  -104.702 -19.468 1.00 23.79 ? 83   ASN B O   1 
ATOM   1623 C CB  . ASN B 2 83  ? 18.551  -104.626 -22.206 1.00 24.16 ? 83   ASN B CB  1 
ATOM   1624 C CG  . ASN B 2 83  ? 19.498  -104.778 -23.367 1.00 27.53 ? 83   ASN B CG  1 
ATOM   1625 O OD1 . ASN B 2 83  ? 20.554  -105.389 -23.237 1.00 33.30 ? 83   ASN B OD1 1 
ATOM   1626 N ND2 . ASN B 2 83  ? 19.118  -104.248 -24.529 1.00 29.91 ? 83   ASN B ND2 1 
ATOM   1627 N N   . LEU B 2 84  ? 16.912  -106.724 -19.609 1.00 23.81 ? 84   LEU B N   1 
ATOM   1628 C CA  . LEU B 2 84  ? 16.200  -106.564 -18.334 1.00 24.11 ? 84   LEU B CA  1 
ATOM   1629 C C   . LEU B 2 84  ? 17.001  -107.178 -17.153 1.00 24.77 ? 84   LEU B C   1 
ATOM   1630 O O   . LEU B 2 84  ? 16.621  -107.043 -15.978 1.00 24.50 ? 84   LEU B O   1 
ATOM   1631 C CB  . LEU B 2 84  ? 14.804  -107.195 -18.463 1.00 23.31 ? 84   LEU B CB  1 
ATOM   1632 C CG  . LEU B 2 84  ? 13.942  -106.609 -19.583 1.00 22.18 ? 84   LEU B CG  1 
ATOM   1633 C CD1 . LEU B 2 84  ? 12.560  -107.248 -19.585 1.00 20.84 ? 84   LEU B CD1 1 
ATOM   1634 C CD2 . LEU B 2 84  ? 13.799  -105.040 -19.413 1.00 20.30 ? 84   LEU B CD2 1 
ATOM   1635 N N   . VAL B 2 85  ? 18.094  -107.847 -17.484 1.00 24.02 ? 85   VAL B N   1 
ATOM   1636 C CA  . VAL B 2 85  ? 19.027  -108.392 -16.494 1.00 24.80 ? 85   VAL B CA  1 
ATOM   1637 C C   . VAL B 2 85  ? 20.338  -107.590 -16.532 1.00 25.30 ? 85   VAL B C   1 
ATOM   1638 O O   . VAL B 2 85  ? 21.098  -107.680 -17.516 1.00 24.82 ? 85   VAL B O   1 
ATOM   1639 C CB  . VAL B 2 85  ? 19.301  -109.904 -16.735 1.00 25.83 ? 85   VAL B CB  1 
ATOM   1640 C CG1 . VAL B 2 85  ? 20.208  -110.476 -15.613 1.00 27.34 ? 85   VAL B CG1 1 
ATOM   1641 C CG2 . VAL B 2 85  ? 17.979  -110.705 -16.799 1.00 24.81 ? 85   VAL B CG2 1 
ATOM   1642 N N   . PRO B 2 86  ? 20.626  -106.805 -15.463 1.00 24.60 ? 86   PRO B N   1 
ATOM   1643 C CA  . PRO B 2 86  ? 21.845  -105.984 -15.488 1.00 24.32 ? 86   PRO B CA  1 
ATOM   1644 C C   . PRO B 2 86  ? 23.083  -106.837 -15.594 1.00 23.94 ? 86   PRO B C   1 
ATOM   1645 O O   . PRO B 2 86  ? 23.064  -108.003 -15.188 1.00 23.06 ? 86   PRO B O   1 
ATOM   1646 C CB  . PRO B 2 86  ? 21.805  -105.250 -14.137 1.00 23.76 ? 86   PRO B CB  1 
ATOM   1647 C CG  . PRO B 2 86  ? 20.326  -105.257 -13.775 1.00 23.97 ? 86   PRO B CG  1 
ATOM   1648 C CD  . PRO B 2 86  ? 19.890  -106.622 -14.199 1.00 25.35 ? 86   PRO B CD  1 
ATOM   1649 N N   . ASP B 2 87  ? 24.149  -106.261 -16.161 1.00 25.14 ? 87   ASP B N   1 
ATOM   1650 C CA  . ASP B 2 87  ? 25.423  -106.956 -16.318 1.00 25.47 ? 87   ASP B CA  1 
ATOM   1651 C C   . ASP B 2 87  ? 25.948  -107.351 -14.950 1.00 25.10 ? 87   ASP B C   1 
ATOM   1652 O O   . ASP B 2 87  ? 25.826  -106.589 -13.990 1.00 24.09 ? 87   ASP B O   1 
ATOM   1653 C CB  . ASP B 2 87  ? 26.481  -106.023 -16.904 1.00 26.45 ? 87   ASP B CB  1 
ATOM   1654 C CG  . ASP B 2 87  ? 26.164  -105.569 -18.305 1.00 29.98 ? 87   ASP B CG  1 
ATOM   1655 O OD1 . ASP B 2 87  ? 26.682  -104.503 -18.698 1.00 33.19 ? 87   ASP B OD1 1 
ATOM   1656 O OD2 . ASP B 2 87  ? 25.457  -106.290 -19.028 1.00 32.45 ? 87   ASP B OD2 1 
ATOM   1657 N N   . GLY B 2 88  ? 26.570  -108.520 -14.887 1.00 24.46 ? 88   GLY B N   1 
ATOM   1658 C CA  . GLY B 2 88  ? 27.188  -108.976 -13.652 1.00 24.28 ? 88   GLY B CA  1 
ATOM   1659 C C   . GLY B 2 88  ? 26.230  -109.814 -12.809 1.00 23.37 ? 88   GLY B C   1 
ATOM   1660 O O   . GLY B 2 88  ? 26.610  -110.300 -11.731 1.00 22.09 ? 88   GLY B O   1 
ATOM   1661 N N   . TRP B 2 89  ? 24.987  -109.947 -13.258 1.00 22.96 ? 89   TRP B N   1 
ATOM   1662 C CA  . TRP B 2 89  ? 24.007  -110.749 -12.511 1.00 24.55 ? 89   TRP B CA  1 
ATOM   1663 C C   . TRP B 2 89  ? 24.552  -112.143 -12.139 1.00 24.66 ? 89   TRP B C   1 
ATOM   1664 O O   . TRP B 2 89  ? 24.417  -112.589 -10.991 1.00 24.84 ? 89   TRP B O   1 
ATOM   1665 C CB  . TRP B 2 89  ? 22.694  -110.896 -13.276 1.00 24.44 ? 89   TRP B CB  1 
ATOM   1666 C CG  . TRP B 2 89  ? 21.763  -111.873 -12.630 1.00 24.10 ? 89   TRP B CG  1 
ATOM   1667 C CD1 . TRP B 2 89  ? 20.871  -111.628 -11.598 1.00 24.38 ? 89   TRP B CD1 1 
ATOM   1668 C CD2 . TRP B 2 89  ? 21.632  -113.254 -12.961 1.00 24.21 ? 89   TRP B CD2 1 
ATOM   1669 N NE1 . TRP B 2 89  ? 20.202  -112.786 -11.282 1.00 24.89 ? 89   TRP B NE1 1 
ATOM   1670 C CE2 . TRP B 2 89  ? 20.661  -113.804 -12.085 1.00 25.53 ? 89   TRP B CE2 1 
ATOM   1671 C CE3 . TRP B 2 89  ? 22.272  -114.095 -13.893 1.00 23.60 ? 89   TRP B CE3 1 
ATOM   1672 C CZ2 . TRP B 2 89  ? 20.281  -115.164 -12.139 1.00 25.80 ? 89   TRP B CZ2 1 
ATOM   1673 C CZ3 . TRP B 2 89  ? 21.895  -115.442 -13.959 1.00 23.86 ? 89   TRP B CZ3 1 
ATOM   1674 C CH2 . TRP B 2 89  ? 20.904  -115.965 -13.068 1.00 23.40 ? 89   TRP B CH2 1 
ATOM   1675 N N   . GLY B 2 90  ? 25.191  -112.809 -13.100 1.00 25.29 ? 90   GLY B N   1 
ATOM   1676 C CA  . GLY B 2 90  ? 25.652  -114.187 -12.883 1.00 24.97 ? 90   GLY B CA  1 
ATOM   1677 C C   . GLY B 2 90  ? 25.703  -115.005 -14.162 1.00 25.75 ? 90   GLY B C   1 
ATOM   1678 O O   . GLY B 2 90  ? 25.726  -114.443 -15.270 1.00 26.15 ? 90   GLY B O   1 
ATOM   1679 N N   . GLY B 2 91  ? 25.681  -116.333 -14.007 1.00 25.24 ? 91   GLY B N   1 
ATOM   1680 C CA  . GLY B 2 91  ? 25.738  -117.258 -15.131 1.00 25.07 ? 91   GLY B CA  1 
ATOM   1681 C C   . GLY B 2 91  ? 27.148  -117.718 -15.498 1.00 26.18 ? 91   GLY B C   1 
ATOM   1682 O O   . GLY B 2 91  ? 27.389  -118.198 -16.632 1.00 26.63 ? 91   GLY B O   1 
ATOM   1683 N N   . TYR B 2 92  ? 28.097  -117.568 -14.578 1.00 25.64 ? 92   TYR B N   1 
ATOM   1684 C CA  . TYR B 2 92  ? 29.499  -117.924 -14.855 1.00 26.44 ? 92   TYR B CA  1 
ATOM   1685 C C   . TYR B 2 92  ? 29.664  -119.431 -14.990 1.00 26.74 ? 92   TYR B C   1 
ATOM   1686 O O   . TYR B 2 92  ? 29.293  -120.170 -14.086 1.00 26.35 ? 92   TYR B O   1 
ATOM   1687 C CB  . TYR B 2 92  ? 30.416  -117.435 -13.734 1.00 26.60 ? 92   TYR B CB  1 
ATOM   1688 C CG  . TYR B 2 92  ? 30.293  -115.951 -13.531 1.00 27.78 ? 92   TYR B CG  1 
ATOM   1689 C CD1 . TYR B 2 92  ? 29.526  -115.432 -12.482 1.00 27.27 ? 92   TYR B CD1 1 
ATOM   1690 C CD2 . TYR B 2 92  ? 30.914  -115.069 -14.408 1.00 27.35 ? 92   TYR B CD2 1 
ATOM   1691 C CE1 . TYR B 2 92  ? 29.390  -114.049 -12.303 1.00 28.64 ? 92   TYR B CE1 1 
ATOM   1692 C CE2 . TYR B 2 92  ? 30.792  -113.694 -14.245 1.00 30.05 ? 92   TYR B CE2 1 
ATOM   1693 C CZ  . TYR B 2 92  ? 30.027  -113.195 -13.185 1.00 30.77 ? 92   TYR B CZ  1 
ATOM   1694 O OH  . TYR B 2 92  ? 29.903  -111.844 -13.039 1.00 30.98 ? 92   TYR B OH  1 
ATOM   1695 N N   . VAL B 2 93  ? 30.244  -119.872 -16.106 1.00 25.87 ? 93   VAL B N   1 
ATOM   1696 C CA  . VAL B 2 93  ? 30.501  -121.287 -16.319 1.00 24.26 ? 93   VAL B CA  1 
ATOM   1697 C C   . VAL B 2 93  ? 31.846  -121.743 -15.738 1.00 24.60 ? 93   VAL B C   1 
ATOM   1698 O O   . VAL B 2 93  ? 32.062  -122.941 -15.553 1.00 24.04 ? 93   VAL B O   1 
ATOM   1699 C CB  . VAL B 2 93  ? 30.396  -121.658 -17.817 1.00 24.91 ? 93   VAL B CB  1 
ATOM   1700 C CG1 . VAL B 2 93  ? 31.640  -121.259 -18.574 1.00 24.82 ? 93   VAL B CG1 1 
ATOM   1701 C CG2 . VAL B 2 93  ? 30.196  -123.171 -17.992 1.00 23.46 ? 93   VAL B CG2 1 
ATOM   1702 N N   . TYR B 2 94  ? 32.747  -120.810 -15.429 1.00 23.89 ? 94   TYR B N   1 
ATOM   1703 C CA  . TYR B 2 94  ? 34.070  -121.239 -14.968 1.00 24.44 ? 94   TYR B CA  1 
ATOM   1704 C C   . TYR B 2 94  ? 34.051  -122.287 -13.848 1.00 23.84 ? 94   TYR B C   1 
ATOM   1705 O O   . TYR B 2 94  ? 34.789  -123.272 -13.940 1.00 24.97 ? 94   TYR B O   1 
ATOM   1706 C CB  . TYR B 2 94  ? 35.000  -120.072 -14.630 1.00 24.49 ? 94   TYR B CB  1 
ATOM   1707 C CG  . TYR B 2 94  ? 36.397  -120.569 -14.347 1.00 26.25 ? 94   TYR B CG  1 
ATOM   1708 C CD1 . TYR B 2 94  ? 37.273  -120.878 -15.395 1.00 26.81 ? 94   TYR B CD1 1 
ATOM   1709 C CD2 . TYR B 2 94  ? 36.817  -120.800 -13.038 1.00 24.94 ? 94   TYR B CD2 1 
ATOM   1710 C CE1 . TYR B 2 94  ? 38.544  -121.353 -15.141 1.00 26.26 ? 94   TYR B CE1 1 
ATOM   1711 C CE2 . TYR B 2 94  ? 38.083  -121.274 -12.768 1.00 26.52 ? 94   TYR B CE2 1 
ATOM   1712 C CZ  . TYR B 2 94  ? 38.936  -121.550 -13.817 1.00 26.29 ? 94   TYR B CZ  1 
ATOM   1713 O OH  . TYR B 2 94  ? 40.175  -122.022 -13.546 1.00 27.31 ? 94   TYR B OH  1 
ATOM   1714 N N   . PRO B 2 95  ? 33.211  -122.103 -12.794 1.00 24.16 ? 95   PRO B N   1 
ATOM   1715 C CA  . PRO B 2 95  ? 33.217  -123.131 -11.734 1.00 23.67 ? 95   PRO B CA  1 
ATOM   1716 C C   . PRO B 2 95  ? 32.879  -124.538 -12.235 1.00 22.84 ? 95   PRO B C   1 
ATOM   1717 O O   . PRO B 2 95  ? 33.423  -125.500 -11.719 1.00 21.14 ? 95   PRO B O   1 
ATOM   1718 C CB  . PRO B 2 95  ? 32.153  -122.617 -10.757 1.00 24.20 ? 95   PRO B CB  1 
ATOM   1719 C CG  . PRO B 2 95  ? 32.213  -121.138 -10.928 1.00 24.85 ? 95   PRO B CG  1 
ATOM   1720 C CD  . PRO B 2 95  ? 32.293  -121.001 -12.429 1.00 23.99 ? 95   PRO B CD  1 
ATOM   1721 N N   . TRP B 2 96  ? 32.014  -124.633 -13.253 1.00 22.31 ? 96   TRP B N   1 
ATOM   1722 C CA  . TRP B 2 96  ? 31.654  -125.902 -13.908 1.00 22.57 ? 96   TRP B CA  1 
ATOM   1723 C C   . TRP B 2 96  ? 32.834  -126.497 -14.663 1.00 22.66 ? 96   TRP B C   1 
ATOM   1724 O O   . TRP B 2 96  ? 33.109  -127.682 -14.551 1.00 22.18 ? 96   TRP B O   1 
ATOM   1725 C CB  . TRP B 2 96  ? 30.470  -125.687 -14.896 1.00 21.99 ? 96   TRP B CB  1 
ATOM   1726 C CG  . TRP B 2 96  ? 29.186  -125.422 -14.170 1.00 22.58 ? 96   TRP B CG  1 
ATOM   1727 C CD1 . TRP B 2 96  ? 28.696  -124.194 -13.784 1.00 23.92 ? 96   TRP B CD1 1 
ATOM   1728 C CD2 . TRP B 2 96  ? 28.239  -126.393 -13.720 1.00 22.71 ? 96   TRP B CD2 1 
ATOM   1729 N NE1 . TRP B 2 96  ? 27.512  -124.343 -13.103 1.00 23.87 ? 96   TRP B NE1 1 
ATOM   1730 C CE2 . TRP B 2 96  ? 27.196  -125.681 -13.055 1.00 23.02 ? 96   TRP B CE2 1 
ATOM   1731 C CE3 . TRP B 2 96  ? 28.176  -127.805 -13.783 1.00 22.67 ? 96   TRP B CE3 1 
ATOM   1732 C CZ2 . TRP B 2 96  ? 26.089  -126.332 -12.480 1.00 23.17 ? 96   TRP B CZ2 1 
ATOM   1733 C CZ3 . TRP B 2 96  ? 27.072  -128.460 -13.189 1.00 22.94 ? 96   TRP B CZ3 1 
ATOM   1734 C CH2 . TRP B 2 96  ? 26.048  -127.722 -12.542 1.00 22.28 ? 96   TRP B CH2 1 
ATOM   1735 N N   . ILE B 2 97  ? 33.509  -125.671 -15.466 1.00 23.01 ? 97   ILE B N   1 
ATOM   1736 C CA  . ILE B 2 97  ? 34.687  -126.155 -16.234 1.00 22.97 ? 97   ILE B CA  1 
ATOM   1737 C C   . ILE B 2 97  ? 35.741  -126.610 -15.266 1.00 23.28 ? 97   ILE B C   1 
ATOM   1738 O O   . ILE B 2 97  ? 36.353  -127.695 -15.424 1.00 23.92 ? 97   ILE B O   1 
ATOM   1739 C CB  . ILE B 2 97  ? 35.268  -125.070 -17.163 1.00 22.95 ? 97   ILE B CB  1 
ATOM   1740 C CG1 . ILE B 2 97  ? 34.158  -124.430 -18.031 1.00 23.50 ? 97   ILE B CG1 1 
ATOM   1741 C CG2 . ILE B 2 97  ? 36.419  -125.635 -18.014 1.00 23.99 ? 97   ILE B CG2 1 
ATOM   1742 C CD1 . ILE B 2 97  ? 33.264  -125.423 -18.834 1.00 25.13 ? 97   ILE B CD1 1 
ATOM   1743 N N   . GLU B 2 98  ? 35.958  -125.797 -14.235 1.00 23.25 ? 98   GLU B N   1 
ATOM   1744 C CA  . GLU B 2 98  ? 37.004  -126.106 -13.284 1.00 23.50 ? 98   GLU B CA  1 
ATOM   1745 C C   . GLU B 2 98  ? 36.724  -127.442 -12.617 1.00 22.82 ? 98   GLU B C   1 
ATOM   1746 O O   . GLU B 2 98  ? 37.625  -128.280 -12.485 1.00 21.92 ? 98   GLU B O   1 
ATOM   1747 C CB  . GLU B 2 98  ? 37.121  -125.008 -12.230 1.00 23.99 ? 98   GLU B CB  1 
ATOM   1748 C CG  . GLU B 2 98  ? 38.438  -125.042 -11.505 1.00 28.38 ? 98   GLU B CG  1 
ATOM   1749 C CD  . GLU B 2 98  ? 38.329  -124.499 -10.116 1.00 34.66 ? 98   GLU B CD  1 
ATOM   1750 O OE1 . GLU B 2 98  ? 39.206  -123.694 -9.710  1.00 38.44 ? 98   GLU B OE1 1 
ATOM   1751 O OE2 . GLU B 2 98  ? 37.365  -124.887 -9.418  1.00 38.20 ? 98   GLU B OE2 1 
ATOM   1752 N N   . ALA B 2 99  ? 35.476  -127.632 -12.187 1.00 22.80 ? 99   ALA B N   1 
ATOM   1753 C CA  . ALA B 2 99  ? 35.087  -128.870 -11.509 1.00 23.83 ? 99   ALA B CA  1 
ATOM   1754 C C   . ALA B 2 99  ? 35.163  -130.096 -12.441 1.00 23.98 ? 99   ALA B C   1 
ATOM   1755 O O   . ALA B 2 99  ? 35.696  -131.133 -12.046 1.00 24.19 ? 99   ALA B O   1 
ATOM   1756 C CB  . ALA B 2 99  ? 33.711  -128.734 -10.829 1.00 23.85 ? 99   ALA B CB  1 
ATOM   1757 N N   . MET B 2 100 ? 34.659  -129.962 -13.667 1.00 24.04 ? 100  MET B N   1 
ATOM   1758 C CA  . MET B 2 100 ? 34.770  -131.009 -14.701 1.00 25.44 ? 100  MET B CA  1 
ATOM   1759 C C   . MET B 2 100 ? 36.218  -131.335 -15.151 1.00 25.03 ? 100  MET B C   1 
ATOM   1760 O O   . MET B 2 100 ? 36.538  -132.497 -15.464 1.00 24.94 ? 100  MET B O   1 
ATOM   1761 C CB  . MET B 2 100 ? 33.911  -130.662 -15.927 1.00 24.35 ? 100  MET B CB  1 
ATOM   1762 C CG  . MET B 2 100 ? 32.407  -130.707 -15.633 1.00 25.70 ? 100  MET B CG  1 
ATOM   1763 S SD  . MET B 2 100 ? 31.383  -130.465 -17.094 1.00 27.43 ? 100  MET B SD  1 
ATOM   1764 C CE  . MET B 2 100 ? 31.831  -128.796 -17.579 1.00 27.24 ? 100  MET B CE  1 
ATOM   1765 N N   . SER B 2 101 ? 37.079  -130.315 -15.156 1.00 24.89 ? 101  SER B N   1 
ATOM   1766 C CA  . SER B 2 101 ? 38.450  -130.442 -15.676 1.00 24.69 ? 101  SER B CA  1 
ATOM   1767 C C   . SER B 2 101 ? 39.225  -131.593 -15.019 1.00 25.68 ? 101  SER B C   1 
ATOM   1768 O O   . SER B 2 101 ? 40.009  -132.271 -15.685 1.00 25.98 ? 101  SER B O   1 
ATOM   1769 C CB  . SER B 2 101 ? 39.213  -129.134 -15.486 1.00 24.41 ? 101  SER B CB  1 
ATOM   1770 O OG  . SER B 2 101 ? 39.556  -128.962 -14.110 1.00 24.94 ? 101  SER B OG  1 
ATOM   1771 N N   . SER B 2 102 ? 39.008  -131.810 -13.724 1.00 25.79 ? 102  SER B N   1 
ATOM   1772 C CA  . SER B 2 102 ? 39.692  -132.900 -13.026 1.00 26.77 ? 102  SER B CA  1 
ATOM   1773 C C   . SER B 2 102 ? 38.879  -134.194 -12.949 1.00 26.34 ? 102  SER B C   1 
ATOM   1774 O O   . SER B 2 102 ? 39.403  -135.229 -12.542 1.00 26.78 ? 102  SER B O   1 
ATOM   1775 C CB  . SER B 2 102 ? 40.177  -132.471 -11.633 1.00 26.81 ? 102  SER B CB  1 
ATOM   1776 O OG  . SER B 2 102 ? 39.129  -131.919 -10.861 1.00 28.80 ? 102  SER B OG  1 
ATOM   1777 N N   . SER B 2 103 ? 37.611  -134.149 -13.359 1.00 25.23 ? 103  SER B N   1 
ATOM   1778 C CA  . SER B 2 103 ? 36.773  -135.336 -13.255 1.00 25.57 ? 103  SER B CA  1 
ATOM   1779 C C   . SER B 2 103 ? 36.287  -135.919 -14.570 1.00 24.54 ? 103  SER B C   1 
ATOM   1780 O O   . SER B 2 103 ? 36.319  -137.131 -14.751 1.00 26.66 ? 103  SER B O   1 
ATOM   1781 C CB  . SER B 2 103 ? 35.595  -135.077 -12.302 1.00 25.29 ? 103  SER B CB  1 
ATOM   1782 O OG  . SER B 2 103 ? 36.070  -134.923 -10.958 1.00 26.09 ? 103  SER B OG  1 
ATOM   1783 N N   . TYR B 2 104 ? 35.834  -135.072 -15.489 1.00 25.53 ? 104  TYR B N   1 
ATOM   1784 C CA  . TYR B 2 104 ? 35.182  -135.551 -16.700 1.00 23.80 ? 104  TYR B CA  1 
ATOM   1785 C C   . TYR B 2 104 ? 36.214  -135.600 -17.813 1.00 25.76 ? 104  TYR B C   1 
ATOM   1786 O O   . TYR B 2 104 ? 36.064  -134.994 -18.891 1.00 23.05 ? 104  TYR B O   1 
ATOM   1787 C CB  . TYR B 2 104 ? 34.033  -134.635 -17.058 1.00 24.42 ? 104  TYR B CB  1 
ATOM   1788 C CG  . TYR B 2 104 ? 32.791  -134.855 -16.232 1.00 22.77 ? 104  TYR B CG  1 
ATOM   1789 C CD1 . TYR B 2 104 ? 31.710  -134.014 -16.408 1.00 23.98 ? 104  TYR B CD1 1 
ATOM   1790 C CD2 . TYR B 2 104 ? 32.681  -135.908 -15.297 1.00 23.80 ? 104  TYR B CD2 1 
ATOM   1791 C CE1 . TYR B 2 104 ? 30.565  -134.193 -15.707 1.00 22.11 ? 104  TYR B CE1 1 
ATOM   1792 C CE2 . TYR B 2 104 ? 31.495  -136.098 -14.574 1.00 20.85 ? 104  TYR B CE2 1 
ATOM   1793 C CZ  . TYR B 2 104 ? 30.452  -135.212 -14.807 1.00 22.45 ? 104  TYR B CZ  1 
ATOM   1794 O OH  . TYR B 2 104 ? 29.247  -135.304 -14.175 1.00 21.71 ? 104  TYR B OH  1 
ATOM   1795 N N   . THR B 2 105 ? 37.274  -136.340 -17.554 1.00 24.75 ? 105  THR B N   1 
ATOM   1796 C CA  . THR B 2 105 ? 38.487  -136.241 -18.405 1.00 27.09 ? 105  THR B CA  1 
ATOM   1797 C C   . THR B 2 105 ? 38.131  -136.768 -19.850 1.00 24.58 ? 105  THR B C   1 
ATOM   1798 O O   . THR B 2 105 ? 38.661  -136.306 -20.849 1.00 24.13 ? 105  THR B O   1 
ATOM   1799 C CB  . THR B 2 105 ? 39.581  -137.201 -17.897 1.00 26.34 ? 105  THR B CB  1 
ATOM   1800 O OG1 . THR B 2 105 ? 39.033  -138.508 -17.808 1.00 34.15 ? 105  THR B OG1 1 
ATOM   1801 C CG2 . THR B 2 105 ? 40.077  -136.784 -16.479 1.00 30.56 ? 105  THR B CG2 1 
ATOM   1802 N N   . TRP B 2 106 ? 37.249  -137.860 -19.974 1.00 24.74 ? 106  TRP B N   1 
ATOM   1803 C CA  . TRP B 2 106 ? 36.768  -138.301 -21.274 1.00 27.10 ? 106  TRP B CA  1 
ATOM   1804 C C   . TRP B 2 106 ? 35.645  -137.401 -21.861 1.00 24.38 ? 106  TRP B C   1 
ATOM   1805 O O   . TRP B 2 106 ? 34.961  -137.783 -22.794 1.00 26.37 ? 106  TRP B O   1 
ATOM   1806 C CB  . TRP B 2 106 ? 36.288  -139.745 -21.166 1.00 27.48 ? 106  TRP B CB  1 
ATOM   1807 C CG  . TRP B 2 106 ? 37.414  -140.656 -21.187 1.00 32.63 ? 106  TRP B CG  1 
ATOM   1808 C CD1 . TRP B 2 106 ? 38.353  -140.825 -20.217 1.00 32.91 ? 106  TRP B CD1 1 
ATOM   1809 C CD2 . TRP B 2 106 ? 37.771  -141.516 -22.265 1.00 33.84 ? 106  TRP B CD2 1 
ATOM   1810 N NE1 . TRP B 2 106 ? 39.276  -141.763 -20.615 1.00 35.69 ? 106  TRP B NE1 1 
ATOM   1811 C CE2 . TRP B 2 106 ? 38.940  -142.198 -21.880 1.00 35.80 ? 106  TRP B CE2 1 
ATOM   1812 C CE3 . TRP B 2 106 ? 37.206  -141.781 -23.530 1.00 35.26 ? 106  TRP B CE3 1 
ATOM   1813 C CZ2 . TRP B 2 106 ? 39.557  -143.140 -22.707 1.00 32.05 ? 106  TRP B CZ2 1 
ATOM   1814 C CZ3 . TRP B 2 106 ? 37.819  -142.714 -24.349 1.00 33.33 ? 106  TRP B CZ3 1 
ATOM   1815 C CH2 . TRP B 2 106 ? 38.990  -143.373 -23.934 1.00 31.88 ? 106  TRP B CH2 1 
ATOM   1816 N N   . LEU B 2 107 ? 35.455  -136.203 -21.322 1.00 25.03 ? 107  LEU B N   1 
ATOM   1817 C CA  . LEU B 2 107 ? 34.356  -135.299 -21.780 1.00 21.72 ? 107  LEU B CA  1 
ATOM   1818 C C   . LEU B 2 107 ? 34.403  -134.889 -23.293 1.00 21.57 ? 107  LEU B C   1 
ATOM   1819 O O   . LEU B 2 107 ? 35.464  -134.539 -23.794 1.00 21.04 ? 107  LEU B O   1 
ATOM   1820 C CB  . LEU B 2 107 ? 34.341  -134.014 -20.959 1.00 22.92 ? 107  LEU B CB  1 
ATOM   1821 C CG  . LEU B 2 107 ? 33.160  -133.013 -21.198 1.00 21.39 ? 107  LEU B CG  1 
ATOM   1822 C CD1 . LEU B 2 107 ? 31.812  -133.594 -20.683 1.00 23.13 ? 107  LEU B CD1 1 
ATOM   1823 C CD2 . LEU B 2 107 ? 33.358  -131.682 -20.497 1.00 22.59 ? 107  LEU B CD2 1 
ATOM   1824 N N   . GLU B 2 108 ? 33.242  -134.843 -23.994 1.00 20.28 ? 108  GLU B N   1 
ATOM   1825 C CA  . GLU B 2 108 ? 33.260  -134.669 -25.446 1.00 19.69 ? 108  GLU B CA  1 
ATOM   1826 C C   . GLU B 2 108 ? 32.451  -133.456 -25.930 1.00 19.00 ? 108  GLU B C   1 
ATOM   1827 O O   . GLU B 2 108 ? 32.715  -132.948 -27.005 1.00 19.60 ? 108  GLU B O   1 
ATOM   1828 C CB  . GLU B 2 108 ? 32.702  -135.899 -26.166 1.00 19.15 ? 108  GLU B CB  1 
ATOM   1829 C CG  . GLU B 2 108 ? 33.552  -137.156 -26.015 1.00 21.77 ? 108  GLU B CG  1 
ATOM   1830 C CD  . GLU B 2 108 ? 32.951  -138.320 -26.767 1.00 24.74 ? 108  GLU B CD  1 
ATOM   1831 O OE1 . GLU B 2 108 ? 31.838  -138.169 -27.326 1.00 29.37 ? 108  GLU B OE1 1 
ATOM   1832 O OE2 . GLU B 2 108 ? 33.587  -139.377 -26.780 1.00 30.25 ? 108  GLU B OE2 1 
ATOM   1833 N N   . GLU B 2 109 ? 31.436  -133.074 -25.170 1.00 19.83 ? 109  GLU B N   1 
ATOM   1834 C CA  . GLU B 2 109 ? 30.478  -132.017 -25.623 1.00 20.71 ? 109  GLU B CA  1 
ATOM   1835 C C   . GLU B 2 109 ? 30.111  -131.060 -24.504 1.00 21.59 ? 109  GLU B C   1 
ATOM   1836 O O   . GLU B 2 109 ? 29.762  -131.485 -23.402 1.00 22.30 ? 109  GLU B O   1 
ATOM   1837 C CB  . GLU B 2 109 ? 29.200  -132.670 -26.177 1.00 21.18 ? 109  GLU B CB  1 
ATOM   1838 C CG  . GLU B 2 109 ? 29.466  -133.878 -27.117 1.00 22.14 ? 109  GLU B CG  1 
ATOM   1839 C CD  . GLU B 2 109 ? 28.216  -134.335 -27.866 1.00 24.20 ? 109  GLU B CD  1 
ATOM   1840 O OE1 . GLU B 2 109 ? 27.133  -133.769 -27.647 1.00 27.09 ? 109  GLU B OE1 1 
ATOM   1841 O OE2 . GLU B 2 109 ? 28.307  -135.260 -28.668 1.00 27.63 ? 109  GLU B OE2 1 
ATOM   1842 N N   . ILE B 2 110 ? 30.147  -129.755 -24.800 1.00 22.34 ? 110  ILE B N   1 
ATOM   1843 C CA  . ILE B 2 110 ? 29.723  -128.719 -23.880 1.00 22.51 ? 110  ILE B CA  1 
ATOM   1844 C C   . ILE B 2 110 ? 28.826  -127.819 -24.698 1.00 22.99 ? 110  ILE B C   1 
ATOM   1845 O O   . ILE B 2 110 ? 29.250  -127.321 -25.753 1.00 21.91 ? 110  ILE B O   1 
ATOM   1846 C CB  . ILE B 2 110 ? 30.931  -127.912 -23.324 1.00 23.32 ? 110  ILE B CB  1 
ATOM   1847 C CG1 . ILE B 2 110 ? 31.728  -128.788 -22.330 1.00 20.31 ? 110  ILE B CG1 1 
ATOM   1848 C CG2 . ILE B 2 110 ? 30.438  -126.644 -22.623 1.00 24.15 ? 110  ILE B CG2 1 
ATOM   1849 C CD1 . ILE B 2 110 ? 33.041  -128.210 -21.871 1.00 22.98 ? 110  ILE B CD1 1 
ATOM   1850 N N   . ARG B 2 111 ? 27.577  -127.692 -24.256 1.00 22.45 ? 111  ARG B N   1 
ATOM   1851 C CA  . ARG B 2 111 ? 26.606  -126.800 -24.891 1.00 23.62 ? 111  ARG B CA  1 
ATOM   1852 C C   . ARG B 2 111 ? 26.139  -125.829 -23.859 1.00 23.41 ? 111  ARG B C   1 
ATOM   1853 O O   . ARG B 2 111 ? 25.539  -126.239 -22.852 1.00 24.18 ? 111  ARG B O   1 
ATOM   1854 C CB  . ARG B 2 111 ? 25.406  -127.599 -25.405 1.00 23.64 ? 111  ARG B CB  1 
ATOM   1855 C CG  . ARG B 2 111 ? 25.780  -128.507 -26.602 1.00 27.09 ? 111  ARG B CG  1 
ATOM   1856 C CD  . ARG B 2 111 ? 24.703  -129.527 -26.865 1.00 32.41 ? 111  ARG B CD  1 
ATOM   1857 N NE  . ARG B 2 111 ? 25.237  -130.704 -27.571 1.00 37.34 ? 111  ARG B NE  1 
ATOM   1858 C CZ  . ARG B 2 111 ? 25.249  -130.747 -28.883 1.00 35.68 ? 111  ARG B CZ  1 
ATOM   1859 N NH1 . ARG B 2 111 ? 24.790  -129.685 -29.505 1.00 35.62 ? 111  ARG B NH1 1 
ATOM   1860 N NH2 . ARG B 2 111 ? 25.703  -131.798 -29.554 1.00 30.71 ? 111  ARG B NH2 1 
ATOM   1861 N N   . LEU B 2 112 ? 26.354  -124.531 -24.110 1.00 23.24 ? 112  LEU B N   1 
ATOM   1862 C CA  . LEU B 2 112 ? 26.033  -123.524 -23.101 1.00 22.06 ? 112  LEU B CA  1 
ATOM   1863 C C   . LEU B 2 112 ? 25.089  -122.487 -23.697 1.00 22.94 ? 112  LEU B C   1 
ATOM   1864 O O   . LEU B 2 112 ? 25.185  -122.190 -24.901 1.00 23.24 ? 112  LEU B O   1 
ATOM   1865 C CB  . LEU B 2 112 ? 27.324  -122.785 -22.684 1.00 23.20 ? 112  LEU B CB  1 
ATOM   1866 C CG  . LEU B 2 112 ? 28.506  -123.614 -22.171 1.00 22.62 ? 112  LEU B CG  1 
ATOM   1867 C CD1 . LEU B 2 112 ? 29.641  -122.696 -21.752 1.00 22.78 ? 112  LEU B CD1 1 
ATOM   1868 C CD2 . LEU B 2 112 ? 28.031  -124.459 -20.981 1.00 22.59 ? 112  LEU B CD2 1 
ATOM   1869 N N   . LYS B 2 113 ? 24.173  -121.978 -22.883 1.00 22.32 ? 113  LYS B N   1 
ATOM   1870 C CA  . LYS B 2 113 ? 23.263  -120.941 -23.377 1.00 22.80 ? 113  LYS B CA  1 
ATOM   1871 C C   . LYS B 2 113 ? 23.130  -119.884 -22.327 1.00 22.79 ? 113  LYS B C   1 
ATOM   1872 O O   . LYS B 2 113 ? 22.834  -120.185 -21.155 1.00 23.23 ? 113  LYS B O   1 
ATOM   1873 C CB  . LYS B 2 113 ? 21.873  -121.511 -23.704 1.00 22.17 ? 113  LYS B CB  1 
ATOM   1874 C CG  . LYS B 2 113 ? 20.989  -120.449 -24.454 1.00 23.46 ? 113  LYS B CG  1 
ATOM   1875 C CD  . LYS B 2 113 ? 19.607  -121.054 -24.809 1.00 24.04 ? 113  LYS B CD  1 
ATOM   1876 C CE  . LYS B 2 113 ? 18.779  -120.037 -25.541 1.00 22.69 ? 113  LYS B CE  1 
ATOM   1877 N NZ  . LYS B 2 113 ? 17.447  -120.624 -25.829 1.00 27.92 ? 113  LYS B NZ  1 
ATOM   1878 N N   . ARG B 2 114 ? 23.268  -118.632 -22.755 1.00 23.38 ? 114  ARG B N   1 
ATOM   1879 C CA  . ARG B 2 114 ? 23.228  -117.495 -21.839 1.00 24.41 ? 114  ARG B CA  1 
ATOM   1880 C C   . ARG B 2 114 ? 24.128  -117.635 -20.622 1.00 23.88 ? 114  ARG B C   1 
ATOM   1881 O O   . ARG B 2 114 ? 23.710  -117.339 -19.493 1.00 24.76 ? 114  ARG B O   1 
ATOM   1882 C CB  . ARG B 2 114 ? 21.771  -117.130 -21.449 1.00 25.06 ? 114  ARG B CB  1 
ATOM   1883 C CG  . ARG B 2 114 ? 20.909  -116.734 -22.648 1.00 23.99 ? 114  ARG B CG  1 
ATOM   1884 C CD  . ARG B 2 114 ? 19.466  -116.275 -22.197 1.00 25.03 ? 114  ARG B CD  1 
ATOM   1885 N NE  . ARG B 2 114 ? 18.612  -116.021 -23.358 1.00 25.94 ? 114  ARG B NE  1 
ATOM   1886 C CZ  . ARG B 2 114 ? 17.629  -116.837 -23.750 1.00 26.35 ? 114  ARG B CZ  1 
ATOM   1887 N NH1 . ARG B 2 114 ? 17.374  -117.936 -23.071 1.00 27.66 ? 114  ARG B NH1 1 
ATOM   1888 N NH2 . ARG B 2 114 ? 16.889  -116.517 -24.811 1.00 30.81 ? 114  ARG B NH2 1 
ATOM   1889 N N   . MET B 2 115 ? 25.368  -118.083 -20.848 1.00 23.20 ? 115  MET B N   1 
ATOM   1890 C CA  . MET B 2 115 ? 26.348  -118.151 -19.772 1.00 23.44 ? 115  MET B CA  1 
ATOM   1891 C C   . MET B 2 115 ? 27.416  -117.107 -20.049 1.00 23.00 ? 115  MET B C   1 
ATOM   1892 O O   . MET B 2 115 ? 27.585  -116.641 -21.201 1.00 22.39 ? 115  MET B O   1 
ATOM   1893 C CB  . MET B 2 115 ? 27.065  -119.503 -19.680 1.00 23.30 ? 115  MET B CB  1 
ATOM   1894 C CG  . MET B 2 115 ? 26.193  -120.802 -19.589 1.00 28.55 ? 115  MET B CG  1 
ATOM   1895 S SD  . MET B 2 115 ? 25.513  -121.152 -17.992 1.00 36.50 ? 115  MET B SD  1 
ATOM   1896 C CE  . MET B 2 115 ? 26.907  -121.437 -16.874 1.00 29.73 ? 115  MET B CE  1 
ATOM   1897 N N   . VAL B 2 116 ? 28.150  -116.771 -18.997 1.00 22.25 ? 116  VAL B N   1 
ATOM   1898 C CA  . VAL B 2 116 ? 29.350  -115.959 -19.134 1.00 22.89 ? 116  VAL B CA  1 
ATOM   1899 C C   . VAL B 2 116 ? 30.503  -116.949 -19.247 1.00 22.71 ? 116  VAL B C   1 
ATOM   1900 O O   . VAL B 2 116 ? 30.715  -117.765 -18.345 1.00 22.39 ? 116  VAL B O   1 
ATOM   1901 C CB  . VAL B 2 116 ? 29.519  -115.038 -17.925 1.00 23.07 ? 116  VAL B CB  1 
ATOM   1902 C CG1 . VAL B 2 116 ? 30.870  -114.263 -17.976 1.00 23.66 ? 116  VAL B CG1 1 
ATOM   1903 C CG2 . VAL B 2 116 ? 28.327  -114.074 -17.828 1.00 24.06 ? 116  VAL B CG2 1 
ATOM   1904 N N   . VAL B 2 117 ? 31.197  -116.892 -20.378 1.00 22.48 ? 117  VAL B N   1 
ATOM   1905 C CA  . VAL B 2 117 ? 32.266  -117.822 -20.739 1.00 23.35 ? 117  VAL B CA  1 
ATOM   1906 C C   . VAL B 2 117 ? 33.498  -116.950 -21.020 1.00 24.05 ? 117  VAL B C   1 
ATOM   1907 O O   . VAL B 2 117 ? 33.433  -116.014 -21.833 1.00 23.76 ? 117  VAL B O   1 
ATOM   1908 C CB  . VAL B 2 117 ? 31.901  -118.617 -22.043 1.00 23.64 ? 117  VAL B CB  1 
ATOM   1909 C CG1 . VAL B 2 117 ? 32.979  -119.703 -22.381 1.00 24.33 ? 117  VAL B CG1 1 
ATOM   1910 C CG2 . VAL B 2 117 ? 30.506  -119.301 -21.908 1.00 24.44 ? 117  VAL B CG2 1 
ATOM   1911 N N   . THR B 2 118 ? 34.616  -117.259 -20.369 1.00 24.20 ? 118  THR B N   1 
ATOM   1912 C CA  . THR B 2 118 ? 35.821  -116.424 -20.504 1.00 24.05 ? 118  THR B CA  1 
ATOM   1913 C C   . THR B 2 118 ? 36.910  -117.153 -21.275 1.00 23.82 ? 118  THR B C   1 
ATOM   1914 O O   . THR B 2 118 ? 36.783  -118.346 -21.573 1.00 22.72 ? 118  THR B O   1 
ATOM   1915 C CB  . THR B 2 118 ? 36.384  -116.019 -19.139 1.00 23.92 ? 118  THR B CB  1 
ATOM   1916 O OG1 . THR B 2 118 ? 36.790  -117.194 -18.437 1.00 24.56 ? 118  THR B OG1 1 
ATOM   1917 C CG2 . THR B 2 118 ? 35.348  -115.285 -18.305 1.00 25.18 ? 118  THR B CG2 1 
ATOM   1918 N N   . ASP B 2 119 ? 37.986  -116.439 -21.596 1.00 23.74 ? 119  ASP B N   1 
ATOM   1919 C CA  . ASP B 2 119 ? 39.122  -117.077 -22.255 1.00 24.38 ? 119  ASP B CA  1 
ATOM   1920 C C   . ASP B 2 119 ? 39.737  -118.147 -21.362 1.00 24.43 ? 119  ASP B C   1 
ATOM   1921 O O   . ASP B 2 119 ? 40.128  -119.203 -21.858 1.00 25.11 ? 119  ASP B O   1 
ATOM   1922 C CB  . ASP B 2 119 ? 40.164  -116.049 -22.727 1.00 24.57 ? 119  ASP B CB  1 
ATOM   1923 C CG  . ASP B 2 119 ? 39.671  -115.236 -23.921 1.00 25.21 ? 119  ASP B CG  1 
ATOM   1924 O OD1 . ASP B 2 119 ? 38.726  -115.690 -24.615 1.00 24.07 ? 119  ASP B OD1 1 
ATOM   1925 O OD2 . ASP B 2 119 ? 40.202  -114.131 -24.140 1.00 26.90 ? 119  ASP B OD2 1 
ATOM   1926 N N   . ASP B 2 120 ? 39.764  -117.902 -20.055 1.00 24.33 ? 120  ASP B N   1 
ATOM   1927 C CA  . ASP B 2 120 ? 40.228  -118.918 -19.091 1.00 24.88 ? 120  ASP B CA  1 
ATOM   1928 C C   . ASP B 2 120 ? 39.416  -120.203 -19.168 1.00 23.72 ? 120  ASP B C   1 
ATOM   1929 O O   . ASP B 2 120 ? 39.985  -121.284 -19.059 1.00 22.48 ? 120  ASP B O   1 
ATOM   1930 C CB  . ASP B 2 120 ? 40.205  -118.405 -17.647 1.00 25.22 ? 120  ASP B CB  1 
ATOM   1931 C CG  . ASP B 2 120 ? 41.403  -117.536 -17.319 1.00 27.82 ? 120  ASP B CG  1 
ATOM   1932 O OD1 . ASP B 2 120 ? 42.338  -117.431 -18.162 1.00 30.69 ? 120  ASP B OD1 1 
ATOM   1933 O OD2 . ASP B 2 120 ? 41.414  -116.969 -16.205 1.00 28.56 ? 120  ASP B OD2 1 
ATOM   1934 N N   . CYS B 2 121 ? 38.091  -120.080 -19.308 1.00 23.69 ? 121  CYS B N   1 
ATOM   1935 C CA  . CYS B 2 121 ? 37.216  -121.260 -19.514 1.00 23.28 ? 121  CYS B CA  1 
ATOM   1936 C C   . CYS B 2 121 ? 37.655  -122.010 -20.773 1.00 23.38 ? 121  CYS B C   1 
ATOM   1937 O O   . CYS B 2 121 ? 37.746  -123.248 -20.783 1.00 23.48 ? 121  CYS B O   1 
ATOM   1938 C CB  . CYS B 2 121 ? 35.734  -120.851 -19.704 1.00 22.50 ? 121  CYS B CB  1 
ATOM   1939 S SG  . CYS B 2 121 ? 34.973  -120.030 -18.298 1.00 25.68 ? 121  CYS B SG  1 
ATOM   1940 N N   . LEU B 2 122 ? 37.859  -121.267 -21.860 1.00 22.93 ? 122  LEU B N   1 
ATOM   1941 C CA  . LEU B 2 122 ? 38.137  -121.899 -23.153 1.00 23.23 ? 122  LEU B CA  1 
ATOM   1942 C C   . LEU B 2 122 ? 39.528  -122.580 -23.144 1.00 24.16 ? 122  LEU B C   1 
ATOM   1943 O O   . LEU B 2 122 ? 39.695  -123.706 -23.619 1.00 24.14 ? 122  LEU B O   1 
ATOM   1944 C CB  . LEU B 2 122 ? 37.989  -120.884 -24.294 1.00 23.01 ? 122  LEU B CB  1 
ATOM   1945 C CG  . LEU B 2 122 ? 36.537  -120.454 -24.510 1.00 24.48 ? 122  LEU B CG  1 
ATOM   1946 C CD1 . LEU B 2 122 ? 36.388  -119.374 -25.583 1.00 24.42 ? 122  LEU B CD1 1 
ATOM   1947 C CD2 . LEU B 2 122 ? 35.716  -121.712 -24.868 1.00 22.18 ? 122  LEU B CD2 1 
ATOM   1948 N N   . GLU B 2 123 ? 40.507  -121.911 -22.574 1.00 23.84 ? 123  GLU B N   1 
ATOM   1949 C CA  . GLU B 2 123 ? 41.819  -122.520 -22.393 1.00 25.35 ? 123  GLU B CA  1 
ATOM   1950 C C   . GLU B 2 123 ? 41.806  -123.790 -21.530 1.00 25.05 ? 123  GLU B C   1 
ATOM   1951 O O   . GLU B 2 123 ? 42.526  -124.758 -21.824 1.00 24.10 ? 123  GLU B O   1 
ATOM   1952 C CB  . GLU B 2 123 ? 42.760  -121.484 -21.795 1.00 26.05 ? 123  GLU B CB  1 
ATOM   1953 C CG  . GLU B 2 123 ? 42.814  -120.295 -22.699 1.00 30.31 ? 123  GLU B CG  1 
ATOM   1954 C CD  . GLU B 2 123 ? 44.129  -119.639 -22.667 1.00 36.21 ? 123  GLU B CD  1 
ATOM   1955 O OE1 . GLU B 2 123 ? 44.457  -119.060 -21.608 1.00 39.76 ? 123  GLU B OE1 1 
ATOM   1956 O OE2 . GLU B 2 123 ? 44.836  -119.709 -23.698 1.00 39.19 ? 123  GLU B OE2 1 
ATOM   1957 N N   . LEU B 2 124 ? 40.998  -123.785 -20.473 1.00 23.97 ? 124  LEU B N   1 
ATOM   1958 C CA  . LEU B 2 124 ? 40.897  -124.942 -19.559 1.00 24.33 ? 124  LEU B CA  1 
ATOM   1959 C C   . LEU B 2 124 ? 40.219  -126.120 -20.262 1.00 24.30 ? 124  LEU B C   1 
ATOM   1960 O O   . LEU B 2 124 ? 40.593  -127.272 -20.036 1.00 24.38 ? 124  LEU B O   1 
ATOM   1961 C CB  . LEU B 2 124 ? 40.076  -124.614 -18.296 1.00 23.92 ? 124  LEU B CB  1 
ATOM   1962 C CG  . LEU B 2 124 ? 40.547  -125.105 -16.934 1.00 25.01 ? 124  LEU B CG  1 
ATOM   1963 C CD1 . LEU B 2 124 ? 39.413  -125.308 -15.910 1.00 25.99 ? 124  LEU B CD1 1 
ATOM   1964 C CD2 . LEU B 2 124 ? 41.619  -126.264 -16.896 1.00 25.18 ? 124  LEU B CD2 1 
ATOM   1965 N N   . ILE B 2 125 ? 39.212  -125.826 -21.082 1.00 24.06 ? 125  ILE B N   1 
ATOM   1966 C CA  . ILE B 2 125 ? 38.535  -126.835 -21.911 1.00 23.55 ? 125  ILE B CA  1 
ATOM   1967 C C   . ILE B 2 125 ? 39.544  -127.522 -22.851 1.00 24.20 ? 125  ILE B C   1 
ATOM   1968 O O   . ILE B 2 125 ? 39.630  -128.760 -22.890 1.00 24.43 ? 125  ILE B O   1 
ATOM   1969 C CB  . ILE B 2 125 ? 37.356  -126.211 -22.736 1.00 24.43 ? 125  ILE B CB  1 
ATOM   1970 C CG1 . ILE B 2 125 ? 36.113  -125.949 -21.847 1.00 23.72 ? 125  ILE B CG1 1 
ATOM   1971 C CG2 . ILE B 2 125 ? 36.922  -127.111 -23.909 1.00 22.84 ? 125  ILE B CG2 1 
ATOM   1972 C CD1 . ILE B 2 125 ? 35.148  -124.923 -22.459 1.00 22.81 ? 125  ILE B CD1 1 
ATOM   1973 N N   . ALA B 2 126 ? 40.324  -126.717 -23.573 1.00 24.52 ? 126  ALA B N   1 
ATOM   1974 C CA  . ALA B 2 126 ? 41.273  -127.223 -24.561 1.00 24.48 ? 126  ALA B CA  1 
ATOM   1975 C C   . ALA B 2 126 ? 42.273  -128.143 -23.881 1.00 25.52 ? 126  ALA B C   1 
ATOM   1976 O O   . ALA B 2 126 ? 42.609  -129.229 -24.376 1.00 26.36 ? 126  ALA B O   1 
ATOM   1977 C CB  . ALA B 2 126 ? 41.990  -126.066 -25.219 1.00 24.56 ? 126  ALA B CB  1 
ATOM   1978 N N   . LYS B 2 127 ? 42.762  -127.718 -22.733 1.00 24.89 ? 127  LYS B N   1 
ATOM   1979 C CA  . LYS B 2 127 ? 43.828  -128.476 -22.126 1.00 25.21 ? 127  LYS B CA  1 
ATOM   1980 C C   . LYS B 2 127 ? 43.349  -129.656 -21.289 1.00 24.42 ? 127  LYS B C   1 
ATOM   1981 O O   . LYS B 2 127 ? 44.102  -130.592 -21.050 1.00 23.28 ? 127  LYS B O   1 
ATOM   1982 C CB  . LYS B 2 127 ? 44.752  -127.563 -21.357 1.00 26.87 ? 127  LYS B CB  1 
ATOM   1983 C CG  . LYS B 2 127 ? 44.182  -126.860 -20.197 1.00 28.78 ? 127  LYS B CG  1 
ATOM   1984 C CD  . LYS B 2 127 ? 45.380  -126.367 -19.389 1.00 35.11 ? 127  LYS B CD  1 
ATOM   1985 C CE  . LYS B 2 127 ? 46.102  -127.527 -18.708 1.00 38.51 ? 127  LYS B CE  1 
ATOM   1986 N NZ  . LYS B 2 127 ? 45.581  -127.825 -17.325 1.00 41.49 ? 127  LYS B NZ  1 
ATOM   1987 N N   . SER B 2 128 ? 42.086  -129.626 -20.886 1.00 22.61 ? 128  SER B N   1 
ATOM   1988 C CA  . SER B 2 128 ? 41.542  -130.653 -20.004 1.00 22.96 ? 128  SER B CA  1 
ATOM   1989 C C   . SER B 2 128 ? 40.912  -131.851 -20.715 1.00 22.59 ? 128  SER B C   1 
ATOM   1990 O O   . SER B 2 128 ? 40.969  -132.960 -20.188 1.00 22.63 ? 128  SER B O   1 
ATOM   1991 C CB  . SER B 2 128 ? 40.535  -130.039 -19.019 1.00 22.82 ? 128  SER B CB  1 
ATOM   1992 O OG  . SER B 2 128 ? 41.230  -129.091 -18.236 1.00 21.98 ? 128  SER B OG  1 
ATOM   1993 N N   . PHE B 2 129 ? 40.316  -131.625 -21.885 1.00 22.28 ? 129  PHE B N   1 
ATOM   1994 C CA  . PHE B 2 129 ? 39.460  -132.638 -22.523 1.00 21.67 ? 129  PHE B CA  1 
ATOM   1995 C C   . PHE B 2 129 ? 40.024  -133.135 -23.858 1.00 21.84 ? 129  PHE B C   1 
ATOM   1996 O O   . PHE B 2 129 ? 39.709  -132.618 -24.927 1.00 21.11 ? 129  PHE B O   1 
ATOM   1997 C CB  . PHE B 2 129 ? 38.018  -132.107 -22.646 1.00 22.13 ? 129  PHE B CB  1 
ATOM   1998 C CG  . PHE B 2 129 ? 37.493  -131.556 -21.355 1.00 21.42 ? 129  PHE B CG  1 
ATOM   1999 C CD1 . PHE B 2 129 ? 37.060  -130.222 -21.272 1.00 23.64 ? 129  PHE B CD1 1 
ATOM   2000 C CD2 . PHE B 2 129 ? 37.439  -132.365 -20.213 1.00 20.19 ? 129  PHE B CD2 1 
ATOM   2001 C CE1 . PHE B 2 129 ? 36.579  -129.692 -20.035 1.00 21.09 ? 129  PHE B CE1 1 
ATOM   2002 C CE2 . PHE B 2 129 ? 36.975  -131.863 -18.971 1.00 20.59 ? 129  PHE B CE2 1 
ATOM   2003 C CZ  . PHE B 2 129 ? 36.535  -130.518 -18.887 1.00 23.58 ? 129  PHE B CZ  1 
ATOM   2004 N N   . LYS B 2 130 ? 40.870  -134.161 -23.794 1.00 22.47 ? 130  LYS B N   1 
ATOM   2005 C CA  . LYS B 2 130 ? 41.520  -134.654 -25.013 1.00 23.66 ? 130  LYS B CA  1 
ATOM   2006 C C   . LYS B 2 130 ? 40.563  -135.049 -26.136 1.00 23.90 ? 130  LYS B C   1 
ATOM   2007 O O   . LYS B 2 130 ? 40.820  -134.737 -27.322 1.00 25.65 ? 130  LYS B O   1 
ATOM   2008 C CB  . LYS B 2 130 ? 42.525  -135.763 -24.670 1.00 23.63 ? 130  LYS B CB  1 
ATOM   2009 C CG  . LYS B 2 130 ? 43.860  -135.172 -24.357 1.00 28.21 ? 130  LYS B CG  1 
ATOM   2010 C CD  . LYS B 2 130 ? 43.758  -134.068 -23.295 1.00 33.29 ? 130  LYS B CD  1 
ATOM   2011 C CE  . LYS B 2 130 ? 45.072  -133.895 -22.533 1.00 36.65 ? 130  LYS B CE  1 
ATOM   2012 N NZ  . LYS B 2 130 ? 44.800  -133.310 -21.179 1.00 39.45 ? 130  LYS B NZ  1 
ATOM   2013 N N   . ASN B 2 131 ? 39.422  -135.650 -25.771 1.00 23.50 ? 131  ASN B N   1 
ATOM   2014 C CA  . ASN B 2 131 ? 38.407  -136.064 -26.746 1.00 22.67 ? 131  ASN B CA  1 
ATOM   2015 C C   . ASN B 2 131 ? 37.361  -135.036 -27.053 1.00 22.21 ? 131  ASN B C   1 
ATOM   2016 O O   . ASN B 2 131 ? 36.294  -135.380 -27.527 1.00 23.16 ? 131  ASN B O   1 
ATOM   2017 C CB  . ASN B 2 131 ? 37.711  -137.358 -26.297 1.00 22.66 ? 131  ASN B CB  1 
ATOM   2018 C CG  . ASN B 2 131 ? 38.681  -138.563 -26.267 1.00 23.25 ? 131  ASN B CG  1 
ATOM   2019 O OD1 . ASN B 2 131 ? 39.829  -138.443 -26.663 1.00 26.20 ? 131  ASN B OD1 1 
ATOM   2020 N ND2 . ASN B 2 131 ? 38.202  -139.712 -25.813 1.00 25.32 ? 131  ASN B ND2 1 
ATOM   2021 N N   . PHE B 2 132 ? 37.669  -133.764 -26.844 1.00 22.36 ? 132  PHE B N   1 
ATOM   2022 C CA  . PHE B 2 132 ? 36.642  -132.758 -27.008 1.00 22.09 ? 132  PHE B CA  1 
ATOM   2023 C C   . PHE B 2 132 ? 36.186  -132.642 -28.458 1.00 21.96 ? 132  PHE B C   1 
ATOM   2024 O O   . PHE B 2 132 ? 37.012  -132.518 -29.367 1.00 21.32 ? 132  PHE B O   1 
ATOM   2025 C CB  . PHE B 2 132 ? 37.144  -131.433 -26.449 1.00 22.87 ? 132  PHE B CB  1 
ATOM   2026 C CG  . PHE B 2 132 ? 36.079  -130.410 -26.316 1.00 24.63 ? 132  PHE B CG  1 
ATOM   2027 C CD1 . PHE B 2 132 ? 35.006  -130.611 -25.441 1.00 23.86 ? 132  PHE B CD1 1 
ATOM   2028 C CD2 . PHE B 2 132 ? 36.150  -129.235 -27.042 1.00 25.33 ? 132  PHE B CD2 1 
ATOM   2029 C CE1 . PHE B 2 132 ? 34.001  -129.635 -25.319 1.00 23.14 ? 132  PHE B CE1 1 
ATOM   2030 C CE2 . PHE B 2 132 ? 35.171  -128.283 -26.926 1.00 25.57 ? 132  PHE B CE2 1 
ATOM   2031 C CZ  . PHE B 2 132 ? 34.089  -128.487 -26.065 1.00 24.62 ? 132  PHE B CZ  1 
ATOM   2032 N N   . LYS B 2 133 ? 34.862  -132.672 -28.673 1.00 21.26 ? 133  LYS B N   1 
ATOM   2033 C CA  . LYS B 2 133 ? 34.314  -132.729 -30.018 1.00 21.37 ? 133  LYS B CA  1 
ATOM   2034 C C   . LYS B 2 133 ? 33.334  -131.607 -30.343 1.00 22.12 ? 133  LYS B C   1 
ATOM   2035 O O   . LYS B 2 133 ? 33.256  -131.221 -31.489 1.00 23.67 ? 133  LYS B O   1 
ATOM   2036 C CB  . LYS B 2 133 ? 33.667  -134.087 -30.336 1.00 20.16 ? 133  LYS B CB  1 
ATOM   2037 C CG  . LYS B 2 133 ? 34.708  -135.259 -30.436 1.00 21.08 ? 133  LYS B CG  1 
ATOM   2038 C CD  . LYS B 2 133 ? 33.987  -136.558 -30.661 1.00 20.18 ? 133  LYS B CD  1 
ATOM   2039 C CE  . LYS B 2 133 ? 34.971  -137.658 -31.038 1.00 25.16 ? 133  LYS B CE  1 
ATOM   2040 N NZ  . LYS B 2 133 ? 34.225  -138.924 -31.004 1.00 30.91 ? 133  LYS B NZ  1 
ATOM   2041 N N   . VAL B 2 134 ? 32.587  -131.097 -29.361 1.00 21.53 ? 134  VAL B N   1 
ATOM   2042 C CA  . VAL B 2 134 ? 31.435  -130.205 -29.669 1.00 21.65 ? 134  VAL B CA  1 
ATOM   2043 C C   . VAL B 2 134 ? 31.448  -129.052 -28.681 1.00 22.98 ? 134  VAL B C   1 
ATOM   2044 O O   . VAL B 2 134 ? 31.314  -129.259 -27.457 1.00 22.50 ? 134  VAL B O   1 
ATOM   2045 C CB  . VAL B 2 134 ? 30.072  -130.975 -29.565 1.00 22.54 ? 134  VAL B CB  1 
ATOM   2046 C CG1 . VAL B 2 134 ? 28.844  -130.024 -29.697 1.00 21.16 ? 134  VAL B CG1 1 
ATOM   2047 C CG2 . VAL B 2 134 ? 30.001  -132.078 -30.657 1.00 22.37 ? 134  VAL B CG2 1 
ATOM   2048 N N   . LEU B 2 135 ? 31.562  -127.844 -29.216 1.00 23.09 ? 135  LEU B N   1 
ATOM   2049 C CA  . LEU B 2 135 ? 31.347  -126.639 -28.405 1.00 23.56 ? 135  LEU B CA  1 
ATOM   2050 C C   . LEU B 2 135 ? 30.262  -125.772 -29.029 1.00 23.49 ? 135  LEU B C   1 
ATOM   2051 O O   . LEU B 2 135 ? 30.396  -125.328 -30.178 1.00 24.30 ? 135  LEU B O   1 
ATOM   2052 C CB  . LEU B 2 135 ? 32.652  -125.863 -28.309 1.00 23.25 ? 135  LEU B CB  1 
ATOM   2053 C CG  . LEU B 2 135 ? 32.568  -124.566 -27.479 1.00 25.00 ? 135  LEU B CG  1 
ATOM   2054 C CD1 . LEU B 2 135 ? 32.333  -124.896 -26.007 1.00 26.22 ? 135  LEU B CD1 1 
ATOM   2055 C CD2 . LEU B 2 135 ? 33.834  -123.752 -27.694 1.00 27.85 ? 135  LEU B CD2 1 
ATOM   2056 N N   . VAL B 2 136 ? 29.177  -125.581 -28.292 1.00 23.05 ? 136  VAL B N   1 
ATOM   2057 C CA  . VAL B 2 136 ? 28.084  -124.662 -28.709 1.00 23.36 ? 136  VAL B CA  1 
ATOM   2058 C C   . VAL B 2 136 ? 27.987  -123.572 -27.663 1.00 23.16 ? 136  VAL B C   1 
ATOM   2059 O O   . VAL B 2 136 ? 27.730  -123.841 -26.480 1.00 24.86 ? 136  VAL B O   1 
ATOM   2060 C CB  . VAL B 2 136 ? 26.704  -125.384 -28.859 1.00 22.71 ? 136  VAL B CB  1 
ATOM   2061 C CG1 . VAL B 2 136 ? 25.607  -124.377 -29.320 1.00 23.89 ? 136  VAL B CG1 1 
ATOM   2062 C CG2 . VAL B 2 136 ? 26.838  -126.536 -29.827 1.00 22.84 ? 136  VAL B CG2 1 
ATOM   2063 N N   . LEU B 2 137 ? 28.232  -122.339 -28.089 1.00 23.75 ? 137  LEU B N   1 
ATOM   2064 C CA  . LEU B 2 137 ? 28.106  -121.163 -27.207 1.00 23.46 ? 137  LEU B CA  1 
ATOM   2065 C C   . LEU B 2 137 ? 26.957  -120.331 -27.765 1.00 23.60 ? 137  LEU B C   1 
ATOM   2066 O O   . LEU B 2 137 ? 27.126  -119.626 -28.743 1.00 22.91 ? 137  LEU B O   1 
ATOM   2067 C CB  . LEU B 2 137 ? 29.436  -120.386 -27.229 1.00 24.27 ? 137  LEU B CB  1 
ATOM   2068 C CG  . LEU B 2 137 ? 30.633  -121.172 -26.675 1.00 23.84 ? 137  LEU B CG  1 
ATOM   2069 C CD1 . LEU B 2 137 ? 31.936  -120.377 -26.764 1.00 25.15 ? 137  LEU B CD1 1 
ATOM   2070 C CD2 . LEU B 2 137 ? 30.365  -121.566 -25.214 1.00 26.81 ? 137  LEU B CD2 1 
ATOM   2071 N N   . SER B 2 138 ? 25.766  -120.495 -27.186 1.00 23.75 ? 138  SER B N   1 
ATOM   2072 C CA  . SER B 2 138 ? 24.554  -119.913 -27.710 1.00 23.37 ? 138  SER B CA  1 
ATOM   2073 C C   . SER B 2 138 ? 24.156  -118.711 -26.857 1.00 23.73 ? 138  SER B C   1 
ATOM   2074 O O   . SER B 2 138 ? 23.859  -118.845 -25.662 1.00 23.92 ? 138  SER B O   1 
ATOM   2075 C CB  . SER B 2 138 ? 23.452  -120.980 -27.730 1.00 23.57 ? 138  SER B CB  1 
ATOM   2076 O OG  . SER B 2 138 ? 22.215  -120.393 -28.061 1.00 25.89 ? 138  SER B OG  1 
ATOM   2077 N N   . SER B 2 139 ? 24.175  -117.525 -27.455 1.00 22.37 ? 139  SER B N   1 
ATOM   2078 C CA  . SER B 2 139 ? 23.933  -116.278 -26.717 1.00 22.19 ? 139  SER B CA  1 
ATOM   2079 C C   . SER B 2 139 ? 24.802  -116.185 -25.452 1.00 22.28 ? 139  SER B C   1 
ATOM   2080 O O   . SER B 2 139 ? 24.290  -115.832 -24.378 1.00 21.71 ? 139  SER B O   1 
ATOM   2081 C CB  . SER B 2 139 ? 22.447  -116.098 -26.352 1.00 22.43 ? 139  SER B CB  1 
ATOM   2082 O OG  . SER B 2 139 ? 21.658  -116.119 -27.540 1.00 24.75 ? 139  SER B OG  1 
ATOM   2083 N N   . CYS B 2 140 ? 26.090  -116.495 -25.583 1.00 21.05 ? 140  CYS B N   1 
ATOM   2084 C CA  . CYS B 2 140 ? 27.035  -116.371 -24.486 1.00 22.11 ? 140  CYS B CA  1 
ATOM   2085 C C   . CYS B 2 140 ? 27.850  -115.095 -24.650 1.00 23.06 ? 140  CYS B C   1 
ATOM   2086 O O   . CYS B 2 140 ? 27.812  -114.461 -25.711 1.00 22.41 ? 140  CYS B O   1 
ATOM   2087 C CB  . CYS B 2 140 ? 27.944  -117.617 -24.385 1.00 21.38 ? 140  CYS B CB  1 
ATOM   2088 S SG  . CYS B 2 140 ? 27.046  -119.100 -23.868 1.00 23.64 ? 140  CYS B SG  1 
ATOM   2089 N N   . GLU B 2 141 ? 28.561  -114.697 -23.599 1.00 22.67 ? 141  GLU B N   1 
ATOM   2090 C CA  . GLU B 2 141 ? 29.398  -113.488 -23.642 1.00 23.49 ? 141  GLU B CA  1 
ATOM   2091 C C   . GLU B 2 141 ? 30.597  -113.699 -22.718 1.00 23.29 ? 141  GLU B C   1 
ATOM   2092 O O   . GLU B 2 141 ? 30.571  -114.592 -21.870 1.00 23.67 ? 141  GLU B O   1 
ATOM   2093 C CB  . GLU B 2 141 ? 28.565  -112.297 -23.161 1.00 23.72 ? 141  GLU B CB  1 
ATOM   2094 C CG  . GLU B 2 141 ? 28.102  -112.508 -21.715 1.00 27.98 ? 141  GLU B CG  1 
ATOM   2095 C CD  . GLU B 2 141 ? 27.108  -111.510 -21.208 1.00 37.06 ? 141  GLU B CD  1 
ATOM   2096 O OE1 . GLU B 2 141 ? 27.288  -110.287 -21.434 1.00 38.65 ? 141  GLU B OE1 1 
ATOM   2097 O OE2 . GLU B 2 141 ? 26.139  -111.965 -20.538 1.00 42.11 ? 141  GLU B OE2 1 
ATOM   2098 N N   . GLY B 2 142 ? 31.638  -112.879 -22.868 1.00 23.53 ? 142  GLY B N   1 
ATOM   2099 C CA  . GLY B 2 142 ? 32.724  -112.812 -21.887 1.00 23.32 ? 142  GLY B CA  1 
ATOM   2100 C C   . GLY B 2 142 ? 34.069  -113.330 -22.375 1.00 23.70 ? 142  GLY B C   1 
ATOM   2101 O O   . GLY B 2 142 ? 35.056  -113.316 -21.637 1.00 23.19 ? 142  GLY B O   1 
ATOM   2102 N N   . PHE B 2 143 ? 34.106  -113.778 -23.622 1.00 23.51 ? 143  PHE B N   1 
ATOM   2103 C CA  . PHE B 2 143 ? 35.321  -114.341 -24.225 1.00 24.31 ? 143  PHE B CA  1 
ATOM   2104 C C   . PHE B 2 143 ? 35.695  -113.596 -25.500 1.00 24.70 ? 143  PHE B C   1 
ATOM   2105 O O   . PHE B 2 143 ? 34.921  -112.780 -26.012 1.00 24.64 ? 143  PHE B O   1 
ATOM   2106 C CB  . PHE B 2 143 ? 35.167  -115.843 -24.523 1.00 23.78 ? 143  PHE B CB  1 
ATOM   2107 C CG  . PHE B 2 143 ? 34.064  -116.163 -25.514 1.00 25.63 ? 143  PHE B CG  1 
ATOM   2108 C CD1 . PHE B 2 143 ? 34.375  -116.506 -26.841 1.00 26.84 ? 143  PHE B CD1 1 
ATOM   2109 C CD2 . PHE B 2 143 ? 32.725  -116.117 -25.131 1.00 26.52 ? 143  PHE B CD2 1 
ATOM   2110 C CE1 . PHE B 2 143 ? 33.368  -116.814 -27.760 1.00 23.03 ? 143  PHE B CE1 1 
ATOM   2111 C CE2 . PHE B 2 143 ? 31.705  -116.417 -26.049 1.00 24.82 ? 143  PHE B CE2 1 
ATOM   2112 C CZ  . PHE B 2 143 ? 32.044  -116.767 -27.371 1.00 25.62 ? 143  PHE B CZ  1 
ATOM   2113 N N   . SER B 2 144 ? 36.906  -113.885 -25.978 1.00 24.56 ? 144  SER B N   1 
ATOM   2114 C CA  . SER B 2 144 ? 37.483  -113.232 -27.123 1.00 24.78 ? 144  SER B CA  1 
ATOM   2115 C C   . SER B 2 144 ? 37.982  -114.256 -28.127 1.00 24.29 ? 144  SER B C   1 
ATOM   2116 O O   . SER B 2 144 ? 37.949  -115.489 -27.876 1.00 24.18 ? 144  SER B O   1 
ATOM   2117 C CB  . SER B 2 144 ? 38.639  -112.323 -26.669 1.00 25.18 ? 144  SER B CB  1 
ATOM   2118 O OG  . SER B 2 144 ? 39.848  -113.048 -26.529 1.00 25.61 ? 144  SER B OG  1 
ATOM   2119 N N   . THR B 2 145 ? 38.461  -113.738 -29.260 1.00 24.08 ? 145  THR B N   1 
ATOM   2120 C CA  . THR B 2 145 ? 39.092  -114.559 -30.290 1.00 24.04 ? 145  THR B CA  1 
ATOM   2121 C C   . THR B 2 145 ? 40.351  -115.283 -29.792 1.00 24.35 ? 145  THR B C   1 
ATOM   2122 O O   . THR B 2 145 ? 40.715  -116.347 -30.302 1.00 24.86 ? 145  THR B O   1 
ATOM   2123 C CB  . THR B 2 145 ? 39.363  -113.735 -31.560 1.00 23.90 ? 145  THR B CB  1 
ATOM   2124 O OG1 . THR B 2 145 ? 40.007  -112.506 -31.202 1.00 25.66 ? 145  THR B OG1 1 
ATOM   2125 C CG2 . THR B 2 145 ? 38.022  -113.441 -32.279 1.00 23.72 ? 145  THR B CG2 1 
ATOM   2126 N N   . ASP B 2 146 ? 40.993  -114.740 -28.762 1.00 24.80 ? 146  ASP B N   1 
ATOM   2127 C CA  . ASP B 2 146 ? 42.105  -115.437 -28.113 1.00 25.46 ? 146  ASP B CA  1 
ATOM   2128 C C   . ASP B 2 146 ? 41.681  -116.797 -27.501 1.00 25.12 ? 146  ASP B C   1 
ATOM   2129 O O   . ASP B 2 146 ? 42.410  -117.786 -27.605 1.00 25.47 ? 146  ASP B O   1 
ATOM   2130 C CB  . ASP B 2 146 ? 42.764  -114.541 -27.042 1.00 25.89 ? 146  ASP B CB  1 
ATOM   2131 C CG  . ASP B 2 146 ? 43.657  -113.454 -27.629 1.00 28.69 ? 146  ASP B CG  1 
ATOM   2132 O OD1 . ASP B 2 146 ? 43.994  -113.459 -28.842 1.00 30.29 ? 146  ASP B OD1 1 
ATOM   2133 O OD2 . ASP B 2 146 ? 44.062  -112.582 -26.837 1.00 33.19 ? 146  ASP B OD2 1 
ATOM   2134 N N   . GLY B 2 147 ? 40.506  -116.848 -26.883 1.00 25.09 ? 147  GLY B N   1 
ATOM   2135 C CA  . GLY B 2 147 ? 39.950  -118.106 -26.345 1.00 24.42 ? 147  GLY B CA  1 
ATOM   2136 C C   . GLY B 2 147 ? 39.641  -119.084 -27.465 1.00 24.33 ? 147  GLY B C   1 
ATOM   2137 O O   . GLY B 2 147 ? 39.933  -120.294 -27.370 1.00 24.08 ? 147  GLY B O   1 
ATOM   2138 N N   . LEU B 2 148 ? 39.076  -118.553 -28.545 1.00 23.54 ? 148  LEU B N   1 
ATOM   2139 C CA  . LEU B 2 148 ? 38.829  -119.353 -29.739 1.00 23.27 ? 148  LEU B CA  1 
ATOM   2140 C C   . LEU B 2 148 ? 40.132  -119.903 -30.334 1.00 23.91 ? 148  LEU B C   1 
ATOM   2141 O O   . LEU B 2 148 ? 40.152  -121.046 -30.813 1.00 24.15 ? 148  LEU B O   1 
ATOM   2142 C CB  . LEU B 2 148 ? 38.095  -118.513 -30.780 1.00 22.87 ? 148  LEU B CB  1 
ATOM   2143 C CG  . LEU B 2 148 ? 36.694  -117.991 -30.426 1.00 22.02 ? 148  LEU B CG  1 
ATOM   2144 C CD1 . LEU B 2 148 ? 36.178  -117.222 -31.648 1.00 22.25 ? 148  LEU B CD1 1 
ATOM   2145 C CD2 . LEU B 2 148 ? 35.769  -119.151 -30.056 1.00 23.68 ? 148  LEU B CD2 1 
ATOM   2146 N N   . ALA B 2 149 ? 41.208  -119.100 -30.307 1.00 23.71 ? 149  ALA B N   1 
ATOM   2147 C CA  . ALA B 2 149 ? 42.512  -119.539 -30.813 1.00 24.34 ? 149  ALA B CA  1 
ATOM   2148 C C   . ALA B 2 149 ? 43.033  -120.763 -30.046 1.00 24.70 ? 149  ALA B C   1 
ATOM   2149 O O   . ALA B 2 149 ? 43.656  -121.654 -30.645 1.00 24.58 ? 149  ALA B O   1 
ATOM   2150 C CB  . ALA B 2 149 ? 43.525  -118.418 -30.758 1.00 23.67 ? 149  ALA B CB  1 
ATOM   2151 N N   . ALA B 2 150 ? 42.767  -120.787 -28.734 1.00 24.40 ? 150  ALA B N   1 
ATOM   2152 C CA  . ALA B 2 150 ? 43.178  -121.888 -27.851 1.00 24.58 ? 150  ALA B CA  1 
ATOM   2153 C C   . ALA B 2 150 ? 42.472  -123.189 -28.205 1.00 24.34 ? 150  ALA B C   1 
ATOM   2154 O O   . ALA B 2 150 ? 43.109  -124.237 -28.261 1.00 25.63 ? 150  ALA B O   1 
ATOM   2155 C CB  . ALA B 2 150 ? 42.945  -121.527 -26.390 1.00 23.88 ? 150  ALA B CB  1 
ATOM   2156 N N   . ILE B 2 151 ? 41.181  -123.095 -28.491 1.00 23.98 ? 151  ILE B N   1 
ATOM   2157 C CA  . ILE B 2 151 ? 40.350  -124.232 -28.956 1.00 24.60 ? 151  ILE B CA  1 
ATOM   2158 C C   . ILE B 2 151 ? 40.872  -124.772 -30.297 1.00 24.53 ? 151  ILE B C   1 
ATOM   2159 O O   . ILE B 2 151 ? 41.135  -125.976 -30.444 1.00 24.63 ? 151  ILE B O   1 
ATOM   2160 C CB  . ILE B 2 151 ? 38.833  -123.827 -29.088 1.00 24.66 ? 151  ILE B CB  1 
ATOM   2161 C CG1 . ILE B 2 151 ? 38.237  -123.430 -27.720 1.00 25.07 ? 151  ILE B CG1 1 
ATOM   2162 C CG2 . ILE B 2 151 ? 37.990  -124.964 -29.725 1.00 24.25 ? 151  ILE B CG2 1 
ATOM   2163 C CD1 . ILE B 2 151 ? 38.138  -124.555 -26.701 1.00 26.50 ? 151  ILE B CD1 1 
ATOM   2164 N N   . ALA B 2 152 ? 41.061  -123.858 -31.242 1.00 24.14 ? 152  ALA B N   1 
ATOM   2165 C CA  . ALA B 2 152 ? 41.533  -124.184 -32.593 1.00 24.10 ? 152  ALA B CA  1 
ATOM   2166 C C   . ALA B 2 152 ? 42.912  -124.867 -32.558 1.00 23.87 ? 152  ALA B C   1 
ATOM   2167 O O   . ALA B 2 152 ? 43.136  -125.893 -33.228 1.00 23.24 ? 152  ALA B O   1 
ATOM   2168 C CB  . ALA B 2 152 ? 41.597  -122.936 -33.401 1.00 24.73 ? 152  ALA B CB  1 
ATOM   2169 N N   . ALA B 2 153 ? 43.818  -124.306 -31.755 1.00 22.98 ? 153  ALA B N   1 
ATOM   2170 C CA  . ALA B 2 153 ? 45.197  -124.825 -31.671 1.00 24.20 ? 153  ALA B CA  1 
ATOM   2171 C C   . ALA B 2 153 ? 45.288  -126.240 -31.095 1.00 24.28 ? 153  ALA B C   1 
ATOM   2172 O O   . ALA B 2 153 ? 46.133  -127.039 -31.511 1.00 24.82 ? 153  ALA B O   1 
ATOM   2173 C CB  . ALA B 2 153 ? 46.065  -123.882 -30.853 1.00 23.91 ? 153  ALA B CB  1 
ATOM   2174 N N   . THR B 2 154 ? 44.419  -126.532 -30.130 1.00 24.29 ? 154  THR B N   1 
ATOM   2175 C CA  . THR B 2 154 ? 44.611  -127.646 -29.205 1.00 25.29 ? 154  THR B CA  1 
ATOM   2176 C C   . THR B 2 154 ? 43.607  -128.771 -29.380 1.00 25.00 ? 154  THR B C   1 
ATOM   2177 O O   . THR B 2 154 ? 43.951  -129.932 -29.161 1.00 26.37 ? 154  THR B O   1 
ATOM   2178 C CB  . THR B 2 154 ? 44.543  -127.118 -27.745 1.00 25.06 ? 154  THR B CB  1 
ATOM   2179 O OG1 . THR B 2 154 ? 45.513  -126.073 -27.614 1.00 29.22 ? 154  THR B OG1 1 
ATOM   2180 C CG2 . THR B 2 154 ? 44.854  -128.213 -26.733 1.00 24.91 ? 154  THR B CG2 1 
ATOM   2181 N N   . CYS B 2 155 ? 42.373  -128.435 -29.751 1.00 24.99 ? 155  CYS B N   1 
ATOM   2182 C CA  . CYS B 2 155 ? 41.305  -129.442 -29.811 1.00 25.05 ? 155  CYS B CA  1 
ATOM   2183 C C   . CYS B 2 155 ? 41.393  -130.234 -31.109 1.00 24.36 ? 155  CYS B C   1 
ATOM   2184 O O   . CYS B 2 155 ? 40.670  -129.972 -32.053 1.00 23.72 ? 155  CYS B O   1 
ATOM   2185 C CB  . CYS B 2 155 ? 39.933  -128.817 -29.632 1.00 25.35 ? 155  CYS B CB  1 
ATOM   2186 S SG  . CYS B 2 155 ? 39.768  -128.162 -27.969 1.00 27.47 ? 155  CYS B SG  1 
ATOM   2187 N N   . ARG B 2 156 ? 42.270  -131.236 -31.108 1.00 23.15 ? 156  ARG B N   1 
ATOM   2188 C CA  . ARG B 2 156 ? 42.559  -131.993 -32.326 1.00 23.94 ? 156  ARG B CA  1 
ATOM   2189 C C   . ARG B 2 156 ? 41.415  -132.844 -32.867 1.00 23.22 ? 156  ARG B C   1 
ATOM   2190 O O   . ARG B 2 156 ? 41.416  -133.187 -34.050 1.00 23.74 ? 156  ARG B O   1 
ATOM   2191 C CB  . ARG B 2 156 ? 43.779  -132.856 -32.127 1.00 22.91 ? 156  ARG B CB  1 
ATOM   2192 C CG  . ARG B 2 156 ? 43.564  -133.944 -31.124 1.00 26.52 ? 156  ARG B CG  1 
ATOM   2193 C CD  . ARG B 2 156 ? 44.876  -134.412 -30.628 1.00 25.64 ? 156  ARG B CD  1 
ATOM   2194 N NE  . ARG B 2 156 ? 45.253  -135.695 -31.203 1.00 34.18 ? 156  ARG B NE  1 
ATOM   2195 C CZ  . ARG B 2 156 ? 46.474  -136.217 -31.086 1.00 34.68 ? 156  ARG B CZ  1 
ATOM   2196 N NH1 . ARG B 2 156 ? 47.409  -135.536 -30.444 1.00 38.41 ? 156  ARG B NH1 1 
ATOM   2197 N NH2 . ARG B 2 156 ? 46.772  -137.404 -31.612 1.00 37.86 ? 156  ARG B NH2 1 
ATOM   2198 N N   . ASN B 2 157 ? 40.454  -133.192 -32.010 1.00 22.74 ? 157  ASN B N   1 
ATOM   2199 C CA  . ASN B 2 157 ? 39.268  -133.977 -32.417 1.00 22.40 ? 157  ASN B CA  1 
ATOM   2200 C C   . ASN B 2 157 ? 37.971  -133.164 -32.626 1.00 23.19 ? 157  ASN B C   1 
ATOM   2201 O O   . ASN B 2 157 ? 36.861  -133.717 -32.846 1.00 23.20 ? 157  ASN B O   1 
ATOM   2202 C CB  . ASN B 2 157 ? 39.061  -135.059 -31.372 1.00 21.83 ? 157  ASN B CB  1 
ATOM   2203 C CG  . ASN B 2 157 ? 40.270  -135.972 -31.270 1.00 22.66 ? 157  ASN B CG  1 
ATOM   2204 O OD1 . ASN B 2 157 ? 40.672  -136.554 -32.267 1.00 20.73 ? 157  ASN B OD1 1 
ATOM   2205 N ND2 . ASN B 2 157 ? 40.870  -136.070 -30.094 1.00 20.14 ? 157  ASN B ND2 1 
ATOM   2206 N N   . LEU B 2 158 ? 38.109  -131.842 -32.613 1.00 22.94 ? 158  LEU B N   1 
ATOM   2207 C CA  . LEU B 2 158 ? 36.927  -130.971 -32.668 1.00 22.72 ? 158  LEU B CA  1 
ATOM   2208 C C   . LEU B 2 158 ? 36.073  -131.230 -33.924 1.00 23.44 ? 158  LEU B C   1 
ATOM   2209 O O   . LEU B 2 158 ? 36.590  -131.323 -35.042 1.00 24.32 ? 158  LEU B O   1 
ATOM   2210 C CB  . LEU B 2 158 ? 37.347  -129.487 -32.620 1.00 21.74 ? 158  LEU B CB  1 
ATOM   2211 C CG  . LEU B 2 158 ? 36.199  -128.503 -32.248 1.00 21.92 ? 158  LEU B CG  1 
ATOM   2212 C CD1 . LEU B 2 158 ? 35.916  -128.582 -30.736 1.00 25.00 ? 158  LEU B CD1 1 
ATOM   2213 C CD2 . LEU B 2 158 ? 36.632  -127.088 -32.662 1.00 23.07 ? 158  LEU B CD2 1 
ATOM   2214 N N   . LYS B 2 159 ? 34.755  -131.336 -33.741 1.00 22.94 ? 159  LYS B N   1 
ATOM   2215 C CA  . LYS B 2 159 ? 33.863  -131.537 -34.855 1.00 21.71 ? 159  LYS B CA  1 
ATOM   2216 C C   . LYS B 2 159 ? 32.907  -130.353 -35.022 1.00 21.94 ? 159  LYS B C   1 
ATOM   2217 O O   . LYS B 2 159 ? 32.510  -130.054 -36.138 1.00 21.15 ? 159  LYS B O   1 
ATOM   2218 C CB  . LYS B 2 159 ? 33.064  -132.822 -34.654 1.00 22.30 ? 159  LYS B CB  1 
ATOM   2219 C CG  . LYS B 2 159 ? 33.926  -134.050 -34.705 1.00 22.64 ? 159  LYS B CG  1 
ATOM   2220 C CD  . LYS B 2 159 ? 33.213  -135.270 -34.197 1.00 24.63 ? 159  LYS B CD  1 
ATOM   2221 C CE  . LYS B 2 159 ? 32.061  -135.650 -35.082 1.00 26.53 ? 159  LYS B CE  1 
ATOM   2222 N NZ  . LYS B 2 159 ? 31.649  -137.045 -34.658 1.00 27.47 ? 159  LYS B NZ  1 
ATOM   2223 N N   . GLU B 2 160 ? 32.563  -129.688 -33.911 1.00 22.54 ? 160  GLU B N   1 
ATOM   2224 C CA  . GLU B 2 160 ? 31.595  -128.557 -33.954 1.00 23.75 ? 160  GLU B CA  1 
ATOM   2225 C C   . GLU B 2 160 ? 32.062  -127.383 -33.116 1.00 24.42 ? 160  GLU B C   1 
ATOM   2226 O O   . GLU B 2 160 ? 32.371  -127.523 -31.926 1.00 24.71 ? 160  GLU B O   1 
ATOM   2227 C CB  . GLU B 2 160 ? 30.225  -128.980 -33.476 1.00 23.96 ? 160  GLU B CB  1 
ATOM   2228 C CG  . GLU B 2 160 ? 29.651  -130.161 -34.210 1.00 24.80 ? 160  GLU B CG  1 
ATOM   2229 C CD  . GLU B 2 160 ? 28.221  -130.444 -33.830 1.00 27.54 ? 160  GLU B CD  1 
ATOM   2230 O OE1 . GLU B 2 160 ? 27.834  -131.622 -33.960 1.00 28.18 ? 160  GLU B OE1 1 
ATOM   2231 O OE2 . GLU B 2 160 ? 27.487  -129.504 -33.427 1.00 26.66 ? 160  GLU B OE2 1 
ATOM   2232 N N   . LEU B 2 161 ? 32.113  -126.227 -33.759 1.00 24.74 ? 161  LEU B N   1 
ATOM   2233 C CA  . LEU B 2 161 ? 32.366  -124.961 -33.104 1.00 24.42 ? 161  LEU B CA  1 
ATOM   2234 C C   . LEU B 2 161 ? 31.229  -124.041 -33.567 1.00 24.06 ? 161  LEU B C   1 
ATOM   2235 O O   . LEU B 2 161 ? 31.226  -123.595 -34.699 1.00 22.82 ? 161  LEU B O   1 
ATOM   2236 C CB  . LEU B 2 161 ? 33.731  -124.383 -33.506 1.00 24.89 ? 161  LEU B CB  1 
ATOM   2237 C CG  . LEU B 2 161 ? 34.027  -123.020 -32.839 1.00 26.05 ? 161  LEU B CG  1 
ATOM   2238 C CD1 . LEU B 2 161 ? 33.986  -123.212 -31.299 1.00 27.16 ? 161  LEU B CD1 1 
ATOM   2239 C CD2 . LEU B 2 161 ? 35.369  -122.474 -33.283 1.00 25.45 ? 161  LEU B CD2 1 
ATOM   2240 N N   . ASP B 2 162 ? 30.227  -123.851 -32.697 1.00 23.84 ? 162  ASP B N   1 
ATOM   2241 C CA  . ASP B 2 162 ? 28.985  -123.112 -33.057 1.00 23.72 ? 162  ASP B CA  1 
ATOM   2242 C C   . ASP B 2 162 ? 28.808  -121.962 -32.047 1.00 22.72 ? 162  ASP B C   1 
ATOM   2243 O O   . ASP B 2 162 ? 28.575  -122.204 -30.847 1.00 22.51 ? 162  ASP B O   1 
ATOM   2244 C CB  . ASP B 2 162 ? 27.828  -124.090 -32.939 1.00 23.91 ? 162  ASP B CB  1 
ATOM   2245 C CG  . ASP B 2 162 ? 26.512  -123.554 -33.404 1.00 25.28 ? 162  ASP B CG  1 
ATOM   2246 O OD1 . ASP B 2 162 ? 26.249  -122.333 -33.418 1.00 27.67 ? 162  ASP B OD1 1 
ATOM   2247 O OD2 . ASP B 2 162 ? 25.669  -124.417 -33.751 1.00 30.09 ? 162  ASP B OD2 1 
ATOM   2248 N N   . LEU B 2 163 ? 28.887  -120.731 -32.543 1.00 23.17 ? 163  LEU B N   1 
ATOM   2249 C CA  . LEU B 2 163 ? 28.926  -119.541 -31.700 1.00 23.05 ? 163  LEU B CA  1 
ATOM   2250 C C   . LEU B 2 163 ? 27.622  -118.742 -31.773 1.00 24.06 ? 163  LEU B C   1 
ATOM   2251 O O   . LEU B 2 163 ? 27.602  -117.559 -31.439 1.00 25.49 ? 163  LEU B O   1 
ATOM   2252 C CB  . LEU B 2 163 ? 30.129  -118.662 -32.144 1.00 22.99 ? 163  LEU B CB  1 
ATOM   2253 C CG  . LEU B 2 163 ? 31.517  -119.338 -32.037 1.00 24.22 ? 163  LEU B CG  1 
ATOM   2254 C CD1 . LEU B 2 163 ? 32.627  -118.361 -32.480 1.00 21.99 ? 163  LEU B CD1 1 
ATOM   2255 C CD2 . LEU B 2 163 ? 31.759  -119.832 -30.605 1.00 22.37 ? 163  LEU B CD2 1 
ATOM   2256 N N   . ARG B 2 164 ? 26.527  -119.374 -32.166 1.00 23.30 ? 164  ARG B N   1 
ATOM   2257 C CA  . ARG B 2 164 ? 25.268  -118.670 -32.408 1.00 23.72 ? 164  ARG B CA  1 
ATOM   2258 C C   . ARG B 2 164 ? 24.849  -117.549 -31.451 1.00 24.13 ? 164  ARG B C   1 
ATOM   2259 O O   . ARG B 2 164 ? 24.709  -117.746 -30.226 1.00 24.00 ? 164  ARG B O   1 
ATOM   2260 C CB  . ARG B 2 164 ? 24.115  -119.647 -32.622 1.00 24.17 ? 164  ARG B CB  1 
ATOM   2261 C CG  . ARG B 2 164 ? 23.866  -120.608 -31.545 1.00 26.86 ? 164  ARG B CG  1 
ATOM   2262 C CD  . ARG B 2 164 ? 23.633  -121.916 -32.217 1.00 35.21 ? 164  ARG B CD  1 
ATOM   2263 N NE  . ARG B 2 164 ? 22.432  -122.598 -31.774 1.00 39.39 ? 164  ARG B NE  1 
ATOM   2264 C CZ  . ARG B 2 164 ? 22.248  -123.914 -31.907 1.00 39.59 ? 164  ARG B CZ  1 
ATOM   2265 N NH1 . ARG B 2 164 ? 23.193  -124.684 -32.459 1.00 39.21 ? 164  ARG B NH1 1 
ATOM   2266 N NH2 . ARG B 2 164 ? 21.121  -124.459 -31.486 1.00 40.38 ? 164  ARG B NH2 1 
ATOM   2267 N N   . GLU B 2 165 ? 24.626  -116.377 -32.039 1.00 23.30 ? 165  GLU B N   1 
ATOM   2268 C CA  . GLU B 2 165 ? 24.211  -115.185 -31.340 1.00 23.56 ? 165  GLU B CA  1 
ATOM   2269 C C   . GLU B 2 165 ? 25.066  -114.829 -30.103 1.00 23.62 ? 165  GLU B C   1 
ATOM   2270 O O   . GLU B 2 165 ? 24.612  -114.109 -29.239 1.00 23.77 ? 165  GLU B O   1 
ATOM   2271 C CB  . GLU B 2 165 ? 22.716  -115.250 -30.951 1.00 23.60 ? 165  GLU B CB  1 
ATOM   2272 C CG  . GLU B 2 165 ? 21.721  -115.418 -32.111 1.00 28.43 ? 165  GLU B CG  1 
ATOM   2273 C CD  . GLU B 2 165 ? 21.653  -116.857 -32.576 1.00 36.01 ? 165  GLU B CD  1 
ATOM   2274 O OE1 . GLU B 2 165 ? 21.566  -117.746 -31.696 1.00 39.07 ? 165  GLU B OE1 1 
ATOM   2275 O OE2 . GLU B 2 165 ? 21.718  -117.112 -33.810 1.00 39.30 ? 165  GLU B OE2 1 
ATOM   2276 N N   . SER B 2 166 ? 26.303  -115.300 -30.031 1.00 23.18 ? 166  SER B N   1 
ATOM   2277 C CA  . SER B 2 166 ? 27.161  -114.939 -28.889 1.00 23.09 ? 166  SER B CA  1 
ATOM   2278 C C   . SER B 2 166 ? 27.780  -113.545 -29.081 1.00 23.37 ? 166  SER B C   1 
ATOM   2279 O O   . SER B 2 166 ? 27.864  -113.059 -30.206 1.00 23.69 ? 166  SER B O   1 
ATOM   2280 C CB  . SER B 2 166 ? 28.239  -116.008 -28.692 1.00 22.14 ? 166  SER B CB  1 
ATOM   2281 O OG  . SER B 2 166 ? 27.684  -117.097 -27.975 1.00 21.35 ? 166  SER B OG  1 
ATOM   2282 N N   . ASP B 2 167 ? 28.154  -112.891 -27.980 1.00 24.09 ? 167  ASP B N   1 
ATOM   2283 C CA  . ASP B 2 167 ? 28.848  -111.603 -28.017 1.00 25.08 ? 167  ASP B CA  1 
ATOM   2284 C C   . ASP B 2 167 ? 30.331  -111.870 -27.756 1.00 25.26 ? 167  ASP B C   1 
ATOM   2285 O O   . ASP B 2 167 ? 30.711  -112.100 -26.613 1.00 24.80 ? 167  ASP B O   1 
ATOM   2286 C CB  . ASP B 2 167 ? 28.295  -110.649 -26.934 1.00 25.56 ? 167  ASP B CB  1 
ATOM   2287 C CG  . ASP B 2 167 ? 28.855  -109.251 -27.052 1.00 28.99 ? 167  ASP B CG  1 
ATOM   2288 O OD1 . ASP B 2 167 ? 29.244  -108.863 -28.180 1.00 32.76 ? 167  ASP B OD1 1 
ATOM   2289 O OD2 . ASP B 2 167 ? 28.877  -108.516 -26.025 1.00 32.32 ? 167  ASP B OD2 1 
ATOM   2290 N N   . VAL B 2 168 ? 31.152  -111.853 -28.812 1.00 25.12 ? 168  VAL B N   1 
ATOM   2291 C CA  . VAL B 2 168 ? 32.586  -112.155 -28.697 1.00 26.09 ? 168  VAL B CA  1 
ATOM   2292 C C   . VAL B 2 168 ? 33.440  -110.864 -28.745 1.00 27.46 ? 168  VAL B C   1 
ATOM   2293 O O   . VAL B 2 168 ? 33.133  -109.933 -29.495 1.00 27.53 ? 168  VAL B O   1 
ATOM   2294 C CB  . VAL B 2 168 ? 33.023  -113.130 -29.790 1.00 26.46 ? 168  VAL B CB  1 
ATOM   2295 C CG1 . VAL B 2 168 ? 34.445  -113.638 -29.561 1.00 25.33 ? 168  VAL B CG1 1 
ATOM   2296 C CG2 . VAL B 2 168 ? 32.069  -114.339 -29.821 1.00 26.00 ? 168  VAL B CG2 1 
ATOM   2297 N N   . ASP B 2 169 ? 34.483  -110.802 -27.927 1.00 28.44 ? 169  ASP B N   1 
ATOM   2298 C CA  . ASP B 2 169 ? 35.439  -109.691 -28.022 1.00 30.83 ? 169  ASP B CA  1 
ATOM   2299 C C   . ASP B 2 169 ? 36.327  -109.904 -29.262 1.00 31.24 ? 169  ASP B C   1 
ATOM   2300 O O   . ASP B 2 169 ? 37.149  -110.820 -29.305 1.00 31.44 ? 169  ASP B O   1 
ATOM   2301 C CB  . ASP B 2 169 ? 36.233  -109.564 -26.728 1.00 30.90 ? 169  ASP B CB  1 
ATOM   2302 C CG  . ASP B 2 169 ? 35.340  -109.216 -25.536 1.00 34.24 ? 169  ASP B CG  1 
ATOM   2303 O OD1 . ASP B 2 169 ? 34.515  -108.277 -25.677 1.00 39.24 ? 169  ASP B OD1 1 
ATOM   2304 O OD2 . ASP B 2 169 ? 35.449  -109.868 -24.464 1.00 35.55 ? 169  ASP B OD2 1 
ATOM   2305 N N   . ASP B 2 170 ? 36.111  -109.085 -30.287 1.00 32.89 ? 170  ASP B N   1 
ATOM   2306 C CA  . ASP B 2 170 ? 36.718  -109.332 -31.610 1.00 34.47 ? 170  ASP B CA  1 
ATOM   2307 C C   . ASP B 2 170 ? 38.149  -108.747 -31.731 1.00 34.57 ? 170  ASP B C   1 
ATOM   2308 O O   . ASP B 2 170 ? 38.401  -107.796 -32.484 1.00 35.09 ? 170  ASP B O   1 
ATOM   2309 C CB  . ASP B 2 170 ? 35.771  -108.902 -32.753 1.00 34.84 ? 170  ASP B CB  1 
ATOM   2310 C CG  . ASP B 2 170 ? 34.766  -110.022 -33.163 1.00 36.56 ? 170  ASP B CG  1 
ATOM   2311 O OD1 . ASP B 2 170 ? 35.201  -110.996 -33.820 1.00 39.32 ? 170  ASP B OD1 1 
ATOM   2312 O OD2 . ASP B 2 170 ? 33.542  -109.915 -32.868 1.00 37.21 ? 170  ASP B OD2 1 
ATOM   2313 N N   . VAL B 2 171 ? 39.071  -109.354 -30.984 1.00 34.39 ? 171  VAL B N   1 
ATOM   2314 C CA  . VAL B 2 171 ? 40.477  -108.944 -30.930 1.00 34.31 ? 171  VAL B CA  1 
ATOM   2315 C C   . VAL B 2 171 ? 41.225  -109.112 -32.277 1.00 34.40 ? 171  VAL B C   1 
ATOM   2316 O O   . VAL B 2 171 ? 42.095  -108.291 -32.597 1.00 34.46 ? 171  VAL B O   1 
ATOM   2317 C CB  . VAL B 2 171 ? 41.221  -109.647 -29.746 1.00 34.30 ? 171  VAL B CB  1 
ATOM   2318 C CG1 . VAL B 2 171 ? 42.741  -109.435 -29.800 1.00 34.61 ? 171  VAL B CG1 1 
ATOM   2319 C CG2 . VAL B 2 171 ? 40.682  -109.152 -28.407 1.00 34.19 ? 171  VAL B CG2 1 
ATOM   2320 N N   . SER B 2 172 ? 40.859  -110.120 -33.064 1.00 34.11 ? 172  SER B N   1 
ATOM   2321 C CA  . SER B 2 172 ? 41.633  -110.502 -34.240 1.00 33.61 ? 172  SER B CA  1 
ATOM   2322 C C   . SER B 2 172 ? 41.081  -111.762 -34.907 1.00 33.08 ? 172  SER B C   1 
ATOM   2323 O O   . SER B 2 172 ? 40.751  -112.729 -34.239 1.00 33.27 ? 172  SER B O   1 
ATOM   2324 C CB  . SER B 2 172 ? 43.106  -110.692 -33.871 1.00 33.90 ? 172  SER B CB  1 
ATOM   2325 O OG  . SER B 2 172 ? 43.734  -111.683 -34.658 1.00 34.87 ? 172  SER B OG  1 
ATOM   2326 N N   . GLY B 2 173 ? 41.000  -111.745 -36.231 1.00 31.97 ? 173  GLY B N   1 
ATOM   2327 C CA  . GLY B 2 173 ? 40.557  -112.901 -36.985 1.00 30.38 ? 173  GLY B CA  1 
ATOM   2328 C C   . GLY B 2 173 ? 41.615  -113.970 -37.152 1.00 29.85 ? 173  GLY B C   1 
ATOM   2329 O O   . GLY B 2 173 ? 41.372  -115.004 -37.767 1.00 29.31 ? 173  GLY B O   1 
ATOM   2330 N N   . HIS B 2 174 ? 42.790  -113.723 -36.588 1.00 28.85 ? 174  HIS B N   1 
ATOM   2331 C CA  . HIS B 2 174 ? 43.890  -114.664 -36.687 1.00 28.40 ? 174  HIS B CA  1 
ATOM   2332 C C   . HIS B 2 174 ? 43.672  -116.002 -35.972 1.00 27.17 ? 174  HIS B C   1 
ATOM   2333 O O   . HIS B 2 174 ? 44.415  -116.943 -36.192 1.00 27.03 ? 174  HIS B O   1 
ATOM   2334 C CB  . HIS B 2 174 ? 45.200  -114.025 -36.249 1.00 29.17 ? 174  HIS B CB  1 
ATOM   2335 C CG  . HIS B 2 174 ? 46.408  -114.804 -36.657 1.00 32.24 ? 174  HIS B CG  1 
ATOM   2336 N ND1 . HIS B 2 174 ? 46.784  -114.952 -37.972 1.00 33.82 ? 174  HIS B ND1 1 
ATOM   2337 C CD2 . HIS B 2 174 ? 47.317  -115.490 -35.926 1.00 34.57 ? 174  HIS B CD2 1 
ATOM   2338 C CE1 . HIS B 2 174 ? 47.875  -115.693 -38.034 1.00 34.76 ? 174  HIS B CE1 1 
ATOM   2339 N NE2 . HIS B 2 174 ? 48.219  -116.033 -36.807 1.00 35.29 ? 174  HIS B NE2 1 
ATOM   2340 N N   . TRP B 2 175 ? 42.649  -116.083 -35.129 1.00 24.45 ? 175  TRP B N   1 
ATOM   2341 C CA  . TRP B 2 175 ? 42.399  -117.291 -34.371 1.00 22.55 ? 175  TRP B CA  1 
ATOM   2342 C C   . TRP B 2 175 ? 42.180  -118.512 -35.262 1.00 22.55 ? 175  TRP B C   1 
ATOM   2343 O O   . TRP B 2 175 ? 42.596  -119.620 -34.916 1.00 21.93 ? 175  TRP B O   1 
ATOM   2344 C CB  . TRP B 2 175 ? 41.191  -117.103 -33.428 1.00 21.88 ? 175  TRP B CB  1 
ATOM   2345 C CG  . TRP B 2 175 ? 39.868  -116.949 -34.146 1.00 19.64 ? 175  TRP B CG  1 
ATOM   2346 C CD1 . TRP B 2 175 ? 39.299  -115.784 -34.570 1.00 18.53 ? 175  TRP B CD1 1 
ATOM   2347 C CD2 . TRP B 2 175 ? 38.952  -118.002 -34.498 1.00 20.47 ? 175  TRP B CD2 1 
ATOM   2348 N NE1 . TRP B 2 175 ? 38.077  -116.046 -35.182 1.00 17.90 ? 175  TRP B NE1 1 
ATOM   2349 C CE2 . TRP B 2 175 ? 37.859  -117.403 -35.160 1.00 18.50 ? 175  TRP B CE2 1 
ATOM   2350 C CE3 . TRP B 2 175 ? 38.978  -119.407 -34.354 1.00 20.73 ? 175  TRP B CE3 1 
ATOM   2351 C CZ2 . TRP B 2 175 ? 36.785  -118.141 -35.658 1.00 19.67 ? 175  TRP B CZ2 1 
ATOM   2352 C CZ3 . TRP B 2 175 ? 37.909  -120.147 -34.859 1.00 19.68 ? 175  TRP B CZ3 1 
ATOM   2353 C CH2 . TRP B 2 175 ? 36.814  -119.510 -35.487 1.00 19.20 ? 175  TRP B CH2 1 
ATOM   2354 N N   . LEU B 2 176 ? 41.521  -118.317 -36.400 1.00 22.76 ? 176  LEU B N   1 
ATOM   2355 C CA  . LEU B 2 176 ? 41.181  -119.449 -37.267 1.00 23.58 ? 176  LEU B CA  1 
ATOM   2356 C C   . LEU B 2 176 ? 42.454  -120.084 -37.867 1.00 23.73 ? 176  LEU B C   1 
ATOM   2357 O O   . LEU B 2 176 ? 42.497  -121.292 -38.117 1.00 23.65 ? 176  LEU B O   1 
ATOM   2358 C CB  . LEU B 2 176 ? 40.120  -119.046 -38.312 1.00 24.15 ? 176  LEU B CB  1 
ATOM   2359 C CG  . LEU B 2 176 ? 39.577  -120.166 -39.204 1.00 26.11 ? 176  LEU B CG  1 
ATOM   2360 C CD1 . LEU B 2 176 ? 38.051  -120.135 -39.332 1.00 25.74 ? 176  LEU B CD1 1 
ATOM   2361 C CD2 . LEU B 2 176 ? 40.270  -120.117 -40.562 1.00 26.53 ? 176  LEU B CD2 1 
ATOM   2362 N N   . SER B 2 177 ? 43.515  -119.287 -37.997 1.00 23.58 ? 177  SER B N   1 
ATOM   2363 C CA  . SER B 2 177 ? 44.785  -119.770 -38.537 1.00 23.55 ? 177  SER B CA  1 
ATOM   2364 C C   . SER B 2 177 ? 45.457  -120.768 -37.608 1.00 22.69 ? 177  SER B C   1 
ATOM   2365 O O   . SER B 2 177 ? 46.386  -121.458 -38.011 1.00 22.91 ? 177  SER B O   1 
ATOM   2366 C CB  . SER B 2 177 ? 45.720  -118.592 -38.818 1.00 23.43 ? 177  SER B CB  1 
ATOM   2367 O OG  . SER B 2 177 ? 45.074  -117.706 -39.728 1.00 27.41 ? 177  SER B OG  1 
ATOM   2368 N N   . HIS B 2 178 ? 44.996  -120.828 -36.359 1.00 22.71 ? 178  HIS B N   1 
ATOM   2369 C CA  . HIS B 2 178 ? 45.534  -121.762 -35.371 1.00 21.68 ? 178  HIS B CA  1 
ATOM   2370 C C   . HIS B 2 178 ? 45.141  -123.232 -35.531 1.00 21.39 ? 178  HIS B C   1 
ATOM   2371 O O   . HIS B 2 178 ? 45.837  -124.090 -34.976 1.00 20.95 ? 178  HIS B O   1 
ATOM   2372 C CB  . HIS B 2 178 ? 45.250  -121.287 -33.936 1.00 21.64 ? 178  HIS B CB  1 
ATOM   2373 C CG  . HIS B 2 178 ? 46.017  -120.065 -33.559 1.00 22.22 ? 178  HIS B CG  1 
ATOM   2374 N ND1 . HIS B 2 178 ? 47.133  -120.108 -32.758 1.00 24.17 ? 178  HIS B ND1 1 
ATOM   2375 C CD2 . HIS B 2 178 ? 45.845  -118.766 -33.900 1.00 21.32 ? 178  HIS B CD2 1 
ATOM   2376 C CE1 . HIS B 2 178 ? 47.616  -118.887 -32.615 1.00 26.04 ? 178  HIS B CE1 1 
ATOM   2377 N NE2 . HIS B 2 178 ? 46.856  -118.054 -33.305 1.00 25.47 ? 178  HIS B NE2 1 
ATOM   2378 N N   . PHE B 2 179 ? 44.076  -123.538 -36.275 1.00 20.88 ? 179  PHE B N   1 
ATOM   2379 C CA  . PHE B 2 179 ? 43.783  -124.940 -36.621 1.00 21.58 ? 179  PHE B CA  1 
ATOM   2380 C C   . PHE B 2 179 ? 45.009  -125.508 -37.362 1.00 21.26 ? 179  PHE B C   1 
ATOM   2381 O O   . PHE B 2 179 ? 45.402  -124.972 -38.399 1.00 20.82 ? 179  PHE B O   1 
ATOM   2382 C CB  . PHE B 2 179 ? 42.518  -125.099 -37.504 1.00 21.46 ? 179  PHE B CB  1 
ATOM   2383 C CG  . PHE B 2 179 ? 41.207  -124.953 -36.766 1.00 23.00 ? 179  PHE B CG  1 
ATOM   2384 C CD1 . PHE B 2 179 ? 40.374  -123.879 -37.047 1.00 21.31 ? 179  PHE B CD1 1 
ATOM   2385 C CD2 . PHE B 2 179 ? 40.780  -125.904 -35.824 1.00 21.10 ? 179  PHE B CD2 1 
ATOM   2386 C CE1 . PHE B 2 179 ? 39.150  -123.732 -36.393 1.00 21.33 ? 179  PHE B CE1 1 
ATOM   2387 C CE2 . PHE B 2 179 ? 39.540  -125.766 -35.143 1.00 22.64 ? 179  PHE B CE2 1 
ATOM   2388 C CZ  . PHE B 2 179 ? 38.723  -124.671 -35.446 1.00 21.77 ? 179  PHE B CZ  1 
ATOM   2389 N N   . PRO B 2 180 ? 45.650  -126.564 -36.816 1.00 21.43 ? 180  PRO B N   1 
ATOM   2390 C CA  . PRO B 2 180 ? 46.836  -127.033 -37.550 1.00 21.42 ? 180  PRO B CA  1 
ATOM   2391 C C   . PRO B 2 180 ? 46.521  -127.743 -38.860 1.00 22.15 ? 180  PRO B C   1 
ATOM   2392 O O   . PRO B 2 180 ? 45.388  -128.109 -39.103 1.00 21.12 ? 180  PRO B O   1 
ATOM   2393 C CB  . PRO B 2 180 ? 47.532  -127.990 -36.571 1.00 21.80 ? 180  PRO B CB  1 
ATOM   2394 C CG  . PRO B 2 180 ? 46.518  -128.413 -35.628 1.00 21.69 ? 180  PRO B CG  1 
ATOM   2395 C CD  . PRO B 2 180 ? 45.400  -127.345 -35.596 1.00 21.04 ? 180  PRO B CD  1 
ATOM   2396 N N   . ASP B 2 181 ? 47.545  -127.925 -39.689 1.00 22.51 ? 181  ASP B N   1 
ATOM   2397 C CA  . ASP B 2 181 ? 47.398  -128.579 -40.983 1.00 23.80 ? 181  ASP B CA  1 
ATOM   2398 C C   . ASP B 2 181 ? 46.940  -130.030 -40.860 1.00 23.81 ? 181  ASP B C   1 
ATOM   2399 O O   . ASP B 2 181 ? 46.351  -130.564 -41.793 1.00 24.04 ? 181  ASP B O   1 
ATOM   2400 C CB  . ASP B 2 181 ? 48.724  -128.527 -41.738 1.00 25.23 ? 181  ASP B CB  1 
ATOM   2401 C CG  . ASP B 2 181 ? 48.908  -127.220 -42.498 1.00 28.08 ? 181  ASP B CG  1 
ATOM   2402 O OD1 . ASP B 2 181 ? 47.993  -126.380 -42.441 1.00 30.91 ? 181  ASP B OD1 1 
ATOM   2403 O OD2 . ASP B 2 181 ? 49.974  -127.037 -43.149 1.00 35.11 ? 181  ASP B OD2 1 
ATOM   2404 N N   . THR B 2 182 ? 47.201  -130.652 -39.706 1.00 23.57 ? 182  THR B N   1 
ATOM   2405 C CA  . THR B 2 182 ? 46.800  -132.039 -39.459 1.00 23.18 ? 182  THR B CA  1 
ATOM   2406 C C   . THR B 2 182 ? 45.323  -132.161 -39.037 1.00 23.49 ? 182  THR B C   1 
ATOM   2407 O O   . THR B 2 182 ? 44.780  -133.268 -38.980 1.00 23.00 ? 182  THR B O   1 
ATOM   2408 C CB  . THR B 2 182 ? 47.683  -132.685 -38.390 1.00 23.36 ? 182  THR B CB  1 
ATOM   2409 O OG1 . THR B 2 182 ? 47.674  -131.867 -37.213 1.00 23.32 ? 182  THR B OG1 1 
ATOM   2410 C CG2 . THR B 2 182 ? 49.103  -132.817 -38.904 1.00 23.69 ? 182  THR B CG2 1 
ATOM   2411 N N   . TYR B 2 183 ? 44.685  -131.022 -38.747 1.00 22.03 ? 183  TYR B N   1 
ATOM   2412 C CA  . TYR B 2 183 ? 43.276  -130.995 -38.370 1.00 22.37 ? 183  TYR B CA  1 
ATOM   2413 C C   . TYR B 2 183 ? 42.346  -131.077 -39.587 1.00 22.68 ? 183  TYR B C   1 
ATOM   2414 O O   . TYR B 2 183 ? 42.457  -130.281 -40.520 1.00 23.18 ? 183  TYR B O   1 
ATOM   2415 C CB  . TYR B 2 183 ? 42.979  -129.745 -37.541 1.00 21.23 ? 183  TYR B CB  1 
ATOM   2416 C CG  . TYR B 2 183 ? 41.512  -129.566 -37.211 1.00 20.63 ? 183  TYR B CG  1 
ATOM   2417 C CD1 . TYR B 2 183 ? 40.948  -130.229 -36.120 1.00 20.03 ? 183  TYR B CD1 1 
ATOM   2418 C CD2 . TYR B 2 183 ? 40.686  -128.738 -37.995 1.00 18.28 ? 183  TYR B CD2 1 
ATOM   2419 C CE1 . TYR B 2 183 ? 39.609  -130.062 -35.792 1.00 21.61 ? 183  TYR B CE1 1 
ATOM   2420 C CE2 . TYR B 2 183 ? 39.351  -128.596 -37.677 1.00 19.58 ? 183  TYR B CE2 1 
ATOM   2421 C CZ  . TYR B 2 183 ? 38.817  -129.267 -36.591 1.00 20.78 ? 183  TYR B CZ  1 
ATOM   2422 O OH  . TYR B 2 183 ? 37.472  -129.119 -36.273 1.00 20.64 ? 183  TYR B OH  1 
ATOM   2423 N N   . THR B 2 184 ? 41.422  -132.044 -39.546 1.00 23.00 ? 184  THR B N   1 
ATOM   2424 C CA  . THR B 2 184 ? 40.578  -132.421 -40.684 1.00 22.62 ? 184  THR B CA  1 
ATOM   2425 C C   . THR B 2 184 ? 39.143  -132.825 -40.217 1.00 22.79 ? 184  THR B C   1 
ATOM   2426 O O   . THR B 2 184 ? 38.323  -133.251 -41.033 1.00 23.27 ? 184  THR B O   1 
ATOM   2427 C CB  . THR B 2 184 ? 41.193  -133.621 -41.492 1.00 23.11 ? 184  THR B CB  1 
ATOM   2428 O OG1 . THR B 2 184 ? 41.262  -134.782 -40.652 1.00 22.24 ? 184  THR B OG1 1 
ATOM   2429 C CG2 . THR B 2 184 ? 42.628  -133.320 -42.023 1.00 22.79 ? 184  THR B CG2 1 
ATOM   2430 N N   . SER B 2 185 ? 38.851  -132.729 -38.915 1.00 22.06 ? 185  SER B N   1 
ATOM   2431 C CA  . SER B 2 185 ? 37.629  -133.341 -38.366 1.00 21.61 ? 185  SER B CA  1 
ATOM   2432 C C   . SER B 2 185 ? 36.392  -132.434 -38.332 1.00 21.60 ? 185  SER B C   1 
ATOM   2433 O O   . SER B 2 185 ? 35.289  -132.868 -37.952 1.00 20.34 ? 185  SER B O   1 
ATOM   2434 C CB  . SER B 2 185 ? 37.911  -133.949 -36.990 1.00 23.23 ? 185  SER B CB  1 
ATOM   2435 O OG  . SER B 2 185 ? 38.483  -132.999 -36.099 1.00 22.80 ? 185  SER B OG  1 
ATOM   2436 N N   . LEU B 2 186 ? 36.544  -131.178 -38.758 1.00 21.16 ? 186  LEU B N   1 
ATOM   2437 C CA  . LEU B 2 186 ? 35.412  -130.236 -38.615 1.00 20.86 ? 186  LEU B CA  1 
ATOM   2438 C C   . LEU B 2 186 ? 34.177  -130.713 -39.367 1.00 19.90 ? 186  LEU B C   1 
ATOM   2439 O O   . LEU B 2 186 ? 34.258  -131.040 -40.562 1.00 21.10 ? 186  LEU B O   1 
ATOM   2440 C CB  . LEU B 2 186 ? 35.799  -128.839 -39.124 1.00 20.10 ? 186  LEU B CB  1 
ATOM   2441 C CG  . LEU B 2 186 ? 34.855  -127.637 -38.879 1.00 21.62 ? 186  LEU B CG  1 
ATOM   2442 C CD1 . LEU B 2 186 ? 34.719  -127.354 -37.392 1.00 23.19 ? 186  LEU B CD1 1 
ATOM   2443 C CD2 . LEU B 2 186 ? 35.477  -126.450 -39.609 1.00 21.83 ? 186  LEU B CD2 1 
ATOM   2444 N N   . VAL B 2 187 ? 33.038  -130.697 -38.674 1.00 20.69 ? 187  VAL B N   1 
ATOM   2445 C CA  . VAL B 2 187 ? 31.721  -130.959 -39.246 1.00 20.67 ? 187  VAL B CA  1 
ATOM   2446 C C   . VAL B 2 187 ? 30.785  -129.721 -39.319 1.00 20.85 ? 187  VAL B C   1 
ATOM   2447 O O   . VAL B 2 187 ? 29.991  -129.577 -40.267 1.00 20.46 ? 187  VAL B O   1 
ATOM   2448 C CB  . VAL B 2 187 ? 31.034  -132.103 -38.432 1.00 21.24 ? 187  VAL B CB  1 
ATOM   2449 C CG1 . VAL B 2 187 ? 29.550  -132.277 -38.797 1.00 23.19 ? 187  VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 2 187 ? 31.836  -133.434 -38.563 1.00 22.17 ? 187  VAL B CG2 1 
ATOM   2451 N N   . SER B 2 188 ? 30.855  -128.847 -38.314 1.00 22.47 ? 188  SER B N   1 
ATOM   2452 C CA  . SER B 2 188 ? 29.931  -127.701 -38.218 1.00 22.14 ? 188  SER B CA  1 
ATOM   2453 C C   . SER B 2 188 ? 30.695  -126.515 -37.712 1.00 23.10 ? 188  SER B C   1 
ATOM   2454 O O   . SER B 2 188 ? 31.299  -126.590 -36.654 1.00 22.85 ? 188  SER B O   1 
ATOM   2455 C CB  . SER B 2 188 ? 28.738  -128.017 -37.273 1.00 22.26 ? 188  SER B CB  1 
ATOM   2456 O OG  . SER B 2 188 ? 27.942  -126.848 -37.040 1.00 26.09 ? 188  SER B OG  1 
ATOM   2457 N N   . LEU B 2 189 ? 30.640  -125.394 -38.439 1.00 21.18 ? 189  LEU B N   1 
ATOM   2458 C CA  . LEU B 2 189 ? 31.342  -124.192 -38.025 1.00 21.02 ? 189  LEU B CA  1 
ATOM   2459 C C   . LEU B 2 189 ? 30.354  -123.022 -38.185 1.00 20.61 ? 189  LEU B C   1 
ATOM   2460 O O   . LEU B 2 189 ? 29.915  -122.724 -39.284 1.00 21.18 ? 189  LEU B O   1 
ATOM   2461 C CB  . LEU B 2 189 ? 32.576  -123.939 -38.888 1.00 21.05 ? 189  LEU B CB  1 
ATOM   2462 C CG  . LEU B 2 189 ? 33.396  -122.669 -38.549 1.00 20.41 ? 189  LEU B CG  1 
ATOM   2463 C CD1 . LEU B 2 189 ? 33.998  -122.740 -37.122 1.00 20.85 ? 189  LEU B CD1 1 
ATOM   2464 C CD2 . LEU B 2 189 ? 34.502  -122.429 -39.556 1.00 21.86 ? 189  LEU B CD2 1 
ATOM   2465 N N   . ASN B 2 190 ? 29.993  -122.414 -37.075 1.00 20.81 ? 190  ASN B N   1 
ATOM   2466 C CA  . ASN B 2 190 ? 29.107  -121.262 -37.106 1.00 19.81 ? 190  ASN B CA  1 
ATOM   2467 C C   . ASN B 2 190 ? 29.843  -120.074 -36.489 1.00 21.29 ? 190  ASN B C   1 
ATOM   2468 O O   . ASN B 2 190 ? 29.931  -119.954 -35.246 1.00 20.40 ? 190  ASN B O   1 
ATOM   2469 C CB  . ASN B 2 190 ? 27.802  -121.543 -36.371 1.00 19.15 ? 190  ASN B CB  1 
ATOM   2470 C CG  . ASN B 2 190 ? 26.835  -120.360 -36.441 1.00 21.21 ? 190  ASN B CG  1 
ATOM   2471 O OD1 . ASN B 2 190 ? 27.189  -119.308 -36.984 1.00 21.58 ? 190  ASN B OD1 1 
ATOM   2472 N ND2 . ASN B 2 190 ? 25.650  -120.500 -35.880 1.00 21.42 ? 190  ASN B ND2 1 
ATOM   2473 N N   . ILE B 2 191 ? 30.357  -119.194 -37.354 1.00 21.10 ? 191  ILE B N   1 
ATOM   2474 C CA  . ILE B 2 191 ? 31.046  -117.973 -36.909 1.00 21.08 ? 191  ILE B CA  1 
ATOM   2475 C C   . ILE B 2 191 ? 30.258  -116.714 -37.265 1.00 21.75 ? 191  ILE B C   1 
ATOM   2476 O O   . ILE B 2 191 ? 30.829  -115.632 -37.329 1.00 22.33 ? 191  ILE B O   1 
ATOM   2477 C CB  . ILE B 2 191 ? 32.489  -117.865 -37.476 1.00 21.25 ? 191  ILE B CB  1 
ATOM   2478 C CG1 . ILE B 2 191 ? 32.461  -117.919 -39.018 1.00 22.30 ? 191  ILE B CG1 1 
ATOM   2479 C CG2 . ILE B 2 191 ? 33.374  -118.972 -36.880 1.00 20.73 ? 191  ILE B CG2 1 
ATOM   2480 C CD1 . ILE B 2 191 ? 33.804  -117.568 -39.699 1.00 21.86 ? 191  ILE B CD1 1 
ATOM   2481 N N   . SER B 2 192 ? 28.949  -116.858 -37.455 1.00 22.25 ? 192  SER B N   1 
ATOM   2482 C CA  . SER B 2 192 ? 28.101  -115.755 -37.964 1.00 23.15 ? 192  SER B CA  1 
ATOM   2483 C C   . SER B 2 192 ? 28.022  -114.507 -37.067 1.00 22.96 ? 192  SER B C   1 
ATOM   2484 O O   . SER B 2 192 ? 27.673  -113.419 -37.554 1.00 23.31 ? 192  SER B O   1 
ATOM   2485 C CB  . SER B 2 192 ? 26.705  -116.277 -38.304 1.00 23.29 ? 192  SER B CB  1 
ATOM   2486 O OG  . SER B 2 192 ? 26.036  -116.700 -37.132 1.00 25.71 ? 192  SER B OG  1 
ATOM   2487 N N   . CYS B 2 193 ? 28.385  -114.643 -35.797 1.00 21.99 ? 193  CYS B N   1 
ATOM   2488 C CA  . CYS B 2 193 ? 28.335  -113.546 -34.835 1.00 22.65 ? 193  CYS B CA  1 
ATOM   2489 C C   . CYS B 2 193 ? 29.649  -112.740 -34.757 1.00 22.46 ? 193  CYS B C   1 
ATOM   2490 O O   . CYS B 2 193 ? 29.715  -111.698 -34.068 1.00 21.78 ? 193  CYS B O   1 
ATOM   2491 C CB  . CYS B 2 193 ? 28.008  -114.087 -33.424 1.00 21.67 ? 193  CYS B CB  1 
ATOM   2492 S SG  . CYS B 2 193 ? 29.315  -115.174 -32.708 1.00 26.40 ? 193  CYS B SG  1 
ATOM   2493 N N   . LEU B 2 194 ? 30.690  -113.216 -35.440 1.00 21.61 ? 194  LEU B N   1 
ATOM   2494 C CA  . LEU B 2 194 ? 32.009  -112.589 -35.343 1.00 22.37 ? 194  LEU B CA  1 
ATOM   2495 C C   . LEU B 2 194 ? 32.144  -111.395 -36.266 1.00 23.66 ? 194  LEU B C   1 
ATOM   2496 O O   . LEU B 2 194 ? 31.913  -111.483 -37.478 1.00 23.03 ? 194  LEU B O   1 
ATOM   2497 C CB  . LEU B 2 194 ? 33.137  -113.598 -35.613 1.00 21.51 ? 194  LEU B CB  1 
ATOM   2498 C CG  . LEU B 2 194 ? 33.240  -114.770 -34.661 1.00 22.32 ? 194  LEU B CG  1 
ATOM   2499 C CD1 . LEU B 2 194 ? 34.423  -115.622 -35.049 1.00 21.49 ? 194  LEU B CD1 1 
ATOM   2500 C CD2 . LEU B 2 194 ? 33.381  -114.269 -33.199 1.00 22.18 ? 194  LEU B CD2 1 
ATOM   2501 N N   . ALA B 2 195 ? 32.512  -110.258 -35.684 1.00 25.65 ? 195  ALA B N   1 
ATOM   2502 C CA  . ALA B 2 195 ? 32.633  -109.030 -36.458 1.00 26.86 ? 195  ALA B CA  1 
ATOM   2503 C C   . ALA B 2 195 ? 33.971  -108.979 -37.186 1.00 28.65 ? 195  ALA B C   1 
ATOM   2504 O O   . ALA B 2 195 ? 34.094  -108.329 -38.230 1.00 29.65 ? 195  ALA B O   1 
ATOM   2505 C CB  . ALA B 2 195 ? 32.473  -107.807 -35.545 1.00 26.99 ? 195  ALA B CB  1 
ATOM   2506 N N   . SER B 2 196 ? 34.969  -109.666 -36.645 1.00 29.23 ? 196  SER B N   1 
ATOM   2507 C CA  . SER B 2 196 ? 36.315  -109.624 -37.205 1.00 30.07 ? 196  SER B CA  1 
ATOM   2508 C C   . SER B 2 196 ? 36.473  -110.616 -38.361 1.00 30.23 ? 196  SER B C   1 
ATOM   2509 O O   . SER B 2 196 ? 35.885  -111.726 -38.363 1.00 30.39 ? 196  SER B O   1 
ATOM   2510 C CB  . SER B 2 196 ? 37.366  -109.873 -36.116 1.00 30.21 ? 196  SER B CB  1 
ATOM   2511 O OG  . SER B 2 196 ? 37.131  -111.117 -35.437 1.00 32.98 ? 196  SER B OG  1 
ATOM   2512 N N   . GLU B 2 197 ? 37.281  -110.214 -39.333 1.00 29.13 ? 197  GLU B N   1 
ATOM   2513 C CA  . GLU B 2 197 ? 37.450  -110.959 -40.566 1.00 29.01 ? 197  GLU B CA  1 
ATOM   2514 C C   . GLU B 2 197 ? 38.501  -112.048 -40.353 1.00 28.32 ? 197  GLU B C   1 
ATOM   2515 O O   . GLU B 2 197 ? 39.638  -111.741 -40.005 1.00 27.34 ? 197  GLU B O   1 
ATOM   2516 C CB  . GLU B 2 197 ? 37.904  -109.995 -41.689 1.00 28.78 ? 197  GLU B CB  1 
ATOM   2517 C CG  . GLU B 2 197 ? 38.183  -110.692 -43.015 1.00 29.20 ? 197  GLU B CG  1 
ATOM   2518 C CD  . GLU B 2 197 ? 38.856  -109.809 -44.062 1.00 30.52 ? 197  GLU B CD  1 
ATOM   2519 O OE1 . GLU B 2 197 ? 39.193  -108.635 -43.776 1.00 32.60 ? 197  GLU B OE1 1 
ATOM   2520 O OE2 . GLU B 2 197 ? 39.066  -110.309 -45.186 1.00 32.13 ? 197  GLU B OE2 1 
ATOM   2521 N N   . VAL B 2 198 ? 38.143  -113.312 -40.548 1.00 27.67 ? 198  VAL B N   1 
ATOM   2522 C CA  . VAL B 2 198 ? 39.176  -114.372 -40.525 1.00 27.45 ? 198  VAL B CA  1 
ATOM   2523 C C   . VAL B 2 198 ? 40.075  -114.310 -41.781 1.00 27.42 ? 198  VAL B C   1 
ATOM   2524 O O   . VAL B 2 198 ? 39.709  -113.674 -42.768 1.00 27.74 ? 198  VAL B O   1 
ATOM   2525 C CB  . VAL B 2 198 ? 38.546  -115.778 -40.331 1.00 27.75 ? 198  VAL B CB  1 
ATOM   2526 C CG1 . VAL B 2 198 ? 37.745  -115.800 -39.040 1.00 27.64 ? 198  VAL B CG1 1 
ATOM   2527 C CG2 . VAL B 2 198 ? 37.658  -116.157 -41.527 1.00 27.25 ? 198  VAL B CG2 1 
ATOM   2528 N N   . SER B 2 199 ? 41.262  -114.922 -41.737 1.00 26.83 ? 199  SER B N   1 
ATOM   2529 C CA  . SER B 2 199 ? 42.104  -115.028 -42.933 1.00 26.30 ? 199  SER B CA  1 
ATOM   2530 C C   . SER B 2 199 ? 41.345  -115.870 -43.957 1.00 25.96 ? 199  SER B C   1 
ATOM   2531 O O   . SER B 2 199 ? 41.006  -117.026 -43.678 1.00 25.49 ? 199  SER B O   1 
ATOM   2532 C CB  . SER B 2 199 ? 43.428  -115.706 -42.596 1.00 26.44 ? 199  SER B CB  1 
ATOM   2533 O OG  . SER B 2 199 ? 44.068  -116.214 -43.767 1.00 28.08 ? 199  SER B OG  1 
ATOM   2534 N N   . PHE B 2 200 ? 41.031  -115.297 -45.116 1.00 24.72 ? 200  PHE B N   1 
ATOM   2535 C CA  . PHE B 2 200 ? 40.263  -116.071 -46.085 1.00 24.28 ? 200  PHE B CA  1 
ATOM   2536 C C   . PHE B 2 200 ? 41.074  -117.278 -46.590 1.00 24.60 ? 200  PHE B C   1 
ATOM   2537 O O   . PHE B 2 200 ? 40.528  -118.369 -46.805 1.00 23.85 ? 200  PHE B O   1 
ATOM   2538 C CB  . PHE B 2 200 ? 39.792  -115.221 -47.273 1.00 24.12 ? 200  PHE B CB  1 
ATOM   2539 C CG  . PHE B 2 200 ? 38.978  -116.005 -48.253 1.00 23.33 ? 200  PHE B CG  1 
ATOM   2540 C CD1 . PHE B 2 200 ? 37.633  -116.269 -47.998 1.00 23.92 ? 200  PHE B CD1 1 
ATOM   2541 C CD2 . PHE B 2 200 ? 39.573  -116.561 -49.381 1.00 24.32 ? 200  PHE B CD2 1 
ATOM   2542 C CE1 . PHE B 2 200 ? 36.878  -117.040 -48.866 1.00 23.39 ? 200  PHE B CE1 1 
ATOM   2543 C CE2 . PHE B 2 200 ? 38.832  -117.323 -50.263 1.00 24.31 ? 200  PHE B CE2 1 
ATOM   2544 C CZ  . PHE B 2 200 ? 37.482  -117.577 -50.006 1.00 22.82 ? 200  PHE B CZ  1 
ATOM   2545 N N   . SER B 2 201 ? 42.378  -117.079 -46.781 1.00 24.52 ? 201  SER B N   1 
ATOM   2546 C CA  . SER B 2 201 ? 43.247  -118.181 -47.178 1.00 25.04 ? 201  SER B CA  1 
ATOM   2547 C C   . SER B 2 201 ? 43.207  -119.312 -46.147 1.00 24.37 ? 201  SER B C   1 
ATOM   2548 O O   . SER B 2 201 ? 43.002  -120.460 -46.518 1.00 24.50 ? 201  SER B O   1 
ATOM   2549 C CB  . SER B 2 201 ? 44.676  -117.706 -47.508 1.00 25.67 ? 201  SER B CB  1 
ATOM   2550 O OG  . SER B 2 201 ? 45.379  -117.295 -46.354 1.00 26.87 ? 201  SER B OG  1 
ATOM   2551 N N   . ALA B 2 202 ? 43.316  -118.988 -44.862 1.00 24.20 ? 202  ALA B N   1 
ATOM   2552 C CA  . ALA B 2 202 ? 43.194  -120.021 -43.823 1.00 24.12 ? 202  ALA B CA  1 
ATOM   2553 C C   . ALA B 2 202 ? 41.823  -120.718 -43.825 1.00 24.25 ? 202  ALA B C   1 
ATOM   2554 O O   . ALA B 2 202 ? 41.767  -121.932 -43.691 1.00 23.99 ? 202  ALA B O   1 
ATOM   2555 C CB  . ALA B 2 202 ? 43.553  -119.482 -42.423 1.00 23.73 ? 202  ALA B CB  1 
ATOM   2556 N N   . LEU B 2 203 ? 40.737  -119.955 -44.001 1.00 23.80 ? 203  LEU B N   1 
ATOM   2557 C CA  . LEU B 2 203 ? 39.388  -120.516 -44.140 1.00 23.70 ? 203  LEU B CA  1 
ATOM   2558 C C   . LEU B 2 203 ? 39.252  -121.444 -45.358 1.00 23.36 ? 203  LEU B C   1 
ATOM   2559 O O   . LEU B 2 203 ? 38.735  -122.559 -45.232 1.00 22.81 ? 203  LEU B O   1 
ATOM   2560 C CB  . LEU B 2 203 ? 38.352  -119.385 -44.215 1.00 23.37 ? 203  LEU B CB  1 
ATOM   2561 C CG  . LEU B 2 203 ? 36.860  -119.743 -44.342 1.00 24.66 ? 203  LEU B CG  1 
ATOM   2562 C CD1 . LEU B 2 203 ? 36.345  -120.621 -43.143 1.00 25.58 ? 203  LEU B CD1 1 
ATOM   2563 C CD2 . LEU B 2 203 ? 36.001  -118.468 -44.516 1.00 23.60 ? 203  LEU B CD2 1 
ATOM   2564 N N   . GLU B 2 204 ? 39.762  -121.013 -46.513 1.00 23.67 ? 204  GLU B N   1 
ATOM   2565 C CA  . GLU B 2 204 ? 39.721  -121.850 -47.709 1.00 24.06 ? 204  GLU B CA  1 
ATOM   2566 C C   . GLU B 2 204 ? 40.477  -123.206 -47.532 1.00 24.45 ? 204  GLU B C   1 
ATOM   2567 O O   . GLU B 2 204 ? 39.969  -124.263 -47.917 1.00 24.78 ? 204  GLU B O   1 
ATOM   2568 C CB  . GLU B 2 204 ? 40.227  -121.086 -48.939 1.00 24.76 ? 204  GLU B CB  1 
ATOM   2569 C CG  . GLU B 2 204 ? 39.777  -121.769 -50.203 1.00 27.13 ? 204  GLU B CG  1 
ATOM   2570 C CD  . GLU B 2 204 ? 40.386  -121.229 -51.464 1.00 31.27 ? 204  GLU B CD  1 
ATOM   2571 O OE1 . GLU B 2 204 ? 40.908  -120.082 -51.469 1.00 33.70 ? 204  GLU B OE1 1 
ATOM   2572 O OE2 . GLU B 2 204 ? 40.319  -121.969 -52.473 1.00 31.53 ? 204  GLU B OE2 1 
ATOM   2573 N N   . ARG B 2 205 ? 41.662  -123.174 -46.930 1.00 23.51 ? 205  ARG B N   1 
ATOM   2574 C CA  . ARG B 2 205 ? 42.425  -124.397 -46.661 1.00 24.23 ? 205  ARG B CA  1 
ATOM   2575 C C   . ARG B 2 205 ? 41.744  -125.285 -45.640 1.00 23.60 ? 205  ARG B C   1 
ATOM   2576 O O   . ARG B 2 205 ? 41.783  -126.506 -45.755 1.00 22.44 ? 205  ARG B O   1 
ATOM   2577 C CB  . ARG B 2 205 ? 43.829  -124.060 -46.168 1.00 24.10 ? 205  ARG B CB  1 
ATOM   2578 C CG  . ARG B 2 205 ? 44.750  -123.605 -47.290 1.00 26.61 ? 205  ARG B CG  1 
ATOM   2579 C CD  . ARG B 2 205 ? 46.144  -123.340 -46.755 1.00 31.86 ? 205  ARG B CD  1 
ATOM   2580 N NE  . ARG B 2 205 ? 46.299  -121.967 -46.269 1.00 36.04 ? 205  ARG B NE  1 
ATOM   2581 C CZ  . ARG B 2 205 ? 46.434  -121.614 -44.988 1.00 37.83 ? 205  ARG B CZ  1 
ATOM   2582 N NH1 . ARG B 2 205 ? 46.441  -122.533 -44.016 1.00 37.74 ? 205  ARG B NH1 1 
ATOM   2583 N NH2 . ARG B 2 205 ? 46.574  -120.324 -44.687 1.00 38.42 ? 205  ARG B NH2 1 
ATOM   2584 N N   . LEU B 2 206 ? 41.115  -124.657 -44.647 1.00 24.50 ? 206  LEU B N   1 
ATOM   2585 C CA  . LEU B 2 206 ? 40.384  -125.371 -43.591 1.00 24.63 ? 206  LEU B CA  1 
ATOM   2586 C C   . LEU B 2 206 ? 39.229  -126.152 -44.223 1.00 24.54 ? 206  LEU B C   1 
ATOM   2587 O O   . LEU B 2 206 ? 39.099  -127.357 -44.030 1.00 24.74 ? 206  LEU B O   1 
ATOM   2588 C CB  . LEU B 2 206 ? 39.838  -124.387 -42.549 1.00 25.09 ? 206  LEU B CB  1 
ATOM   2589 C CG  . LEU B 2 206 ? 39.605  -124.754 -41.058 1.00 26.85 ? 206  LEU B CG  1 
ATOM   2590 C CD1 . LEU B 2 206 ? 38.463  -123.966 -40.410 1.00 22.10 ? 206  LEU B CD1 1 
ATOM   2591 C CD2 . LEU B 2 206 ? 39.554  -126.216 -40.716 1.00 27.83 ? 206  LEU B CD2 1 
ATOM   2592 N N   . VAL B 2 207 ? 38.389  -125.451 -44.980 1.00 24.75 ? 207  VAL B N   1 
ATOM   2593 C CA  . VAL B 2 207 ? 37.230  -126.066 -45.660 1.00 24.02 ? 207  VAL B CA  1 
ATOM   2594 C C   . VAL B 2 207 ? 37.677  -127.207 -46.595 1.00 24.32 ? 207  VAL B C   1 
ATOM   2595 O O   . VAL B 2 207 ? 37.063  -128.281 -46.606 1.00 24.63 ? 207  VAL B O   1 
ATOM   2596 C CB  . VAL B 2 207 ? 36.437  -125.008 -46.445 1.00 24.12 ? 207  VAL B CB  1 
ATOM   2597 C CG1 . VAL B 2 207 ? 35.397  -125.664 -47.358 1.00 24.54 ? 207  VAL B CG1 1 
ATOM   2598 C CG2 . VAL B 2 207 ? 35.752  -124.056 -45.487 1.00 23.60 ? 207  VAL B CG2 1 
ATOM   2599 N N   . THR B 2 208 ? 38.764  -126.973 -47.336 1.00 24.19 ? 208  THR B N   1 
ATOM   2600 C CA  . THR B 2 208 ? 39.315  -127.952 -48.281 1.00 24.48 ? 208  THR B CA  1 
ATOM   2601 C C   . THR B 2 208 ? 39.756  -129.245 -47.594 1.00 24.14 ? 208  THR B C   1 
ATOM   2602 O O   . THR B 2 208 ? 39.518  -130.336 -48.122 1.00 25.40 ? 208  THR B O   1 
ATOM   2603 C CB  . THR B 2 208 ? 40.490  -127.343 -49.085 1.00 24.78 ? 208  THR B CB  1 
ATOM   2604 O OG1 . THR B 2 208 ? 40.034  -126.155 -49.735 1.00 25.10 ? 208  THR B OG1 1 
ATOM   2605 C CG2 . THR B 2 208 ? 41.029  -128.314 -50.124 1.00 25.31 ? 208  THR B CG2 1 
ATOM   2606 N N   . ARG B 2 209 ? 40.377  -129.141 -46.421 1.00 23.60 ? 209  ARG B N   1 
ATOM   2607 C CA  . ARG B 2 209 ? 40.906  -130.331 -45.757 1.00 23.02 ? 209  ARG B CA  1 
ATOM   2608 C C   . ARG B 2 209 ? 39.939  -131.034 -44.796 1.00 22.78 ? 209  ARG B C   1 
ATOM   2609 O O   . ARG B 2 209 ? 40.297  -132.025 -44.131 1.00 21.39 ? 209  ARG B O   1 
ATOM   2610 C CB  . ARG B 2 209 ? 42.274  -130.052 -45.111 1.00 23.28 ? 209  ARG B CB  1 
ATOM   2611 C CG  . ARG B 2 209 ? 42.251  -129.184 -43.866 1.00 23.15 ? 209  ARG B CG  1 
ATOM   2612 C CD  . ARG B 2 209 ? 43.668  -129.045 -43.348 1.00 23.60 ? 209  ARG B CD  1 
ATOM   2613 N NE  . ARG B 2 209 ? 43.699  -128.347 -42.063 1.00 25.11 ? 209  ARG B NE  1 
ATOM   2614 C CZ  . ARG B 2 209 ? 43.750  -127.022 -41.943 1.00 24.97 ? 209  ARG B CZ  1 
ATOM   2615 N NH1 . ARG B 2 209 ? 43.796  -126.264 -43.027 1.00 24.46 ? 209  ARG B NH1 1 
ATOM   2616 N NH2 . ARG B 2 209 ? 43.772  -126.457 -40.750 1.00 23.86 ? 209  ARG B NH2 1 
ATOM   2617 N N   . CYS B 2 210 ? 38.708  -130.546 -44.740 1.00 21.79 ? 210  CYS B N   1 
ATOM   2618 C CA  . CYS B 2 210 ? 37.722  -131.122 -43.841 1.00 23.08 ? 210  CYS B CA  1 
ATOM   2619 C C   . CYS B 2 210 ? 36.580  -131.728 -44.640 1.00 23.52 ? 210  CYS B C   1 
ATOM   2620 O O   . CYS B 2 210 ? 35.547  -131.060 -44.855 1.00 23.72 ? 210  CYS B O   1 
ATOM   2621 C CB  . CYS B 2 210 ? 37.183  -130.058 -42.870 1.00 22.91 ? 210  CYS B CB  1 
ATOM   2622 S SG  . CYS B 2 210 ? 38.379  -129.488 -41.649 1.00 23.78 ? 210  CYS B SG  1 
ATOM   2623 N N   . PRO B 2 211 ? 36.733  -132.996 -45.063 1.00 23.96 ? 211  PRO B N   1 
ATOM   2624 C CA  . PRO B 2 211 ? 35.751  -133.540 -45.999 1.00 24.06 ? 211  PRO B CA  1 
ATOM   2625 C C   . PRO B 2 211 ? 34.395  -133.896 -45.364 1.00 24.08 ? 211  PRO B C   1 
ATOM   2626 O O   . PRO B 2 211 ? 33.431  -134.134 -46.097 1.00 23.75 ? 211  PRO B O   1 
ATOM   2627 C CB  . PRO B 2 211 ? 36.468  -134.773 -46.572 1.00 24.64 ? 211  PRO B CB  1 
ATOM   2628 C CG  . PRO B 2 211 ? 37.361  -135.229 -45.443 1.00 25.21 ? 211  PRO B CG  1 
ATOM   2629 C CD  . PRO B 2 211 ? 37.760  -133.986 -44.685 1.00 24.45 ? 211  PRO B CD  1 
ATOM   2630 N N   . ASN B 2 212 ? 34.317  -133.913 -44.026 1.00 23.44 ? 212  ASN B N   1 
ATOM   2631 C CA  . ASN B 2 212 ? 33.047  -134.164 -43.324 1.00 22.77 ? 212  ASN B CA  1 
ATOM   2632 C C   . ASN B 2 212 ? 32.287  -132.904 -42.925 1.00 22.41 ? 212  ASN B C   1 
ATOM   2633 O O   . ASN B 2 212 ? 31.274  -132.978 -42.203 1.00 21.01 ? 212  ASN B O   1 
ATOM   2634 C CB  . ASN B 2 212 ? 33.298  -135.027 -42.090 1.00 22.84 ? 212  ASN B CB  1 
ATOM   2635 C CG  . ASN B 2 212 ? 33.913  -136.364 -42.449 1.00 27.22 ? 212  ASN B CG  1 
ATOM   2636 O OD1 . ASN B 2 212 ? 33.563  -136.955 -43.468 1.00 27.03 ? 212  ASN B OD1 1 
ATOM   2637 N ND2 . ASN B 2 212 ? 34.849  -136.838 -41.624 1.00 28.63 ? 212  ASN B ND2 1 
ATOM   2638 N N   . LEU B 2 213 ? 32.780  -131.749 -43.372 1.00 21.76 ? 213  LEU B N   1 
ATOM   2639 C CA  . LEU B 2 213 ? 32.095  -130.470 -43.106 1.00 22.51 ? 213  LEU B CA  1 
ATOM   2640 C C   . LEU B 2 213 ? 30.699  -130.484 -43.723 1.00 23.33 ? 213  LEU B C   1 
ATOM   2641 O O   . LEU B 2 213 ? 30.560  -130.675 -44.943 1.00 24.21 ? 213  LEU B O   1 
ATOM   2642 C CB  . LEU B 2 213 ? 32.896  -129.314 -43.702 1.00 22.42 ? 213  LEU B CB  1 
ATOM   2643 C CG  . LEU B 2 213 ? 32.408  -127.861 -43.471 1.00 21.35 ? 213  LEU B CG  1 
ATOM   2644 C CD1 . LEU B 2 213 ? 32.426  -127.476 -41.997 1.00 20.67 ? 213  LEU B CD1 1 
ATOM   2645 C CD2 . LEU B 2 213 ? 33.287  -126.916 -44.315 1.00 22.68 ? 213  LEU B CD2 1 
ATOM   2646 N N   . LYS B 2 214 ? 29.676  -130.319 -42.878 1.00 23.08 ? 214  LYS B N   1 
ATOM   2647 C CA  . LYS B 2 214 ? 28.293  -130.318 -43.341 1.00 23.80 ? 214  LYS B CA  1 
ATOM   2648 C C   . LYS B 2 214 ? 27.570  -128.986 -43.169 1.00 22.89 ? 214  LYS B C   1 
ATOM   2649 O O   . LYS B 2 214 ? 26.593  -128.714 -43.874 1.00 23.86 ? 214  LYS B O   1 
ATOM   2650 C CB  . LYS B 2 214 ? 27.505  -131.426 -42.654 1.00 23.65 ? 214  LYS B CB  1 
ATOM   2651 C CG  . LYS B 2 214 ? 27.980  -132.830 -43.026 1.00 26.91 ? 214  LYS B CG  1 
ATOM   2652 C CD  . LYS B 2 214 ? 27.502  -133.233 -44.390 1.00 32.04 ? 214  LYS B CD  1 
ATOM   2653 C CE  . LYS B 2 214 ? 28.003  -134.632 -44.746 1.00 33.85 ? 214  LYS B CE  1 
ATOM   2654 N NZ  . LYS B 2 214 ? 29.254  -134.523 -45.515 1.00 39.93 ? 214  LYS B NZ  1 
ATOM   2655 N N   . SER B 2 215 ? 28.021  -128.175 -42.207 1.00 22.48 ? 215  SER B N   1 
ATOM   2656 C CA  . SER B 2 215 ? 27.361  -126.917 -41.871 1.00 21.51 ? 215  SER B CA  1 
ATOM   2657 C C   . SER B 2 215 ? 28.415  -125.837 -41.753 1.00 22.49 ? 215  SER B C   1 
ATOM   2658 O O   . SER B 2 215 ? 29.368  -125.959 -40.953 1.00 22.60 ? 215  SER B O   1 
ATOM   2659 C CB  . SER B 2 215 ? 26.581  -127.013 -40.540 1.00 22.50 ? 215  SER B CB  1 
ATOM   2660 O OG  . SER B 2 215 ? 25.953  -125.740 -40.251 1.00 21.76 ? 215  SER B OG  1 
ATOM   2661 N N   . LEU B 2 216 ? 28.267  -124.784 -42.552 1.00 21.72 ? 216  LEU B N   1 
ATOM   2662 C CA  . LEU B 2 216 ? 29.240  -123.703 -42.566 1.00 22.16 ? 216  LEU B CA  1 
ATOM   2663 C C   . LEU B 2 216 ? 28.472  -122.400 -42.557 1.00 21.88 ? 216  LEU B C   1 
ATOM   2664 O O   . LEU B 2 216 ? 27.831  -122.054 -43.553 1.00 22.95 ? 216  LEU B O   1 
ATOM   2665 C CB  . LEU B 2 216 ? 30.110  -123.776 -43.828 1.00 22.51 ? 216  LEU B CB  1 
ATOM   2666 C CG  . LEU B 2 216 ? 31.188  -122.684 -43.986 1.00 22.85 ? 216  LEU B CG  1 
ATOM   2667 C CD1 . LEU B 2 216 ? 32.190  -122.733 -42.848 1.00 22.97 ? 216  LEU B CD1 1 
ATOM   2668 C CD2 . LEU B 2 216 ? 31.902  -122.860 -45.337 1.00 22.81 ? 216  LEU B CD2 1 
ATOM   2669 N N   . LYS B 2 217 ? 28.472  -121.704 -41.424 1.00 21.63 ? 217  LYS B N   1 
ATOM   2670 C CA  . LYS B 2 217 ? 27.742  -120.438 -41.329 1.00 22.03 ? 217  LYS B CA  1 
ATOM   2671 C C   . LYS B 2 217 ? 28.752  -119.335 -41.148 1.00 22.26 ? 217  LYS B C   1 
ATOM   2672 O O   . LYS B 2 217 ? 29.403  -119.229 -40.112 1.00 22.45 ? 217  LYS B O   1 
ATOM   2673 C CB  . LYS B 2 217 ? 26.687  -120.454 -40.225 1.00 22.03 ? 217  LYS B CB  1 
ATOM   2674 C CG  . LYS B 2 217 ? 25.619  -121.500 -40.539 1.00 23.38 ? 217  LYS B CG  1 
ATOM   2675 C CD  . LYS B 2 217 ? 24.715  -121.654 -39.380 1.00 28.32 ? 217  LYS B CD  1 
ATOM   2676 C CE  . LYS B 2 217 ? 23.667  -122.696 -39.648 1.00 31.20 ? 217  LYS B CE  1 
ATOM   2677 N NZ  . LYS B 2 217 ? 22.645  -122.733 -38.546 1.00 34.80 ? 217  LYS B NZ  1 
ATOM   2678 N N   . LEU B 2 218 ? 28.905  -118.538 -42.197 1.00 21.59 ? 218  LEU B N   1 
ATOM   2679 C CA  . LEU B 2 218 ? 29.959  -117.562 -42.249 1.00 21.09 ? 218  LEU B CA  1 
ATOM   2680 C C   . LEU B 2 218 ? 29.596  -116.257 -41.570 1.00 22.19 ? 218  LEU B C   1 
ATOM   2681 O O   . LEU B 2 218 ? 28.437  -116.026 -41.198 1.00 22.37 ? 218  LEU B O   1 
ATOM   2682 C CB  . LEU B 2 218 ? 30.328  -117.283 -43.729 1.00 21.02 ? 218  LEU B CB  1 
ATOM   2683 C CG  . LEU B 2 218 ? 30.787  -118.489 -44.549 1.00 20.04 ? 218  LEU B CG  1 
ATOM   2684 C CD1 . LEU B 2 218 ? 30.850  -118.122 -46.049 1.00 22.19 ? 218  LEU B CD1 1 
ATOM   2685 C CD2 . LEU B 2 218 ? 32.160  -119.014 -44.007 1.00 18.25 ? 218  LEU B CD2 1 
ATOM   2686 N N   . ASN B 2 219 ? 30.606  -115.403 -41.405 1.00 22.09 ? 219  ASN B N   1 
ATOM   2687 C CA  . ASN B 2 219 ? 30.365  -114.042 -40.960 1.00 22.75 ? 219  ASN B CA  1 
ATOM   2688 C C   . ASN B 2 219 ? 30.256  -113.042 -42.112 1.00 22.99 ? 219  ASN B C   1 
ATOM   2689 O O   . ASN B 2 219 ? 30.596  -113.322 -43.269 1.00 23.39 ? 219  ASN B O   1 
ATOM   2690 C CB  . ASN B 2 219 ? 31.353  -113.589 -39.858 1.00 22.85 ? 219  ASN B CB  1 
ATOM   2691 C CG  . ASN B 2 219 ? 32.811  -113.588 -40.305 1.00 23.94 ? 219  ASN B CG  1 
ATOM   2692 O OD1 . ASN B 2 219 ? 33.196  -114.230 -41.303 1.00 25.37 ? 219  ASN B OD1 1 
ATOM   2693 N ND2 . ASN B 2 219 ? 33.655  -112.892 -39.525 1.00 23.99 ? 219  ASN B ND2 1 
ATOM   2694 N N   . ARG B 2 220 ? 29.691  -111.890 -41.792 1.00 22.80 ? 220  ARG B N   1 
ATOM   2695 C CA  . ARG B 2 220 ? 29.439  -110.873 -42.778 1.00 23.87 ? 220  ARG B CA  1 
ATOM   2696 C C   . ARG B 2 220 ? 30.732  -110.486 -43.502 1.00 23.84 ? 220  ARG B C   1 
ATOM   2697 O O   . ARG B 2 220 ? 30.695  -110.136 -44.692 1.00 24.49 ? 220  ARG B O   1 
ATOM   2698 C CB  . ARG B 2 220 ? 28.825  -109.663 -42.054 1.00 23.73 ? 220  ARG B CB  1 
ATOM   2699 C CG  . ARG B 2 220 ? 28.231  -108.643 -42.948 1.00 26.36 ? 220  ARG B CG  1 
ATOM   2700 C CD  . ARG B 2 220 ? 27.975  -107.399 -42.094 1.00 30.69 ? 220  ARG B CD  1 
ATOM   2701 N NE  . ARG B 2 220 ? 26.943  -106.542 -42.671 1.00 34.40 ? 220  ARG B NE  1 
ATOM   2702 C CZ  . ARG B 2 220 ? 25.822  -106.186 -42.049 1.00 36.87 ? 220  ARG B CZ  1 
ATOM   2703 N NH1 . ARG B 2 220 ? 25.580  -106.601 -40.808 1.00 38.88 ? 220  ARG B NH1 1 
ATOM   2704 N NH2 . ARG B 2 220 ? 24.950  -105.381 -42.661 1.00 39.59 ? 220  ARG B NH2 1 
ATOM   2705 N N   . ALA B 2 221 ? 31.871  -110.601 -42.811 1.00 23.34 ? 221  ALA B N   1 
ATOM   2706 C CA  . ALA B 2 221 ? 33.179  -110.216 -43.403 1.00 23.96 ? 221  ALA B CA  1 
ATOM   2707 C C   . ALA B 2 221 ? 33.682  -111.085 -44.575 1.00 23.79 ? 221  ALA B C   1 
ATOM   2708 O O   . ALA B 2 221 ? 34.635  -110.700 -45.252 1.00 23.30 ? 221  ALA B O   1 
ATOM   2709 C CB  . ALA B 2 221 ? 34.258  -110.093 -42.348 1.00 23.02 ? 221  ALA B CB  1 
ATOM   2710 N N   . VAL B 2 222 ? 33.077  -112.243 -44.816 1.00 22.58 ? 222  VAL B N   1 
ATOM   2711 C CA  . VAL B 2 222 ? 33.383  -112.964 -46.056 1.00 23.08 ? 222  VAL B CA  1 
ATOM   2712 C C   . VAL B 2 222 ? 32.503  -112.364 -47.148 1.00 23.04 ? 222  VAL B C   1 
ATOM   2713 O O   . VAL B 2 222 ? 31.282  -112.564 -47.127 1.00 24.24 ? 222  VAL B O   1 
ATOM   2714 C CB  . VAL B 2 222 ? 33.102  -114.482 -45.952 1.00 23.13 ? 222  VAL B CB  1 
ATOM   2715 C CG1 . VAL B 2 222 ? 33.442  -115.178 -47.277 1.00 21.19 ? 222  VAL B CG1 1 
ATOM   2716 C CG2 . VAL B 2 222 ? 33.905  -115.113 -44.769 1.00 22.94 ? 222  VAL B CG2 1 
ATOM   2717 N N   . PRO B 2 223 ? 33.106  -111.645 -48.115 1.00 23.80 ? 223  PRO B N   1 
ATOM   2718 C CA  . PRO B 2 223 ? 32.292  -110.927 -49.107 1.00 23.38 ? 223  PRO B CA  1 
ATOM   2719 C C   . PRO B 2 223 ? 31.660  -111.864 -50.140 1.00 23.20 ? 223  PRO B C   1 
ATOM   2720 O O   . PRO B 2 223 ? 32.189  -112.945 -50.404 1.00 21.75 ? 223  PRO B O   1 
ATOM   2721 C CB  . PRO B 2 223 ? 33.309  -110.024 -49.793 1.00 24.47 ? 223  PRO B CB  1 
ATOM   2722 C CG  . PRO B 2 223 ? 34.592  -110.783 -49.702 1.00 24.85 ? 223  PRO B CG  1 
ATOM   2723 C CD  . PRO B 2 223 ? 34.552  -111.426 -48.340 1.00 22.76 ? 223  PRO B CD  1 
ATOM   2724 N N   . LEU B 2 224 ? 30.549  -111.437 -50.726 1.00 22.63 ? 224  LEU B N   1 
ATOM   2725 C CA  . LEU B 2 224 ? 29.846  -112.278 -51.693 1.00 22.81 ? 224  LEU B CA  1 
ATOM   2726 C C   . LEU B 2 224 ? 30.781  -112.802 -52.809 1.00 22.63 ? 224  LEU B C   1 
ATOM   2727 O O   . LEU B 2 224 ? 30.658  -113.941 -53.205 1.00 20.98 ? 224  LEU B O   1 
ATOM   2728 C CB  . LEU B 2 224 ? 28.678  -111.516 -52.295 1.00 23.07 ? 224  LEU B CB  1 
ATOM   2729 C CG  . LEU B 2 224 ? 27.764  -112.244 -53.288 1.00 24.34 ? 224  LEU B CG  1 
ATOM   2730 C CD1 . LEU B 2 224 ? 27.287  -113.543 -52.692 1.00 25.42 ? 224  LEU B CD1 1 
ATOM   2731 C CD2 . LEU B 2 224 ? 26.592  -111.347 -53.624 1.00 24.73 ? 224  LEU B CD2 1 
ATOM   2732 N N   . GLU B 2 225 ? 31.732  -111.989 -53.265 1.00 23.10 ? 225  GLU B N   1 
ATOM   2733 C CA  . GLU B 2 225 ? 32.643  -112.393 -54.370 1.00 24.25 ? 225  GLU B CA  1 
ATOM   2734 C C   . GLU B 2 225 ? 33.577  -113.565 -54.060 1.00 24.71 ? 225  GLU B C   1 
ATOM   2735 O O   . GLU B 2 225 ? 34.161  -114.148 -54.969 1.00 25.33 ? 225  GLU B O   1 
ATOM   2736 C CB  . GLU B 2 225 ? 33.448  -111.199 -54.889 1.00 24.28 ? 225  GLU B CB  1 
ATOM   2737 C CG  . GLU B 2 225 ? 32.552  -110.094 -55.356 1.00 27.20 ? 225  GLU B CG  1 
ATOM   2738 C CD  . GLU B 2 225 ? 32.371  -108.991 -54.320 1.00 32.07 ? 225  GLU B CD  1 
ATOM   2739 O OE1 . GLU B 2 225 ? 31.897  -109.229 -53.140 1.00 28.51 ? 225  GLU B OE1 1 
ATOM   2740 O OE2 . GLU B 2 225 ? 32.697  -107.851 -54.743 1.00 34.14 ? 225  GLU B OE2 1 
ATOM   2741 N N   . LYS B 2 226 ? 33.706  -113.913 -52.783 1.00 25.08 ? 226  LYS B N   1 
ATOM   2742 C CA  . LYS B 2 226 ? 34.550  -115.031 -52.371 1.00 25.54 ? 226  LYS B CA  1 
ATOM   2743 C C   . LYS B 2 226 ? 33.735  -116.285 -52.020 1.00 24.95 ? 226  LYS B C   1 
ATOM   2744 O O   . LYS B 2 226 ? 34.296  -117.333 -51.708 1.00 25.38 ? 226  LYS B O   1 
ATOM   2745 C CB  . LYS B 2 226 ? 35.409  -114.616 -51.176 1.00 25.55 ? 226  LYS B CB  1 
ATOM   2746 C CG  . LYS B 2 226 ? 36.398  -113.478 -51.469 1.00 29.38 ? 226  LYS B CG  1 
ATOM   2747 C CD  . LYS B 2 226 ? 37.587  -113.966 -52.276 1.00 33.32 ? 226  LYS B CD  1 
ATOM   2748 C CE  . LYS B 2 226 ? 38.806  -113.028 -52.122 1.00 35.88 ? 226  LYS B CE  1 
ATOM   2749 N NZ  . LYS B 2 226 ? 39.091  -112.733 -50.665 1.00 39.11 ? 226  LYS B NZ  1 
ATOM   2750 N N   . LEU B 2 227 ? 32.415  -116.184 -52.045 1.00 24.85 ? 227  LEU B N   1 
ATOM   2751 C CA  . LEU B 2 227 ? 31.581  -117.301 -51.610 1.00 24.51 ? 227  LEU B CA  1 
ATOM   2752 C C   . LEU B 2 227 ? 31.725  -118.498 -52.544 1.00 23.76 ? 227  LEU B C   1 
ATOM   2753 O O   . LEU B 2 227 ? 31.809  -119.630 -52.089 1.00 24.21 ? 227  LEU B O   1 
ATOM   2754 C CB  . LEU B 2 227 ? 30.104  -116.876 -51.560 1.00 24.93 ? 227  LEU B CB  1 
ATOM   2755 C CG  . LEU B 2 227 ? 29.125  -117.326 -50.495 1.00 27.53 ? 227  LEU B CG  1 
ATOM   2756 C CD1 . LEU B 2 227 ? 27.682  -117.237 -50.992 1.00 24.01 ? 227  LEU B CD1 1 
ATOM   2757 C CD2 . LEU B 2 227 ? 29.433  -118.665 -49.786 1.00 29.23 ? 227  LEU B CD2 1 
ATOM   2758 N N   . ALA B 2 228 ? 31.731  -118.257 -53.855 1.00 23.41 ? 228  ALA B N   1 
ATOM   2759 C CA  . ALA B 2 228 ? 31.796  -119.344 -54.817 1.00 23.05 ? 228  ALA B CA  1 
ATOM   2760 C C   . ALA B 2 228 ? 33.040  -120.181 -54.566 1.00 23.24 ? 228  ALA B C   1 
ATOM   2761 O O   . ALA B 2 228 ? 32.992  -121.397 -54.669 1.00 22.72 ? 228  ALA B O   1 
ATOM   2762 C CB  . ALA B 2 228 ? 31.791  -118.806 -56.243 1.00 23.21 ? 228  ALA B CB  1 
ATOM   2763 N N   . THR B 2 229 ? 34.139  -119.517 -54.208 1.00 23.72 ? 229  THR B N   1 
ATOM   2764 C CA  . THR B 2 229 ? 35.415  -120.191 -53.917 1.00 24.57 ? 229  THR B CA  1 
ATOM   2765 C C   . THR B 2 229 ? 35.291  -121.233 -52.821 1.00 24.00 ? 229  THR B C   1 
ATOM   2766 O O   . THR B 2 229 ? 35.821  -122.334 -52.942 1.00 23.94 ? 229  THR B O   1 
ATOM   2767 C CB  . THR B 2 229 ? 36.521  -119.175 -53.533 1.00 24.90 ? 229  THR B CB  1 
ATOM   2768 O OG1 . THR B 2 229 ? 36.770  -118.313 -54.657 1.00 27.21 ? 229  THR B OG1 1 
ATOM   2769 C CG2 . THR B 2 229 ? 37.798  -119.883 -53.210 1.00 27.61 ? 229  THR B CG2 1 
ATOM   2770 N N   . LEU B 2 230 ? 34.622  -120.878 -51.737 1.00 23.46 ? 230  LEU B N   1 
ATOM   2771 C CA  . LEU B 2 230 ? 34.447  -121.802 -50.634 1.00 24.12 ? 230  LEU B CA  1 
ATOM   2772 C C   . LEU B 2 230 ? 33.485  -122.911 -50.996 1.00 24.18 ? 230  LEU B C   1 
ATOM   2773 O O   . LEU B 2 230 ? 33.699  -124.043 -50.585 1.00 24.61 ? 230  LEU B O   1 
ATOM   2774 C CB  . LEU B 2 230 ? 33.879  -121.079 -49.401 1.00 23.94 ? 230  LEU B CB  1 
ATOM   2775 C CG  . LEU B 2 230 ? 34.774  -119.987 -48.833 1.00 23.01 ? 230  LEU B CG  1 
ATOM   2776 C CD1 . LEU B 2 230 ? 34.024  -119.229 -47.746 1.00 25.09 ? 230  LEU B CD1 1 
ATOM   2777 C CD2 . LEU B 2 230 ? 36.090  -120.629 -48.313 1.00 25.50 ? 230  LEU B CD2 1 
ATOM   2778 N N   . LEU B 2 231 ? 32.403  -122.573 -51.704 1.00 22.78 ? 231  LEU B N   1 
ATOM   2779 C CA  . LEU B 2 231 ? 31.405  -123.574 -52.089 1.00 22.99 ? 231  LEU B CA  1 
ATOM   2780 C C   . LEU B 2 231 ? 31.963  -124.651 -53.007 1.00 24.07 ? 231  LEU B C   1 
ATOM   2781 O O   . LEU B 2 231 ? 31.597  -125.829 -52.907 1.00 22.98 ? 231  LEU B O   1 
ATOM   2782 C CB  . LEU B 2 231 ? 30.186  -122.918 -52.714 1.00 23.00 ? 231  LEU B CB  1 
ATOM   2783 C CG  . LEU B 2 231 ? 29.364  -122.009 -51.813 1.00 23.42 ? 231  LEU B CG  1 
ATOM   2784 C CD1 . LEU B 2 231 ? 28.186  -121.403 -52.566 1.00 25.08 ? 231  LEU B CD1 1 
ATOM   2785 C CD2 . LEU B 2 231 ? 28.856  -122.807 -50.596 1.00 24.66 ? 231  LEU B CD2 1 
ATOM   2786 N N   . GLN B 2 232 ? 32.848  -124.243 -53.920 1.00 24.04 ? 232  GLN B N   1 
ATOM   2787 C CA  . GLN B 2 232 ? 33.525  -125.200 -54.773 1.00 25.12 ? 232  GLN B CA  1 
ATOM   2788 C C   . GLN B 2 232 ? 34.371  -126.190 -53.947 1.00 25.11 ? 232  GLN B C   1 
ATOM   2789 O O   . GLN B 2 232 ? 34.549  -127.334 -54.336 1.00 25.24 ? 232  GLN B O   1 
ATOM   2790 C CB  . GLN B 2 232 ? 34.387  -124.466 -55.797 1.00 25.59 ? 232  GLN B CB  1 
ATOM   2791 C CG  . GLN B 2 232 ? 33.589  -123.716 -56.859 1.00 29.00 ? 232  GLN B CG  1 
ATOM   2792 C CD  . GLN B 2 232 ? 32.917  -124.638 -57.888 1.00 35.11 ? 232  GLN B CD  1 
ATOM   2793 O OE1 . GLN B 2 232 ? 33.055  -125.864 -57.825 1.00 38.52 ? 232  GLN B OE1 1 
ATOM   2794 N NE2 . GLN B 2 232 ? 32.178  -124.046 -58.834 1.00 35.01 ? 232  GLN B NE2 1 
ATOM   2795 N N   . ARG B 2 233 ? 34.870  -125.738 -52.804 1.00 25.37 ? 233  ARG B N   1 
ATOM   2796 C CA  . ARG B 2 233 ? 35.658  -126.578 -51.904 1.00 25.91 ? 233  ARG B CA  1 
ATOM   2797 C C   . ARG B 2 233 ? 34.801  -127.468 -50.996 1.00 25.92 ? 233  ARG B C   1 
ATOM   2798 O O   . ARG B 2 233 ? 35.333  -128.399 -50.384 1.00 25.97 ? 233  ARG B O   1 
ATOM   2799 C CB  . ARG B 2 233 ? 36.536  -125.703 -51.013 1.00 26.05 ? 233  ARG B CB  1 
ATOM   2800 C CG  . ARG B 2 233 ? 37.516  -124.835 -51.780 1.00 27.66 ? 233  ARG B CG  1 
ATOM   2801 C CD  . ARG B 2 233 ? 38.525  -125.669 -52.512 1.00 32.05 ? 233  ARG B CD  1 
ATOM   2802 N NE  . ARG B 2 233 ? 39.731  -124.878 -52.721 1.00 36.33 ? 233  ARG B NE  1 
ATOM   2803 C CZ  . ARG B 2 233 ? 40.858  -125.322 -53.264 1.00 38.18 ? 233  ARG B CZ  1 
ATOM   2804 N NH1 . ARG B 2 233 ? 40.976  -126.581 -53.682 1.00 38.58 ? 233  ARG B NH1 1 
ATOM   2805 N NH2 . ARG B 2 233 ? 41.880  -124.488 -53.389 1.00 39.62 ? 233  ARG B NH2 1 
ATOM   2806 N N   . ALA B 2 234 ? 33.503  -127.178 -50.895 1.00 24.56 ? 234  ALA B N   1 
ATOM   2807 C CA  . ALA B 2 234 ? 32.610  -127.929 -49.994 1.00 24.82 ? 234  ALA B CA  1 
ATOM   2808 C C   . ALA B 2 234 ? 31.286  -128.299 -50.637 1.00 25.18 ? 234  ALA B C   1 
ATOM   2809 O O   . ALA B 2 234 ? 30.233  -127.882 -50.151 1.00 24.99 ? 234  ALA B O   1 
ATOM   2810 C CB  . ALA B 2 234 ? 32.362  -127.129 -48.715 1.00 24.14 ? 234  ALA B CB  1 
ATOM   2811 N N   . PRO B 2 235 ? 31.318  -129.100 -51.719 1.00 25.45 ? 235  PRO B N   1 
ATOM   2812 C CA  . PRO B 2 235 ? 30.063  -129.456 -52.387 1.00 25.62 ? 235  PRO B CA  1 
ATOM   2813 C C   . PRO B 2 235 ? 29.096  -130.370 -51.598 1.00 25.55 ? 235  PRO B C   1 
ATOM   2814 O O   . PRO B 2 235 ? 27.968  -130.582 -52.043 1.00 26.17 ? 235  PRO B O   1 
ATOM   2815 C CB  . PRO B 2 235 ? 30.544  -130.186 -53.636 1.00 25.70 ? 235  PRO B CB  1 
ATOM   2816 C CG  . PRO B 2 235 ? 31.839  -130.783 -53.232 1.00 25.51 ? 235  PRO B CG  1 
ATOM   2817 C CD  . PRO B 2 235 ? 32.475  -129.723 -52.387 1.00 24.91 ? 235  PRO B CD  1 
ATOM   2818 N N   . GLN B 2 236 ? 29.532  -130.894 -50.456 1.00 24.79 ? 236  GLN B N   1 
ATOM   2819 C CA  . GLN B 2 236 ? 28.721  -131.806 -49.642 1.00 23.62 ? 236  GLN B CA  1 
ATOM   2820 C C   . GLN B 2 236 ? 27.873  -131.074 -48.569 1.00 22.98 ? 236  GLN B C   1 
ATOM   2821 O O   . GLN B 2 236 ? 27.151  -131.707 -47.796 1.00 21.66 ? 236  GLN B O   1 
ATOM   2822 C CB  . GLN B 2 236 ? 29.644  -132.814 -48.957 1.00 23.58 ? 236  GLN B CB  1 
ATOM   2823 C CG  . GLN B 2 236 ? 30.471  -132.215 -47.778 1.00 23.10 ? 236  GLN B CG  1 
ATOM   2824 C CD  . GLN B 2 236 ? 31.705  -131.414 -48.209 1.00 23.16 ? 236  GLN B CD  1 
ATOM   2825 O OE1 . GLN B 2 236 ? 32.155  -131.506 -49.346 1.00 23.56 ? 236  GLN B OE1 1 
ATOM   2826 N NE2 . GLN B 2 236 ? 32.251  -130.628 -47.294 1.00 24.93 ? 236  GLN B NE2 1 
ATOM   2827 N N   . LEU B 2 237 ? 27.968  -129.748 -48.540 1.00 23.26 ? 237  LEU B N   1 
ATOM   2828 C CA  . LEU B 2 237 ? 27.366  -128.922 -47.489 1.00 23.71 ? 237  LEU B CA  1 
ATOM   2829 C C   . LEU B 2 237 ? 25.854  -129.137 -47.438 1.00 22.90 ? 237  LEU B C   1 
ATOM   2830 O O   . LEU B 2 237 ? 25.189  -129.109 -48.464 1.00 21.34 ? 237  LEU B O   1 
ATOM   2831 C CB  . LEU B 2 237 ? 27.662  -127.449 -47.788 1.00 23.88 ? 237  LEU B CB  1 
ATOM   2832 C CG  . LEU B 2 237 ? 28.339  -126.528 -46.789 1.00 27.53 ? 237  LEU B CG  1 
ATOM   2833 C CD1 . LEU B 2 237 ? 29.437  -127.218 -46.015 1.00 25.34 ? 237  LEU B CD1 1 
ATOM   2834 C CD2 . LEU B 2 237 ? 28.799  -125.253 -47.481 1.00 24.83 ? 237  LEU B CD2 1 
ATOM   2835 N N   . GLU B 2 238 ? 25.330  -129.319 -46.228 1.00 22.92 ? 238  GLU B N   1 
ATOM   2836 C CA  . GLU B 2 238 ? 23.884  -129.437 -45.988 1.00 22.82 ? 238  GLU B CA  1 
ATOM   2837 C C   . GLU B 2 238 ? 23.288  -128.088 -45.503 1.00 23.18 ? 238  GLU B C   1 
ATOM   2838 O O   . GLU B 2 238 ? 22.122  -127.809 -45.739 1.00 22.54 ? 238  GLU B O   1 
ATOM   2839 C CB  . GLU B 2 238 ? 23.618  -130.511 -44.956 1.00 22.49 ? 238  GLU B CB  1 
ATOM   2840 C CG  . GLU B 2 238 ? 23.989  -131.911 -45.463 1.00 27.19 ? 238  GLU B CG  1 
ATOM   2841 C CD  . GLU B 2 238 ? 23.805  -132.990 -44.425 1.00 31.91 ? 238  GLU B CD  1 
ATOM   2842 O OE1 . GLU B 2 238 ? 23.613  -132.650 -43.243 1.00 35.89 ? 238  GLU B OE1 1 
ATOM   2843 O OE2 . GLU B 2 238 ? 23.865  -134.188 -44.786 1.00 33.92 ? 238  GLU B OE2 1 
ATOM   2844 N N   . GLU B 2 239 ? 24.102  -127.275 -44.843 1.00 22.50 ? 239  GLU B N   1 
ATOM   2845 C CA  . GLU B 2 239 ? 23.647  -125.972 -44.382 1.00 23.84 ? 239  GLU B CA  1 
ATOM   2846 C C   . GLU B 2 239 ? 24.683  -124.952 -44.719 1.00 22.46 ? 239  GLU B C   1 
ATOM   2847 O O   . GLU B 2 239 ? 25.878  -125.166 -44.496 1.00 22.08 ? 239  GLU B O   1 
ATOM   2848 C CB  . GLU B 2 239 ? 23.481  -125.933 -42.856 1.00 23.62 ? 239  GLU B CB  1 
ATOM   2849 C CG  . GLU B 2 239 ? 22.616  -126.965 -42.258 1.00 27.23 ? 239  GLU B CG  1 
ATOM   2850 C CD  . GLU B 2 239 ? 22.581  -126.877 -40.705 1.00 29.11 ? 239  GLU B CD  1 
ATOM   2851 O OE1 . GLU B 2 239 ? 23.342  -126.062 -40.097 1.00 30.46 ? 239  GLU B OE1 1 
ATOM   2852 O OE2 . GLU B 2 239 ? 21.780  -127.639 -40.121 1.00 35.71 ? 239  GLU B OE2 1 
ATOM   2853 N N   . LEU B 2 240 ? 24.227  -123.812 -45.214 1.00 22.16 ? 240  LEU B N   1 
ATOM   2854 C CA  . LEU B 2 240 ? 25.142  -122.759 -45.576 1.00 22.23 ? 240  LEU B CA  1 
ATOM   2855 C C   . LEU B 2 240 ? 24.579  -121.471 -45.021 1.00 23.06 ? 240  LEU B C   1 
ATOM   2856 O O   . LEU B 2 240 ? 23.424  -121.142 -45.287 1.00 24.05 ? 240  LEU B O   1 
ATOM   2857 C CB  . LEU B 2 240 ? 25.299  -122.642 -47.111 1.00 22.25 ? 240  LEU B CB  1 
ATOM   2858 C CG  . LEU B 2 240 ? 25.924  -121.336 -47.611 1.00 20.67 ? 240  LEU B CG  1 
ATOM   2859 C CD1 . LEU B 2 240 ? 27.413  -121.206 -47.182 1.00 20.95 ? 240  LEU B CD1 1 
ATOM   2860 C CD2 . LEU B 2 240 ? 25.787  -121.186 -49.161 1.00 22.45 ? 240  LEU B CD2 1 
ATOM   2861 N N   . GLY B 2 241 ? 25.390  -120.769 -44.237 1.00 23.20 ? 241  GLY B N   1 
ATOM   2862 C CA  . GLY B 2 241 ? 25.132  -119.376 -43.916 1.00 22.46 ? 241  GLY B CA  1 
ATOM   2863 C C   . GLY B 2 241 ? 26.081  -118.535 -44.752 1.00 22.97 ? 241  GLY B C   1 
ATOM   2864 O O   . GLY B 2 241 ? 27.304  -118.617 -44.611 1.00 21.84 ? 241  GLY B O   1 
ATOM   2865 N N   . THR B 2 242 ? 25.528  -117.720 -45.654 1.00 22.83 ? 242  THR B N   1 
ATOM   2866 C CA  . THR B 2 242 ? 26.380  -116.916 -46.512 1.00 23.50 ? 242  THR B CA  1 
ATOM   2867 C C   . THR B 2 242 ? 27.115  -115.891 -45.657 1.00 23.74 ? 242  THR B C   1 
ATOM   2868 O O   . THR B 2 242 ? 26.738  -115.652 -44.517 1.00 24.10 ? 242  THR B O   1 
ATOM   2869 C CB  . THR B 2 242 ? 25.583  -116.148 -47.611 1.00 22.51 ? 242  THR B CB  1 
ATOM   2870 O OG1 . THR B 2 242 ? 24.952  -115.010 -47.020 1.00 20.23 ? 242  THR B OG1 1 
ATOM   2871 C CG2 . THR B 2 242 ? 24.545  -117.052 -48.322 1.00 22.75 ? 242  THR B CG2 1 
ATOM   2872 N N   . GLY B 2 243 ? 28.161  -115.284 -46.211 1.00 24.03 ? 243  GLY B N   1 
ATOM   2873 C CA  . GLY B 2 243 ? 28.703  -114.057 -45.651 1.00 22.75 ? 243  GLY B CA  1 
ATOM   2874 C C   . GLY B 2 243 ? 27.901  -112.866 -46.169 1.00 23.04 ? 243  GLY B C   1 
ATOM   2875 O O   . GLY B 2 243 ? 26.680  -112.951 -46.390 1.00 22.59 ? 243  GLY B O   1 
ATOM   2876 N N   . GLY B 2 244 ? 28.580  -111.743 -46.365 1.00 22.22 ? 244  GLY B N   1 
ATOM   2877 C CA  . GLY B 2 244 ? 27.994  -110.573 -47.018 1.00 22.11 ? 244  GLY B CA  1 
ATOM   2878 C C   . GLY B 2 244 ? 27.360  -111.021 -48.323 1.00 22.18 ? 244  GLY B C   1 
ATOM   2879 O O   . GLY B 2 244 ? 27.834  -111.981 -48.963 1.00 21.43 ? 244  GLY B O   1 
ATOM   2880 N N   . TYR B 2 245 ? 26.262  -110.376 -48.692 1.00 22.18 ? 245  TYR B N   1 
ATOM   2881 C CA  . TYR B 2 245 ? 25.516  -110.793 -49.872 1.00 22.98 ? 245  TYR B CA  1 
ATOM   2882 C C   . TYR B 2 245 ? 25.289  -109.583 -50.775 1.00 23.34 ? 245  TYR B C   1 
ATOM   2883 O O   . TYR B 2 245 ? 24.199  -109.356 -51.315 1.00 22.30 ? 245  TYR B O   1 
ATOM   2884 C CB  . TYR B 2 245 ? 24.187  -111.483 -49.497 1.00 22.37 ? 245  TYR B CB  1 
ATOM   2885 C CG  . TYR B 2 245 ? 23.743  -112.443 -50.565 1.00 23.19 ? 245  TYR B CG  1 
ATOM   2886 C CD1 . TYR B 2 245 ? 24.240  -113.746 -50.598 1.00 21.42 ? 245  TYR B CD1 1 
ATOM   2887 C CD2 . TYR B 2 245 ? 22.880  -112.049 -51.581 1.00 20.39 ? 245  TYR B CD2 1 
ATOM   2888 C CE1 . TYR B 2 245 ? 23.866  -114.640 -51.585 1.00 22.17 ? 245  TYR B CE1 1 
ATOM   2889 C CE2 . TYR B 2 245 ? 22.501  -112.947 -52.569 1.00 21.20 ? 245  TYR B CE2 1 
ATOM   2890 C CZ  . TYR B 2 245 ? 22.997  -114.239 -52.563 1.00 22.81 ? 245  TYR B CZ  1 
ATOM   2891 O OH  . TYR B 2 245 ? 22.628  -115.148 -53.531 1.00 24.67 ? 245  TYR B OH  1 
ATOM   2892 N N   . THR B 2 246 ? 26.359  -108.810 -50.913 1.00 23.60 ? 246  THR B N   1 
ATOM   2893 C CA  . THR B 2 246 ? 26.359  -107.600 -51.703 1.00 24.17 ? 246  THR B CA  1 
ATOM   2894 C C   . THR B 2 246 ? 27.641  -107.477 -52.535 1.00 23.77 ? 246  THR B C   1 
ATOM   2895 O O   . THR B 2 246 ? 28.732  -107.819 -52.071 1.00 23.81 ? 246  THR B O   1 
ATOM   2896 C CB  . THR B 2 246 ? 26.148  -106.362 -50.819 1.00 24.14 ? 246  THR B CB  1 
ATOM   2897 O OG1 . THR B 2 246 ? 26.110  -105.204 -51.643 1.00 26.37 ? 246  THR B OG1 1 
ATOM   2898 C CG2 . THR B 2 246 ? 27.238  -106.209 -49.759 1.00 23.71 ? 246  THR B CG2 1 
ATOM   2899 N N   . ALA B 2 247 ? 27.474  -107.018 -53.772 1.00 24.25 ? 247  ALA B N   1 
ATOM   2900 C CA  . ALA B 2 247 ? 28.566  -106.740 -54.690 1.00 24.18 ? 247  ALA B CA  1 
ATOM   2901 C C   . ALA B 2 247 ? 28.062  -105.854 -55.823 1.00 24.43 ? 247  ALA B C   1 
ATOM   2902 O O   . ALA B 2 247 ? 26.848  -105.698 -56.023 1.00 24.39 ? 247  ALA B O   1 
ATOM   2903 C CB  . ALA B 2 247 ? 29.135  -108.049 -55.258 1.00 24.48 ? 247  ALA B CB  1 
ATOM   2904 N N   . GLU B 2 248 ? 29.003  -105.240 -56.536 1.00 24.29 ? 248  GLU B N   1 
ATOM   2905 C CA  . GLU B 2 248 ? 28.732  -104.624 -57.837 1.00 24.48 ? 248  GLU B CA  1 
ATOM   2906 C C   . GLU B 2 248 ? 28.001  -105.688 -58.647 1.00 23.29 ? 248  GLU B C   1 
ATOM   2907 O O   . GLU B 2 248 ? 28.357  -106.855 -58.604 1.00 22.87 ? 248  GLU B O   1 
ATOM   2908 C CB  . GLU B 2 248 ? 30.057  -104.256 -58.522 1.00 23.80 ? 248  GLU B CB  1 
ATOM   2909 C CG  . GLU B 2 248 ? 29.937  -103.283 -59.655 1.00 26.48 ? 248  GLU B CG  1 
ATOM   2910 C CD  . GLU B 2 248 ? 31.150  -103.302 -60.605 1.00 26.83 ? 248  GLU B CD  1 
ATOM   2911 O OE1 . GLU B 2 248 ? 32.298  -103.515 -60.140 1.00 31.23 ? 248  GLU B OE1 1 
ATOM   2912 O OE2 . GLU B 2 248 ? 30.941  -103.115 -61.823 1.00 30.12 ? 248  GLU B OE2 1 
ATOM   2913 N N   . VAL B 2 249 ? 26.959  -105.293 -59.356 1.00 23.17 ? 249  VAL B N   1 
ATOM   2914 C CA  . VAL B 2 249 ? 26.209  -106.242 -60.160 1.00 23.53 ? 249  VAL B CA  1 
ATOM   2915 C C   . VAL B 2 249 ? 27.023  -106.565 -61.430 1.00 23.03 ? 249  VAL B C   1 
ATOM   2916 O O   . VAL B 2 249 ? 27.265  -105.679 -62.240 1.00 21.53 ? 249  VAL B O   1 
ATOM   2917 C CB  . VAL B 2 249 ? 24.808  -105.666 -60.487 1.00 24.20 ? 249  VAL B CB  1 
ATOM   2918 C CG1 . VAL B 2 249 ? 24.066  -106.527 -61.510 1.00 24.99 ? 249  VAL B CG1 1 
ATOM   2919 C CG2 . VAL B 2 249 ? 24.012  -105.517 -59.212 1.00 24.65 ? 249  VAL B CG2 1 
ATOM   2920 N N   . ARG B 2 250 ? 27.495  -107.813 -61.553 1.00 22.83 ? 250  ARG B N   1 
ATOM   2921 C CA  . ARG B 2 250 ? 28.284  -108.249 -62.726 1.00 23.88 ? 250  ARG B CA  1 
ATOM   2922 C C   . ARG B 2 250 ? 27.889  -109.635 -63.209 1.00 22.23 ? 250  ARG B C   1 
ATOM   2923 O O   . ARG B 2 250 ? 27.736  -110.503 -62.393 1.00 22.45 ? 250  ARG B O   1 
ATOM   2924 C CB  . ARG B 2 250 ? 29.785  -108.281 -62.383 1.00 24.05 ? 250  ARG B CB  1 
ATOM   2925 C CG  . ARG B 2 250 ? 30.397  -106.944 -61.987 1.00 26.47 ? 250  ARG B CG  1 
ATOM   2926 C CD  . ARG B 2 250 ? 31.837  -107.093 -61.512 1.00 26.97 ? 250  ARG B CD  1 
ATOM   2927 N NE  . ARG B 2 250 ? 32.718  -107.672 -62.536 1.00 31.80 ? 250  ARG B NE  1 
ATOM   2928 C CZ  . ARG B 2 250 ? 32.973  -107.151 -63.741 1.00 35.37 ? 250  ARG B CZ  1 
ATOM   2929 N NH1 . ARG B 2 250 ? 32.411  -106.010 -64.154 1.00 38.24 ? 250  ARG B NH1 1 
ATOM   2930 N NH2 . ARG B 2 250 ? 33.802  -107.791 -64.567 1.00 35.78 ? 250  ARG B NH2 1 
ATOM   2931 N N   . PRO B 2 251 ? 27.780  -109.859 -64.547 1.00 22.40 ? 251  PRO B N   1 
ATOM   2932 C CA  . PRO B 2 251 ? 27.497  -111.187 -65.133 1.00 22.10 ? 251  PRO B CA  1 
ATOM   2933 C C   . PRO B 2 251 ? 28.454  -112.299 -64.678 1.00 22.38 ? 251  PRO B C   1 
ATOM   2934 O O   . PRO B 2 251 ? 27.935  -113.376 -64.120 1.00 22.19 ? 251  PRO B O   1 
ATOM   2935 C CB  . PRO B 2 251 ? 27.649  -110.956 -66.654 1.00 22.61 ? 251  PRO B CB  1 
ATOM   2936 C CG  . PRO B 2 251 ? 27.417  -109.527 -66.853 1.00 22.95 ? 251  PRO B CG  1 
ATOM   2937 C CD  . PRO B 2 251 ? 27.924  -108.827 -65.599 1.00 22.22 ? 251  PRO B CD  1 
ATOM   2938 N N   . ASP B 2 252 ? 29.788  -112.101 -64.835 1.00 21.83 ? 252  ASP B N   1 
ATOM   2939 C CA  . ASP B 2 252 ? 30.726  -113.131 -64.385 1.00 23.44 ? 252  ASP B CA  1 
ATOM   2940 C C   . ASP B 2 252 ? 30.587  -113.516 -62.886 1.00 21.68 ? 252  ASP B C   1 
ATOM   2941 O O   . ASP B 2 252 ? 30.756  -114.683 -62.535 1.00 22.70 ? 252  ASP B O   1 
ATOM   2942 C CB  . ASP B 2 252 ? 32.189  -112.807 -64.707 1.00 22.84 ? 252  ASP B CB  1 
ATOM   2943 C CG  . ASP B 2 252 ? 32.708  -111.570 -63.966 1.00 26.66 ? 252  ASP B CG  1 
ATOM   2944 O OD1 . ASP B 2 252 ? 33.945  -111.395 -63.907 1.00 30.29 ? 252  ASP B OD1 1 
ATOM   2945 O OD2 . ASP B 2 252 ? 31.909  -110.762 -63.446 1.00 30.11 ? 252  ASP B OD2 1 
ATOM   2946 N N   . VAL B 2 253 ? 30.294  -112.560 -62.002 1.00 22.85 ? 253  VAL B N   1 
ATOM   2947 C CA  . VAL B 2 253 ? 30.201  -112.851 -60.550 1.00 20.91 ? 253  VAL B CA  1 
ATOM   2948 C C   . VAL B 2 253 ? 28.926  -113.656 -60.218 1.00 21.46 ? 253  VAL B C   1 
ATOM   2949 O O   . VAL B 2 253 ? 28.896  -114.643 -59.368 1.00 19.92 ? 253  VAL B O   1 
ATOM   2950 C CB  . VAL B 2 253 ? 30.189  -111.548 -59.671 1.00 22.39 ? 253  VAL B CB  1 
ATOM   2951 C CG1 . VAL B 2 253 ? 29.899  -111.895 -58.172 1.00 21.18 ? 253  VAL B CG1 1 
ATOM   2952 C CG2 . VAL B 2 253 ? 31.507  -110.769 -59.791 1.00 20.97 ? 253  VAL B CG2 1 
ATOM   2953 N N   . TYR B 2 254 ? 27.848  -113.240 -60.870 1.00 20.83 ? 254  TYR B N   1 
ATOM   2954 C CA  . TYR B 2 254 ? 26.578  -113.927 -60.695 1.00 21.95 ? 254  TYR B CA  1 
ATOM   2955 C C   . TYR B 2 254 ? 26.691  -115.385 -61.178 1.00 21.53 ? 254  TYR B C   1 
ATOM   2956 O O   . TYR B 2 254 ? 26.275  -116.308 -60.473 1.00 22.26 ? 254  TYR B O   1 
ATOM   2957 C CB  . TYR B 2 254 ? 25.434  -113.199 -61.417 1.00 21.82 ? 254  TYR B CB  1 
ATOM   2958 C CG  . TYR B 2 254 ? 24.153  -113.995 -61.301 1.00 23.58 ? 254  TYR B CG  1 
ATOM   2959 C CD1 . TYR B 2 254 ? 23.279  -113.777 -60.245 1.00 22.79 ? 254  TYR B CD1 1 
ATOM   2960 C CD2 . TYR B 2 254 ? 23.849  -115.011 -62.217 1.00 23.40 ? 254  TYR B CD2 1 
ATOM   2961 C CE1 . TYR B 2 254 ? 22.118  -114.518 -60.105 1.00 25.08 ? 254  TYR B CE1 1 
ATOM   2962 C CE2 . TYR B 2 254 ? 22.688  -115.763 -62.085 1.00 25.02 ? 254  TYR B CE2 1 
ATOM   2963 C CZ  . TYR B 2 254 ? 21.834  -115.508 -61.019 1.00 25.11 ? 254  TYR B CZ  1 
ATOM   2964 O OH  . TYR B 2 254 ? 20.673  -116.227 -60.875 1.00 25.49 ? 254  TYR B OH  1 
ATOM   2965 N N   . SER B 2 255 ? 27.249  -115.573 -62.371 1.00 21.21 ? 255  SER B N   1 
ATOM   2966 C CA  . SER B 2 255 ? 27.414  -116.894 -62.983 1.00 21.22 ? 255  SER B CA  1 
ATOM   2967 C C   . SER B 2 255 ? 28.279  -117.830 -62.117 1.00 21.08 ? 255  SER B C   1 
ATOM   2968 O O   . SER B 2 255 ? 27.940  -119.007 -61.924 1.00 20.89 ? 255  SER B O   1 
ATOM   2969 C CB  . SER B 2 255 ? 27.980  -116.750 -64.409 1.00 20.91 ? 255  SER B CB  1 
ATOM   2970 O OG  . SER B 2 255 ? 28.214  -118.006 -65.036 1.00 22.20 ? 255  SER B OG  1 
ATOM   2971 N N   . GLY B 2 256 ? 29.392  -117.315 -61.594 1.00 20.22 ? 256  GLY B N   1 
ATOM   2972 C CA  . GLY B 2 256 ? 30.248  -118.112 -60.723 1.00 19.82 ? 256  GLY B CA  1 
ATOM   2973 C C   . GLY B 2 256 ? 29.500  -118.583 -59.469 1.00 20.02 ? 256  GLY B C   1 
ATOM   2974 O O   . GLY B 2 256 ? 29.672  -119.715 -59.032 1.00 19.98 ? 256  GLY B O   1 
ATOM   2975 N N   . LEU B 2 257 ? 28.673  -117.721 -58.904 1.00 20.28 ? 257  LEU B N   1 
ATOM   2976 C CA  . LEU B 2 257 ? 27.924  -118.038 -57.671 1.00 22.37 ? 257  LEU B CA  1 
ATOM   2977 C C   . LEU B 2 257 ? 26.829  -119.056 -57.981 1.00 22.36 ? 257  LEU B C   1 
ATOM   2978 O O   . LEU B 2 257 ? 26.614  -120.014 -57.237 1.00 20.86 ? 257  LEU B O   1 
ATOM   2979 C CB  . LEU B 2 257 ? 27.279  -116.768 -57.120 1.00 22.58 ? 257  LEU B CB  1 
ATOM   2980 C CG  . LEU B 2 257 ? 27.244  -116.423 -55.637 1.00 27.83 ? 257  LEU B CG  1 
ATOM   2981 C CD1 . LEU B 2 257 ? 26.028  -115.513 -55.432 1.00 30.31 ? 257  LEU B CD1 1 
ATOM   2982 C CD2 . LEU B 2 257 ? 27.225  -117.627 -54.726 1.00 27.67 ? 257  LEU B CD2 1 
ATOM   2983 N N   . SER B 2 258 ? 26.141  -118.825 -59.104 1.00 22.51 ? 258  SER B N   1 
ATOM   2984 C CA  . SER B 2 258 ? 25.091  -119.703 -59.580 1.00 23.80 ? 258  SER B CA  1 
ATOM   2985 C C   . SER B 2 258 ? 25.609  -121.141 -59.774 1.00 23.58 ? 258  SER B C   1 
ATOM   2986 O O   . SER B 2 258 ? 25.026  -122.085 -59.249 1.00 24.03 ? 258  SER B O   1 
ATOM   2987 C CB  . SER B 2 258 ? 24.546  -119.141 -60.896 1.00 24.75 ? 258  SER B CB  1 
ATOM   2988 O OG  . SER B 2 258 ? 23.488  -119.930 -61.408 1.00 28.64 ? 258  SER B OG  1 
ATOM   2989 N N   . VAL B 2 259 ? 26.722  -121.294 -60.487 1.00 23.80 ? 259  VAL B N   1 
ATOM   2990 C CA  . VAL B 2 259 ? 27.354  -122.609 -60.747 1.00 23.21 ? 259  VAL B CA  1 
ATOM   2991 C C   . VAL B 2 259 ? 27.818  -123.301 -59.431 1.00 22.39 ? 259  VAL B C   1 
ATOM   2992 O O   . VAL B 2 259 ? 27.640  -124.514 -59.247 1.00 21.55 ? 259  VAL B O   1 
ATOM   2993 C CB  . VAL B 2 259 ? 28.553  -122.471 -61.720 1.00 22.98 ? 259  VAL B CB  1 
ATOM   2994 C CG1 . VAL B 2 259 ? 29.348  -123.750 -61.800 1.00 24.58 ? 259  VAL B CG1 1 
ATOM   2995 C CG2 . VAL B 2 259 ? 28.091  -122.113 -63.119 1.00 23.75 ? 259  VAL B CG2 1 
ATOM   2996 N N   . ALA B 2 260 ? 28.425  -122.531 -58.530 1.00 22.25 ? 260  ALA B N   1 
ATOM   2997 C CA  . ALA B 2 260 ? 28.918  -123.066 -57.263 1.00 22.40 ? 260  ALA B CA  1 
ATOM   2998 C C   . ALA B 2 260 ? 27.754  -123.592 -56.417 1.00 23.04 ? 260  ALA B C   1 
ATOM   2999 O O   . ALA B 2 260 ? 27.848  -124.672 -55.821 1.00 22.91 ? 260  ALA B O   1 
ATOM   3000 C CB  . ALA B 2 260 ? 29.673  -121.993 -56.487 1.00 22.52 ? 260  ALA B CB  1 
ATOM   3001 N N   . LEU B 2 261 ? 26.678  -122.813 -56.341 1.00 22.16 ? 261  LEU B N   1 
ATOM   3002 C CA  . LEU B 2 261 ? 25.543  -123.178 -55.499 1.00 22.84 ? 261  LEU B CA  1 
ATOM   3003 C C   . LEU B 2 261 ? 24.796  -124.376 -56.113 1.00 23.62 ? 261  LEU B C   1 
ATOM   3004 O O   . LEU B 2 261 ? 24.348  -125.255 -55.384 1.00 24.47 ? 261  LEU B O   1 
ATOM   3005 C CB  . LEU B 2 261 ? 24.587  -122.002 -55.337 1.00 22.60 ? 261  LEU B CB  1 
ATOM   3006 C CG  . LEU B 2 261 ? 24.897  -120.972 -54.272 1.00 22.47 ? 261  LEU B CG  1 
ATOM   3007 C CD1 . LEU B 2 261 ? 24.150  -119.698 -54.613 1.00 25.35 ? 261  LEU B CD1 1 
ATOM   3008 C CD2 . LEU B 2 261 ? 24.499  -121.493 -52.874 1.00 22.11 ? 261  LEU B CD2 1 
ATOM   3009 N N   . SER B 2 262 ? 24.693  -124.422 -57.442 1.00 24.06 ? 262  SER B N   1 
ATOM   3010 C CA  . SER B 2 262 ? 24.063  -125.555 -58.118 1.00 24.39 ? 262  SER B CA  1 
ATOM   3011 C C   . SER B 2 262 ? 24.865  -126.867 -57.950 1.00 23.81 ? 262  SER B C   1 
ATOM   3012 O O   . SER B 2 262 ? 24.301  -127.958 -58.079 1.00 24.11 ? 262  SER B O   1 
ATOM   3013 C CB  . SER B 2 262 ? 23.802  -125.246 -59.601 1.00 25.28 ? 262  SER B CB  1 
ATOM   3014 O OG  . SER B 2 262 ? 25.026  -125.239 -60.323 1.00 28.89 ? 262  SER B OG  1 
ATOM   3015 N N   . GLY B 2 263 ? 26.158  -126.755 -57.664 1.00 22.34 ? 263  GLY B N   1 
ATOM   3016 C CA  . GLY B 2 263 ? 27.000  -127.916 -57.384 1.00 22.65 ? 263  GLY B CA  1 
ATOM   3017 C C   . GLY B 2 263 ? 26.837  -128.432 -55.967 1.00 23.09 ? 263  GLY B C   1 
ATOM   3018 O O   . GLY B 2 263 ? 27.447  -129.445 -55.598 1.00 22.17 ? 263  GLY B O   1 
ATOM   3019 N N   . CYS B 2 264 ? 26.043  -127.717 -55.158 1.00 23.17 ? 264  CYS B N   1 
ATOM   3020 C CA  . CYS B 2 264 ? 25.772  -128.105 -53.776 1.00 23.88 ? 264  CYS B CA  1 
ATOM   3021 C C   . CYS B 2 264 ? 24.430  -128.834 -53.677 1.00 24.06 ? 264  CYS B C   1 
ATOM   3022 O O   . CYS B 2 264 ? 23.428  -128.254 -53.247 1.00 24.52 ? 264  CYS B O   1 
ATOM   3023 C CB  . CYS B 2 264 ? 25.781  -126.892 -52.856 1.00 24.55 ? 264  CYS B CB  1 
ATOM   3024 S SG  . CYS B 2 264 ? 27.388  -126.160 -52.634 1.00 28.28 ? 264  CYS B SG  1 
ATOM   3025 N N   . LYS B 2 265 ? 24.438  -130.118 -54.043 1.00 22.24 ? 265  LYS B N   1 
ATOM   3026 C CA  . LYS B 2 265 ? 23.220  -130.924 -54.159 1.00 22.53 ? 265  LYS B CA  1 
ATOM   3027 C C   . LYS B 2 265 ? 22.515  -131.321 -52.850 1.00 22.06 ? 265  LYS B C   1 
ATOM   3028 O O   . LYS B 2 265 ? 21.339  -131.709 -52.873 1.00 21.56 ? 265  LYS B O   1 
ATOM   3029 C CB  . LYS B 2 265 ? 23.522  -132.183 -54.987 1.00 23.39 ? 265  LYS B CB  1 
ATOM   3030 C CG  . LYS B 2 265 ? 23.136  -132.074 -56.439 1.00 27.07 ? 265  LYS B CG  1 
ATOM   3031 C CD  . LYS B 2 265 ? 23.923  -131.045 -57.224 1.00 31.80 ? 265  LYS B CD  1 
ATOM   3032 C CE  . LYS B 2 265 ? 23.495  -131.120 -58.706 1.00 34.22 ? 265  LYS B CE  1 
ATOM   3033 N NZ  . LYS B 2 265 ? 24.466  -130.459 -59.637 1.00 36.50 ? 265  LYS B NZ  1 
ATOM   3034 N N   . GLU B 2 266 ? 23.237  -131.237 -51.735 1.00 21.37 ? 266  GLU B N   1 
ATOM   3035 C CA  . GLU B 2 266 ? 22.727  -131.636 -50.429 1.00 22.26 ? 266  GLU B CA  1 
ATOM   3036 C C   . GLU B 2 266 ? 22.244  -130.446 -49.543 1.00 22.46 ? 266  GLU B C   1 
ATOM   3037 O O   . GLU B 2 266 ? 21.812  -130.657 -48.414 1.00 21.07 ? 266  GLU B O   1 
ATOM   3038 C CB  . GLU B 2 266 ? 23.796  -132.436 -49.674 1.00 22.08 ? 266  GLU B CB  1 
ATOM   3039 C CG  . GLU B 2 266 ? 24.505  -133.515 -50.550 1.00 25.24 ? 266  GLU B CG  1 
ATOM   3040 C CD  . GLU B 2 266 ? 23.539  -134.530 -51.115 1.00 29.23 ? 266  GLU B CD  1 
ATOM   3041 O OE1 . GLU B 2 266 ? 23.829  -135.096 -52.203 1.00 32.31 ? 266  GLU B OE1 1 
ATOM   3042 O OE2 . GLU B 2 266 ? 22.491  -134.774 -50.465 1.00 31.92 ? 266  GLU B OE2 1 
ATOM   3043 N N   . LEU B 2 267 ? 22.350  -129.223 -50.049 1.00 23.68 ? 267  LEU B N   1 
ATOM   3044 C CA  . LEU B 2 267 ? 21.965  -128.041 -49.266 1.00 26.43 ? 267  LEU B CA  1 
ATOM   3045 C C   . LEU B 2 267 ? 20.488  -128.092 -48.934 1.00 26.60 ? 267  LEU B C   1 
ATOM   3046 O O   . LEU B 2 267 ? 19.655  -128.147 -49.846 1.00 27.56 ? 267  LEU B O   1 
ATOM   3047 C CB  . LEU B 2 267 ? 22.255  -126.760 -50.037 1.00 26.66 ? 267  LEU B CB  1 
ATOM   3048 C CG  . LEU B 2 267 ? 23.582  -126.047 -49.832 1.00 30.17 ? 267  LEU B CG  1 
ATOM   3049 C CD1 . LEU B 2 267 ? 23.598  -124.814 -50.711 1.00 33.01 ? 267  LEU B CD1 1 
ATOM   3050 C CD2 . LEU B 2 267 ? 23.708  -125.666 -48.356 1.00 30.14 ? 267  LEU B CD2 1 
ATOM   3051 N N   . ARG B 2 268 ? 20.165  -128.102 -47.640 1.00 27.23 ? 268  ARG B N   1 
ATOM   3052 C CA  . ARG B 2 268 ? 18.774  -128.052 -47.167 1.00 28.05 ? 268  ARG B CA  1 
ATOM   3053 C C   . ARG B 2 268 ? 18.443  -126.741 -46.404 1.00 29.28 ? 268  ARG B C   1 
ATOM   3054 O O   . ARG B 2 268 ? 17.270  -126.380 -46.243 1.00 27.71 ? 268  ARG B O   1 
ATOM   3055 C CB  . ARG B 2 268 ? 18.470  -129.232 -46.238 1.00 27.94 ? 268  ARG B CB  1 
ATOM   3056 C CG  . ARG B 2 268 ? 18.520  -130.647 -46.850 1.00 28.81 ? 268  ARG B CG  1 
ATOM   3057 C CD  . ARG B 2 268 ? 17.599  -130.786 -48.042 1.00 28.71 ? 268  ARG B CD  1 
ATOM   3058 N NE  . ARG B 2 268 ? 17.764  -132.077 -48.725 1.00 30.34 ? 268  ARG B NE  1 
ATOM   3059 C CZ  . ARG B 2 268 ? 18.498  -132.270 -49.820 1.00 28.86 ? 268  ARG B CZ  1 
ATOM   3060 N NH1 . ARG B 2 268 ? 19.145  -131.260 -50.393 1.00 29.59 ? 268  ARG B NH1 1 
ATOM   3061 N NH2 . ARG B 2 268 ? 18.571  -133.481 -50.357 1.00 31.69 ? 268  ARG B NH2 1 
ATOM   3062 N N   . CYS B 2 269 ? 19.476  -126.048 -45.923 1.00 30.86 ? 269  CYS B N   1 
ATOM   3063 C CA  . CYS B 2 269 ? 19.274  -124.886 -45.055 1.00 29.65 ? 269  CYS B CA  1 
ATOM   3064 C C   . CYS B 2 269 ? 20.133  -123.734 -45.514 1.00 27.36 ? 269  CYS B C   1 
ATOM   3065 O O   . CYS B 2 269 ? 21.330  -123.896 -45.719 1.00 26.39 ? 269  CYS B O   1 
ATOM   3066 C CB  . CYS B 2 269 ? 19.552  -125.221 -43.578 1.00 29.81 ? 269  CYS B CB  1 
ATOM   3067 S SG  . CYS B 2 269 ? 19.485  -123.657 -42.557 1.00 40.39 ? 269  CYS B SG  1 
ATOM   3068 N N   . LEU B 2 270 ? 19.518  -122.576 -45.730 1.00 24.34 ? 270  LEU B N   1 
ATOM   3069 C CA  . LEU B 2 270 ? 20.255  -121.404 -46.171 1.00 23.51 ? 270  LEU B CA  1 
ATOM   3070 C C   . LEU B 2 270 ? 19.954  -120.212 -45.261 1.00 22.54 ? 270  LEU B C   1 
ATOM   3071 O O   . LEU B 2 270 ? 18.788  -119.962 -44.928 1.00 22.01 ? 270  LEU B O   1 
ATOM   3072 C CB  . LEU B 2 270 ? 19.812  -120.991 -47.582 1.00 23.94 ? 270  LEU B CB  1 
ATOM   3073 C CG  . LEU B 2 270 ? 20.445  -121.437 -48.877 1.00 26.48 ? 270  LEU B CG  1 
ATOM   3074 C CD1 . LEU B 2 270 ? 19.764  -120.655 -50.025 1.00 24.65 ? 270  LEU B CD1 1 
ATOM   3075 C CD2 . LEU B 2 270 ? 21.954  -121.215 -48.852 1.00 27.60 ? 270  LEU B CD2 1 
ATOM   3076 N N   . SER B 2 271 ? 20.986  -119.434 -44.942 1.00 21.48 ? 271  SER B N   1 
ATOM   3077 C CA  . SER B 2 271 ? 20.837  -118.295 -44.032 1.00 21.33 ? 271  SER B CA  1 
ATOM   3078 C C   . SER B 2 271 ? 21.937  -117.280 -44.370 1.00 20.89 ? 271  SER B C   1 
ATOM   3079 O O   . SER B 2 271 ? 22.779  -117.499 -45.275 1.00 21.36 ? 271  SER B O   1 
ATOM   3080 C CB  . SER B 2 271 ? 20.959  -118.734 -42.533 1.00 20.83 ? 271  SER B CB  1 
ATOM   3081 O OG  . SER B 2 271 ? 22.198  -119.406 -42.315 1.00 22.89 ? 271  SER B OG  1 
ATOM   3082 N N   . GLY B 2 272 ? 21.954  -116.194 -43.608 1.00 21.35 ? 272  GLY B N   1 
ATOM   3083 C CA  . GLY B 2 272 ? 22.972  -115.139 -43.769 1.00 21.03 ? 272  GLY B CA  1 
ATOM   3084 C C   . GLY B 2 272 ? 22.334  -113.990 -44.520 1.00 21.03 ? 272  GLY B C   1 
ATOM   3085 O O   . GLY B 2 272 ? 21.498  -113.281 -43.989 1.00 20.39 ? 272  GLY B O   1 
ATOM   3086 N N   . PHE B 2 273 ? 22.725  -113.809 -45.783 1.00 21.67 ? 273  PHE B N   1 
ATOM   3087 C CA  . PHE B 2 273 ? 22.113  -112.791 -46.634 1.00 22.48 ? 273  PHE B CA  1 
ATOM   3088 C C   . PHE B 2 273 ? 22.262  -111.347 -46.147 1.00 22.71 ? 273  PHE B C   1 
ATOM   3089 O O   . PHE B 2 273 ? 21.438  -110.521 -46.484 1.00 22.49 ? 273  PHE B O   1 
ATOM   3090 C CB  . PHE B 2 273 ? 20.621  -113.112 -46.901 1.00 22.82 ? 273  PHE B CB  1 
ATOM   3091 C CG  . PHE B 2 273 ? 20.394  -114.459 -47.562 1.00 24.07 ? 273  PHE B CG  1 
ATOM   3092 C CD1 . PHE B 2 273 ? 19.829  -115.518 -46.844 1.00 24.22 ? 273  PHE B CD1 1 
ATOM   3093 C CD2 . PHE B 2 273 ? 20.742  -114.661 -48.903 1.00 25.65 ? 273  PHE B CD2 1 
ATOM   3094 C CE1 . PHE B 2 273 ? 19.624  -116.780 -47.430 1.00 25.54 ? 273  PHE B CE1 1 
ATOM   3095 C CE2 . PHE B 2 273 ? 20.545  -115.914 -49.513 1.00 28.03 ? 273  PHE B CE2 1 
ATOM   3096 C CZ  . PHE B 2 273 ? 19.974  -116.978 -48.775 1.00 26.35 ? 273  PHE B CZ  1 
ATOM   3097 N N   . TRP B 2 274 ? 23.308  -111.020 -45.384 1.00 24.05 ? 274  TRP B N   1 
ATOM   3098 C CA  . TRP B 2 274 ? 23.469  -109.630 -44.929 1.00 26.92 ? 274  TRP B CA  1 
ATOM   3099 C C   . TRP B 2 274 ? 23.605  -108.692 -46.086 1.00 27.78 ? 274  TRP B C   1 
ATOM   3100 O O   . TRP B 2 274 ? 24.298  -109.001 -47.060 1.00 28.74 ? 274  TRP B O   1 
ATOM   3101 C CB  . TRP B 2 274 ? 24.708  -109.424 -44.088 1.00 27.94 ? 274  TRP B CB  1 
ATOM   3102 C CG  . TRP B 2 274 ? 24.583  -109.972 -42.759 1.00 29.97 ? 274  TRP B CG  1 
ATOM   3103 C CD1 . TRP B 2 274 ? 23.985  -109.397 -41.662 1.00 31.10 ? 274  TRP B CD1 1 
ATOM   3104 C CD2 . TRP B 2 274 ? 25.067  -111.223 -42.355 1.00 28.70 ? 274  TRP B CD2 1 
ATOM   3105 N NE1 . TRP B 2 274 ? 24.081  -110.249 -40.582 1.00 30.20 ? 274  TRP B NE1 1 
ATOM   3106 C CE2 . TRP B 2 274 ? 24.743  -111.380 -40.989 1.00 30.86 ? 274  TRP B CE2 1 
ATOM   3107 C CE3 . TRP B 2 274 ? 25.761  -112.245 -43.017 1.00 29.91 ? 274  TRP B CE3 1 
ATOM   3108 C CZ2 . TRP B 2 274 ? 25.086  -112.522 -40.273 1.00 30.98 ? 274  TRP B CZ2 1 
ATOM   3109 C CZ3 . TRP B 2 274 ? 26.104  -113.361 -42.317 1.00 29.73 ? 274  TRP B CZ3 1 
ATOM   3110 C CH2 . TRP B 2 274 ? 25.775  -113.495 -40.946 1.00 32.75 ? 274  TRP B CH2 1 
ATOM   3111 N N   . ASP B 2 275 ? 22.972  -107.533 -45.973 1.00 28.54 ? 275  ASP B N   1 
ATOM   3112 C CA  . ASP B 2 275 ? 23.081  -106.522 -47.022 1.00 29.45 ? 275  ASP B CA  1 
ATOM   3113 C C   . ASP B 2 275 ? 22.562  -107.056 -48.388 1.00 29.27 ? 275  ASP B C   1 
ATOM   3114 O O   . ASP B 2 275 ? 22.910  -106.503 -49.433 1.00 28.70 ? 275  ASP B O   1 
ATOM   3115 C CB  . ASP B 2 275 ? 24.556  -106.067 -47.142 1.00 29.84 ? 275  ASP B CB  1 
ATOM   3116 C CG  . ASP B 2 275 ? 25.135  -105.525 -45.814 1.00 33.08 ? 275  ASP B CG  1 
ATOM   3117 O OD1 . ASP B 2 275 ? 24.585  -104.542 -45.281 1.00 34.56 ? 275  ASP B OD1 1 
ATOM   3118 O OD2 . ASP B 2 275 ? 26.156  -106.068 -45.319 1.00 36.26 ? 275  ASP B OD2 1 
ATOM   3119 N N   . ALA B 2 276 ? 21.751  -108.124 -48.383 1.00 27.91 ? 276  ALA B N   1 
ATOM   3120 C CA  . ALA B 2 276 ? 21.336  -108.779 -49.645 1.00 26.95 ? 276  ALA B CA  1 
ATOM   3121 C C   . ALA B 2 276 ? 20.918  -107.790 -50.732 1.00 26.50 ? 276  ALA B C   1 
ATOM   3122 O O   . ALA B 2 276 ? 20.159  -106.866 -50.486 1.00 25.29 ? 276  ALA B O   1 
ATOM   3123 C CB  . ALA B 2 276 ? 20.231  -109.811 -49.414 1.00 26.95 ? 276  ALA B CB  1 
ATOM   3124 N N   . VAL B 2 277 ? 21.449  -108.010 -51.928 1.00 25.49 ? 277  VAL B N   1 
ATOM   3125 C CA  . VAL B 2 277 ? 21.130  -107.236 -53.136 1.00 25.93 ? 277  VAL B CA  1 
ATOM   3126 C C   . VAL B 2 277 ? 20.193  -108.118 -53.966 1.00 24.98 ? 277  VAL B C   1 
ATOM   3127 O O   . VAL B 2 277 ? 20.558  -109.246 -54.290 1.00 25.01 ? 277  VAL B O   1 
ATOM   3128 C CB  . VAL B 2 277 ? 22.472  -106.891 -53.868 1.00 25.49 ? 277  VAL B CB  1 
ATOM   3129 C CG1 . VAL B 2 277 ? 22.287  -106.557 -55.335 1.00 27.63 ? 277  VAL B CG1 1 
ATOM   3130 C CG2 . VAL B 2 277 ? 23.148  -105.732 -53.159 1.00 26.74 ? 277  VAL B CG2 1 
ATOM   3131 N N   . PRO B 2 278 ? 18.978  -107.627 -54.284 1.00 25.03 ? 278  PRO B N   1 
ATOM   3132 C CA  . PRO B 2 278 ? 18.025  -108.414 -55.057 1.00 25.09 ? 278  PRO B CA  1 
ATOM   3133 C C   . PRO B 2 278 ? 18.623  -109.031 -56.308 1.00 25.16 ? 278  PRO B C   1 
ATOM   3134 O O   . PRO B 2 278 ? 18.291  -110.171 -56.645 1.00 25.81 ? 278  PRO B O   1 
ATOM   3135 C CB  . PRO B 2 278 ? 16.951  -107.387 -55.449 1.00 25.02 ? 278  PRO B CB  1 
ATOM   3136 C CG  . PRO B 2 278 ? 16.993  -106.393 -54.374 1.00 24.95 ? 278  PRO B CG  1 
ATOM   3137 C CD  . PRO B 2 278 ? 18.419  -106.302 -53.934 1.00 24.96 ? 278  PRO B CD  1 
ATOM   3138 N N   . ALA B 2 279 ? 19.504  -108.300 -56.989 1.00 24.31 ? 279  ALA B N   1 
ATOM   3139 C CA  . ALA B 2 279 ? 20.143  -108.803 -58.212 1.00 23.37 ? 279  ALA B CA  1 
ATOM   3140 C C   . ALA B 2 279 ? 20.869  -110.148 -58.029 1.00 22.88 ? 279  ALA B C   1 
ATOM   3141 O O   . ALA B 2 279 ? 20.990  -110.917 -58.981 1.00 22.40 ? 279  ALA B O   1 
ATOM   3142 C CB  . ALA B 2 279 ? 21.088  -107.747 -58.798 1.00 23.06 ? 279  ALA B CB  1 
ATOM   3143 N N   . TYR B 2 280 ? 21.336  -110.440 -56.814 1.00 22.19 ? 280  TYR B N   1 
ATOM   3144 C CA  . TYR B 2 280 ? 22.068  -111.696 -56.572 1.00 22.56 ? 280  TYR B CA  1 
ATOM   3145 C C   . TYR B 2 280 ? 21.261  -112.855 -55.919 1.00 22.84 ? 280  TYR B C   1 
ATOM   3146 O O   . TYR B 2 280 ? 21.710  -114.001 -55.934 1.00 22.82 ? 280  TYR B O   1 
ATOM   3147 C CB  . TYR B 2 280 ? 23.374  -111.438 -55.815 1.00 22.32 ? 280  TYR B CB  1 
ATOM   3148 C CG  . TYR B 2 280 ? 24.495  -110.836 -56.662 1.00 21.67 ? 280  TYR B CG  1 
ATOM   3149 C CD1 . TYR B 2 280 ? 24.831  -109.490 -56.557 1.00 21.81 ? 280  TYR B CD1 1 
ATOM   3150 C CD2 . TYR B 2 280 ? 25.232  -111.631 -57.539 1.00 21.08 ? 280  TYR B CD2 1 
ATOM   3151 C CE1 . TYR B 2 280 ? 25.876  -108.937 -57.340 1.00 22.69 ? 280  TYR B CE1 1 
ATOM   3152 C CE2 . TYR B 2 280 ? 26.273  -111.086 -58.318 1.00 22.52 ? 280  TYR B CE2 1 
ATOM   3153 C CZ  . TYR B 2 280 ? 26.589  -109.756 -58.214 1.00 21.30 ? 280  TYR B CZ  1 
ATOM   3154 O OH  . TYR B 2 280 ? 27.631  -109.262 -58.986 1.00 20.09 ? 280  TYR B OH  1 
ATOM   3155 N N   . LEU B 2 281 ? 20.057  -112.582 -55.425 1.00 23.40 ? 281  LEU B N   1 
ATOM   3156 C CA  . LEU B 2 281 ? 19.253  -113.657 -54.827 1.00 23.24 ? 281  LEU B CA  1 
ATOM   3157 C C   . LEU B 2 281 ? 18.930  -114.821 -55.773 1.00 22.49 ? 281  LEU B C   1 
ATOM   3158 O O   . LEU B 2 281 ? 18.971  -115.982 -55.326 1.00 22.56 ? 281  LEU B O   1 
ATOM   3159 C CB  . LEU B 2 281 ? 17.959  -113.110 -54.219 1.00 23.08 ? 281  LEU B CB  1 
ATOM   3160 C CG  . LEU B 2 281 ? 17.988  -112.488 -52.843 1.00 25.03 ? 281  LEU B CG  1 
ATOM   3161 C CD1 . LEU B 2 281 ? 16.588  -111.922 -52.560 1.00 27.10 ? 281  LEU B CD1 1 
ATOM   3162 C CD2 . LEU B 2 281 ? 18.410  -113.553 -51.789 1.00 24.35 ? 281  LEU B CD2 1 
ATOM   3163 N N   . PRO B 2 282 ? 18.621  -114.557 -57.070 1.00 22.12 ? 282  PRO B N   1 
ATOM   3164 C CA  . PRO B 2 282 ? 18.318  -115.712 -57.946 1.00 21.85 ? 282  PRO B CA  1 
ATOM   3165 C C   . PRO B 2 282 ? 19.374  -116.816 -58.023 1.00 22.14 ? 282  PRO B C   1 
ATOM   3166 O O   . PRO B 2 282 ? 19.063  -117.944 -58.423 1.00 21.70 ? 282  PRO B O   1 
ATOM   3167 C CB  . PRO B 2 282 ? 18.164  -115.063 -59.328 1.00 22.04 ? 282  PRO B CB  1 
ATOM   3168 C CG  . PRO B 2 282 ? 17.634  -113.713 -58.996 1.00 22.75 ? 282  PRO B CG  1 
ATOM   3169 C CD  . PRO B 2 282 ? 18.460  -113.291 -57.821 1.00 21.72 ? 282  PRO B CD  1 
ATOM   3170 N N   . ALA B 2 283 ? 20.606  -116.506 -57.648 1.00 21.90 ? 283  ALA B N   1 
ATOM   3171 C CA  . ALA B 2 283 ? 21.673  -117.503 -57.698 1.00 22.65 ? 283  ALA B CA  1 
ATOM   3172 C C   . ALA B 2 283 ? 21.413  -118.714 -56.803 1.00 23.30 ? 283  ALA B C   1 
ATOM   3173 O O   . ALA B 2 283 ? 21.990  -119.784 -57.056 1.00 25.08 ? 283  ALA B O   1 
ATOM   3174 C CB  . ALA B 2 283 ? 23.022  -116.863 -57.358 1.00 22.17 ? 283  ALA B CB  1 
ATOM   3175 N N   . VAL B 2 284 ? 20.596  -118.542 -55.759 1.00 23.58 ? 284  VAL B N   1 
ATOM   3176 C CA  . VAL B 2 284 ? 20.240  -119.632 -54.822 1.00 24.35 ? 284  VAL B CA  1 
ATOM   3177 C C   . VAL B 2 284 ? 19.039  -120.481 -55.299 1.00 24.83 ? 284  VAL B C   1 
ATOM   3178 O O   . VAL B 2 284 ? 18.740  -121.526 -54.700 1.00 25.09 ? 284  VAL B O   1 
ATOM   3179 C CB  . VAL B 2 284 ? 19.978  -119.111 -53.354 1.00 23.98 ? 284  VAL B CB  1 
ATOM   3180 C CG1 . VAL B 2 284 ? 21.193  -118.364 -52.833 1.00 25.19 ? 284  VAL B CG1 1 
ATOM   3181 C CG2 . VAL B 2 284 ? 18.743  -118.220 -53.285 1.00 23.89 ? 284  VAL B CG2 1 
ATOM   3182 N N   . TYR B 2 285 ? 18.369  -120.026 -56.360 1.00 24.69 ? 285  TYR B N   1 
ATOM   3183 C CA  . TYR B 2 285 ? 17.154  -120.678 -56.873 1.00 25.49 ? 285  TYR B CA  1 
ATOM   3184 C C   . TYR B 2 285 ? 17.312  -122.178 -57.142 1.00 25.96 ? 285  TYR B C   1 
ATOM   3185 O O   . TYR B 2 285 ? 16.385  -122.945 -56.884 1.00 26.68 ? 285  TYR B O   1 
ATOM   3186 C CB  . TYR B 2 285 ? 16.626  -119.963 -58.124 1.00 26.20 ? 285  TYR B CB  1 
ATOM   3187 C CG  . TYR B 2 285 ? 15.959  -118.602 -57.890 1.00 26.02 ? 285  TYR B CG  1 
ATOM   3188 C CD1 . TYR B 2 285 ? 15.871  -118.021 -56.608 1.00 25.20 ? 285  TYR B CD1 1 
ATOM   3189 C CD2 . TYR B 2 285 ? 15.445  -117.883 -58.973 1.00 27.20 ? 285  TYR B CD2 1 
ATOM   3190 C CE1 . TYR B 2 285 ? 15.253  -116.749 -56.433 1.00 24.71 ? 285  TYR B CE1 1 
ATOM   3191 C CE2 . TYR B 2 285 ? 14.832  -116.628 -58.810 1.00 26.14 ? 285  TYR B CE2 1 
ATOM   3192 C CZ  . TYR B 2 285 ? 14.764  -116.065 -57.536 1.00 26.37 ? 285  TYR B CZ  1 
ATOM   3193 O OH  . TYR B 2 285 ? 14.162  -114.830 -57.410 1.00 26.43 ? 285  TYR B OH  1 
ATOM   3194 N N   . SER B 2 286 ? 18.482  -122.605 -57.610 1.00 26.62 ? 286  SER B N   1 
ATOM   3195 C CA  . SER B 2 286 ? 18.724  -124.031 -57.937 1.00 28.28 ? 286  SER B CA  1 
ATOM   3196 C C   . SER B 2 286 ? 18.629  -124.904 -56.693 1.00 28.20 ? 286  SER B C   1 
ATOM   3197 O O   . SER B 2 286 ? 18.255  -126.071 -56.748 1.00 28.68 ? 286  SER B O   1 
ATOM   3198 C CB  . SER B 2 286 ? 20.101  -124.224 -58.582 1.00 27.77 ? 286  SER B CB  1 
ATOM   3199 O OG  . SER B 2 286 ? 21.132  -124.089 -57.607 1.00 29.51 ? 286  SER B OG  1 
ATOM   3200 N N   . VAL B 2 287 ? 18.983  -124.286 -55.581 1.00 28.84 ? 287  VAL B N   1 
ATOM   3201 C CA  . VAL B 2 287 ? 19.058  -124.877 -54.274 1.00 30.92 ? 287  VAL B CA  1 
ATOM   3202 C C   . VAL B 2 287 ? 17.654  -125.001 -53.677 1.00 31.05 ? 287  VAL B C   1 
ATOM   3203 O O   . VAL B 2 287 ? 17.396  -125.852 -52.839 1.00 31.13 ? 287  VAL B O   1 
ATOM   3204 C CB  . VAL B 2 287 ? 20.006  -123.959 -53.409 1.00 30.73 ? 287  VAL B CB  1 
ATOM   3205 C CG1 . VAL B 2 287 ? 19.631  -123.916 -51.952 1.00 33.57 ? 287  VAL B CG1 1 
ATOM   3206 C CG2 . VAL B 2 287 ? 21.445  -124.369 -53.607 1.00 33.48 ? 287  VAL B CG2 1 
ATOM   3207 N N   . CYS B 2 288 ? 16.734  -124.162 -54.116 1.00 32.41 ? 288  CYS B N   1 
ATOM   3208 C CA  . CYS B 2 288 ? 15.499  -124.032 -53.358 1.00 34.62 ? 288  CYS B CA  1 
ATOM   3209 C C   . CYS B 2 288 ? 14.363  -124.888 -53.863 1.00 34.65 ? 288  CYS B C   1 
ATOM   3210 O O   . CYS B 2 288 ? 13.220  -124.483 -53.851 1.00 37.29 ? 288  CYS B O   1 
ATOM   3211 C CB  . CYS B 2 288 ? 15.120  -122.551 -53.116 1.00 35.14 ? 288  CYS B CB  1 
ATOM   3212 S SG  . CYS B 2 288 ? 15.077  -121.427 -54.545 1.00 39.65 ? 288  CYS B SG  1 
ATOM   3213 N N   . SER B 2 289 ? 14.670  -126.088 -54.335 1.00 34.15 ? 289  SER B N   1 
ATOM   3214 C CA  . SER B 2 289 ? 13.629  -127.055 -54.632 1.00 33.06 ? 289  SER B CA  1 
ATOM   3215 C C   . SER B 2 289 ? 13.601  -128.005 -53.472 1.00 31.69 ? 289  SER B C   1 
ATOM   3216 O O   . SER B 2 289 ? 12.565  -128.568 -53.135 1.00 31.38 ? 289  SER B O   1 
ATOM   3217 C CB  . SER B 2 289 ? 13.958  -127.823 -55.897 1.00 33.93 ? 289  SER B CB  1 
ATOM   3218 O OG  . SER B 2 289 ? 14.170  -126.925 -56.964 1.00 35.76 ? 289  SER B OG  1 
ATOM   3219 N N   . ARG B 2 290 ? 14.762  -128.137 -52.840 1.00 29.32 ? 290  ARG B N   1 
ATOM   3220 C CA  . ARG B 2 290 ? 14.937  -129.056 -51.739 1.00 28.40 ? 290  ARG B CA  1 
ATOM   3221 C C   . ARG B 2 290 ? 15.090  -128.355 -50.374 1.00 26.70 ? 290  ARG B C   1 
ATOM   3222 O O   . ARG B 2 290 ? 15.187  -129.013 -49.342 1.00 25.84 ? 290  ARG B O   1 
ATOM   3223 C CB  . ARG B 2 290 ? 16.145  -129.933 -52.025 1.00 28.45 ? 290  ARG B CB  1 
ATOM   3224 C CG  . ARG B 2 290 ? 17.440  -129.137 -52.287 1.00 30.37 ? 290  ARG B CG  1 
ATOM   3225 C CD  . ARG B 2 290 ? 18.389  -129.894 -53.305 1.00 29.81 ? 290  ARG B CD  1 
ATOM   3226 N NE  . ARG B 2 290 ? 19.617  -129.109 -53.440 1.00 35.13 ? 290  ARG B NE  1 
ATOM   3227 C CZ  . ARG B 2 290 ? 20.217  -128.778 -54.595 1.00 36.68 ? 290  ARG B CZ  1 
ATOM   3228 N NH1 . ARG B 2 290 ? 19.772  -129.233 -55.773 1.00 38.42 ? 290  ARG B NH1 1 
ATOM   3229 N NH2 . ARG B 2 290 ? 21.303  -128.012 -54.564 1.00 37.53 ? 290  ARG B NH2 1 
ATOM   3230 N N   . LEU B 2 291 ? 15.119  -127.026 -50.367 1.00 25.48 ? 291  LEU B N   1 
ATOM   3231 C CA  . LEU B 2 291 ? 15.350  -126.316 -49.109 1.00 25.28 ? 291  LEU B CA  1 
ATOM   3232 C C   . LEU B 2 291 ? 14.258  -126.612 -48.105 1.00 24.13 ? 291  LEU B C   1 
ATOM   3233 O O   . LEU B 2 291 ? 13.074  -126.554 -48.447 1.00 23.90 ? 291  LEU B O   1 
ATOM   3234 C CB  . LEU B 2 291 ? 15.411  -124.806 -49.321 1.00 25.65 ? 291  LEU B CB  1 
ATOM   3235 C CG  . LEU B 2 291 ? 16.726  -124.231 -49.828 1.00 27.24 ? 291  LEU B CG  1 
ATOM   3236 C CD1 . LEU B 2 291 ? 16.618  -122.742 -49.679 1.00 27.83 ? 291  LEU B CD1 1 
ATOM   3237 C CD2 . LEU B 2 291 ? 17.920  -124.758 -49.038 1.00 28.17 ? 291  LEU B CD2 1 
ATOM   3238 N N   . THR B 2 292 ? 14.655  -126.940 -46.877 1.00 22.88 ? 292  THR B N   1 
ATOM   3239 C CA  . THR B 2 292 ? 13.680  -127.101 -45.807 1.00 22.85 ? 292  THR B CA  1 
ATOM   3240 C C   . THR B 2 292 ? 13.687  -125.940 -44.813 1.00 22.72 ? 292  THR B C   1 
ATOM   3241 O O   . THR B 2 292 ? 12.700  -125.741 -44.099 1.00 22.27 ? 292  THR B O   1 
ATOM   3242 C CB  . THR B 2 292 ? 13.776  -128.453 -45.083 1.00 23.39 ? 292  THR B CB  1 
ATOM   3243 O OG1 . THR B 2 292 ? 15.093  -128.648 -44.561 1.00 22.45 ? 292  THR B OG1 1 
ATOM   3244 C CG2 . THR B 2 292 ? 13.442  -129.634 -46.038 1.00 23.26 ? 292  THR B CG2 1 
ATOM   3245 N N   . THR B 2 293 ? 14.809  -125.204 -44.747 1.00 22.22 ? 293  THR B N   1 
ATOM   3246 C CA  . THR B 2 293 ? 14.944  -124.036 -43.821 1.00 22.32 ? 293  THR B CA  1 
ATOM   3247 C C   . THR B 2 293 ? 15.517  -122.878 -44.581 1.00 21.96 ? 293  THR B C   1 
ATOM   3248 O O   . THR B 2 293 ? 16.504  -123.017 -45.296 1.00 21.33 ? 293  THR B O   1 
ATOM   3249 C CB  . THR B 2 293 ? 15.793  -124.308 -42.534 1.00 22.23 ? 293  THR B CB  1 
ATOM   3250 O OG1 . THR B 2 293 ? 15.054  -125.161 -41.660 1.00 25.32 ? 293  THR B OG1 1 
ATOM   3251 C CG2 . THR B 2 293 ? 16.098  -122.997 -41.720 1.00 22.16 ? 293  THR B CG2 1 
ATOM   3252 N N   . LEU B 2 294 ? 14.839  -121.734 -44.467 1.00 22.31 ? 294  LEU B N   1 
ATOM   3253 C CA  . LEU B 2 294 ? 15.344  -120.530 -45.082 1.00 23.24 ? 294  LEU B CA  1 
ATOM   3254 C C   . LEU B 2 294 ? 15.310  -119.438 -44.041 1.00 21.63 ? 294  LEU B C   1 
ATOM   3255 O O   . LEU B 2 294 ? 14.254  -119.221 -43.439 1.00 21.90 ? 294  LEU B O   1 
ATOM   3256 C CB  . LEU B 2 294 ? 14.449  -120.152 -46.269 1.00 23.80 ? 294  LEU B CB  1 
ATOM   3257 C CG  . LEU B 2 294 ? 14.810  -118.949 -47.144 1.00 25.05 ? 294  LEU B CG  1 
ATOM   3258 C CD1 . LEU B 2 294 ? 16.220  -119.114 -47.756 1.00 24.74 ? 294  LEU B CD1 1 
ATOM   3259 C CD2 . LEU B 2 294 ? 13.755  -118.879 -48.264 1.00 24.94 ? 294  LEU B CD2 1 
ATOM   3260 N N   . ASN B 2 295 ? 16.451  -118.788 -43.806 1.00 21.15 ? 295  ASN B N   1 
ATOM   3261 C CA  . ASN B 2 295 ? 16.467  -117.683 -42.845 1.00 22.02 ? 295  ASN B CA  1 
ATOM   3262 C C   . ASN B 2 295 ? 16.813  -116.377 -43.545 1.00 21.50 ? 295  ASN B C   1 
ATOM   3263 O O   . ASN B 2 295 ? 17.960  -116.121 -43.838 1.00 21.65 ? 295  ASN B O   1 
ATOM   3264 C CB  . ASN B 2 295 ? 17.444  -117.938 -41.683 1.00 21.44 ? 295  ASN B CB  1 
ATOM   3265 C CG  . ASN B 2 295 ? 17.416  -116.828 -40.616 1.00 22.02 ? 295  ASN B CG  1 
ATOM   3266 O OD1 . ASN B 2 295 ? 16.796  -115.783 -40.795 1.00 20.91 ? 295  ASN B OD1 1 
ATOM   3267 N ND2 . ASN B 2 295 ? 18.084  -117.066 -39.506 1.00 23.38 ? 295  ASN B ND2 1 
ATOM   3268 N N   . LEU B 2 296 ? 15.804  -115.546 -43.749 1.00 22.61 ? 296  LEU B N   1 
ATOM   3269 C CA  . LEU B 2 296 ? 15.984  -114.305 -44.466 1.00 24.17 ? 296  LEU B CA  1 
ATOM   3270 C C   . LEU B 2 296 ? 15.839  -113.097 -43.539 1.00 25.53 ? 296  LEU B C   1 
ATOM   3271 O O   . LEU B 2 296 ? 15.635  -111.986 -44.024 1.00 25.44 ? 296  LEU B O   1 
ATOM   3272 C CB  . LEU B 2 296 ? 14.948  -114.223 -45.595 1.00 24.50 ? 296  LEU B CB  1 
ATOM   3273 C CG  . LEU B 2 296 ? 15.168  -115.187 -46.768 1.00 25.91 ? 296  LEU B CG  1 
ATOM   3274 C CD1 . LEU B 2 296 ? 13.837  -115.287 -47.461 1.00 26.13 ? 296  LEU B CD1 1 
ATOM   3275 C CD2 . LEU B 2 296 ? 16.243  -114.626 -47.686 1.00 24.69 ? 296  LEU B CD2 1 
ATOM   3276 N N   . SER B 2 297 ? 15.980  -113.336 -42.230 1.00 25.30 ? 297  SER B N   1 
ATOM   3277 C CA  . SER B 2 297 ? 15.917  -112.292 -41.182 1.00 26.97 ? 297  SER B CA  1 
ATOM   3278 C C   . SER B 2 297 ? 16.745  -111.040 -41.441 1.00 27.52 ? 297  SER B C   1 
ATOM   3279 O O   . SER B 2 297 ? 16.395  -109.960 -40.937 1.00 26.97 ? 297  SER B O   1 
ATOM   3280 C CB  . SER B 2 297 ? 16.453  -112.850 -39.847 1.00 26.40 ? 297  SER B CB  1 
ATOM   3281 O OG  . SER B 2 297 ? 15.608  -113.822 -39.378 1.00 31.66 ? 297  SER B OG  1 
ATOM   3282 N N   . TYR B 2 298 ? 17.864  -111.173 -42.154 1.00 27.22 ? 298  TYR B N   1 
ATOM   3283 C CA  . TYR B 2 298 ? 18.762  -110.043 -42.346 1.00 28.94 ? 298  TYR B CA  1 
ATOM   3284 C C   . TYR B 2 298 ? 18.700  -109.437 -43.737 1.00 29.17 ? 298  TYR B C   1 
ATOM   3285 O O   . TYR B 2 298 ? 19.342  -108.441 -43.973 1.00 29.34 ? 298  TYR B O   1 
ATOM   3286 C CB  . TYR B 2 298 ? 20.211  -110.444 -42.060 1.00 30.48 ? 298  TYR B CB  1 
ATOM   3287 C CG  . TYR B 2 298 ? 20.395  -111.017 -40.702 1.00 33.27 ? 298  TYR B CG  1 
ATOM   3288 C CD1 . TYR B 2 298 ? 21.004  -112.250 -40.523 1.00 37.52 ? 298  TYR B CD1 1 
ATOM   3289 C CD2 . TYR B 2 298 ? 19.927  -110.332 -39.577 1.00 37.84 ? 298  TYR B CD2 1 
ATOM   3290 C CE1 . TYR B 2 298 ? 21.157  -112.785 -39.251 1.00 38.98 ? 298  TYR B CE1 1 
ATOM   3291 C CE2 . TYR B 2 298 ? 20.074  -110.845 -38.316 1.00 38.51 ? 298  TYR B CE2 1 
ATOM   3292 C CZ  . TYR B 2 298 ? 20.685  -112.071 -38.157 1.00 38.17 ? 298  TYR B CZ  1 
ATOM   3293 O OH  . TYR B 2 298 ? 20.837  -112.569 -36.883 1.00 39.87 ? 298  TYR B OH  1 
ATOM   3294 N N   . ALA B 2 299 ? 17.953  -110.053 -44.648 1.00 29.81 ? 299  ALA B N   1 
ATOM   3295 C CA  . ALA B 2 299 ? 17.789  -109.532 -45.998 1.00 30.15 ? 299  ALA B CA  1 
ATOM   3296 C C   . ALA B 2 299 ? 16.712  -108.454 -45.980 1.00 30.55 ? 299  ALA B C   1 
ATOM   3297 O O   . ALA B 2 299 ? 15.564  -108.730 -45.686 1.00 31.68 ? 299  ALA B O   1 
ATOM   3298 C CB  . ALA B 2 299 ? 17.376  -110.656 -46.938 1.00 30.33 ? 299  ALA B CB  1 
ATOM   3299 N N   . THR B 2 300 ? 17.056  -107.229 -46.318 1.00 30.62 ? 300  THR B N   1 
ATOM   3300 C CA  . THR B 2 300 ? 16.036  -106.174 -46.310 1.00 31.38 ? 300  THR B CA  1 
ATOM   3301 C C   . THR B 2 300 ? 15.443  -105.919 -47.719 1.00 30.73 ? 300  THR B C   1 
ATOM   3302 O O   . THR B 2 300 ? 15.210  -104.769 -48.109 1.00 31.88 ? 300  THR B O   1 
ATOM   3303 C CB  . THR B 2 300 ? 16.596  -104.870 -45.713 1.00 31.41 ? 300  THR B CB  1 
ATOM   3304 O OG1 . THR B 2 300 ? 17.684  -104.441 -46.521 1.00 34.21 ? 300  THR B OG1 1 
ATOM   3305 C CG2 . THR B 2 300 ? 17.112  -105.109 -44.306 1.00 31.79 ? 300  THR B CG2 1 
ATOM   3306 N N   . VAL B 2 301 ? 15.198  -106.995 -48.463 1.00 28.50 ? 301  VAL B N   1 
ATOM   3307 C CA  . VAL B 2 301 ? 14.631  -106.899 -49.808 1.00 26.68 ? 301  VAL B CA  1 
ATOM   3308 C C   . VAL B 2 301 ? 13.104  -106.925 -49.730 1.00 25.92 ? 301  VAL B C   1 
ATOM   3309 O O   . VAL B 2 301 ? 12.522  -107.404 -48.734 1.00 24.09 ? 301  VAL B O   1 
ATOM   3310 C CB  . VAL B 2 301 ? 15.147  -108.008 -50.719 1.00 26.37 ? 301  VAL B CB  1 
ATOM   3311 C CG1 . VAL B 2 301 ? 16.646  -107.886 -50.853 1.00 26.28 ? 301  VAL B CG1 1 
ATOM   3312 C CG2 . VAL B 2 301 ? 14.748  -109.384 -50.178 1.00 26.30 ? 301  VAL B CG2 1 
ATOM   3313 N N   . GLN B 2 302 ? 12.443  -106.445 -50.779 1.00 23.59 ? 302  GLN B N   1 
ATOM   3314 C CA  . GLN B 2 302 ? 11.026  -106.164 -50.627 1.00 24.27 ? 302  GLN B CA  1 
ATOM   3315 C C   . GLN B 2 302 ? 10.154  -107.344 -50.975 1.00 23.19 ? 302  GLN B C   1 
ATOM   3316 O O   . GLN B 2 302 ? 10.657  -108.350 -51.477 1.00 22.88 ? 302  GLN B O   1 
ATOM   3317 C CB  . GLN B 2 302 ? 10.647  -104.908 -51.416 1.00 24.86 ? 302  GLN B CB  1 
ATOM   3318 C CG  . GLN B 2 302 ? 11.511  -103.685 -51.014 1.00 30.20 ? 302  GLN B CG  1 
ATOM   3319 C CD  . GLN B 2 302 ? 11.325  -103.253 -49.544 1.00 35.15 ? 302  GLN B CD  1 
ATOM   3320 O OE1 . GLN B 2 302 ? 10.268  -102.724 -49.169 1.00 37.82 ? 302  GLN B OE1 1 
ATOM   3321 N NE2 . GLN B 2 302 ? 12.368  -103.461 -48.713 1.00 35.14 ? 302  GLN B NE2 1 
ATOM   3322 N N   . SER B 2 303 ? 8.848   -107.193 -50.759 1.00 21.47 ? 303  SER B N   1 
ATOM   3323 C CA  . SER B 2 303 ? 7.903   -108.306 -50.881 1.00 21.84 ? 303  SER B CA  1 
ATOM   3324 C C   . SER B 2 303 ? 8.059   -109.130 -52.172 1.00 21.67 ? 303  SER B C   1 
ATOM   3325 O O   . SER B 2 303 ? 8.137   -110.371 -52.132 1.00 21.91 ? 303  SER B O   1 
ATOM   3326 C CB  . SER B 2 303 ? 6.464   -107.796 -50.798 1.00 21.62 ? 303  SER B CB  1 
ATOM   3327 O OG  . SER B 2 303 ? 5.563   -108.890 -50.757 1.00 23.85 ? 303  SER B OG  1 
ATOM   3328 N N   . TYR B 2 304 ? 8.088   -108.441 -53.302 1.00 21.31 ? 304  TYR B N   1 
ATOM   3329 C CA  . TYR B 2 304 ? 8.081   -109.121 -54.594 1.00 21.51 ? 304  TYR B CA  1 
ATOM   3330 C C   . TYR B 2 304 ? 9.336   -109.973 -54.786 1.00 22.49 ? 304  TYR B C   1 
ATOM   3331 O O   . TYR B 2 304 ? 9.257   -111.079 -55.290 1.00 22.56 ? 304  TYR B O   1 
ATOM   3332 C CB  . TYR B 2 304 ? 7.882   -108.130 -55.721 1.00 20.73 ? 304  TYR B CB  1 
ATOM   3333 C CG  . TYR B 2 304 ? 7.693   -108.786 -57.069 1.00 20.53 ? 304  TYR B CG  1 
ATOM   3334 C CD1 . TYR B 2 304 ? 6.466   -109.373 -57.419 1.00 18.67 ? 304  TYR B CD1 1 
ATOM   3335 C CD2 . TYR B 2 304 ? 8.749   -108.844 -57.989 1.00 18.32 ? 304  TYR B CD2 1 
ATOM   3336 C CE1 . TYR B 2 304 ? 6.296   -109.986 -58.666 1.00 20.35 ? 304  TYR B CE1 1 
ATOM   3337 C CE2 . TYR B 2 304 ? 8.583   -109.470 -59.227 1.00 20.12 ? 304  TYR B CE2 1 
ATOM   3338 C CZ  . TYR B 2 304 ? 7.355   -110.036 -59.554 1.00 19.04 ? 304  TYR B CZ  1 
ATOM   3339 O OH  . TYR B 2 304 ? 7.202   -110.626 -60.790 1.00 20.30 ? 304  TYR B OH  1 
ATOM   3340 N N   . ASP B 2 305 ? 10.480  -109.453 -54.353 1.00 23.26 ? 305  ASP B N   1 
ATOM   3341 C CA  . ASP B 2 305 ? 11.735  -110.208 -54.369 1.00 24.43 ? 305  ASP B CA  1 
ATOM   3342 C C   . ASP B 2 305 ? 11.661  -111.461 -53.489 1.00 23.50 ? 305  ASP B C   1 
ATOM   3343 O O   . ASP B 2 305 ? 12.127  -112.523 -53.898 1.00 23.28 ? 305  ASP B O   1 
ATOM   3344 C CB  . ASP B 2 305 ? 12.908  -109.320 -53.928 1.00 25.23 ? 305  ASP B CB  1 
ATOM   3345 C CG  . ASP B 2 305 ? 13.194  -108.205 -54.921 1.00 28.37 ? 305  ASP B CG  1 
ATOM   3346 O OD1 . ASP B 2 305 ? 13.296  -108.513 -56.112 1.00 29.09 ? 305  ASP B OD1 1 
ATOM   3347 O OD2 . ASP B 2 305 ? 13.305  -107.031 -54.500 1.00 34.15 ? 305  ASP B OD2 1 
ATOM   3348 N N   . LEU B 2 306 ? 11.067  -111.333 -52.304 1.00 22.52 ? 306  LEU B N   1 
ATOM   3349 C CA  . LEU B 2 306 ? 10.857  -112.484 -51.414 1.00 22.59 ? 306  LEU B CA  1 
ATOM   3350 C C   . LEU B 2 306 ? 9.949   -113.551 -52.024 1.00 22.53 ? 306  LEU B C   1 
ATOM   3351 O O   . LEU B 2 306 ? 10.268  -114.743 -51.961 1.00 22.69 ? 306  LEU B O   1 
ATOM   3352 C CB  . LEU B 2 306 ? 10.348  -112.051 -50.033 1.00 22.47 ? 306  LEU B CB  1 
ATOM   3353 C CG  . LEU B 2 306 ? 11.339  -111.211 -49.219 1.00 22.46 ? 306  LEU B CG  1 
ATOM   3354 C CD1 . LEU B 2 306 ? 10.624  -110.491 -48.068 1.00 24.39 ? 306  LEU B CD1 1 
ATOM   3355 C CD2 . LEU B 2 306 ? 12.502  -112.090 -48.692 1.00 24.36 ? 306  LEU B CD2 1 
ATOM   3356 N N   . VAL B 2 307 ? 8.858   -113.110 -52.638 1.00 22.29 ? 307  VAL B N   1 
ATOM   3357 C CA  . VAL B 2 307 ? 7.903   -113.985 -53.333 1.00 22.47 ? 307  VAL B CA  1 
ATOM   3358 C C   . VAL B 2 307 ? 8.544   -114.798 -54.463 1.00 22.23 ? 307  VAL B C   1 
ATOM   3359 O O   . VAL B 2 307 ? 8.267   -116.007 -54.596 1.00 22.62 ? 307  VAL B O   1 
ATOM   3360 C CB  . VAL B 2 307 ? 6.683   -113.181 -53.847 1.00 21.67 ? 307  VAL B CB  1 
ATOM   3361 C CG1 . VAL B 2 307 ? 5.853   -113.994 -54.837 1.00 22.02 ? 307  VAL B CG1 1 
ATOM   3362 C CG2 . VAL B 2 307 ? 5.815   -112.750 -52.679 1.00 22.48 ? 307  VAL B CG2 1 
ATOM   3363 N N   . LYS B 2 308 ? 9.373   -114.161 -55.289 1.00 22.29 ? 308  LYS B N   1 
ATOM   3364 C CA  . LYS B 2 308 ? 10.015  -114.863 -56.388 1.00 22.61 ? 308  LYS B CA  1 
ATOM   3365 C C   . LYS B 2 308 ? 10.882  -116.001 -55.851 1.00 22.93 ? 308  LYS B C   1 
ATOM   3366 O O   . LYS B 2 308 ? 10.926  -117.066 -56.432 1.00 23.53 ? 308  LYS B O   1 
ATOM   3367 C CB  . LYS B 2 308 ? 10.855  -113.927 -57.271 1.00 21.96 ? 308  LYS B CB  1 
ATOM   3368 C CG  . LYS B 2 308 ? 10.044  -112.900 -58.031 1.00 21.99 ? 308  LYS B CG  1 
ATOM   3369 C CD  . LYS B 2 308 ? 10.887  -112.184 -59.054 1.00 23.16 ? 308  LYS B CD  1 
ATOM   3370 C CE  . LYS B 2 308 ? 11.853  -111.187 -58.420 1.00 25.41 ? 308  LYS B CE  1 
ATOM   3371 N NZ  . LYS B 2 308 ? 12.525  -110.441 -59.532 1.00 28.46 ? 308  LYS B NZ  1 
ATOM   3372 N N   . LEU B 2 309 ? 11.573  -115.765 -54.750 1.00 23.80 ? 309  LEU B N   1 
ATOM   3373 C CA  . LEU B 2 309 ? 12.337  -116.816 -54.070 1.00 24.57 ? 309  LEU B CA  1 
ATOM   3374 C C   . LEU B 2 309 ? 11.398  -117.883 -53.490 1.00 24.18 ? 309  LEU B C   1 
ATOM   3375 O O   . LEU B 2 309 ? 11.559  -119.077 -53.767 1.00 24.26 ? 309  LEU B O   1 
ATOM   3376 C CB  . LEU B 2 309 ? 13.190  -116.218 -52.945 1.00 24.97 ? 309  LEU B CB  1 
ATOM   3377 C CG  . LEU B 2 309 ? 14.550  -116.782 -52.533 1.00 28.17 ? 309  LEU B CG  1 
ATOM   3378 C CD1 . LEU B 2 309 ? 14.756  -116.587 -51.048 1.00 32.08 ? 309  LEU B CD1 1 
ATOM   3379 C CD2 . LEU B 2 309 ? 14.827  -118.237 -52.946 1.00 31.09 ? 309  LEU B CD2 1 
ATOM   3380 N N   . LEU B 2 310 ? 10.430  -117.458 -52.696 1.00 23.62 ? 310  LEU B N   1 
ATOM   3381 C CA  . LEU B 2 310 ? 9.557   -118.391 -51.990 1.00 23.85 ? 310  LEU B CA  1 
ATOM   3382 C C   . LEU B 2 310 ? 8.733   -119.297 -52.913 1.00 24.00 ? 310  LEU B C   1 
ATOM   3383 O O   . LEU B 2 310 ? 8.482   -120.446 -52.569 1.00 23.32 ? 310  LEU B O   1 
ATOM   3384 C CB  . LEU B 2 310 ? 8.637   -117.663 -50.986 1.00 24.99 ? 310  LEU B CB  1 
ATOM   3385 C CG  . LEU B 2 310 ? 9.382   -117.000 -49.822 1.00 24.90 ? 310  LEU B CG  1 
ATOM   3386 C CD1 . LEU B 2 310 ? 8.391   -116.107 -49.099 1.00 28.11 ? 310  LEU B CD1 1 
ATOM   3387 C CD2 . LEU B 2 310 ? 10.022  -118.037 -48.865 1.00 27.20 ? 310  LEU B CD2 1 
ATOM   3388 N N   . CYS B 2 311 ? 8.350   -118.789 -54.087 1.00 25.08 ? 311  CYS B N   1 
ATOM   3389 C CA  . CYS B 2 311 ? 7.678   -119.587 -55.104 1.00 26.72 ? 311  CYS B CA  1 
ATOM   3390 C C   . CYS B 2 311 ? 8.450   -120.821 -55.534 1.00 26.91 ? 311  CYS B C   1 
ATOM   3391 O O   . CYS B 2 311 ? 7.868   -121.759 -56.068 1.00 27.16 ? 311  CYS B O   1 
ATOM   3392 C CB  . CYS B 2 311 ? 7.401   -118.761 -56.365 1.00 27.38 ? 311  CYS B CB  1 
ATOM   3393 S SG  . CYS B 2 311 ? 6.060   -117.727 -56.021 1.00 31.02 ? 311  CYS B SG  1 
ATOM   3394 N N   . GLN B 2 312 ? 9.754   -120.789 -55.322 1.00 27.09 ? 312  GLN B N   1 
ATOM   3395 C CA  . GLN B 2 312 ? 10.634  -121.849 -55.752 1.00 27.52 ? 312  GLN B CA  1 
ATOM   3396 C C   . GLN B 2 312 ? 10.958  -122.813 -54.641 1.00 26.86 ? 312  GLN B C   1 
ATOM   3397 O O   . GLN B 2 312 ? 11.773  -123.699 -54.851 1.00 26.02 ? 312  GLN B O   1 
ATOM   3398 C CB  . GLN B 2 312 ? 11.927  -121.258 -56.346 1.00 28.31 ? 312  GLN B CB  1 
ATOM   3399 C CG  . GLN B 2 312 ? 11.586  -120.305 -57.454 1.00 31.05 ? 312  GLN B CG  1 
ATOM   3400 C CD  . GLN B 2 312 ? 12.532  -120.322 -58.610 1.00 33.46 ? 312  GLN B CD  1 
ATOM   3401 O OE1 . GLN B 2 312 ? 12.873  -121.370 -59.150 1.00 35.37 ? 312  GLN B OE1 1 
ATOM   3402 N NE2 . GLN B 2 312 ? 12.942  -119.143 -59.026 1.00 36.54 ? 312  GLN B NE2 1 
ATOM   3403 N N   . CYS B 2 313 ? 10.299  -122.664 -53.477 1.00 25.52 ? 313  CYS B N   1 
ATOM   3404 C CA  . CYS B 2 313 ? 10.603  -123.464 -52.299 1.00 25.92 ? 313  CYS B CA  1 
ATOM   3405 C C   . CYS B 2 313 ? 9.442   -124.347 -51.806 1.00 25.30 ? 313  CYS B C   1 
ATOM   3406 O O   . CYS B 2 313 ? 8.995   -124.148 -50.674 1.00 24.98 ? 313  CYS B O   1 
ATOM   3407 C CB  . CYS B 2 313 ? 11.039  -122.540 -51.147 1.00 26.06 ? 313  CYS B CB  1 
ATOM   3408 S SG  . CYS B 2 313 ? 12.481  -121.532 -51.547 1.00 30.69 ? 313  CYS B SG  1 
ATOM   3409 N N   . PRO B 2 314 ? 8.989   -125.335 -52.621 1.00 24.91 ? 314  PRO B N   1 
ATOM   3410 C CA  . PRO B 2 314 ? 7.831   -126.161 -52.248 1.00 24.68 ? 314  PRO B CA  1 
ATOM   3411 C C   . PRO B 2 314 ? 8.037   -127.051 -51.003 1.00 24.52 ? 314  PRO B C   1 
ATOM   3412 O O   . PRO B 2 314 ? 7.053   -127.412 -50.343 1.00 24.06 ? 314  PRO B O   1 
ATOM   3413 C CB  . PRO B 2 314 ? 7.594   -127.048 -53.493 1.00 24.51 ? 314  PRO B CB  1 
ATOM   3414 C CG  . PRO B 2 314 ? 8.876   -127.063 -54.227 1.00 24.70 ? 314  PRO B CG  1 
ATOM   3415 C CD  . PRO B 2 314 ? 9.541   -125.736 -53.937 1.00 24.87 ? 314  PRO B CD  1 
ATOM   3416 N N   . LYS B 2 315 ? 9.289   -127.391 -50.683 1.00 23.56 ? 315  LYS B N   1 
ATOM   3417 C CA  . LYS B 2 315 ? 9.564   -128.243 -49.531 1.00 22.66 ? 315  LYS B CA  1 
ATOM   3418 C C   . LYS B 2 315 ? 9.856   -127.496 -48.222 1.00 22.61 ? 315  LYS B C   1 
ATOM   3419 O O   . LYS B 2 315 ? 10.220  -128.104 -47.214 1.00 21.76 ? 315  LYS B O   1 
ATOM   3420 C CB  . LYS B 2 315 ? 10.673  -129.252 -49.853 1.00 22.66 ? 315  LYS B CB  1 
ATOM   3421 C CG  . LYS B 2 315 ? 10.266  -130.292 -50.923 1.00 23.80 ? 315  LYS B CG  1 
ATOM   3422 C CD  . LYS B 2 315 ? 11.371  -131.298 -51.115 1.00 24.27 ? 315  LYS B CD  1 
ATOM   3423 C CE  . LYS B 2 315 ? 10.846  -132.618 -51.736 1.00 32.99 ? 315  LYS B CE  1 
ATOM   3424 N NZ  . LYS B 2 315 ? 9.438   -132.527 -52.265 1.00 34.66 ? 315  LYS B NZ  1 
ATOM   3425 N N   . LEU B 2 316 ? 9.649   -126.180 -48.208 1.00 22.21 ? 316  LEU B N   1 
ATOM   3426 C CA  . LEU B 2 316 ? 10.059  -125.394 -47.076 1.00 23.10 ? 316  LEU B CA  1 
ATOM   3427 C C   . LEU B 2 316 ? 9.298   -125.809 -45.813 1.00 22.22 ? 316  LEU B C   1 
ATOM   3428 O O   . LEU B 2 316 ? 8.077   -125.956 -45.826 1.00 22.42 ? 316  LEU B O   1 
ATOM   3429 C CB  . LEU B 2 316 ? 9.855   -123.892 -47.370 1.00 23.94 ? 316  LEU B CB  1 
ATOM   3430 C CG  . LEU B 2 316 ? 10.639  -122.851 -46.593 1.00 24.83 ? 316  LEU B CG  1 
ATOM   3431 C CD1 . LEU B 2 316 ? 12.155  -123.037 -46.731 1.00 26.00 ? 316  LEU B CD1 1 
ATOM   3432 C CD2 . LEU B 2 316 ? 10.182  -121.416 -46.980 1.00 24.03 ? 316  LEU B CD2 1 
ATOM   3433 N N   . GLN B 2 317 ? 10.029  -126.007 -44.732 1.00 21.34 ? 317  GLN B N   1 
ATOM   3434 C CA  . GLN B 2 317 ? 9.442   -126.370 -43.452 1.00 21.70 ? 317  GLN B CA  1 
ATOM   3435 C C   . GLN B 2 317 ? 9.572   -125.258 -42.408 1.00 21.79 ? 317  GLN B C   1 
ATOM   3436 O O   . GLN B 2 317 ? 8.781   -125.177 -41.478 1.00 22.29 ? 317  GLN B O   1 
ATOM   3437 C CB  . GLN B 2 317 ? 10.103  -127.632 -42.912 1.00 20.68 ? 317  GLN B CB  1 
ATOM   3438 C CG  . GLN B 2 317 ? 9.732   -128.877 -43.737 1.00 21.22 ? 317  GLN B CG  1 
ATOM   3439 C CD  . GLN B 2 317 ? 10.304  -130.151 -43.196 1.00 25.30 ? 317  GLN B CD  1 
ATOM   3440 O OE1 . GLN B 2 317 ? 9.846   -131.248 -43.548 1.00 26.75 ? 317  GLN B OE1 1 
ATOM   3441 N NE2 . GLN B 2 317 ? 11.326  -130.041 -42.360 1.00 23.37 ? 317  GLN B NE2 1 
ATOM   3442 N N   . ARG B 2 318 ? 10.618  -124.436 -42.540 1.00 23.06 ? 318  ARG B N   1 
ATOM   3443 C CA  . ARG B 2 318 ? 10.893  -123.340 -41.592 1.00 24.41 ? 318  ARG B CA  1 
ATOM   3444 C C   . ARG B 2 318 ? 11.282  -122.082 -42.367 1.00 24.19 ? 318  ARG B C   1 
ATOM   3445 O O   . ARG B 2 318 ? 12.241  -122.107 -43.189 1.00 23.64 ? 318  ARG B O   1 
ATOM   3446 C CB  . ARG B 2 318 ? 12.033  -123.723 -40.615 1.00 24.17 ? 318  ARG B CB  1 
ATOM   3447 C CG  . ARG B 2 318 ? 12.383  -122.548 -39.669 1.00 27.84 ? 318  ARG B CG  1 
ATOM   3448 C CD  . ARG B 2 318 ? 13.397  -122.883 -38.587 1.00 29.91 ? 318  ARG B CD  1 
ATOM   3449 N NE  . ARG B 2 318 ? 13.472  -124.297 -38.257 1.00 38.94 ? 318  ARG B NE  1 
ATOM   3450 C CZ  . ARG B 2 318 ? 14.405  -124.809 -37.457 1.00 45.17 ? 318  ARG B CZ  1 
ATOM   3451 N NH1 . ARG B 2 318 ? 15.321  -124.010 -36.899 1.00 44.59 ? 318  ARG B NH1 1 
ATOM   3452 N NH2 . ARG B 2 318 ? 14.418  -126.122 -37.202 1.00 47.71 ? 318  ARG B NH2 1 
ATOM   3453 N N   . LEU B 2 319 ? 10.531  -120.996 -42.142 1.00 22.73 ? 319  LEU B N   1 
ATOM   3454 C CA  . LEU B 2 319 ? 10.853  -119.698 -42.728 1.00 22.77 ? 319  LEU B CA  1 
ATOM   3455 C C   . LEU B 2 319 ? 11.015  -118.638 -41.643 1.00 22.14 ? 319  LEU B C   1 
ATOM   3456 O O   . LEU B 2 319 ? 10.074  -118.386 -40.883 1.00 22.25 ? 319  LEU B O   1 
ATOM   3457 C CB  . LEU B 2 319 ? 9.753   -119.219 -43.682 1.00 23.54 ? 319  LEU B CB  1 
ATOM   3458 C CG  . LEU B 2 319 ? 9.999   -117.822 -44.295 1.00 22.74 ? 319  LEU B CG  1 
ATOM   3459 C CD1 . LEU B 2 319 ? 11.278  -117.797 -45.162 1.00 19.38 ? 319  LEU B CD1 1 
ATOM   3460 C CD2 . LEU B 2 319 ? 8.787   -117.410 -45.142 1.00 22.46 ? 319  LEU B CD2 1 
ATOM   3461 N N   . TRP B 2 320 ? 12.182  -117.993 -41.604 1.00 21.51 ? 320  TRP B N   1 
ATOM   3462 C CA  . TRP B 2 320 ? 12.332  -116.753 -40.834 1.00 21.66 ? 320  TRP B CA  1 
ATOM   3463 C C   . TRP B 2 320 ? 12.490  -115.618 -41.844 1.00 23.33 ? 320  TRP B C   1 
ATOM   3464 O O   . TRP B 2 320 ? 13.282  -115.728 -42.786 1.00 21.04 ? 320  TRP B O   1 
ATOM   3465 C CB  . TRP B 2 320 ? 13.549  -116.825 -39.953 1.00 22.98 ? 320  TRP B CB  1 
ATOM   3466 C CG  . TRP B 2 320 ? 13.450  -117.823 -38.838 1.00 22.84 ? 320  TRP B CG  1 
ATOM   3467 C CD1 . TRP B 2 320 ? 12.584  -118.855 -38.713 1.00 22.93 ? 320  TRP B CD1 1 
ATOM   3468 C CD2 . TRP B 2 320 ? 14.282  -117.842 -37.683 1.00 23.95 ? 320  TRP B CD2 1 
ATOM   3469 N NE1 . TRP B 2 320 ? 12.847  -119.551 -37.547 1.00 23.71 ? 320  TRP B NE1 1 
ATOM   3470 C CE2 . TRP B 2 320 ? 13.889  -118.943 -36.902 1.00 24.44 ? 320  TRP B CE2 1 
ATOM   3471 C CE3 . TRP B 2 320 ? 15.344  -117.030 -37.247 1.00 24.88 ? 320  TRP B CE3 1 
ATOM   3472 C CZ2 . TRP B 2 320 ? 14.482  -119.236 -35.665 1.00 27.14 ? 320  TRP B CZ2 1 
ATOM   3473 C CZ3 . TRP B 2 320 ? 15.948  -117.319 -36.027 1.00 26.85 ? 320  TRP B CZ3 1 
ATOM   3474 C CH2 . TRP B 2 320 ? 15.513  -118.422 -35.250 1.00 26.35 ? 320  TRP B CH2 1 
ATOM   3475 N N   . VAL B 2 321 ? 11.716  -114.538 -41.672 1.00 23.41 ? 321  VAL B N   1 
ATOM   3476 C CA  . VAL B 2 321 ? 11.653  -113.480 -42.695 1.00 24.55 ? 321  VAL B CA  1 
ATOM   3477 C C   . VAL B 2 321 ? 11.368  -112.146 -42.010 1.00 24.06 ? 321  VAL B C   1 
ATOM   3478 O O   . VAL B 2 321 ? 10.764  -112.105 -40.913 1.00 23.97 ? 321  VAL B O   1 
ATOM   3479 C CB  . VAL B 2 321 ? 10.400  -113.545 -43.675 1.00 25.26 ? 321  VAL B CB  1 
ATOM   3480 C CG1 . VAL B 2 321 ? 10.715  -113.465 -45.161 1.00 26.02 ? 321  VAL B CG1 1 
ATOM   3481 C CG2 . VAL B 2 321 ? 9.198   -114.344 -43.190 1.00 26.37 ? 321  VAL B CG2 1 
ATOM   3482 N N   . LEU B 2 322 ? 11.748  -111.059 -42.668 1.00 24.11 ? 322  LEU B N   1 
ATOM   3483 C CA  . LEU B 2 322 ? 11.309  -109.739 -42.193 1.00 23.67 ? 322  LEU B CA  1 
ATOM   3484 C C   . LEU B 2 322 ? 9.866   -109.446 -42.603 1.00 23.52 ? 322  LEU B C   1 
ATOM   3485 O O   . LEU B 2 322 ? 9.338   -110.062 -43.545 1.00 23.76 ? 322  LEU B O   1 
ATOM   3486 C CB  . LEU B 2 322 ? 12.247  -108.630 -42.695 1.00 23.86 ? 322  LEU B CB  1 
ATOM   3487 C CG  . LEU B 2 322 ? 13.607  -108.558 -42.026 1.00 24.48 ? 322  LEU B CG  1 
ATOM   3488 C CD1 . LEU B 2 322 ? 14.553  -107.546 -42.735 1.00 24.46 ? 322  LEU B CD1 1 
ATOM   3489 C CD2 . LEU B 2 322 ? 13.482  -108.247 -40.518 1.00 27.30 ? 322  LEU B CD2 1 
ATOM   3490 N N   . ASP B 2 323 ? 9.236   -108.481 -41.930 1.00 22.64 ? 323  ASP B N   1 
ATOM   3491 C CA  . ASP B 2 323 ? 7.854   -108.119 -42.263 1.00 21.88 ? 323  ASP B CA  1 
ATOM   3492 C C   . ASP B 2 323 ? 7.702   -107.504 -43.664 1.00 21.61 ? 323  ASP B C   1 
ATOM   3493 O O   . ASP B 2 323 ? 6.575   -107.350 -44.144 1.00 21.39 ? 323  ASP B O   1 
ATOM   3494 C CB  . ASP B 2 323 ? 7.248   -107.224 -41.171 1.00 22.30 ? 323  ASP B CB  1 
ATOM   3495 C CG  . ASP B 2 323 ? 8.038   -105.959 -40.953 1.00 22.24 ? 323  ASP B CG  1 
ATOM   3496 O OD1 . ASP B 2 323 ? 8.896   -105.601 -41.809 1.00 22.03 ? 323  ASP B OD1 1 
ATOM   3497 O OD2 . ASP B 2 323 ? 7.783   -105.275 -39.941 1.00 24.69 ? 323  ASP B OD2 1 
ATOM   3498 N N   . TYR B 2 324 ? 8.826   -107.202 -44.331 1.00 21.51 ? 324  TYR B N   1 
ATOM   3499 C CA  . TYR B 2 324 ? 8.821   -106.876 -45.793 1.00 21.42 ? 324  TYR B CA  1 
ATOM   3500 C C   . TYR B 2 324 ? 8.076   -107.885 -46.665 1.00 22.55 ? 324  TYR B C   1 
ATOM   3501 O O   . TYR B 2 324 ? 7.616   -107.552 -47.763 1.00 22.69 ? 324  TYR B O   1 
ATOM   3502 C CB  . TYR B 2 324 ? 10.240  -106.736 -46.312 1.00 22.83 ? 324  TYR B CB  1 
ATOM   3503 C CG  . TYR B 2 324 ? 10.957  -105.520 -45.773 1.00 22.53 ? 324  TYR B CG  1 
ATOM   3504 C CD1 . TYR B 2 324 ? 12.259  -105.617 -45.293 1.00 24.16 ? 324  TYR B CD1 1 
ATOM   3505 C CD2 . TYR B 2 324 ? 10.342  -104.274 -45.773 1.00 27.21 ? 324  TYR B CD2 1 
ATOM   3506 C CE1 . TYR B 2 324 ? 12.946  -104.488 -44.825 1.00 22.98 ? 324  TYR B CE1 1 
ATOM   3507 C CE2 . TYR B 2 324 ? 11.008  -103.137 -45.303 1.00 25.44 ? 324  TYR B CE2 1 
ATOM   3508 C CZ  . TYR B 2 324 ? 12.298  -103.262 -44.826 1.00 25.71 ? 324  TYR B CZ  1 
ATOM   3509 O OH  . TYR B 2 324 ? 12.955  -102.138 -44.383 1.00 25.87 ? 324  TYR B OH  1 
ATOM   3510 N N   . ILE B 2 325 ? 7.974   -109.129 -46.189 1.00 22.43 ? 325  ILE B N   1 
ATOM   3511 C CA  . ILE B 2 325 ? 7.166   -110.129 -46.889 1.00 22.35 ? 325  ILE B CA  1 
ATOM   3512 C C   . ILE B 2 325 ? 5.767   -109.594 -47.178 1.00 22.28 ? 325  ILE B C   1 
ATOM   3513 O O   . ILE B 2 325 ? 5.242   -109.831 -48.247 1.00 21.34 ? 325  ILE B O   1 
ATOM   3514 C CB  . ILE B 2 325 ? 7.129   -111.464 -46.111 1.00 22.35 ? 325  ILE B CB  1 
ATOM   3515 C CG1 . ILE B 2 325 ? 6.493   -112.593 -46.965 1.00 25.02 ? 325  ILE B CG1 1 
ATOM   3516 C CG2 . ILE B 2 325 ? 6.423   -111.310 -44.727 1.00 22.02 ? 325  ILE B CG2 1 
ATOM   3517 C CD1 . ILE B 2 325 ? 7.162   -112.832 -48.315 1.00 27.15 ? 325  ILE B CD1 1 
ATOM   3518 N N   . GLU B 2 326 ? 5.198   -108.861 -46.207 1.00 23.20 ? 326  GLU B N   1 
ATOM   3519 C CA  . GLU B 2 326 ? 3.860   -108.239 -46.279 1.00 23.37 ? 326  GLU B CA  1 
ATOM   3520 C C   . GLU B 2 326 ? 2.742   -109.267 -46.391 1.00 22.83 ? 326  GLU B C   1 
ATOM   3521 O O   . GLU B 2 326 ? 3.009   -110.455 -46.583 1.00 22.72 ? 326  GLU B O   1 
ATOM   3522 C CB  . GLU B 2 326 ? 3.807   -107.185 -47.402 1.00 24.51 ? 326  GLU B CB  1 
ATOM   3523 C CG  . GLU B 2 326 ? 4.726   -105.991 -47.152 1.00 24.54 ? 326  GLU B CG  1 
ATOM   3524 C CD  . GLU B 2 326 ? 4.506   -104.862 -48.135 1.00 26.35 ? 326  GLU B CD  1 
ATOM   3525 O OE1 . GLU B 2 326 ? 4.293   -105.113 -49.354 1.00 27.34 ? 326  GLU B OE1 1 
ATOM   3526 O OE2 . GLU B 2 326 ? 4.549   -103.700 -47.681 1.00 28.43 ? 326  GLU B OE2 1 
ATOM   3527 N N   . ASP B 2 327 ? 1.488   -108.820 -46.291 1.00 22.64 ? 327  ASP B N   1 
ATOM   3528 C CA  . ASP B 2 327 ? 0.346   -109.732 -46.361 1.00 21.94 ? 327  ASP B CA  1 
ATOM   3529 C C   . ASP B 2 327 ? 0.304   -110.463 -47.730 1.00 21.93 ? 327  ASP B C   1 
ATOM   3530 O O   . ASP B 2 327 ? -0.026  -111.645 -47.814 1.00 22.01 ? 327  ASP B O   1 
ATOM   3531 C CB  . ASP B 2 327 ? -0.985  -108.962 -46.140 1.00 22.05 ? 327  ASP B CB  1 
ATOM   3532 C CG  . ASP B 2 327 ? -1.165  -108.461 -44.699 1.00 21.64 ? 327  ASP B CG  1 
ATOM   3533 O OD1 . ASP B 2 327 ? -0.489  -108.948 -43.750 1.00 22.92 ? 327  ASP B OD1 1 
ATOM   3534 O OD2 . ASP B 2 327 ? -1.980  -107.525 -44.519 1.00 22.81 ? 327  ASP B OD2 1 
ATOM   3535 N N   . ALA B 2 328 ? 0.605   -109.753 -48.802 1.00 21.46 ? 328  ALA B N   1 
ATOM   3536 C CA  . ALA B 2 328 ? 0.538   -110.373 -50.138 1.00 21.80 ? 328  ALA B CA  1 
ATOM   3537 C C   . ALA B 2 328 ? 1.567   -111.516 -50.287 1.00 21.59 ? 328  ALA B C   1 
ATOM   3538 O O   . ALA B 2 328 ? 1.284   -112.541 -50.915 1.00 22.22 ? 328  ALA B O   1 
ATOM   3539 C CB  . ALA B 2 328 ? 0.729   -109.313 -51.210 1.00 22.22 ? 328  ALA B CB  1 
ATOM   3540 N N   . GLY B 2 329 ? 2.754   -111.330 -49.716 1.00 21.53 ? 329  GLY B N   1 
ATOM   3541 C CA  . GLY B 2 329 ? 3.831   -112.347 -49.727 1.00 21.89 ? 329  GLY B CA  1 
ATOM   3542 C C   . GLY B 2 329 ? 3.455   -113.564 -48.891 1.00 22.54 ? 329  GLY B C   1 
ATOM   3543 O O   . GLY B 2 329 ? 3.728   -114.711 -49.283 1.00 22.87 ? 329  GLY B O   1 
ATOM   3544 N N   . LEU B 2 330 ? 2.771   -113.327 -47.764 1.00 22.66 ? 330  LEU B N   1 
ATOM   3545 C CA  . LEU B 2 330 ? 2.307   -114.445 -46.907 1.00 22.81 ? 330  LEU B CA  1 
ATOM   3546 C C   . LEU B 2 330 ? 1.167   -115.245 -47.553 1.00 23.29 ? 330  LEU B C   1 
ATOM   3547 O O   . LEU B 2 330 ? 1.053   -116.468 -47.361 1.00 22.48 ? 330  LEU B O   1 
ATOM   3548 C CB  . LEU B 2 330 ? 1.949   -113.957 -45.493 1.00 23.17 ? 330  LEU B CB  1 
ATOM   3549 C CG  . LEU B 2 330 ? 3.168   -113.545 -44.646 1.00 23.10 ? 330  LEU B CG  1 
ATOM   3550 C CD1 . LEU B 2 330 ? 2.647   -112.954 -43.282 1.00 25.03 ? 330  LEU B CD1 1 
ATOM   3551 C CD2 . LEU B 2 330 ? 4.186   -114.697 -44.347 1.00 25.87 ? 330  LEU B CD2 1 
ATOM   3552 N N   . GLU B 2 331 ? 0.348   -114.559 -48.342 1.00 22.60 ? 331  GLU B N   1 
ATOM   3553 C CA  . GLU B 2 331 ? -0.707  -115.215 -49.080 1.00 25.04 ? 331  GLU B CA  1 
ATOM   3554 C C   . GLU B 2 331 ? -0.078  -116.190 -50.107 1.00 24.34 ? 331  GLU B C   1 
ATOM   3555 O O   . GLU B 2 331 ? -0.571  -117.321 -50.316 1.00 25.12 ? 331  GLU B O   1 
ATOM   3556 C CB  . GLU B 2 331 ? -1.539  -114.153 -49.786 1.00 25.87 ? 331  GLU B CB  1 
ATOM   3557 C CG  . GLU B 2 331 ? -2.759  -114.676 -50.452 1.00 31.21 ? 331  GLU B CG  1 
ATOM   3558 C CD  . GLU B 2 331 ? -3.770  -113.580 -50.712 1.00 39.96 ? 331  GLU B CD  1 
ATOM   3559 O OE1 . GLU B 2 331 ? -3.400  -112.536 -51.312 1.00 43.45 ? 331  GLU B OE1 1 
ATOM   3560 O OE2 . GLU B 2 331 ? -4.947  -113.766 -50.307 1.00 45.72 ? 331  GLU B OE2 1 
ATOM   3561 N N   . VAL B 2 332 ? 1.022   -115.765 -50.726 1.00 24.25 ? 332  VAL B N   1 
ATOM   3562 C CA  . VAL B 2 332 ? 1.754   -116.637 -51.673 1.00 23.25 ? 332  VAL B CA  1 
ATOM   3563 C C   . VAL B 2 332 ? 2.426   -117.796 -50.945 1.00 23.62 ? 332  VAL B C   1 
ATOM   3564 O O   . VAL B 2 332 ? 2.363   -118.940 -51.386 1.00 23.33 ? 332  VAL B O   1 
ATOM   3565 C CB  . VAL B 2 332 ? 2.792   -115.849 -52.489 1.00 24.34 ? 332  VAL B CB  1 
ATOM   3566 C CG1 . VAL B 2 332 ? 3.736   -116.798 -53.216 1.00 22.97 ? 332  VAL B CG1 1 
ATOM   3567 C CG2 . VAL B 2 332 ? 2.075   -114.985 -53.496 1.00 21.89 ? 332  VAL B CG2 1 
ATOM   3568 N N   . LEU B 2 333 ? 3.057   -117.491 -49.816 1.00 23.69 ? 333  LEU B N   1 
ATOM   3569 C CA  . LEU B 2 333 ? 3.623   -118.521 -48.939 1.00 24.79 ? 333  LEU B CA  1 
ATOM   3570 C C   . LEU B 2 333 ? 2.566   -119.588 -48.591 1.00 25.28 ? 333  LEU B C   1 
ATOM   3571 O O   . LEU B 2 333 ? 2.829   -120.779 -48.697 1.00 25.55 ? 333  LEU B O   1 
ATOM   3572 C CB  . LEU B 2 333 ? 4.197   -117.896 -47.685 1.00 24.91 ? 333  LEU B CB  1 
ATOM   3573 C CG  . LEU B 2 333 ? 4.788   -118.885 -46.677 1.00 26.07 ? 333  LEU B CG  1 
ATOM   3574 C CD1 . LEU B 2 333 ? 6.114   -119.467 -47.205 1.00 28.24 ? 333  LEU B CD1 1 
ATOM   3575 C CD2 . LEU B 2 333 ? 5.010   -118.241 -45.326 1.00 24.14 ? 333  LEU B CD2 1 
ATOM   3576 N N   . ALA B 2 334 ? 1.364   -119.157 -48.223 1.00 25.16 ? 334  ALA B N   1 
ATOM   3577 C CA  . ALA B 2 334 ? 0.275   -120.085 -47.863 1.00 24.64 ? 334  ALA B CA  1 
ATOM   3578 C C   . ALA B 2 334 ? -0.127  -121.030 -49.004 1.00 25.68 ? 334  ALA B C   1 
ATOM   3579 O O   . ALA B 2 334 ? -0.493  -122.192 -48.765 1.00 26.52 ? 334  ALA B O   1 
ATOM   3580 C CB  . ALA B 2 334 ? -0.937  -119.296 -47.374 1.00 25.48 ? 334  ALA B CB  1 
ATOM   3581 N N   . SER B 2 335 ? -0.080  -120.531 -50.233 1.00 24.22 ? 335  SER B N   1 
ATOM   3582 C CA  . SER B 2 335 ? -0.348  -121.356 -51.424 1.00 24.86 ? 335  SER B CA  1 
ATOM   3583 C C   . SER B 2 335 ? 0.748   -122.366 -51.801 1.00 24.68 ? 335  SER B C   1 
ATOM   3584 O O   . SER B 2 335 ? 0.462   -123.420 -52.403 1.00 24.60 ? 335  SER B O   1 
ATOM   3585 C CB  . SER B 2 335 ? -0.557  -120.432 -52.625 1.00 23.32 ? 335  SER B CB  1 
ATOM   3586 O OG  . SER B 2 335 ? -0.996  -121.194 -53.716 1.00 30.40 ? 335  SER B OG  1 
ATOM   3587 N N   . THR B 2 336 ? 1.993   -121.993 -51.524 1.00 24.55 ? 336  THR B N   1 
ATOM   3588 C CA  . THR B 2 336 ? 3.196   -122.659 -52.023 1.00 26.20 ? 336  THR B CA  1 
ATOM   3589 C C   . THR B 2 336 ? 3.767   -123.713 -51.101 1.00 25.43 ? 336  THR B C   1 
ATOM   3590 O O   . THR B 2 336 ? 4.228   -124.768 -51.557 1.00 25.52 ? 336  THR B O   1 
ATOM   3591 C CB  . THR B 2 336 ? 4.348   -121.624 -52.178 1.00 25.89 ? 336  THR B CB  1 
ATOM   3592 O OG1 . THR B 2 336 ? 3.908   -120.603 -53.078 1.00 29.09 ? 336  THR B OG1 1 
ATOM   3593 C CG2 . THR B 2 336 ? 5.623   -122.308 -52.739 1.00 27.09 ? 336  THR B CG2 1 
ATOM   3594 N N   . CYS B 2 337 ? 3.822   -123.391 -49.822 1.00 25.48 ? 337  CYS B N   1 
ATOM   3595 C CA  . CYS B 2 337 ? 4.614   -124.181 -48.891 1.00 25.23 ? 337  CYS B CA  1 
ATOM   3596 C C   . CYS B 2 337 ? 3.706   -125.010 -48.000 1.00 24.85 ? 337  CYS B C   1 
ATOM   3597 O O   . CYS B 2 337 ? 3.464   -124.659 -46.860 1.00 25.35 ? 337  CYS B O   1 
ATOM   3598 C CB  . CYS B 2 337 ? 5.548   -123.291 -48.083 1.00 25.36 ? 337  CYS B CB  1 
ATOM   3599 S SG  . CYS B 2 337 ? 6.641   -122.283 -49.154 1.00 26.43 ? 337  CYS B SG  1 
ATOM   3600 N N   . LYS B 2 338 ? 3.182   -126.110 -48.541 1.00 23.57 ? 338  LYS B N   1 
ATOM   3601 C CA  . LYS B 2 338 ? 2.193   -126.918 -47.807 1.00 23.13 ? 338  LYS B CA  1 
ATOM   3602 C C   . LYS B 2 338 ? 2.779   -127.723 -46.658 1.00 23.17 ? 338  LYS B C   1 
ATOM   3603 O O   . LYS B 2 338 ? 2.028   -128.285 -45.833 1.00 22.24 ? 338  LYS B O   1 
ATOM   3604 C CB  . LYS B 2 338 ? 1.428   -127.812 -48.768 1.00 23.38 ? 338  LYS B CB  1 
ATOM   3605 C CG  . LYS B 2 338 ? 0.613   -127.012 -49.779 1.00 23.99 ? 338  LYS B CG  1 
ATOM   3606 C CD  . LYS B 2 338 ? -0.348  -126.088 -49.043 1.00 21.76 ? 338  LYS B CD  1 
ATOM   3607 C CE  . LYS B 2 338 ? -1.266  -125.394 -49.998 1.00 25.09 ? 338  LYS B CE  1 
ATOM   3608 N NZ  . LYS B 2 338 ? -2.116  -124.441 -49.260 1.00 26.20 ? 338  LYS B NZ  1 
ATOM   3609 N N   . ASP B 2 339 ? 4.118   -127.789 -46.612 1.00 22.31 ? 339  ASP B N   1 
ATOM   3610 C CA  . ASP B 2 339 ? 4.798   -128.487 -45.543 1.00 22.44 ? 339  ASP B CA  1 
ATOM   3611 C C   . ASP B 2 339 ? 5.337   -127.543 -44.480 1.00 21.68 ? 339  ASP B C   1 
ATOM   3612 O O   . ASP B 2 339 ? 6.035   -127.992 -43.571 1.00 20.72 ? 339  ASP B O   1 
ATOM   3613 C CB  . ASP B 2 339 ? 5.949   -129.355 -46.067 1.00 22.50 ? 339  ASP B CB  1 
ATOM   3614 C CG  . ASP B 2 339 ? 6.236   -130.548 -45.164 1.00 25.31 ? 339  ASP B CG  1 
ATOM   3615 O OD1 . ASP B 2 339 ? 5.286   -131.041 -44.515 1.00 25.56 ? 339  ASP B OD1 1 
ATOM   3616 O OD2 . ASP B 2 339 ? 7.406   -131.005 -45.101 1.00 26.07 ? 339  ASP B OD2 1 
ATOM   3617 N N   . LEU B 2 340 ? 5.006   -126.249 -44.568 1.00 21.70 ? 340  LEU B N   1 
ATOM   3618 C CA  . LEU B 2 340 ? 5.499   -125.297 -43.593 1.00 22.43 ? 340  LEU B CA  1 
ATOM   3619 C C   . LEU B 2 340 ? 5.090   -125.695 -42.167 1.00 22.74 ? 340  LEU B C   1 
ATOM   3620 O O   . LEU B 2 340 ? 3.910   -125.940 -41.905 1.00 23.32 ? 340  LEU B O   1 
ATOM   3621 C CB  . LEU B 2 340 ? 5.012   -123.864 -43.925 1.00 21.80 ? 340  LEU B CB  1 
ATOM   3622 C CG  . LEU B 2 340 ? 5.834   -122.763 -43.251 1.00 24.39 ? 340  LEU B CG  1 
ATOM   3623 C CD1 . LEU B 2 340 ? 7.218   -122.638 -43.847 1.00 25.11 ? 340  LEU B CD1 1 
ATOM   3624 C CD2 . LEU B 2 340 ? 5.088   -121.407 -43.356 1.00 23.13 ? 340  LEU B CD2 1 
ATOM   3625 N N   . ARG B 2 341 ? 6.064   -125.730 -41.260 1.00 21.36 ? 341  ARG B N   1 
ATOM   3626 C CA  . ARG B 2 341 ? 5.854   -126.064 -39.857 1.00 22.21 ? 341  ARG B CA  1 
ATOM   3627 C C   . ARG B 2 341 ? 6.037   -124.850 -38.925 1.00 21.77 ? 341  ARG B C   1 
ATOM   3628 O O   . ARG B 2 341 ? 5.521   -124.827 -37.811 1.00 21.14 ? 341  ARG B O   1 
ATOM   3629 C CB  . ARG B 2 341 ? 6.859   -127.127 -39.399 1.00 22.68 ? 341  ARG B CB  1 
ATOM   3630 C CG  . ARG B 2 341 ? 7.021   -128.353 -40.339 1.00 22.80 ? 341  ARG B CG  1 
ATOM   3631 C CD  . ARG B 2 341 ? 5.761   -129.141 -40.410 1.00 25.85 ? 341  ARG B CD  1 
ATOM   3632 N NE  . ARG B 2 341 ? 5.839   -130.272 -41.355 1.00 26.93 ? 341  ARG B NE  1 
ATOM   3633 C CZ  . ARG B 2 341 ? 6.290   -131.481 -41.047 1.00 28.26 ? 341  ARG B CZ  1 
ATOM   3634 N NH1 . ARG B 2 341 ? 6.733   -131.729 -39.824 1.00 28.99 ? 341  ARG B NH1 1 
ATOM   3635 N NH2 . ARG B 2 341 ? 6.285   -132.457 -41.962 1.00 27.20 ? 341  ARG B NH2 1 
ATOM   3636 N N   . GLU B 2 342 ? 6.882   -123.903 -39.330 1.00 21.79 ? 342  GLU B N   1 
ATOM   3637 C CA  . GLU B 2 342 ? 7.282   -122.816 -38.432 1.00 23.41 ? 342  GLU B CA  1 
ATOM   3638 C C   . GLU B 2 342 ? 7.482   -121.576 -39.263 1.00 24.01 ? 342  GLU B C   1 
ATOM   3639 O O   . GLU B 2 342 ? 8.156   -121.639 -40.302 1.00 23.33 ? 342  GLU B O   1 
ATOM   3640 C CB  . GLU B 2 342 ? 8.588   -123.168 -37.700 1.00 23.91 ? 342  GLU B CB  1 
ATOM   3641 C CG  . GLU B 2 342 ? 9.214   -122.006 -36.874 1.00 23.63 ? 342  GLU B CG  1 
ATOM   3642 C CD  . GLU B 2 342 ? 10.599  -122.410 -36.316 1.00 24.93 ? 342  GLU B CD  1 
ATOM   3643 O OE1 . GLU B 2 342 ? 10.863  -123.630 -36.134 1.00 30.63 ? 342  GLU B OE1 1 
ATOM   3644 O OE2 . GLU B 2 342 ? 11.442  -121.540 -36.106 1.00 25.71 ? 342  GLU B OE2 1 
ATOM   3645 N N   . LEU B 2 343 ? 6.866   -120.463 -38.816 1.00 23.94 ? 343  LEU B N   1 
ATOM   3646 C CA  . LEU B 2 343 ? 7.003   -119.164 -39.443 1.00 24.87 ? 343  LEU B CA  1 
ATOM   3647 C C   . LEU B 2 343 ? 7.401   -118.130 -38.413 1.00 23.94 ? 343  LEU B C   1 
ATOM   3648 O O   . LEU B 2 343 ? 6.713   -117.974 -37.384 1.00 23.82 ? 343  LEU B O   1 
ATOM   3649 C CB  . LEU B 2 343 ? 5.697   -118.705 -40.109 1.00 25.34 ? 343  LEU B CB  1 
ATOM   3650 C CG  . LEU B 2 343 ? 5.692   -117.264 -40.687 1.00 25.45 ? 343  LEU B CG  1 
ATOM   3651 C CD1 . LEU B 2 343 ? 6.700   -117.134 -41.868 1.00 26.83 ? 343  LEU B CD1 1 
ATOM   3652 C CD2 . LEU B 2 343 ? 4.287   -116.853 -41.161 1.00 26.39 ? 343  LEU B CD2 1 
ATOM   3653 N N   . ARG B 2 344 ? 8.487   -117.399 -38.675 1.00 23.70 ? 344  ARG B N   1 
ATOM   3654 C CA  . ARG B 2 344 ? 8.841   -116.250 -37.792 1.00 22.36 ? 344  ARG B CA  1 
ATOM   3655 C C   . ARG B 2 344 ? 8.954   -115.016 -38.655 1.00 23.86 ? 344  ARG B C   1 
ATOM   3656 O O   . ARG B 2 344 ? 9.755   -114.999 -39.608 1.00 24.06 ? 344  ARG B O   1 
ATOM   3657 C CB  . ARG B 2 344 ? 10.158  -116.485 -37.026 1.00 23.66 ? 344  ARG B CB  1 
ATOM   3658 C CG  . ARG B 2 344 ? 10.122  -117.759 -36.188 1.00 22.77 ? 344  ARG B CG  1 
ATOM   3659 C CD  . ARG B 2 344 ? 11.221  -117.730 -35.126 1.00 26.79 ? 344  ARG B CD  1 
ATOM   3660 N NE  . ARG B 2 344 ? 11.260  -119.040 -34.517 1.00 25.47 ? 344  ARG B NE  1 
ATOM   3661 C CZ  . ARG B 2 344 ? 11.767  -119.341 -33.332 1.00 25.14 ? 344  ARG B CZ  1 
ATOM   3662 N NH1 . ARG B 2 344 ? 12.353  -118.419 -32.574 1.00 22.53 ? 344  ARG B NH1 1 
ATOM   3663 N NH2 . ARG B 2 344 ? 11.727  -120.618 -32.939 1.00 26.31 ? 344  ARG B NH2 1 
ATOM   3664 N N   . VAL B 2 345 ? 8.131   -114.006 -38.345 1.00 23.29 ? 345  VAL B N   1 
ATOM   3665 C CA  . VAL B 2 345 ? 8.104   -112.731 -39.094 1.00 22.75 ? 345  VAL B CA  1 
ATOM   3666 C C   . VAL B 2 345 ? 8.577   -111.631 -38.143 1.00 22.57 ? 345  VAL B C   1 
ATOM   3667 O O   . VAL B 2 345 ? 7.884   -111.285 -37.157 1.00 21.81 ? 345  VAL B O   1 
ATOM   3668 C CB  . VAL B 2 345 ? 6.685   -112.412 -39.654 1.00 23.12 ? 345  VAL B CB  1 
ATOM   3669 C CG1 . VAL B 2 345 ? 6.648   -111.039 -40.366 1.00 23.58 ? 345  VAL B CG1 1 
ATOM   3670 C CG2 . VAL B 2 345 ? 6.226   -113.506 -40.640 1.00 25.11 ? 345  VAL B CG2 1 
ATOM   3671 N N   . PHE B 2 346 ? 9.769   -111.104 -38.423 1.00 22.09 ? 346  PHE B N   1 
ATOM   3672 C CA  . PHE B 2 346 ? 10.462  -110.163 -37.544 1.00 21.92 ? 346  PHE B CA  1 
ATOM   3673 C C   . PHE B 2 346 ? 10.220  -108.746 -38.035 1.00 21.14 ? 346  PHE B C   1 
ATOM   3674 O O   . PHE B 2 346 ? 10.028  -108.544 -39.244 1.00 21.38 ? 346  PHE B O   1 
ATOM   3675 C CB  . PHE B 2 346 ? 11.963  -110.454 -37.581 1.00 22.01 ? 346  PHE B CB  1 
ATOM   3676 C CG  . PHE B 2 346 ? 12.341  -111.778 -36.914 1.00 22.54 ? 346  PHE B CG  1 
ATOM   3677 C CD1 . PHE B 2 346 ? 12.616  -112.901 -37.668 1.00 24.10 ? 346  PHE B CD1 1 
ATOM   3678 C CD2 . PHE B 2 346 ? 12.363  -111.891 -35.522 1.00 24.00 ? 346  PHE B CD2 1 
ATOM   3679 C CE1 . PHE B 2 346 ? 12.917  -114.131 -37.038 1.00 22.86 ? 346  PHE B CE1 1 
ATOM   3680 C CE2 . PHE B 2 346 ? 12.700  -113.121 -34.895 1.00 26.80 ? 346  PHE B CE2 1 
ATOM   3681 C CZ  . PHE B 2 346 ? 12.955  -114.226 -35.661 1.00 22.52 ? 346  PHE B CZ  1 
ATOM   3682 N N   . PRO B 2 347 ? 10.269  -107.754 -37.126 1.00 21.71 ? 347  PRO B N   1 
ATOM   3683 C CA  . PRO B 2 347 ? 9.979   -106.362 -37.532 1.00 21.76 ? 347  PRO B CA  1 
ATOM   3684 C C   . PRO B 2 347 ? 11.187  -105.709 -38.253 1.00 21.85 ? 347  PRO B C   1 
ATOM   3685 O O   . PRO B 2 347 ? 12.317  -105.842 -37.793 1.00 22.11 ? 347  PRO B O   1 
ATOM   3686 C CB  . PRO B 2 347 ? 9.695   -105.651 -36.184 1.00 22.00 ? 347  PRO B CB  1 
ATOM   3687 C CG  . PRO B 2 347 ? 10.516  -106.451 -35.138 1.00 20.89 ? 347  PRO B CG  1 
ATOM   3688 C CD  . PRO B 2 347 ? 10.629  -107.879 -35.691 1.00 21.33 ? 347  PRO B CD  1 
ATOM   3689 N N   . SER B 2 348 ? 10.957  -105.040 -39.382 1.00 22.51 ? 348  SER B N   1 
ATOM   3690 C CA  . SER B 2 348 ? 12.042  -104.362 -40.105 1.00 22.63 ? 348  SER B CA  1 
ATOM   3691 C C   . SER B 2 348 ? 12.368  -103.034 -39.393 1.00 23.18 ? 348  SER B C   1 
ATOM   3692 O O   . SER B 2 348 ? 13.521  -102.590 -39.332 1.00 22.10 ? 348  SER B O   1 
ATOM   3693 C CB  . SER B 2 348 ? 11.639  -104.132 -41.569 1.00 22.01 ? 348  SER B CB  1 
ATOM   3694 O OG  . SER B 2 348 ? 10.404  -103.454 -41.674 1.00 21.92 ? 348  SER B OG  1 
ATOM   3695 N N   . GLU B 2 349 ? 11.338  -102.419 -38.817 1.00 23.21 ? 349  GLU B N   1 
ATOM   3696 C CA  . GLU B 2 349 ? 11.507  -101.179 -38.079 1.00 22.99 ? 349  GLU B CA  1 
ATOM   3697 C C   . GLU B 2 349 ? 10.759  -101.238 -36.743 1.00 22.65 ? 349  GLU B C   1 
ATOM   3698 O O   . GLU B 2 349 ? 9.749   -100.550 -36.571 1.00 23.16 ? 349  GLU B O   1 
ATOM   3699 C CB  . GLU B 2 349 ? 10.996  -99.986  -38.907 1.00 23.37 ? 349  GLU B CB  1 
ATOM   3700 C CG  . GLU B 2 349 ? 11.745  -99.843  -40.235 1.00 25.59 ? 349  GLU B CG  1 
ATOM   3701 C CD  . GLU B 2 349 ? 13.099  -99.180  -40.079 1.00 33.77 ? 349  GLU B CD  1 
ATOM   3702 O OE1 . GLU B 2 349 ? 13.470  -98.787  -38.941 1.00 34.47 ? 349  GLU B OE1 1 
ATOM   3703 O OE2 . GLU B 2 349 ? 13.802  -99.028  -41.114 1.00 38.65 ? 349  GLU B OE2 1 
ATOM   3704 N N   . PRO B 2 350 ? 11.285  -102.014 -35.787 1.00 22.29 ? 350  PRO B N   1 
ATOM   3705 C CA  . PRO B 2 350 ? 10.575  -102.272 -34.539 1.00 22.80 ? 350  PRO B CA  1 
ATOM   3706 C C   . PRO B 2 350 ? 10.358  -100.995 -33.707 1.00 22.15 ? 350  PRO B C   1 
ATOM   3707 O O   . PRO B 2 350 ? 9.463   -100.945 -32.868 1.00 22.90 ? 350  PRO B O   1 
ATOM   3708 C CB  . PRO B 2 350 ? 11.499  -103.243 -33.785 1.00 22.59 ? 350  PRO B CB  1 
ATOM   3709 C CG  . PRO B 2 350 ? 12.820  -103.209 -34.465 1.00 22.25 ? 350  PRO B CG  1 
ATOM   3710 C CD  . PRO B 2 350 ? 12.592  -102.696 -35.859 1.00 23.04 ? 350  PRO B CD  1 
ATOM   3711 N N   . PHE B 2 351 ? 11.182  -99.977  -33.919 1.00 23.52 ? 351  PHE B N   1 
ATOM   3712 C CA  . PHE B 2 351 ? 11.110  -98.799  -33.074 1.00 23.07 ? 351  PHE B CA  1 
ATOM   3713 C C   . PHE B 2 351 ? 10.376  -97.625  -33.728 1.00 24.24 ? 351  PHE B C   1 
ATOM   3714 O O   . PHE B 2 351 ? 10.442  -96.505  -33.239 1.00 21.80 ? 351  PHE B O   1 
ATOM   3715 C CB  . PHE B 2 351 ? 12.499  -98.415  -32.529 1.00 23.67 ? 351  PHE B CB  1 
ATOM   3716 C CG  . PHE B 2 351 ? 13.282  -99.591  -31.995 1.00 23.94 ? 351  PHE B CG  1 
ATOM   3717 C CD1 . PHE B 2 351 ? 14.377  -100.080 -32.689 1.00 21.96 ? 351  PHE B CD1 1 
ATOM   3718 C CD2 . PHE B 2 351 ? 12.921  -100.215 -30.791 1.00 26.69 ? 351  PHE B CD2 1 
ATOM   3719 C CE1 . PHE B 2 351 ? 15.098  -101.183 -32.201 1.00 23.66 ? 351  PHE B CE1 1 
ATOM   3720 C CE2 . PHE B 2 351 ? 13.635  -101.315 -30.315 1.00 26.97 ? 351  PHE B CE2 1 
ATOM   3721 C CZ  . PHE B 2 351 ? 14.716  -101.803 -31.033 1.00 24.64 ? 351  PHE B CZ  1 
ATOM   3722 N N   . VAL B 2 352 ? 9.650   -97.894  -34.808 1.00 25.22 ? 352  VAL B N   1 
ATOM   3723 C CA  . VAL B 2 352 ? 8.769   -96.883  -35.398 1.00 27.22 ? 352  VAL B CA  1 
ATOM   3724 C C   . VAL B 2 352 ? 7.311   -97.298  -35.183 1.00 28.63 ? 352  VAL B C   1 
ATOM   3725 O O   . VAL B 2 352 ? 6.933   -98.475  -35.423 1.00 29.10 ? 352  VAL B O   1 
ATOM   3726 C CB  . VAL B 2 352 ? 9.015   -96.694  -36.913 1.00 26.67 ? 352  VAL B CB  1 
ATOM   3727 C CG1 . VAL B 2 352 ? 8.234   -95.474  -37.408 1.00 26.48 ? 352  VAL B CG1 1 
ATOM   3728 C CG2 . VAL B 2 352 ? 10.488  -96.514  -37.205 1.00 27.11 ? 352  VAL B CG2 1 
ATOM   3729 N N   . MET B 2 353 ? 6.504   -96.330  -34.767 1.00 30.07 ? 353  MET B N   1 
ATOM   3730 C CA  . MET B 2 353 ? 5.093   -96.540  -34.407 1.00 32.63 ? 353  MET B CA  1 
ATOM   3731 C C   . MET B 2 353 ? 4.185   -96.747  -35.612 1.00 31.48 ? 353  MET B C   1 
ATOM   3732 O O   . MET B 2 353 ? 3.429   -97.720  -35.660 1.00 31.75 ? 353  MET B O   1 
ATOM   3733 C CB  . MET B 2 353 ? 4.545   -95.360  -33.579 1.00 32.78 ? 353  MET B CB  1 
ATOM   3734 C CG  . MET B 2 353 ? 3.347   -95.767  -32.699 1.00 34.67 ? 353  MET B CG  1 
ATOM   3735 S SD  . MET B 2 353 ? 2.183   -94.464  -32.256 1.00 38.39 ? 353  MET B SD  1 
ATOM   3736 C CE  . MET B 2 353 ? 0.670   -95.453  -32.253 1.00 37.80 ? 353  MET B CE  1 
ATOM   3737 N N   . GLU B 2 354 ? 4.232   -95.820  -36.568 1.00 30.47 ? 354  GLU B N   1 
ATOM   3738 C CA  . GLU B 2 354 ? 3.431   -95.970  -37.777 1.00 29.94 ? 354  GLU B CA  1 
ATOM   3739 C C   . GLU B 2 354 ? 4.045   -97.050  -38.683 1.00 28.39 ? 354  GLU B C   1 
ATOM   3740 O O   . GLU B 2 354 ? 5.269   -97.132  -38.790 1.00 28.02 ? 354  GLU B O   1 
ATOM   3741 C CB  . GLU B 2 354 ? 3.277   -94.647  -38.531 1.00 30.40 ? 354  GLU B CB  1 
ATOM   3742 C CG  . GLU B 2 354 ? 2.264   -93.614  -37.908 1.00 33.55 ? 354  GLU B CG  1 
ATOM   3743 C CD  . GLU B 2 354 ? 0.907   -94.239  -37.505 1.00 38.36 ? 354  GLU B CD  1 
ATOM   3744 O OE1 . GLU B 2 354 ? 0.295   -94.974  -38.328 1.00 39.66 ? 354  GLU B OE1 1 
ATOM   3745 O OE2 . GLU B 2 354 ? 0.447   -93.985  -36.361 1.00 40.25 ? 354  GLU B OE2 1 
ATOM   3746 N N   . PRO B 2 355 ? 3.189   -97.849  -39.355 1.00 27.36 ? 355  PRO B N   1 
ATOM   3747 C CA  . PRO B 2 355 ? 3.617   -99.014  -40.152 1.00 26.95 ? 355  PRO B CA  1 
ATOM   3748 C C   . PRO B 2 355 ? 4.464   -98.627  -41.353 1.00 25.39 ? 355  PRO B C   1 
ATOM   3749 O O   . PRO B 2 355 ? 4.163   -97.645  -42.045 1.00 25.00 ? 355  PRO B O   1 
ATOM   3750 C CB  . PRO B 2 355 ? 2.298   -99.650  -40.616 1.00 27.13 ? 355  PRO B CB  1 
ATOM   3751 C CG  . PRO B 2 355 ? 1.209   -98.958  -39.837 1.00 28.51 ? 355  PRO B CG  1 
ATOM   3752 C CD  . PRO B 2 355 ? 1.731   -97.637  -39.425 1.00 27.68 ? 355  PRO B CD  1 
ATOM   3753 N N   . ASN B 2 356 ? 5.527   -99.389  -41.605 1.00 24.74 ? 356  ASN B N   1 
ATOM   3754 C CA  . ASN B 2 356 ? 6.351   -99.105  -42.759 1.00 24.40 ? 356  ASN B CA  1 
ATOM   3755 C C   . ASN B 2 356 ? 6.114   -100.124 -43.849 1.00 24.53 ? 356  ASN B C   1 
ATOM   3756 O O   . ASN B 2 356 ? 6.595   -99.972  -44.966 1.00 25.56 ? 356  ASN B O   1 
ATOM   3757 C CB  . ASN B 2 356 ? 7.830   -98.987  -42.394 1.00 24.51 ? 356  ASN B CB  1 
ATOM   3758 C CG  . ASN B 2 356 ? 8.399   -100.272 -41.902 1.00 23.32 ? 356  ASN B CG  1 
ATOM   3759 O OD1 . ASN B 2 356 ? 7.892   -100.858 -40.945 1.00 25.26 ? 356  ASN B OD1 1 
ATOM   3760 N ND2 . ASN B 2 356 ? 9.456   -100.742 -42.556 1.00 21.49 ? 356  ASN B ND2 1 
ATOM   3761 N N   . VAL B 2 357 ? 5.334   -101.140 -43.522 1.00 23.84 ? 357  VAL B N   1 
ATOM   3762 C CA  . VAL B 2 357 ? 5.009   -102.216 -44.423 1.00 24.15 ? 357  VAL B CA  1 
ATOM   3763 C C   . VAL B 2 357 ? 3.548   -102.586 -44.251 1.00 24.70 ? 357  VAL B C   1 
ATOM   3764 O O   . VAL B 2 357 ? 2.979   -102.398 -43.173 1.00 24.78 ? 357  VAL B O   1 
ATOM   3765 C CB  . VAL B 2 357 ? 5.844   -103.503 -44.067 1.00 23.21 ? 357  VAL B CB  1 
ATOM   3766 C CG1 . VAL B 2 357 ? 7.263   -103.299 -44.473 1.00 23.28 ? 357  VAL B CG1 1 
ATOM   3767 C CG2 . VAL B 2 357 ? 5.776   -103.768 -42.560 1.00 23.27 ? 357  VAL B CG2 1 
ATOM   3768 N N   . ALA B 2 358 ? 2.970   -103.167 -45.293 1.00 25.00 ? 358  ALA B N   1 
ATOM   3769 C CA  . ALA B 2 358 ? 1.614   -103.684 -45.253 1.00 25.34 ? 358  ALA B CA  1 
ATOM   3770 C C   . ALA B 2 358 ? 1.621   -105.132 -44.755 1.00 25.72 ? 358  ALA B C   1 
ATOM   3771 O O   . ALA B 2 358 ? 1.293   -106.045 -45.504 1.00 26.27 ? 358  ALA B O   1 
ATOM   3772 C CB  . ALA B 2 358 ? 0.987   -103.588 -46.650 1.00 25.32 ? 358  ALA B CB  1 
ATOM   3773 N N   . LEU B 2 359 ? 1.996   -105.318 -43.488 1.00 25.05 ? 359  LEU B N   1 
ATOM   3774 C CA  . LEU B 2 359 ? 1.963   -106.609 -42.820 1.00 26.07 ? 359  LEU B CA  1 
ATOM   3775 C C   . LEU B 2 359 ? 1.009   -106.426 -41.640 1.00 26.96 ? 359  LEU B C   1 
ATOM   3776 O O   . LEU B 2 359 ? 1.269   -105.599 -40.747 1.00 28.45 ? 359  LEU B O   1 
ATOM   3777 C CB  . LEU B 2 359 ? 3.350   -106.958 -42.301 1.00 24.90 ? 359  LEU B CB  1 
ATOM   3778 C CG  . LEU B 2 359 ? 3.179   -108.300 -41.592 1.00 28.48 ? 359  LEU B CG  1 
ATOM   3779 C CD1 . LEU B 2 359 ? 3.648   -109.439 -42.469 1.00 25.54 ? 359  LEU B CD1 1 
ATOM   3780 C CD2 . LEU B 2 359 ? 3.681   -108.325 -40.121 1.00 25.24 ? 359  LEU B CD2 1 
ATOM   3781 N N   . THR B 2 360 ? -0.100  -107.163 -41.635 1.00 25.65 ? 360  THR B N   1 
ATOM   3782 C CA  . THR B 2 360 ? -1.141  -106.970 -40.628 1.00 24.76 ? 360  THR B CA  1 
ATOM   3783 C C   . THR B 2 360 ? -1.572  -108.333 -40.141 1.00 24.33 ? 360  THR B C   1 
ATOM   3784 O O   . THR B 2 360 ? -0.902  -109.329 -40.411 1.00 24.54 ? 360  THR B O   1 
ATOM   3785 C CB  . THR B 2 360 ? -2.376  -106.254 -41.216 1.00 24.35 ? 360  THR B CB  1 
ATOM   3786 O OG1 . THR B 2 360 ? -3.010  -107.123 -42.153 1.00 23.23 ? 360  THR B OG1 1 
ATOM   3787 C CG2 . THR B 2 360 ? -2.014  -104.942 -41.906 1.00 25.79 ? 360  THR B CG2 1 
ATOM   3788 N N   . GLU B 2 361 ? -2.674  -108.384 -39.406 1.00 24.00 ? 361  GLU B N   1 
ATOM   3789 C CA  . GLU B 2 361 ? -3.212  -109.663 -38.997 1.00 24.20 ? 361  GLU B CA  1 
ATOM   3790 C C   . GLU B 2 361 ? -3.516  -110.567 -40.182 1.00 24.28 ? 361  GLU B C   1 
ATOM   3791 O O   . GLU B 2 361 ? -3.496  -111.778 -40.026 1.00 24.60 ? 361  GLU B O   1 
ATOM   3792 C CB  . GLU B 2 361 ? -4.494  -109.482 -38.151 1.00 24.39 ? 361  GLU B CB  1 
ATOM   3793 C CG  . GLU B 2 361 ? -5.791  -109.088 -38.939 1.00 23.80 ? 361  GLU B CG  1 
ATOM   3794 C CD  . GLU B 2 361 ? -5.895  -107.599 -39.244 1.00 22.93 ? 361  GLU B CD  1 
ATOM   3795 O OE1 . GLU B 2 361 ? -6.998  -107.152 -39.644 1.00 25.01 ? 361  GLU B OE1 1 
ATOM   3796 O OE2 . GLU B 2 361 ? -4.899  -106.858 -39.081 1.00 20.73 ? 361  GLU B OE2 1 
ATOM   3797 N N   . GLN B 2 362 ? -3.877  -109.996 -41.339 1.00 23.98 ? 362  GLN B N   1 
ATOM   3798 C CA  . GLN B 2 362 ? -4.296  -110.818 -42.481 1.00 23.95 ? 362  GLN B CA  1 
ATOM   3799 C C   . GLN B 2 362 ? -3.216  -111.830 -42.938 1.00 23.43 ? 362  GLN B C   1 
ATOM   3800 O O   . GLN B 2 362 ? -3.537  -112.973 -43.265 1.00 23.10 ? 362  GLN B O   1 
ATOM   3801 C CB  . GLN B 2 362 ? -4.752  -109.963 -43.646 1.00 24.78 ? 362  GLN B CB  1 
ATOM   3802 C CG  . GLN B 2 362 ? -5.249  -110.771 -44.863 1.00 30.71 ? 362  GLN B CG  1 
ATOM   3803 C CD  . GLN B 2 362 ? -6.298  -111.843 -44.532 1.00 34.45 ? 362  GLN B CD  1 
ATOM   3804 O OE1 . GLN B 2 362 ? -7.333  -111.564 -43.891 1.00 36.22 ? 362  GLN B OE1 1 
ATOM   3805 N NE2 . GLN B 2 362 ? -6.049  -113.078 -45.011 1.00 33.92 ? 362  GLN B NE2 1 
ATOM   3806 N N   . GLY B 2 363 ? -1.959  -111.422 -42.959 1.00 22.22 ? 363  GLY B N   1 
ATOM   3807 C CA  . GLY B 2 363 ? -0.886  -112.387 -43.324 1.00 23.37 ? 363  GLY B CA  1 
ATOM   3808 C C   . GLY B 2 363 ? -0.886  -113.649 -42.462 1.00 24.58 ? 363  GLY B C   1 
ATOM   3809 O O   . GLY B 2 363 ? -0.746  -114.774 -42.975 1.00 24.50 ? 363  GLY B O   1 
ATOM   3810 N N   . LEU B 2 364 ? -1.042  -113.490 -41.143 1.00 23.73 ? 364  LEU B N   1 
ATOM   3811 C CA  . LEU B 2 364 ? -1.047  -114.655 -40.244 1.00 24.19 ? 364  LEU B CA  1 
ATOM   3812 C C   . LEU B 2 364 ? -2.284  -115.506 -40.458 1.00 22.92 ? 364  LEU B C   1 
ATOM   3813 O O   . LEU B 2 364 ? -2.204  -116.715 -40.440 1.00 24.06 ? 364  LEU B O   1 
ATOM   3814 C CB  . LEU B 2 364 ? -0.950  -114.234 -38.762 1.00 23.66 ? 364  LEU B CB  1 
ATOM   3815 C CG  . LEU B 2 364 ? -0.192  -115.067 -37.709 1.00 28.20 ? 364  LEU B CG  1 
ATOM   3816 C CD1 . LEU B 2 364 ? -0.626  -114.778 -36.271 1.00 24.56 ? 364  LEU B CD1 1 
ATOM   3817 C CD2 . LEU B 2 364 ? 0.038   -116.533 -37.953 1.00 29.83 ? 364  LEU B CD2 1 
ATOM   3818 N N   . VAL B 2 365 ? -3.433  -114.877 -40.667 1.00 22.98 ? 365  VAL B N   1 
ATOM   3819 C CA  . VAL B 2 365 ? -4.656  -115.601 -41.029 1.00 23.19 ? 365  VAL B CA  1 
ATOM   3820 C C   . VAL B 2 365 ? -4.446  -116.425 -42.320 1.00 23.96 ? 365  VAL B C   1 
ATOM   3821 O O   . VAL B 2 365 ? -4.796  -117.598 -42.369 1.00 24.14 ? 365  VAL B O   1 
ATOM   3822 C CB  . VAL B 2 365 ? -5.883  -114.643 -41.150 1.00 22.15 ? 365  VAL B CB  1 
ATOM   3823 C CG1 . VAL B 2 365 ? -7.098  -115.389 -41.630 1.00 24.19 ? 365  VAL B CG1 1 
ATOM   3824 C CG2 . VAL B 2 365 ? -6.152  -113.999 -39.779 1.00 23.07 ? 365  VAL B CG2 1 
ATOM   3825 N N   . SER B 2 366 ? -3.842  -115.820 -43.335 1.00 23.87 ? 366  SER B N   1 
ATOM   3826 C CA  . SER B 2 366 ? -3.590  -116.541 -44.604 1.00 24.73 ? 366  SER B CA  1 
ATOM   3827 C C   . SER B 2 366 ? -2.785  -117.839 -44.395 1.00 23.95 ? 366  SER B C   1 
ATOM   3828 O O   . SER B 2 366 ? -3.212  -118.910 -44.836 1.00 23.68 ? 366  SER B O   1 
ATOM   3829 C CB  . SER B 2 366 ? -2.897  -115.656 -45.640 1.00 24.73 ? 366  SER B CB  1 
ATOM   3830 O OG  . SER B 2 366 ? -3.754  -114.616 -46.065 1.00 26.16 ? 366  SER B OG  1 
ATOM   3831 N N   . VAL B 2 367 ? -1.657  -117.736 -43.712 1.00 24.48 ? 367  VAL B N   1 
ATOM   3832 C CA  . VAL B 2 367 ? -0.825  -118.909 -43.457 1.00 25.95 ? 367  VAL B CA  1 
ATOM   3833 C C   . VAL B 2 367 ? -1.531  -119.934 -42.572 1.00 25.49 ? 367  VAL B C   1 
ATOM   3834 O O   . VAL B 2 367 ? -1.427  -121.128 -42.776 1.00 25.76 ? 367  VAL B O   1 
ATOM   3835 C CB  . VAL B 2 367 ? 0.536   -118.468 -42.878 1.00 27.52 ? 367  VAL B CB  1 
ATOM   3836 C CG1 . VAL B 2 367 ? 1.375   -119.664 -42.430 1.00 30.35 ? 367  VAL B CG1 1 
ATOM   3837 C CG2 . VAL B 2 367 ? 1.291   -117.644 -43.948 1.00 27.86 ? 367  VAL B CG2 1 
ATOM   3838 N N   . SER B 2 368 ? -2.256  -119.478 -41.568 1.00 25.12 ? 368  SER B N   1 
ATOM   3839 C CA  . SER B 2 368 ? -3.016  -120.424 -40.742 1.00 24.75 ? 368  SER B CA  1 
ATOM   3840 C C   . SER B 2 368 ? -4.009  -121.249 -41.559 1.00 24.78 ? 368  SER B C   1 
ATOM   3841 O O   . SER B 2 368 ? -4.223  -122.417 -41.256 1.00 23.37 ? 368  SER B O   1 
ATOM   3842 C CB  . SER B 2 368 ? -3.732  -119.700 -39.571 1.00 24.83 ? 368  SER B CB  1 
ATOM   3843 O OG  . SER B 2 368 ? -4.954  -119.069 -39.986 1.00 26.95 ? 368  SER B OG  1 
ATOM   3844 N N   . MET B 2 369 ? -4.636  -120.621 -42.559 1.00 25.62 ? 369  MET B N   1 
ATOM   3845 C CA  . MET B 2 369 ? -5.604  -121.300 -43.407 1.00 28.49 ? 369  MET B CA  1 
ATOM   3846 C C   . MET B 2 369 ? -4.896  -122.235 -44.392 1.00 26.41 ? 369  MET B C   1 
ATOM   3847 O O   . MET B 2 369 ? -5.325  -123.351 -44.567 1.00 26.58 ? 369  MET B O   1 
ATOM   3848 C CB  . MET B 2 369 ? -6.530  -120.298 -44.128 1.00 28.00 ? 369  MET B CB  1 
ATOM   3849 C CG  . MET B 2 369 ? -7.160  -119.288 -43.128 1.00 32.66 ? 369  MET B CG  1 
ATOM   3850 S SD  . MET B 2 369 ? -8.743  -118.444 -43.406 1.00 37.70 ? 369  MET B SD  1 
ATOM   3851 C CE  . MET B 2 369 ? -9.934  -119.778 -43.193 1.00 40.08 ? 369  MET B CE  1 
ATOM   3852 N N   . GLY B 2 370 ? -3.787  -121.790 -44.983 1.00 25.68 ? 370  GLY B N   1 
ATOM   3853 C CA  . GLY B 2 370 ? -3.153  -122.527 -46.097 1.00 25.24 ? 370  GLY B CA  1 
ATOM   3854 C C   . GLY B 2 370 ? -2.120  -123.591 -45.749 1.00 24.88 ? 370  GLY B C   1 
ATOM   3855 O O   . GLY B 2 370 ? -1.816  -124.477 -46.581 1.00 25.00 ? 370  GLY B O   1 
ATOM   3856 N N   . CYS B 2 371 ? -1.599  -123.535 -44.530 1.00 24.57 ? 371  CYS B N   1 
ATOM   3857 C CA  . CYS B 2 371 ? -0.482  -124.392 -44.105 1.00 24.31 ? 371  CYS B CA  1 
ATOM   3858 C C   . CYS B 2 371 ? -0.906  -125.391 -43.038 1.00 23.31 ? 371  CYS B C   1 
ATOM   3859 O O   . CYS B 2 371 ? -0.869  -125.090 -41.848 1.00 22.86 ? 371  CYS B O   1 
ATOM   3860 C CB  . CYS B 2 371 ? 0.667   -123.512 -43.587 1.00 24.93 ? 371  CYS B CB  1 
ATOM   3861 S SG  . CYS B 2 371 ? 1.335   -122.472 -44.922 1.00 29.28 ? 371  CYS B SG  1 
ATOM   3862 N N   . PRO B 2 372 ? -1.330  -126.575 -43.456 1.00 23.30 ? 372  PRO B N   1 
ATOM   3863 C CA  . PRO B 2 372 ? -1.936  -127.477 -42.486 1.00 22.92 ? 372  PRO B CA  1 
ATOM   3864 C C   . PRO B 2 372 ? -1.015  -128.016 -41.384 1.00 22.37 ? 372  PRO B C   1 
ATOM   3865 O O   . PRO B 2 372 ? -1.523  -128.533 -40.389 1.00 22.24 ? 372  PRO B O   1 
ATOM   3866 C CB  . PRO B 2 372 ? -2.464  -128.627 -43.344 1.00 23.51 ? 372  PRO B CB  1 
ATOM   3867 C CG  . PRO B 2 372 ? -1.690  -128.574 -44.605 1.00 23.94 ? 372  PRO B CG  1 
ATOM   3868 C CD  . PRO B 2 372 ? -1.346  -127.134 -44.825 1.00 22.95 ? 372  PRO B CD  1 
ATOM   3869 N N   . LYS B 2 373 ? 0.297   -127.920 -41.569 1.00 21.27 ? 373  LYS B N   1 
ATOM   3870 C CA  . LYS B 2 373 ? 1.266   -128.433 -40.588 1.00 22.35 ? 373  LYS B CA  1 
ATOM   3871 C C   . LYS B 2 373 ? 1.924   -127.296 -39.800 1.00 22.18 ? 373  LYS B C   1 
ATOM   3872 O O   . LYS B 2 373 ? 2.840   -127.526 -39.002 1.00 20.72 ? 373  LYS B O   1 
ATOM   3873 C CB  . LYS B 2 373 ? 2.351   -129.274 -41.283 1.00 22.29 ? 373  LYS B CB  1 
ATOM   3874 C CG  . LYS B 2 373 ? 1.841   -130.341 -42.218 1.00 25.54 ? 373  LYS B CG  1 
ATOM   3875 C CD  . LYS B 2 373 ? 1.380   -131.574 -41.458 1.00 31.33 ? 373  LYS B CD  1 
ATOM   3876 C CE  . LYS B 2 373 ? 1.125   -132.783 -42.384 1.00 34.28 ? 373  LYS B CE  1 
ATOM   3877 N NZ  . LYS B 2 373 ? 2.334   -133.674 -42.522 1.00 37.58 ? 373  LYS B NZ  1 
ATOM   3878 N N   . LEU B 2 374 ? 1.434   -126.077 -40.016 1.00 22.30 ? 374  LEU B N   1 
ATOM   3879 C CA  . LEU B 2 374 ? 1.978   -124.894 -39.330 1.00 23.25 ? 374  LEU B CA  1 
ATOM   3880 C C   . LEU B 2 374 ? 1.676   -125.064 -37.837 1.00 22.57 ? 374  LEU B C   1 
ATOM   3881 O O   . LEU B 2 374 ? 0.494   -125.184 -37.458 1.00 22.75 ? 374  LEU B O   1 
ATOM   3882 C CB  . LEU B 2 374 ? 1.290   -123.630 -39.898 1.00 23.43 ? 374  LEU B CB  1 
ATOM   3883 C CG  . LEU B 2 374 ? 1.846   -122.212 -39.607 1.00 25.83 ? 374  LEU B CG  1 
ATOM   3884 C CD1 . LEU B 2 374 ? 0.881   -121.262 -38.921 1.00 28.75 ? 374  LEU B CD1 1 
ATOM   3885 C CD2 . LEU B 2 374 ? 3.289   -122.096 -39.179 1.00 25.85 ? 374  LEU B CD2 1 
ATOM   3886 N N   . GLU B 2 375 ? 2.724   -125.145 -37.004 1.00 22.10 ? 375  GLU B N   1 
ATOM   3887 C CA  . GLU B 2 375 ? 2.513   -125.336 -35.548 1.00 22.02 ? 375  GLU B CA  1 
ATOM   3888 C C   . GLU B 2 375 ? 3.339   -124.414 -34.666 1.00 21.10 ? 375  GLU B C   1 
ATOM   3889 O O   . GLU B 2 375 ? 3.185   -124.430 -33.448 1.00 21.15 ? 375  GLU B O   1 
ATOM   3890 C CB  . GLU B 2 375 ? 2.770   -126.790 -35.131 1.00 22.65 ? 375  GLU B CB  1 
ATOM   3891 C CG  . GLU B 2 375 ? 4.237   -127.161 -35.241 1.00 24.75 ? 375  GLU B CG  1 
ATOM   3892 C CD  . GLU B 2 375 ? 4.547   -128.496 -34.634 1.00 27.69 ? 375  GLU B CD  1 
ATOM   3893 O OE1 . GLU B 2 375 ? 4.729   -128.595 -33.403 1.00 28.08 ? 375  GLU B OE1 1 
ATOM   3894 O OE2 . GLU B 2 375 ? 4.647   -129.450 -35.411 1.00 28.17 ? 375  GLU B OE2 1 
ATOM   3895 N N   . SER B 2 376 ? 4.208   -123.607 -35.271 1.00 20.76 ? 376  SER B N   1 
ATOM   3896 C CA  . SER B 2 376 ? 5.067   -122.686 -34.493 1.00 20.70 ? 376  SER B CA  1 
ATOM   3897 C C   . SER B 2 376 ? 5.066   -121.355 -35.160 1.00 20.78 ? 376  SER B C   1 
ATOM   3898 O O   . SER B 2 376 ? 5.424   -121.243 -36.337 1.00 21.15 ? 376  SER B O   1 
ATOM   3899 C CB  . SER B 2 376 ? 6.509   -123.218 -34.406 1.00 20.27 ? 376  SER B CB  1 
ATOM   3900 O OG  . SER B 2 376 ? 7.334   -122.285 -33.727 1.00 21.64 ? 376  SER B OG  1 
ATOM   3901 N N   . VAL B 2 377 ? 4.652   -120.333 -34.422 1.00 21.50 ? 377  VAL B N   1 
ATOM   3902 C CA  . VAL B 2 377 ? 4.552   -118.979 -34.988 1.00 20.28 ? 377  VAL B CA  1 
ATOM   3903 C C   . VAL B 2 377 ? 5.263   -118.000 -34.065 1.00 20.97 ? 377  VAL B C   1 
ATOM   3904 O O   . VAL B 2 377 ? 5.131   -118.106 -32.824 1.00 20.73 ? 377  VAL B O   1 
ATOM   3905 C CB  . VAL B 2 377 ? 3.047   -118.546 -35.142 1.00 21.03 ? 377  VAL B CB  1 
ATOM   3906 C CG1 . VAL B 2 377 ? 2.933   -117.022 -35.323 1.00 20.41 ? 377  VAL B CG1 1 
ATOM   3907 C CG2 . VAL B 2 377 ? 2.398   -119.267 -36.326 1.00 22.27 ? 377  VAL B CG2 1 
ATOM   3908 N N   . LEU B 2 378 ? 6.058   -117.093 -34.645 1.00 20.12 ? 378  LEU B N   1 
ATOM   3909 C CA  . LEU B 2 378 ? 6.505   -115.867 -33.934 1.00 21.36 ? 378  LEU B CA  1 
ATOM   3910 C C   . LEU B 2 378 ? 6.205   -114.730 -34.881 1.00 22.09 ? 378  LEU B C   1 
ATOM   3911 O O   . LEU B 2 378 ? 6.701   -114.729 -36.014 1.00 23.12 ? 378  LEU B O   1 
ATOM   3912 C CB  . LEU B 2 378 ? 8.022   -115.923 -33.587 1.00 21.52 ? 378  LEU B CB  1 
ATOM   3913 C CG  . LEU B 2 378 ? 8.634   -114.611 -33.026 1.00 19.83 ? 378  LEU B CG  1 
ATOM   3914 C CD1 . LEU B 2 378 ? 7.941   -114.131 -31.680 1.00 21.44 ? 378  LEU B CD1 1 
ATOM   3915 C CD2 . LEU B 2 378 ? 10.116  -114.795 -32.721 1.00 20.87 ? 378  LEU B CD2 1 
ATOM   3916 N N   . TYR B 2 379 ? 5.360   -113.776 -34.482 1.00 22.20 ? 379  TYR B N   1 
ATOM   3917 C CA  . TYR B 2 379 ? 4.845   -112.807 -35.489 1.00 22.79 ? 379  TYR B CA  1 
ATOM   3918 C C   . TYR B 2 379 ? 4.842   -111.434 -34.859 1.00 22.57 ? 379  TYR B C   1 
ATOM   3919 O O   . TYR B 2 379 ? 4.278   -111.265 -33.779 1.00 23.65 ? 379  TYR B O   1 
ATOM   3920 C CB  . TYR B 2 379 ? 3.424   -113.217 -35.889 1.00 22.39 ? 379  TYR B CB  1 
ATOM   3921 C CG  . TYR B 2 379 ? 2.841   -112.583 -37.128 1.00 21.84 ? 379  TYR B CG  1 
ATOM   3922 C CD1 . TYR B 2 379 ? 3.114   -113.115 -38.387 1.00 24.21 ? 379  TYR B CD1 1 
ATOM   3923 C CD2 . TYR B 2 379 ? 1.958   -111.494 -37.038 1.00 21.78 ? 379  TYR B CD2 1 
ATOM   3924 C CE1 . TYR B 2 379 ? 2.570   -112.581 -39.520 1.00 23.80 ? 379  TYR B CE1 1 
ATOM   3925 C CE2 . TYR B 2 379 ? 1.389   -110.925 -38.198 1.00 21.69 ? 379  TYR B CE2 1 
ATOM   3926 C CZ  . TYR B 2 379 ? 1.711   -111.484 -39.427 1.00 23.90 ? 379  TYR B CZ  1 
ATOM   3927 O OH  . TYR B 2 379 ? 1.166   -111.023 -40.595 1.00 22.80 ? 379  TYR B OH  1 
ATOM   3928 N N   . PHE B 2 380 ? 5.528   -110.479 -35.485 1.00 22.05 ? 380  PHE B N   1 
ATOM   3929 C CA  . PHE B 2 380 ? 5.578   -109.101 -34.977 1.00 21.60 ? 380  PHE B CA  1 
ATOM   3930 C C   . PHE B 2 380 ? 4.746   -108.277 -35.935 1.00 22.40 ? 380  PHE B C   1 
ATOM   3931 O O   . PHE B 2 380 ? 4.996   -108.292 -37.162 1.00 21.63 ? 380  PHE B O   1 
ATOM   3932 C CB  . PHE B 2 380 ? 7.014   -108.546 -34.959 1.00 21.52 ? 380  PHE B CB  1 
ATOM   3933 C CG  . PHE B 2 380 ? 7.881   -109.091 -33.866 1.00 20.34 ? 380  PHE B CG  1 
ATOM   3934 C CD1 . PHE B 2 380 ? 8.473   -110.365 -33.994 1.00 22.78 ? 380  PHE B CD1 1 
ATOM   3935 C CD2 . PHE B 2 380 ? 8.175   -108.336 -32.757 1.00 22.66 ? 380  PHE B CD2 1 
ATOM   3936 C CE1 . PHE B 2 380 ? 9.318   -110.873 -32.985 1.00 20.39 ? 380  PHE B CE1 1 
ATOM   3937 C CE2 . PHE B 2 380 ? 9.024   -108.838 -31.717 1.00 22.80 ? 380  PHE B CE2 1 
ATOM   3938 C CZ  . PHE B 2 380 ? 9.598   -110.117 -31.852 1.00 20.94 ? 380  PHE B CZ  1 
ATOM   3939 N N   . CYS B 2 381 ? 3.766   -107.553 -35.385 1.00 21.67 ? 381  CYS B N   1 
ATOM   3940 C CA  . CYS B 2 381 ? 2.936   -106.694 -36.224 1.00 21.26 ? 381  CYS B CA  1 
ATOM   3941 C C   . CYS B 2 381 ? 2.466   -105.484 -35.446 1.00 20.28 ? 381  CYS B C   1 
ATOM   3942 O O   . CYS B 2 381 ? 2.783   -105.310 -34.265 1.00 19.82 ? 381  CYS B O   1 
ATOM   3943 C CB  . CYS B 2 381 ? 1.750   -107.474 -36.813 1.00 20.94 ? 381  CYS B CB  1 
ATOM   3944 S SG  . CYS B 2 381 ? 0.703   -108.263 -35.596 1.00 25.85 ? 381  CYS B SG  1 
ATOM   3945 N N   . ARG B 2 382 ? 1.706   -104.621 -36.095 1.00 19.64 ? 382  ARG B N   1 
ATOM   3946 C CA  . ARG B 2 382 ? 1.257   -103.424 -35.386 1.00 19.12 ? 382  ARG B CA  1 
ATOM   3947 C C   . ARG B 2 382 ? -0.221  -103.383 -35.099 1.00 19.60 ? 382  ARG B C   1 
ATOM   3948 O O   . ARG B 2 382 ? -0.679  -102.487 -34.391 1.00 17.87 ? 382  ARG B O   1 
ATOM   3949 C CB  . ARG B 2 382 ? 1.662   -102.170 -36.150 1.00 20.34 ? 382  ARG B CB  1 
ATOM   3950 C CG  . ARG B 2 382 ? 3.167   -102.023 -36.284 1.00 21.41 ? 382  ARG B CG  1 
ATOM   3951 C CD  . ARG B 2 382 ? 3.501   -100.724 -36.977 1.00 24.86 ? 382  ARG B CD  1 
ATOM   3952 N NE  . ARG B 2 382 ? 4.908   -100.350 -36.820 1.00 27.51 ? 382  ARG B NE  1 
ATOM   3953 C CZ  . ARG B 2 382 ? 5.914   -100.952 -37.448 1.00 29.56 ? 382  ARG B CZ  1 
ATOM   3954 N NH1 . ARG B 2 382 ? 5.680   -101.991 -38.247 1.00 31.02 ? 382  ARG B NH1 1 
ATOM   3955 N NH2 . ARG B 2 382 ? 7.160   -100.530 -37.264 1.00 30.84 ? 382  ARG B NH2 1 
ATOM   3956 N N   . GLN B 2 383 ? -0.982  -104.325 -35.662 1.00 19.66 ? 383  GLN B N   1 
ATOM   3957 C CA  . GLN B 2 383 ? -2.424  -104.342 -35.411 1.00 19.96 ? 383  GLN B CA  1 
ATOM   3958 C C   . GLN B 2 383 ? -2.898  -105.778 -35.346 1.00 20.66 ? 383  GLN B C   1 
ATOM   3959 O O   . GLN B 2 383 ? -2.252  -106.665 -35.912 1.00 19.23 ? 383  GLN B O   1 
ATOM   3960 C CB  . GLN B 2 383 ? -3.179  -103.594 -36.525 1.00 19.27 ? 383  GLN B CB  1 
ATOM   3961 C CG  . GLN B 2 383 ? -3.179  -104.283 -37.886 1.00 19.35 ? 383  GLN B CG  1 
ATOM   3962 C CD  . GLN B 2 383 ? -3.880  -103.462 -38.957 1.00 21.71 ? 383  GLN B CD  1 
ATOM   3963 O OE1 . GLN B 2 383 ? -4.600  -104.000 -39.791 1.00 22.00 ? 383  GLN B OE1 1 
ATOM   3964 N NE2 . GLN B 2 383 ? -3.689  -102.147 -38.916 1.00 21.63 ? 383  GLN B NE2 1 
ATOM   3965 N N   . MET B 2 384 ? -4.035  -105.988 -34.686 1.00 20.44 ? 384  MET B N   1 
ATOM   3966 C CA  . MET B 2 384 ? -4.614  -107.312 -34.489 1.00 21.80 ? 384  MET B CA  1 
ATOM   3967 C C   . MET B 2 384 ? -6.116  -107.163 -34.197 1.00 23.01 ? 384  MET B C   1 
ATOM   3968 O O   . MET B 2 384 ? -6.564  -106.100 -33.753 1.00 23.91 ? 384  MET B O   1 
ATOM   3969 C CB  . MET B 2 384 ? -3.894  -108.021 -33.333 1.00 21.02 ? 384  MET B CB  1 
ATOM   3970 C CG  . MET B 2 384 ? -4.260  -109.511 -33.087 1.00 22.79 ? 384  MET B CG  1 
ATOM   3971 S SD  . MET B 2 384 ? -4.283  -110.548 -34.601 1.00 23.94 ? 384  MET B SD  1 
ATOM   3972 C CE  . MET B 2 384 ? -2.601  -110.187 -35.193 1.00 22.46 ? 384  MET B CE  1 
ATOM   3973 N N   . THR B 2 385 ? -6.885  -108.216 -34.491 1.00 23.63 ? 385  THR B N   1 
ATOM   3974 C CA  . THR B 2 385 ? -8.265  -108.311 -34.091 1.00 23.40 ? 385  THR B CA  1 
ATOM   3975 C C   . THR B 2 385 ? -8.543  -109.611 -33.355 1.00 24.29 ? 385  THR B C   1 
ATOM   3976 O O   . THR B 2 385 ? -7.823  -110.609 -33.522 1.00 24.80 ? 385  THR B O   1 
ATOM   3977 C CB  . THR B 2 385 ? -9.237  -108.228 -35.294 1.00 24.50 ? 385  THR B CB  1 
ATOM   3978 O OG1 . THR B 2 385 ? -8.995  -109.336 -36.161 1.00 22.77 ? 385  THR B OG1 1 
ATOM   3979 C CG2 . THR B 2 385 ? -9.027  -106.937 -36.082 1.00 23.58 ? 385  THR B CG2 1 
ATOM   3980 N N   . ASN B 2 386 ? -9.609  -109.604 -32.547 1.00 23.48 ? 386  ASN B N   1 
ATOM   3981 C CA  . ASN B 2 386 ? -10.137 -110.834 -32.003 1.00 24.12 ? 386  ASN B CA  1 
ATOM   3982 C C   . ASN B 2 386 ? -10.618 -111.790 -33.099 1.00 23.69 ? 386  ASN B C   1 
ATOM   3983 O O   . ASN B 2 386 ? -10.400 -113.007 -33.000 1.00 23.47 ? 386  ASN B O   1 
ATOM   3984 C CB  . ASN B 2 386 ? -11.243 -110.526 -30.996 1.00 23.73 ? 386  ASN B CB  1 
ATOM   3985 C CG  . ASN B 2 386 ? -10.689 -109.956 -29.692 1.00 23.29 ? 386  ASN B CG  1 
ATOM   3986 O OD1 . ASN B 2 386 ? -9.826  -110.563 -29.084 1.00 23.24 ? 386  ASN B OD1 1 
ATOM   3987 N ND2 . ASN B 2 386 ? -11.200 -108.811 -29.254 1.00 20.85 ? 386  ASN B ND2 1 
ATOM   3988 N N   . ALA B 2 387 ? -11.242 -111.245 -34.150 1.00 23.82 ? 387  ALA B N   1 
ATOM   3989 C CA  . ALA B 2 387 ? -11.730 -112.079 -35.248 1.00 24.07 ? 387  ALA B CA  1 
ATOM   3990 C C   . ALA B 2 387 ? -10.588 -112.856 -35.872 1.00 24.26 ? 387  ALA B C   1 
ATOM   3991 O O   . ALA B 2 387 ? -10.742 -114.063 -36.126 1.00 24.79 ? 387  ALA B O   1 
ATOM   3992 C CB  . ALA B 2 387 ? -12.498 -111.246 -36.336 1.00 23.97 ? 387  ALA B CB  1 
ATOM   3993 N N   . ALA B 2 388 ? -9.454  -112.188 -36.139 1.00 23.37 ? 388  ALA B N   1 
ATOM   3994 C CA  . ALA B 2 388 ? -8.278  -112.865 -36.678 1.00 24.32 ? 388  ALA B CA  1 
ATOM   3995 C C   . ALA B 2 388 ? -7.779  -113.984 -35.798 1.00 24.32 ? 388  ALA B C   1 
ATOM   3996 O O   . ALA B 2 388 ? -7.523  -115.087 -36.282 1.00 24.63 ? 388  ALA B O   1 
ATOM   3997 C CB  . ALA B 2 388 ? -7.115  -111.869 -36.937 1.00 25.17 ? 388  ALA B CB  1 
ATOM   3998 N N   . LEU B 2 389 ? -7.609  -113.710 -34.502 1.00 23.80 ? 389  LEU B N   1 
ATOM   3999 C CA  . LEU B 2 389 ? -7.115  -114.740 -33.557 1.00 22.95 ? 389  LEU B CA  1 
ATOM   4000 C C   . LEU B 2 389 ? -8.070  -115.942 -33.442 1.00 23.32 ? 389  LEU B C   1 
ATOM   4001 O O   . LEU B 2 389 ? -7.642  -117.092 -33.384 1.00 23.67 ? 389  LEU B O   1 
ATOM   4002 C CB  . LEU B 2 389 ? -6.905  -114.108 -32.174 1.00 22.81 ? 389  LEU B CB  1 
ATOM   4003 C CG  . LEU B 2 389 ? -5.712  -113.159 -32.017 1.00 22.05 ? 389  LEU B CG  1 
ATOM   4004 C CD1 . LEU B 2 389 ? -5.704  -112.393 -30.664 1.00 22.36 ? 389  LEU B CD1 1 
ATOM   4005 C CD2 . LEU B 2 389 ? -4.412  -113.966 -32.150 1.00 22.81 ? 389  LEU B CD2 1 
ATOM   4006 N N   . ILE B 2 390 ? -9.366  -115.671 -33.417 1.00 22.70 ? 390  ILE B N   1 
ATOM   4007 C CA  . ILE B 2 390 ? -10.370 -116.748 -33.439 1.00 24.31 ? 390  ILE B CA  1 
ATOM   4008 C C   . ILE B 2 390 ? -10.253 -117.606 -34.730 1.00 24.27 ? 390  ILE B C   1 
ATOM   4009 O O   . ILE B 2 390 ? -10.321 -118.831 -34.665 1.00 23.55 ? 390  ILE B O   1 
ATOM   4010 C CB  . ILE B 2 390 ? -11.809 -116.203 -33.269 1.00 23.35 ? 390  ILE B CB  1 
ATOM   4011 C CG1 . ILE B 2 390 ? -12.014 -115.685 -31.827 1.00 23.57 ? 390  ILE B CG1 1 
ATOM   4012 C CG2 . ILE B 2 390 ? -12.868 -117.303 -33.589 1.00 25.22 ? 390  ILE B CG2 1 
ATOM   4013 C CD1 . ILE B 2 390 ? -13.315 -114.887 -31.572 1.00 26.16 ? 390  ILE B CD1 1 
ATOM   4014 N N   . THR B 2 391 ? -10.101 -116.962 -35.886 1.00 23.24 ? 391  THR B N   1 
ATOM   4015 C CA  . THR B 2 391 ? -9.906  -117.694 -37.170 1.00 23.61 ? 391  THR B CA  1 
ATOM   4016 C C   . THR B 2 391 ? -8.620  -118.533 -37.142 1.00 23.59 ? 391  THR B C   1 
ATOM   4017 O O   . THR B 2 391 ? -8.611  -119.710 -37.549 1.00 21.90 ? 391  THR B O   1 
ATOM   4018 C CB  . THR B 2 391 ? -9.890  -116.722 -38.366 1.00 22.99 ? 391  THR B CB  1 
ATOM   4019 O OG1 . THR B 2 391 ? -11.148 -116.063 -38.429 1.00 22.85 ? 391  THR B OG1 1 
ATOM   4020 C CG2 . THR B 2 391 ? -9.674  -117.441 -39.755 1.00 23.88 ? 391  THR B CG2 1 
ATOM   4021 N N   . ILE B 2 392 ? -7.544  -117.938 -36.641 1.00 22.72 ? 392  ILE B N   1 
ATOM   4022 C CA  . ILE B 2 392 ? -6.295  -118.689 -36.505 1.00 23.55 ? 392  ILE B CA  1 
ATOM   4023 C C   . ILE B 2 392 ? -6.481  -119.945 -35.645 1.00 24.41 ? 392  ILE B C   1 
ATOM   4024 O O   . ILE B 2 392 ? -6.048  -121.051 -36.036 1.00 24.88 ? 392  ILE B O   1 
ATOM   4025 C CB  . ILE B 2 392 ? -5.152  -117.785 -35.995 1.00 23.25 ? 392  ILE B CB  1 
ATOM   4026 C CG1 . ILE B 2 392 ? -4.845  -116.734 -37.058 1.00 23.95 ? 392  ILE B CG1 1 
ATOM   4027 C CG2 . ILE B 2 392 ? -3.848  -118.622 -35.655 1.00 22.79 ? 392  ILE B CG2 1 
ATOM   4028 C CD1 . ILE B 2 392 ? -4.048  -115.524 -36.557 1.00 25.86 ? 392  ILE B CD1 1 
ATOM   4029 N N   . ALA B 2 393 ? -7.099  -119.780 -34.467 1.00 24.71 ? 393  ALA B N   1 
ATOM   4030 C CA  . ALA B 2 393 ? -7.260  -120.869 -33.501 1.00 24.59 ? 393  ALA B CA  1 
ATOM   4031 C C   . ALA B 2 393 ? -8.095  -121.993 -34.118 1.00 25.09 ? 393  ALA B C   1 
ATOM   4032 O O   . ALA B 2 393 ? -7.747  -123.180 -34.020 1.00 25.91 ? 393  ALA B O   1 
ATOM   4033 C CB  . ALA B 2 393 ? -7.929  -120.339 -32.237 1.00 24.34 ? 393  ALA B CB  1 
ATOM   4034 N N   . ARG B 2 394 ? -9.177  -121.601 -34.777 1.00 25.17 ? 394  ARG B N   1 
ATOM   4035 C CA  . ARG B 2 394 ? -10.050 -122.568 -35.435 1.00 25.82 ? 394  ARG B CA  1 
ATOM   4036 C C   . ARG B 2 394 ? -9.365  -123.272 -36.605 1.00 25.12 ? 394  ARG B C   1 
ATOM   4037 O O   . ARG B 2 394 ? -9.638  -124.437 -36.855 1.00 25.23 ? 394  ARG B O   1 
ATOM   4038 C CB  . ARG B 2 394 ? -11.336 -121.907 -35.878 1.00 26.48 ? 394  ARG B CB  1 
ATOM   4039 C CG  . ARG B 2 394 ? -12.147 -121.387 -34.701 1.00 30.57 ? 394  ARG B CG  1 
ATOM   4040 C CD  . ARG B 2 394 ? -13.343 -120.572 -35.181 1.00 36.48 ? 394  ARG B CD  1 
ATOM   4041 N NE  . ARG B 2 394 ? -14.515 -121.414 -35.321 1.00 43.30 ? 394  ARG B NE  1 
ATOM   4042 C CZ  . ARG B 2 394 ? -15.323 -121.747 -34.313 1.00 47.03 ? 394  ARG B CZ  1 
ATOM   4043 N NH1 . ARG B 2 394 ? -15.082 -121.303 -33.076 1.00 49.17 ? 394  ARG B NH1 1 
ATOM   4044 N NH2 . ARG B 2 394 ? -16.375 -122.527 -34.542 1.00 47.50 ? 394  ARG B NH2 1 
ATOM   4045 N N   . ASN B 2 395 ? -8.477  -122.587 -37.318 1.00 24.06 ? 395  ASN B N   1 
ATOM   4046 C CA  . ASN B 2 395 ? -7.873  -123.226 -38.487 1.00 24.54 ? 395  ASN B CA  1 
ATOM   4047 C C   . ASN B 2 395 ? -6.755  -124.170 -38.049 1.00 23.37 ? 395  ASN B C   1 
ATOM   4048 O O   . ASN B 2 395 ? -6.533  -125.224 -38.647 1.00 21.74 ? 395  ASN B O   1 
ATOM   4049 C CB  . ASN B 2 395 ? -7.281  -122.205 -39.442 1.00 24.71 ? 395  ASN B CB  1 
ATOM   4050 C CG  . ASN B 2 395 ? -8.318  -121.363 -40.155 1.00 28.25 ? 395  ASN B CG  1 
ATOM   4051 O OD1 . ASN B 2 395 ? -9.502  -121.686 -40.224 1.00 27.28 ? 395  ASN B OD1 1 
ATOM   4052 N ND2 . ASN B 2 395 ? -7.856  -120.255 -40.699 1.00 31.32 ? 395  ASN B ND2 1 
ATOM   4053 N N   . ARG B 2 396 ? -6.062  -123.781 -36.993 1.00 22.98 ? 396  ARG B N   1 
ATOM   4054 C CA  . ARG B 2 396 ? -4.863  -124.500 -36.551 1.00 23.19 ? 396  ARG B CA  1 
ATOM   4055 C C   . ARG B 2 396 ? -4.924  -125.018 -35.118 1.00 23.85 ? 396  ARG B C   1 
ATOM   4056 O O   . ARG B 2 396 ? -4.122  -124.602 -34.289 1.00 23.85 ? 396  ARG B O   1 
ATOM   4057 C CB  . ARG B 2 396 ? -3.633  -123.592 -36.713 1.00 23.37 ? 396  ARG B CB  1 
ATOM   4058 C CG  . ARG B 2 396 ? -3.251  -123.308 -38.196 1.00 22.92 ? 396  ARG B CG  1 
ATOM   4059 C CD  . ARG B 2 396 ? -2.481  -124.440 -38.926 1.00 21.83 ? 396  ARG B CD  1 
ATOM   4060 N NE  . ARG B 2 396 ? -3.216  -125.706 -39.047 1.00 21.88 ? 396  ARG B NE  1 
ATOM   4061 C CZ  . ARG B 2 396 ? -4.087  -126.020 -39.998 1.00 22.39 ? 396  ARG B CZ  1 
ATOM   4062 N NH1 . ARG B 2 396 ? -4.403  -125.175 -40.990 1.00 21.89 ? 396  ARG B NH1 1 
ATOM   4063 N NH2 . ARG B 2 396 ? -4.668  -127.216 -39.962 1.00 24.12 ? 396  ARG B NH2 1 
ATOM   4064 N N   . PRO B 2 397 ? -5.819  -125.987 -34.836 1.00 24.32 ? 397  PRO B N   1 
ATOM   4065 C CA  . PRO B 2 397 ? -5.919  -126.559 -33.471 1.00 25.05 ? 397  PRO B CA  1 
ATOM   4066 C C   . PRO B 2 397 ? -4.646  -127.346 -33.084 1.00 24.95 ? 397  PRO B C   1 
ATOM   4067 O O   . PRO B 2 397 ? -4.441  -127.693 -31.912 1.00 25.06 ? 397  PRO B O   1 
ATOM   4068 C CB  . PRO B 2 397 ? -7.150  -127.501 -33.579 1.00 24.67 ? 397  PRO B CB  1 
ATOM   4069 C CG  . PRO B 2 397 ? -7.195  -127.910 -35.049 1.00 25.51 ? 397  PRO B CG  1 
ATOM   4070 C CD  . PRO B 2 397 ? -6.753  -126.630 -35.779 1.00 24.46 ? 397  PRO B CD  1 
ATOM   4071 N N   . ASN B 2 398 ? -3.795  -127.591 -34.080 1.00 24.15 ? 398  ASN B N   1 
ATOM   4072 C CA  . ASN B 2 398 ? -2.531  -128.313 -33.891 1.00 24.16 ? 398  ASN B CA  1 
ATOM   4073 C C   . ASN B 2 398 ? -1.356  -127.429 -33.440 1.00 23.32 ? 398  ASN B C   1 
ATOM   4074 O O   . ASN B 2 398 ? -0.249  -127.929 -33.193 1.00 24.07 ? 398  ASN B O   1 
ATOM   4075 C CB  . ASN B 2 398 ? -2.138  -129.028 -35.191 1.00 24.69 ? 398  ASN B CB  1 
ATOM   4076 C CG  . ASN B 2 398 ? -1.915  -128.064 -36.367 1.00 26.65 ? 398  ASN B CG  1 
ATOM   4077 O OD1 . ASN B 2 398 ? -2.724  -127.154 -36.632 1.00 28.12 ? 398  ASN B OD1 1 
ATOM   4078 N ND2 . ASN B 2 398 ? -0.816  -128.288 -37.100 1.00 29.39 ? 398  ASN B ND2 1 
ATOM   4079 N N   . MET B 2 399 ? -1.604  -126.127 -33.322 1.00 22.51 ? 399  MET B N   1 
ATOM   4080 C CA  . MET B 2 399 ? -0.567  -125.159 -32.902 1.00 21.41 ? 399  MET B CA  1 
ATOM   4081 C C   . MET B 2 399 ? 0.085   -125.529 -31.569 1.00 21.87 ? 399  MET B C   1 
ATOM   4082 O O   . MET B 2 399 ? -0.597  -125.810 -30.602 1.00 21.96 ? 399  MET B O   1 
ATOM   4083 C CB  . MET B 2 399 ? -1.192  -123.764 -32.788 1.00 21.91 ? 399  MET B CB  1 
ATOM   4084 C CG  . MET B 2 399 ? -0.163  -122.604 -32.685 1.00 22.33 ? 399  MET B CG  1 
ATOM   4085 S SD  . MET B 2 399 ? 0.636   -122.200 -34.288 1.00 27.59 ? 399  MET B SD  1 
ATOM   4086 C CE  . MET B 2 399 ? -0.755  -121.543 -35.186 1.00 28.14 ? 399  MET B CE  1 
ATOM   4087 N N   . THR B 2 400 ? 1.425   -125.529 -31.515 1.00 22.29 ? 400  THR B N   1 
ATOM   4088 C CA  . THR B 2 400 ? 2.115   -125.869 -30.304 1.00 21.26 ? 400  THR B CA  1 
ATOM   4089 C C   . THR B 2 400 ? 2.889   -124.690 -29.705 1.00 20.90 ? 400  THR B C   1 
ATOM   4090 O O   . THR B 2 400 ? 3.158   -124.679 -28.512 1.00 21.46 ? 400  THR B O   1 
ATOM   4091 C CB  . THR B 2 400 ? 3.076   -127.065 -30.519 1.00 21.16 ? 400  THR B CB  1 
ATOM   4092 O OG1 . THR B 2 400 ? 4.103   -126.708 -31.471 1.00 22.59 ? 400  THR B OG1 1 
ATOM   4093 C CG2 . THR B 2 400 ? 2.294   -128.335 -31.022 1.00 23.00 ? 400  THR B CG2 1 
ATOM   4094 N N   . ARG B 2 401 ? 3.300   -123.744 -30.536 1.00 20.52 ? 401  ARG B N   1 
ATOM   4095 C CA  . ARG B 2 401 ? 4.005   -122.518 -30.048 1.00 21.16 ? 401  ARG B CA  1 
ATOM   4096 C C   . ARG B 2 401 ? 3.408   -121.311 -30.736 1.00 21.92 ? 401  ARG B C   1 
ATOM   4097 O O   . ARG B 2 401 ? 3.386   -121.228 -31.955 1.00 22.13 ? 401  ARG B O   1 
ATOM   4098 C CB  . ARG B 2 401 ? 5.497   -122.594 -30.326 1.00 20.89 ? 401  ARG B CB  1 
ATOM   4099 C CG  . ARG B 2 401 ? 6.165   -123.713 -29.509 1.00 23.93 ? 401  ARG B CG  1 
ATOM   4100 C CD  . ARG B 2 401 ? 7.372   -124.340 -30.168 1.00 31.78 ? 401  ARG B CD  1 
ATOM   4101 N NE  . ARG B 2 401 ? 6.887   -125.184 -31.225 1.00 37.84 ? 401  ARG B NE  1 
ATOM   4102 C CZ  . ARG B 2 401 ? 7.605   -126.085 -31.871 1.00 37.32 ? 401  ARG B CZ  1 
ATOM   4103 N NH1 . ARG B 2 401 ? 8.876   -126.279 -31.576 1.00 39.81 ? 401  ARG B NH1 1 
ATOM   4104 N NH2 . ARG B 2 401 ? 7.038   -126.774 -32.828 1.00 35.38 ? 401  ARG B NH2 1 
ATOM   4105 N N   . PHE B 2 402 ? 2.880   -120.377 -29.961 1.00 23.20 ? 402  PHE B N   1 
ATOM   4106 C CA  . PHE B 2 402 ? 2.193   -119.240 -30.560 1.00 22.76 ? 402  PHE B CA  1 
ATOM   4107 C C   . PHE B 2 402 ? 2.669   -117.978 -29.829 1.00 23.23 ? 402  PHE B C   1 
ATOM   4108 O O   . PHE B 2 402 ? 2.343   -117.766 -28.661 1.00 23.24 ? 402  PHE B O   1 
ATOM   4109 C CB  . PHE B 2 402 ? 0.665   -119.379 -30.480 1.00 22.67 ? 402  PHE B CB  1 
ATOM   4110 C CG  . PHE B 2 402 ? -0.069  -118.331 -31.273 1.00 24.07 ? 402  PHE B CG  1 
ATOM   4111 C CD1 . PHE B 2 402 ? -0.182  -118.463 -32.672 1.00 24.54 ? 402  PHE B CD1 1 
ATOM   4112 C CD2 . PHE B 2 402 ? -0.633  -117.218 -30.650 1.00 24.18 ? 402  PHE B CD2 1 
ATOM   4113 C CE1 . PHE B 2 402 ? -0.878  -117.491 -33.423 1.00 24.14 ? 402  PHE B CE1 1 
ATOM   4114 C CE2 . PHE B 2 402 ? -1.311  -116.232 -31.409 1.00 26.11 ? 402  PHE B CE2 1 
ATOM   4115 C CZ  . PHE B 2 402 ? -1.425  -116.387 -32.794 1.00 24.31 ? 402  PHE B CZ  1 
ATOM   4116 N N   . ARG B 2 403 ? 3.447   -117.167 -30.535 1.00 22.55 ? 403  ARG B N   1 
ATOM   4117 C CA  . ARG B 2 403 ? 4.109   -115.991 -29.943 1.00 22.92 ? 403  ARG B CA  1 
ATOM   4118 C C   . ARG B 2 403 ? 3.726   -114.777 -30.803 1.00 23.29 ? 403  ARG B C   1 
ATOM   4119 O O   . ARG B 2 403 ? 4.075   -114.664 -32.006 1.00 22.33 ? 403  ARG B O   1 
ATOM   4120 C CB  . ARG B 2 403 ? 5.615   -116.203 -29.898 1.00 22.43 ? 403  ARG B CB  1 
ATOM   4121 C CG  . ARG B 2 403 ? 6.027   -117.320 -28.931 1.00 25.19 ? 403  ARG B CG  1 
ATOM   4122 C CD  . ARG B 2 403 ? 7.475   -117.831 -29.151 1.00 23.44 ? 403  ARG B CD  1 
ATOM   4123 N NE  . ARG B 2 403 ? 8.433   -116.713 -28.899 1.00 22.31 ? 403  ARG B NE  1 
ATOM   4124 C CZ  . ARG B 2 403 ? 9.733   -116.823 -29.084 1.00 25.78 ? 403  ARG B CZ  1 
ATOM   4125 N NH1 . ARG B 2 403 ? 10.229  -117.992 -29.538 1.00 23.08 ? 403  ARG B NH1 1 
ATOM   4126 N NH2 . ARG B 2 403 ? 10.544  -115.794 -28.796 1.00 21.61 ? 403  ARG B NH2 1 
ATOM   4127 N N   . LEU B 2 404 ? 2.944   -113.899 -30.206 1.00 22.83 ? 404  LEU B N   1 
ATOM   4128 C CA  . LEU B 2 404 ? 2.420   -112.756 -30.942 1.00 23.67 ? 404  LEU B CA  1 
ATOM   4129 C C   . LEU B 2 404 ? 2.786   -111.462 -30.238 1.00 23.71 ? 404  LEU B C   1 
ATOM   4130 O O   . LEU B 2 404 ? 2.387   -111.225 -29.080 1.00 23.62 ? 404  LEU B O   1 
ATOM   4131 C CB  . LEU B 2 404 ? 0.900   -112.871 -31.083 1.00 23.96 ? 404  LEU B CB  1 
ATOM   4132 C CG  . LEU B 2 404 ? 0.245   -111.626 -31.739 1.00 27.98 ? 404  LEU B CG  1 
ATOM   4133 C CD1 . LEU B 2 404 ? 0.654   -111.589 -33.229 1.00 28.94 ? 404  LEU B CD1 1 
ATOM   4134 C CD2 . LEU B 2 404 ? -1.207  -111.693 -31.634 1.00 30.03 ? 404  LEU B CD2 1 
ATOM   4135 N N   . CYS B 2 405 ? 3.528   -110.629 -30.950 1.00 24.18 ? 405  CYS B N   1 
ATOM   4136 C CA  . CYS B 2 405 ? 3.995   -109.354 -30.434 1.00 23.78 ? 405  CYS B CA  1 
ATOM   4137 C C   . CYS B 2 405 ? 3.406   -108.227 -31.265 1.00 24.08 ? 405  CYS B C   1 
ATOM   4138 O O   . CYS B 2 405 ? 3.797   -107.997 -32.401 1.00 23.65 ? 405  CYS B O   1 
ATOM   4139 C CB  . CYS B 2 405 ? 5.519   -109.287 -30.457 1.00 24.01 ? 405  CYS B CB  1 
ATOM   4140 S SG  . CYS B 2 405 ? 6.114   -107.641 -29.970 1.00 27.84 ? 405  CYS B SG  1 
ATOM   4141 N N   . ILE B 2 406 ? 2.427   -107.550 -30.694 1.00 23.60 ? 406  ILE B N   1 
ATOM   4142 C CA  . ILE B 2 406 ? 1.925   -106.291 -31.249 1.00 23.64 ? 406  ILE B CA  1 
ATOM   4143 C C   . ILE B 2 406 ? 2.853   -105.220 -30.674 1.00 23.98 ? 406  ILE B C   1 
ATOM   4144 O O   . ILE B 2 406 ? 3.093   -105.161 -29.456 1.00 24.51 ? 406  ILE B O   1 
ATOM   4145 C CB  . ILE B 2 406 ? 0.444   -106.065 -30.857 1.00 23.29 ? 406  ILE B CB  1 
ATOM   4146 C CG1 . ILE B 2 406 ? -0.442  -107.230 -31.356 1.00 25.85 ? 406  ILE B CG1 1 
ATOM   4147 C CG2 . ILE B 2 406 ? -0.066  -104.654 -31.326 1.00 21.62 ? 406  ILE B CG2 1 
ATOM   4148 C CD1 . ILE B 2 406 ? -1.751  -107.436 -30.470 1.00 25.23 ? 406  ILE B CD1 1 
ATOM   4149 N N   . ILE B 2 407 ? 3.406   -104.414 -31.560 1.00 23.76 ? 407  ILE B N   1 
ATOM   4150 C CA  . ILE B 2 407 ? 4.473   -103.479 -31.247 1.00 25.86 ? 407  ILE B CA  1 
ATOM   4151 C C   . ILE B 2 407 ? 4.058   -102.425 -30.169 1.00 26.01 ? 407  ILE B C   1 
ATOM   4152 O O   . ILE B 2 407 ? 4.791   -102.198 -29.190 1.00 25.65 ? 407  ILE B O   1 
ATOM   4153 C CB  . ILE B 2 407 ? 4.967   -102.835 -32.564 1.00 26.25 ? 407  ILE B CB  1 
ATOM   4154 C CG1 . ILE B 2 407 ? 5.690   -103.893 -33.415 1.00 29.17 ? 407  ILE B CG1 1 
ATOM   4155 C CG2 . ILE B 2 407 ? 5.915   -101.663 -32.338 1.00 28.94 ? 407  ILE B CG2 1 
ATOM   4156 C CD1 . ILE B 2 407 ? 6.753   -104.672 -32.650 1.00 32.54 ? 407  ILE B CD1 1 
ATOM   4157 N N   . GLU B 2 408 ? 2.890   -101.829 -30.332 1.00 25.67 ? 408  GLU B N   1 
ATOM   4158 C CA  . GLU B 2 408 ? 2.439   -100.850 -29.342 1.00 25.80 ? 408  GLU B CA  1 
ATOM   4159 C C   . GLU B 2 408 ? 1.840   -101.504 -28.103 1.00 25.37 ? 408  GLU B C   1 
ATOM   4160 O O   . GLU B 2 408 ? 0.899   -102.332 -28.199 1.00 23.96 ? 408  GLU B O   1 
ATOM   4161 C CB  . GLU B 2 408 ? 1.465   -99.864  -29.952 1.00 27.07 ? 408  GLU B CB  1 
ATOM   4162 C CG  . GLU B 2 408 ? 1.021   -98.765  -28.971 1.00 30.37 ? 408  GLU B CG  1 
ATOM   4163 C CD  . GLU B 2 408 ? 2.088   -97.674  -28.695 1.00 39.98 ? 408  GLU B CD  1 
ATOM   4164 O OE1 . GLU B 2 408 ? 3.180   -97.681  -29.343 1.00 41.24 ? 408  GLU B OE1 1 
ATOM   4165 O OE2 . GLU B 2 408 ? 1.812   -96.790  -27.822 1.00 42.01 ? 408  GLU B OE2 1 
ATOM   4166 N N   . PRO B 2 409 ? 2.405   -101.198 -26.921 1.00 25.53 ? 409  PRO B N   1 
ATOM   4167 C CA  . PRO B 2 409 ? 1.847   -101.827 -25.698 1.00 25.46 ? 409  PRO B CA  1 
ATOM   4168 C C   . PRO B 2 409 ? 0.368   -101.488 -25.527 1.00 25.62 ? 409  PRO B C   1 
ATOM   4169 O O   . PRO B 2 409 ? -0.045  -100.341 -25.822 1.00 23.70 ? 409  PRO B O   1 
ATOM   4170 C CB  . PRO B 2 409 ? 2.665   -101.172 -24.578 1.00 26.93 ? 409  PRO B CB  1 
ATOM   4171 C CG  . PRO B 2 409 ? 4.012   -100.927 -25.247 1.00 25.32 ? 409  PRO B CG  1 
ATOM   4172 C CD  . PRO B 2 409 ? 3.583   -100.366 -26.605 1.00 24.93 ? 409  PRO B CD  1 
ATOM   4173 N N   . LYS B 2 410 ? -0.418  -102.479 -25.110 1.00 24.54 ? 410  LYS B N   1 
ATOM   4174 C CA  . LYS B 2 410 ? -1.843  -102.282 -24.765 1.00 24.35 ? 410  LYS B CA  1 
ATOM   4175 C C   . LYS B 2 410 ? -2.742  -101.875 -25.937 1.00 24.34 ? 410  LYS B C   1 
ATOM   4176 O O   . LYS B 2 410 ? -3.827  -101.315 -25.711 1.00 21.93 ? 410  LYS B O   1 
ATOM   4177 C CB  . LYS B 2 410 ? -1.993  -101.264 -23.600 1.00 24.04 ? 410  LYS B CB  1 
ATOM   4178 C CG  . LYS B 2 410 ? -1.220  -101.667 -22.345 1.00 25.35 ? 410  LYS B CG  1 
ATOM   4179 C CD  . LYS B 2 410 ? -1.278  -100.575 -21.288 1.00 26.00 ? 410  LYS B CD  1 
ATOM   4180 C CE  . LYS B 2 410 ? -0.335  -100.863 -20.156 1.00 30.03 ? 410  LYS B CE  1 
ATOM   4181 N NZ  . LYS B 2 410 ? -0.445  -99.754  -19.119 1.00 32.51 ? 410  LYS B NZ  1 
ATOM   4182 N N   . ALA B 2 411 ? -2.302  -102.130 -27.167 1.00 23.58 ? 411  ALA B N   1 
ATOM   4183 C CA  . ALA B 2 411 ? -3.143  -101.835 -28.324 1.00 23.40 ? 411  ALA B CA  1 
ATOM   4184 C C   . ALA B 2 411 ? -4.352  -102.768 -28.325 1.00 22.39 ? 411  ALA B C   1 
ATOM   4185 O O   . ALA B 2 411 ? -4.198  -103.978 -28.257 1.00 21.49 ? 411  ALA B O   1 
ATOM   4186 C CB  . ALA B 2 411 ? -2.348  -101.983 -29.625 1.00 24.60 ? 411  ALA B CB  1 
ATOM   4187 N N   . PRO B 2 412 ? -5.573  -102.194 -28.371 1.00 22.24 ? 412  PRO B N   1 
ATOM   4188 C CA  . PRO B 2 412 ? -6.761  -103.041 -28.427 1.00 22.50 ? 412  PRO B CA  1 
ATOM   4189 C C   . PRO B 2 412 ? -7.021  -103.566 -29.851 1.00 22.25 ? 412  PRO B C   1 
ATOM   4190 O O   . PRO B 2 412 ? -6.331  -103.137 -30.812 1.00 23.16 ? 412  PRO B O   1 
ATOM   4191 C CB  . PRO B 2 412 ? -7.889  -102.070 -28.019 1.00 20.76 ? 412  PRO B CB  1 
ATOM   4192 C CG  . PRO B 2 412 ? -7.423  -100.724 -28.526 1.00 21.41 ? 412  PRO B CG  1 
ATOM   4193 C CD  . PRO B 2 412 ? -5.908  -100.753 -28.345 1.00 22.10 ? 412  PRO B CD  1 
ATOM   4194 N N   . ASP B 2 413 ? -8.022  -104.442 -30.002 1.00 22.02 ? 413  ASP B N   1 
ATOM   4195 C CA  . ASP B 2 413 ? -8.532  -104.816 -31.325 1.00 22.57 ? 413  ASP B CA  1 
ATOM   4196 C C   . ASP B 2 413 ? -8.778  -103.506 -32.106 1.00 23.21 ? 413  ASP B C   1 
ATOM   4197 O O   . ASP B 2 413 ? -9.480  -102.650 -31.620 1.00 22.52 ? 413  ASP B O   1 
ATOM   4198 C CB  . ASP B 2 413 ? -9.855  -105.568 -31.109 1.00 23.82 ? 413  ASP B CB  1 
ATOM   4199 C CG  . ASP B 2 413 ? -10.547 -105.986 -32.418 1.00 23.28 ? 413  ASP B CG  1 
ATOM   4200 O OD1 . ASP B 2 413 ? -10.715 -105.163 -33.347 1.00 21.39 ? 413  ASP B OD1 1 
ATOM   4201 O OD2 . ASP B 2 413 ? -10.974 -107.171 -32.474 1.00 23.26 ? 413  ASP B OD2 1 
ATOM   4202 N N   . TYR B 2 414 ? -8.207  -103.317 -33.311 1.00 23.18 ? 414  TYR B N   1 
ATOM   4203 C CA  . TYR B 2 414 ? -8.321  -101.975 -33.928 1.00 23.40 ? 414  TYR B CA  1 
ATOM   4204 C C   . TYR B 2 414 ? -9.673  -101.661 -34.544 1.00 22.78 ? 414  TYR B C   1 
ATOM   4205 O O   . TYR B 2 414 ? -10.009 -100.478 -34.809 1.00 22.44 ? 414  TYR B O   1 
ATOM   4206 C CB  . TYR B 2 414 ? -7.205  -101.762 -34.984 1.00 24.27 ? 414  TYR B CB  1 
ATOM   4207 C CG  . TYR B 2 414 ? -7.373  -102.539 -36.248 1.00 24.85 ? 414  TYR B CG  1 
ATOM   4208 C CD1 . TYR B 2 414 ? -7.948  -101.947 -37.387 1.00 26.40 ? 414  TYR B CD1 1 
ATOM   4209 C CD2 . TYR B 2 414 ? -6.910  -103.856 -36.335 1.00 25.69 ? 414  TYR B CD2 1 
ATOM   4210 C CE1 . TYR B 2 414 ? -8.075  -102.663 -38.585 1.00 26.89 ? 414  TYR B CE1 1 
ATOM   4211 C CE2 . TYR B 2 414 ? -7.031  -104.583 -37.527 1.00 25.50 ? 414  TYR B CE2 1 
ATOM   4212 C CZ  . TYR B 2 414 ? -7.634  -103.981 -38.626 1.00 24.86 ? 414  TYR B CZ  1 
ATOM   4213 O OH  . TYR B 2 414 ? -7.747  -104.703 -39.786 1.00 26.29 ? 414  TYR B OH  1 
ATOM   4214 N N   . LEU B 2 415 ? -10.448 -102.712 -34.793 1.00 22.63 ? 415  LEU B N   1 
ATOM   4215 C CA  . LEU B 2 415 ? -11.805 -102.564 -35.349 1.00 22.96 ? 415  LEU B CA  1 
ATOM   4216 C C   . LEU B 2 415 ? -12.881 -102.358 -34.284 1.00 22.99 ? 415  LEU B C   1 
ATOM   4217 O O   . LEU B 2 415 ? -13.793 -101.565 -34.477 1.00 24.02 ? 415  LEU B O   1 
ATOM   4218 C CB  . LEU B 2 415 ? -12.150 -103.774 -36.204 1.00 22.89 ? 415  LEU B CB  1 
ATOM   4219 C CG  . LEU B 2 415 ? -11.369 -103.878 -37.514 1.00 22.74 ? 415  LEU B CG  1 
ATOM   4220 C CD1 . LEU B 2 415 ? -11.747 -105.166 -38.208 1.00 24.73 ? 415  LEU B CD1 1 
ATOM   4221 C CD2 . LEU B 2 415 ? -11.632 -102.672 -38.412 1.00 25.03 ? 415  LEU B CD2 1 
ATOM   4222 N N   . THR B 2 416 ? -12.778 -103.058 -33.153 1.00 22.83 ? 416  THR B N   1 
ATOM   4223 C CA  . THR B 2 416 ? -13.840 -102.994 -32.127 1.00 22.49 ? 416  THR B CA  1 
ATOM   4224 C C   . THR B 2 416 ? -13.394 -102.240 -30.887 1.00 22.32 ? 416  THR B C   1 
ATOM   4225 O O   . THR B 2 416 ? -14.230 -101.850 -30.070 1.00 21.39 ? 416  THR B O   1 
ATOM   4226 C CB  . THR B 2 416 ? -14.237 -104.401 -31.680 1.00 22.48 ? 416  THR B CB  1 
ATOM   4227 O OG1 . THR B 2 416 ? -13.151 -104.949 -30.932 1.00 22.76 ? 416  THR B OG1 1 
ATOM   4228 C CG2 . THR B 2 416 ? -14.491 -105.316 -32.921 1.00 24.84 ? 416  THR B CG2 1 
ATOM   4229 N N   . LEU B 2 417 ? -12.067 -102.099 -30.727 1.00 21.47 ? 417  LEU B N   1 
ATOM   4230 C CA  . LEU B 2 417 ? -11.451 -101.442 -29.566 1.00 21.66 ? 417  LEU B CA  1 
ATOM   4231 C C   . LEU B 2 417 ? -11.513 -102.206 -28.274 1.00 23.11 ? 417  LEU B C   1 
ATOM   4232 O O   . LEU B 2 417 ? -11.195 -101.674 -27.206 1.00 23.42 ? 417  LEU B O   1 
ATOM   4233 C CB  . LEU B 2 417 ? -11.996 -100.012 -29.352 1.00 20.57 ? 417  LEU B CB  1 
ATOM   4234 C CG  . LEU B 2 417 ? -11.838 -99.141  -30.590 1.00 22.56 ? 417  LEU B CG  1 
ATOM   4235 C CD1 . LEU B 2 417 ? -12.391 -97.767  -30.267 1.00 16.66 ? 417  LEU B CD1 1 
ATOM   4236 C CD2 . LEU B 2 417 ? -10.385 -99.017  -31.008 1.00 19.91 ? 417  LEU B CD2 1 
ATOM   4237 N N   . GLU B 2 418 ? -11.871 -103.478 -28.382 1.00 23.04 ? 418  GLU B N   1 
ATOM   4238 C CA  . GLU B 2 418 ? -11.978 -104.348 -27.234 1.00 24.21 ? 418  GLU B CA  1 
ATOM   4239 C C   . GLU B 2 418 ? -10.602 -104.969 -26.895 1.00 22.63 ? 418  GLU B C   1 
ATOM   4240 O O   . GLU B 2 418 ? -9.698  -105.018 -27.754 1.00 22.56 ? 418  GLU B O   1 
ATOM   4241 C CB  . GLU B 2 418 ? -12.991 -105.453 -27.541 1.00 23.12 ? 418  GLU B CB  1 
ATOM   4242 C CG  . GLU B 2 418 ? -14.384 -104.901 -27.798 1.00 26.44 ? 418  GLU B CG  1 
ATOM   4243 C CD  . GLU B 2 418 ? -15.452 -105.975 -28.016 1.00 29.76 ? 418  GLU B CD  1 
ATOM   4244 O OE1 . GLU B 2 418 ? -16.666 -105.592 -28.029 1.00 35.82 ? 418  GLU B OE1 1 
ATOM   4245 O OE2 . GLU B 2 418 ? -15.109 -107.185 -28.180 1.00 33.51 ? 418  GLU B OE2 1 
ATOM   4246 N N   . PRO B 2 419 ? -10.446 -105.440 -25.658 1.00 22.47 ? 419  PRO B N   1 
ATOM   4247 C CA  . PRO B 2 419 ? -9.225  -106.160 -25.311 1.00 22.71 ? 419  PRO B CA  1 
ATOM   4248 C C   . PRO B 2 419 ? -9.137  -107.378 -26.179 1.00 22.16 ? 419  PRO B C   1 
ATOM   4249 O O   . PRO B 2 419 ? -10.151 -107.800 -26.739 1.00 23.03 ? 419  PRO B O   1 
ATOM   4250 C CB  . PRO B 2 419 ? -9.456  -106.610 -23.843 1.00 23.03 ? 419  PRO B CB  1 
ATOM   4251 C CG  . PRO B 2 419 ? -10.640 -105.959 -23.401 1.00 22.96 ? 419  PRO B CG  1 
ATOM   4252 C CD  . PRO B 2 419 ? -11.376 -105.305 -24.518 1.00 23.09 ? 419  PRO B CD  1 
ATOM   4253 N N   . LEU B 2 420 ? -7.944  -107.965 -26.258 1.00 22.63 ? 420  LEU B N   1 
ATOM   4254 C CA  . LEU B 2 420 ? -7.741  -109.173 -27.044 1.00 23.14 ? 420  LEU B CA  1 
ATOM   4255 C C   . LEU B 2 420 ? -7.966  -110.467 -26.232 1.00 23.86 ? 420  LEU B C   1 
ATOM   4256 O O   . LEU B 2 420 ? -7.571  -111.553 -26.679 1.00 23.01 ? 420  LEU B O   1 
ATOM   4257 C CB  . LEU B 2 420 ? -6.350  -109.167 -27.654 1.00 22.50 ? 420  LEU B CB  1 
ATOM   4258 C CG  . LEU B 2 420 ? -6.151  -108.085 -28.731 1.00 23.56 ? 420  LEU B CG  1 
ATOM   4259 C CD1 . LEU B 2 420 ? -4.747  -108.272 -29.260 1.00 26.20 ? 420  LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 2 420 ? -7.138  -108.247 -29.902 1.00 25.89 ? 420  LEU B CD2 1 
ATOM   4261 N N   . ASP B 2 421 ? -8.636  -110.345 -25.073 1.00 23.01 ? 421  ASP B N   1 
ATOM   4262 C CA  . ASP B 2 421 ? -8.952  -111.504 -24.213 1.00 23.29 ? 421  ASP B CA  1 
ATOM   4263 C C   . ASP B 2 421 ? -9.585  -112.677 -24.982 1.00 23.97 ? 421  ASP B C   1 
ATOM   4264 O O   . ASP B 2 421 ? -9.103  -113.811 -24.899 1.00 25.08 ? 421  ASP B O   1 
ATOM   4265 C CB  . ASP B 2 421 ? -9.918  -111.103 -23.075 1.00 22.14 ? 421  ASP B CB  1 
ATOM   4266 C CG  . ASP B 2 421 ? -9.384  -109.975 -22.206 1.00 24.16 ? 421  ASP B CG  1 
ATOM   4267 O OD1 . ASP B 2 421 ? -8.168  -109.756 -22.161 1.00 23.89 ? 421  ASP B OD1 1 
ATOM   4268 O OD2 . ASP B 2 421 ? -10.200 -109.308 -21.530 1.00 25.18 ? 421  ASP B OD2 1 
ATOM   4269 N N   . ILE B 2 422 ? -10.652 -112.411 -25.731 1.00 24.17 ? 422  ILE B N   1 
ATOM   4270 C CA  . ILE B 2 422 ? -11.372 -113.529 -26.381 1.00 25.89 ? 422  ILE B CA  1 
ATOM   4271 C C   . ILE B 2 422 ? -10.550 -114.179 -27.502 1.00 25.76 ? 422  ILE B C   1 
ATOM   4272 O O   . ILE B 2 422 ? -10.682 -115.390 -27.785 1.00 26.32 ? 422  ILE B O   1 
ATOM   4273 C CB  . ILE B 2 422 ? -12.830 -113.146 -26.810 1.00 26.03 ? 422  ILE B CB  1 
ATOM   4274 C CG1 . ILE B 2 422 ? -12.851 -112.187 -28.009 1.00 26.41 ? 422  ILE B CG1 1 
ATOM   4275 C CG2 . ILE B 2 422 ? -13.602 -112.621 -25.626 1.00 26.88 ? 422  ILE B CG2 1 
ATOM   4276 C CD1 . ILE B 2 422 ? -14.267 -111.854 -28.554 1.00 28.05 ? 422  ILE B CD1 1 
ATOM   4277 N N   . GLY B 2 423 ? -9.696  -113.378 -28.136 1.00 25.18 ? 423  GLY B N   1 
ATOM   4278 C CA  . GLY B 2 423 ? -8.866  -113.863 -29.242 1.00 24.21 ? 423  GLY B CA  1 
ATOM   4279 C C   . GLY B 2 423 ? -7.826  -114.818 -28.700 1.00 24.58 ? 423  GLY B C   1 
ATOM   4280 O O   . GLY B 2 423 ? -7.685  -115.960 -29.193 1.00 24.72 ? 423  GLY B O   1 
ATOM   4281 N N   . PHE B 2 424 ? -7.103  -114.393 -27.661 1.00 23.63 ? 424  PHE B N   1 
ATOM   4282 C CA  . PHE B 2 424 ? -6.134  -115.307 -27.061 1.00 24.41 ? 424  PHE B CA  1 
ATOM   4283 C C   . PHE B 2 424 ? -6.833  -116.457 -26.321 1.00 24.71 ? 424  PHE B C   1 
ATOM   4284 O O   . PHE B 2 424 ? -6.302  -117.577 -26.236 1.00 24.30 ? 424  PHE B O   1 
ATOM   4285 C CB  . PHE B 2 424 ? -5.165  -114.555 -26.147 1.00 24.35 ? 424  PHE B CB  1 
ATOM   4286 C CG  . PHE B 2 424 ? -4.114  -113.794 -26.891 1.00 25.49 ? 424  PHE B CG  1 
ATOM   4287 C CD1 . PHE B 2 424 ? -4.203  -112.418 -27.022 1.00 25.29 ? 424  PHE B CD1 1 
ATOM   4288 C CD2 . PHE B 2 424 ? -3.006  -114.473 -27.451 1.00 25.63 ? 424  PHE B CD2 1 
ATOM   4289 C CE1 . PHE B 2 424 ? -3.220  -111.693 -27.723 1.00 26.01 ? 424  PHE B CE1 1 
ATOM   4290 C CE2 . PHE B 2 424 ? -1.993  -113.758 -28.134 1.00 28.55 ? 424  PHE B CE2 1 
ATOM   4291 C CZ  . PHE B 2 424 ? -2.091  -112.382 -28.264 1.00 26.44 ? 424  PHE B CZ  1 
ATOM   4292 N N   . GLY B 2 425 ? -8.031  -116.193 -25.815 1.00 24.03 ? 425  GLY B N   1 
ATOM   4293 C CA  . GLY B 2 425 ? -8.844  -117.265 -25.211 1.00 24.28 ? 425  GLY B CA  1 
ATOM   4294 C C   . GLY B 2 425 ? -9.140  -118.363 -26.216 1.00 24.72 ? 425  GLY B C   1 
ATOM   4295 O O   . GLY B 2 425 ? -9.079  -119.543 -25.867 1.00 24.75 ? 425  GLY B O   1 
ATOM   4296 N N   . ALA B 2 426 ? -9.454  -117.981 -27.461 1.00 23.85 ? 426  ALA B N   1 
ATOM   4297 C CA  . ALA B 2 426 ? -9.700  -118.952 -28.507 1.00 23.51 ? 426  ALA B CA  1 
ATOM   4298 C C   . ALA B 2 426 ? -8.453  -119.778 -28.808 1.00 23.19 ? 426  ALA B C   1 
ATOM   4299 O O   . ALA B 2 426 ? -8.542  -120.980 -29.009 1.00 23.81 ? 426  ALA B O   1 
ATOM   4300 C CB  . ALA B 2 426 ? -10.260 -118.271 -29.786 1.00 22.76 ? 426  ALA B CB  1 
ATOM   4301 N N   . ILE B 2 427 ? -7.278  -119.153 -28.822 1.00 22.92 ? 427  ILE B N   1 
ATOM   4302 C CA  . ILE B 2 427 ? -6.028  -119.908 -29.033 1.00 22.78 ? 427  ILE B CA  1 
ATOM   4303 C C   . ILE B 2 427 ? -5.829  -120.985 -27.971 1.00 23.58 ? 427  ILE B C   1 
ATOM   4304 O O   . ILE B 2 427 ? -5.510  -122.123 -28.292 1.00 23.74 ? 427  ILE B O   1 
ATOM   4305 C CB  . ILE B 2 427 ? -4.808  -118.926 -29.025 1.00 21.35 ? 427  ILE B CB  1 
ATOM   4306 C CG1 . ILE B 2 427 ? -4.904  -117.972 -30.230 1.00 22.65 ? 427  ILE B CG1 1 
ATOM   4307 C CG2 . ILE B 2 427 ? -3.444  -119.674 -28.996 1.00 22.08 ? 427  ILE B CG2 1 
ATOM   4308 C CD1 . ILE B 2 427 ? -4.435  -118.621 -31.553 1.00 23.51 ? 427  ILE B CD1 1 
ATOM   4309 N N   . VAL B 2 428 ? -5.996  -120.634 -26.696 1.00 23.04 ? 428  VAL B N   1 
ATOM   4310 C CA  . VAL B 2 428 ? -5.760  -121.643 -25.645 1.00 22.73 ? 428  VAL B CA  1 
ATOM   4311 C C   . VAL B 2 428 ? -6.884  -122.678 -25.584 1.00 23.23 ? 428  VAL B C   1 
ATOM   4312 O O   . VAL B 2 428 ? -6.661  -123.860 -25.238 1.00 22.49 ? 428  VAL B O   1 
ATOM   4313 C CB  . VAL B 2 428 ? -5.456  -120.999 -24.228 1.00 22.52 ? 428  VAL B CB  1 
ATOM   4314 C CG1 . VAL B 2 428 ? -4.100  -120.250 -24.265 1.00 22.64 ? 428  VAL B CG1 1 
ATOM   4315 C CG2 . VAL B 2 428 ? -6.628  -120.121 -23.661 1.00 22.49 ? 428  VAL B CG2 1 
ATOM   4316 N N   . GLU B 2 429 ? -8.081  -122.248 -25.958 1.00 23.48 ? 429  GLU B N   1 
ATOM   4317 C CA  . GLU B 2 429 ? -9.223  -123.161 -25.974 1.00 24.22 ? 429  GLU B CA  1 
ATOM   4318 C C   . GLU B 2 429 ? -9.075  -124.190 -27.088 1.00 24.62 ? 429  GLU B C   1 
ATOM   4319 O O   . GLU B 2 429 ? -9.323  -125.386 -26.863 1.00 25.08 ? 429  GLU B O   1 
ATOM   4320 C CB  . GLU B 2 429 ? -10.535 -122.390 -26.153 1.00 23.47 ? 429  GLU B CB  1 
ATOM   4321 C CG  . GLU B 2 429 ? -11.757 -123.285 -26.204 1.00 26.18 ? 429  GLU B CG  1 
ATOM   4322 C CD  . GLU B 2 429 ? -13.060 -122.511 -26.472 1.00 27.67 ? 429  GLU B CD  1 
ATOM   4323 O OE1 . GLU B 2 429 ? -13.017 -121.256 -26.465 1.00 29.54 ? 429  GLU B OE1 1 
ATOM   4324 O OE2 . GLU B 2 429 ? -14.122 -123.149 -26.673 1.00 31.06 ? 429  GLU B OE2 1 
ATOM   4325 N N   . HIS B 2 430 ? -8.723  -123.732 -28.290 1.00 23.70 ? 430  HIS B N   1 
ATOM   4326 C CA  . HIS B 2 430 ? -8.702  -124.615 -29.474 1.00 25.44 ? 430  HIS B CA  1 
ATOM   4327 C C   . HIS B 2 430 ? -7.413  -125.408 -29.694 1.00 24.75 ? 430  HIS B C   1 
ATOM   4328 O O   . HIS B 2 430 ? -7.437  -126.468 -30.320 1.00 25.33 ? 430  HIS B O   1 
ATOM   4329 C CB  . HIS B 2 430 ? -9.026  -123.830 -30.732 1.00 25.86 ? 430  HIS B CB  1 
ATOM   4330 C CG  . HIS B 2 430 ? -10.459 -123.420 -30.814 1.00 29.45 ? 430  HIS B CG  1 
ATOM   4331 N ND1 . HIS B 2 430 ? -11.433 -124.234 -31.347 1.00 32.08 ? 430  HIS B ND1 1 
ATOM   4332 C CD2 . HIS B 2 430 ? -11.090 -122.299 -30.394 1.00 31.48 ? 430  HIS B CD2 1 
ATOM   4333 C CE1 . HIS B 2 430 ? -12.601 -123.621 -31.270 1.00 34.09 ? 430  HIS B CE1 1 
ATOM   4334 N NE2 . HIS B 2 430 ? -12.420 -122.449 -30.690 1.00 32.65 ? 430  HIS B NE2 1 
ATOM   4335 N N   . CYS B 2 431 ? -6.304  -124.864 -29.237 1.00 23.31 ? 431  CYS B N   1 
ATOM   4336 C CA  . CYS B 2 431 ? -4.972  -125.452 -29.438 1.00 23.97 ? 431  CYS B CA  1 
ATOM   4337 C C   . CYS B 2 431 ? -4.583  -126.234 -28.192 1.00 22.81 ? 431  CYS B C   1 
ATOM   4338 O O   . CYS B 2 431 ? -3.840  -125.751 -27.352 1.00 22.92 ? 431  CYS B O   1 
ATOM   4339 C CB  . CYS B 2 431 ? -3.953  -124.354 -29.759 1.00 23.34 ? 431  CYS B CB  1 
ATOM   4340 S SG  . CYS B 2 431 ? -4.517  -123.232 -31.107 1.00 25.13 ? 431  CYS B SG  1 
ATOM   4341 N N   . LYS B 2 432 ? -5.120  -127.442 -28.056 1.00 23.45 ? 432  LYS B N   1 
ATOM   4342 C CA  . LYS B 2 432 ? -4.972  -128.199 -26.803 1.00 24.29 ? 432  LYS B CA  1 
ATOM   4343 C C   . LYS B 2 432 ? -3.563  -128.596 -26.460 1.00 24.25 ? 432  LYS B C   1 
ATOM   4344 O O   . LYS B 2 432 ? -3.261  -128.835 -25.283 1.00 25.64 ? 432  LYS B O   1 
ATOM   4345 C CB  . LYS B 2 432 ? -5.806  -129.492 -26.818 1.00 25.17 ? 432  LYS B CB  1 
ATOM   4346 C CG  . LYS B 2 432 ? -7.159  -129.337 -27.366 1.00 30.92 ? 432  LYS B CG  1 
ATOM   4347 C CD  . LYS B 2 432 ? -7.993  -128.353 -26.605 1.00 36.26 ? 432  LYS B CD  1 
ATOM   4348 C CE  . LYS B 2 432 ? -9.410  -128.596 -27.036 1.00 39.51 ? 432  LYS B CE  1 
ATOM   4349 N NZ  . LYS B 2 432 ? -9.887  -129.877 -26.417 1.00 40.35 ? 432  LYS B NZ  1 
ATOM   4350 N N   . ASP B 2 433 ? -2.702  -128.711 -27.471 1.00 23.56 ? 433  ASP B N   1 
ATOM   4351 C CA  . ASP B 2 433 ? -1.315  -129.081 -27.204 1.00 23.19 ? 433  ASP B CA  1 
ATOM   4352 C C   . ASP B 2 433 ? -0.349  -127.892 -27.263 1.00 22.59 ? 433  ASP B C   1 
ATOM   4353 O O   . ASP B 2 433 ? 0.851   -128.071 -27.445 1.00 22.83 ? 433  ASP B O   1 
ATOM   4354 C CB  . ASP B 2 433 ? -0.876  -130.211 -28.098 1.00 24.04 ? 433  ASP B CB  1 
ATOM   4355 C CG  . ASP B 2 433 ? -1.711  -131.473 -27.871 1.00 27.85 ? 433  ASP B CG  1 
ATOM   4356 O OD1 . ASP B 2 433 ? -2.202  -132.020 -28.868 1.00 29.84 ? 433  ASP B OD1 1 
ATOM   4357 O OD2 . ASP B 2 433 ? -1.884  -131.889 -26.698 1.00 31.25 ? 433  ASP B OD2 1 
ATOM   4358 N N   . LEU B 2 434 ? -0.878  -126.696 -27.042 1.00 21.18 ? 434  LEU B N   1 
ATOM   4359 C CA  . LEU B 2 434 ? -0.051  -125.480 -27.045 1.00 21.48 ? 434  LEU B CA  1 
ATOM   4360 C C   . LEU B 2 434 ? 0.930   -125.539 -25.864 1.00 21.96 ? 434  LEU B C   1 
ATOM   4361 O O   . LEU B 2 434 ? 0.501   -125.575 -24.689 1.00 22.23 ? 434  LEU B O   1 
ATOM   4362 C CB  . LEU B 2 434 ? -0.942  -124.235 -26.931 1.00 21.68 ? 434  LEU B CB  1 
ATOM   4363 C CG  . LEU B 2 434 ? -0.202  -122.879 -27.119 1.00 20.46 ? 434  LEU B CG  1 
ATOM   4364 C CD1 . LEU B 2 434 ? -0.044  -122.769 -28.618 1.00 22.90 ? 434  LEU B CD1 1 
ATOM   4365 C CD2 . LEU B 2 434 ? -1.112  -121.753 -26.590 1.00 23.38 ? 434  LEU B CD2 1 
ATOM   4366 N N   . ARG B 2 435 ? 2.230   -125.559 -26.163 1.00 21.70 ? 435  ARG B N   1 
ATOM   4367 C CA  . ARG B 2 435 ? 3.256   -125.611 -25.118 1.00 21.51 ? 435  ARG B CA  1 
ATOM   4368 C C   . ARG B 2 435 ? 3.874   -124.232 -24.787 1.00 22.01 ? 435  ARG B C   1 
ATOM   4369 O O   . ARG B 2 435 ? 4.505   -124.080 -23.754 1.00 22.29 ? 435  ARG B O   1 
ATOM   4370 C CB  . ARG B 2 435 ? 4.405   -126.518 -25.546 1.00 22.03 ? 435  ARG B CB  1 
ATOM   4371 C CG  . ARG B 2 435 ? 4.033   -127.895 -25.951 1.00 27.87 ? 435  ARG B CG  1 
ATOM   4372 C CD  . ARG B 2 435 ? 5.333   -128.746 -26.025 1.00 33.65 ? 435  ARG B CD  1 
ATOM   4373 N NE  . ARG B 2 435 ? 6.287   -128.304 -27.062 1.00 36.04 ? 435  ARG B NE  1 
ATOM   4374 C CZ  . ARG B 2 435 ? 6.269   -128.701 -28.343 1.00 36.69 ? 435  ARG B CZ  1 
ATOM   4375 N NH1 . ARG B 2 435 ? 5.318   -129.504 -28.807 1.00 29.70 ? 435  ARG B NH1 1 
ATOM   4376 N NH2 . ARG B 2 435 ? 7.209   -128.273 -29.177 1.00 40.23 ? 435  ARG B NH2 1 
ATOM   4377 N N   . ARG B 2 436 ? 3.676   -123.256 -25.665 1.00 22.33 ? 436  ARG B N   1 
ATOM   4378 C CA  . ARG B 2 436 ? 4.328   -121.951 -25.498 1.00 21.81 ? 436  ARG B CA  1 
ATOM   4379 C C   . ARG B 2 436 ? 3.384   -120.887 -25.983 1.00 23.11 ? 436  ARG B C   1 
ATOM   4380 O O   . ARG B 2 436 ? 2.823   -121.007 -27.085 1.00 22.98 ? 436  ARG B O   1 
ATOM   4381 C CB  . ARG B 2 436 ? 5.631   -121.855 -26.304 1.00 22.42 ? 436  ARG B CB  1 
ATOM   4382 C CG  . ARG B 2 436 ? 6.312   -120.480 -26.024 1.00 23.66 ? 436  ARG B CG  1 
ATOM   4383 C CD  . ARG B 2 436 ? 7.759   -120.507 -26.100 1.00 27.17 ? 436  ARG B CD  1 
ATOM   4384 N NE  . ARG B 2 436 ? 8.381   -119.190 -25.882 1.00 22.72 ? 436  ARG B NE  1 
ATOM   4385 C CZ  . ARG B 2 436 ? 9.651   -118.995 -26.194 1.00 23.65 ? 436  ARG B CZ  1 
ATOM   4386 N NH1 . ARG B 2 436 ? 10.321  -120.023 -26.739 1.00 23.60 ? 436  ARG B NH1 1 
ATOM   4387 N NH2 . ARG B 2 436 ? 10.223  -117.796 -25.982 1.00 20.53 ? 436  ARG B NH2 1 
ATOM   4388 N N   . LEU B 2 437 ? 3.289   -119.809 -25.199 1.00 22.10 ? 437  LEU B N   1 
ATOM   4389 C CA  . LEU B 2 437 ? 2.445   -118.698 -25.578 1.00 21.72 ? 437  LEU B CA  1 
ATOM   4390 C C   . LEU B 2 437 ? 3.144   -117.403 -25.147 1.00 21.47 ? 437  LEU B C   1 
ATOM   4391 O O   . LEU B 2 437 ? 3.750   -117.350 -24.065 1.00 22.34 ? 437  LEU B O   1 
ATOM   4392 C CB  . LEU B 2 437 ? 1.110   -118.822 -24.867 1.00 20.52 ? 437  LEU B CB  1 
ATOM   4393 C CG  . LEU B 2 437 ? 0.060   -117.700 -25.049 1.00 21.86 ? 437  LEU B CG  1 
ATOM   4394 C CD1 . LEU B 2 437 ? -0.359  -117.594 -26.512 1.00 21.31 ? 437  LEU B CD1 1 
ATOM   4395 C CD2 . LEU B 2 437 ? -1.191  -117.964 -24.163 1.00 23.14 ? 437  LEU B CD2 1 
ATOM   4396 N N   . SER B 2 438 ? 3.115   -116.404 -26.012 1.00 22.54 ? 438  SER B N   1 
ATOM   4397 C CA  . SER B 2 438 ? 3.393   -115.031 -25.572 1.00 22.79 ? 438  SER B CA  1 
ATOM   4398 C C   . SER B 2 438 ? 2.257   -114.132 -26.080 1.00 24.34 ? 438  SER B C   1 
ATOM   4399 O O   . SER B 2 438 ? 1.760   -114.328 -27.212 1.00 25.49 ? 438  SER B O   1 
ATOM   4400 C CB  . SER B 2 438 ? 4.795   -114.585 -25.986 1.00 24.26 ? 438  SER B CB  1 
ATOM   4401 O OG  . SER B 2 438 ? 4.905   -114.528 -27.392 1.00 26.90 ? 438  SER B OG  1 
ATOM   4402 N N   . LEU B 2 439 ? 1.893   -113.154 -25.227 1.00 23.55 ? 439  LEU B N   1 
ATOM   4403 C CA  . LEU B 2 439 ? 0.661   -112.357 -25.324 1.00 25.04 ? 439  LEU B CA  1 
ATOM   4404 C C   . LEU B 2 439 ? 1.063   -110.931 -25.576 1.00 22.79 ? 439  LEU B C   1 
ATOM   4405 O O   . LEU B 2 439 ? 2.147   -110.528 -25.148 1.00 22.81 ? 439  LEU B O   1 
ATOM   4406 C CB  . LEU B 2 439 ? 0.000   -112.309 -23.898 1.00 26.85 ? 439  LEU B CB  1 
ATOM   4407 C CG  . LEU B 2 439 ? -0.506  -113.626 -23.330 1.00 28.93 ? 439  LEU B CG  1 
ATOM   4408 C CD1 . LEU B 2 439 ? -0.826  -113.480 -21.829 1.00 34.16 ? 439  LEU B CD1 1 
ATOM   4409 C CD2 . LEU B 2 439 ? -1.796  -113.898 -24.103 1.00 34.25 ? 439  LEU B CD2 1 
ATOM   4410 N N   . SER B 2 440 ? 0.183   -110.150 -26.209 1.00 22.30 ? 440  SER B N   1 
ATOM   4411 C CA  . SER B 2 440 ? 0.379   -108.699 -26.203 1.00 21.93 ? 440  SER B CA  1 
ATOM   4412 C C   . SER B 2 440 ? -0.940  -108.064 -26.558 1.00 22.27 ? 440  SER B C   1 
ATOM   4413 O O   . SER B 2 440 ? -1.949  -108.756 -26.727 1.00 22.26 ? 440  SER B O   1 
ATOM   4414 C CB  . SER B 2 440 ? 1.480   -108.264 -27.221 1.00 23.08 ? 440  SER B CB  1 
ATOM   4415 O OG  . SER B 2 440 ? 1.217   -108.840 -28.493 1.00 25.87 ? 440  SER B OG  1 
ATOM   4416 N N   . GLY B 2 441 ? -0.931  -106.737 -26.689 1.00 21.93 ? 441  GLY B N   1 
ATOM   4417 C CA  . GLY B 2 441 ? -2.187  -106.022 -26.919 1.00 22.78 ? 441  GLY B CA  1 
ATOM   4418 C C   . GLY B 2 441 ? -2.877  -105.726 -25.590 1.00 22.33 ? 441  GLY B C   1 
ATOM   4419 O O   . GLY B 2 441 ? -2.403  -106.126 -24.547 1.00 22.78 ? 441  GLY B O   1 
ATOM   4420 N N   . LEU B 2 442 ? -4.044  -105.101 -25.662 1.00 22.16 ? 442  LEU B N   1 
ATOM   4421 C CA  . LEU B 2 442 ? -4.813  -104.731 -24.482 1.00 21.32 ? 442  LEU B CA  1 
ATOM   4422 C C   . LEU B 2 442 ? -5.396  -106.013 -23.897 1.00 21.77 ? 442  LEU B C   1 
ATOM   4423 O O   . LEU B 2 442 ? -6.131  -106.708 -24.594 1.00 22.24 ? 442  LEU B O   1 
ATOM   4424 C CB  . LEU B 2 442 ? -5.937  -103.753 -24.867 1.00 20.71 ? 442  LEU B CB  1 
ATOM   4425 C CG  . LEU B 2 442 ? -6.875  -103.290 -23.750 1.00 19.98 ? 442  LEU B CG  1 
ATOM   4426 C CD1 . LEU B 2 442 ? -6.075  -102.605 -22.643 1.00 20.95 ? 442  LEU B CD1 1 
ATOM   4427 C CD2 . LEU B 2 442 ? -7.984  -102.365 -24.284 1.00 20.33 ? 442  LEU B CD2 1 
ATOM   4428 N N   . LEU B 2 443 ? -5.033  -106.330 -22.639 1.00 20.90 ? 443  LEU B N   1 
ATOM   4429 C CA  . LEU B 2 443 ? -5.470  -107.562 -21.998 1.00 21.31 ? 443  LEU B CA  1 
ATOM   4430 C C   . LEU B 2 443 ? -5.878  -107.299 -20.545 1.00 21.82 ? 443  LEU B C   1 
ATOM   4431 O O   . LEU B 2 443 ? -5.204  -106.564 -19.810 1.00 21.89 ? 443  LEU B O   1 
ATOM   4432 C CB  . LEU B 2 443 ? -4.354  -108.625 -22.063 1.00 21.05 ? 443  LEU B CB  1 
ATOM   4433 C CG  . LEU B 2 443 ? -3.940  -109.049 -23.486 1.00 22.10 ? 443  LEU B CG  1 
ATOM   4434 C CD1 . LEU B 2 443 ? -2.607  -109.804 -23.365 1.00 22.33 ? 443  LEU B CD1 1 
ATOM   4435 C CD2 . LEU B 2 443 ? -4.988  -109.997 -24.093 1.00 21.35 ? 443  LEU B CD2 1 
ATOM   4436 N N   . THR B 2 444 ? -7.023  -107.854 -20.175 1.00 22.27 ? 444  THR B N   1 
ATOM   4437 C CA  . THR B 2 444 ? -7.544  -107.768 -18.811 1.00 22.79 ? 444  THR B CA  1 
ATOM   4438 C C   . THR B 2 444 ? -7.322  -109.096 -18.058 1.00 23.46 ? 444  THR B C   1 
ATOM   4439 O O   . THR B 2 444 ? -6.758  -110.041 -18.611 1.00 24.61 ? 444  THR B O   1 
ATOM   4440 C CB  . THR B 2 444 ? -9.049  -107.417 -18.802 1.00 23.22 ? 444  THR B CB  1 
ATOM   4441 O OG1 . THR B 2 444 ? -9.838  -108.576 -19.090 1.00 23.60 ? 444  THR B OG1 1 
ATOM   4442 C CG2 . THR B 2 444 ? -9.385  -106.307 -19.863 1.00 23.66 ? 444  THR B CG2 1 
ATOM   4443 N N   . ASP B 2 445 ? -7.763  -109.152 -16.806 1.00 23.32 ? 445  ASP B N   1 
ATOM   4444 C CA  . ASP B 2 445 ? -7.651  -110.353 -16.014 1.00 24.21 ? 445  ASP B CA  1 
ATOM   4445 C C   . ASP B 2 445 ? -8.359  -111.519 -16.716 1.00 24.67 ? 445  ASP B C   1 
ATOM   4446 O O   . ASP B 2 445 ? -8.019  -112.667 -16.483 1.00 24.48 ? 445  ASP B O   1 
ATOM   4447 C CB  . ASP B 2 445 ? -8.261  -110.145 -14.621 1.00 24.08 ? 445  ASP B CB  1 
ATOM   4448 C CG  . ASP B 2 445 ? -7.368  -109.377 -13.686 1.00 25.71 ? 445  ASP B CG  1 
ATOM   4449 O OD1 . ASP B 2 445 ? -7.848  -109.057 -12.578 1.00 24.85 ? 445  ASP B OD1 1 
ATOM   4450 O OD2 . ASP B 2 445 ? -6.180  -109.159 -14.011 1.00 27.01 ? 445  ASP B OD2 1 
ATOM   4451 N N   . LYS B 2 446 ? -9.351  -111.217 -17.553 1.00 25.05 ? 446  LYS B N   1 
ATOM   4452 C CA  . LYS B 2 446 ? -10.134 -112.270 -18.241 1.00 25.87 ? 446  LYS B CA  1 
ATOM   4453 C C   . LYS B 2 446 ? -9.296  -113.222 -19.127 1.00 24.76 ? 446  LYS B C   1 
ATOM   4454 O O   . LYS B 2 446 ? -9.539  -114.457 -19.151 1.00 23.87 ? 446  LYS B O   1 
ATOM   4455 C CB  . LYS B 2 446 ? -11.299 -111.674 -19.033 1.00 25.70 ? 446  LYS B CB  1 
ATOM   4456 C CG  . LYS B 2 446 ? -12.364 -112.686 -19.389 1.00 30.58 ? 446  LYS B CG  1 
ATOM   4457 C CD  . LYS B 2 446 ? -13.179 -113.042 -18.141 1.00 32.88 ? 446  LYS B CD  1 
ATOM   4458 C CE  . LYS B 2 446 ? -14.105 -114.221 -18.360 1.00 35.83 ? 446  LYS B CE  1 
ATOM   4459 N NZ  . LYS B 2 446 ? -14.974 -114.350 -17.142 1.00 32.11 ? 446  LYS B NZ  1 
ATOM   4460 N N   . VAL B 2 447 ? -8.317  -112.687 -19.860 1.00 24.67 ? 447  VAL B N   1 
ATOM   4461 C CA  . VAL B 2 447 ? -7.455  -113.568 -20.653 1.00 23.95 ? 447  VAL B CA  1 
ATOM   4462 C C   . VAL B 2 447 ? -6.716  -114.616 -19.781 1.00 24.51 ? 447  VAL B C   1 
ATOM   4463 O O   . VAL B 2 447 ? -6.600  -115.796 -20.153 1.00 23.80 ? 447  VAL B O   1 
ATOM   4464 C CB  . VAL B 2 447 ? -6.469  -112.777 -21.585 1.00 23.65 ? 447  VAL B CB  1 
ATOM   4465 C CG1 . VAL B 2 447 ? -5.295  -112.168 -20.808 1.00 20.89 ? 447  VAL B CG1 1 
ATOM   4466 C CG2 . VAL B 2 447 ? -5.922  -113.699 -22.675 1.00 24.41 ? 447  VAL B CG2 1 
ATOM   4467 N N   . PHE B 2 448 ? -6.271  -114.197 -18.594 1.00 24.40 ? 448  PHE B N   1 
ATOM   4468 C CA  . PHE B 2 448 ? -5.571  -115.068 -17.698 1.00 24.67 ? 448  PHE B CA  1 
ATOM   4469 C C   . PHE B 2 448 ? -6.521  -116.113 -17.139 1.00 24.89 ? 448  PHE B C   1 
ATOM   4470 O O   . PHE B 2 448 ? -6.123  -117.240 -16.877 1.00 24.56 ? 448  PHE B O   1 
ATOM   4471 C CB  . PHE B 2 448 ? -4.928  -114.208 -16.620 1.00 25.18 ? 448  PHE B CB  1 
ATOM   4472 C CG  . PHE B 2 448 ? -3.908  -113.281 -17.207 1.00 26.80 ? 448  PHE B CG  1 
ATOM   4473 C CD1 . PHE B 2 448 ? -4.189  -111.935 -17.402 1.00 23.52 ? 448  PHE B CD1 1 
ATOM   4474 C CD2 . PHE B 2 448 ? -2.699  -113.796 -17.664 1.00 27.35 ? 448  PHE B CD2 1 
ATOM   4475 C CE1 . PHE B 2 448 ? -3.267  -111.097 -18.015 1.00 26.74 ? 448  PHE B CE1 1 
ATOM   4476 C CE2 . PHE B 2 448 ? -1.766  -112.980 -18.281 1.00 29.92 ? 448  PHE B CE2 1 
ATOM   4477 C CZ  . PHE B 2 448 ? -2.043  -111.611 -18.447 1.00 27.31 ? 448  PHE B CZ  1 
ATOM   4478 N N   . GLU B 2 449 ? -7.792  -115.740 -17.002 1.00 24.94 ? 449  GLU B N   1 
ATOM   4479 C CA  . GLU B 2 449 ? -8.831  -116.715 -16.613 1.00 26.25 ? 449  GLU B CA  1 
ATOM   4480 C C   . GLU B 2 449 ? -8.933  -117.798 -17.686 1.00 25.64 ? 449  GLU B C   1 
ATOM   4481 O O   . GLU B 2 449 ? -8.919  -119.000 -17.367 1.00 27.12 ? 449  GLU B O   1 
ATOM   4482 C CB  . GLU B 2 449 ? -10.178 -116.026 -16.383 1.00 25.99 ? 449  GLU B CB  1 
ATOM   4483 C CG  . GLU B 2 449 ? -11.169 -116.921 -15.700 1.00 30.43 ? 449  GLU B CG  1 
ATOM   4484 C CD  . GLU B 2 449 ? -12.584 -116.401 -15.813 1.00 34.06 ? 449  GLU B CD  1 
ATOM   4485 O OE1 . GLU B 2 449 ? -12.820 -115.202 -15.538 1.00 31.99 ? 449  GLU B OE1 1 
ATOM   4486 O OE2 . GLU B 2 449 ? -13.454 -117.213 -16.187 1.00 38.41 ? 449  GLU B OE2 1 
ATOM   4487 N N   . TYR B 2 450 ? -9.028  -117.383 -18.952 1.00 24.44 ? 450  TYR B N   1 
ATOM   4488 C CA  . TYR B 2 450 ? -9.036  -118.342 -20.056 1.00 24.24 ? 450  TYR B CA  1 
ATOM   4489 C C   . TYR B 2 450 ? -7.786  -119.211 -20.085 1.00 23.09 ? 450  TYR B C   1 
ATOM   4490 O O   . TYR B 2 450 ? -7.876  -120.412 -20.277 1.00 22.92 ? 450  TYR B O   1 
ATOM   4491 C CB  . TYR B 2 450 ? -9.133  -117.616 -21.415 1.00 24.36 ? 450  TYR B CB  1 
ATOM   4492 C CG  . TYR B 2 450 ? -10.400 -116.805 -21.587 1.00 24.12 ? 450  TYR B CG  1 
ATOM   4493 C CD1 . TYR B 2 450 ? -10.389 -115.645 -22.346 1.00 21.63 ? 450  TYR B CD1 1 
ATOM   4494 C CD2 . TYR B 2 450 ? -11.602 -117.199 -20.981 1.00 25.14 ? 450  TYR B CD2 1 
ATOM   4495 C CE1 . TYR B 2 450 ? -11.546 -114.896 -22.527 1.00 24.35 ? 450  TYR B CE1 1 
ATOM   4496 C CE2 . TYR B 2 450 ? -12.767 -116.445 -21.146 1.00 27.79 ? 450  TYR B CE2 1 
ATOM   4497 C CZ  . TYR B 2 450 ? -12.717 -115.291 -21.922 1.00 26.72 ? 450  TYR B CZ  1 
ATOM   4498 O OH  . TYR B 2 450 ? -13.828 -114.536 -22.112 1.00 27.53 ? 450  TYR B OH  1 
ATOM   4499 N N   . ILE B 2 451 ? -6.620  -118.598 -19.913 1.00 23.05 ? 451  ILE B N   1 
ATOM   4500 C CA  . ILE B 2 451 ? -5.345  -119.347 -19.868 1.00 22.87 ? 451  ILE B CA  1 
ATOM   4501 C C   . ILE B 2 451 ? -5.367  -120.371 -18.736 1.00 23.23 ? 451  ILE B C   1 
ATOM   4502 O O   . ILE B 2 451 ? -5.008  -121.575 -18.954 1.00 22.62 ? 451  ILE B O   1 
ATOM   4503 C CB  . ILE B 2 451 ? -4.114  -118.354 -19.781 1.00 22.52 ? 451  ILE B CB  1 
ATOM   4504 C CG1 . ILE B 2 451 ? -3.988  -117.582 -21.102 1.00 24.19 ? 451  ILE B CG1 1 
ATOM   4505 C CG2 . ILE B 2 451 ? -2.770  -119.079 -19.499 1.00 23.77 ? 451  ILE B CG2 1 
ATOM   4506 C CD1 . ILE B 2 451 ? -3.084  -116.370 -20.972 1.00 22.51 ? 451  ILE B CD1 1 
ATOM   4507 N N   . GLY B 2 452 ? -5.750  -119.949 -17.520 1.00 22.74 ? 452  GLY B N   1 
ATOM   4508 C CA  . GLY B 2 452 ? -5.819  -120.934 -16.424 1.00 22.51 ? 452  GLY B CA  1 
ATOM   4509 C C   . GLY B 2 452 ? -6.829  -122.066 -16.655 1.00 23.26 ? 452  GLY B C   1 
ATOM   4510 O O   . GLY B 2 452 ? -6.610  -123.182 -16.211 1.00 24.51 ? 452  GLY B O   1 
ATOM   4511 N N   . THR B 2 453 ? -7.948  -121.789 -17.309 1.00 23.13 ? 453  THR B N   1 
ATOM   4512 C CA  . THR B 2 453 ? -8.944  -122.822 -17.581 1.00 24.27 ? 453  THR B CA  1 
ATOM   4513 C C   . THR B 2 453 ? -8.510  -123.768 -18.696 1.00 24.77 ? 453  THR B C   1 
ATOM   4514 O O   . THR B 2 453 ? -8.743  -124.999 -18.598 1.00 24.22 ? 453  THR B O   1 
ATOM   4515 C CB  . THR B 2 453 ? -10.265 -122.168 -17.957 1.00 23.90 ? 453  THR B CB  1 
ATOM   4516 O OG1 . THR B 2 453 ? -10.671 -121.393 -16.828 1.00 24.39 ? 453  THR B OG1 1 
ATOM   4517 C CG2 . THR B 2 453 ? -11.333 -123.190 -18.323 1.00 23.50 ? 453  THR B CG2 1 
ATOM   4518 N N   . TYR B 2 454 ? -7.929  -123.210 -19.764 1.00 22.88 ? 454  TYR B N   1 
ATOM   4519 C CA  . TYR B 2 454 ? -7.718  -123.998 -20.987 1.00 24.59 ? 454  TYR B CA  1 
ATOM   4520 C C   . TYR B 2 454 ? -6.289  -124.429 -21.324 1.00 24.75 ? 454  TYR B C   1 
ATOM   4521 O O   . TYR B 2 454 ? -6.103  -125.424 -22.041 1.00 23.07 ? 454  TYR B O   1 
ATOM   4522 C CB  . TYR B 2 454 ? -8.263  -123.264 -22.203 1.00 25.24 ? 454  TYR B CB  1 
ATOM   4523 C CG  . TYR B 2 454 ? -9.761  -123.121 -22.191 1.00 24.47 ? 454  TYR B CG  1 
ATOM   4524 C CD1 . TYR B 2 454 ? -10.344 -121.866 -21.968 1.00 26.13 ? 454  TYR B CD1 1 
ATOM   4525 C CD2 . TYR B 2 454 ? -10.595 -124.224 -22.377 1.00 25.20 ? 454  TYR B CD2 1 
ATOM   4526 C CE1 . TYR B 2 454 ? -11.742 -121.714 -21.956 1.00 26.48 ? 454  TYR B CE1 1 
ATOM   4527 C CE2 . TYR B 2 454 ? -11.991 -124.079 -22.366 1.00 26.57 ? 454  TYR B CE2 1 
ATOM   4528 C CZ  . TYR B 2 454 ? -12.542 -122.821 -22.155 1.00 27.83 ? 454  TYR B CZ  1 
ATOM   4529 O OH  . TYR B 2 454 ? -13.912 -122.683 -22.124 1.00 29.10 ? 454  TYR B OH  1 
ATOM   4530 N N   . ALA B 2 455 ? -5.296  -123.679 -20.846 1.00 24.79 ? 455  ALA B N   1 
ATOM   4531 C CA  . ALA B 2 455 ? -3.906  -123.892 -21.309 1.00 24.25 ? 455  ALA B CA  1 
ATOM   4532 C C   . ALA B 2 455 ? -3.188  -124.920 -20.423 1.00 24.19 ? 455  ALA B C   1 
ATOM   4533 O O   . ALA B 2 455 ? -2.223  -124.613 -19.737 1.00 25.07 ? 455  ALA B O   1 
ATOM   4534 C CB  . ALA B 2 455 ? -3.149  -122.561 -21.370 1.00 25.08 ? 455  ALA B CB  1 
ATOM   4535 N N   . LYS B 2 456 ? -3.705  -126.141 -20.434 1.00 22.96 ? 456  LYS B N   1 
ATOM   4536 C CA  . LYS B 2 456 ? -3.273  -127.211 -19.512 1.00 22.65 ? 456  LYS B CA  1 
ATOM   4537 C C   . LYS B 2 456 ? -1.940  -127.852 -19.892 1.00 22.59 ? 456  LYS B C   1 
ATOM   4538 O O   . LYS B 2 456 ? -1.294  -128.478 -19.040 1.00 22.99 ? 456  LYS B O   1 
ATOM   4539 C CB  . LYS B 2 456 ? -4.368  -128.276 -19.396 1.00 22.65 ? 456  LYS B CB  1 
ATOM   4540 C CG  . LYS B 2 456 ? -5.704  -127.790 -18.821 1.00 22.78 ? 456  LYS B CG  1 
ATOM   4541 C CD  . LYS B 2 456 ? -5.526  -127.230 -17.395 1.00 24.20 ? 456  LYS B CD  1 
ATOM   4542 C CE  . LYS B 2 456 ? -6.853  -126.951 -16.686 1.00 27.18 ? 456  LYS B CE  1 
ATOM   4543 N NZ  . LYS B 2 456 ? -6.664  -126.116 -15.478 1.00 28.42 ? 456  LYS B NZ  1 
ATOM   4544 N N   . LYS B 2 457 ? -1.535  -127.686 -21.155 1.00 22.06 ? 457  LYS B N   1 
ATOM   4545 C CA  . LYS B 2 457 ? -0.225  -128.182 -21.641 1.00 22.79 ? 457  LYS B CA  1 
ATOM   4546 C C   . LYS B 2 457 ? 0.869   -127.104 -21.798 1.00 23.02 ? 457  LYS B C   1 
ATOM   4547 O O   . LYS B 2 457 ? 2.011   -127.424 -22.172 1.00 21.78 ? 457  LYS B O   1 
ATOM   4548 C CB  . LYS B 2 457 ? -0.403  -128.910 -22.988 1.00 22.51 ? 457  LYS B CB  1 
ATOM   4549 C CG  . LYS B 2 457 ? -1.220  -130.208 -22.911 1.00 23.89 ? 457  LYS B CG  1 
ATOM   4550 C CD  . LYS B 2 457 ? -0.532  -131.225 -22.022 1.00 32.27 ? 457  LYS B CD  1 
ATOM   4551 C CE  . LYS B 2 457 ? -1.116  -132.640 -22.218 1.00 37.22 ? 457  LYS B CE  1 
ATOM   4552 N NZ  . LYS B 2 457 ? -2.459  -132.737 -21.585 1.00 42.99 ? 457  LYS B NZ  1 
ATOM   4553 N N   . MET B 2 458 ? 0.507   -125.834 -21.543 1.00 23.00 ? 458  MET B N   1 
ATOM   4554 C CA  . MET B 2 458 ? 1.447   -124.713 -21.668 1.00 24.17 ? 458  MET B CA  1 
ATOM   4555 C C   . MET B 2 458 ? 2.576   -124.822 -20.652 1.00 23.79 ? 458  MET B C   1 
ATOM   4556 O O   . MET B 2 458 ? 2.311   -124.987 -19.436 1.00 24.86 ? 458  MET B O   1 
ATOM   4557 C CB  . MET B 2 458 ? 0.714   -123.373 -21.548 1.00 24.41 ? 458  MET B CB  1 
ATOM   4558 C CG  . MET B 2 458 ? 1.609   -122.139 -21.948 1.00 23.80 ? 458  MET B CG  1 
ATOM   4559 S SD  . MET B 2 458 ? 0.604   -120.748 -21.541 1.00 30.14 ? 458  MET B SD  1 
ATOM   4560 C CE  . MET B 2 458 ? 0.352   -120.919 -19.741 1.00 31.21 ? 458  MET B CE  1 
ATOM   4561 N N   . GLU B 2 459 ? 3.832   -124.753 -21.151 1.00 23.86 ? 459  GLU B N   1 
ATOM   4562 C CA  . GLU B 2 459 ? 5.019   -124.871 -20.344 1.00 23.00 ? 459  GLU B CA  1 
ATOM   4563 C C   . GLU B 2 459 ? 5.729   -123.536 -20.162 1.00 24.14 ? 459  GLU B C   1 
ATOM   4564 O O   . GLU B 2 459 ? 6.413   -123.354 -19.161 1.00 24.03 ? 459  GLU B O   1 
ATOM   4565 C CB  . GLU B 2 459 ? 5.992   -125.871 -20.969 1.00 21.99 ? 459  GLU B CB  1 
ATOM   4566 C CG  . GLU B 2 459 ? 5.422   -127.305 -21.029 1.00 21.60 ? 459  GLU B CG  1 
ATOM   4567 C CD  . GLU B 2 459 ? 6.325   -128.251 -21.800 1.00 27.01 ? 459  GLU B CD  1 
ATOM   4568 O OE1 . GLU B 2 459 ? 7.544   -127.980 -21.848 1.00 26.54 ? 459  GLU B OE1 1 
ATOM   4569 O OE2 . GLU B 2 459 ? 5.823   -129.267 -22.330 1.00 25.93 ? 459  GLU B OE2 1 
ATOM   4570 N N   . MET B 2 460 ? 5.539   -122.602 -21.097 1.00 23.93 ? 460  MET B N   1 
ATOM   4571 C CA  . MET B 2 460 ? 6.252   -121.302 -21.041 1.00 23.70 ? 460  MET B CA  1 
ATOM   4572 C C   . MET B 2 460 ? 5.275   -120.207 -21.451 1.00 23.80 ? 460  MET B C   1 
ATOM   4573 O O   . MET B 2 460 ? 4.608   -120.308 -22.519 1.00 23.78 ? 460  MET B O   1 
ATOM   4574 C CB  . MET B 2 460 ? 7.487   -121.306 -21.970 1.00 24.12 ? 460  MET B CB  1 
ATOM   4575 C CG  . MET B 2 460 ? 8.276   -119.938 -22.015 1.00 24.47 ? 460  MET B CG  1 
ATOM   4576 S SD  . MET B 2 460 ? 9.873   -120.226 -22.777 1.00 27.45 ? 460  MET B SD  1 
ATOM   4577 C CE  . MET B 2 460 ? 10.666  -118.655 -22.488 1.00 28.33 ? 460  MET B CE  1 
ATOM   4578 N N   . LEU B 2 461 ? 5.173   -119.162 -20.610 1.00 21.59 ? 461  LEU B N   1 
ATOM   4579 C CA  . LEU B 2 461 ? 4.260   -118.067 -20.908 1.00 21.98 ? 461  LEU B CA  1 
ATOM   4580 C C   . LEU B 2 461 ? 5.027   -116.776 -20.696 1.00 21.87 ? 461  LEU B C   1 
ATOM   4581 O O   . LEU B 2 461 ? 5.696   -116.631 -19.663 1.00 22.75 ? 461  LEU B O   1 
ATOM   4582 C CB  . LEU B 2 461 ? 3.017   -118.124 -19.992 1.00 21.01 ? 461  LEU B CB  1 
ATOM   4583 C CG  . LEU B 2 461 ? 2.088   -116.909 -20.024 1.00 23.62 ? 461  LEU B CG  1 
ATOM   4584 C CD1 . LEU B 2 461 ? 1.436   -116.826 -21.464 1.00 24.22 ? 461  LEU B CD1 1 
ATOM   4585 C CD2 . LEU B 2 461 ? 0.981   -117.081 -18.936 1.00 21.46 ? 461  LEU B CD2 1 
ATOM   4586 N N   . SER B 2 462 ? 4.908   -115.834 -21.642 1.00 22.55 ? 462  SER B N   1 
ATOM   4587 C CA  . SER B 2 462 ? 5.632   -114.552 -21.517 1.00 23.32 ? 462  SER B CA  1 
ATOM   4588 C C   . SER B 2 462 ? 4.531   -113.488 -21.581 1.00 23.72 ? 462  SER B C   1 
ATOM   4589 O O   . SER B 2 462 ? 3.649   -113.533 -22.473 1.00 24.76 ? 462  SER B O   1 
ATOM   4590 C CB  . SER B 2 462 ? 6.586   -114.321 -22.721 1.00 22.85 ? 462  SER B CB  1 
ATOM   4591 O OG  . SER B 2 462 ? 7.525   -115.389 -22.895 1.00 22.86 ? 462  SER B OG  1 
ATOM   4592 N N   . VAL B 2 463 ? 4.597   -112.512 -20.666 1.00 23.86 ? 463  VAL B N   1 
ATOM   4593 C CA  . VAL B 2 463 ? 3.494   -111.551 -20.486 1.00 23.30 ? 463  VAL B CA  1 
ATOM   4594 C C   . VAL B 2 463 ? 4.127   -110.150 -20.312 1.00 22.14 ? 463  VAL B C   1 
ATOM   4595 O O   . VAL B 2 463 ? 5.105   -110.023 -19.590 1.00 21.57 ? 463  VAL B O   1 
ATOM   4596 C CB  . VAL B 2 463 ? 2.681   -111.892 -19.214 1.00 24.57 ? 463  VAL B CB  1 
ATOM   4597 C CG1 . VAL B 2 463 ? 1.353   -111.118 -19.200 1.00 25.52 ? 463  VAL B CG1 1 
ATOM   4598 C CG2 . VAL B 2 463 ? 2.348   -113.406 -19.130 1.00 25.45 ? 463  VAL B CG2 1 
ATOM   4599 N N   . ALA B 2 464 ? 3.598   -109.123 -20.998 1.00 22.72 ? 464  ALA B N   1 
ATOM   4600 C CA  . ALA B 2 464 ? 4.040   -107.749 -20.736 1.00 21.44 ? 464  ALA B CA  1 
ATOM   4601 C C   . ALA B 2 464 ? 2.846   -106.804 -20.838 1.00 22.77 ? 464  ALA B C   1 
ATOM   4602 O O   . ALA B 2 464 ? 1.971   -106.993 -21.690 1.00 23.24 ? 464  ALA B O   1 
ATOM   4603 C CB  . ALA B 2 464 ? 5.107   -107.322 -21.750 1.00 22.06 ? 464  ALA B CB  1 
ATOM   4604 N N   . PHE B 2 465 ? 2.825   -105.776 -19.991 1.00 21.55 ? 465  PHE B N   1 
ATOM   4605 C CA  . PHE B 2 465 ? 1.775   -104.723 -20.079 1.00 23.00 ? 465  PHE B CA  1 
ATOM   4606 C C   . PHE B 2 465 ? 0.355   -105.297 -20.198 1.00 22.91 ? 465  PHE B C   1 
ATOM   4607 O O   . PHE B 2 465 ? -0.369  -104.993 -21.154 1.00 22.41 ? 465  PHE B O   1 
ATOM   4608 C CB  . PHE B 2 465 ? 2.062   -103.761 -21.260 1.00 24.87 ? 465  PHE B CB  1 
ATOM   4609 C CG  . PHE B 2 465 ? 3.449   -103.184 -21.255 1.00 23.68 ? 465  PHE B CG  1 
ATOM   4610 C CD1 . PHE B 2 465 ? 4.438   -103.717 -22.116 1.00 28.31 ? 465  PHE B CD1 1 
ATOM   4611 C CD2 . PHE B 2 465 ? 3.771   -102.128 -20.414 1.00 28.08 ? 465  PHE B CD2 1 
ATOM   4612 C CE1 . PHE B 2 465 ? 5.738   -103.187 -22.107 1.00 27.79 ? 465  PHE B CE1 1 
ATOM   4613 C CE2 . PHE B 2 465 ? 5.072   -101.588 -20.406 1.00 30.63 ? 465  PHE B CE2 1 
ATOM   4614 C CZ  . PHE B 2 465 ? 6.051   -102.147 -21.242 1.00 28.01 ? 465  PHE B CZ  1 
ATOM   4615 N N   . ALA B 2 466 ? -0.045  -106.103 -19.216 1.00 22.18 ? 466  ALA B N   1 
ATOM   4616 C CA  . ALA B 2 466 ? -1.264  -106.896 -19.305 1.00 23.38 ? 466  ALA B CA  1 
ATOM   4617 C C   . ALA B 2 466 ? -1.849  -107.144 -17.934 1.00 24.60 ? 466  ALA B C   1 
ATOM   4618 O O   . ALA B 2 466 ? -1.101  -107.242 -16.937 1.00 25.80 ? 466  ALA B O   1 
ATOM   4619 C CB  . ALA B 2 466 ? -0.989  -108.284 -20.013 1.00 22.28 ? 466  ALA B CB  1 
ATOM   4620 N N   . GLY B 2 467 ? -3.175  -107.289 -17.898 1.00 24.89 ? 467  GLY B N   1 
ATOM   4621 C CA  . GLY B 2 467 ? -3.875  -107.682 -16.691 1.00 22.95 ? 467  GLY B CA  1 
ATOM   4622 C C   . GLY B 2 467 ? -4.343  -106.483 -15.890 1.00 23.74 ? 467  GLY B C   1 
ATOM   4623 O O   . GLY B 2 467 ? -3.948  -105.324 -16.152 1.00 22.91 ? 467  GLY B O   1 
ATOM   4624 N N   . ASP B 2 468 ? -5.150  -106.762 -14.869 1.00 23.05 ? 468  ASP B N   1 
ATOM   4625 C CA  . ASP B 2 468 ? -5.697  -105.673 -14.042 1.00 23.96 ? 468  ASP B CA  1 
ATOM   4626 C C   . ASP B 2 468 ? -5.296  -105.785 -12.580 1.00 23.46 ? 468  ASP B C   1 
ATOM   4627 O O   . ASP B 2 468 ? -5.128  -104.757 -11.908 1.00 22.02 ? 468  ASP B O   1 
ATOM   4628 C CB  . ASP B 2 468 ? -7.214  -105.639 -14.142 1.00 25.08 ? 468  ASP B CB  1 
ATOM   4629 C CG  . ASP B 2 468 ? -7.691  -105.461 -15.556 1.00 28.68 ? 468  ASP B CG  1 
ATOM   4630 O OD1 . ASP B 2 468 ? -7.182  -104.553 -16.252 1.00 28.31 ? 468  ASP B OD1 1 
ATOM   4631 O OD2 . ASP B 2 468 ? -8.606  -106.219 -15.940 1.00 31.28 ? 468  ASP B OD2 1 
ATOM   4632 N N   . SER B 2 469 ? -5.139  -107.018 -12.083 1.00 22.54 ? 469  SER B N   1 
ATOM   4633 C CA  . SER B 2 469 ? -5.017  -107.226 -10.626 1.00 23.23 ? 469  SER B CA  1 
ATOM   4634 C C   . SER B 2 469 ? -4.337  -108.555 -10.370 1.00 24.00 ? 469  SER B C   1 
ATOM   4635 O O   . SER B 2 469 ? -4.080  -109.332 -11.319 1.00 22.60 ? 469  SER B O   1 
ATOM   4636 C CB  . SER B 2 469 ? -6.402  -107.223 -9.963  1.00 23.90 ? 469  SER B CB  1 
ATOM   4637 O OG  . SER B 2 469 ? -7.033  -108.486 -10.124 1.00 23.47 ? 469  SER B OG  1 
ATOM   4638 N N   . ASP B 2 470 ? -4.073  -108.850 -9.099  1.00 23.29 ? 470  ASP B N   1 
ATOM   4639 C CA  . ASP B 2 470 ? -3.468  -110.143 -8.785  1.00 24.22 ? 470  ASP B CA  1 
ATOM   4640 C C   . ASP B 2 470 ? -4.263  -111.374 -9.242  1.00 24.83 ? 470  ASP B C   1 
ATOM   4641 O O   . ASP B 2 470 ? -3.680  -112.470 -9.358  1.00 25.42 ? 470  ASP B O   1 
ATOM   4642 C CB  . ASP B 2 470 ? -3.200  -110.259 -7.297  1.00 24.93 ? 470  ASP B CB  1 
ATOM   4643 C CG  . ASP B 2 470 ? -1.979  -109.471 -6.893  1.00 27.85 ? 470  ASP B CG  1 
ATOM   4644 O OD1 . ASP B 2 470 ? -0.899  -110.030 -6.924  1.00 31.93 ? 470  ASP B OD1 1 
ATOM   4645 O OD2 . ASP B 2 470 ? -2.103  -108.285 -6.602  1.00 33.58 ? 470  ASP B OD2 1 
ATOM   4646 N N   . LEU B 2 471 ? -5.561  -111.209 -9.463  1.00 24.98 ? 471  LEU B N   1 
ATOM   4647 C CA  . LEU B 2 471 ? -6.430  -112.336 -9.887  1.00 26.04 ? 471  LEU B CA  1 
ATOM   4648 C C   . LEU B 2 471 ? -5.895  -112.888 -11.175 1.00 25.29 ? 471  LEU B C   1 
ATOM   4649 O O   . LEU B 2 471 ? -5.991  -114.121 -11.411 1.00 24.65 ? 471  LEU B O   1 
ATOM   4650 C CB  . LEU B 2 471 ? -7.839  -111.854 -10.173 1.00 27.33 ? 471  LEU B CB  1 
ATOM   4651 C CG  . LEU B 2 471 ? -9.126  -112.598 -9.803  1.00 34.13 ? 471  LEU B CG  1 
ATOM   4652 C CD1 . LEU B 2 471 ? -10.203 -112.450 -10.923 1.00 36.36 ? 471  LEU B CD1 1 
ATOM   4653 C CD2 . LEU B 2 471 ? -8.900  -114.054 -9.342  1.00 35.53 ? 471  LEU B CD2 1 
ATOM   4654 N N   . GLY B 2 472 ? -5.337  -112.004 -12.021 1.00 23.67 ? 472  GLY B N   1 
ATOM   4655 C CA  . GLY B 2 472 ? -4.781  -112.447 -13.309 1.00 24.34 ? 472  GLY B CA  1 
ATOM   4656 C C   . GLY B 2 472 ? -3.654  -113.474 -13.128 1.00 25.61 ? 472  GLY B C   1 
ATOM   4657 O O   . GLY B 2 472 ? -3.707  -114.582 -13.675 1.00 24.14 ? 472  GLY B O   1 
ATOM   4658 N N   . MET B 2 473 ? -2.633  -113.120 -12.352 1.00 24.99 ? 473  MET B N   1 
ATOM   4659 C CA  . MET B 2 473 ? -1.546  -114.073 -12.137 1.00 26.74 ? 473  MET B CA  1 
ATOM   4660 C C   . MET B 2 473 ? -1.988  -115.308 -11.366 1.00 24.66 ? 473  MET B C   1 
ATOM   4661 O O   . MET B 2 473 ? -1.502  -116.413 -11.625 1.00 24.59 ? 473  MET B O   1 
ATOM   4662 C CB  . MET B 2 473 ? -0.341  -113.430 -11.463 1.00 26.43 ? 473  MET B CB  1 
ATOM   4663 C CG  . MET B 2 473 ? 0.858   -114.395 -11.391 1.00 27.84 ? 473  MET B CG  1 
ATOM   4664 S SD  . MET B 2 473 ? 2.386   -113.555 -10.975 1.00 32.16 ? 473  MET B SD  1 
ATOM   4665 C CE  . MET B 2 473 ? 2.338   -113.572 -9.213  1.00 33.06 ? 473  MET B CE  1 
ATOM   4666 N N   . HIS B 2 474 ? -2.904  -115.120 -10.436 1.00 24.00 ? 474  HIS B N   1 
ATOM   4667 C CA  . HIS B 2 474 ? -3.474  -116.241 -9.692  1.00 24.16 ? 474  HIS B CA  1 
ATOM   4668 C C   . HIS B 2 474 ? -4.076  -117.288 -10.628 1.00 23.42 ? 474  HIS B C   1 
ATOM   4669 O O   . HIS B 2 474 ? -3.825  -118.473 -10.453 1.00 23.11 ? 474  HIS B O   1 
ATOM   4670 C CB  . HIS B 2 474 ? -4.541  -115.744 -8.693  1.00 22.92 ? 474  HIS B CB  1 
ATOM   4671 C CG  . HIS B 2 474 ? -5.301  -116.850 -8.049  1.00 23.05 ? 474  HIS B CG  1 
ATOM   4672 N ND1 . HIS B 2 474 ? -4.732  -117.675 -7.096  1.00 21.82 ? 474  HIS B ND1 1 
ATOM   4673 C CD2 . HIS B 2 474 ? -6.552  -117.318 -8.262  1.00 23.22 ? 474  HIS B CD2 1 
ATOM   4674 C CE1 . HIS B 2 474 ? -5.610  -118.600 -6.744  1.00 20.57 ? 474  HIS B CE1 1 
ATOM   4675 N NE2 . HIS B 2 474 ? -6.721  -118.403 -7.432  1.00 24.24 ? 474  HIS B NE2 1 
ATOM   4676 N N   . HIS B 2 475 ? -4.874  -116.857 -11.604 1.00 22.49 ? 475  HIS B N   1 
ATOM   4677 C CA  . HIS B 2 475 ? -5.510  -117.826 -12.524 1.00 23.48 ? 475  HIS B CA  1 
ATOM   4678 C C   . HIS B 2 475 ? -4.469  -118.710 -13.219 1.00 22.88 ? 475  HIS B C   1 
ATOM   4679 O O   . HIS B 2 475 ? -4.677  -119.923 -13.374 1.00 23.81 ? 475  HIS B O   1 
ATOM   4680 C CB  . HIS B 2 475 ? -6.391  -117.122 -13.573 1.00 23.08 ? 475  HIS B CB  1 
ATOM   4681 C CG  . HIS B 2 475 ? -7.653  -116.518 -13.013 1.00 24.89 ? 475  HIS B CG  1 
ATOM   4682 N ND1 . HIS B 2 475 ? -8.467  -117.180 -12.120 1.00 28.46 ? 475  HIS B ND1 1 
ATOM   4683 C CD2 . HIS B 2 475 ? -8.253  -115.330 -13.257 1.00 28.58 ? 475  HIS B CD2 1 
ATOM   4684 C CE1 . HIS B 2 475 ? -9.504  -116.415 -11.819 1.00 30.77 ? 475  HIS B CE1 1 
ATOM   4685 N NE2 . HIS B 2 475 ? -9.400  -115.289 -12.502 1.00 29.58 ? 475  HIS B NE2 1 
ATOM   4686 N N   . VAL B 2 476 ? -3.368  -118.094 -13.637 1.00 23.39 ? 476  VAL B N   1 
ATOM   4687 C CA  . VAL B 2 476 ? -2.262  -118.828 -14.277 1.00 23.36 ? 476  VAL B CA  1 
ATOM   4688 C C   . VAL B 2 476 ? -1.566  -119.816 -13.344 1.00 23.89 ? 476  VAL B C   1 
ATOM   4689 O O   . VAL B 2 476 ? -1.417  -120.990 -13.670 1.00 23.09 ? 476  VAL B O   1 
ATOM   4690 C CB  . VAL B 2 476 ? -1.250  -117.842 -14.925 1.00 24.03 ? 476  VAL B CB  1 
ATOM   4691 C CG1 . VAL B 2 476 ? 0.026   -118.558 -15.429 1.00 25.89 ? 476  VAL B CG1 1 
ATOM   4692 C CG2 . VAL B 2 476 ? -1.961  -117.116 -16.086 1.00 26.11 ? 476  VAL B CG2 1 
ATOM   4693 N N   . LEU B 2 477 ? -1.120  -119.350 -12.189 1.00 22.35 ? 477  LEU B N   1 
ATOM   4694 C CA  . LEU B 2 477 ? -0.441  -120.251 -11.261 1.00 22.38 ? 477  LEU B CA  1 
ATOM   4695 C C   . LEU B 2 477 ? -1.391  -121.344 -10.736 1.00 23.63 ? 477  LEU B C   1 
ATOM   4696 O O   . LEU B 2 477 ? -0.964  -122.475 -10.501 1.00 23.59 ? 477  LEU B O   1 
ATOM   4697 C CB  . LEU B 2 477 ? 0.163   -119.451 -10.097 1.00 23.43 ? 477  LEU B CB  1 
ATOM   4698 C CG  . LEU B 2 477 ? 1.243   -118.430 -10.490 1.00 22.98 ? 477  LEU B CG  1 
ATOM   4699 C CD1 . LEU B 2 477 ? 1.721   -117.613 -9.248  1.00 25.15 ? 477  LEU B CD1 1 
ATOM   4700 C CD2 . LEU B 2 477 ? 2.456   -119.195 -11.102 1.00 23.98 ? 477  LEU B CD2 1 
ATOM   4701 N N   . SER B 2 478 ? -2.660  -121.020 -10.556 1.00 22.73 ? 478  SER B N   1 
ATOM   4702 C CA  . SER B 2 478 ? -3.606  -122.011 -10.036 1.00 25.13 ? 478  SER B CA  1 
ATOM   4703 C C   . SER B 2 478 ? -4.008  -123.035 -11.119 1.00 24.60 ? 478  SER B C   1 
ATOM   4704 O O   . SER B 2 478 ? -4.217  -124.230 -10.820 1.00 24.74 ? 478  SER B O   1 
ATOM   4705 C CB  . SER B 2 478 ? -4.843  -121.289 -9.466  1.00 25.54 ? 478  SER B CB  1 
ATOM   4706 O OG  . SER B 2 478 ? -5.864  -122.194 -9.184  1.00 31.16 ? 478  SER B OG  1 
ATOM   4707 N N   . GLY B 2 479 ? -4.107  -122.599 -12.370 1.00 23.45 ? 479  GLY B N   1 
ATOM   4708 C CA  . GLY B 2 479 ? -4.759  -123.443 -13.388 1.00 24.79 ? 479  GLY B CA  1 
ATOM   4709 C C   . GLY B 2 479 ? -3.830  -124.138 -14.390 1.00 24.94 ? 479  GLY B C   1 
ATOM   4710 O O   . GLY B 2 479 ? -4.228  -125.147 -15.000 1.00 26.04 ? 479  GLY B O   1 
ATOM   4711 N N   . CYS B 2 480 ? -2.617  -123.593 -14.577 1.00 24.16 ? 480  CYS B N   1 
ATOM   4712 C CA  . CYS B 2 480 ? -1.731  -124.055 -15.668 1.00 24.05 ? 480  CYS B CA  1 
ATOM   4713 C C   . CYS B 2 480 ? -0.894  -125.231 -15.215 1.00 24.29 ? 480  CYS B C   1 
ATOM   4714 O O   . CYS B 2 480 ? 0.244   -125.066 -14.791 1.00 23.88 ? 480  CYS B O   1 
ATOM   4715 C CB  . CYS B 2 480 ? -0.842  -122.913 -16.174 1.00 23.36 ? 480  CYS B CB  1 
ATOM   4716 S SG  . CYS B 2 480 ? -1.850  -121.663 -16.992 1.00 25.75 ? 480  CYS B SG  1 
ATOM   4717 N N   . ASP B 2 481 ? -1.490  -126.420 -15.335 1.00 24.21 ? 481  ASP B N   1 
ATOM   4718 C CA  . ASP B 2 481 ? -0.888  -127.646 -14.843 1.00 25.53 ? 481  ASP B CA  1 
ATOM   4719 C C   . ASP B 2 481 ? 0.568   -127.891 -15.259 1.00 24.45 ? 481  ASP B C   1 
ATOM   4720 O O   . ASP B 2 481 ? 1.342   -128.442 -14.470 1.00 23.70 ? 481  ASP B O   1 
ATOM   4721 C CB  . ASP B 2 481 ? -1.704  -128.852 -15.307 1.00 24.76 ? 481  ASP B CB  1 
ATOM   4722 C CG  . ASP B 2 481 ? -3.115  -128.910 -14.720 1.00 28.49 ? 481  ASP B CG  1 
ATOM   4723 O OD1 . ASP B 2 481 ? -3.520  -128.058 -13.916 1.00 30.94 ? 481  ASP B OD1 1 
ATOM   4724 O OD2 . ASP B 2 481 ? -3.831  -129.852 -15.084 1.00 31.14 ? 481  ASP B OD2 1 
ATOM   4725 N N   . SER B 2 482 ? 0.916   -127.548 -16.504 1.00 23.27 ? 482  SER B N   1 
ATOM   4726 C CA  . SER B 2 482 ? 2.197   -127.949 -17.070 1.00 22.69 ? 482  SER B CA  1 
ATOM   4727 C C   . SER B 2 482 ? 3.256   -126.863 -17.002 1.00 23.43 ? 482  SER B C   1 
ATOM   4728 O O   . SER B 2 482 ? 4.364   -127.031 -17.527 1.00 23.36 ? 482  SER B O   1 
ATOM   4729 C CB  . SER B 2 482 ? 2.018   -128.421 -18.532 1.00 22.17 ? 482  SER B CB  1 
ATOM   4730 O OG  . SER B 2 482 ? 1.109   -129.524 -18.610 1.00 21.99 ? 482  SER B OG  1 
ATOM   4731 N N   . LEU B 2 483 ? 2.895   -125.737 -16.390 1.00 23.10 ? 483  LEU B N   1 
ATOM   4732 C CA  . LEU B 2 483 ? 3.758   -124.551 -16.400 1.00 24.47 ? 483  LEU B CA  1 
ATOM   4733 C C   . LEU B 2 483 ? 5.178   -124.810 -15.876 1.00 23.72 ? 483  LEU B C   1 
ATOM   4734 O O   . LEU B 2 483 ? 5.386   -125.358 -14.786 1.00 24.05 ? 483  LEU B O   1 
ATOM   4735 C CB  . LEU B 2 483 ? 3.093   -123.464 -15.565 1.00 24.36 ? 483  LEU B CB  1 
ATOM   4736 C CG  . LEU B 2 483 ? 2.975   -122.004 -15.955 1.00 31.31 ? 483  LEU B CG  1 
ATOM   4737 C CD1 . LEU B 2 483 ? 3.000   -121.076 -14.644 1.00 28.32 ? 483  LEU B CD1 1 
ATOM   4738 C CD2 . LEU B 2 483 ? 3.744   -121.465 -17.184 1.00 29.34 ? 483  LEU B CD2 1 
ATOM   4739 N N   . ARG B 2 484 ? 6.165   -124.422 -16.670 1.00 23.66 ? 484  ARG B N   1 
ATOM   4740 C CA  . ARG B 2 484 ? 7.563   -124.558 -16.261 1.00 24.75 ? 484  ARG B CA  1 
ATOM   4741 C C   . ARG B 2 484 ? 8.271   -123.209 -16.131 1.00 23.80 ? 484  ARG B C   1 
ATOM   4742 O O   . ARG B 2 484 ? 9.109   -123.061 -15.255 1.00 22.71 ? 484  ARG B O   1 
ATOM   4743 C CB  . ARG B 2 484 ? 8.335   -125.430 -17.253 1.00 25.24 ? 484  ARG B CB  1 
ATOM   4744 C CG  . ARG B 2 484 ? 7.924   -126.917 -17.219 1.00 28.36 ? 484  ARG B CG  1 
ATOM   4745 C CD  . ARG B 2 484 ? 8.514   -127.672 -18.445 1.00 30.33 ? 484  ARG B CD  1 
ATOM   4746 N NE  . ARG B 2 484 ? 9.869   -127.223 -18.646 1.00 38.11 ? 484  ARG B NE  1 
ATOM   4747 C CZ  . ARG B 2 484 ? 10.356  -126.631 -19.739 1.00 39.20 ? 484  ARG B CZ  1 
ATOM   4748 N NH1 . ARG B 2 484 ? 9.648   -126.470 -20.838 1.00 40.60 ? 484  ARG B NH1 1 
ATOM   4749 N NH2 . ARG B 2 484 ? 11.609  -126.229 -19.719 1.00 40.42 ? 484  ARG B NH2 1 
ATOM   4750 N N   . LYS B 2 485 ? 7.982   -122.258 -17.022 1.00 22.81 ? 485  LYS B N   1 
ATOM   4751 C CA  . LYS B 2 485 ? 8.622   -120.929 -16.905 1.00 22.55 ? 485  LYS B CA  1 
ATOM   4752 C C   . LYS B 2 485 ? 7.537   -119.884 -17.105 1.00 22.70 ? 485  LYS B C   1 
ATOM   4753 O O   . LYS B 2 485 ? 6.780   -119.967 -18.079 1.00 23.24 ? 485  LYS B O   1 
ATOM   4754 C CB  . LYS B 2 485 ? 9.663   -120.723 -18.016 1.00 24.29 ? 485  LYS B CB  1 
ATOM   4755 C CG  . LYS B 2 485 ? 10.965  -121.534 -17.797 1.00 23.97 ? 485  LYS B CG  1 
ATOM   4756 C CD  . LYS B 2 485 ? 11.816  -121.484 -19.059 1.00 28.99 ? 485  LYS B CD  1 
ATOM   4757 C CE  . LYS B 2 485 ? 11.368  -122.488 -20.075 1.00 26.00 ? 485  LYS B CE  1 
ATOM   4758 N NZ  . LYS B 2 485 ? 12.151  -122.410 -21.389 1.00 26.60 ? 485  LYS B NZ  1 
ATOM   4759 N N   . LEU B 2 486 ? 7.451   -118.933 -16.187 1.00 21.64 ? 486  LEU B N   1 
ATOM   4760 C CA  . LEU B 2 486 ? 6.527   -117.806 -16.350 1.00 22.24 ? 486  LEU B CA  1 
ATOM   4761 C C   . LEU B 2 486 ? 7.398   -116.527 -16.251 1.00 22.02 ? 486  LEU B C   1 
ATOM   4762 O O   . LEU B 2 486 ? 8.236   -116.430 -15.349 1.00 22.09 ? 486  LEU B O   1 
ATOM   4763 C CB  . LEU B 2 486 ? 5.472   -117.855 -15.225 1.00 22.33 ? 486  LEU B CB  1 
ATOM   4764 C CG  . LEU B 2 486 ? 4.490   -116.653 -15.118 1.00 23.80 ? 486  LEU B CG  1 
ATOM   4765 C CD1 . LEU B 2 486 ? 3.771   -116.471 -16.479 1.00 21.06 ? 486  LEU B CD1 1 
ATOM   4766 C CD2 . LEU B 2 486 ? 3.456   -116.913 -14.023 1.00 24.17 ? 486  LEU B CD2 1 
ATOM   4767 N N   . GLU B 2 487 ? 7.241   -115.586 -17.191 1.00 22.79 ? 487  GLU B N   1 
ATOM   4768 C CA  . GLU B 2 487 ? 8.136   -114.397 -17.199 1.00 22.98 ? 487  GLU B CA  1 
ATOM   4769 C C   . GLU B 2 487 ? 7.237   -113.215 -17.499 1.00 22.22 ? 487  GLU B C   1 
ATOM   4770 O O   . GLU B 2 487 ? 6.498   -113.219 -18.504 1.00 22.74 ? 487  GLU B O   1 
ATOM   4771 C CB  . GLU B 2 487 ? 9.275   -114.490 -18.236 1.00 22.56 ? 487  GLU B CB  1 
ATOM   4772 C CG  . GLU B 2 487 ? 8.830   -114.931 -19.674 1.00 23.23 ? 487  GLU B CG  1 
ATOM   4773 C CD  . GLU B 2 487 ? 10.017  -115.299 -20.583 1.00 25.20 ? 487  GLU B CD  1 
ATOM   4774 O OE1 . GLU B 2 487 ? 9.855   -115.340 -21.839 1.00 27.61 ? 487  GLU B OE1 1 
ATOM   4775 O OE2 . GLU B 2 487 ? 11.102  -115.558 -20.046 1.00 25.82 ? 487  GLU B OE2 1 
ATOM   4776 N N   . ILE B 2 488 ? 7.279   -112.239 -16.592 1.00 21.83 ? 488  ILE B N   1 
ATOM   4777 C CA  . ILE B 2 488 ? 6.260   -111.168 -16.608 1.00 22.77 ? 488  ILE B CA  1 
ATOM   4778 C C   . ILE B 2 488 ? 6.956   -109.844 -16.465 1.00 21.40 ? 488  ILE B C   1 
ATOM   4779 O O   . ILE B 2 488 ? 7.834   -109.686 -15.585 1.00 22.71 ? 488  ILE B O   1 
ATOM   4780 C CB  . ILE B 2 488 ? 5.261   -111.359 -15.416 1.00 21.99 ? 488  ILE B CB  1 
ATOM   4781 C CG1 . ILE B 2 488 ? 4.534   -112.732 -15.520 1.00 23.29 ? 488  ILE B CG1 1 
ATOM   4782 C CG2 . ILE B 2 488 ? 4.170   -110.230 -15.432 1.00 24.06 ? 488  ILE B CG2 1 
ATOM   4783 C CD1 . ILE B 2 488 ? 3.823   -113.123 -14.153 1.00 24.41 ? 488  ILE B CD1 1 
ATOM   4784 N N   . ARG B 2 489 ? 6.534   -108.832 -17.250 1.00 21.41 ? 489  ARG B N   1 
ATOM   4785 C CA  . ARG B 2 489 ? 7.084   -107.494 -16.980 1.00 21.90 ? 489  ARG B CA  1 
ATOM   4786 C C   . ARG B 2 489 ? 5.933   -106.492 -17.033 1.00 21.64 ? 489  ARG B C   1 
ATOM   4787 O O   . ARG B 2 489 ? 5.016   -106.649 -17.842 1.00 21.50 ? 489  ARG B O   1 
ATOM   4788 C CB  . ARG B 2 489 ? 8.165   -107.137 -18.027 1.00 21.60 ? 489  ARG B CB  1 
ATOM   4789 C CG  . ARG B 2 489 ? 7.663   -107.213 -19.475 1.00 23.11 ? 489  ARG B CG  1 
ATOM   4790 C CD  . ARG B 2 489 ? 8.591   -106.508 -20.480 1.00 24.18 ? 489  ARG B CD  1 
ATOM   4791 N NE  . ARG B 2 489 ? 8.674   -105.076 -20.195 1.00 24.70 ? 489  ARG B NE  1 
ATOM   4792 C CZ  . ARG B 2 489 ? 9.558   -104.246 -20.751 1.00 28.40 ? 489  ARG B CZ  1 
ATOM   4793 N NH1 . ARG B 2 489 ? 10.424  -104.686 -21.661 1.00 26.46 ? 489  ARG B NH1 1 
ATOM   4794 N NH2 . ARG B 2 489 ? 9.557   -102.968 -20.414 1.00 26.97 ? 489  ARG B NH2 1 
ATOM   4795 N N   . ASP B 2 490 ? 5.988   -105.480 -16.173 1.00 23.09 ? 490  ASP B N   1 
ATOM   4796 C CA  . ASP B 2 490 ? 5.093   -104.316 -16.292 1.00 24.49 ? 490  ASP B CA  1 
ATOM   4797 C C   . ASP B 2 490 ? 3.623   -104.686 -16.229 1.00 24.63 ? 490  ASP B C   1 
ATOM   4798 O O   . ASP B 2 490 ? 2.835   -104.236 -17.053 1.00 25.19 ? 490  ASP B O   1 
ATOM   4799 C CB  . ASP B 2 490 ? 5.408   -103.548 -17.601 1.00 25.77 ? 490  ASP B CB  1 
ATOM   4800 C CG  . ASP B 2 490 ? 6.797   -102.938 -17.610 1.00 25.48 ? 490  ASP B CG  1 
ATOM   4801 O OD1 . ASP B 2 490 ? 6.971   -101.829 -17.075 1.00 24.91 ? 490  ASP B OD1 1 
ATOM   4802 O OD2 . ASP B 2 490 ? 7.715   -103.552 -18.185 1.00 25.08 ? 490  ASP B OD2 1 
ATOM   4803 N N   . CYS B 2 491 ? 3.251   -105.511 -15.234 1.00 23.51 ? 491  CYS B N   1 
ATOM   4804 C CA  . CYS B 2 491 ? 1.871   -105.914 -15.018 1.00 23.61 ? 491  CYS B CA  1 
ATOM   4805 C C   . CYS B 2 491 ? 1.521   -105.625 -13.562 1.00 24.36 ? 491  CYS B C   1 
ATOM   4806 O O   . CYS B 2 491 ? 2.384   -105.705 -12.696 1.00 24.26 ? 491  CYS B O   1 
ATOM   4807 C CB  . CYS B 2 491 ? 1.711   -107.425 -15.285 1.00 23.31 ? 491  CYS B CB  1 
ATOM   4808 S SG  . CYS B 2 491 ? 1.938   -107.920 -17.054 1.00 24.50 ? 491  CYS B SG  1 
ATOM   4809 N N   . PRO B 2 492 ? 0.246   -105.315 -13.281 1.00 24.71 ? 492  PRO B N   1 
ATOM   4810 C CA  . PRO B 2 492 ? -0.219  -105.044 -11.908 1.00 25.48 ? 492  PRO B CA  1 
ATOM   4811 C C   . PRO B 2 492 ? -0.451  -106.327 -11.082 1.00 26.32 ? 492  PRO B C   1 
ATOM   4812 O O   . PRO B 2 492 ? -1.554  -106.560 -10.576 1.00 26.20 ? 492  PRO B O   1 
ATOM   4813 C CB  . PRO B 2 492 ? -1.519  -104.287 -12.141 1.00 24.94 ? 492  PRO B CB  1 
ATOM   4814 C CG  . PRO B 2 492 ? -2.043  -104.842 -13.431 1.00 25.70 ? 492  PRO B CG  1 
ATOM   4815 C CD  . PRO B 2 492 ? -0.831  -105.151 -14.280 1.00 25.46 ? 492  PRO B CD  1 
ATOM   4816 N N   . PHE B 2 493 ? 0.603   -107.128 -10.973 1.00 26.20 ? 493  PHE B N   1 
ATOM   4817 C CA  . PHE B 2 493 ? 0.621   -108.402 -10.271 1.00 26.08 ? 493  PHE B CA  1 
ATOM   4818 C C   . PHE B 2 493 ? 1.634   -108.241 -9.151  1.00 26.82 ? 493  PHE B C   1 
ATOM   4819 O O   . PHE B 2 493 ? 2.731   -107.673 -9.349  1.00 25.15 ? 493  PHE B O   1 
ATOM   4820 C CB  . PHE B 2 493 ? 1.118   -109.548 -11.181 1.00 26.77 ? 493  PHE B CB  1 
ATOM   4821 C CG  . PHE B 2 493 ? 0.282   -109.793 -12.449 1.00 27.01 ? 493  PHE B CG  1 
ATOM   4822 C CD1 . PHE B 2 493 ? 0.869   -110.411 -13.560 1.00 25.63 ? 493  PHE B CD1 1 
ATOM   4823 C CD2 . PHE B 2 493 ? -1.082  -109.466 -12.514 1.00 25.37 ? 493  PHE B CD2 1 
ATOM   4824 C CE1 . PHE B 2 493 ? 0.103   -110.673 -14.709 1.00 25.90 ? 493  PHE B CE1 1 
ATOM   4825 C CE2 . PHE B 2 493 ? -1.840  -109.707 -13.641 1.00 23.48 ? 493  PHE B CE2 1 
ATOM   4826 C CZ  . PHE B 2 493 ? -1.251  -110.308 -14.757 1.00 25.72 ? 493  PHE B CZ  1 
ATOM   4827 N N   . GLY B 2 494 ? 1.299   -108.766 -7.969  1.00 26.32 ? 494  GLY B N   1 
ATOM   4828 C CA  . GLY B 2 494 ? 2.068   -108.404 -6.800  1.00 26.60 ? 494  GLY B CA  1 
ATOM   4829 C C   . GLY B 2 494 ? 2.136   -109.476 -5.763  1.00 26.32 ? 494  GLY B C   1 
ATOM   4830 O O   . GLY B 2 494 ? 2.186   -110.682 -6.059  1.00 27.47 ? 494  GLY B O   1 
ATOM   4831 N N   . ASP B 2 495 ? 2.042   -109.027 -4.531  1.00 24.75 ? 495  ASP B N   1 
ATOM   4832 C CA  . ASP B 2 495 ? 2.233   -109.907 -3.394  1.00 23.41 ? 495  ASP B CA  1 
ATOM   4833 C C   . ASP B 2 495 ? 1.181   -111.007 -3.299  1.00 22.96 ? 495  ASP B C   1 
ATOM   4834 O O   . ASP B 2 495 ? 1.489   -112.122 -2.867  1.00 21.05 ? 495  ASP B O   1 
ATOM   4835 C CB  . ASP B 2 495 ? 2.165   -109.076 -2.121  1.00 23.19 ? 495  ASP B CB  1 
ATOM   4836 C CG  . ASP B 2 495 ? 3.251   -107.999 -2.076  1.00 23.43 ? 495  ASP B CG  1 
ATOM   4837 O OD1 . ASP B 2 495 ? 4.037   -107.927 -3.041  1.00 25.06 ? 495  ASP B OD1 1 
ATOM   4838 O OD2 . ASP B 2 495 ? 3.333   -107.267 -1.088  1.00 22.55 ? 495  ASP B OD2 1 
ATOM   4839 N N   . LYS B 2 496 ? -0.067  -110.655 -3.604  1.00 21.01 ? 496  LYS B N   1 
ATOM   4840 C CA  . LYS B 2 496 ? -1.196  -111.525 -3.235  1.00 21.95 ? 496  LYS B CA  1 
ATOM   4841 C C   . LYS B 2 496 ? -1.187  -112.827 -4.025  1.00 22.58 ? 496  LYS B C   1 
ATOM   4842 O O   . LYS B 2 496 ? -1.292  -113.904 -3.430  1.00 23.35 ? 496  LYS B O   1 
ATOM   4843 C CB  . LYS B 2 496 ? -2.510  -110.790 -3.424  1.00 21.27 ? 496  LYS B CB  1 
ATOM   4844 C CG  . LYS B 2 496 ? -2.732  -109.708 -2.339  1.00 21.71 ? 496  LYS B CG  1 
ATOM   4845 C CD  . LYS B 2 496 ? -4.044  -109.015 -2.616  1.00 28.82 ? 496  LYS B CD  1 
ATOM   4846 C CE  . LYS B 2 496 ? -3.932  -107.540 -2.304  1.00 35.66 ? 496  LYS B CE  1 
ATOM   4847 N NZ  . LYS B 2 496 ? -2.898  -106.899 -3.189  1.00 34.43 ? 496  LYS B NZ  1 
ATOM   4848 N N   . ALA B 2 497 ? -1.039  -112.741 -5.356  1.00 23.10 ? 497  ALA B N   1 
ATOM   4849 C CA  . ALA B 2 497 ? -1.023  -113.967 -6.173  1.00 22.97 ? 497  ALA B CA  1 
ATOM   4850 C C   . ALA B 2 497 ? 0.225   -114.781 -5.940  1.00 22.83 ? 497  ALA B C   1 
ATOM   4851 O O   . ALA B 2 497 ? 0.166   -116.011 -5.917  1.00 22.60 ? 497  ALA B O   1 
ATOM   4852 C CB  . ALA B 2 497 ? -1.199  -113.647 -7.663  1.00 23.95 ? 497  ALA B CB  1 
ATOM   4853 N N   . LEU B 2 498 ? 1.350   -114.089 -5.724  1.00 21.97 ? 498  LEU B N   1 
ATOM   4854 C CA  . LEU B 2 498 ? 2.644   -114.765 -5.544  1.00 22.66 ? 498  LEU B CA  1 
ATOM   4855 C C   . LEU B 2 498 ? 2.638   -115.625 -4.272  1.00 22.60 ? 498  LEU B C   1 
ATOM   4856 O O   . LEU B 2 498 ? 3.064   -116.801 -4.257  1.00 22.28 ? 498  LEU B O   1 
ATOM   4857 C CB  . LEU B 2 498 ? 3.751   -113.688 -5.413  1.00 22.84 ? 498  LEU B CB  1 
ATOM   4858 C CG  . LEU B 2 498 ? 5.184   -114.164 -5.223  1.00 22.95 ? 498  LEU B CG  1 
ATOM   4859 C CD1 . LEU B 2 498 ? 5.608   -114.896 -6.489  1.00 24.71 ? 498  LEU B CD1 1 
ATOM   4860 C CD2 . LEU B 2 498 ? 6.105   -112.978 -4.954  1.00 24.22 ? 498  LEU B CD2 1 
ATOM   4861 N N   . LEU B 2 499 ? 2.215   -115.030 -3.165  1.00 21.73 ? 499  LEU B N   1 
ATOM   4862 C CA  . LEU B 2 499 ? 2.269   -115.770 -1.913  1.00 20.39 ? 499  LEU B CA  1 
ATOM   4863 C C   . LEU B 2 499 ? 1.116   -116.780 -1.820  1.00 21.02 ? 499  LEU B C   1 
ATOM   4864 O O   . LEU B 2 499 ? 1.277   -117.830 -1.224  1.00 21.64 ? 499  LEU B O   1 
ATOM   4865 C CB  . LEU B 2 499 ? 2.208   -114.802 -0.744  1.00 20.66 ? 499  LEU B CB  1 
ATOM   4866 C CG  . LEU B 2 499 ? 3.445   -113.892 -0.583  1.00 21.60 ? 499  LEU B CG  1 
ATOM   4867 C CD1 . LEU B 2 499 ? 3.100   -112.850 0.465   1.00 20.40 ? 499  LEU B CD1 1 
ATOM   4868 C CD2 . LEU B 2 499 ? 4.647   -114.707 -0.191  1.00 22.46 ? 499  LEU B CD2 1 
ATOM   4869 N N   . ALA B 2 500 ? -0.022  -116.478 -2.426  1.00 20.59 ? 500  ALA B N   1 
ATOM   4870 C CA  . ALA B 2 500 ? -1.163  -117.427 -2.410  1.00 22.34 ? 500  ALA B CA  1 
ATOM   4871 C C   . ALA B 2 500 ? -0.851  -118.732 -3.157  1.00 22.73 ? 500  ALA B C   1 
ATOM   4872 O O   . ALA B 2 500 ? -1.455  -119.784 -2.880  1.00 23.67 ? 500  ALA B O   1 
ATOM   4873 C CB  . ALA B 2 500 ? -2.355  -116.804 -3.014  1.00 21.56 ? 500  ALA B CB  1 
ATOM   4874 N N   . ASN B 2 501 ? 0.087   -118.647 -4.095  1.00 23.25 ? 501  ASN B N   1 
ATOM   4875 C CA  . ASN B 2 501 ? 0.492   -119.792 -4.899  1.00 24.19 ? 501  ASN B CA  1 
ATOM   4876 C C   . ASN B 2 501 ? 1.943   -120.179 -4.719  1.00 24.65 ? 501  ASN B C   1 
ATOM   4877 O O   . ASN B 2 501 ? 2.549   -120.693 -5.656  1.00 24.94 ? 501  ASN B O   1 
ATOM   4878 C CB  . ASN B 2 501 ? 0.245   -119.435 -6.373  1.00 23.94 ? 501  ASN B CB  1 
ATOM   4879 C CG  . ASN B 2 501 ? -1.217  -119.207 -6.650  1.00 25.32 ? 501  ASN B CG  1 
ATOM   4880 O OD1 . ASN B 2 501 ? -1.698  -118.047 -6.686  1.00 27.41 ? 501  ASN B OD1 1 
ATOM   4881 N ND2 . ASN B 2 501 ? -1.963  -120.298 -6.769  1.00 21.73 ? 501  ASN B ND2 1 
ATOM   4882 N N   . ALA B 2 502 ? 2.515   -119.945 -3.525  1.00 24.70 ? 502  ALA B N   1 
ATOM   4883 C CA  . ALA B 2 502 ? 3.932   -120.211 -3.305  1.00 24.67 ? 502  ALA B CA  1 
ATOM   4884 C C   . ALA B 2 502 ? 4.329   -121.656 -3.654  1.00 25.27 ? 502  ALA B C   1 
ATOM   4885 O O   . ALA B 2 502 ? 5.376   -121.858 -4.235  1.00 24.85 ? 502  ALA B O   1 
ATOM   4886 C CB  . ALA B 2 502 ? 4.338   -119.904 -1.869  1.00 25.22 ? 502  ALA B CB  1 
ATOM   4887 N N   . SER B 2 503 ? 3.528   -122.655 -3.267  1.00 23.74 ? 503  SER B N   1 
ATOM   4888 C CA  . SER B 2 503 ? 3.932   -124.055 -3.497  1.00 24.34 ? 503  SER B CA  1 
ATOM   4889 C C   . SER B 2 503 ? 4.038   -124.405 -4.990  1.00 23.43 ? 503  SER B C   1 
ATOM   4890 O O   . SER B 2 503 ? 4.809   -125.299 -5.378  1.00 22.97 ? 503  SER B O   1 
ATOM   4891 C CB  . SER B 2 503 ? 2.970   -125.008 -2.801  1.00 25.34 ? 503  SER B CB  1 
ATOM   4892 O OG  . SER B 2 503 ? 1.683   -124.854 -3.386  1.00 31.60 ? 503  SER B OG  1 
ATOM   4893 N N   . LYS B 2 504 ? 3.272   -123.704 -5.819  1.00 22.87 ? 504  LYS B N   1 
ATOM   4894 C CA  . LYS B 2 504 ? 3.322   -123.898 -7.284  1.00 22.69 ? 504  LYS B CA  1 
ATOM   4895 C C   . LYS B 2 504 ? 4.747   -123.677 -7.814  1.00 21.69 ? 504  LYS B C   1 
ATOM   4896 O O   . LYS B 2 504 ? 5.182   -124.331 -8.764  1.00 22.18 ? 504  LYS B O   1 
ATOM   4897 C CB  . LYS B 2 504 ? 2.308   -122.957 -7.992  1.00 22.26 ? 504  LYS B CB  1 
ATOM   4898 C CG  . LYS B 2 504 ? 2.324   -123.049 -9.559  1.00 22.66 ? 504  LYS B CG  1 
ATOM   4899 C CD  . LYS B 2 504 ? 1.893   -124.456 -10.074 1.00 21.99 ? 504  LYS B CD  1 
ATOM   4900 C CE  . LYS B 2 504 ? 1.640   -124.329 -11.608 1.00 22.96 ? 504  LYS B CE  1 
ATOM   4901 N NZ  . LYS B 2 504 ? 1.291   -125.683 -12.208 1.00 22.39 ? 504  LYS B NZ  1 
ATOM   4902 N N   . LEU B 2 505 ? 5.470   -122.742 -7.194  1.00 21.99 ? 505  LEU B N   1 
ATOM   4903 C CA  . LEU B 2 505 ? 6.809   -122.338 -7.623  1.00 23.23 ? 505  LEU B CA  1 
ATOM   4904 C C   . LEU B 2 505 ? 7.816   -123.481 -7.535  1.00 23.62 ? 505  LEU B C   1 
ATOM   4905 O O   . LEU B 2 505 ? 8.818   -123.475 -8.292  1.00 25.08 ? 505  LEU B O   1 
ATOM   4906 C CB  . LEU B 2 505 ? 7.293   -121.093 -6.827  1.00 22.85 ? 505  LEU B CB  1 
ATOM   4907 C CG  . LEU B 2 505 ? 6.335   -119.873 -6.876  1.00 25.19 ? 505  LEU B CG  1 
ATOM   4908 C CD1 . LEU B 2 505 ? 6.864   -118.718 -5.978  1.00 25.76 ? 505  LEU B CD1 1 
ATOM   4909 C CD2 . LEU B 2 505 ? 6.101   -119.393 -8.335  1.00 26.37 ? 505  LEU B CD2 1 
ATOM   4910 N N   . GLU B 2 506 ? 7.572   -124.452 -6.641  1.00 22.43 ? 506  GLU B N   1 
ATOM   4911 C CA  . GLU B 2 506 ? 8.459   -125.630 -6.529  1.00 23.00 ? 506  GLU B CA  1 
ATOM   4912 C C   . GLU B 2 506 ? 8.263   -126.611 -7.688  1.00 22.95 ? 506  GLU B C   1 
ATOM   4913 O O   . GLU B 2 506 ? 9.035   -127.548 -7.822  1.00 21.89 ? 506  GLU B O   1 
ATOM   4914 C CB  . GLU B 2 506 ? 8.287   -126.371 -5.179  1.00 22.61 ? 506  GLU B CB  1 
ATOM   4915 C CG  . GLU B 2 506 ? 9.048   -125.694 -4.100  1.00 25.55 ? 506  GLU B CG  1 
ATOM   4916 C CD  . GLU B 2 506 ? 9.021   -126.425 -2.760  1.00 29.91 ? 506  GLU B CD  1 
ATOM   4917 O OE1 . GLU B 2 506 ? 8.126   -127.271 -2.550  1.00 31.40 ? 506  GLU B OE1 1 
ATOM   4918 O OE2 . GLU B 2 506 ? 9.893   -126.134 -1.930  1.00 30.22 ? 506  GLU B OE2 1 
ATOM   4919 N N   . THR B 2 507 ? 7.237   -126.381 -8.520  1.00 23.92 ? 507  THR B N   1 
ATOM   4920 C CA  . THR B 2 507 ? 6.939   -127.223 -9.689  1.00 23.70 ? 507  THR B CA  1 
ATOM   4921 C C   . THR B 2 507 ? 7.404   -126.626 -11.012 1.00 24.82 ? 507  THR B C   1 
ATOM   4922 O O   . THR B 2 507 ? 7.173   -127.224 -12.058 1.00 24.08 ? 507  THR B O   1 
ATOM   4923 C CB  . THR B 2 507 ? 5.420   -127.539 -9.804  1.00 24.00 ? 507  THR B CB  1 
ATOM   4924 O OG1 . THR B 2 507 ? 4.728   -126.350 -10.234 1.00 23.80 ? 507  THR B OG1 1 
ATOM   4925 C CG2 . THR B 2 507 ? 4.911   -127.984 -8.460  1.00 25.74 ? 507  THR B CG2 1 
ATOM   4926 N N   . MET B 2 508 ? 8.073   -125.469 -10.957 1.00 24.32 ? 508  MET B N   1 
ATOM   4927 C CA  . MET B 2 508 ? 8.485   -124.712 -12.134 1.00 24.50 ? 508  MET B CA  1 
ATOM   4928 C C   . MET B 2 508 ? 9.986   -124.533 -12.146 1.00 24.03 ? 508  MET B C   1 
ATOM   4929 O O   . MET B 2 508 ? 10.603  -124.510 -11.078 1.00 24.16 ? 508  MET B O   1 
ATOM   4930 C CB  . MET B 2 508 ? 7.874   -123.289 -12.086 1.00 24.40 ? 508  MET B CB  1 
ATOM   4931 C CG  . MET B 2 508 ? 6.353   -123.280 -12.012 1.00 23.95 ? 508  MET B CG  1 
ATOM   4932 S SD  . MET B 2 508 ? 5.553   -121.741 -11.572 1.00 25.33 ? 508  MET B SD  1 
ATOM   4933 C CE  . MET B 2 508 ? 6.217   -120.607 -12.836 1.00 24.09 ? 508  MET B CE  1 
ATOM   4934 N N   . ARG B 2 509 ? 10.576  -124.349 -13.326 1.00 22.61 ? 509  ARG B N   1 
ATOM   4935 C CA  . ARG B 2 509 ? 11.993  -123.926 -13.372 1.00 23.70 ? 509  ARG B CA  1 
ATOM   4936 C C   . ARG B 2 509 ? 12.169  -122.547 -12.697 1.00 23.72 ? 509  ARG B C   1 
ATOM   4937 O O   . ARG B 2 509 ? 13.073  -122.371 -11.845 1.00 23.52 ? 509  ARG B O   1 
ATOM   4938 C CB  . ARG B 2 509 ? 12.532  -123.865 -14.802 1.00 23.01 ? 509  ARG B CB  1 
ATOM   4939 C CG  . ARG B 2 509 ? 14.013  -123.373 -14.849 1.00 25.88 ? 509  ARG B CG  1 
ATOM   4940 C CD  . ARG B 2 509 ? 14.534  -123.131 -16.248 1.00 24.92 ? 509  ARG B CD  1 
ATOM   4941 N NE  . ARG B 2 509 ? 14.620  -124.388 -16.974 1.00 28.48 ? 509  ARG B NE  1 
ATOM   4942 C CZ  . ARG B 2 509 ? 14.806  -124.447 -18.279 1.00 31.73 ? 509  ARG B CZ  1 
ATOM   4943 N NH1 . ARG B 2 509 ? 14.945  -123.311 -18.981 1.00 30.96 ? 509  ARG B NH1 1 
ATOM   4944 N NH2 . ARG B 2 509 ? 14.844  -125.625 -18.863 1.00 30.71 ? 509  ARG B NH2 1 
ATOM   4945 N N   . SER B 2 510 ? 11.296  -121.584 -13.041 1.00 23.21 ? 510  SER B N   1 
ATOM   4946 C CA  . SER B 2 510 ? 11.533  -120.211 -12.565 1.00 23.24 ? 510  SER B CA  1 
ATOM   4947 C C   . SER B 2 510 ? 10.340  -119.315 -12.789 1.00 23.58 ? 510  SER B C   1 
ATOM   4948 O O   . SER B 2 510 ? 9.502   -119.609 -13.644 1.00 24.01 ? 510  SER B O   1 
ATOM   4949 C CB  . SER B 2 510 ? 12.763  -119.620 -13.276 1.00 22.49 ? 510  SER B CB  1 
ATOM   4950 O OG  . SER B 2 510 ? 12.560  -119.459 -14.695 1.00 25.61 ? 510  SER B OG  1 
ATOM   4951 N N   . LEU B 2 511 ? 10.290  -118.215 -12.020 1.00 22.85 ? 511  LEU B N   1 
ATOM   4952 C CA  . LEU B 2 511 ? 9.328   -117.164 -12.239 1.00 22.71 ? 511  LEU B CA  1 
ATOM   4953 C C   . LEU B 2 511 ? 10.154  -115.864 -12.266 1.00 23.28 ? 511  LEU B C   1 
ATOM   4954 O O   . LEU B 2 511 ? 10.972  -115.637 -11.347 1.00 22.63 ? 511  LEU B O   1 
ATOM   4955 C CB  . LEU B 2 511 ? 8.307   -117.149 -11.107 1.00 23.03 ? 511  LEU B CB  1 
ATOM   4956 C CG  . LEU B 2 511 ? 7.488   -115.848 -10.948 1.00 22.21 ? 511  LEU B CG  1 
ATOM   4957 C CD1 . LEU B 2 511 ? 6.627   -115.727 -12.230 1.00 21.85 ? 511  LEU B CD1 1 
ATOM   4958 C CD2 . LEU B 2 511 ? 6.659   -115.942 -9.680  1.00 25.91 ? 511  LEU B CD2 1 
ATOM   4959 N N   . TRP B 2 512 ? 9.964   -115.063 -13.321 1.00 22.69 ? 512  TRP B N   1 
ATOM   4960 C CA  . TRP B 2 512 ? 10.617  -113.722 -13.444 1.00 23.12 ? 512  TRP B CA  1 
ATOM   4961 C C   . TRP B 2 512 ? 9.515   -112.673 -13.392 1.00 23.16 ? 512  TRP B C   1 
ATOM   4962 O O   . TRP B 2 512 ? 8.486   -112.806 -14.080 1.00 22.33 ? 512  TRP B O   1 
ATOM   4963 C CB  . TRP B 2 512 ? 11.379  -113.611 -14.783 1.00 22.56 ? 512  TRP B CB  1 
ATOM   4964 C CG  . TRP B 2 512 ? 11.855  -112.195 -15.072 1.00 22.60 ? 512  TRP B CG  1 
ATOM   4965 C CD1 . TRP B 2 512 ? 11.115  -111.167 -15.556 1.00 23.13 ? 512  TRP B CD1 1 
ATOM   4966 C CD2 . TRP B 2 512 ? 13.141  -111.664 -14.765 1.00 23.87 ? 512  TRP B CD2 1 
ATOM   4967 N NE1 . TRP B 2 512 ? 11.880  -110.012 -15.609 1.00 23.92 ? 512  TRP B NE1 1 
ATOM   4968 C CE2 . TRP B 2 512 ? 13.133  -110.301 -15.136 1.00 21.94 ? 512  TRP B CE2 1 
ATOM   4969 C CE3 . TRP B 2 512 ? 14.318  -112.222 -14.237 1.00 20.95 ? 512  TRP B CE3 1 
ATOM   4970 C CZ2 . TRP B 2 512 ? 14.266  -109.464 -14.996 1.00 23.80 ? 512  TRP B CZ2 1 
ATOM   4971 C CZ3 . TRP B 2 512 ? 15.441  -111.405 -14.090 1.00 22.70 ? 512  TRP B CZ3 1 
ATOM   4972 C CH2 . TRP B 2 512 ? 15.408  -110.035 -14.486 1.00 24.65 ? 512  TRP B CH2 1 
ATOM   4973 N N   . MET B 2 513 ? 9.662   -111.668 -12.515 1.00 23.54 ? 513  MET B N   1 
ATOM   4974 C CA  . MET B 2 513 ? 8.744   -110.542 -12.521 1.00 23.80 ? 513  MET B CA  1 
ATOM   4975 C C   . MET B 2 513 ? 9.550   -109.259 -12.405 1.00 24.32 ? 513  MET B C   1 
ATOM   4976 O O   . MET B 2 513 ? 10.211  -109.018 -11.356 1.00 22.90 ? 513  MET B O   1 
ATOM   4977 C CB  . MET B 2 513 ? 7.761   -110.619 -11.335 1.00 24.55 ? 513  MET B CB  1 
ATOM   4978 C CG  . MET B 2 513 ? 6.839   -111.873 -11.325 1.00 24.66 ? 513  MET B CG  1 
ATOM   4979 S SD  . MET B 2 513 ? 5.760   -111.969 -9.906  1.00 26.12 ? 513  MET B SD  1 
ATOM   4980 C CE  . MET B 2 513 ? 4.528   -110.683 -10.250 1.00 24.81 ? 513  MET B CE  1 
ATOM   4981 N N   . SER B 2 514 ? 9.441   -108.403 -13.418 1.00 23.33 ? 514  SER B N   1 
ATOM   4982 C CA  . SER B 2 514 ? 10.113  -107.089 -13.357 1.00 22.90 ? 514  SER B CA  1 
ATOM   4983 C C   . SER B 2 514 ? 9.120   -105.972 -13.572 1.00 23.38 ? 514  SER B C   1 
ATOM   4984 O O   . SER B 2 514 ? 8.198   -106.091 -14.391 1.00 21.59 ? 514  SER B O   1 
ATOM   4985 C CB  . SER B 2 514 ? 11.229  -106.998 -14.389 1.00 23.01 ? 514  SER B CB  1 
ATOM   4986 O OG  . SER B 2 514 ? 10.746  -107.276 -15.694 1.00 24.07 ? 514  SER B OG  1 
ATOM   4987 N N   . SER B 2 515 ? 9.358   -104.846 -12.891 1.00 22.57 ? 515  SER B N   1 
ATOM   4988 C CA  . SER B 2 515 ? 8.473   -103.700 -12.962 1.00 22.23 ? 515  SER B CA  1 
ATOM   4989 C C   . SER B 2 515 ? 7.008   -104.040 -12.689 1.00 22.67 ? 515  SER B C   1 
ATOM   4990 O O   . SER B 2 515 ? 6.102   -103.416 -13.267 1.00 23.43 ? 515  SER B O   1 
ATOM   4991 C CB  . SER B 2 515 ? 8.607   -102.991 -14.320 1.00 22.35 ? 515  SER B CB  1 
ATOM   4992 O OG  . SER B 2 515 ? 9.918   -102.473 -14.478 1.00 21.97 ? 515  SER B OG  1 
ATOM   4993 N N   . CYS B 2 516 ? 6.777   -104.993 -11.788 1.00 23.26 ? 516  CYS B N   1 
ATOM   4994 C CA  . CYS B 2 516 ? 5.430   -105.356 -11.328 1.00 23.26 ? 516  CYS B CA  1 
ATOM   4995 C C   . CYS B 2 516 ? 5.204   -104.725 -9.966  1.00 24.09 ? 516  CYS B C   1 
ATOM   4996 O O   . CYS B 2 516 ? 5.794   -103.678 -9.672  1.00 24.11 ? 516  CYS B O   1 
ATOM   4997 C CB  . CYS B 2 516 ? 5.223   -106.888 -11.290 1.00 23.07 ? 516  CYS B CB  1 
ATOM   4998 S SG  . CYS B 2 516 ? 5.287   -107.606 -12.985 1.00 24.24 ? 516  CYS B SG  1 
ATOM   4999 N N   . SER B 2 517 ? 4.309   -105.305 -9.164  1.00 24.53 ? 517  SER B N   1 
ATOM   5000 C CA  . SER B 2 517 ? 4.002   -104.711 -7.853  1.00 26.32 ? 517  SER B CA  1 
ATOM   5001 C C   . SER B 2 517 ? 4.494   -105.483 -6.627  1.00 25.72 ? 517  SER B C   1 
ATOM   5002 O O   . SER B 2 517 ? 4.009   -105.266 -5.520  1.00 28.17 ? 517  SER B O   1 
ATOM   5003 C CB  . SER B 2 517 ? 2.497   -104.414 -7.754  1.00 27.11 ? 517  SER B CB  1 
ATOM   5004 O OG  . SER B 2 517 ? 2.174   -103.354 -8.675  1.00 31.11 ? 517  SER B OG  1 
ATOM   5005 N N   . VAL B 2 518 ? 5.463   -106.359 -6.789  1.00 24.60 ? 518  VAL B N   1 
ATOM   5006 C CA  . VAL B 2 518 ? 5.854   -107.225 -5.690  1.00 23.76 ? 518  VAL B CA  1 
ATOM   5007 C C   . VAL B 2 518 ? 6.716   -106.430 -4.698  1.00 23.76 ? 518  VAL B C   1 
ATOM   5008 O O   . VAL B 2 518 ? 7.745   -105.869 -5.090  1.00 21.91 ? 518  VAL B O   1 
ATOM   5009 C CB  . VAL B 2 518 ? 6.642   -108.485 -6.181  1.00 24.97 ? 518  VAL B CB  1 
ATOM   5010 C CG1 . VAL B 2 518 ? 6.943   -109.401 -5.009  1.00 24.62 ? 518  VAL B CG1 1 
ATOM   5011 C CG2 . VAL B 2 518 ? 5.850   -109.281 -7.231  1.00 24.32 ? 518  VAL B CG2 1 
ATOM   5012 N N   . SER B 2 519 ? 6.307   -106.405 -3.423  1.00 22.68 ? 519  SER B N   1 
ATOM   5013 C CA  . SER B 2 519 ? 7.018   -105.581 -2.433  1.00 21.83 ? 519  SER B CA  1 
ATOM   5014 C C   . SER B 2 519 ? 8.233   -106.312 -1.914  1.00 21.76 ? 519  SER B C   1 
ATOM   5015 O O   . SER B 2 519 ? 8.326   -107.536 -1.999  1.00 19.95 ? 519  SER B O   1 
ATOM   5016 C CB  . SER B 2 519 ? 6.124   -105.256 -1.237  1.00 20.61 ? 519  SER B CB  1 
ATOM   5017 O OG  . SER B 2 519 ? 5.753   -106.433 -0.556  1.00 20.24 ? 519  SER B OG  1 
ATOM   5018 N N   . PHE B 2 520 ? 9.168   -105.567 -1.339  1.00 21.05 ? 520  PHE B N   1 
ATOM   5019 C CA  . PHE B 2 520 ? 10.288  -106.227 -0.699  1.00 21.98 ? 520  PHE B CA  1 
ATOM   5020 C C   . PHE B 2 520 ? 9.810   -107.146 0.466   1.00 21.25 ? 520  PHE B C   1 
ATOM   5021 O O   . PHE B 2 520 ? 10.290  -108.282 0.621   1.00 21.04 ? 520  PHE B O   1 
ATOM   5022 C CB  . PHE B 2 520 ? 11.309  -105.178 -0.227  1.00 22.00 ? 520  PHE B CB  1 
ATOM   5023 C CG  . PHE B 2 520 ? 12.419  -105.757 0.570   1.00 24.61 ? 520  PHE B CG  1 
ATOM   5024 C CD1 . PHE B 2 520 ? 13.208  -106.784 0.049   1.00 28.55 ? 520  PHE B CD1 1 
ATOM   5025 C CD2 . PHE B 2 520 ? 12.687  -105.274 1.837   1.00 26.09 ? 520  PHE B CD2 1 
ATOM   5026 C CE1 . PHE B 2 520 ? 14.243  -107.319 0.800   1.00 30.19 ? 520  PHE B CE1 1 
ATOM   5027 C CE2 . PHE B 2 520 ? 13.729  -105.807 2.582   1.00 29.97 ? 520  PHE B CE2 1 
ATOM   5028 C CZ  . PHE B 2 520 ? 14.487  -106.829 2.063   1.00 25.81 ? 520  PHE B CZ  1 
ATOM   5029 N N   . GLY B 2 521 ? 8.838   -106.678 1.251   1.00 20.54 ? 521  GLY B N   1 
ATOM   5030 C CA  . GLY B 2 521 ? 8.261   -107.500 2.318   1.00 19.47 ? 521  GLY B CA  1 
ATOM   5031 C C   . GLY B 2 521 ? 7.747   -108.867 1.856   1.00 20.48 ? 521  GLY B C   1 
ATOM   5032 O O   . GLY B 2 521 ? 7.921   -109.863 2.558   1.00 18.84 ? 521  GLY B O   1 
ATOM   5033 N N   . ALA B 2 522 ? 7.106   -108.909 0.692   1.00 19.08 ? 522  ALA B N   1 
ATOM   5034 C CA  . ALA B 2 522 ? 6.584   -110.201 0.192   1.00 20.76 ? 522  ALA B CA  1 
ATOM   5035 C C   . ALA B 2 522 ? 7.725   -111.113 -0.245  1.00 20.94 ? 522  ALA B C   1 
ATOM   5036 O O   . ALA B 2 522 ? 7.667   -112.340 -0.048  1.00 22.54 ? 522  ALA B O   1 
ATOM   5037 C CB  . ALA B 2 522 ? 5.610   -109.994 -0.982  1.00 20.96 ? 522  ALA B CB  1 
ATOM   5038 N N   . CYS B 2 523 ? 8.751   -110.528 -0.854  1.00 20.63 ? 523  CYS B N   1 
ATOM   5039 C CA  . CYS B 2 523 ? 9.943   -111.274 -1.247  1.00 21.76 ? 523  CYS B CA  1 
ATOM   5040 C C   . CYS B 2 523 ? 10.603  -111.891 -0.005  1.00 21.51 ? 523  CYS B C   1 
ATOM   5041 O O   . CYS B 2 523 ? 10.962  -113.062 -0.002  1.00 21.48 ? 523  CYS B O   1 
ATOM   5042 C CB  . CYS B 2 523 ? 10.944  -110.354 -1.988  1.00 23.29 ? 523  CYS B CB  1 
ATOM   5043 S SG  . CYS B 2 523 ? 10.415  -109.754 -3.629  1.00 25.00 ? 523  CYS B SG  1 
ATOM   5044 N N   . LYS B 2 524 ? 10.776  -111.105 1.055   1.00 21.71 ? 524  LYS B N   1 
ATOM   5045 C CA  . LYS B 2 524 ? 11.315  -111.657 2.302   1.00 21.26 ? 524  LYS B CA  1 
ATOM   5046 C C   . LYS B 2 524 ? 10.449  -112.795 2.847   1.00 21.44 ? 524  LYS B C   1 
ATOM   5047 O O   . LYS B 2 524 ? 10.959  -113.855 3.275   1.00 20.13 ? 524  LYS B O   1 
ATOM   5048 C CB  . LYS B 2 524 ? 11.408  -110.573 3.374   1.00 22.01 ? 524  LYS B CB  1 
ATOM   5049 C CG  . LYS B 2 524 ? 12.562  -109.603 3.159   1.00 24.79 ? 524  LYS B CG  1 
ATOM   5050 C CD  . LYS B 2 524 ? 12.700  -108.692 4.390   1.00 31.19 ? 524  LYS B CD  1 
ATOM   5051 C CE  . LYS B 2 524 ? 11.525  -107.740 4.531   1.00 33.21 ? 524  LYS B CE  1 
ATOM   5052 N NZ  . LYS B 2 524 ? 11.798  -106.743 5.612   1.00 38.33 ? 524  LYS B NZ  1 
ATOM   5053 N N   . LEU B 2 525 ? 9.141   -112.568 2.899   1.00 20.21 ? 525  LEU B N   1 
ATOM   5054 C CA  . LEU B 2 525 ? 8.275   -113.617 3.454   1.00 21.17 ? 525  LEU B CA  1 
ATOM   5055 C C   . LEU B 2 525 ? 8.299   -114.874 2.592   1.00 20.74 ? 525  LEU B C   1 
ATOM   5056 O O   . LEU B 2 525 ? 8.340   -115.974 3.126   1.00 22.09 ? 525  LEU B O   1 
ATOM   5057 C CB  . LEU B 2 525 ? 6.840   -113.115 3.693   1.00 20.38 ? 525  LEU B CB  1 
ATOM   5058 C CG  . LEU B 2 525 ? 6.020   -114.007 4.635   1.00 22.77 ? 525  LEU B CG  1 
ATOM   5059 C CD1 . LEU B 2 525 ? 6.623   -113.967 6.036   1.00 26.44 ? 525  LEU B CD1 1 
ATOM   5060 C CD2 . LEU B 2 525 ? 4.602   -113.490 4.714   1.00 27.06 ? 525  LEU B CD2 1 
ATOM   5061 N N   . LEU B 2 526 ? 8.303   -114.721 1.269   1.00 21.55 ? 526  LEU B N   1 
ATOM   5062 C CA  . LEU B 2 526 ? 8.375   -115.884 0.368   1.00 21.15 ? 526  LEU B CA  1 
ATOM   5063 C C   . LEU B 2 526 ? 9.668   -116.682 0.598   1.00 22.52 ? 526  LEU B C   1 
ATOM   5064 O O   . LEU B 2 526 ? 9.634   -117.923 0.669   1.00 22.50 ? 526  LEU B O   1 
ATOM   5065 C CB  . LEU B 2 526 ? 8.288   -115.473 -1.105  1.00 20.70 ? 526  LEU B CB  1 
ATOM   5066 C CG  . LEU B 2 526 ? 8.384   -116.616 -2.136  1.00 21.26 ? 526  LEU B CG  1 
ATOM   5067 C CD1 . LEU B 2 526 ? 7.196   -117.595 -2.046  1.00 21.22 ? 526  LEU B CD1 1 
ATOM   5068 C CD2 . LEU B 2 526 ? 8.495   -116.067 -3.576  1.00 21.44 ? 526  LEU B CD2 1 
ATOM   5069 N N   . GLY B 2 527 ? 10.791  -115.963 0.736   1.00 22.32 ? 527  GLY B N   1 
ATOM   5070 C CA  . GLY B 2 527 ? 12.083  -116.586 1.055   1.00 22.20 ? 527  GLY B CA  1 
ATOM   5071 C C   . GLY B 2 527 ? 12.071  -117.366 2.345   1.00 23.10 ? 527  GLY B C   1 
ATOM   5072 O O   . GLY B 2 527 ? 12.649  -118.445 2.405   1.00 22.53 ? 527  GLY B O   1 
ATOM   5073 N N   . GLN B 2 528 ? 11.419  -116.813 3.372   1.00 24.25 ? 528  GLN B N   1 
ATOM   5074 C CA  . GLN B 2 528 ? 11.222  -117.458 4.678   1.00 25.46 ? 528  GLN B CA  1 
ATOM   5075 C C   . GLN B 2 528 ? 10.432  -118.747 4.548   1.00 24.80 ? 528  GLN B C   1 
ATOM   5076 O O   . GLN B 2 528 ? 10.794  -119.788 5.116   1.00 25.02 ? 528  GLN B O   1 
ATOM   5077 C CB  . GLN B 2 528 ? 10.380  -116.573 5.613   1.00 26.53 ? 528  GLN B CB  1 
ATOM   5078 C CG  . GLN B 2 528 ? 11.092  -115.578 6.437   1.00 31.75 ? 528  GLN B CG  1 
ATOM   5079 C CD  . GLN B 2 528 ? 11.666  -116.174 7.703   1.00 35.83 ? 528  GLN B CD  1 
ATOM   5080 O OE1 . GLN B 2 528 ? 11.030  -116.963 8.414   1.00 37.89 ? 528  GLN B OE1 1 
ATOM   5081 N NE2 . GLN B 2 528 ? 12.892  -115.797 7.988   1.00 39.97 ? 528  GLN B NE2 1 
ATOM   5082 N N   . LYS B 2 529 ? 9.296   -118.620 3.885   1.00 23.82 ? 529  LYS B N   1 
ATOM   5083 C CA  . LYS B 2 529 ? 8.364   -119.707 3.719   1.00 24.10 ? 529  LYS B CA  1 
ATOM   5084 C C   . LYS B 2 529 ? 8.927   -120.877 2.897   1.00 23.90 ? 529  LYS B C   1 
ATOM   5085 O O   . LYS B 2 529 ? 8.593   -122.029 3.157   1.00 23.20 ? 529  LYS B O   1 
ATOM   5086 C CB  . LYS B 2 529 ? 7.115   -119.195 3.015   1.00 22.99 ? 529  LYS B CB  1 
ATOM   5087 C CG  . LYS B 2 529 ? 5.989   -120.241 2.994   1.00 26.42 ? 529  LYS B CG  1 
ATOM   5088 C CD  . LYS B 2 529 ? 4.833   -119.827 2.118   1.00 28.17 ? 529  LYS B CD  1 
ATOM   5089 C CE  . LYS B 2 529 ? 3.986   -121.040 1.724   1.00 28.76 ? 529  LYS B CE  1 
ATOM   5090 N NZ  . LYS B 2 529 ? 3.400   -121.735 2.880   1.00 24.72 ? 529  LYS B NZ  1 
ATOM   5091 N N   . MET B 2 530 ? 9.726   -120.555 1.881   1.00 23.57 ? 530  MET B N   1 
ATOM   5092 C CA  . MET B 2 530 ? 10.137  -121.527 0.856   1.00 24.49 ? 530  MET B CA  1 
ATOM   5093 C C   . MET B 2 530 ? 11.661  -121.623 0.812   1.00 24.29 ? 530  MET B C   1 
ATOM   5094 O O   . MET B 2 530 ? 12.277  -121.114 -0.115  1.00 24.47 ? 530  MET B O   1 
ATOM   5095 C CB  . MET B 2 530 ? 9.616   -121.128 -0.533  1.00 24.34 ? 530  MET B CB  1 
ATOM   5096 C CG  . MET B 2 530 ? 8.086   -120.898 -0.633  1.00 24.44 ? 530  MET B CG  1 
ATOM   5097 S SD  . MET B 2 530 ? 7.144   -122.372 -0.271  1.00 26.22 ? 530  MET B SD  1 
ATOM   5098 C CE  . MET B 2 530 ? 7.475   -123.294 -1.800  1.00 25.81 ? 530  MET B CE  1 
ATOM   5099 N N   . PRO B 2 531 ? 12.275  -122.264 1.817   1.00 24.78 ? 531  PRO B N   1 
ATOM   5100 C CA  . PRO B 2 531 ? 13.732  -122.266 1.829   1.00 25.17 ? 531  PRO B CA  1 
ATOM   5101 C C   . PRO B 2 531 ? 14.362  -122.999 0.637   1.00 25.62 ? 531  PRO B C   1 
ATOM   5102 O O   . PRO B 2 531 ? 15.541  -122.804 0.377   1.00 26.50 ? 531  PRO B O   1 
ATOM   5103 C CB  . PRO B 2 531 ? 14.079  -122.954 3.161   1.00 26.13 ? 531  PRO B CB  1 
ATOM   5104 C CG  . PRO B 2 531 ? 12.878  -123.836 3.437   1.00 25.26 ? 531  PRO B CG  1 
ATOM   5105 C CD  . PRO B 2 531 ? 11.714  -123.013 2.955   1.00 24.28 ? 531  PRO B CD  1 
ATOM   5106 N N   . LYS B 2 532 ? 13.610  -123.816 -0.096  1.00 25.20 ? 532  LYS B N   1 
ATOM   5107 C CA  . LYS B 2 532 ? 14.200  -124.515 -1.269  1.00 25.27 ? 532  LYS B CA  1 
ATOM   5108 C C   . LYS B 2 532 ? 14.074  -123.724 -2.579  1.00 24.91 ? 532  LYS B C   1 
ATOM   5109 O O   . LYS B 2 532 ? 14.491  -124.203 -3.647  1.00 24.66 ? 532  LYS B O   1 
ATOM   5110 C CB  . LYS B 2 532 ? 13.627  -125.930 -1.433  1.00 24.94 ? 532  LYS B CB  1 
ATOM   5111 C CG  . LYS B 2 532 ? 13.793  -126.831 -0.211  1.00 27.75 ? 532  LYS B CG  1 
ATOM   5112 C CD  . LYS B 2 532 ? 13.258  -128.225 -0.515  1.00 32.38 ? 532  LYS B CD  1 
ATOM   5113 C CE  . LYS B 2 532 ? 13.267  -129.127 0.721   1.00 36.12 ? 532  LYS B CE  1 
ATOM   5114 N NZ  . LYS B 2 532 ? 11.920  -129.248 1.405   1.00 37.06 ? 532  LYS B NZ  1 
ATOM   5115 N N   . LEU B 2 533 ? 13.529  -122.510 -2.487  1.00 24.01 ? 533  LEU B N   1 
ATOM   5116 C CA  . LEU B 2 533 ? 13.594  -121.550 -3.555  1.00 24.51 ? 533  LEU B CA  1 
ATOM   5117 C C   . LEU B 2 533 ? 14.703  -120.526 -3.300  1.00 24.21 ? 533  LEU B C   1 
ATOM   5118 O O   . LEU B 2 533 ? 14.956  -120.146 -2.156  1.00 23.82 ? 533  LEU B O   1 
ATOM   5119 C CB  . LEU B 2 533 ? 12.273  -120.777 -3.655  1.00 24.59 ? 533  LEU B CB  1 
ATOM   5120 C CG  . LEU B 2 533 ? 11.050  -121.278 -4.453  1.00 28.54 ? 533  LEU B CG  1 
ATOM   5121 C CD1 . LEU B 2 533 ? 11.000  -122.709 -5.028  1.00 27.39 ? 533  LEU B CD1 1 
ATOM   5122 C CD2 . LEU B 2 533 ? 9.676   -120.738 -3.981  1.00 25.08 ? 533  LEU B CD2 1 
ATOM   5123 N N   . ASN B 2 534 ? 15.345  -120.064 -4.367  1.00 22.04 ? 534  ASN B N   1 
ATOM   5124 C CA  . ASN B 2 534 ? 16.161  -118.862 -4.273  1.00 22.22 ? 534  ASN B CA  1 
ATOM   5125 C C   . ASN B 2 534 ? 15.287  -117.737 -4.736  1.00 22.27 ? 534  ASN B C   1 
ATOM   5126 O O   . ASN B 2 534 ? 14.825  -117.712 -5.897  1.00 22.93 ? 534  ASN B O   1 
ATOM   5127 C CB  . ASN B 2 534 ? 17.439  -118.942 -5.131  1.00 22.49 ? 534  ASN B CB  1 
ATOM   5128 C CG  . ASN B 2 534 ? 18.535  -119.740 -4.479  1.00 23.55 ? 534  ASN B CG  1 
ATOM   5129 O OD1 . ASN B 2 534 ? 18.397  -120.199 -3.329  1.00 22.57 ? 534  ASN B OD1 1 
ATOM   5130 N ND2 . ASN B 2 534 ? 19.664  -119.907 -5.202  1.00 20.25 ? 534  ASN B ND2 1 
ATOM   5131 N N   . VAL B 2 535 ? 15.023  -116.811 -3.832  1.00 22.11 ? 535  VAL B N   1 
ATOM   5132 C CA  . VAL B 2 535 ? 14.209  -115.635 -4.160  1.00 22.55 ? 535  VAL B CA  1 
ATOM   5133 C C   . VAL B 2 535 ? 15.199  -114.489 -4.261  1.00 22.89 ? 535  VAL B C   1 
ATOM   5134 O O   . VAL B 2 535 ? 15.690  -114.011 -3.233  1.00 22.75 ? 535  VAL B O   1 
ATOM   5135 C CB  . VAL B 2 535 ? 13.146  -115.364 -3.069  1.00 22.39 ? 535  VAL B CB  1 
ATOM   5136 C CG1 . VAL B 2 535 ? 12.284  -114.089 -3.409  1.00 22.23 ? 535  VAL B CG1 1 
ATOM   5137 C CG2 . VAL B 2 535 ? 12.254  -116.605 -2.919  1.00 24.05 ? 535  VAL B CG2 1 
ATOM   5138 N N   . GLU B 2 536 ? 15.502  -114.071 -5.492  1.00 23.21 ? 536  GLU B N   1 
ATOM   5139 C CA  . GLU B 2 536 ? 16.520  -113.060 -5.729  1.00 23.49 ? 536  GLU B CA  1 
ATOM   5140 C C   . GLU B 2 536 ? 15.894  -111.721 -6.121  1.00 23.71 ? 536  GLU B C   1 
ATOM   5141 O O   . GLU B 2 536 ? 15.256  -111.617 -7.153  1.00 25.43 ? 536  GLU B O   1 
ATOM   5142 C CB  . GLU B 2 536 ? 17.485  -113.525 -6.833  1.00 22.92 ? 536  GLU B CB  1 
ATOM   5143 C CG  . GLU B 2 536 ? 18.226  -114.846 -6.500  1.00 22.34 ? 536  GLU B CG  1 
ATOM   5144 C CD  . GLU B 2 536 ? 19.357  -115.162 -7.494  1.00 24.97 ? 536  GLU B CD  1 
ATOM   5145 O OE1 . GLU B 2 536 ? 19.503  -114.402 -8.491  1.00 25.80 ? 536  GLU B OE1 1 
ATOM   5146 O OE2 . GLU B 2 536 ? 20.078  -116.154 -7.247  1.00 25.75 ? 536  GLU B OE2 1 
ATOM   5147 N N   . VAL B 2 537 ? 16.094  -110.722 -5.281  1.00 22.21 ? 537  VAL B N   1 
ATOM   5148 C CA  . VAL B 2 537 ? 15.742  -109.344 -5.580  1.00 23.33 ? 537  VAL B CA  1 
ATOM   5149 C C   . VAL B 2 537 ? 16.886  -108.708 -6.368  1.00 22.57 ? 537  VAL B C   1 
ATOM   5150 O O   . VAL B 2 537 ? 18.020  -108.680 -5.904  1.00 23.99 ? 537  VAL B O   1 
ATOM   5151 C CB  . VAL B 2 537 ? 15.514  -108.550 -4.294  1.00 23.07 ? 537  VAL B CB  1 
ATOM   5152 C CG1 . VAL B 2 537 ? 15.413  -107.036 -4.588  1.00 22.71 ? 537  VAL B CG1 1 
ATOM   5153 C CG2 . VAL B 2 537 ? 14.282  -109.084 -3.561  1.00 24.38 ? 537  VAL B CG2 1 
ATOM   5154 N N   . ILE B 2 538 ? 16.581  -108.213 -7.561  1.00 22.57 ? 538  ILE B N   1 
ATOM   5155 C CA  . ILE B 2 538 ? 17.608  -107.683 -8.460  1.00 22.29 ? 538  ILE B CA  1 
ATOM   5156 C C   . ILE B 2 538 ? 17.224  -106.232 -8.629  1.00 22.40 ? 538  ILE B C   1 
ATOM   5157 O O   . ILE B 2 538 ? 16.258  -105.919 -9.328  1.00 22.27 ? 538  ILE B O   1 
ATOM   5158 C CB  . ILE B 2 538 ? 17.623  -108.419 -9.839  1.00 22.44 ? 538  ILE B CB  1 
ATOM   5159 C CG1 . ILE B 2 538 ? 17.693  -109.953 -9.665  1.00 22.42 ? 538  ILE B CG1 1 
ATOM   5160 C CG2 . ILE B 2 538 ? 18.794  -107.893 -10.754 1.00 20.32 ? 538  ILE B CG2 1 
ATOM   5161 C CD1 . ILE B 2 538 ? 17.374  -110.745 -10.988 1.00 22.80 ? 538  ILE B CD1 1 
ATOM   5162 N N   . ASP B 2 539 ? 17.978  -105.351 -7.986  1.00 21.67 ? 539  ASP B N   1 
ATOM   5163 C CA  . ASP B 2 539 ? 17.553  -103.979 -7.802  1.00 21.87 ? 539  ASP B CA  1 
ATOM   5164 C C   . ASP B 2 539 ? 18.795  -103.103 -7.699  1.00 21.80 ? 539  ASP B C   1 
ATOM   5165 O O   . ASP B 2 539 ? 19.662  -103.307 -6.837  1.00 21.30 ? 539  ASP B O   1 
ATOM   5166 C CB  . ASP B 2 539 ? 16.660  -103.853 -6.536  1.00 21.92 ? 539  ASP B CB  1 
ATOM   5167 C CG  . ASP B 2 539 ? 15.823  -102.553 -6.502  1.00 22.79 ? 539  ASP B CG  1 
ATOM   5168 O OD1 . ASP B 2 539 ? 14.560  -102.613 -6.304  1.00 21.34 ? 539  ASP B OD1 1 
ATOM   5169 O OD2 . ASP B 2 539 ? 16.420  -101.469 -6.673  1.00 22.09 ? 539  ASP B OD2 1 
ATOM   5170 N N   . GLU B 2 540 ? 18.860  -102.105 -8.562  1.00 21.72 ? 540  GLU B N   1 
ATOM   5171 C CA  . GLU B 2 540 ? 20.026  -101.257 -8.631  1.00 22.20 ? 540  GLU B CA  1 
ATOM   5172 C C   . GLU B 2 540 ? 19.973  -99.992  -7.759  1.00 22.66 ? 540  GLU B C   1 
ATOM   5173 O O   . GLU B 2 540 ? 20.844  -99.151  -7.870  1.00 22.51 ? 540  GLU B O   1 
ATOM   5174 C CB  . GLU B 2 540 ? 20.349  -100.915 -10.092 1.00 21.96 ? 540  GLU B CB  1 
ATOM   5175 C CG  . GLU B 2 540 ? 20.681  -102.194 -10.927 1.00 21.75 ? 540  GLU B CG  1 
ATOM   5176 C CD  . GLU B 2 540 ? 21.079  -101.866 -12.341 1.00 23.79 ? 540  GLU B CD  1 
ATOM   5177 O OE1 . GLU B 2 540 ? 20.202  -101.452 -13.119 1.00 27.03 ? 540  GLU B OE1 1 
ATOM   5178 O OE2 . GLU B 2 540 ? 22.279  -101.986 -12.651 1.00 26.65 ? 540  GLU B OE2 1 
ATOM   5179 N N   . ARG B 2 541 ? 18.963  -99.855  -6.909  1.00 23.52 ? 541  ARG B N   1 
ATOM   5180 C CA  . ARG B 2 541 ? 18.870  -98.682  -6.046  1.00 24.88 ? 541  ARG B CA  1 
ATOM   5181 C C   . ARG B 2 541 ? 19.592  -98.833  -4.696  1.00 26.04 ? 541  ARG B C   1 
ATOM   5182 O O   . ARG B 2 541 ? 19.332  -98.057  -3.786  1.00 26.07 ? 541  ARG B O   1 
ATOM   5183 C CB  . ARG B 2 541 ? 17.404  -98.294  -5.775  1.00 24.52 ? 541  ARG B CB  1 
ATOM   5184 C CG  . ARG B 2 541 ? 16.518  -98.128  -6.956  1.00 23.76 ? 541  ARG B CG  1 
ATOM   5185 C CD  . ARG B 2 541 ? 15.413  -99.174  -6.843  1.00 32.85 ? 541  ARG B CD  1 
ATOM   5186 N NE  . ARG B 2 541 ? 14.181  -98.505  -6.551  1.00 32.61 ? 541  ARG B NE  1 
ATOM   5187 C CZ  . ARG B 2 541 ? 13.046  -99.074  -6.187  1.00 28.43 ? 541  ARG B CZ  1 
ATOM   5188 N NH1 . ARG B 2 541 ? 12.924  -100.384 -5.985  1.00 24.99 ? 541  ARG B NH1 1 
ATOM   5189 N NH2 . ARG B 2 541 ? 12.033  -98.266  -5.968  1.00 26.46 ? 541  ARG B NH2 1 
ATOM   5190 N N   . GLY B 2 542 ? 20.460  -99.823  -4.522  1.00 26.96 ? 542  GLY B N   1 
ATOM   5191 C CA  . GLY B 2 542 ? 21.056  -100.023 -3.184  1.00 28.04 ? 542  GLY B CA  1 
ATOM   5192 C C   . GLY B 2 542 ? 20.165  -100.891 -2.289  1.00 29.10 ? 542  GLY B C   1 
ATOM   5193 O O   . GLY B 2 542 ? 19.125  -101.372 -2.734  1.00 29.51 ? 542  GLY B O   1 
ATOM   5194 N N   . ALA B 2 543 ? 20.575  -101.093 -1.035  1.00 29.31 ? 543  ALA B N   1 
ATOM   5195 C CA  . ALA B 2 543 ? 19.924  -102.056 -0.128  1.00 29.95 ? 543  ALA B CA  1 
ATOM   5196 C C   . ALA B 2 543 ? 18.387  -101.889 -0.065  1.00 29.93 ? 543  ALA B C   1 
ATOM   5197 O O   . ALA B 2 543 ? 17.904  -100.769 0.191   1.00 30.16 ? 543  ALA B O   1 
ATOM   5198 C CB  . ALA B 2 543 ? 20.526  -101.911 1.276   1.00 29.65 ? 543  ALA B CB  1 
ATOM   5199 N N   . PRO B 2 544 ? 17.619  -102.980 -0.285  1.00 29.90 ? 544  PRO B N   1 
ATOM   5200 C CA  . PRO B 2 544 ? 16.151  -102.857 -0.237  1.00 29.94 ? 544  PRO B CA  1 
ATOM   5201 C C   . PRO B 2 544 ? 15.654  -102.475 1.153   1.00 29.82 ? 544  PRO B C   1 
ATOM   5202 O O   . PRO B 2 544 ? 14.600  -101.856 1.269   1.00 29.24 ? 544  PRO B O   1 
ATOM   5203 C CB  . PRO B 2 544 ? 15.659  -104.253 -0.614  1.00 29.96 ? 544  PRO B CB  1 
ATOM   5204 C CG  . PRO B 2 544 ? 16.812  -104.922 -1.295  1.00 30.63 ? 544  PRO B CG  1 
ATOM   5205 C CD  . PRO B 2 544 ? 18.028  -104.364 -0.583  1.00 29.67 ? 544  PRO B CD  1 
ATOM   5206 N N   . ASP B 2 545 ? 16.440  -102.844 2.174   1.00 30.54 ? 545  ASP B N   1 
ATOM   5207 C CA  . ASP B 2 545 ? 16.305  -102.381 3.561   1.00 31.23 ? 545  ASP B CA  1 
ATOM   5208 C C   . ASP B 2 545 ? 16.248  -100.860 3.713   1.00 30.89 ? 545  ASP B C   1 
ATOM   5209 O O   . ASP B 2 545 ? 15.736  -100.362 4.726   1.00 30.24 ? 545  ASP B O   1 
ATOM   5210 C CB  . ASP B 2 545 ? 17.538  -102.805 4.369   1.00 32.50 ? 545  ASP B CB  1 
ATOM   5211 C CG  . ASP B 2 545 ? 17.414  -104.186 4.944   1.00 35.50 ? 545  ASP B CG  1 
ATOM   5212 O OD1 . ASP B 2 545 ? 16.358  -104.849 4.753   1.00 36.37 ? 545  ASP B OD1 1 
ATOM   5213 O OD2 . ASP B 2 545 ? 18.393  -104.603 5.604   1.00 40.08 ? 545  ASP B OD2 1 
ATOM   5214 N N   . SER B 2 546 ? 16.826  -100.136 2.753   1.00 30.12 ? 546  SER B N   1 
ATOM   5215 C CA  . SER B 2 546 ? 16.905  -98.671  2.849   1.00 30.27 ? 546  SER B CA  1 
ATOM   5216 C C   . SER B 2 546 ? 15.576  -98.020  2.476   1.00 29.81 ? 546  SER B C   1 
ATOM   5217 O O   . SER B 2 546 ? 15.423  -96.799  2.582   1.00 29.54 ? 546  SER B O   1 
ATOM   5218 C CB  . SER B 2 546 ? 18.063  -98.103  2.007   1.00 30.32 ? 546  SER B CB  1 
ATOM   5219 O OG  . SER B 2 546 ? 17.868  -98.333  0.622   1.00 30.38 ? 546  SER B OG  1 
ATOM   5220 N N   . ARG B 2 547 ? 14.613  -98.852  2.086   1.00 28.46 ? 547  ARG B N   1 
ATOM   5221 C CA  . ARG B 2 547 ? 13.293  -98.397  1.670   1.00 28.25 ? 547  ARG B CA  1 
ATOM   5222 C C   . ARG B 2 547 ? 12.215  -99.151  2.464   1.00 27.15 ? 547  ARG B C   1 
ATOM   5223 O O   . ARG B 2 547 ? 12.472  -100.257 2.942   1.00 26.61 ? 547  ARG B O   1 
ATOM   5224 C CB  . ARG B 2 547 ? 13.087  -98.713  0.195   1.00 28.62 ? 547  ARG B CB  1 
ATOM   5225 C CG  . ARG B 2 547 ? 13.854  -97.850  -0.775  1.00 28.52 ? 547  ARG B CG  1 
ATOM   5226 C CD  . ARG B 2 547 ? 13.551  -98.293  -2.219  1.00 29.25 ? 547  ARG B CD  1 
ATOM   5227 N NE  . ARG B 2 547 ? 14.069  -99.626  -2.562  1.00 31.91 ? 547  ARG B NE  1 
ATOM   5228 C CZ  . ARG B 2 547 ? 15.362  -99.897  -2.778  1.00 31.49 ? 547  ARG B CZ  1 
ATOM   5229 N NH1 . ARG B 2 547 ? 16.278  -98.945  -2.668  1.00 29.19 ? 547  ARG B NH1 1 
ATOM   5230 N NH2 . ARG B 2 547 ? 15.745  -101.118 -3.073  1.00 29.87 ? 547  ARG B NH2 1 
ATOM   5231 N N   . PRO B 2 548 ? 11.006  -98.572  2.577   1.00 26.18 ? 548  PRO B N   1 
ATOM   5232 C CA  . PRO B 2 548 ? 9.922   -99.255  3.272   1.00 26.40 ? 548  PRO B CA  1 
ATOM   5233 C C   . PRO B 2 548 ? 9.695   -100.660 2.718   1.00 25.54 ? 548  PRO B C   1 
ATOM   5234 O O   . PRO B 2 548 ? 9.895   -100.885 1.517   1.00 24.35 ? 548  PRO B O   1 
ATOM   5235 C CB  . PRO B 2 548 ? 8.723   -98.356  2.988   1.00 26.83 ? 548  PRO B CB  1 
ATOM   5236 C CG  . PRO B 2 548 ? 9.343   -96.969  2.914   1.00 26.16 ? 548  PRO B CG  1 
ATOM   5237 C CD  . PRO B 2 548 ? 10.578  -97.242  2.103   1.00 27.31 ? 548  PRO B CD  1 
ATOM   5238 N N   . GLU B 2 549 ? 9.313   -101.592 3.593   1.00 25.43 ? 549  GLU B N   1 
ATOM   5239 C CA  . GLU B 2 549 ? 9.040   -102.992 3.210   1.00 26.44 ? 549  GLU B CA  1 
ATOM   5240 C C   . GLU B 2 549 ? 8.010   -103.071 2.081   1.00 24.58 ? 549  GLU B C   1 
ATOM   5241 O O   . GLU B 2 549 ? 8.041   -103.965 1.226   1.00 22.61 ? 549  GLU B O   1 
ATOM   5242 C CB  . GLU B 2 549 ? 8.526   -103.750 4.435   1.00 27.23 ? 549  GLU B CB  1 
ATOM   5243 C CG  . GLU B 2 549 ? 9.275   -105.038 4.735   1.00 31.94 ? 549  GLU B CG  1 
ATOM   5244 C CD  . GLU B 2 549 ? 8.565   -105.951 5.774   1.00 31.15 ? 549  GLU B CD  1 
ATOM   5245 O OE1 . GLU B 2 549 ? 9.113   -106.083 6.893   1.00 31.31 ? 549  GLU B OE1 1 
ATOM   5246 O OE2 . GLU B 2 549 ? 7.470   -106.536 5.467   1.00 36.02 ? 549  GLU B OE2 1 
ATOM   5247 N N   . SER B 2 550 ? 7.098   -102.108 2.061   1.00 24.05 ? 550  SER B N   1 
ATOM   5248 C CA  . SER B 2 550 ? 6.018   -102.117 1.060   1.00 23.99 ? 550  SER B CA  1 
ATOM   5249 C C   . SER B 2 550 ? 6.452   -101.668 -0.348  1.00 24.19 ? 550  SER B C   1 
ATOM   5250 O O   . SER B 2 550 ? 5.692   -101.835 -1.306  1.00 23.65 ? 550  SER B O   1 
ATOM   5251 C CB  . SER B 2 550 ? 4.902   -101.205 1.559   1.00 24.10 ? 550  SER B CB  1 
ATOM   5252 O OG  . SER B 2 550 ? 5.426   -99.917  1.697   1.00 23.52 ? 550  SER B OG  1 
ATOM   5253 N N   . CYS B 2 551 ? 7.652   -101.097 -0.475  1.00 24.75 ? 551  CYS B N   1 
ATOM   5254 C CA  . CYS B 2 551 ? 8.117   -100.622 -1.796  1.00 26.28 ? 551  CYS B CA  1 
ATOM   5255 C C   . CYS B 2 551 ? 8.391   -101.757 -2.776  1.00 25.14 ? 551  CYS B C   1 
ATOM   5256 O O   . CYS B 2 551 ? 9.135   -102.702 -2.465  1.00 25.28 ? 551  CYS B O   1 
ATOM   5257 C CB  . CYS B 2 551 ? 9.328   -99.679  -1.682  1.00 26.88 ? 551  CYS B CB  1 
ATOM   5258 S SG  . CYS B 2 551 ? 8.865   -98.092  -0.841  1.00 36.95 ? 551  CYS B SG  1 
ATOM   5259 N N   . PRO B 2 552 ? 7.764   -101.691 -3.972  1.00 24.45 ? 552  PRO B N   1 
ATOM   5260 C CA  . PRO B 2 552 ? 8.064   -102.720 -4.967  1.00 23.73 ? 552  PRO B CA  1 
ATOM   5261 C C   . PRO B 2 552 ? 9.532   -102.790 -5.345  1.00 23.07 ? 552  PRO B C   1 
ATOM   5262 O O   . PRO B 2 552 ? 10.196  -101.757 -5.415  1.00 24.35 ? 552  PRO B O   1 
ATOM   5263 C CB  . PRO B 2 552 ? 7.230   -102.295 -6.174  1.00 23.63 ? 552  PRO B CB  1 
ATOM   5264 C CG  . PRO B 2 552 ? 6.041   -101.613 -5.544  1.00 24.58 ? 552  PRO B CG  1 
ATOM   5265 C CD  . PRO B 2 552 ? 6.711   -100.771 -4.449  1.00 23.70 ? 552  PRO B CD  1 
ATOM   5266 N N   . VAL B 2 553 ? 10.025  -104.009 -5.556  1.00 22.93 ? 553  VAL B N   1 
ATOM   5267 C CA  . VAL B 2 553 ? 11.403  -104.219 -6.034  1.00 22.39 ? 553  VAL B CA  1 
ATOM   5268 C C   . VAL B 2 553 ? 11.407  -103.970 -7.540  1.00 21.74 ? 553  VAL B C   1 
ATOM   5269 O O   . VAL B 2 553 ? 10.344  -104.087 -8.193  1.00 22.08 ? 553  VAL B O   1 
ATOM   5270 C CB  . VAL B 2 553 ? 11.938  -105.607 -5.625  1.00 21.76 ? 553  VAL B CB  1 
ATOM   5271 C CG1 . VAL B 2 553 ? 11.959  -105.697 -4.050  1.00 21.81 ? 553  VAL B CG1 1 
ATOM   5272 C CG2 . VAL B 2 553 ? 11.099  -106.737 -6.225  1.00 21.48 ? 553  VAL B CG2 1 
ATOM   5273 N N   . GLU B 2 554 ? 12.553  -103.585 -8.091  1.00 20.22 ? 554  GLU B N   1 
ATOM   5274 C CA  . GLU B 2 554 ? 12.661  -103.425 -9.545  1.00 20.72 ? 554  GLU B CA  1 
ATOM   5275 C C   . GLU B 2 554 ? 12.381  -104.781 -10.239 1.00 21.59 ? 554  GLU B C   1 
ATOM   5276 O O   . GLU B 2 554 ? 11.625  -104.839 -11.223 1.00 22.77 ? 554  GLU B O   1 
ATOM   5277 C CB  . GLU B 2 554 ? 14.030  -102.928 -9.939  1.00 20.07 ? 554  GLU B CB  1 
ATOM   5278 C CG  . GLU B 2 554 ? 14.258  -101.461 -9.519  1.00 19.93 ? 554  GLU B CG  1 
ATOM   5279 C CD  . GLU B 2 554 ? 15.581  -100.945 -9.941  1.00 21.89 ? 554  GLU B CD  1 
ATOM   5280 O OE1 . GLU B 2 554 ? 15.713  -99.708  -9.949  1.00 23.39 ? 554  GLU B OE1 1 
ATOM   5281 O OE2 . GLU B 2 554 ? 16.489  -101.744 -10.266 1.00 21.93 ? 554  GLU B OE2 1 
ATOM   5282 N N   . ARG B 2 555 ? 13.006  -105.850 -9.733  1.00 21.69 ? 555  ARG B N   1 
ATOM   5283 C CA  . ARG B 2 555 ? 12.845  -107.188 -10.320 1.00 22.16 ? 555  ARG B CA  1 
ATOM   5284 C C   . ARG B 2 555 ? 12.938  -108.188 -9.215  1.00 23.00 ? 555  ARG B C   1 
ATOM   5285 O O   . ARG B 2 555 ? 13.667  -107.976 -8.229  1.00 22.54 ? 555  ARG B O   1 
ATOM   5286 C CB  . ARG B 2 555 ? 13.962  -107.525 -11.341 1.00 21.43 ? 555  ARG B CB  1 
ATOM   5287 C CG  . ARG B 2 555 ? 14.344  -106.428 -12.369 1.00 22.31 ? 555  ARG B CG  1 
ATOM   5288 C CD  . ARG B 2 555 ? 15.779  -106.601 -12.841 1.00 23.14 ? 555  ARG B CD  1 
ATOM   5289 N NE  . ARG B 2 555 ? 16.229  -105.481 -13.659 1.00 24.44 ? 555  ARG B NE  1 
ATOM   5290 C CZ  . ARG B 2 555 ? 16.630  -104.315 -13.162 1.00 26.41 ? 555  ARG B CZ  1 
ATOM   5291 N NH1 . ARG B 2 555 ? 16.669  -104.113 -11.849 1.00 27.26 ? 555  ARG B NH1 1 
ATOM   5292 N NH2 . ARG B 2 555 ? 16.987  -103.361 -13.976 1.00 26.28 ? 555  ARG B NH2 1 
ATOM   5293 N N   . VAL B 2 556 ? 12.243  -109.308 -9.412  1.00 22.42 ? 556  VAL B N   1 
ATOM   5294 C CA  . VAL B 2 556 ? 12.433  -110.479 -8.587  1.00 23.99 ? 556  VAL B CA  1 
ATOM   5295 C C   . VAL B 2 556 ? 12.528  -111.697 -9.534  1.00 22.94 ? 556  VAL B C   1 
ATOM   5296 O O   . VAL B 2 556 ? 11.725  -111.850 -10.476 1.00 23.13 ? 556  VAL B O   1 
ATOM   5297 C CB  . VAL B 2 556 ? 11.349  -110.616 -7.439  1.00 24.07 ? 556  VAL B CB  1 
ATOM   5298 C CG1 . VAL B 2 556 ? 9.953   -110.788 -7.972  1.00 25.94 ? 556  VAL B CG1 1 
ATOM   5299 C CG2 . VAL B 2 556 ? 11.680  -111.755 -6.441  1.00 26.35 ? 556  VAL B CG2 1 
ATOM   5300 N N   . PHE B 2 557 ? 13.517  -112.535 -9.263  1.00 23.42 ? 557  PHE B N   1 
ATOM   5301 C CA  . PHE B 2 557 ? 13.713  -113.784 -9.990  1.00 23.50 ? 557  PHE B CA  1 
ATOM   5302 C C   . PHE B 2 557 ? 13.723  -114.924 -8.978  1.00 23.62 ? 557  PHE B C   1 
ATOM   5303 O O   . PHE B 2 557 ? 14.546  -114.960 -8.078  1.00 24.81 ? 557  PHE B O   1 
ATOM   5304 C CB  . PHE B 2 557 ? 15.036  -113.716 -10.767 1.00 22.83 ? 557  PHE B CB  1 
ATOM   5305 C CG  . PHE B 2 557 ? 15.317  -114.935 -11.616 1.00 25.49 ? 557  PHE B CG  1 
ATOM   5306 C CD1 . PHE B 2 557 ? 14.352  -115.431 -12.491 1.00 25.88 ? 557  PHE B CD1 1 
ATOM   5307 C CD2 . PHE B 2 557 ? 16.568  -115.543 -11.575 1.00 25.91 ? 557  PHE B CD2 1 
ATOM   5308 C CE1 . PHE B 2 557 ? 14.631  -116.545 -13.329 1.00 24.61 ? 557  PHE B CE1 1 
ATOM   5309 C CE2 . PHE B 2 557 ? 16.864  -116.677 -12.396 1.00 23.77 ? 557  PHE B CE2 1 
ATOM   5310 C CZ  . PHE B 2 557 ? 15.867  -117.179 -13.268 1.00 24.00 ? 557  PHE B CZ  1 
ATOM   5311 N N   . ILE B 2 558 ? 12.831  -115.884 -9.173  1.00 22.53 ? 558  ILE B N   1 
ATOM   5312 C CA  . ILE B 2 558 ? 12.602  -116.960 -8.187  1.00 22.39 ? 558  ILE B CA  1 
ATOM   5313 C C   . ILE B 2 558 ? 12.825  -118.271 -8.880  1.00 22.39 ? 558  ILE B C   1 
ATOM   5314 O O   . ILE B 2 558 ? 12.262  -118.498 -9.932  1.00 23.66 ? 558  ILE B O   1 
ATOM   5315 C CB  . ILE B 2 558 ? 11.124  -116.909 -7.653  1.00 22.49 ? 558  ILE B CB  1 
ATOM   5316 C CG1 . ILE B 2 558 ? 10.921  -115.642 -6.798  1.00 19.39 ? 558  ILE B CG1 1 
ATOM   5317 C CG2 . ILE B 2 558 ? 10.817  -118.106 -6.747  1.00 23.02 ? 558  ILE B CG2 1 
ATOM   5318 C CD1 . ILE B 2 558 ? 9.494   -115.050 -6.919  1.00 23.17 ? 558  ILE B CD1 1 
ATOM   5319 N N   . TYR B 2 559 ? 13.638  -119.147 -8.308  1.00 22.84 ? 559  TYR B N   1 
ATOM   5320 C CA  . TYR B 2 559 ? 13.844  -120.464 -8.941  1.00 22.82 ? 559  TYR B CA  1 
ATOM   5321 C C   . TYR B 2 559 ? 14.114  -121.512 -7.848  1.00 22.37 ? 559  TYR B C   1 
ATOM   5322 O O   . TYR B 2 559 ? 14.852  -121.267 -6.891  1.00 21.95 ? 559  TYR B O   1 
ATOM   5323 C CB  . TYR B 2 559 ? 14.953  -120.438 -10.018 1.00 22.86 ? 559  TYR B CB  1 
ATOM   5324 C CG  . TYR B 2 559 ? 16.300  -119.948 -9.465  1.00 23.01 ? 559  TYR B CG  1 
ATOM   5325 C CD1 . TYR B 2 559 ? 17.197  -120.852 -8.880  1.00 22.02 ? 559  TYR B CD1 1 
ATOM   5326 C CD2 . TYR B 2 559 ? 16.629  -118.599 -9.490  1.00 23.62 ? 559  TYR B CD2 1 
ATOM   5327 C CE1 . TYR B 2 559 ? 18.419  -120.421 -8.349  1.00 19.51 ? 559  TYR B CE1 1 
ATOM   5328 C CE2 . TYR B 2 559 ? 17.836  -118.146 -8.973  1.00 23.80 ? 559  TYR B CE2 1 
ATOM   5329 C CZ  . TYR B 2 559 ? 18.733  -119.075 -8.406  1.00 24.12 ? 559  TYR B CZ  1 
ATOM   5330 O OH  . TYR B 2 559 ? 19.909  -118.637 -7.858  1.00 23.17 ? 559  TYR B OH  1 
ATOM   5331 N N   . ARG B 2 560 ? 13.464  -122.667 -7.996  1.00 22.44 ? 560  ARG B N   1 
ATOM   5332 C CA  . ARG B 2 560 ? 13.752  -123.840 -7.183  1.00 22.32 ? 560  ARG B CA  1 
ATOM   5333 C C   . ARG B 2 560 ? 15.193  -124.320 -7.391  1.00 22.24 ? 560  ARG B C   1 
ATOM   5334 O O   . ARG B 2 560 ? 15.734  -124.294 -8.524  1.00 23.02 ? 560  ARG B O   1 
ATOM   5335 C CB  . ARG B 2 560 ? 12.744  -124.966 -7.487  1.00 22.04 ? 560  ARG B CB  1 
ATOM   5336 C CG  . ARG B 2 560 ? 12.916  -125.599 -8.875  1.00 22.78 ? 560  ARG B CG  1 
ATOM   5337 C CD  . ARG B 2 560 ? 11.782  -126.630 -9.156  1.00 21.79 ? 560  ARG B CD  1 
ATOM   5338 N NE  . ARG B 2 560 ? 11.993  -127.196 -10.482 1.00 23.01 ? 560  ARG B NE  1 
ATOM   5339 C CZ  . ARG B 2 560 ? 11.189  -128.086 -11.071 1.00 26.56 ? 560  ARG B CZ  1 
ATOM   5340 N NH1 . ARG B 2 560 ? 10.109  -128.527 -10.454 1.00 24.93 ? 560  ARG B NH1 1 
ATOM   5341 N NH2 . ARG B 2 560 ? 11.470  -128.517 -12.288 1.00 25.62 ? 560  ARG B NH2 1 
ATOM   5342 N N   . THR B 2 561 ? 15.806  -124.816 -6.311  1.00 21.76 ? 561  THR B N   1 
ATOM   5343 C CA  . THR B 2 561 ? 17.218  -125.240 -6.375  1.00 21.87 ? 561  THR B CA  1 
ATOM   5344 C C   . THR B 2 561 ? 17.497  -126.263 -5.294  1.00 21.61 ? 561  THR B C   1 
ATOM   5345 O O   . THR B 2 561 ? 16.859  -126.241 -4.242  1.00 22.61 ? 561  THR B O   1 
ATOM   5346 C CB  . THR B 2 561 ? 18.220  -124.043 -6.326  1.00 21.93 ? 561  THR B CB  1 
ATOM   5347 O OG1 . THR B 2 561 ? 19.547  -124.576 -6.219  1.00 21.74 ? 561  THR B OG1 1 
ATOM   5348 C CG2 . THR B 2 561 ? 17.954  -123.119 -5.104  1.00 21.94 ? 561  THR B CG2 1 
ATOM   5349 N N   . VAL B 2 562 ? 18.399  -127.196 -5.570  1.00 22.33 ? 562  VAL B N   1 
ATOM   5350 C CA  . VAL B 2 562 ? 18.846  -128.121 -4.521  1.00 22.22 ? 562  VAL B CA  1 
ATOM   5351 C C   . VAL B 2 562 ? 20.172  -127.660 -3.930  1.00 22.94 ? 562  VAL B C   1 
ATOM   5352 O O   . VAL B 2 562 ? 20.693  -128.280 -3.010  1.00 21.26 ? 562  VAL B O   1 
ATOM   5353 C CB  . VAL B 2 562 ? 18.930  -129.604 -4.993  1.00 22.37 ? 562  VAL B CB  1 
ATOM   5354 C CG1 . VAL B 2 562 ? 17.560  -130.118 -5.395  1.00 22.16 ? 562  VAL B CG1 1 
ATOM   5355 C CG2 . VAL B 2 562 ? 19.960  -129.790 -6.133  1.00 22.48 ? 562  VAL B CG2 1 
ATOM   5356 N N   . ALA B 2 563 ? 20.698  -126.550 -4.450  1.00 22.96 ? 563  ALA B N   1 
ATOM   5357 C CA  . ALA B 2 563 ? 22.032  -126.083 -4.079  1.00 23.40 ? 563  ALA B CA  1 
ATOM   5358 C C   . ALA B 2 563 ? 21.992  -124.988 -3.031  1.00 23.80 ? 563  ALA B C   1 
ATOM   5359 O O   . ALA B 2 563 ? 23.006  -124.680 -2.441  1.00 23.50 ? 563  ALA B O   1 
ATOM   5360 C CB  . ALA B 2 563 ? 22.748  -125.574 -5.304  1.00 22.77 ? 563  ALA B CB  1 
ATOM   5361 N N   . GLY B 2 564 ? 20.841  -124.340 -2.860  1.00 23.68 ? 564  GLY B N   1 
ATOM   5362 C CA  . GLY B 2 564 ? 20.747  -123.276 -1.884  1.00 24.67 ? 564  GLY B CA  1 
ATOM   5363 C C   . GLY B 2 564 ? 21.218  -121.979 -2.508  1.00 25.06 ? 564  GLY B C   1 
ATOM   5364 O O   . GLY B 2 564 ? 21.440  -121.920 -3.739  1.00 25.68 ? 564  GLY B O   1 
ATOM   5365 N N   . PRO B 2 565 ? 21.351  -120.917 -1.683  1.00 25.41 ? 565  PRO B N   1 
ATOM   5366 C CA  . PRO B 2 565 ? 21.819  -119.638 -2.187  1.00 24.68 ? 565  PRO B CA  1 
ATOM   5367 C C   . PRO B 2 565 ? 23.151  -119.738 -2.956  1.00 24.82 ? 565  PRO B C   1 
ATOM   5368 O O   . PRO B 2 565 ? 24.060  -120.449 -2.565  1.00 23.27 ? 565  PRO B O   1 
ATOM   5369 C CB  . PRO B 2 565 ? 21.993  -118.809 -0.916  1.00 25.11 ? 565  PRO B CB  1 
ATOM   5370 C CG  . PRO B 2 565 ? 21.004  -119.394 0.032   1.00 25.81 ? 565  PRO B CG  1 
ATOM   5371 C CD  . PRO B 2 565 ? 21.095  -120.862 -0.226  1.00 25.42 ? 565  PRO B CD  1 
ATOM   5372 N N   . ARG B 2 566 ? 23.182  -119.004 -4.056  1.00 24.88 ? 566  ARG B N   1 
ATOM   5373 C CA  . ARG B 2 566 ? 24.297  -118.742 -4.960  1.00 25.86 ? 566  ARG B CA  1 
ATOM   5374 C C   . ARG B 2 566 ? 25.499  -118.087 -4.284  1.00 25.64 ? 566  ARG B C   1 
ATOM   5375 O O   . ARG B 2 566 ? 25.331  -117.250 -3.395  1.00 26.33 ? 566  ARG B O   1 
ATOM   5376 C CB  . ARG B 2 566 ? 23.675  -117.750 -5.960  1.00 26.61 ? 566  ARG B CB  1 
ATOM   5377 C CG  . ARG B 2 566 ? 24.281  -117.552 -7.208  1.00 28.46 ? 566  ARG B CG  1 
ATOM   5378 C CD  . ARG B 2 566 ? 23.178  -117.332 -8.248  1.00 25.21 ? 566  ARG B CD  1 
ATOM   5379 N NE  . ARG B 2 566 ? 22.571  -116.011 -8.441  1.00 21.68 ? 566  ARG B NE  1 
ATOM   5380 C CZ  . ARG B 2 566 ? 23.138  -114.952 -9.024  1.00 23.18 ? 566  ARG B CZ  1 
ATOM   5381 N NH1 . ARG B 2 566 ? 24.426  -114.941 -9.366  1.00 20.93 ? 566  ARG B NH1 1 
ATOM   5382 N NH2 . ARG B 2 566 ? 22.403  -113.868 -9.228  1.00 21.06 ? 566  ARG B NH2 1 
ATOM   5383 N N   . PHE B 2 567 ? 26.713  -118.433 -4.716  1.00 25.27 ? 567  PHE B N   1 
ATOM   5384 C CA  . PHE B 2 567 ? 27.926  -117.887 -4.082  1.00 25.72 ? 567  PHE B CA  1 
ATOM   5385 C C   . PHE B 2 567 ? 28.500  -116.697 -4.849  1.00 25.53 ? 567  PHE B C   1 
ATOM   5386 O O   . PHE B 2 567 ? 29.483  -116.072 -4.422  1.00 24.71 ? 567  PHE B O   1 
ATOM   5387 C CB  . PHE B 2 567 ? 28.993  -118.973 -3.920  1.00 26.88 ? 567  PHE B CB  1 
ATOM   5388 C CG  . PHE B 2 567 ? 28.686  -119.961 -2.844  1.00 28.66 ? 567  PHE B CG  1 
ATOM   5389 C CD1 . PHE B 2 567 ? 29.164  -119.769 -1.560  1.00 31.22 ? 567  PHE B CD1 1 
ATOM   5390 C CD2 . PHE B 2 567 ? 27.889  -121.081 -3.109  1.00 31.41 ? 567  PHE B CD2 1 
ATOM   5391 C CE1 . PHE B 2 567 ? 28.875  -120.690 -0.548  1.00 33.33 ? 567  PHE B CE1 1 
ATOM   5392 C CE2 . PHE B 2 567 ? 27.594  -122.000 -2.097  1.00 30.70 ? 567  PHE B CE2 1 
ATOM   5393 C CZ  . PHE B 2 567 ? 28.074  -121.797 -0.824  1.00 30.77 ? 567  PHE B CZ  1 
ATOM   5394 N N   . ASP B 2 568 ? 27.855  -116.356 -5.961  1.00 24.92 ? 568  ASP B N   1 
ATOM   5395 C CA  . ASP B 2 568 ? 28.435  -115.393 -6.886  1.00 24.60 ? 568  ASP B CA  1 
ATOM   5396 C C   . ASP B 2 568 ? 27.505  -114.233 -7.195  1.00 24.59 ? 568  ASP B C   1 
ATOM   5397 O O   . ASP B 2 568 ? 27.539  -113.719 -8.312  1.00 24.43 ? 568  ASP B O   1 
ATOM   5398 C CB  . ASP B 2 568 ? 28.826  -116.102 -8.182  1.00 24.40 ? 568  ASP B CB  1 
ATOM   5399 C CG  . ASP B 2 568 ? 27.628  -116.650 -8.934  1.00 22.22 ? 568  ASP B CG  1 
ATOM   5400 O OD1 . ASP B 2 568 ? 26.466  -116.640 -8.408  1.00 21.33 ? 568  ASP B OD1 1 
ATOM   5401 O OD2 . ASP B 2 568 ? 27.858  -117.109 -10.073 1.00 23.53 ? 568  ASP B OD2 1 
ATOM   5402 N N   . MET B 2 569 ? 26.678  -113.810 -6.225  1.00 23.53 ? 569  MET B N   1 
ATOM   5403 C CA  . MET B 2 569 ? 25.768  -112.670 -6.476  1.00 22.65 ? 569  MET B CA  1 
ATOM   5404 C C   . MET B 2 569 ? 26.563  -111.368 -6.458  1.00 21.42 ? 569  MET B C   1 
ATOM   5405 O O   . MET B 2 569 ? 27.435  -111.194 -5.621  1.00 21.17 ? 569  MET B O   1 
ATOM   5406 C CB  . MET B 2 569 ? 24.637  -112.574 -5.432  1.00 22.91 ? 569  MET B CB  1 
ATOM   5407 C CG  . MET B 2 569 ? 23.628  -113.685 -5.489  1.00 22.91 ? 569  MET B CG  1 
ATOM   5408 S SD  . MET B 2 569 ? 22.432  -113.609 -4.109  1.00 25.23 ? 569  MET B SD  1 
ATOM   5409 C CE  . MET B 2 569 ? 23.405  -114.329 -2.794  1.00 25.85 ? 569  MET B CE  1 
ATOM   5410 N N   . PRO B 2 570 ? 26.253  -110.450 -7.388  1.00 20.62 ? 570  PRO B N   1 
ATOM   5411 C CA  . PRO B 2 570 ? 26.870  -109.145 -7.391  1.00 20.97 ? 570  PRO B CA  1 
ATOM   5412 C C   . PRO B 2 570 ? 26.202  -108.320 -6.290  1.00 20.80 ? 570  PRO B C   1 
ATOM   5413 O O   . PRO B 2 570 ? 25.282  -108.814 -5.627  1.00 20.48 ? 570  PRO B O   1 
ATOM   5414 C CB  . PRO B 2 570 ? 26.492  -108.602 -8.772  1.00 20.28 ? 570  PRO B CB  1 
ATOM   5415 C CG  . PRO B 2 570 ? 25.126  -109.198 -8.991  1.00 20.69 ? 570  PRO B CG  1 
ATOM   5416 C CD  . PRO B 2 570 ? 25.275  -110.598 -8.486  1.00 19.92 ? 570  PRO B CD  1 
ATOM   5417 N N   . GLY B 2 571 ? 26.607  -107.070 -6.175  1.00 21.42 ? 571  GLY B N   1 
ATOM   5418 C CA  . GLY B 2 571 ? 26.188  -106.205 -5.073  1.00 22.16 ? 571  GLY B CA  1 
ATOM   5419 C C   . GLY B 2 571 ? 24.732  -105.806 -5.145  1.00 21.61 ? 571  GLY B C   1 
ATOM   5420 O O   . GLY B 2 571 ? 24.174  -105.338 -4.165  1.00 21.80 ? 571  GLY B O   1 
ATOM   5421 N N   . PHE B 2 572 ? 24.136  -105.973 -6.318  1.00 21.41 ? 572  PHE B N   1 
ATOM   5422 C CA  . PHE B 2 572 ? 22.767  -105.540 -6.584  1.00 21.99 ? 572  PHE B CA  1 
ATOM   5423 C C   . PHE B 2 572 ? 21.822  -106.742 -6.606  1.00 21.46 ? 572  PHE B C   1 
ATOM   5424 O O   . PHE B 2 572 ? 20.681  -106.639 -7.012  1.00 22.11 ? 572  PHE B O   1 
ATOM   5425 C CB  . PHE B 2 572 ? 22.668  -104.729 -7.899  1.00 22.24 ? 572  PHE B CB  1 
ATOM   5426 C CG  . PHE B 2 572 ? 22.999  -105.523 -9.142  1.00 21.94 ? 572  PHE B CG  1 
ATOM   5427 C CD1 . PHE B 2 572 ? 22.059  -106.368 -9.744  1.00 23.51 ? 572  PHE B CD1 1 
ATOM   5428 C CD2 . PHE B 2 572 ? 24.277  -105.449 -9.683  1.00 23.53 ? 572  PHE B CD2 1 
ATOM   5429 C CE1 . PHE B 2 572 ? 22.414  -107.115 -10.881 1.00 22.11 ? 572  PHE B CE1 1 
ATOM   5430 C CE2 . PHE B 2 572 ? 24.620  -106.164 -10.823 1.00 24.64 ? 572  PHE B CE2 1 
ATOM   5431 C CZ  . PHE B 2 572 ? 23.705  -106.990 -11.411 1.00 22.38 ? 572  PHE B CZ  1 
ATOM   5432 N N   . VAL B 2 573 ? 22.300  -107.890 -6.163  1.00 21.87 ? 573  VAL B N   1 
ATOM   5433 C CA  . VAL B 2 573 ? 21.396  -109.022 -5.993  1.00 21.97 ? 573  VAL B CA  1 
ATOM   5434 C C   . VAL B 2 573 ? 21.391  -109.470 -4.532  1.00 22.17 ? 573  VAL B C   1 
ATOM   5435 O O   . VAL B 2 573 ? 22.451  -109.565 -3.924  1.00 21.52 ? 573  VAL B O   1 
ATOM   5436 C CB  . VAL B 2 573 ? 21.752  -110.185 -6.966  1.00 22.18 ? 573  VAL B CB  1 
ATOM   5437 C CG1 . VAL B 2 573 ? 20.817  -111.417 -6.765  1.00 21.26 ? 573  VAL B CG1 1 
ATOM   5438 C CG2 . VAL B 2 573 ? 21.653  -109.688 -8.417  1.00 21.30 ? 573  VAL B CG2 1 
ATOM   5439 N N   . TRP B 2 574 ? 20.184  -109.757 -4.003  1.00 22.92 ? 574  TRP B N   1 
ATOM   5440 C CA  . TRP B 2 574 ? 19.983  -110.231 -2.639  1.00 23.64 ? 574  TRP B CA  1 
ATOM   5441 C C   . TRP B 2 574 ? 19.119  -111.480 -2.630  1.00 23.86 ? 574  TRP B C   1 
ATOM   5442 O O   . TRP B 2 574 ? 18.063  -111.500 -3.235  1.00 23.51 ? 574  TRP B O   1 
ATOM   5443 C CB  . TRP B 2 574 ? 19.305  -109.143 -1.781  1.00 24.94 ? 574  TRP B CB  1 
ATOM   5444 C CG  . TRP B 2 574 ? 20.157  -107.928 -1.576  1.00 26.19 ? 574  TRP B CG  1 
ATOM   5445 C CD1 . TRP B 2 574 ? 21.069  -107.727 -0.580  1.00 28.20 ? 574  TRP B CD1 1 
ATOM   5446 C CD2 . TRP B 2 574 ? 20.178  -106.750 -2.389  1.00 27.36 ? 574  TRP B CD2 1 
ATOM   5447 N NE1 . TRP B 2 574 ? 21.656  -106.478 -0.719  1.00 29.60 ? 574  TRP B NE1 1 
ATOM   5448 C CE2 . TRP B 2 574 ? 21.130  -105.870 -1.831  1.00 28.41 ? 574  TRP B CE2 1 
ATOM   5449 C CE3 . TRP B 2 574 ? 19.476  -106.350 -3.537  1.00 29.41 ? 574  TRP B CE3 1 
ATOM   5450 C CZ2 . TRP B 2 574 ? 21.393  -104.611 -2.373  1.00 28.63 ? 574  TRP B CZ2 1 
ATOM   5451 C CZ3 . TRP B 2 574 ? 19.753  -105.093 -4.082  1.00 28.86 ? 574  TRP B CZ3 1 
ATOM   5452 C CH2 . TRP B 2 574 ? 20.695  -104.253 -3.510  1.00 27.95 ? 574  TRP B CH2 1 
ATOM   5453 N N   . ASN B 2 575 ? 19.575  -112.516 -1.938  1.00 23.74 ? 575  ASN B N   1 
ATOM   5454 C CA  . ASN B 2 575 ? 18.807  -113.725 -1.799  1.00 23.95 ? 575  ASN B CA  1 
ATOM   5455 C C   . ASN B 2 575 ? 17.990  -113.566 -0.512  1.00 23.97 ? 575  ASN B C   1 
ATOM   5456 O O   . ASN B 2 575 ? 18.535  -113.154 0.524   1.00 21.34 ? 575  ASN B O   1 
ATOM   5457 C CB  . ASN B 2 575 ? 19.761  -114.916 -1.675  1.00 24.55 ? 575  ASN B CB  1 
ATOM   5458 C CG  . ASN B 2 575 ? 19.033  -116.270 -1.647  1.00 27.20 ? 575  ASN B CG  1 
ATOM   5459 O OD1 . ASN B 2 575 ? 19.088  -117.025 -2.612  1.00 34.39 ? 575  ASN B OD1 1 
ATOM   5460 N ND2 . ASN B 2 575 ? 18.373  -116.578 -0.545  1.00 25.45 ? 575  ASN B ND2 1 
ATOM   5461 N N   . MET B 2 576 ? 16.701  -113.892 -0.571  1.00 23.33 ? 576  MET B N   1 
ATOM   5462 C CA  . MET B 2 576 ? 15.881  -113.733 0.609   1.00 25.31 ? 576  MET B CA  1 
ATOM   5463 C C   . MET B 2 576 ? 16.127  -114.962 1.514   1.00 25.79 ? 576  MET B C   1 
ATOM   5464 O O   . MET B 2 576 ? 15.303  -115.242 2.373   1.00 30.19 ? 576  MET B O   1 
ATOM   5465 C CB  . MET B 2 576 ? 14.402  -113.502 0.232   1.00 24.56 ? 576  MET B CB  1 
ATOM   5466 C CG  . MET B 2 576 ? 14.169  -112.354 -0.764  1.00 24.39 ? 576  MET B CG  1 
ATOM   5467 S SD  . MET B 2 576 ? 14.362  -110.693 -0.034  1.00 26.81 ? 576  MET B SD  1 
ATOM   5468 C CE  . MET B 2 576 ? 16.109  -110.367 -0.292  1.00 22.81 ? 576  MET B CE  1 
ATOM   5469 N N   . GLN C 3 1   ? 8.069   -94.388  -25.027 1.00 33.49 ? 1    GLN C N   1 
ATOM   5470 C CA  . GLN C 3 1   ? 9.186   -95.357  -25.268 1.00 33.45 ? 1    GLN C CA  1 
ATOM   5471 C C   . GLN C 3 1   ? 9.409   -96.239  -24.035 1.00 32.29 ? 1    GLN C C   1 
ATOM   5472 O O   . GLN C 3 1   ? 9.219   -95.772  -22.908 1.00 32.89 ? 1    GLN C O   1 
ATOM   5473 C CB  . GLN C 3 1   ? 10.472  -94.596  -25.619 1.00 33.37 ? 1    GLN C CB  1 
ATOM   5474 C CG  . GLN C 3 1   ? 11.674  -95.511  -25.917 1.00 35.84 ? 1    GLN C CG  1 
ATOM   5475 C CD  . GLN C 3 1   ? 12.776  -94.753  -26.671 1.00 34.81 ? 1    GLN C CD  1 
ATOM   5476 O OE1 . GLN C 3 1   ? 14.009  -95.016  -26.376 1.00 39.82 ? 1    GLN C OE1 1 
ATOM   5477 N NE2 . GLN C 3 1   ? 12.336  -93.836  -27.684 1.00 35.65 ? 1    GLN C NE2 1 
ATOM   5478 N N   . VAL C 3 2   ? 9.829   -97.493  -24.241 1.00 30.54 ? 2    VAL C N   1 
ATOM   5479 C CA  . VAL C 3 2   ? 9.969   -98.446  -23.144 1.00 28.89 ? 2    VAL C CA  1 
ATOM   5480 C C   . VAL C 3 2   ? 11.233  -99.322  -23.271 1.00 27.83 ? 2    VAL C C   1 
ATOM   5481 O O   . VAL C 3 2   ? 11.544  -99.823  -24.355 1.00 27.25 ? 2    VAL C O   1 
ATOM   5482 C CB  . VAL C 3 2   ? 8.709   -99.361  -23.043 1.00 29.22 ? 2    VAL C CB  1 
ATOM   5483 C CG1 . VAL C 3 2   ? 8.927   -100.479 -22.041 1.00 30.11 ? 2    VAL C CG1 1 
ATOM   5484 C CG2 . VAL C 3 2   ? 7.462   -98.565  -22.672 1.00 28.74 ? 2    VAL C CG2 1 
ATOM   5485 N N   . VAL C 3 3   ? 11.931  -99.522  -22.148 1.00 26.33 ? 3    VAL C N   1 
ATOM   5486 C CA  . VAL C 3 3   ? 13.146  -100.364 -22.094 1.00 25.27 ? 3    VAL C CA  1 
ATOM   5487 C C   . VAL C 3 3   ? 12.866  -101.850 -22.430 1.00 24.86 ? 3    VAL C C   1 
ATOM   5488 O O   . VAL C 3 3   ? 11.974  -102.459 -21.833 1.00 24.00 ? 3    VAL C O   1 
ATOM   5489 C CB  . VAL C 3 3   ? 13.867  -100.178 -20.718 1.00 25.38 ? 3    VAL C CB  1 
ATOM   5490 C CG1 . VAL C 3 3   ? 15.057  -101.135 -20.527 1.00 25.99 ? 3    VAL C CG1 1 
ATOM   5491 C CG2 . VAL C 3 3   ? 14.326  -98.703  -20.561 1.00 24.69 ? 3    VAL C CG2 1 
ATOM   5492 N N   . GLY C 3 4   ? 13.600  -102.409 -23.400 1.00 23.41 ? 4    GLY C N   1 
ATOM   5493 C CA  . GLY C 3 4   ? 13.444  -103.824 -23.791 1.00 23.63 ? 4    GLY C CA  1 
ATOM   5494 C C   . GLY C 3 4   ? 12.159  -104.138 -24.545 1.00 22.98 ? 4    GLY C C   1 
ATOM   5495 O O   . GLY C 3 4   ? 11.805  -105.306 -24.720 1.00 22.89 ? 4    GLY C O   1 
ATOM   5496 N N   . TRP C 3 5   ? 11.441  -103.080 -24.957 1.00 21.90 ? 5    TRP C N   1 
ATOM   5497 C CA  . TRP C 3 5   ? 10.240  -103.209 -25.780 1.00 21.27 ? 5    TRP C CA  1 
ATOM   5498 C C   . TRP C 3 5   ? 10.384  -102.394 -27.094 1.00 21.01 ? 5    TRP C C   1 
ATOM   5499 O O   . TRP C 3 5   ? 10.802  -101.206 -27.055 1.00 20.28 ? 5    TRP C O   1 
ATOM   5500 C CB  . TRP C 3 5   ? 8.969   -102.759 -25.020 1.00 21.50 ? 5    TRP C CB  1 
ATOM   5501 C CG  . TRP C 3 5   ? 7.734   -103.332 -25.634 1.00 21.35 ? 5    TRP C CG  1 
ATOM   5502 C CD1 . TRP C 3 5   ? 6.908   -102.719 -26.508 1.00 21.35 ? 5    TRP C CD1 1 
ATOM   5503 C CD2 . TRP C 3 5   ? 7.248   -104.682 -25.500 1.00 23.59 ? 5    TRP C CD2 1 
ATOM   5504 N NE1 . TRP C 3 5   ? 5.898   -103.571 -26.893 1.00 24.98 ? 5    TRP C NE1 1 
ATOM   5505 C CE2 . TRP C 3 5   ? 6.092   -104.787 -26.292 1.00 24.07 ? 5    TRP C CE2 1 
ATOM   5506 C CE3 . TRP C 3 5   ? 7.663   -105.798 -24.754 1.00 25.58 ? 5    TRP C CE3 1 
ATOM   5507 C CZ2 . TRP C 3 5   ? 5.341   -105.973 -26.375 1.00 25.42 ? 5    TRP C CZ2 1 
ATOM   5508 C CZ3 . TRP C 3 5   ? 6.916   -106.971 -24.831 1.00 22.59 ? 5    TRP C CZ3 1 
ATOM   5509 C CH2 . TRP C 3 5   ? 5.780   -107.051 -25.642 1.00 22.90 ? 5    TRP C CH2 1 
ATOM   5510 N N   . PRO C 3 6   ? 10.022  -102.995 -28.240 1.00 21.16 ? 6    PRO C N   1 
ATOM   5511 C CA  . PRO C 3 6   ? 9.503   -104.347 -28.383 1.00 21.91 ? 6    PRO C CA  1 
ATOM   5512 C C   . PRO C 3 6   ? 10.594  -105.383 -28.078 1.00 21.09 ? 6    PRO C C   1 
ATOM   5513 O O   . PRO C 3 6   ? 11.790  -105.050 -28.118 1.00 22.49 ? 6    PRO C O   1 
ATOM   5514 C CB  . PRO C 3 6   ? 9.086   -104.407 -29.871 1.00 21.88 ? 6    PRO C CB  1 
ATOM   5515 C CG  . PRO C 3 6   ? 9.086   -103.108 -30.333 1.00 22.25 ? 6    PRO C CG  1 
ATOM   5516 C CD  . PRO C 3 6   ? 10.079  -102.329 -29.549 1.00 21.84 ? 6    PRO C CD  1 
ATOM   5517 N N   . PRO C 3 7   ? 10.206  -106.638 -27.767 1.00 21.59 ? 7    PRO C N   1 
ATOM   5518 C CA  . PRO C 3 7   ? 11.190  -107.623 -27.343 1.00 21.56 ? 7    PRO C CA  1 
ATOM   5519 C C   . PRO C 3 7   ? 12.016  -108.237 -28.500 1.00 23.31 ? 7    PRO C C   1 
ATOM   5520 O O   . PRO C 3 7   ? 11.770  -109.399 -28.953 1.00 22.05 ? 7    PRO C O   1 
ATOM   5521 C CB  . PRO C 3 7   ? 10.321  -108.684 -26.680 1.00 21.03 ? 7    PRO C CB  1 
ATOM   5522 C CG  . PRO C 3 7   ? 9.095   -108.660 -27.511 1.00 20.92 ? 7    PRO C CG  1 
ATOM   5523 C CD  . PRO C 3 7   ? 8.851   -107.207 -27.824 1.00 20.44 ? 7    PRO C CD  1 
ATOM   5524 N N   . VAL C 3 8   ? 13.028  -107.483 -28.924 1.00 23.76 ? 8    VAL C N   1 
ATOM   5525 C CA  . VAL C 3 8   ? 13.878  -107.840 -30.061 1.00 24.75 ? 8    VAL C CA  1 
ATOM   5526 C C   . VAL C 3 8   ? 15.317  -107.585 -29.666 1.00 24.70 ? 8    VAL C C   1 
ATOM   5527 O O   . VAL C 3 8   ? 15.568  -106.836 -28.742 1.00 25.05 ? 8    VAL C O   1 
ATOM   5528 C CB  . VAL C 3 8   ? 13.590  -106.968 -31.346 1.00 24.44 ? 8    VAL C CB  1 
ATOM   5529 C CG1 . VAL C 3 8   ? 12.234  -107.286 -31.948 1.00 26.46 ? 8    VAL C CG1 1 
ATOM   5530 C CG2 . VAL C 3 8   ? 13.779  -105.474 -31.063 1.00 24.76 ? 8    VAL C CG2 1 
ATOM   5531 N N   . ARG C 3 9   ? 16.263  -108.189 -30.378 1.00 24.57 ? 9    ARG C N   1 
ATOM   5532 C CA  . ARG C 3 9   ? 17.672  -107.977 -30.074 1.00 25.07 ? 9    ARG C CA  1 
ATOM   5533 C C   . ARG C 3 9   ? 18.328  -106.863 -30.916 1.00 25.44 ? 9    ARG C C   1 
ATOM   5534 O O   . ARG C 3 9   ? 19.495  -106.495 -30.667 1.00 26.06 ? 9    ARG C O   1 
ATOM   5535 C CB  . ARG C 3 9   ? 18.446  -109.296 -30.173 1.00 25.74 ? 9    ARG C CB  1 
ATOM   5536 C CG  . ARG C 3 9   ? 18.157  -110.284 -29.026 1.00 25.45 ? 9    ARG C CG  1 
ATOM   5537 C CD  . ARG C 3 9   ? 19.376  -111.184 -28.775 1.00 24.65 ? 9    ARG C CD  1 
ATOM   5538 N NE  . ARG C 3 9   ? 18.986  -112.529 -28.400 1.00 23.50 ? 9    ARG C NE  1 
ATOM   5539 C CZ  . ARG C 3 9   ? 19.820  -113.567 -28.279 1.00 23.65 ? 9    ARG C CZ  1 
ATOM   5540 N NH1 . ARG C 3 9   ? 21.125  -113.422 -28.493 1.00 23.07 ? 9    ARG C NH1 1 
ATOM   5541 N NH2 . ARG C 3 9   ? 19.344  -114.758 -27.925 1.00 21.86 ? 9    ARG C NH2 1 
ATOM   5542 N N   . ASN C 3 10  ? 17.571  -106.322 -31.882 1.00 24.94 ? 10   ASN C N   1 
ATOM   5543 C CA  . ASN C 3 10  ? 17.991  -105.185 -32.742 1.00 24.47 ? 10   ASN C CA  1 
ATOM   5544 C C   . ASN C 3 10  ? 18.554  -104.001 -31.959 1.00 24.06 ? 10   ASN C C   1 
ATOM   5545 O O   . ASN C 3 10  ? 18.016  -103.634 -30.906 1.00 23.29 ? 10   ASN C O   1 
ATOM   5546 C CB  . ASN C 3 10  ? 16.794  -104.645 -33.564 1.00 23.91 ? 10   ASN C CB  1 
ATOM   5547 C CG  . ASN C 3 10  ? 16.145  -105.704 -34.443 1.00 25.46 ? 10   ASN C CG  1 
ATOM   5548 O OD1 . ASN C 3 10  ? 15.717  -106.757 -33.959 1.00 23.29 ? 10   ASN C OD1 1 
ATOM   5549 N ND2 . ASN C 3 10  ? 16.051  -105.417 -35.746 1.00 23.09 ? 10   ASN C ND2 1 
ATOM   5550 N N   . TYR C 3 11  ? 19.635  -103.413 -32.474 1.00 23.13 ? 11   TYR C N   1 
ATOM   5551 C CA  . TYR C 3 11  ? 20.086  -102.117 -31.990 1.00 23.78 ? 11   TYR C CA  1 
ATOM   5552 C C   . TYR C 3 11  ? 19.011  -101.088 -32.286 1.00 24.00 ? 11   TYR C C   1 
ATOM   5553 O O   . TYR C 3 11  ? 18.339  -101.174 -33.315 1.00 23.81 ? 11   TYR C O   1 
ATOM   5554 C CB  . TYR C 3 11  ? 21.310  -101.677 -32.774 1.00 23.73 ? 11   TYR C CB  1 
ATOM   5555 C CG  . TYR C 3 11  ? 22.598  -102.394 -32.485 1.00 23.97 ? 11   TYR C CG  1 
ATOM   5556 C CD1 . TYR C 3 11  ? 23.409  -102.835 -33.535 1.00 24.76 ? 11   TYR C CD1 1 
ATOM   5557 C CD2 . TYR C 3 11  ? 23.052  -102.573 -31.177 1.00 24.01 ? 11   TYR C CD2 1 
ATOM   5558 C CE1 . TYR C 3 11  ? 24.638  -103.456 -33.293 1.00 24.79 ? 11   TYR C CE1 1 
ATOM   5559 C CE2 . TYR C 3 11  ? 24.286  -103.188 -30.921 1.00 24.87 ? 11   TYR C CE2 1 
ATOM   5560 C CZ  . TYR C 3 11  ? 25.066  -103.634 -31.988 1.00 24.53 ? 11   TYR C CZ  1 
ATOM   5561 O OH  . TYR C 3 11  ? 26.275  -104.248 -31.757 1.00 24.76 ? 11   TYR C OH  1 
ATOM   5562 N N   . ARG C 3 12  ? 18.875  -100.089 -31.415 1.00 24.76 ? 12   ARG C N   1 
ATOM   5563 C CA  . ARG C 3 12  ? 18.086  -98.922  -31.775 1.00 25.62 ? 12   ARG C CA  1 
ATOM   5564 C C   . ARG C 3 12  ? 18.974  -98.048  -32.680 1.00 25.99 ? 12   ARG C C   1 
ATOM   5565 O O   . ARG C 3 12  ? 20.205  -98.072  -32.571 1.00 25.79 ? 12   ARG C O   1 
ATOM   5566 C CB  . ARG C 3 12  ? 17.596  -98.194  -30.525 1.00 25.26 ? 12   ARG C CB  1 
ATOM   5567 C CG  . ARG C 3 12  ? 16.707  -99.049  -29.641 1.00 25.98 ? 12   ARG C CG  1 
ATOM   5568 C CD  . ARG C 3 12  ? 16.265  -98.351  -28.350 1.00 26.82 ? 12   ARG C CD  1 
ATOM   5569 N NE  . ARG C 3 12  ? 15.520  -99.305  -27.510 1.00 29.44 ? 12   ARG C NE  1 
ATOM   5570 C CZ  . ARG C 3 12  ? 14.167  -99.364  -27.456 1.00 29.71 ? 12   ARG C CZ  1 
ATOM   5571 N NH1 . ARG C 3 12  ? 13.359  -98.505  -28.186 1.00 29.17 ? 12   ARG C NH1 1 
ATOM   5572 N NH2 . ARG C 3 12  ? 13.614  -100.293 -26.664 1.00 29.05 ? 12   ARG C NH2 1 
ATOM   5573 N N   . LYS C 3 13  ? 18.371  -97.317  -33.608 1.00 26.80 ? 13   LYS C N   1 
ATOM   5574 C CA  . LYS C 3 13  ? 19.177  -96.645  -34.630 1.00 27.33 ? 13   LYS C CA  1 
ATOM   5575 C C   . LYS C 3 13  ? 19.035  -95.131  -34.632 1.00 27.53 ? 13   LYS C C   1 
ATOM   5576 O O   . LYS C 3 13  ? 19.933  -94.438  -35.122 1.00 27.56 ? 13   LYS C O   1 
ATOM   5577 C CB  . LYS C 3 13  ? 18.897  -97.212  -36.025 1.00 27.54 ? 13   LYS C CB  1 
ATOM   5578 C CG  . LYS C 3 13  ? 19.273  -98.674  -36.172 1.00 28.86 ? 13   LYS C CG  1 
ATOM   5579 C CD  . LYS C 3 13  ? 19.374  -99.079  -37.633 1.00 30.93 ? 13   LYS C CD  1 
ATOM   5580 C CE  . LYS C 3 13  ? 19.449  -100.594 -37.791 1.00 32.06 ? 13   LYS C CE  1 
ATOM   5581 N NZ  . LYS C 3 13  ? 20.369  -101.224 -36.797 1.00 33.99 ? 13   LYS C NZ  1 
ATOM   5582 O OXT . LYS C 3 13  ? 18.044  -94.576  -34.150 1.00 27.52 ? 13   LYS C OXT 1 
HETATM 5583 C C1  . IHP D 4 .   ? 13.333  -123.814 -24.708 1.00 29.13 ? 801  IHP B C1  1 
HETATM 5584 C C2  . IHP D 4 .   ? 13.248  -124.561 -26.032 1.00 30.10 ? 801  IHP B C2  1 
HETATM 5585 C C3  . IHP D 4 .   ? 12.591  -123.675 -27.070 1.00 30.58 ? 801  IHP B C3  1 
HETATM 5586 C C4  . IHP D 4 .   ? 13.429  -122.386 -27.289 1.00 26.77 ? 801  IHP B C4  1 
HETATM 5587 C C5  . IHP D 4 .   ? 13.518  -121.571 -25.988 1.00 25.07 ? 801  IHP B C5  1 
HETATM 5588 C C6  . IHP D 4 .   ? 14.046  -122.453 -24.841 1.00 27.04 ? 801  IHP B C6  1 
HETATM 5589 O O11 . IHP D 4 .   ? 14.150  -124.631 -23.877 1.00 31.05 ? 801  IHP B O11 1 
HETATM 5590 P P1  . IHP D 4 .   ? 13.682  -125.503 -22.601 1.00 35.52 ? 801  IHP B P1  1 
HETATM 5591 O O21 . IHP D 4 .   ? 14.880  -125.584 -21.695 1.00 31.70 ? 801  IHP B O21 1 
HETATM 5592 O O31 . IHP D 4 .   ? 12.404  -124.831 -21.924 1.00 33.85 ? 801  IHP B O31 1 
HETATM 5593 O O41 . IHP D 4 .   ? 13.100  -126.822 -23.250 1.00 37.66 ? 801  IHP B O41 1 
HETATM 5594 O O12 . IHP D 4 .   ? 14.575  -124.789 -26.499 1.00 36.67 ? 801  IHP B O12 1 
HETATM 5595 P P2  . IHP D 4 .   ? 15.519  -126.158 -26.346 1.00 42.25 ? 801  IHP B P2  1 
HETATM 5596 O O22 . IHP D 4 .   ? 16.827  -125.744 -25.744 1.00 41.46 ? 801  IHP B O22 1 
HETATM 5597 O O32 . IHP D 4 .   ? 14.677  -127.302 -25.508 1.00 39.41 ? 801  IHP B O32 1 
HETATM 5598 O O42 . IHP D 4 .   ? 15.633  -126.667 -27.847 1.00 42.81 ? 801  IHP B O42 1 
HETATM 5599 O O13 . IHP D 4 .   ? 12.594  -124.426 -28.272 1.00 38.64 ? 801  IHP B O13 1 
HETATM 5600 P P3  . IHP D 4 .   ? 11.403  -125.494 -28.636 1.00 46.44 ? 801  IHP B P3  1 
HETATM 5601 O O23 . IHP D 4 .   ? 11.110  -126.567 -27.638 1.00 44.72 ? 801  IHP B O23 1 
HETATM 5602 O O33 . IHP D 4 .   ? 11.741  -126.060 -30.118 1.00 46.64 ? 801  IHP B O33 1 
HETATM 5603 O O43 . IHP D 4 .   ? 10.140  -124.482 -28.830 1.00 42.18 ? 801  IHP B O43 1 
HETATM 5604 O O14 . IHP D 4 .   ? 12.734  -121.608 -28.243 1.00 32.54 ? 801  IHP B O14 1 
HETATM 5605 P P4  . IHP D 4 .   ? 13.332  -120.989 -29.595 1.00 35.55 ? 801  IHP B P4  1 
HETATM 5606 O O24 . IHP D 4 .   ? 12.991  -119.525 -29.732 1.00 34.22 ? 801  IHP B O24 1 
HETATM 5607 O O34 . IHP D 4 .   ? 14.879  -121.331 -29.731 1.00 35.64 ? 801  IHP B O34 1 
HETATM 5608 O O44 . IHP D 4 .   ? 12.701  -121.872 -30.701 1.00 37.16 ? 801  IHP B O44 1 
HETATM 5609 O O15 . IHP D 4 .   ? 14.413  -120.460 -26.203 1.00 23.98 ? 801  IHP B O15 1 
HETATM 5610 P P5  . IHP D 4 .   ? 13.942  -118.894 -25.915 1.00 24.96 ? 801  IHP B P5  1 
HETATM 5611 O O25 . IHP D 4 .   ? 13.383  -118.867 -24.540 1.00 22.97 ? 801  IHP B O25 1 
HETATM 5612 O O35 . IHP D 4 .   ? 12.945  -118.618 -27.047 1.00 25.81 ? 801  IHP B O35 1 
HETATM 5613 O O45 . IHP D 4 .   ? 15.302  -118.176 -26.121 1.00 23.23 ? 801  IHP B O45 1 
HETATM 5614 O O16 . IHP D 4 .   ? 13.941  -121.779 -23.576 1.00 24.28 ? 801  IHP B O16 1 
HETATM 5615 P P6  . IHP D 4 .   ? 15.225  -121.224 -22.786 1.00 27.56 ? 801  IHP B P6  1 
HETATM 5616 O O26 . IHP D 4 .   ? 16.543  -121.705 -23.367 1.00 25.48 ? 801  IHP B O26 1 
HETATM 5617 O O36 . IHP D 4 .   ? 14.889  -121.712 -21.305 1.00 28.28 ? 801  IHP B O36 1 
HETATM 5618 O O46 . IHP D 4 .   ? 14.996  -119.679 -22.888 1.00 28.58 ? 801  IHP B O46 1 
HETATM 5619 C C   . IAC E 5 .   ? 5.746   -110.951 -25.187 1.00 18.01 ? 901  IAC B C   1 
HETATM 5620 C C1  . IAC E 5 .   ? 6.954   -111.250 -25.820 1.00 18.86 ? 901  IAC B C1  1 
HETATM 5621 C C2  . IAC E 5 .   ? 8.202   -111.196 -25.132 1.00 17.99 ? 901  IAC B C2  1 
HETATM 5622 C C3  . IAC E 5 .   ? 8.203   -110.836 -23.768 1.00 18.81 ? 901  IAC B C3  1 
HETATM 5623 C C4  . IAC E 5 .   ? 6.977   -110.538 -23.146 1.00 18.07 ? 901  IAC B C4  1 
HETATM 5624 C C5  . IAC E 5 .   ? 5.743   -110.618 -23.823 1.00 18.78 ? 901  IAC B C5  1 
HETATM 5625 C C7  . IAC E 5 .   ? 6.608   -111.548 -27.150 1.00 18.21 ? 901  IAC B C7  1 
HETATM 5626 C C8  . IAC E 5 .   ? 5.256   -111.427 -27.265 1.00 18.10 ? 901  IAC B C8  1 
HETATM 5627 C C17 . IAC E 5 .   ? 7.583   -111.948 -28.298 1.00 17.38 ? 901  IAC B C17 1 
HETATM 5628 C C18 . IAC E 5 .   ? 8.284   -113.291 -27.994 1.00 18.58 ? 901  IAC B C18 1 
HETATM 5629 N N   . IAC E 5 .   ? 4.747   -111.062 -26.073 1.00 18.07 ? 901  IAC B N   1 
HETATM 5630 O O2  . IAC E 5 .   ? 9.497   -113.296 -28.143 1.00 19.76 ? 901  IAC B O2  1 
HETATM 5631 O O3  . IAC E 5 .   ? 7.601   -114.274 -27.638 1.00 19.47 ? 901  IAC B O3  1 
HETATM 5632 O O   . HOH F 6 .   ? 17.805  -127.438 -14.063 1.00 25.80 ? 161  HOH A O   1 
HETATM 5633 O O   . HOH F 6 .   ? 14.584  -126.491 -11.909 1.00 22.48 ? 162  HOH A O   1 
HETATM 5634 O O   . HOH F 6 .   ? 19.264  -168.467 -19.430 1.00 38.18 ? 163  HOH A O   1 
HETATM 5635 O O   . HOH F 6 .   ? 22.604  -181.474 -15.731 1.00 40.85 ? 164  HOH A O   1 
HETATM 5636 O O   . HOH F 6 .   ? 20.086  -134.760 -17.574 1.00 41.20 ? 165  HOH A O   1 
HETATM 5637 O O   . HOH F 6 .   ? 13.848  -180.099 -24.673 1.00 42.32 ? 166  HOH A O   1 
HETATM 5638 O O   . HOH F 6 .   ? 12.024  -141.786 5.173   1.00 51.05 ? 167  HOH A O   1 
HETATM 5639 O O   . HOH F 6 .   ? 11.524  -137.341 -13.282 1.00 50.65 ? 168  HOH A O   1 
HETATM 5640 O O   . HOH F 6 .   ? 20.859  -138.211 -5.693  1.00 36.40 ? 169  HOH A O   1 
HETATM 5641 O O   . HOH F 6 .   ? 16.271  -174.351 -32.519 1.00 42.39 ? 170  HOH A O   1 
HETATM 5642 O O   . HOH F 6 .   ? 17.365  -133.435 -3.489  1.00 36.38 ? 171  HOH A O   1 
HETATM 5643 O O   . HOH F 6 .   ? 24.115  -164.172 -17.768 1.00 40.87 ? 172  HOH A O   1 
HETATM 5644 O O   . HOH F 6 .   ? 8.988   -130.875 -7.519  1.00 46.53 ? 173  HOH A O   1 
HETATM 5645 O O   . HOH F 6 .   ? 20.247  -132.962 -3.974  1.00 33.65 ? 174  HOH A O   1 
HETATM 5646 O O   . HOH F 6 .   ? 9.879   -142.656 -17.638 1.00 42.12 ? 175  HOH A O   1 
HETATM 5647 O O   . HOH F 6 .   ? 18.155  -152.404 -5.158  1.00 43.76 ? 176  HOH A O   1 
HETATM 5648 O O   . HOH F 6 .   ? 14.566  -177.111 -21.042 1.00 36.03 ? 177  HOH A O   1 
HETATM 5649 O O   . HOH F 6 .   ? 12.393  -138.452 -11.348 1.00 38.79 ? 178  HOH A O   1 
HETATM 5650 O O   . HOH F 6 .   ? 21.098  -180.708 -14.062 1.00 52.96 ? 179  HOH A O   1 
HETATM 5651 O O   . HOH F 6 .   ? 18.360  -171.107 -19.685 1.00 34.60 ? 180  HOH A O   1 
HETATM 5652 O O   . HOH F 6 .   ? 13.816  -172.623 -19.680 1.00 50.95 ? 181  HOH A O   1 
HETATM 5653 O O   . HOH F 6 .   ? 24.184  -179.390 -16.313 1.00 41.30 ? 182  HOH A O   1 
HETATM 5654 O O   . HOH F 6 .   ? 26.029  -178.920 -18.148 1.00 41.50 ? 183  HOH A O   1 
HETATM 5655 O O   . HOH F 6 .   ? 18.694  -139.854 -1.243  1.00 54.47 ? 184  HOH A O   1 
HETATM 5656 O O   . HOH F 6 .   ? 23.302  -167.208 -17.085 1.00 41.73 ? 185  HOH A O   1 
HETATM 5657 O O   . HOH F 6 .   ? 23.008  -175.178 -37.436 1.00 47.42 ? 186  HOH A O   1 
HETATM 5658 O O   . HOH F 6 .   ? 16.267  -163.084 -14.668 1.00 60.43 ? 187  HOH A O   1 
HETATM 5659 O O   . HOH F 6 .   ? 28.292  -162.591 -31.310 1.00 48.32 ? 188  HOH A O   1 
HETATM 5660 O O   . HOH F 6 .   ? 29.638  -167.258 -37.092 1.00 44.93 ? 189  HOH A O   1 
HETATM 5661 O O   . HOH F 6 .   ? 24.625  -182.353 -17.350 1.00 51.10 ? 190  HOH A O   1 
HETATM 5662 O O   . HOH F 6 .   ? 6.248   -143.990 -9.464  1.00 44.58 ? 191  HOH A O   1 
HETATM 5663 O O   . HOH F 6 .   ? 12.738  -156.856 -43.013 1.00 59.28 ? 192  HOH A O   1 
HETATM 5664 O O   . HOH F 6 .   ? 25.686  -179.953 -20.368 1.00 48.49 ? 193  HOH A O   1 
HETATM 5665 O O   . HOH F 6 .   ? 11.188  -134.608 -0.697  1.00 74.02 ? 194  HOH A O   1 
HETATM 5666 O O   . HOH F 6 .   ? 20.080  -185.402 -26.938 1.00 43.68 ? 195  HOH A O   1 
HETATM 5667 O O   . HOH F 6 .   ? 22.087  -168.508 -19.087 1.00 41.52 ? 196  HOH A O   1 
HETATM 5668 O O   . HOH F 6 .   ? 29.163  -173.602 -40.739 1.00 55.78 ? 197  HOH A O   1 
HETATM 5669 O O   . HOH F 6 .   ? 8.876   -138.634 -3.579  1.00 67.06 ? 198  HOH A O   1 
HETATM 5670 O O   . HOH F 6 .   ? 7.783   -140.811 -17.985 1.00 67.29 ? 199  HOH A O   1 
HETATM 5671 O O   . HOH F 6 .   ? 9.719   -154.389 -25.866 1.00 68.00 ? 200  HOH A O   1 
HETATM 5672 O O   . HOH F 6 .   ? 9.871   -133.416 -6.107  1.00 64.26 ? 201  HOH A O   1 
HETATM 5673 O O   . HOH F 6 .   ? 26.825  -161.401 -32.919 1.00 56.26 ? 202  HOH A O   1 
HETATM 5674 O O   . HOH F 6 .   ? 16.334  -170.056 -37.693 1.00 48.91 ? 203  HOH A O   1 
HETATM 5675 O O   . HOH F 6 .   ? 23.572  -177.170 -14.903 1.00 47.38 ? 204  HOH A O   1 
HETATM 5676 O O   . HOH F 6 .   ? 2.511   -144.737 -12.217 1.00 59.24 ? 205  HOH A O   1 
HETATM 5677 O O   . HOH F 6 .   ? 24.912  -163.825 -45.139 1.00 86.57 ? 206  HOH A O   1 
HETATM 5678 O O   . HOH F 6 .   ? 20.869  -174.286 -16.627 1.00 52.76 ? 207  HOH A O   1 
HETATM 5679 O O   . HOH F 6 .   ? 29.953  -166.732 -19.868 1.00 51.77 ? 208  HOH A O   1 
HETATM 5680 O O   . HOH F 6 .   ? 20.602  -137.490 -3.377  1.00 61.92 ? 209  HOH A O   1 
HETATM 5681 O O   . HOH F 6 .   ? 1.345   -143.480 -14.209 1.00 68.38 ? 210  HOH A O   1 
HETATM 5682 O O   . HOH F 6 .   ? 13.143  -156.562 -5.574  1.00 58.82 ? 211  HOH A O   1 
HETATM 5683 O O   . HOH F 6 .   ? 13.555  -157.642 -39.249 1.00 56.50 ? 212  HOH A O   1 
HETATM 5684 O O   . HOH F 6 .   ? 14.981  -156.342 -44.058 1.00 68.45 ? 213  HOH A O   1 
HETATM 5685 O O   . HOH F 6 .   ? 10.229  -134.967 -3.580  1.00 63.49 ? 214  HOH A O   1 
HETATM 5686 O O   . HOH F 6 .   ? 29.975  -172.928 -18.881 1.00 62.29 ? 215  HOH A O   1 
HETATM 5687 O O   . HOH F 6 .   ? 24.663  -164.852 -48.249 1.00 63.36 ? 216  HOH A O   1 
HETATM 5688 O O   . HOH F 6 .   ? 30.831  -181.381 -30.436 1.00 69.50 ? 217  HOH A O   1 
HETATM 5689 O O   . HOH F 6 .   ? 32.728  -165.367 -23.991 1.00 60.56 ? 218  HOH A O   1 
HETATM 5690 O O   . HOH F 6 .   ? 18.843  -158.926 -34.002 1.00 52.14 ? 219  HOH A O   1 
HETATM 5691 O O   . HOH F 6 .   ? 23.031  -185.728 -24.774 1.00 50.71 ? 220  HOH A O   1 
HETATM 5692 O O   . HOH F 6 .   ? 8.609   -168.879 -26.305 1.00 72.06 ? 221  HOH A O   1 
HETATM 5693 O O   . HOH F 6 .   ? 29.559  -162.758 -20.882 1.00 61.40 ? 222  HOH A O   1 
HETATM 5694 O O   . HOH F 6 .   ? 26.148  -182.940 -20.245 1.00 51.79 ? 223  HOH A O   1 
HETATM 5695 O O   . HOH F 6 .   ? 11.587  -162.191 -36.019 1.00 54.17 ? 224  HOH A O   1 
HETATM 5696 O O   . HOH F 6 .   ? 17.021  -181.278 -16.269 1.00 41.72 ? 225  HOH A O   1 
HETATM 5697 O O   . HOH F 6 .   ? 23.093  -136.088 -4.839  1.00 44.28 ? 226  HOH A O   1 
HETATM 5698 O O   . HOH F 6 .   ? 34.949  -167.666 -22.590 1.00 52.64 ? 227  HOH A O   1 
HETATM 5699 O O   . HOH F 6 .   ? 4.799   -156.701 -9.136  1.00 64.56 ? 228  HOH A O   1 
HETATM 5700 O O   . HOH F 6 .   ? 5.180   -164.169 -18.652 1.00 78.28 ? 229  HOH A O   1 
HETATM 5701 O O   . HOH F 6 .   ? 15.881  -156.378 -35.370 1.00 60.63 ? 230  HOH A O   1 
HETATM 5702 O O   . HOH F 6 .   ? 18.404  -177.539 -16.867 1.00 52.33 ? 231  HOH A O   1 
HETATM 5703 O O   . HOH F 6 .   ? 18.149  -183.584 -16.995 1.00 44.55 ? 232  HOH A O   1 
HETATM 5704 O O   . HOH F 6 .   ? 13.261  -176.009 -19.050 1.00 55.39 ? 233  HOH A O   1 
HETATM 5705 O O   . HOH F 6 .   ? 14.167  -154.456 -30.540 1.00 64.72 ? 234  HOH A O   1 
HETATM 5706 O O   . HOH F 6 .   ? 11.426  -149.103 0.916   1.00 60.50 ? 235  HOH A O   1 
HETATM 5707 O O   . HOH F 6 .   ? 18.819  -152.443 -30.567 1.00 73.63 ? 236  HOH A O   1 
HETATM 5708 O O   . HOH F 6 .   ? 21.033  -156.826 -33.102 1.00 65.57 ? 237  HOH A O   1 
HETATM 5709 O O   . HOH F 6 .   ? 27.517  -165.388 -41.024 1.00 68.61 ? 238  HOH A O   1 
HETATM 5710 O O   . HOH F 6 .   ? 27.148  -165.256 -17.397 1.00 61.12 ? 239  HOH A O   1 
HETATM 5711 O O   . HOH F 6 .   ? 8.380   -140.473 -1.626  1.00 68.25 ? 240  HOH A O   1 
HETATM 5712 O O   . HOH F 6 .   ? 32.715  -163.837 -21.837 1.00 62.61 ? 241  HOH A O   1 
HETATM 5713 O O   . HOH F 6 .   ? 10.274  -130.541 -2.407  1.00 64.88 ? 242  HOH A O   1 
HETATM 5714 O O   . HOH F 6 .   ? 12.373  -173.054 -27.288 1.00 45.87 ? 243  HOH A O   1 
HETATM 5715 O O   . HOH F 6 .   ? 20.758  -153.438 -3.725  1.00 58.41 ? 244  HOH A O   1 
HETATM 5716 O O   . HOH F 6 .   ? 23.271  -138.153 -3.407  1.00 52.17 ? 245  HOH A O   1 
HETATM 5717 O O   . HOH F 6 .   ? 22.326  -151.274 -3.322  1.00 53.66 ? 246  HOH A O   1 
HETATM 5718 O O   . HOH F 6 .   ? 26.105  -180.332 -38.772 1.00 61.25 ? 247  HOH A O   1 
HETATM 5719 O O   . HOH G 6 .   ? 23.678  -129.196 -5.087  1.00 20.65 ? 902  HOH B O   1 
HETATM 5720 O O   . HOH G 6 .   ? 8.688   -115.511 -25.496 1.00 19.86 ? 903  HOH B O   1 
HETATM 5721 O O   . HOH G 6 .   ? -0.074  -125.455 -18.115 1.00 18.19 ? 904  HOH B O   1 
HETATM 5722 O O   . HOH G 6 .   ? 11.493  -112.026 -29.185 1.00 22.79 ? 905  HOH B O   1 
HETATM 5723 O O   . HOH G 6 .   ? 15.157  -123.899 -11.232 1.00 19.37 ? 906  HOH B O   1 
HETATM 5724 O O   . HOH G 6 .   ? 10.944  -122.436 -9.438  1.00 20.57 ? 907  HOH B O   1 
HETATM 5725 O O   . HOH G 6 .   ? 32.907  -117.970 -16.409 1.00 25.04 ? 908  HOH B O   1 
HETATM 5726 O O   . HOH G 6 .   ? 1.291   -109.485 -22.621 1.00 22.97 ? 909  HOH B O   1 
HETATM 5727 O O   . HOH G 6 .   ? 6.605   -117.709 -23.978 1.00 17.65 ? 910  HOH B O   1 
HETATM 5728 O O   . HOH G 6 .   ? 37.912  -135.558 -23.352 1.00 30.29 ? 911  HOH B O   1 
HETATM 5729 O O   . HOH G 6 .   ? 10.887  -117.586 -15.900 1.00 19.89 ? 912  HOH B O   1 
HETATM 5730 O O   . HOH G 6 .   ? 26.992  -124.491 -38.197 1.00 22.68 ? 913  HOH B O   1 
HETATM 5731 O O   . HOH G 6 .   ? 1.819   -126.522 -43.654 1.00 26.23 ? 914  HOH B O   1 
HETATM 5732 O O   . HOH G 6 .   ? 25.996  -116.678 -42.103 1.00 22.05 ? 915  HOH B O   1 
HETATM 5733 O O   . HOH G 6 .   ? 35.797  -133.009 -41.772 1.00 27.22 ? 916  HOH B O   1 
HETATM 5734 O O   . HOH G 6 .   ? 8.867   -120.567 -30.038 1.00 23.13 ? 917  HOH B O   1 
HETATM 5735 O O   . HOH G 6 .   ? 13.301  -99.072  -36.046 1.00 26.16 ? 918  HOH B O   1 
HETATM 5736 O O   . HOH G 6 .   ? -2.346  -104.276 -1.595  1.00 35.06 ? 919  HOH B O   1 
HETATM 5737 O O   . HOH G 6 .   ? 8.345   -106.910 -10.239 1.00 23.82 ? 920  HOH B O   1 
HETATM 5738 O O   . HOH G 6 .   ? 27.818  -140.962 -15.474 1.00 30.48 ? 921  HOH B O   1 
HETATM 5739 O O   . HOH G 6 .   ? 11.854  -126.102 -50.819 1.00 31.74 ? 922  HOH B O   1 
HETATM 5740 O O   . HOH G 6 .   ? -2.447  -127.785 -30.152 1.00 25.17 ? 923  HOH B O   1 
HETATM 5741 O O   . HOH G 6 .   ? -8.860  -119.727 -14.685 1.00 28.03 ? 924  HOH B O   1 
HETATM 5742 O O   . HOH G 6 .   ? 29.291  -114.293 -48.657 1.00 28.63 ? 925  HOH B O   1 
HETATM 5743 O O   . HOH G 6 .   ? 8.128   -105.565 -7.972  1.00 25.61 ? 926  HOH B O   1 
HETATM 5744 O O   . HOH G 6 .   ? 39.832  -132.267 -29.259 1.00 26.77 ? 927  HOH B O   1 
HETATM 5745 O O   . HOH G 6 .   ? 12.113  -101.960 -2.578  1.00 32.77 ? 928  HOH B O   1 
HETATM 5746 O O   . HOH G 6 .   ? 6.419   -126.370 -47.968 1.00 28.70 ? 929  HOH B O   1 
HETATM 5747 O O   . HOH G 6 .   ? 19.082  -113.824 -43.096 1.00 25.69 ? 930  HOH B O   1 
HETATM 5748 O O   . HOH G 6 .   ? -12.595 -108.455 -34.155 1.00 24.04 ? 931  HOH B O   1 
HETATM 5749 O O   . HOH G 6 .   ? 12.976  -114.179 -18.235 1.00 20.37 ? 932  HOH B O   1 
HETATM 5750 O O   . HOH G 6 .   ? -2.112  -103.670 -17.577 1.00 30.37 ? 933  HOH B O   1 
HETATM 5751 O O   . HOH G 6 .   ? -4.692  -103.564 -33.012 1.00 24.56 ? 934  HOH B O   1 
HETATM 5752 O O   . HOH G 6 .   ? 12.068  -102.100 0.365   1.00 28.02 ? 935  HOH B O   1 
HETATM 5753 O O   . HOH G 6 .   ? 11.641  -117.845 -18.704 1.00 22.84 ? 936  HOH B O   1 
HETATM 5754 O O   . HOH G 6 .   ? 3.996   -126.623 -12.804 1.00 22.76 ? 937  HOH B O   1 
HETATM 5755 O O   . HOH G 6 .   ? -3.078  -104.549 -21.493 1.00 21.61 ? 938  HOH B O   1 
HETATM 5756 O O   . HOH G 6 .   ? 19.883  -108.152 -19.884 1.00 25.55 ? 939  HOH B O   1 
HETATM 5757 O O   . HOH G 6 .   ? -1.895  -125.530 -23.231 1.00 22.04 ? 940  HOH B O   1 
HETATM 5758 O O   . HOH G 6 .   ? -13.693 -107.672 -30.417 1.00 29.67 ? 941  HOH B O   1 
HETATM 5759 O O   . HOH G 6 .   ? 42.569  -113.258 -31.251 1.00 41.96 ? 942  HOH B O   1 
HETATM 5760 O O   . HOH G 6 .   ? 14.263  -118.969 0.349   1.00 25.82 ? 943  HOH B O   1 
HETATM 5761 O O   . HOH G 6 .   ? 13.289  -110.979 -45.025 1.00 22.65 ? 944  HOH B O   1 
HETATM 5762 O O   . HOH G 6 .   ? 3.279   -129.746 -37.804 1.00 27.95 ? 945  HOH B O   1 
HETATM 5763 O O   . HOH G 6 .   ? 27.177  -120.406 -6.870  1.00 35.44 ? 946  HOH B O   1 
HETATM 5764 O O   . HOH G 6 .   ? 3.179   -129.656 -22.459 1.00 31.42 ? 947  HOH B O   1 
HETATM 5765 O O   . HOH G 6 .   ? 22.660  -121.889 -6.385  1.00 24.60 ? 948  HOH B O   1 
HETATM 5766 O O   . HOH G 6 .   ? 5.695   -105.778 -38.594 1.00 25.20 ? 949  HOH B O   1 
HETATM 5767 O O   . HOH G 6 .   ? 20.816  -116.686 -4.641  1.00 30.27 ? 950  HOH B O   1 
HETATM 5768 O O   . HOH G 6 .   ? 34.602  -135.400 -38.438 1.00 31.47 ? 951  HOH B O   1 
HETATM 5769 O O   . HOH G 6 .   ? 37.737  -113.597 -21.466 1.00 32.07 ? 952  HOH B O   1 
HETATM 5770 O O   . HOH G 6 .   ? -4.285  -125.107 -24.675 1.00 23.04 ? 953  HOH B O   1 
HETATM 5771 O O   . HOH G 6 .   ? 41.282  -130.767 -26.381 1.00 35.56 ? 954  HOH B O   1 
HETATM 5772 O O   . HOH G 6 .   ? 5.900   -130.094 -31.615 1.00 38.16 ? 955  HOH B O   1 
HETATM 5773 O O   . HOH G 6 .   ? 25.505  -129.813 -50.907 1.00 28.52 ? 956  HOH B O   1 
HETATM 5774 O O   . HOH G 6 .   ? 25.708  -123.843 -9.370  1.00 26.29 ? 957  HOH B O   1 
HETATM 5775 O O   . HOH G 6 .   ? 14.462  -113.190 -55.341 1.00 30.71 ? 958  HOH B O   1 
HETATM 5776 O O   . HOH G 6 .   ? 13.495  -115.894 -32.802 1.00 32.31 ? 959  HOH B O   1 
HETATM 5777 O O   . HOH G 6 .   ? 29.398  -108.880 -49.728 1.00 29.57 ? 960  HOH B O   1 
HETATM 5778 O O   . HOH G 6 .   ? -4.452  -106.728 -7.200  1.00 30.95 ? 961  HOH B O   1 
HETATM 5779 O O   . HOH G 6 .   ? 8.211   -99.296  -31.017 1.00 28.73 ? 962  HOH B O   1 
HETATM 5780 O O   . HOH G 6 .   ? 20.423  -115.574 -41.216 1.00 24.34 ? 963  HOH B O   1 
HETATM 5781 O O   . HOH G 6 .   ? 23.600  -118.537 -35.750 1.00 27.07 ? 964  HOH B O   1 
HETATM 5782 O O   . HOH G 6 .   ? 10.899  -105.026 -16.965 1.00 28.89 ? 965  HOH B O   1 
HETATM 5783 O O   . HOH G 6 .   ? 23.847  -117.823 -40.778 1.00 23.91 ? 966  HOH B O   1 
HETATM 5784 O O   . HOH G 6 .   ? 13.241  -113.923 -27.838 1.00 27.15 ? 967  HOH B O   1 
HETATM 5785 O O   . HOH G 6 .   ? -10.109 -109.221 -38.662 1.00 33.20 ? 968  HOH B O   1 
HETATM 5786 O O   . HOH G 6 .   ? 9.828   -123.096 -33.221 1.00 34.21 ? 969  HOH B O   1 
HETATM 5787 O O   . HOH G 6 .   ? -2.507  -112.266 -46.404 1.00 29.15 ? 970  HOH B O   1 
HETATM 5788 O O   . HOH G 6 .   ? 8.245   -105.090 -49.011 1.00 31.63 ? 971  HOH B O   1 
HETATM 5789 O O   . HOH G 6 .   ? 9.346   -130.615 -46.904 1.00 28.49 ? 972  HOH B O   1 
HETATM 5790 O O   . HOH G 6 .   ? -0.461  -112.291 -53.003 1.00 31.63 ? 973  HOH B O   1 
HETATM 5791 O O   . HOH G 6 .   ? 15.541  -116.919 -1.088  1.00 23.95 ? 974  HOH B O   1 
HETATM 5792 O O   . HOH G 6 .   ? 31.007  -115.919 -55.199 1.00 30.18 ? 975  HOH B O   1 
HETATM 5793 O O   . HOH G 6 .   ? 10.756  -124.614 -0.119  1.00 31.58 ? 976  HOH B O   1 
HETATM 5794 O O   . HOH G 6 .   ? -5.637  -106.285 -42.618 1.00 44.75 ? 977  HOH B O   1 
HETATM 5795 O O   . HOH G 6 .   ? -7.633  -126.322 -24.281 1.00 30.08 ? 978  HOH B O   1 
HETATM 5796 O O   . HOH G 6 .   ? -6.245  -104.281 -18.823 1.00 25.43 ? 979  HOH B O   1 
HETATM 5797 O O   . HOH G 6 .   ? 7.124   -119.945 -32.075 1.00 21.60 ? 980  HOH B O   1 
HETATM 5798 O O   . HOH G 6 .   ? 0.276   -102.952 -17.257 1.00 26.83 ? 981  HOH B O   1 
HETATM 5799 O O   . HOH G 6 .   ? 30.892  -110.381 -66.389 1.00 41.71 ? 982  HOH B O   1 
HETATM 5800 O O   . HOH G 6 .   ? 23.329  -103.440 -16.952 1.00 41.25 ? 983  HOH B O   1 
HETATM 5801 O O   . HOH G 6 .   ? 23.913  -145.351 -20.656 1.00 31.14 ? 984  HOH B O   1 
HETATM 5802 O O   . HOH G 6 .   ? 14.355  -118.218 -18.997 1.00 31.94 ? 985  HOH B O   1 
HETATM 5803 O O   . HOH G 6 .   ? 18.122  -121.089 -17.399 1.00 30.00 ? 986  HOH B O   1 
HETATM 5804 O O   . HOH G 6 .   ? 25.164  -140.610 -6.057  1.00 36.99 ? 987  HOH B O   1 
HETATM 5805 O O   . HOH G 6 .   ? 35.479  -139.506 -24.792 1.00 38.22 ? 988  HOH B O   1 
HETATM 5806 O O   . HOH G 6 .   ? 37.396  -114.047 -44.320 1.00 32.16 ? 989  HOH B O   1 
HETATM 5807 O O   . HOH G 6 .   ? 31.002  -115.483 -57.938 1.00 28.91 ? 990  HOH B O   1 
HETATM 5808 O O   . HOH G 6 .   ? 26.530  -111.786 -15.767 1.00 33.82 ? 991  HOH B O   1 
HETATM 5809 O O   . HOH G 6 .   ? -9.810  -100.143 -25.680 1.00 41.60 ? 992  HOH B O   1 
HETATM 5810 O O   . HOH G 6 .   ? 39.719  -115.167 -18.917 1.00 34.48 ? 993  HOH B O   1 
HETATM 5811 O O   . HOH G 6 .   ? -0.699  -102.060 -39.096 1.00 37.88 ? 994  HOH B O   1 
HETATM 5812 O O   . HOH G 6 .   ? 3.925   -129.266 -13.469 1.00 41.04 ? 995  HOH B O   1 
HETATM 5813 O O   . HOH G 6 .   ? 3.634   -104.175 -38.954 1.00 27.14 ? 996  HOH B O   1 
HETATM 5814 O O   . HOH G 6 .   ? 30.509  -127.178 -6.518  1.00 28.24 ? 997  HOH B O   1 
HETATM 5815 O O   . HOH G 6 .   ? 41.255  -133.868 -36.778 1.00 33.66 ? 998  HOH B O   1 
HETATM 5816 O O   . HOH G 6 .   ? 15.391  -120.652 -18.804 1.00 31.83 ? 999  HOH B O   1 
HETATM 5817 O O   . HOH G 6 .   ? 17.657  -129.584 -16.081 1.00 25.67 ? 1000 HOH B O   1 
HETATM 5818 O O   . HOH G 6 .   ? 21.121  -142.180 -10.701 1.00 31.48 ? 1001 HOH B O   1 
HETATM 5819 O O   . HOH G 6 .   ? -4.635  -127.729 -23.013 1.00 25.24 ? 1002 HOH B O   1 
HETATM 5820 O O   . HOH G 6 .   ? 24.907  -123.887 -36.490 1.00 31.10 ? 1003 HOH B O   1 
HETATM 5821 O O   . HOH G 6 .   ? -12.091 -98.665  -34.653 1.00 37.67 ? 1004 HOH B O   1 
HETATM 5822 O O   . HOH G 6 .   ? 13.644  -122.711 -35.171 1.00 34.59 ? 1005 HOH B O   1 
HETATM 5823 O O   . HOH G 6 .   ? 13.145  -116.770 -29.200 1.00 40.69 ? 1006 HOH B O   1 
HETATM 5824 O O   . HOH G 6 .   ? 7.247   -133.730 -44.922 1.00 48.08 ? 1007 HOH B O   1 
HETATM 5825 O O   . HOH G 6 .   ? 26.292  -122.169 -11.719 1.00 27.47 ? 1008 HOH B O   1 
HETATM 5826 O O   . HOH G 6 .   ? 36.769  -136.094 -34.148 1.00 31.21 ? 1009 HOH B O   1 
HETATM 5827 O O   . HOH G 6 .   ? 16.466  -103.272 -16.873 1.00 32.95 ? 1010 HOH B O   1 
HETATM 5828 O O   . HOH G 6 .   ? 7.411   -105.608 -53.382 1.00 29.97 ? 1011 HOH B O   1 
HETATM 5829 O O   . HOH G 6 .   ? 14.692  -119.144 -15.956 1.00 33.23 ? 1012 HOH B O   1 
HETATM 5830 O O   . HOH G 6 .   ? 20.403  -122.287 -28.383 1.00 34.65 ? 1013 HOH B O   1 
HETATM 5831 O O   . HOH G 6 .   ? 13.699  -113.795 4.385   1.00 40.58 ? 1014 HOH B O   1 
HETATM 5832 O O   . HOH G 6 .   ? 4.304   -127.748 -50.581 1.00 36.13 ? 1015 HOH B O   1 
HETATM 5833 O O   . HOH G 6 .   ? 29.971  -126.229 -55.410 1.00 37.09 ? 1016 HOH B O   1 
HETATM 5834 O O   . HOH G 6 .   ? 28.707  -111.431 -38.988 1.00 33.66 ? 1017 HOH B O   1 
HETATM 5835 O O   . HOH G 6 .   ? 19.175  -119.103 -13.893 1.00 31.21 ? 1018 HOH B O   1 
HETATM 5836 O O   . HOH G 6 .   ? -12.540 -119.455 -18.075 1.00 39.22 ? 1019 HOH B O   1 
HETATM 5837 O O   . HOH G 6 .   ? -13.429 -114.629 -36.479 1.00 32.41 ? 1020 HOH B O   1 
HETATM 5838 O O   . HOH G 6 .   ? 18.673  -115.295 -37.215 1.00 37.64 ? 1021 HOH B O   1 
HETATM 5839 O O   . HOH G 6 .   ? 17.884  -100.924 -12.975 1.00 31.59 ? 1022 HOH B O   1 
HETATM 5840 O O   . HOH G 6 .   ? 35.819  -113.406 -42.084 1.00 35.23 ? 1023 HOH B O   1 
HETATM 5841 O O   . HOH G 6 .   ? 21.177  -118.236 -29.195 1.00 32.86 ? 1024 HOH B O   1 
HETATM 5842 O O   . HOH G 6 .   ? 1.271   -122.226 -1.322  1.00 33.80 ? 1025 HOH B O   1 
HETATM 5843 O O   . HOH G 6 .   ? 42.615  -128.564 -33.611 1.00 27.19 ? 1026 HOH B O   1 
HETATM 5844 O O   . HOH G 6 .   ? 19.669  -105.409 -57.052 1.00 35.41 ? 1027 HOH B O   1 
HETATM 5845 O O   . HOH G 6 .   ? 34.481  -116.780 -55.400 1.00 37.47 ? 1028 HOH B O   1 
HETATM 5846 O O   . HOH G 6 .   ? 29.774  -135.053 -41.514 1.00 35.30 ? 1029 HOH B O   1 
HETATM 5847 O O   . HOH G 6 .   ? 35.793  -132.333 -9.858  1.00 39.64 ? 1030 HOH B O   1 
HETATM 5848 O O   . HOH G 6 .   ? -4.672  -118.951 -47.407 1.00 44.08 ? 1031 HOH B O   1 
HETATM 5849 O O   . HOH G 6 .   ? 38.220  -111.854 -48.473 1.00 45.88 ? 1032 HOH B O   1 
HETATM 5850 O O   . HOH G 6 .   ? 0.893   -130.186 -36.567 1.00 35.06 ? 1033 HOH B O   1 
HETATM 5851 O O   . HOH G 6 .   ? -12.743 -116.821 -27.371 1.00 28.89 ? 1034 HOH B O   1 
HETATM 5852 O O   . HOH G 6 .   ? -3.291  -101.344 -33.532 1.00 32.45 ? 1035 HOH B O   1 
HETATM 5853 O O   . HOH G 6 .   ? 2.571   -99.427  -33.673 1.00 36.32 ? 1036 HOH B O   1 
HETATM 5854 O O   . HOH G 6 .   ? 0.261   -130.407 -32.460 1.00 41.37 ? 1037 HOH B O   1 
HETATM 5855 O O   . HOH G 6 .   ? 7.578   -109.901 5.352   1.00 36.85 ? 1038 HOH B O   1 
HETATM 5856 O O   . HOH G 6 .   ? 22.137  -121.907 -42.719 1.00 36.91 ? 1039 HOH B O   1 
HETATM 5857 O O   . HOH G 6 .   ? 1.116   -106.735 0.581   1.00 38.26 ? 1040 HOH B O   1 
HETATM 5858 O O   . HOH G 6 .   ? 1.083   -97.840  -25.058 1.00 41.92 ? 1041 HOH B O   1 
HETATM 5859 O O   . HOH G 6 .   ? 2.604   -129.865 -27.512 1.00 33.10 ? 1042 HOH B O   1 
HETATM 5860 O O   . HOH G 6 .   ? 29.676  -118.839 -10.174 1.00 39.47 ? 1043 HOH B O   1 
HETATM 5861 O O   . HOH G 6 .   ? 48.502  -126.411 -32.630 1.00 46.00 ? 1044 HOH B O   1 
HETATM 5862 O O   . HOH G 6 .   ? 14.449  -112.940 -59.594 1.00 38.64 ? 1045 HOH B O   1 
HETATM 5863 O O   . HOH G 6 .   ? -8.259  -98.313  -34.731 1.00 45.16 ? 1046 HOH B O   1 
HETATM 5864 O O   . HOH G 6 .   ? -11.032 -113.578 -39.722 1.00 38.25 ? 1047 HOH B O   1 
HETATM 5865 O O   . HOH G 6 .   ? -5.595  -100.489 -31.823 1.00 35.04 ? 1048 HOH B O   1 
HETATM 5866 O O   . HOH G 6 .   ? 0.355   -106.942 -48.759 1.00 31.68 ? 1049 HOH B O   1 
HETATM 5867 O O   . HOH G 6 .   ? 41.780  -133.872 -45.261 1.00 33.03 ? 1050 HOH B O   1 
HETATM 5868 O O   . HOH G 6 .   ? -12.201 -108.086 -18.029 1.00 40.14 ? 1051 HOH B O   1 
HETATM 5869 O O   . HOH G 6 .   ? 26.950  -109.777 -17.489 1.00 41.34 ? 1052 HOH B O   1 
HETATM 5870 O O   . HOH G 6 .   ? 1.137   -104.820 -27.440 1.00 29.25 ? 1053 HOH B O   1 
HETATM 5871 O O   . HOH G 6 .   ? 48.370  -124.514 -34.346 1.00 37.81 ? 1054 HOH B O   1 
HETATM 5872 O O   . HOH G 6 .   ? -1.334  -125.254 -11.373 1.00 40.29 ? 1055 HOH B O   1 
HETATM 5873 O O   . HOH G 6 .   ? 0.272   -104.464 -38.597 1.00 28.85 ? 1056 HOH B O   1 
HETATM 5874 O O   . HOH G 6 .   ? 17.526  -122.199 -1.579  1.00 35.33 ? 1057 HOH B O   1 
HETATM 5875 O O   . HOH G 6 .   ? -8.530  -119.832 -11.161 1.00 34.28 ? 1058 HOH B O   1 
HETATM 5876 O O   . HOH G 6 .   ? 25.027  -115.696 -34.685 1.00 36.53 ? 1059 HOH B O   1 
HETATM 5877 O O   . HOH G 6 .   ? 1.296   -101.556 -32.628 1.00 29.64 ? 1060 HOH B O   1 
HETATM 5878 O O   . HOH G 6 .   ? 42.567  -116.566 -39.411 1.00 38.06 ? 1061 HOH B O   1 
HETATM 5879 O O   . HOH G 6 .   ? 23.668  -124.369 -26.277 1.00 31.40 ? 1062 HOH B O   1 
HETATM 5880 O O   . HOH G 6 .   ? 13.566  -98.143  -10.318 1.00 43.13 ? 1063 HOH B O   1 
HETATM 5881 O O   . HOH G 6 .   ? 25.894  -136.120 -5.915  1.00 37.71 ? 1064 HOH B O   1 
HETATM 5882 O O   . HOH G 6 .   ? 41.297  -135.466 -21.310 1.00 36.51 ? 1065 HOH B O   1 
HETATM 5883 O O   . HOH G 6 .   ? -6.339  -127.560 -42.377 1.00 49.60 ? 1066 HOH B O   1 
HETATM 5884 O O   . HOH G 6 .   ? 35.022  -129.598 -47.811 1.00 34.25 ? 1067 HOH B O   1 
HETATM 5885 O O   . HOH G 6 .   ? 21.826  -112.254 0.001   1.00 35.94 ? 1068 HOH B O   1 
HETATM 5886 O O   . HOH G 6 .   ? 21.043  -112.541 -23.415 1.00 38.30 ? 1069 HOH B O   1 
HETATM 5887 O O   . HOH G 6 .   ? 7.341   -129.826 -37.137 1.00 54.00 ? 1070 HOH B O   1 
HETATM 5888 O O   . HOH G 6 .   ? 21.935  -131.449 -3.318  1.00 42.01 ? 1071 HOH B O   1 
HETATM 5889 O O   . HOH G 6 .   ? 15.707  -131.121 -44.061 1.00 43.54 ? 1072 HOH B O   1 
HETATM 5890 O O   . HOH G 6 .   ? 26.695  -131.915 -54.012 1.00 34.63 ? 1073 HOH B O   1 
HETATM 5891 O O   . HOH G 6 .   ? -9.109  -119.859 -8.229  1.00 36.51 ? 1074 HOH B O   1 
HETATM 5892 O O   . HOH G 6 .   ? 16.626  -103.655 -25.284 1.00 40.16 ? 1075 HOH B O   1 
HETATM 5893 O O   . HOH G 6 .   ? 12.946  -128.530 -40.724 1.00 45.41 ? 1076 HOH B O   1 
HETATM 5894 O O   . HOH G 6 .   ? 6.671   -100.152 -29.053 1.00 31.99 ? 1077 HOH B O   1 
HETATM 5895 O O   . HOH G 6 .   ? 37.042  -113.401 -36.266 1.00 35.12 ? 1078 HOH B O   1 
HETATM 5896 O O   . HOH G 6 .   ? 13.744  -104.503 -15.732 1.00 34.91 ? 1079 HOH B O   1 
HETATM 5897 O O   . HOH G 6 .   ? 8.610   -102.766 -9.779  1.00 34.28 ? 1080 HOH B O   1 
HETATM 5898 O O   . HOH G 6 .   ? 30.352  -111.022 -31.482 1.00 35.83 ? 1081 HOH B O   1 
HETATM 5899 O O   . HOH G 6 .   ? 22.851  -141.054 -20.758 1.00 37.20 ? 1082 HOH B O   1 
HETATM 5900 O O   . HOH G 6 .   ? 45.703  -127.210 -45.340 1.00 39.65 ? 1083 HOH B O   1 
HETATM 5901 O O   . HOH G 6 .   ? -10.080 -103.902 -17.326 1.00 37.94 ? 1084 HOH B O   1 
HETATM 5902 O O   . HOH G 6 .   ? -1.882  -98.555  -27.243 1.00 44.92 ? 1085 HOH B O   1 
HETATM 5903 O O   . HOH G 6 .   ? 31.733  -121.433 -59.532 1.00 42.60 ? 1086 HOH B O   1 
HETATM 5904 O O   . HOH G 6 .   ? 41.139  -112.545 -45.593 1.00 40.76 ? 1087 HOH B O   1 
HETATM 5905 O O   . HOH G 6 .   ? 0.551   -127.549 -10.419 1.00 49.10 ? 1088 HOH B O   1 
HETATM 5906 O O   . HOH G 6 .   ? 5.534   -129.264 -17.723 1.00 34.93 ? 1089 HOH B O   1 
HETATM 5907 O O   . HOH G 6 .   ? 17.913  -98.521  -10.762 1.00 37.20 ? 1090 HOH B O   1 
HETATM 5908 O O   . HOH G 6 .   ? -14.275 -111.808 -22.447 1.00 48.16 ? 1091 HOH B O   1 
HETATM 5909 O O   . HOH G 6 .   ? 16.584  -135.944 -23.178 1.00 38.99 ? 1092 HOH B O   1 
HETATM 5910 O O   . HOH G 6 .   ? -4.911  -99.157  -24.578 1.00 31.12 ? 1093 HOH B O   1 
HETATM 5911 O O   . HOH G 6 .   ? 43.782  -127.559 -47.458 1.00 37.61 ? 1094 HOH B O   1 
HETATM 5912 O O   . HOH G 6 .   ? 13.304  -108.628 -46.449 1.00 38.38 ? 1095 HOH B O   1 
HETATM 5913 O O   . HOH G 6 .   ? -11.430 -113.474 -14.147 1.00 44.60 ? 1096 HOH B O   1 
HETATM 5914 O O   . HOH G 6 .   ? 23.436  -110.082 -16.979 1.00 35.72 ? 1097 HOH B O   1 
HETATM 5915 O O   . HOH G 6 .   ? 0.879   -130.726 -45.777 1.00 38.22 ? 1098 HOH B O   1 
HETATM 5916 O O   . HOH G 6 .   ? -14.394 -108.775 -26.058 1.00 40.52 ? 1099 HOH B O   1 
HETATM 5917 O O   . HOH G 6 .   ? 20.593  -101.160 -15.773 1.00 43.72 ? 1100 HOH B O   1 
HETATM 5918 O O   . HOH G 6 .   ? 32.065  -107.498 -31.693 1.00 53.67 ? 1101 HOH B O   1 
HETATM 5919 O O   . HOH G 6 .   ? 35.078  -111.626 -19.410 1.00 40.52 ? 1102 HOH B O   1 
HETATM 5920 O O   . HOH G 6 .   ? 46.794  -124.611 -40.779 1.00 44.85 ? 1103 HOH B O   1 
HETATM 5921 O O   . HOH G 6 .   ? 8.501   -102.823 -39.167 1.00 24.67 ? 1104 HOH B O   1 
HETATM 5922 O O   . HOH G 6 .   ? 34.306  -116.328 -14.781 1.00 31.54 ? 1105 HOH B O   1 
HETATM 5923 O O   . HOH G 6 .   ? 25.167  -122.710 -6.813  1.00 34.97 ? 1106 HOH B O   1 
HETATM 5924 O O   . HOH G 6 .   ? 46.797  -115.793 -33.524 1.00 39.45 ? 1107 HOH B O   1 
HETATM 5925 O O   . HOH G 6 .   ? 13.408  -136.057 -21.495 1.00 36.69 ? 1108 HOH B O   1 
HETATM 5926 O O   . HOH G 6 .   ? 32.040  -110.114 -39.844 1.00 35.56 ? 1109 HOH B O   1 
HETATM 5927 O O   . HOH G 6 .   ? -4.014  -102.853 -19.485 1.00 30.32 ? 1110 HOH B O   1 
HETATM 5928 O O   . HOH G 6 .   ? -14.653 -109.090 -32.450 1.00 31.13 ? 1111 HOH B O   1 
HETATM 5929 O O   . HOH G 6 .   ? 25.955  -131.117 -24.517 1.00 40.05 ? 1112 HOH B O   1 
HETATM 5930 O O   . HOH G 6 .   ? 22.382  -124.949 -23.765 1.00 37.28 ? 1113 HOH B O   1 
HETATM 5931 O O   . HOH G 6 .   ? -13.850 -107.556 -36.237 1.00 34.39 ? 1114 HOH B O   1 
HETATM 5932 O O   . HOH G 6 .   ? 17.958  -124.807 -1.915  1.00 34.00 ? 1115 HOH B O   1 
HETATM 5933 O O   . HOH G 6 .   ? 24.700  -147.948 -20.515 1.00 36.22 ? 1116 HOH B O   1 
HETATM 5934 O O   . HOH G 6 .   ? -8.224  -102.913 -19.759 1.00 32.36 ? 1117 HOH B O   1 
HETATM 5935 O O   . HOH G 6 .   ? 15.177  -127.747 -41.940 1.00 41.14 ? 1118 HOH B O   1 
HETATM 5936 O O   . HOH G 6 .   ? 15.465  -126.685 -15.447 1.00 36.05 ? 1119 HOH B O   1 
HETATM 5937 O O   . HOH G 6 .   ? 45.609  -131.957 -35.440 1.00 45.24 ? 1120 HOH B O   1 
HETATM 5938 O O   . HOH G 6 .   ? 25.060  -129.777 -32.048 1.00 37.89 ? 1121 HOH B O   1 
HETATM 5939 O O   . HOH G 6 .   ? 14.884  -143.052 -23.658 1.00 40.99 ? 1122 HOH B O   1 
HETATM 5940 O O   . HOH G 6 .   ? 11.004  -99.734  -44.407 1.00 37.80 ? 1123 HOH B O   1 
HETATM 5941 O O   . HOH G 6 .   ? 43.714  -123.431 -42.536 1.00 35.87 ? 1124 HOH B O   1 
HETATM 5942 O O   . HOH G 6 .   ? 32.464  -136.849 -38.875 1.00 37.60 ? 1125 HOH B O   1 
HETATM 5943 O O   . HOH G 6 .   ? 16.725  -120.279 -14.964 1.00 31.74 ? 1126 HOH B O   1 
HETATM 5944 O O   . HOH G 6 .   ? -1.854  -98.368  -29.832 1.00 47.23 ? 1127 HOH B O   1 
HETATM 5945 O O   . HOH G 6 .   ? 36.896  -117.110 -15.712 1.00 34.29 ? 1128 HOH B O   1 
HETATM 5946 O O   . HOH G 6 .   ? 21.657  -132.378 -23.686 1.00 45.02 ? 1129 HOH B O   1 
HETATM 5947 O O   . HOH G 6 .   ? 6.358   -103.974 -51.353 1.00 42.20 ? 1130 HOH B O   1 
HETATM 5948 O O   . HOH G 6 .   ? 29.052  -106.405 -7.422  1.00 41.50 ? 1131 HOH B O   1 
HETATM 5949 O O   . HOH G 6 .   ? -0.664  -107.564 -4.329  1.00 39.63 ? 1132 HOH B O   1 
HETATM 5950 O O   . HOH G 6 .   ? 17.369  -119.392 -0.626  1.00 40.34 ? 1133 HOH B O   1 
HETATM 5951 O O   . HOH G 6 .   ? -3.040  -118.239 -50.144 1.00 51.69 ? 1134 HOH B O   1 
HETATM 5952 O O   . HOH G 6 .   ? 34.296  -125.463 -9.352  1.00 38.43 ? 1135 HOH B O   1 
HETATM 5953 O O   . HOH G 6 .   ? 2.849   -131.241 -24.737 1.00 40.67 ? 1136 HOH B O   1 
HETATM 5954 O O   . HOH G 6 .   ? 41.927  -128.429 -13.387 1.00 50.65 ? 1137 HOH B O   1 
HETATM 5955 O O   . HOH G 6 .   ? 14.409  -103.281 -3.380  1.00 43.59 ? 1138 HOH B O   1 
HETATM 5956 O O   . HOH G 6 .   ? 30.729  -135.887 -29.727 1.00 40.93 ? 1139 HOH B O   1 
HETATM 5957 O O   . HOH G 6 .   ? 0.979   -126.384 -6.204  1.00 44.86 ? 1140 HOH B O   1 
HETATM 5958 O O   . HOH G 6 .   ? 18.961  -119.670 -21.113 1.00 39.73 ? 1141 HOH B O   1 
HETATM 5959 O O   . HOH G 6 .   ? 17.709  -123.069 -27.086 1.00 35.08 ? 1142 HOH B O   1 
HETATM 5960 O O   . HOH G 6 .   ? 44.038  -114.704 -47.197 1.00 44.92 ? 1143 HOH B O   1 
HETATM 5961 O O   . HOH G 6 .   ? -1.287  -122.861 -6.961  1.00 41.92 ? 1144 HOH B O   1 
HETATM 5962 O O   . HOH G 6 .   ? -9.384  -111.694 -39.741 1.00 36.30 ? 1145 HOH B O   1 
HETATM 5963 O O   . HOH G 6 .   ? 11.271  -132.504 -46.970 1.00 39.84 ? 1146 HOH B O   1 
HETATM 5964 O O   . HOH G 6 .   ? 2.984   -102.643 -11.185 1.00 46.53 ? 1147 HOH B O   1 
HETATM 5965 O O   . HOH G 6 .   ? 12.885  -112.740 -31.297 1.00 33.05 ? 1148 HOH B O   1 
HETATM 5966 O O   . HOH G 6 .   ? 16.307  -110.601 -36.384 1.00 51.05 ? 1149 HOH B O   1 
HETATM 5967 O O   . HOH G 6 .   ? 39.118  -117.241 -14.403 1.00 50.08 ? 1150 HOH B O   1 
HETATM 5968 O O   . HOH G 6 .   ? 32.006  -117.406 -10.284 1.00 45.31 ? 1151 HOH B O   1 
HETATM 5969 O O   . HOH G 6 .   ? 2.608   -131.517 -20.562 1.00 35.64 ? 1152 HOH B O   1 
HETATM 5970 O O   . HOH G 6 .   ? 29.642  -130.232 -57.279 1.00 50.89 ? 1153 HOH B O   1 
HETATM 5971 O O   . HOH G 6 .   ? 22.954  -146.696 -3.195  1.00 76.21 ? 1154 HOH B O   1 
HETATM 5972 O O   . HOH G 6 .   ? 43.799  -123.061 -39.994 1.00 38.51 ? 1155 HOH B O   1 
HETATM 5973 O O   . HOH G 6 .   ? 18.654  -120.369 -39.594 1.00 38.07 ? 1156 HOH B O   1 
HETATM 5974 O O   . HOH G 6 .   ? 33.311  -138.194 -17.876 1.00 56.76 ? 1157 HOH B O   1 
HETATM 5975 O O   . HOH G 6 .   ? -4.832  -105.223 -2.061  1.00 50.36 ? 1158 HOH B O   1 
HETATM 5976 O O   . HOH G 6 .   ? -3.035  -109.888 -50.029 1.00 56.11 ? 1159 HOH B O   1 
HETATM 5977 O O   . HOH G 6 .   ? 50.080  -126.745 -38.876 1.00 39.46 ? 1160 HOH B O   1 
HETATM 5978 O O   . HOH G 6 .   ? 20.946  -133.127 -47.045 1.00 45.72 ? 1161 HOH B O   1 
HETATM 5979 O O   . HOH G 6 .   ? 28.550  -106.351 -46.524 1.00 51.78 ? 1162 HOH B O   1 
HETATM 5980 O O   . HOH G 6 .   ? 16.377  -123.335 -29.458 1.00 49.81 ? 1163 HOH B O   1 
HETATM 5981 O O   . HOH G 6 .   ? -4.089  -99.935  -36.001 1.00 45.42 ? 1164 HOH B O   1 
HETATM 5982 O O   . HOH G 6 .   ? 20.139  -117.999 -62.467 1.00 43.41 ? 1165 HOH B O   1 
HETATM 5983 O O   . HOH G 6 .   ? 33.609  -131.500 -8.166  1.00 42.85 ? 1166 HOH B O   1 
HETATM 5984 O O   . HOH G 6 .   ? 37.278  -112.128 -46.122 1.00 37.55 ? 1167 HOH B O   1 
HETATM 5985 O O   . HOH G 6 .   ? 28.901  -137.396 -26.403 1.00 41.78 ? 1168 HOH B O   1 
HETATM 5986 O O   . HOH G 6 .   ? 44.906  -129.693 -32.948 1.00 43.18 ? 1169 HOH B O   1 
HETATM 5987 O O   . HOH G 6 .   ? 26.655  -114.793 -3.430  1.00 37.47 ? 1170 HOH B O   1 
HETATM 5988 O O   . HOH G 6 .   ? 28.487  -120.723 -11.608 1.00 35.83 ? 1171 HOH B O   1 
HETATM 5989 O O   . HOH G 6 .   ? -7.127  -121.020 -12.740 1.00 44.97 ? 1172 HOH B O   1 
HETATM 5990 O O   . HOH G 6 .   ? 24.090  -101.521 -10.291 1.00 41.75 ? 1173 HOH B O   1 
HETATM 5991 O O   . HOH G 6 .   ? 7.701   -130.771 -10.240 1.00 48.14 ? 1174 HOH B O   1 
HETATM 5992 O O   . HOH G 6 .   ? -4.905  -129.607 -37.917 1.00 37.57 ? 1175 HOH B O   1 
HETATM 5993 O O   . HOH G 6 .   ? 21.346  -106.954 -43.666 1.00 42.29 ? 1176 HOH B O   1 
HETATM 5994 O O   . HOH G 6 .   ? -10.437 -126.411 -17.076 1.00 46.17 ? 1177 HOH B O   1 
HETATM 5995 O O   . HOH G 6 .   ? -12.876 -108.655 -38.703 1.00 42.52 ? 1178 HOH B O   1 
HETATM 5996 O O   . HOH G 6 .   ? -13.412 -118.170 -38.067 1.00 51.36 ? 1179 HOH B O   1 
HETATM 5997 O O   . HOH G 6 .   ? 26.427  -133.943 -47.490 1.00 40.67 ? 1180 HOH B O   1 
HETATM 5998 O O   . HOH G 6 .   ? 13.303  -127.762 -14.185 1.00 43.74 ? 1181 HOH B O   1 
HETATM 5999 O O   . HOH G 6 .   ? -12.734 -109.287 -22.173 1.00 41.09 ? 1182 HOH B O   1 
HETATM 6000 O O   . HOH G 6 .   ? 40.688  -136.514 -36.810 1.00 35.45 ? 1183 HOH B O   1 
HETATM 6001 O O   . HOH G 6 .   ? 3.245   -100.581 -8.077  1.00 53.33 ? 1184 HOH B O   1 
HETATM 6002 O O   . HOH G 6 .   ? 44.057  -129.996 -48.465 1.00 43.77 ? 1185 HOH B O   1 
HETATM 6003 O O   . HOH G 6 .   ? -2.335  -105.388 -45.960 1.00 46.20 ? 1186 HOH B O   1 
HETATM 6004 O O   . HOH G 6 .   ? 7.899   -127.072 -35.353 1.00 49.17 ? 1187 HOH B O   1 
HETATM 6005 O O   . HOH G 6 .   ? 26.224  -102.609 -59.145 1.00 45.93 ? 1188 HOH B O   1 
HETATM 6006 O O   . HOH G 6 .   ? 43.641  -133.777 -35.560 1.00 38.71 ? 1189 HOH B O   1 
HETATM 6007 O O   . HOH G 6 .   ? 9.667   -99.085  -5.969  1.00 45.45 ? 1190 HOH B O   1 
HETATM 6008 O O   . HOH G 6 .   ? 28.604  -123.166 -9.840  1.00 38.01 ? 1191 HOH B O   1 
HETATM 6009 O O   . HOH G 6 .   ? 25.601  -103.778 -13.767 1.00 40.07 ? 1192 HOH B O   1 
HETATM 6010 O O   . HOH G 6 .   ? 26.819  -148.544 -14.457 1.00 42.52 ? 1193 HOH B O   1 
HETATM 6011 O O   . HOH G 6 .   ? 13.152  -120.500 6.422   1.00 44.60 ? 1194 HOH B O   1 
HETATM 6012 O O   . HOH G 6 .   ? 26.799  -127.265 -34.654 1.00 33.35 ? 1195 HOH B O   1 
HETATM 6013 O O   . HOH G 6 .   ? 16.654  -113.416 -36.510 1.00 59.74 ? 1196 HOH B O   1 
HETATM 6014 O O   . HOH G 6 .   ? 39.089  -137.478 -34.222 1.00 36.20 ? 1197 HOH B O   1 
HETATM 6015 O O   . HOH G 6 .   ? 7.817   -93.616  -34.281 1.00 51.55 ? 1198 HOH B O   1 
HETATM 6016 O O   . HOH G 6 .   ? 13.518  -131.933 -42.738 1.00 58.34 ? 1199 HOH B O   1 
HETATM 6017 O O   . HOH G 6 .   ? -14.690 -124.899 -28.472 1.00 43.55 ? 1200 HOH B O   1 
HETATM 6018 O O   . HOH G 6 .   ? 3.610   -120.693 -55.636 1.00 41.10 ? 1201 HOH B O   1 
HETATM 6019 O O   . HOH G 6 .   ? -15.004 -104.027 -25.283 1.00 64.23 ? 1202 HOH B O   1 
HETATM 6020 O O   . HOH G 6 .   ? 12.948  -116.261 -16.117 1.00 44.43 ? 1203 HOH B O   1 
HETATM 6021 O O   . HOH G 6 .   ? -15.175 -113.870 -34.630 1.00 42.64 ? 1204 HOH B O   1 
HETATM 6022 O O   . HOH G 6 .   ? 38.782  -136.453 -40.579 1.00 50.85 ? 1205 HOH B O   1 
HETATM 6023 O O   . HOH G 6 .   ? 3.897   -101.368 -48.571 1.00 49.80 ? 1206 HOH B O   1 
HETATM 6024 O O   . HOH G 6 .   ? -9.109  -122.494 -13.651 1.00 50.95 ? 1207 HOH B O   1 
HETATM 6025 O O   . HOH G 6 .   ? 6.978   -100.097 -11.099 1.00 66.66 ? 1208 HOH B O   1 
HETATM 6026 O O   . HOH G 6 .   ? 29.278  -124.854 -5.824  1.00 47.87 ? 1209 HOH B O   1 
HETATM 6027 O O   . HOH G 6 .   ? -10.518 -108.832 -12.479 1.00 40.35 ? 1210 HOH B O   1 
HETATM 6028 O O   . HOH G 6 .   ? 21.433  -124.500 -40.498 1.00 63.56 ? 1211 HOH B O   1 
HETATM 6029 O O   . HOH G 6 .   ? -10.734 -121.214 -11.984 1.00 58.00 ? 1212 HOH B O   1 
HETATM 6030 O O   . HOH G 6 .   ? 43.183  -124.479 -50.326 1.00 49.24 ? 1213 HOH B O   1 
HETATM 6031 O O   . HOH G 6 .   ? 30.872  -107.468 -67.377 1.00 57.45 ? 1214 HOH B O   1 
HETATM 6032 O O   . HOH G 6 .   ? 11.015  -129.963 -54.708 1.00 41.58 ? 1215 HOH B O   1 
HETATM 6033 O O   . HOH G 6 .   ? 0.121   -123.058 -4.545  1.00 42.53 ? 1216 HOH B O   1 
HETATM 6034 O O   . HOH G 6 .   ? 41.670  -140.887 -20.959 1.00 51.19 ? 1217 HOH B O   1 
HETATM 6035 O O   . HOH G 6 .   ? 21.748  -101.738 -5.917  1.00 40.42 ? 1218 HOH B O   1 
HETATM 6036 O O   . HOH G 6 .   ? 24.311  -122.555 -0.710  1.00 46.85 ? 1219 HOH B O   1 
HETATM 6037 O O   . HOH G 6 .   ? 40.978  -136.110 -44.490 1.00 55.39 ? 1220 HOH B O   1 
HETATM 6038 O O   . HOH G 6 .   ? 12.384  -103.409 -13.609 1.00 43.25 ? 1221 HOH B O   1 
HETATM 6039 O O   . HOH G 6 .   ? 37.413  -123.142 -55.111 1.00 41.55 ? 1222 HOH B O   1 
HETATM 6040 O O   . HOH G 6 .   ? 34.082  -138.716 -12.602 1.00 49.93 ? 1223 HOH B O   1 
HETATM 6041 O O   . HOH G 6 .   ? -8.058  -126.918 -39.824 1.00 50.13 ? 1224 HOH B O   1 
HETATM 6042 O O   . HOH G 6 .   ? 29.410  -133.641 -34.777 1.00 45.67 ? 1225 HOH B O   1 
HETATM 6043 O O   . HOH G 6 .   ? 6.142   -100.837 4.640   1.00 47.11 ? 1226 HOH B O   1 
HETATM 6044 O O   . HOH G 6 .   ? 15.645  -110.976 -56.231 1.00 37.25 ? 1227 HOH B O   1 
HETATM 6045 O O   . HOH G 6 .   ? 49.106  -118.878 -36.510 1.00 57.76 ? 1228 HOH B O   1 
HETATM 6046 O O   . HOH G 6 .   ? 1.201   -106.065 -4.222  1.00 41.37 ? 1229 HOH B O   1 
HETATM 6047 O O   . HOH G 6 .   ? -0.849  -106.171 -7.685  1.00 48.13 ? 1230 HOH B O   1 
HETATM 6048 O O   . HOH G 6 .   ? 35.660  -136.927 -36.448 1.00 43.65 ? 1231 HOH B O   1 
HETATM 6049 O O   . HOH G 6 .   ? 42.568  -132.690 -27.963 1.00 42.85 ? 1232 HOH B O   1 
HETATM 6050 O O   . HOH G 6 .   ? 9.892   -126.247 -36.864 1.00 47.71 ? 1233 HOH B O   1 
HETATM 6051 O O   . HOH G 6 .   ? 42.901  -137.692 -32.819 1.00 42.66 ? 1234 HOH B O   1 
HETATM 6052 O O   . HOH G 6 .   ? 30.413  -135.502 -32.217 1.00 54.21 ? 1235 HOH B O   1 
HETATM 6053 O O   . HOH G 6 .   ? -9.434  -127.708 -20.489 1.00 56.23 ? 1236 HOH B O   1 
HETATM 6054 O O   . HOH G 6 .   ? -6.833  -124.871 -42.750 1.00 47.32 ? 1237 HOH B O   1 
HETATM 6055 O O   . HOH G 6 .   ? 23.766  -101.263 -7.645  1.00 48.06 ? 1238 HOH B O   1 
HETATM 6056 O O   . HOH G 6 .   ? 4.710   -106.526 -54.560 1.00 45.93 ? 1239 HOH B O   1 
HETATM 6057 O O   . HOH G 6 .   ? 44.513  -115.057 -32.616 1.00 46.69 ? 1240 HOH B O   1 
HETATM 6058 O O   . HOH G 6 .   ? 35.168  -139.817 -28.592 1.00 41.02 ? 1241 HOH B O   1 
HETATM 6059 O O   . HOH G 6 .   ? 46.698  -117.728 -43.743 1.00 53.38 ? 1242 HOH B O   1 
HETATM 6060 O O   . HOH G 6 .   ? 45.146  -124.765 -16.266 1.00 56.03 ? 1243 HOH B O   1 
HETATM 6061 O O   . HOH G 6 .   ? -15.916 -123.928 -30.995 1.00 58.03 ? 1244 HOH B O   1 
HETATM 6062 O O   . HOH G 6 .   ? -0.942  -99.647  -37.374 1.00 58.23 ? 1245 HOH B O   1 
HETATM 6063 O O   . HOH G 6 .   ? 49.144  -122.420 -32.820 1.00 45.42 ? 1246 HOH B O   1 
HETATM 6064 O O   . HOH G 6 .   ? 3.211   -102.642 -1.566  1.00 41.17 ? 1247 HOH B O   1 
HETATM 6065 O O   . HOH G 6 .   ? 46.987  -121.901 -40.796 1.00 44.92 ? 1248 HOH B O   1 
HETATM 6066 O O   . HOH G 6 .   ? 33.386  -113.776 -57.569 1.00 45.64 ? 1249 HOH B O   1 
HETATM 6067 O O   . HOH G 6 .   ? 25.028  -103.880 -55.989 1.00 46.64 ? 1250 HOH B O   1 
HETATM 6068 O O   . HOH G 6 .   ? -17.373 -103.158 -29.869 1.00 60.50 ? 1251 HOH B O   1 
HETATM 6069 O O   . HOH G 6 .   ? -14.542 -119.300 -23.714 1.00 62.95 ? 1252 HOH B O   1 
HETATM 6070 O O   . HOH G 6 .   ? 29.049  -110.334 -11.294 1.00 41.35 ? 1253 HOH B O   1 
HETATM 6071 O O   . HOH G 6 .   ? -3.020  -130.269 -39.615 1.00 56.18 ? 1254 HOH B O   1 
HETATM 6072 O O   . HOH G 6 .   ? 44.766  -124.240 -23.455 1.00 51.04 ? 1255 HOH B O   1 
HETATM 6073 O O   . HOH G 6 .   ? 27.383  -149.540 -10.072 1.00 46.59 ? 1256 HOH B O   1 
HETATM 6074 O O   . HOH G 6 .   ? 43.460  -129.327 -16.863 1.00 43.28 ? 1257 HOH B O   1 
HETATM 6075 O O   . HOH G 6 .   ? 42.501  -121.469 -17.782 1.00 50.73 ? 1258 HOH B O   1 
HETATM 6076 O O   . HOH G 6 .   ? 26.671  -158.599 -11.405 1.00 59.01 ? 1259 HOH B O   1 
HETATM 6077 O O   . HOH G 6 .   ? 23.903  -102.647 -4.151  1.00 52.14 ? 1260 HOH B O   1 
HETATM 6078 O O   . HOH G 6 .   ? -0.692  -120.411 -0.040  0.50 31.06 ? 1261 HOH B O   1 
HETATM 6079 O O   . HOH G 6 .   ? 3.384   -107.734 -51.289 1.00 57.31 ? 1262 HOH B O   1 
HETATM 6080 O O   . HOH G 6 .   ? 9.144   -108.524 8.441   1.00 41.06 ? 1263 HOH B O   1 
HETATM 6081 O O   . HOH G 6 .   ? 25.237  -114.568 -21.528 1.00 42.07 ? 1264 HOH B O   1 
HETATM 6082 O O   . HOH G 6 .   ? 2.543   -104.215 -3.599  1.00 51.66 ? 1265 HOH B O   1 
HETATM 6083 O O   . HOH G 6 .   ? 31.874  -138.973 -32.410 1.00 54.97 ? 1266 HOH B O   1 
HETATM 6084 O O   . HOH G 6 .   ? 21.096  -120.166 -38.580 1.00 60.34 ? 1267 HOH B O   1 
HETATM 6085 O O   . HOH G 6 .   ? 7.492   -131.555 -49.039 1.00 54.41 ? 1268 HOH B O   1 
HETATM 6086 O O   . HOH G 6 .   ? 3.378   -132.442 -38.480 1.00 50.73 ? 1269 HOH B O   1 
HETATM 6087 O O   . HOH G 6 .   ? -14.629 -100.762 -36.990 1.00 41.50 ? 1270 HOH B O   1 
HETATM 6088 O O   . HOH G 6 .   ? -0.182  -101.923 -42.328 1.00 56.03 ? 1271 HOH B O   1 
HETATM 6089 O O   . HOH G 6 .   ? 34.891  -117.556 -57.996 1.00 41.14 ? 1272 HOH B O   1 
HETATM 6090 O O   . HOH G 6 .   ? 15.792  -119.701 -31.918 1.00 57.61 ? 1273 HOH B O   1 
HETATM 6091 O O   . HOH G 6 .   ? 5.153   -100.588 -15.520 1.00 42.87 ? 1274 HOH B O   1 
HETATM 6092 O O   . HOH G 6 .   ? 23.247  -127.850 -30.462 1.00 54.75 ? 1275 HOH B O   1 
HETATM 6093 O O   . HOH G 6 .   ? -3.911  -110.496 -47.715 1.00 52.11 ? 1276 HOH B O   1 
HETATM 6094 O O   . HOH G 6 .   ? 10.182  -97.297  -40.633 1.00 62.28 ? 1277 HOH B O   1 
HETATM 6095 O O   . HOH G 6 .   ? 15.813  -113.432 -28.076 1.00 49.51 ? 1278 HOH B O   1 
HETATM 6096 O O   . HOH G 6 .   ? -7.633  -124.086 -10.692 1.00 48.80 ? 1279 HOH B O   1 
HETATM 6097 O O   . HOH G 6 .   ? 15.367  -111.713 4.617   1.00 60.01 ? 1280 HOH B O   1 
HETATM 6098 O O   . HOH G 6 .   ? -10.543 -114.116 -42.708 1.00 56.10 ? 1281 HOH B O   1 
HETATM 6099 O O   . HOH G 6 .   ? 18.732  -132.772 -23.395 1.00 58.08 ? 1282 HOH B O   1 
HETATM 6100 O O   . HOH G 6 .   ? 14.801  -132.926 -51.834 1.00 48.53 ? 1283 HOH B O   1 
HETATM 6101 O O   . HOH G 6 .   ? 17.993  -124.650 -31.278 1.00 59.35 ? 1284 HOH B O   1 
HETATM 6102 O O   . HOH G 6 .   ? -5.410  -123.031 -6.481  1.00 50.95 ? 1285 HOH B O   1 
HETATM 6103 O O   . HOH G 6 .   ? 48.815  -123.703 -37.299 1.00 60.22 ? 1286 HOH B O   1 
HETATM 6104 O O   . HOH G 6 .   ? 9.050   -130.589 -12.203 1.00 43.44 ? 1287 HOH B O   1 
HETATM 6105 O O   . HOH G 6 .   ? -14.532 -111.759 -32.534 1.00 38.90 ? 1288 HOH B O   1 
HETATM 6106 O O   . HOH G 6 .   ? 36.046  -140.202 -33.115 1.00 42.16 ? 1289 HOH B O   1 
HETATM 6107 O O   . HOH G 6 .   ? 14.179  -107.546 -36.651 1.00 44.67 ? 1290 HOH B O   1 
HETATM 6108 O O   . HOH G 6 .   ? 26.897  -154.731 -5.534  1.00 60.51 ? 1291 HOH B O   1 
HETATM 6109 O O   . HOH G 6 .   ? 46.775  -120.107 -28.558 1.00 60.24 ? 1292 HOH B O   1 
HETATM 6110 O O   . HOH G 6 .   ? 8.041   -125.937 -26.122 1.00 58.97 ? 1293 HOH B O   1 
HETATM 6111 O O   . HOH G 6 .   ? 33.276  -140.700 -8.307  1.00 61.24 ? 1294 HOH B O   1 
HETATM 6112 O O   . HOH G 6 .   ? 37.527  -110.901 -23.396 1.00 57.07 ? 1295 HOH B O   1 
HETATM 6113 O O   . HOH G 6 .   ? 25.024  -127.946 -36.336 1.00 55.70 ? 1296 HOH B O   1 
HETATM 6114 O O   . HOH G 6 .   ? 10.676  -99.867  -9.718  1.00 57.77 ? 1297 HOH B O   1 
HETATM 6115 O O   . HOH G 6 .   ? 21.041  -128.039 -58.308 1.00 57.25 ? 1298 HOH B O   1 
HETATM 6116 O O   . HOH G 6 .   ? 4.841   -127.940 -4.781  1.00 49.33 ? 1299 HOH B O   1 
HETATM 6117 O O   . HOH G 6 .   ? -6.317  -102.254 -15.637 1.00 54.82 ? 1300 HOH B O   1 
HETATM 6118 O O   . HOH G 6 .   ? -16.528 -100.773 -33.407 1.00 61.04 ? 1301 HOH B O   1 
HETATM 6119 O O   . HOH G 6 .   ? 6.695   -95.744  -40.564 1.00 53.73 ? 1302 HOH B O   1 
HETATM 6120 O O   . HOH G 6 .   ? 34.534  -120.303 -58.055 1.00 52.51 ? 1303 HOH B O   1 
HETATM 6121 O O   . HOH G 6 .   ? -12.580 -114.855 -11.356 1.00 58.91 ? 1304 HOH B O   1 
HETATM 6122 O O   . HOH G 6 .   ? 43.206  -117.377 -24.366 1.00 53.08 ? 1305 HOH B O   1 
HETATM 6123 O O   . HOH G 6 .   ? 0.325   -130.109 -12.210 1.00 63.39 ? 1306 HOH B O   1 
HETATM 6124 O O   . HOH G 6 .   ? -8.870  -125.023 -14.330 1.00 59.75 ? 1307 HOH B O   1 
HETATM 6125 O O   . HOH G 6 .   ? 44.463  -133.636 -45.177 1.00 47.59 ? 1308 HOH B O   1 
HETATM 6126 O O   . HOH G 6 .   ? 6.965   -98.945  -26.549 1.00 50.12 ? 1309 HOH B O   1 
HETATM 6127 O O   . HOH G 6 .   ? 1.456   -131.742 -30.840 1.00 59.61 ? 1310 HOH B O   1 
HETATM 6128 O O   . HOH G 6 .   ? 38.622  -128.892 -53.559 1.00 64.20 ? 1311 HOH B O   1 
HETATM 6129 O O   . HOH G 6 .   ? 34.556  -106.755 -29.851 1.00 54.28 ? 1312 HOH B O   1 
HETATM 6130 O O   . HOH G 6 .   ? 1.288   -100.363 -17.462 1.00 54.29 ? 1313 HOH B O   1 
HETATM 6131 O O   . HOH G 6 .   ? -1.713  -105.733 -48.426 1.00 49.30 ? 1314 HOH B O   1 
HETATM 6132 O O   . HOH G 6 .   ? 13.855  -110.040 -61.743 1.00 58.22 ? 1315 HOH B O   1 
HETATM 6133 O O   . HOH G 6 .   ? -0.590  -103.129 -8.869  1.00 56.87 ? 1316 HOH B O   1 
HETATM 6134 O O   . HOH G 6 .   ? 26.267  -133.498 -32.197 1.00 57.94 ? 1317 HOH B O   1 
HETATM 6135 O O   . HOH G 6 .   ? -12.899 -120.369 -39.205 1.00 59.87 ? 1318 HOH B O   1 
HETATM 6136 O O   . HOH G 6 .   ? -4.817  -103.831 -8.854  1.00 54.62 ? 1319 HOH B O   1 
HETATM 6137 O O   . HOH G 6 .   ? 42.624  -118.602 -50.491 1.00 51.11 ? 1320 HOH B O   1 
HETATM 6138 O O   . HOH G 6 .   ? 3.091   -98.438  -45.419 1.00 68.88 ? 1321 HOH B O   1 
HETATM 6139 O O   . HOH G 6 .   ? 31.598  -103.542 -65.090 1.00 77.71 ? 1322 HOH B O   1 
HETATM 6140 O O   . HOH G 6 .   ? 46.625  -131.005 -29.335 1.00 47.89 ? 1323 HOH B O   1 
HETATM 6141 O O   . HOH G 6 .   ? -15.026 -124.811 -24.439 1.00 53.64 ? 1324 HOH B O   1 
HETATM 6142 O O   . HOH G 6 .   ? 10.384  -133.657 -42.737 1.00 63.99 ? 1325 HOH B O   1 
HETATM 6143 O O   . HOH G 6 .   ? 20.077  -129.473 -26.806 1.00 69.60 ? 1326 HOH B O   1 
HETATM 6144 O O   . HOH G 6 .   ? -4.830  -98.673  -22.037 1.00 42.65 ? 1327 HOH B O   1 
HETATM 6145 O O   . HOH G 6 .   ? 20.911  -145.834 -27.163 1.00 57.06 ? 1328 HOH B O   1 
HETATM 6146 O O   . HOH G 6 .   ? 1.000   -104.939 -24.573 1.00 46.98 ? 1329 HOH B O   1 
HETATM 6147 O O   . HOH G 6 .   ? 25.504  -143.125 -4.209  1.00 58.54 ? 1330 HOH B O   1 
HETATM 6148 O O   . HOH G 6 .   ? 28.375  -101.146 -61.242 1.00 80.14 ? 1331 HOH B O   1 
HETATM 6149 O O   . HOH G 6 .   ? 19.819  -133.796 -54.097 1.00 67.57 ? 1332 HOH B O   1 
HETATM 6150 O O   . HOH G 6 .   ? 32.454  -133.508 -6.836  1.00 53.46 ? 1333 HOH B O   1 
HETATM 6151 O O   . HOH G 6 .   ? 44.040  -123.509 -18.587 1.00 46.42 ? 1334 HOH B O   1 
HETATM 6152 O O   . HOH G 6 .   ? 25.304  -136.171 -42.802 1.00 67.45 ? 1335 HOH B O   1 
HETATM 6153 O O   . HOH G 6 .   ? 43.275  -117.169 -14.370 1.00 66.82 ? 1336 HOH B O   1 
HETATM 6154 O O   . HOH G 6 .   ? 21.656  -121.822 -35.026 1.00 54.25 ? 1337 HOH B O   1 
HETATM 6155 O O   . HOH G 6 .   ? -14.320 -113.658 -38.714 1.00 52.73 ? 1338 HOH B O   1 
HETATM 6156 O O   . HOH G 6 .   ? -3.852  -121.518 -50.146 1.00 59.27 ? 1339 HOH B O   1 
HETATM 6157 O O   . HOH G 6 .   ? -7.798  -110.724 -41.685 1.00 47.25 ? 1340 HOH B O   1 
HETATM 6158 O O   . HOH G 6 .   ? 12.632  -127.216 3.476   1.00 60.40 ? 1341 HOH B O   1 
HETATM 6159 O O   . HOH G 6 .   ? 7.064   -131.090 -23.864 1.00 67.90 ? 1342 HOH B O   1 
HETATM 6160 O O   . HOH G 6 .   ? 22.196  -121.831 -58.808 1.00 55.73 ? 1343 HOH B O   1 
HETATM 6161 O O   . HOH G 6 .   ? 16.298  -108.944 -38.444 1.00 45.63 ? 1344 HOH B O   1 
HETATM 6162 O O   . HOH G 6 .   ? 15.241  -103.932 -41.198 1.00 49.44 ? 1345 HOH B O   1 
HETATM 6163 O O   . HOH G 6 .   ? 22.768  -139.667 -24.561 1.00 52.29 ? 1346 HOH B O   1 
HETATM 6164 O O   . HOH G 6 .   ? 19.603  -120.708 -59.610 1.00 49.16 ? 1347 HOH B O   1 
HETATM 6165 O O   . HOH G 6 .   ? 10.518  -142.508 -23.524 1.00 54.72 ? 1348 HOH B O   1 
HETATM 6166 O O   . HOH G 6 .   ? 33.967  -139.031 -34.508 1.00 65.15 ? 1349 HOH B O   1 
HETATM 6167 O O   . HOH G 6 .   ? 23.433  -126.056 -37.205 1.00 53.70 ? 1350 HOH B O   1 
HETATM 6168 O O   . HOH G 6 .   ? -2.102  -131.694 -18.757 1.00 47.34 ? 1351 HOH B O   1 
HETATM 6169 O O   . HOH G 6 .   ? 11.593  -107.872 -59.790 1.00 50.10 ? 1352 HOH B O   1 
HETATM 6170 O O   . HOH G 6 .   ? 20.601  -103.921 -19.278 1.00 48.95 ? 1353 HOH B O   1 
HETATM 6171 O O   . HOH G 6 .   ? 22.658  -103.854 -50.054 1.00 52.14 ? 1354 HOH B O   1 
HETATM 6172 O O   . HOH G 6 .   ? -4.159  -114.574 -53.951 1.00 56.49 ? 1355 HOH B O   1 
HETATM 6173 O O   . HOH G 6 .   ? 12.262  -94.229  -34.218 1.00 63.61 ? 1356 HOH B O   1 
HETATM 6174 O O   . HOH G 6 .   ? -3.961  -126.949 -48.136 1.00 51.42 ? 1357 HOH B O   1 
HETATM 6175 O O   . HOH G 6 .   ? -5.384  -102.972 -42.461 1.00 49.04 ? 1358 HOH B O   1 
HETATM 6176 O O   . HOH G 6 .   ? 15.355  -125.062 -57.553 1.00 38.94 ? 1359 HOH B O   1 
HETATM 6177 O O   . HOH G 6 .   ? 13.801  -132.227 -48.363 1.00 54.14 ? 1360 HOH B O   1 
HETATM 6178 O O   . HOH G 6 .   ? 19.458  -117.778 -35.160 1.00 46.10 ? 1361 HOH B O   1 
HETATM 6179 O O   . HOH G 6 .   ? 14.022  -102.103 -17.001 1.00 56.49 ? 1362 HOH B O   1 
HETATM 6180 O O   . HOH G 6 .   ? 7.466   -103.797 8.703   1.00 56.23 ? 1363 HOH B O   1 
HETATM 6181 O O   . HOH G 6 .   ? 9.869   -99.902  -13.188 1.00 53.77 ? 1364 HOH B O   1 
HETATM 6182 O O   . HOH G 6 .   ? 20.280  -142.052 -2.525  1.00 69.43 ? 1365 HOH B O   1 
HETATM 6183 O O   . HOH G 6 .   ? 24.566  -110.214 0.803   1.00 56.52 ? 1366 HOH B O   1 
HETATM 6184 O O   . HOH G 6 .   ? 27.106  -151.151 -13.668 1.00 56.52 ? 1367 HOH B O   1 
HETATM 6185 O O   . HOH G 6 .   ? 30.905  -118.572 -64.716 1.00 55.62 ? 1368 HOH B O   1 
HETATM 6186 O O   . HOH G 6 .   ? 10.313  -134.386 -49.100 1.00 57.19 ? 1369 HOH B O   1 
HETATM 6187 O O   . HOH G 6 .   ? 44.786  -131.398 -24.713 1.00 57.50 ? 1370 HOH B O   1 
HETATM 6188 O O   . HOH G 6 .   ? 13.160  -124.410 -60.122 1.00 53.29 ? 1371 HOH B O   1 
HETATM 6189 O O   . HOH G 6 .   ? 10.666  -139.348 -14.928 1.00 60.91 ? 1372 HOH B O   1 
HETATM 6190 O O   . HOH G 6 .   ? 40.276  -135.954 -9.293  1.00 71.16 ? 1373 HOH B O   1 
HETATM 6191 O O   . HOH G 6 .   ? 24.100  -130.206 -40.833 1.00 57.53 ? 1374 HOH B O   1 
HETATM 6192 O O   . HOH G 6 .   ? 9.500   -100.968 6.237   1.00 55.66 ? 1375 HOH B O   1 
HETATM 6193 O O   . HOH G 6 .   ? -1.148  -131.938 -44.518 1.00 51.52 ? 1376 HOH B O   1 
HETATM 6194 O O   . HOH G 6 .   ? 32.244  -107.893 -26.806 1.00 64.80 ? 1377 HOH B O   1 
HETATM 6195 O O   . HOH G 6 .   ? 0.863   -126.046 -53.313 1.00 41.70 ? 1378 HOH B O   1 
HETATM 6196 O O   . HOH G 6 .   ? 16.292  -147.075 -27.728 1.00 56.00 ? 1379 HOH B O   1 
HETATM 6197 O O   . HOH G 6 .   ? -6.237  -126.492 -12.008 1.00 57.12 ? 1380 HOH B O   1 
HETATM 6198 O O   . HOH G 6 .   ? 16.927  -95.235  4.233   1.00 57.71 ? 1381 HOH B O   1 
HETATM 6199 O O   . HOH G 6 .   ? 42.261  -121.647 -15.178 1.00 52.67 ? 1382 HOH B O   1 
HETATM 6200 O O   . HOH G 6 .   ? 8.476   -130.899 -54.137 1.00 53.45 ? 1383 HOH B O   1 
HETATM 6201 O O   . HOH G 6 .   ? 23.757  -110.615 -1.733  1.00 41.31 ? 1384 HOH B O   1 
HETATM 6202 O O   . HOH G 6 .   ? 31.734  -107.370 -40.482 1.00 59.03 ? 1385 HOH B O   1 
HETATM 6203 O O   . HOH G 6 .   ? 10.775  -127.726 -38.941 1.00 51.33 ? 1386 HOH B O   1 
HETATM 6204 O O   . HOH G 6 .   ? 2.774   -127.931 -52.664 1.00 46.82 ? 1387 HOH B O   1 
HETATM 6205 O O   . HOH G 6 .   ? 24.650  -112.703 -26.510 1.00 47.49 ? 1388 HOH B O   1 
HETATM 6206 O O   . HOH G 6 .   ? 8.570   -124.322 -24.208 1.00 50.74 ? 1389 HOH B O   1 
HETATM 6207 O O   . HOH G 6 .   ? -14.897 -101.323 -27.407 1.00 42.11 ? 1390 HOH B O   1 
HETATM 6208 O O   . HOH G 6 .   ? 3.358   -132.757 -44.814 1.00 44.57 ? 1391 HOH B O   1 
HETATM 6209 O O   . HOH G 6 .   ? 31.567  -108.547 -46.746 1.00 50.34 ? 1392 HOH B O   1 
HETATM 6210 O O   . HOH G 6 .   ? 9.415   -104.302 -54.886 1.00 60.19 ? 1393 HOH B O   1 
HETATM 6211 O O   . HOH G 6 .   ? 37.538  -129.727 -51.186 1.00 53.19 ? 1394 HOH B O   1 
HETATM 6212 O O   . HOH G 6 .   ? 45.200  -117.869 -27.021 1.00 51.38 ? 1395 HOH B O   1 
HETATM 6213 O O   . HOH G 6 .   ? 31.167  -117.378 -67.115 1.00 55.00 ? 1396 HOH B O   1 
HETATM 6214 O O   . HOH G 6 .   ? 5.624   -97.947  -0.375  1.00 58.87 ? 1397 HOH B O   1 
HETATM 6215 O O   . HOH G 6 .   ? 27.428  -153.411 -20.066 1.00 58.76 ? 1398 HOH B O   1 
HETATM 6216 O O   . HOH G 6 .   ? 28.210  -151.585 -8.868  1.00 59.38 ? 1399 HOH B O   1 
HETATM 6217 O O   . HOH G 6 .   ? 5.408   -121.509 -57.247 1.00 56.28 ? 1400 HOH B O   1 
HETATM 6218 O O   . HOH G 6 .   ? 12.659  -127.874 -26.613 1.00 68.78 ? 1401 HOH B O   1 
HETATM 6219 O O   . HOH G 6 .   ? 28.401  -128.775 -3.317  1.00 63.70 ? 1402 HOH B O   1 
HETATM 6220 O O   . HOH G 6 .   ? -11.913 -109.606 -25.704 1.00 24.78 ? 1403 HOH B O   1 
HETATM 6221 O O   . HOH G 6 .   ? 34.062  -117.616 -12.123 1.00 33.26 ? 1404 HOH B O   1 
HETATM 6222 O O   . HOH G 6 .   ? 26.657  -124.360 -5.226  1.00 40.24 ? 1405 HOH B O   1 
HETATM 6223 O O   . HOH G 6 .   ? -15.403 -105.445 -36.506 1.00 40.94 ? 1406 HOH B O   1 
HETATM 6224 O O   . HOH G 6 .   ? 36.391  -122.284 -57.358 1.00 52.47 ? 1407 HOH B O   1 
HETATM 6225 O O   . HOH G 6 .   ? 29.993  -123.005 -7.691  1.00 48.92 ? 1408 HOH B O   1 
HETATM 6226 O O   . HOH G 6 .   ? 5.000   -103.309 4.768   1.00 43.38 ? 1409 HOH B O   1 
HETATM 6227 O O   . HOH G 6 .   ? 28.705  -135.414 -36.670 1.00 44.90 ? 1410 HOH B O   1 
HETATM 6228 O O   . HOH G 6 .   ? -2.309  -129.300 -48.197 1.00 51.10 ? 1411 HOH B O   1 
HETATM 6229 O O   . HOH G 6 .   ? 25.097  -138.069 -25.241 1.00 52.00 ? 1412 HOH B O   1 
HETATM 6230 O O   . HOH G 6 .   ? -4.807  -100.174 -20.052 1.00 37.75 ? 1413 HOH B O   1 
HETATM 6231 O O   . HOH G 6 .   ? -6.595  -128.919 -30.243 1.00 49.10 ? 1414 HOH B O   1 
HETATM 6232 O O   . HOH G 6 .   ? 37.829  -125.919 -55.837 1.00 49.36 ? 1415 HOH B O   1 
HETATM 6233 O O   . HOH G 6 .   ? 31.919  -105.453 -55.506 1.00 50.03 ? 1416 HOH B O   1 
HETATM 6234 O O   . HOH G 6 .   ? 17.219  -109.503 3.129   1.00 61.69 ? 1417 HOH B O   1 
HETATM 6235 O O   . HOH G 6 .   ? -13.355 -106.921 -40.841 1.00 55.33 ? 1418 HOH B O   1 
HETATM 6236 O O   . HOH G 6 .   ? -17.479 -108.672 -33.145 1.00 46.82 ? 1419 HOH B O   1 
HETATM 6237 O O   . HOH G 6 .   ? 32.210  -114.492 -9.690  1.00 50.79 ? 1420 HOH B O   1 
HETATM 6238 O O   . HOH G 6 .   ? -12.162 -126.474 -28.531 1.00 54.24 ? 1421 HOH B O   1 
HETATM 6239 O O   . HOH G 6 .   ? 1.535   -124.751 -55.527 1.00 48.10 ? 1422 HOH B O   1 
HETATM 6240 O O   . HOH G 6 .   ? 15.169  -122.908 -60.658 0.50 43.85 ? 1423 HOH B O   1 
HETATM 6241 O O   . HOH G 6 .   ? 25.853  -118.349 -0.714  1.00 52.37 ? 1424 HOH B O   1 
HETATM 6242 O O   . HOH G 6 .   ? 41.167  -117.280 -53.155 1.00 67.00 ? 1425 HOH B O   1 
HETATM 6243 O O   . HOH G 6 .   ? 41.450  -112.004 -48.321 1.00 56.58 ? 1426 HOH B O   1 
HETATM 6244 O O   . HOH G 6 .   ? 25.018  -111.555 -24.547 1.00 52.42 ? 1427 HOH B O   1 
HETATM 6245 O O   . HOH G 6 .   ? 33.174  -141.289 -20.072 1.00 56.54 ? 1428 HOH B O   1 
HETATM 6246 O O   . HOH G 6 .   ? 14.015  -107.264 -62.025 1.00 54.24 ? 1429 HOH B O   1 
HETATM 6247 O O   . HOH G 6 .   ? 12.107  -127.175 -17.094 1.00 45.55 ? 1430 HOH B O   1 
HETATM 6248 O O   . HOH G 6 .   ? -1.849  -102.882 -44.783 1.00 49.44 ? 1431 HOH B O   1 
HETATM 6249 O O   . HOH G 6 .   ? 30.790  -137.385 -44.097 1.00 68.53 ? 1432 HOH B O   1 
HETATM 6250 O O   . HOH G 6 .   ? 26.796  -112.730 -1.845  1.00 56.16 ? 1433 HOH B O   1 
HETATM 6251 O O   . HOH G 6 .   ? -4.736  -125.922 -45.486 1.00 49.99 ? 1434 HOH B O   1 
HETATM 6252 O O   . HOH G 6 .   ? 28.699  -153.224 -15.589 1.00 71.71 ? 1435 HOH B O   1 
HETATM 6253 O O   . HOH G 6 .   ? 26.040  -130.544 -38.650 1.00 64.42 ? 1436 HOH B O   1 
HETATM 6254 O O   . HOH G 6 .   ? -7.579  -107.836 -42.219 1.00 50.26 ? 1437 HOH B O   1 
HETATM 6255 O O   . HOH G 6 .   ? -4.870  -131.301 -35.391 1.00 54.48 ? 1438 HOH B O   1 
HETATM 6256 O O   . HOH G 6 .   ? 43.414  -115.978 -50.404 1.00 69.98 ? 1439 HOH B O   1 
HETATM 6257 O O   . HOH G 6 .   ? 24.773  -154.247 -7.142  1.00 57.54 ? 1440 HOH B O   1 
HETATM 6258 O O   . HOH G 6 .   ? 35.660  -106.920 -40.208 1.00 59.00 ? 1441 HOH B O   1 
HETATM 6259 O O   . HOH G 6 .   ? 16.511  -130.964 -23.269 1.00 72.62 ? 1442 HOH B O   1 
HETATM 6260 O O   . HOH G 6 .   ? 45.323  -131.685 -46.426 1.00 57.05 ? 1443 HOH B O   1 
HETATM 6261 O O   . HOH G 6 .   ? 27.416  -136.037 -49.093 1.00 54.85 ? 1444 HOH B O   1 
HETATM 6262 O O   . HOH G 6 .   ? 42.479  -131.985 -48.926 1.00 56.13 ? 1445 HOH B O   1 
HETATM 6263 O O   . HOH G 6 .   ? -10.960 -106.820 -14.498 1.00 61.94 ? 1446 HOH B O   1 
HETATM 6264 O O   . HOH G 6 .   ? 39.993  -117.505 -11.919 1.00 73.39 ? 1447 HOH B O   1 
HETATM 6265 O O   . HOH G 6 .   ? 29.847  -142.228 -20.698 1.00 69.13 ? 1448 HOH B O   1 
HETATM 6266 O O   . HOH G 6 .   ? 1.567   -100.690 -0.687  1.00 54.42 ? 1449 HOH B O   1 
HETATM 6267 O O   . HOH G 6 .   ? -1.826  -127.126 -53.503 1.00 52.92 ? 1450 HOH B O   1 
HETATM 6268 O O   . HOH G 6 .   ? -12.131 -110.591 -14.427 1.00 56.76 ? 1451 HOH B O   1 
HETATM 6269 O O   . HOH G 6 .   ? 28.416  -126.965 -60.740 1.00 63.24 ? 1452 HOH B O   1 
HETATM 6270 O O   . HOH G 6 .   ? 39.054  -129.501 -10.299 1.00 53.12 ? 1453 HOH B O   1 
HETATM 6271 O O   . HOH G 6 .   ? 42.245  -138.681 -27.607 1.00 46.79 ? 1454 HOH B O   1 
HETATM 6272 O O   . HOH G 6 .   ? 16.759  -143.379 -26.008 1.00 52.34 ? 1455 HOH B O   1 
HETATM 6273 O O   . HOH G 6 .   ? -16.596 -112.820 -30.630 1.00 53.81 ? 1456 HOH B O   1 
HETATM 6274 O O   . HOH G 6 .   ? 4.364   -125.789 -54.110 1.00 60.11 ? 1457 HOH B O   1 
HETATM 6275 O O   . HOH G 6 .   ? 13.876  -100.837 -13.377 1.00 58.30 ? 1458 HOH B O   1 
HETATM 6276 O O   . HOH G 6 .   ? -7.544  -121.577 -6.834  1.00 58.42 ? 1459 HOH B O   1 
HETATM 6277 O O   . HOH G 6 .   ? 16.327  -96.163  -2.310  1.00 58.30 ? 1460 HOH B O   1 
HETATM 6278 O O   . HOH G 6 .   ? 31.117  -141.424 -7.269  1.00 63.88 ? 1461 HOH B O   1 
HETATM 6279 O O   . HOH G 6 .   ? 26.407  -109.421 -23.828 1.00 55.63 ? 1462 HOH B O   1 
HETATM 6280 O O   . HOH G 6 .   ? 17.751  -121.037 1.492   1.00 49.24 ? 1463 HOH B O   1 
HETATM 6281 O O   . HOH G 6 .   ? -13.922 -110.951 -39.553 1.00 62.47 ? 1464 HOH B O   1 
HETATM 6282 O O   . HOH G 6 .   ? 18.636  -106.469 7.787   1.00 67.86 ? 1465 HOH B O   1 
HETATM 6283 O O   . HOH G 6 .   ? 13.857  -130.707 -26.876 1.00 65.62 ? 1466 HOH B O   1 
HETATM 6284 O O   . HOH G 6 .   ? 27.280  -156.295 -22.487 1.00 54.52 ? 1467 HOH B O   1 
HETATM 6285 O O   . HOH G 6 .   ? 33.620  -112.395 -16.941 1.00 58.44 ? 1468 HOH B O   1 
HETATM 6286 O O   . HOH G 6 .   ? 3.958   -121.238 5.486   1.00 39.96 ? 1469 HOH B O   1 
HETATM 6287 O O   . HOH G 6 .   ? 20.998  -139.432 -21.498 1.00 52.56 ? 1470 HOH B O   1 
HETATM 6288 O O   . HOH G 6 .   ? -0.038  -107.049 -23.421 1.00 35.89 ? 1471 HOH B O   1 
HETATM 6289 O O   . HOH G 6 .   ? 30.396  -141.255 -4.495  1.00 52.39 ? 1472 HOH B O   1 
HETATM 6290 O O   . HOH G 6 .   ? 26.751  -151.525 -22.569 1.00 48.77 ? 1473 HOH B O   1 
HETATM 6291 O O   . HOH G 6 .   ? 1.941   -102.341 -13.991 1.00 44.68 ? 1474 HOH B O   1 
HETATM 6292 O O   . HOH G 6 .   ? 42.989  -137.824 -29.545 1.00 48.84 ? 1475 HOH B O   1 
HETATM 6293 O O   . HOH G 6 .   ? 9.394   -110.851 6.758   1.00 59.08 ? 1476 HOH B O   1 
HETATM 6294 O O   . HOH G 6 .   ? 26.196  -150.766 -7.176  1.00 52.89 ? 1477 HOH B O   1 
HETATM 6295 O O   . HOH G 6 .   ? 29.025  -110.638 -16.148 1.00 44.25 ? 1478 HOH B O   1 
HETATM 6296 O O   . HOH G 6 .   ? 8.423   -127.997 -14.340 1.00 40.30 ? 1479 HOH B O   1 
HETATM 6297 O O   . HOH G 6 .   ? 23.745  -101.261 -14.987 1.00 44.00 ? 1480 HOH B O   1 
HETATM 6298 O O   . HOH G 6 .   ? 41.301  -139.569 -22.799 1.00 53.08 ? 1481 HOH B O   1 
HETATM 6299 O O   . HOH G 6 .   ? 11.199  -123.581 -59.442 1.00 62.13 ? 1482 HOH B O   1 
HETATM 6300 O O   . HOH G 6 .   ? 1.081   -130.178 -51.963 1.00 60.41 ? 1483 HOH B O   1 
HETATM 6301 O O   . HOH G 6 .   ? -12.217 -118.964 -24.984 1.00 50.83 ? 1484 HOH B O   1 
HETATM 6302 O O   . HOH G 6 .   ? 29.955  -119.881 -7.345  1.00 54.74 ? 1485 HOH B O   1 
HETATM 6303 O O   . HOH G 6 .   ? 51.028  -129.373 -43.982 1.00 72.93 ? 1486 HOH B O   1 
HETATM 6304 O O   . HOH G 6 .   ? -13.857 -119.902 -29.833 1.00 59.10 ? 1487 HOH B O   1 
HETATM 6305 O O   . HOH G 6 .   ? 35.553  -139.036 -18.049 1.00 54.68 ? 1488 HOH B O   1 
HETATM 6306 O O   . HOH G 6 .   ? 44.304  -131.927 -17.184 1.00 56.98 ? 1489 HOH B O   1 
HETATM 6307 O O   . HOH G 6 .   ? 15.950  -114.343 -34.057 1.00 58.44 ? 1490 HOH B O   1 
HETATM 6308 O O   . HOH G 6 .   ? 9.335   -122.871 -27.394 1.00 41.53 ? 1491 HOH B O   1 
HETATM 6309 O O   . HOH G 6 .   ? 21.622  -118.016 6.354   1.00 48.03 ? 1492 HOH B O   1 
HETATM 6310 O O   . HOH G 6 .   ? 32.869  -138.249 -10.127 1.00 45.26 ? 1493 HOH B O   1 
HETATM 6311 O O   . HOH G 6 .   ? 34.513  -113.572 -15.023 1.00 40.89 ? 1494 HOH B O   1 
HETATM 6312 O O   . HOH G 6 .   ? 9.817   -128.441 0.041   1.00 53.64 ? 1495 HOH B O   1 
HETATM 6313 O O   . HOH G 6 .   ? -14.262 -119.801 -19.784 1.00 48.94 ? 1496 HOH B O   1 
HETATM 6314 O O   . HOH G 6 .   ? 43.876  -139.463 -31.324 1.00 45.91 ? 1497 HOH B O   1 
HETATM 6315 O O   . HOH G 6 .   ? 28.161  -109.283 -37.863 1.00 50.65 ? 1498 HOH B O   1 
HETATM 6316 O O   . HOH G 6 .   ? -16.262 -111.088 -35.989 1.00 48.32 ? 1499 HOH B O   1 
HETATM 6317 O O   . HOH G 6 .   ? -1.414  -114.907 -54.060 1.00 46.36 ? 1500 HOH B O   1 
HETATM 6318 O O   . HOH G 6 .   ? 19.941  -107.409 -26.631 1.00 52.56 ? 1501 HOH B O   1 
HETATM 6319 O O   . HOH G 6 .   ? 27.562  -139.057 -25.249 1.00 56.03 ? 1502 HOH B O   1 
HETATM 6320 O O   . HOH G 6 .   ? 26.287  -138.790 -5.269  1.00 46.62 ? 1503 HOH B O   1 
HETATM 6321 O O   . HOH G 6 .   ? 24.075  -132.667 -22.716 1.00 45.97 ? 1504 HOH B O   1 
HETATM 6322 O O   . HOH G 6 .   ? -6.364  -129.772 -14.435 1.00 48.67 ? 1505 HOH B O   1 
HETATM 6323 O O   . HOH G 6 .   ? 5.100   -96.865  -25.856 1.00 54.63 ? 1506 HOH B O   1 
HETATM 6324 O O   . HOH G 6 .   ? -7.528  -98.884  -25.509 1.00 49.99 ? 1507 HOH B O   1 
HETATM 6325 O O   . HOH G 6 .   ? 1.221   -131.857 -16.469 1.00 45.69 ? 1508 HOH B O   1 
HETATM 6326 O O   . HOH G 6 .   ? -4.297  -125.403 -8.086  1.00 53.93 ? 1509 HOH B O   1 
HETATM 6327 O O   . HOH G 6 .   ? 25.091  -156.379 -3.559  1.00 57.73 ? 1510 HOH B O   1 
HETATM 6328 O O   . HOH G 6 .   ? 18.515  -118.165 -29.002 1.00 55.64 ? 1511 HOH B O   1 
HETATM 6329 O O   . HOH G 6 .   ? 31.927  -110.724 -24.617 1.00 54.14 ? 1512 HOH B O   1 
HETATM 6330 O O   . HOH G 6 .   ? 0.380   -132.770 -25.171 1.00 47.14 ? 1513 HOH B O   1 
HETATM 6331 O O   . HOH G 6 .   ? 8.800   -125.260 1.803   1.00 53.09 ? 1514 HOH B O   1 
HETATM 6332 O O   . HOH G 6 .   ? -16.321 -100.881 -30.936 1.00 55.10 ? 1515 HOH B O   1 
HETATM 6333 O O   . HOH G 6 .   ? -16.909 -103.000 -27.304 1.00 53.50 ? 1516 HOH B O   1 
HETATM 6334 O O   . HOH G 6 .   ? 37.240  -113.284 -56.156 1.00 61.94 ? 1517 HOH B O   1 
HETATM 6335 O O   . HOH G 6 .   ? -5.413  -116.658 -48.022 1.00 63.30 ? 1518 HOH B O   1 
HETATM 6336 O O   . HOH G 6 .   ? 14.809  -119.015 4.410   1.00 61.28 ? 1519 HOH B O   1 
HETATM 6337 O O   . HOH G 6 .   ? 8.685   -124.144 -58.726 1.00 73.05 ? 1520 HOH B O   1 
HETATM 6338 O O   . HOH G 6 .   ? 9.174   -140.013 -22.793 1.00 67.55 ? 1521 HOH B O   1 
HETATM 6339 O O   . HOH G 6 .   ? 3.856   -101.509 -13.093 1.00 52.19 ? 1522 HOH B O   1 
HETATM 6340 O O   . HOH G 6 .   ? 43.818  -120.695 -49.770 1.00 66.02 ? 1523 HOH B O   1 
HETATM 6341 O O   . HOH G 6 .   ? -6.733  -128.900 -22.367 1.00 53.61 ? 1524 HOH B O   1 
HETATM 6342 O O   . HOH G 6 .   ? 14.225  -101.139 -47.548 1.00 69.63 ? 1525 HOH B O   1 
HETATM 6343 O O   . HOH G 6 .   ? -7.594  -129.120 -38.592 1.00 52.72 ? 1526 HOH B O   1 
HETATM 6344 O O   . HOH G 6 .   ? -3.722  -97.289  -26.217 1.00 59.45 ? 1527 HOH B O   1 
HETATM 6345 O O   . HOH G 6 .   ? 12.547  -102.788 5.028   1.00 60.05 ? 1528 HOH B O   1 
HETATM 6346 O O   . HOH G 6 .   ? 18.594  -117.560 7.468   1.00 64.11 ? 1529 HOH B O   1 
HETATM 6347 O O   . HOH G 6 .   ? 28.163  -117.029 -0.240  1.00 51.92 ? 1530 HOH B O   1 
HETATM 6348 O O   . HOH G 6 .   ? 46.947  -131.173 -32.208 1.00 72.60 ? 1531 HOH B O   1 
HETATM 6349 O O   . HOH G 6 .   ? 17.811  -123.475 1.675   1.00 47.08 ? 1532 HOH B O   1 
HETATM 6350 O O   . HOH G 6 .   ? 19.129  -104.293 -16.687 1.00 51.48 ? 1533 HOH B O   1 
HETATM 6351 O O   . HOH G 6 .   ? -3.330  -131.697 -16.663 1.00 56.47 ? 1534 HOH B O   1 
HETATM 6352 O O   . HOH G 6 .   ? -4.676  -131.828 -23.894 1.00 51.63 ? 1535 HOH B O   1 
HETATM 6353 O O   . HOH G 6 .   ? 1.862   -133.782 -21.867 1.00 72.95 ? 1536 HOH B O   1 
HETATM 6354 O O   . HOH G 6 .   ? 28.607  -144.270 -20.229 1.00 58.72 ? 1537 HOH B O   1 
HETATM 6355 O O   . HOH G 6 .   ? 24.794  -156.619 -6.531  1.00 56.31 ? 1538 HOH B O   1 
HETATM 6356 O O   . HOH G 6 .   ? 42.876  -115.078 -20.100 1.00 60.53 ? 1539 HOH B O   1 
HETATM 6357 O O   . HOH G 6 .   ? 32.551  -134.036 -50.877 1.00 60.64 ? 1540 HOH B O   1 
HETATM 6358 O O   . HOH G 6 .   ? 22.704  -113.802 -22.087 1.00 57.55 ? 1541 HOH B O   1 
HETATM 6359 O O   . HOH G 6 .   ? 43.976  -121.422 -53.107 1.00 68.37 ? 1542 HOH B O   1 
HETATM 6360 O O   . HOH G 6 .   ? 33.729  -113.069 -11.687 1.00 66.71 ? 1543 HOH B O   1 
HETATM 6361 O O   . HOH G 6 .   ? 42.704  -111.705 -40.848 1.00 64.60 ? 1544 HOH B O   1 
HETATM 6362 O O   . HOH G 6 .   ? 22.598  -115.049 8.662   1.00 69.84 ? 1545 HOH B O   1 
HETATM 6363 O O   . HOH G 6 .   ? 4.767   -98.155  -31.494 1.00 50.48 ? 1546 HOH B O   1 
HETATM 6364 O O   . HOH G 6 .   ? 5.532   -93.557  -36.672 1.00 56.77 ? 1547 HOH B O   1 
HETATM 6365 O O   . HOH G 6 .   ? 10.954  -142.392 -26.196 1.00 55.64 ? 1548 HOH B O   1 
HETATM 6366 O O   . HOH G 6 .   ? 0.340   -94.243  -40.900 1.00 58.41 ? 1549 HOH B O   1 
HETATM 6367 O O   . HOH G 6 .   ? -1.210  -124.726 -8.365  1.00 51.56 ? 1550 HOH B O   1 
HETATM 6368 O O   . HOH G 6 .   ? 27.147  -134.876 -3.691  1.00 54.68 ? 1551 HOH B O   1 
HETATM 6369 O O   . HOH G 6 .   ? 27.411  -135.199 -51.645 1.00 57.57 ? 1552 HOH B O   1 
HETATM 6370 O O   . HOH G 6 .   ? -16.625 -112.419 -19.605 1.00 59.63 ? 1553 HOH B O   1 
HETATM 6371 O O   . HOH G 6 .   ? -12.008 -118.496 -11.388 1.00 58.92 ? 1554 HOH B O   1 
HETATM 6372 O O   . HOH G 6 .   ? -0.061  -95.109  -28.929 1.00 73.87 ? 1555 HOH B O   1 
HETATM 6373 O O   . HOH G 6 .   ? 30.544  -136.247 -48.702 1.00 53.44 ? 1556 HOH B O   1 
HETATM 6374 O O   . HOH G 6 .   ? 33.741  -108.278 -57.162 1.00 77.49 ? 1557 HOH B O   1 
HETATM 6375 O O   . HOH G 6 .   ? 29.494  -133.866 -52.570 1.00 52.88 ? 1558 HOH B O   1 
HETATM 6376 O O   . HOH G 6 .   ? 31.167  -122.680 -3.842  1.00 56.65 ? 1559 HOH B O   1 
HETATM 6377 O O   . HOH G 6 .   ? 5.981   -108.363 6.295   1.00 50.07 ? 1560 HOH B O   1 
HETATM 6378 O O   . HOH G 6 .   ? 37.627  -145.686 -20.818 1.00 48.19 ? 1561 HOH B O   1 
HETATM 6379 O O   . HOH G 6 .   ? 18.537  -120.677 -36.636 1.00 66.27 ? 1562 HOH B O   1 
HETATM 6380 O O   . HOH G 6 .   ? -2.932  -126.628 -12.059 1.00 47.50 ? 1563 HOH B O   1 
HETATM 6381 O O   . HOH G 6 .   ? 10.867  -122.882 -30.280 1.00 43.14 ? 1564 HOH B O   1 
HETATM 6382 O O   . HOH G 6 .   ? 25.002  -109.291 -2.598  1.00 44.48 ? 1565 HOH B O   1 
HETATM 6383 O O   . HOH G 6 .   ? 24.003  -102.277 -0.704  1.00 52.45 ? 1566 HOH B O   1 
HETATM 6384 O O   . HOH G 6 .   ? 3.577   -98.569  -21.869 1.00 70.45 ? 1567 HOH B O   1 
HETATM 6385 O O   . HOH H 6 .   ? 10.661  -107.134 -23.228 1.00 24.89 ? 53   HOH C O   1 
HETATM 6386 O O   . HOH H 6 .   ? 14.303  -108.829 -34.707 1.00 40.69 ? 108  HOH C O   1 
HETATM 6387 O O   . HOH H 6 .   ? 12.726  -96.108  -22.799 1.00 41.67 ? 245  HOH C O   1 
HETATM 6388 O O   . HOH H 6 .   ? 14.696  -110.454 -32.386 1.00 43.59 ? 312  HOH C O   1 
HETATM 6389 O O   . HOH H 6 .   ? 14.782  -105.667 -26.380 1.00 44.53 ? 343  HOH C O   1 
HETATM 6390 O O   . HOH H 6 .   ? 9.986   -97.905  -29.272 1.00 43.66 ? 355  HOH C O   1 
HETATM 6391 O O   . HOH H 6 .   ? 15.513  -95.811  -31.874 1.00 59.91 ? 386  HOH C O   1 
HETATM 6392 O O   . HOH H 6 .   ? 16.553  -101.173 -35.391 1.00 64.38 ? 411  HOH C O   1 
HETATM 6393 O O   . HOH H 6 .   ? 13.935  -103.294 -27.405 1.00 32.77 ? 424  HOH C O   1 
HETATM 6394 O O   . HOH H 6 .   ? 11.241  -97.257  -20.094 1.00 53.40 ? 477  HOH C O   1 
HETATM 6395 O O   . HOH H 6 .   ? 14.448  -96.138  -29.658 1.00 55.19 ? 510  HOH C O   1 
HETATM 6396 O O   . HOH H 6 .   ? 16.779  -103.925 -28.522 1.00 71.47 ? 562  HOH C O   1 
HETATM 6397 O O   . HOH H 6 .   ? 9.875   -98.690  -26.845 1.00 46.43 ? 650  HOH C O   1 
HETATM 6398 O O   . HOH H 6 .   ? 20.196  -104.166 -35.452 1.00 43.46 ? 660  HOH C O   1 
HETATM 6399 O O   . HOH H 6 .   ? 17.370  -94.040  -31.987 1.00 55.17 ? 695  HOH C O   1 
HETATM 6400 O O   . HOH H 6 .   ? 17.898  -108.959 -34.170 1.00 59.59 ? 727  HOH C O   1 
HETATM 6401 O O   . HOH H 6 .   ? 18.062  -101.603 -27.995 1.00 72.53 ? 750  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  GLN 27  27  27  GLN GLN A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  GLU 34  34  ?   ?   ?   A . n 
A 1 35  ASP 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  CYS 37  37  ?   ?   ?   A . n 
A 1 38  VAL 38  38  ?   ?   ?   A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  HIS 62  62  62  HIS HIS A . n 
A 1 63  VAL 63  63  ?   ?   ?   A . n 
A 1 64  GLU 64  64  ?   ?   ?   A . n 
A 1 65  ALA 65  65  ?   ?   ?   A . n 
A 1 66  ALA 66  66  ?   ?   ?   A . n 
A 1 67  ALA 67  67  ?   ?   ?   A . n 
A 1 68  SER 68  68  ?   ?   ?   A . n 
A 1 69  LYS 69  69  ?   ?   ?   A . n 
A 1 70  ALA 70  70  ?   ?   ?   A . n 
A 1 71  GLU 71  71  ?   ?   ?   A . n 
A 1 72  ALA 72  72  ?   ?   ?   A . n 
A 1 73  VAL 73  73  ?   ?   ?   A . n 
A 1 74  GLU 74  74  ?   ?   ?   A . n 
A 1 75  GLY 75  75  ?   ?   ?   A . n 
A 1 76  ALA 76  76  ?   ?   ?   A . n 
A 1 77  ALA 77  77  ?   ?   ?   A . n 
A 1 78  THR 78  78  ?   ?   ?   A . n 
A 1 79  SER 79  79  ?   ?   ?   A . n 
A 1 80  ASP 80  80  ?   ?   ?   A . n 
A 1 81  ASP 81  81  ?   ?   ?   A . n 
A 1 82  ASP 82  82  ?   ?   ?   A . n 
A 1 83  LEU 83  83  ?   ?   ?   A . n 
A 1 84  LYS 84  84  ?   ?   ?   A . n 
A 1 85  ALA 85  85  ?   ?   ?   A . n 
A 1 86  TRP 86  86  ?   ?   ?   A . n 
A 1 87  ASP 87  87  ?   ?   ?   A . n 
A 1 88  ALA 88  88  ?   ?   ?   A . n 
A 1 89  ASP 89  89  ?   ?   ?   A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 TYR 107 107 107 TYR TYR A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 GLN 119 119 119 GLN GLN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 MET 124 124 124 MET MET A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 GLU 146 146 146 GLU GLU A . n 
A 1 147 GLU 147 147 147 GLU GLU A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ARG 153 153 153 ARG ARG A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ASN 155 155 155 ASN ASN A . n 
A 1 156 GLN 156 156 156 GLN GLN A . n 
A 1 157 TRP 157 157 157 TRP TRP A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   GLN 2   2   ?   ?   ?   B . n 
B 2 3   LYS 3   3   ?   ?   ?   B . n 
B 2 4   ARG 4   4   ?   ?   ?   B . n 
B 2 5   ILE 5   5   ?   ?   ?   B . n 
B 2 6   ALA 6   6   ?   ?   ?   B . n 
B 2 7   LEU 7   7   ?   ?   ?   B . n 
B 2 8   SER 8   8   ?   ?   ?   B . n 
B 2 9   PHE 9   9   9   PHE PHE B . n 
B 2 10  PRO 10  10  10  PRO PRO B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  GLU 12  12  12  GLU GLU B . n 
B 2 13  VAL 13  13  13  VAL VAL B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  GLU 15  15  15  GLU GLU B . n 
B 2 16  HIS 16  16  16  HIS HIS B . n 
B 2 17  VAL 17  17  17  VAL VAL B . n 
B 2 18  PHE 18  18  18  PHE PHE B . n 
B 2 19  SER 19  19  19  SER SER B . n 
B 2 20  PHE 20  20  20  PHE PHE B . n 
B 2 21  ILE 21  21  21  ILE ILE B . n 
B 2 22  GLN 22  22  22  GLN GLN B . n 
B 2 23  LEU 23  23  23  LEU LEU B . n 
B 2 24  ASP 24  24  24  ASP ASP B . n 
B 2 25  LYS 25  25  25  LYS LYS B . n 
B 2 26  ASP 26  26  26  ASP ASP B . n 
B 2 27  ARG 27  27  27  ARG ARG B . n 
B 2 28  ASN 28  28  28  ASN ASN B . n 
B 2 29  SER 29  29  29  SER SER B . n 
B 2 30  VAL 30  30  30  VAL VAL B . n 
B 2 31  SER 31  31  31  SER SER B . n 
B 2 32  LEU 32  32  32  LEU LEU B . n 
B 2 33  VAL 33  33  33  VAL VAL B . n 
B 2 34  CYS 34  34  34  CYS CYS B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  SER 36  36  36  SER SER B . n 
B 2 37  TRP 37  37  37  TRP TRP B . n 
B 2 38  TYR 38  38  38  TYR TYR B . n 
B 2 39  GLU 39  39  39  GLU GLU B . n 
B 2 40  ILE 40  40  40  ILE ILE B . n 
B 2 41  GLU 41  41  41  GLU GLU B . n 
B 2 42  ARG 42  42  42  ARG ARG B . n 
B 2 43  TRP 43  43  43  TRP TRP B . n 
B 2 44  CYS 44  44  44  CYS CYS B . n 
B 2 45  ARG 45  45  45  ARG ARG B . n 
B 2 46  ARG 46  46  46  ARG ARG B . n 
B 2 47  LYS 47  47  47  LYS LYS B . n 
B 2 48  VAL 48  48  48  VAL VAL B . n 
B 2 49  PHE 49  49  49  PHE PHE B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  ASN 52  52  52  ASN ASN B . n 
B 2 53  CYS 53  53  53  CYS CYS B . n 
B 2 54  TYR 54  54  54  TYR TYR B . n 
B 2 55  ALA 55  55  55  ALA ALA B . n 
B 2 56  VAL 56  56  56  VAL VAL B . n 
B 2 57  SER 57  57  57  SER SER B . n 
B 2 58  PRO 58  58  58  PRO PRO B . n 
B 2 59  ALA 59  59  59  ALA ALA B . n 
B 2 60  THR 60  60  60  THR THR B . n 
B 2 61  VAL 61  61  61  VAL VAL B . n 
B 2 62  ILE 62  62  62  ILE ILE B . n 
B 2 63  ARG 63  63  63  ARG ARG B . n 
B 2 64  ARG 64  64  64  ARG ARG B . n 
B 2 65  PHE 65  65  65  PHE PHE B . n 
B 2 66  PRO 66  66  66  PRO PRO B . n 
B 2 67  LYS 67  67  67  LYS LYS B . n 
B 2 68  VAL 68  68  68  VAL VAL B . n 
B 2 69  ARG 69  69  69  ARG ARG B . n 
B 2 70  SER 70  70  70  SER SER B . n 
B 2 71  VAL 71  71  71  VAL VAL B . n 
B 2 72  GLU 72  72  72  GLU GLU B . n 
B 2 73  LEU 73  73  73  LEU LEU B . n 
B 2 74  LYS 74  74  74  LYS LYS B . n 
B 2 75  GLY 75  75  75  GLY GLY B . n 
B 2 76  LYS 76  76  76  LYS LYS B . n 
B 2 77  PRO 77  77  77  PRO PRO B . n 
B 2 78  HIS 78  78  78  HIS HIS B . n 
B 2 79  PHE 79  79  79  PHE PHE B . n 
B 2 80  ALA 80  80  80  ALA ALA B . n 
B 2 81  ASP 81  81  81  ASP ASP B . n 
B 2 82  PHE 82  82  82  PHE PHE B . n 
B 2 83  ASN 83  83  83  ASN ASN B . n 
B 2 84  LEU 84  84  84  LEU LEU B . n 
B 2 85  VAL 85  85  85  VAL VAL B . n 
B 2 86  PRO 86  86  86  PRO PRO B . n 
B 2 87  ASP 87  87  87  ASP ASP B . n 
B 2 88  GLY 88  88  88  GLY GLY B . n 
B 2 89  TRP 89  89  89  TRP TRP B . n 
B 2 90  GLY 90  90  90  GLY GLY B . n 
B 2 91  GLY 91  91  91  GLY GLY B . n 
B 2 92  TYR 92  92  92  TYR TYR B . n 
B 2 93  VAL 93  93  93  VAL VAL B . n 
B 2 94  TYR 94  94  94  TYR TYR B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  TRP 96  96  96  TRP TRP B . n 
B 2 97  ILE 97  97  97  ILE ILE B . n 
B 2 98  GLU 98  98  98  GLU GLU B . n 
B 2 99  ALA 99  99  99  ALA ALA B . n 
B 2 100 MET 100 100 100 MET MET B . n 
B 2 101 SER 101 101 101 SER SER B . n 
B 2 102 SER 102 102 102 SER SER B . n 
B 2 103 SER 103 103 103 SER SER B . n 
B 2 104 TYR 104 104 104 TYR TYR B . n 
B 2 105 THR 105 105 105 THR THR B . n 
B 2 106 TRP 106 106 106 TRP TRP B . n 
B 2 107 LEU 107 107 107 LEU LEU B . n 
B 2 108 GLU 108 108 108 GLU GLU B . n 
B 2 109 GLU 109 109 109 GLU GLU B . n 
B 2 110 ILE 110 110 110 ILE ILE B . n 
B 2 111 ARG 111 111 111 ARG ARG B . n 
B 2 112 LEU 112 112 112 LEU LEU B . n 
B 2 113 LYS 113 113 113 LYS LYS B . n 
B 2 114 ARG 114 114 114 ARG ARG B . n 
B 2 115 MET 115 115 115 MET MET B . n 
B 2 116 VAL 116 116 116 VAL VAL B . n 
B 2 117 VAL 117 117 117 VAL VAL B . n 
B 2 118 THR 118 118 118 THR THR B . n 
B 2 119 ASP 119 119 119 ASP ASP B . n 
B 2 120 ASP 120 120 120 ASP ASP B . n 
B 2 121 CYS 121 121 121 CYS CYS B . n 
B 2 122 LEU 122 122 122 LEU LEU B . n 
B 2 123 GLU 123 123 123 GLU GLU B . n 
B 2 124 LEU 124 124 124 LEU LEU B . n 
B 2 125 ILE 125 125 125 ILE ILE B . n 
B 2 126 ALA 126 126 126 ALA ALA B . n 
B 2 127 LYS 127 127 127 LYS LYS B . n 
B 2 128 SER 128 128 128 SER SER B . n 
B 2 129 PHE 129 129 129 PHE PHE B . n 
B 2 130 LYS 130 130 130 LYS LYS B . n 
B 2 131 ASN 131 131 131 ASN ASN B . n 
B 2 132 PHE 132 132 132 PHE PHE B . n 
B 2 133 LYS 133 133 133 LYS LYS B . n 
B 2 134 VAL 134 134 134 VAL VAL B . n 
B 2 135 LEU 135 135 135 LEU LEU B . n 
B 2 136 VAL 136 136 136 VAL VAL B . n 
B 2 137 LEU 137 137 137 LEU LEU B . n 
B 2 138 SER 138 138 138 SER SER B . n 
B 2 139 SER 139 139 139 SER SER B . n 
B 2 140 CYS 140 140 140 CYS CYS B . n 
B 2 141 GLU 141 141 141 GLU GLU B . n 
B 2 142 GLY 142 142 142 GLY GLY B . n 
B 2 143 PHE 143 143 143 PHE PHE B . n 
B 2 144 SER 144 144 144 SER SER B . n 
B 2 145 THR 145 145 145 THR THR B . n 
B 2 146 ASP 146 146 146 ASP ASP B . n 
B 2 147 GLY 147 147 147 GLY GLY B . n 
B 2 148 LEU 148 148 148 LEU LEU B . n 
B 2 149 ALA 149 149 149 ALA ALA B . n 
B 2 150 ALA 150 150 150 ALA ALA B . n 
B 2 151 ILE 151 151 151 ILE ILE B . n 
B 2 152 ALA 152 152 152 ALA ALA B . n 
B 2 153 ALA 153 153 153 ALA ALA B . n 
B 2 154 THR 154 154 154 THR THR B . n 
B 2 155 CYS 155 155 155 CYS CYS B . n 
B 2 156 ARG 156 156 156 ARG ARG B . n 
B 2 157 ASN 157 157 157 ASN ASN B . n 
B 2 158 LEU 158 158 158 LEU LEU B . n 
B 2 159 LYS 159 159 159 LYS LYS B . n 
B 2 160 GLU 160 160 160 GLU GLU B . n 
B 2 161 LEU 161 161 161 LEU LEU B . n 
B 2 162 ASP 162 162 162 ASP ASP B . n 
B 2 163 LEU 163 163 163 LEU LEU B . n 
B 2 164 ARG 164 164 164 ARG ARG B . n 
B 2 165 GLU 165 165 165 GLU GLU B . n 
B 2 166 SER 166 166 166 SER SER B . n 
B 2 167 ASP 167 167 167 ASP ASP B . n 
B 2 168 VAL 168 168 168 VAL VAL B . n 
B 2 169 ASP 169 169 169 ASP ASP B . n 
B 2 170 ASP 170 170 170 ASP ASP B . n 
B 2 171 VAL 171 171 171 VAL VAL B . n 
B 2 172 SER 172 172 172 SER SER B . n 
B 2 173 GLY 173 173 173 GLY GLY B . n 
B 2 174 HIS 174 174 174 HIS HIS B . n 
B 2 175 TRP 175 175 175 TRP TRP B . n 
B 2 176 LEU 176 176 176 LEU LEU B . n 
B 2 177 SER 177 177 177 SER SER B . n 
B 2 178 HIS 178 178 178 HIS HIS B . n 
B 2 179 PHE 179 179 179 PHE PHE B . n 
B 2 180 PRO 180 180 180 PRO PRO B . n 
B 2 181 ASP 181 181 181 ASP ASP B . n 
B 2 182 THR 182 182 182 THR THR B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 THR 184 184 184 THR THR B . n 
B 2 185 SER 185 185 185 SER SER B . n 
B 2 186 LEU 186 186 186 LEU LEU B . n 
B 2 187 VAL 187 187 187 VAL VAL B . n 
B 2 188 SER 188 188 188 SER SER B . n 
B 2 189 LEU 189 189 189 LEU LEU B . n 
B 2 190 ASN 190 190 190 ASN ASN B . n 
B 2 191 ILE 191 191 191 ILE ILE B . n 
B 2 192 SER 192 192 192 SER SER B . n 
B 2 193 CYS 193 193 193 CYS CYS B . n 
B 2 194 LEU 194 194 194 LEU LEU B . n 
B 2 195 ALA 195 195 195 ALA ALA B . n 
B 2 196 SER 196 196 196 SER SER B . n 
B 2 197 GLU 197 197 197 GLU GLU B . n 
B 2 198 VAL 198 198 198 VAL VAL B . n 
B 2 199 SER 199 199 199 SER SER B . n 
B 2 200 PHE 200 200 200 PHE PHE B . n 
B 2 201 SER 201 201 201 SER SER B . n 
B 2 202 ALA 202 202 202 ALA ALA B . n 
B 2 203 LEU 203 203 203 LEU LEU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 ARG 205 205 205 ARG ARG B . n 
B 2 206 LEU 206 206 206 LEU LEU B . n 
B 2 207 VAL 207 207 207 VAL VAL B . n 
B 2 208 THR 208 208 208 THR THR B . n 
B 2 209 ARG 209 209 209 ARG ARG B . n 
B 2 210 CYS 210 210 210 CYS CYS B . n 
B 2 211 PRO 211 211 211 PRO PRO B . n 
B 2 212 ASN 212 212 212 ASN ASN B . n 
B 2 213 LEU 213 213 213 LEU LEU B . n 
B 2 214 LYS 214 214 214 LYS LYS B . n 
B 2 215 SER 215 215 215 SER SER B . n 
B 2 216 LEU 216 216 216 LEU LEU B . n 
B 2 217 LYS 217 217 217 LYS LYS B . n 
B 2 218 LEU 218 218 218 LEU LEU B . n 
B 2 219 ASN 219 219 219 ASN ASN B . n 
B 2 220 ARG 220 220 220 ARG ARG B . n 
B 2 221 ALA 221 221 221 ALA ALA B . n 
B 2 222 VAL 222 222 222 VAL VAL B . n 
B 2 223 PRO 223 223 223 PRO PRO B . n 
B 2 224 LEU 224 224 224 LEU LEU B . n 
B 2 225 GLU 225 225 225 GLU GLU B . n 
B 2 226 LYS 226 226 226 LYS LYS B . n 
B 2 227 LEU 227 227 227 LEU LEU B . n 
B 2 228 ALA 228 228 228 ALA ALA B . n 
B 2 229 THR 229 229 229 THR THR B . n 
B 2 230 LEU 230 230 230 LEU LEU B . n 
B 2 231 LEU 231 231 231 LEU LEU B . n 
B 2 232 GLN 232 232 232 GLN GLN B . n 
B 2 233 ARG 233 233 233 ARG ARG B . n 
B 2 234 ALA 234 234 234 ALA ALA B . n 
B 2 235 PRO 235 235 235 PRO PRO B . n 
B 2 236 GLN 236 236 236 GLN GLN B . n 
B 2 237 LEU 237 237 237 LEU LEU B . n 
B 2 238 GLU 238 238 238 GLU GLU B . n 
B 2 239 GLU 239 239 239 GLU GLU B . n 
B 2 240 LEU 240 240 240 LEU LEU B . n 
B 2 241 GLY 241 241 241 GLY GLY B . n 
B 2 242 THR 242 242 242 THR THR B . n 
B 2 243 GLY 243 243 243 GLY GLY B . n 
B 2 244 GLY 244 244 244 GLY GLY B . n 
B 2 245 TYR 245 245 245 TYR TYR B . n 
B 2 246 THR 246 246 246 THR THR B . n 
B 2 247 ALA 247 247 247 ALA ALA B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 VAL 249 249 249 VAL VAL B . n 
B 2 250 ARG 250 250 250 ARG ARG B . n 
B 2 251 PRO 251 251 251 PRO PRO B . n 
B 2 252 ASP 252 252 252 ASP ASP B . n 
B 2 253 VAL 253 253 253 VAL VAL B . n 
B 2 254 TYR 254 254 254 TYR TYR B . n 
B 2 255 SER 255 255 255 SER SER B . n 
B 2 256 GLY 256 256 256 GLY GLY B . n 
B 2 257 LEU 257 257 257 LEU LEU B . n 
B 2 258 SER 258 258 258 SER SER B . n 
B 2 259 VAL 259 259 259 VAL VAL B . n 
B 2 260 ALA 260 260 260 ALA ALA B . n 
B 2 261 LEU 261 261 261 LEU LEU B . n 
B 2 262 SER 262 262 262 SER SER B . n 
B 2 263 GLY 263 263 263 GLY GLY B . n 
B 2 264 CYS 264 264 264 CYS CYS B . n 
B 2 265 LYS 265 265 265 LYS LYS B . n 
B 2 266 GLU 266 266 266 GLU GLU B . n 
B 2 267 LEU 267 267 267 LEU LEU B . n 
B 2 268 ARG 268 268 268 ARG ARG B . n 
B 2 269 CYS 269 269 269 CYS CYS B . n 
B 2 270 LEU 270 270 270 LEU LEU B . n 
B 2 271 SER 271 271 271 SER SER B . n 
B 2 272 GLY 272 272 272 GLY GLY B . n 
B 2 273 PHE 273 273 273 PHE PHE B . n 
B 2 274 TRP 274 274 274 TRP TRP B . n 
B 2 275 ASP 275 275 275 ASP ASP B . n 
B 2 276 ALA 276 276 276 ALA ALA B . n 
B 2 277 VAL 277 277 277 VAL VAL B . n 
B 2 278 PRO 278 278 278 PRO PRO B . n 
B 2 279 ALA 279 279 279 ALA ALA B . n 
B 2 280 TYR 280 280 280 TYR TYR B . n 
B 2 281 LEU 281 281 281 LEU LEU B . n 
B 2 282 PRO 282 282 282 PRO PRO B . n 
B 2 283 ALA 283 283 283 ALA ALA B . n 
B 2 284 VAL 284 284 284 VAL VAL B . n 
B 2 285 TYR 285 285 285 TYR TYR B . n 
B 2 286 SER 286 286 286 SER SER B . n 
B 2 287 VAL 287 287 287 VAL VAL B . n 
B 2 288 CYS 288 288 288 CYS CYS B . n 
B 2 289 SER 289 289 289 SER SER B . n 
B 2 290 ARG 290 290 290 ARG ARG B . n 
B 2 291 LEU 291 291 291 LEU LEU B . n 
B 2 292 THR 292 292 292 THR THR B . n 
B 2 293 THR 293 293 293 THR THR B . n 
B 2 294 LEU 294 294 294 LEU LEU B . n 
B 2 295 ASN 295 295 295 ASN ASN B . n 
B 2 296 LEU 296 296 296 LEU LEU B . n 
B 2 297 SER 297 297 297 SER SER B . n 
B 2 298 TYR 298 298 298 TYR TYR B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 THR 300 300 300 THR THR B . n 
B 2 301 VAL 301 301 301 VAL VAL B . n 
B 2 302 GLN 302 302 302 GLN GLN B . n 
B 2 303 SER 303 303 303 SER SER B . n 
B 2 304 TYR 304 304 304 TYR TYR B . n 
B 2 305 ASP 305 305 305 ASP ASP B . n 
B 2 306 LEU 306 306 306 LEU LEU B . n 
B 2 307 VAL 307 307 307 VAL VAL B . n 
B 2 308 LYS 308 308 308 LYS LYS B . n 
B 2 309 LEU 309 309 309 LEU LEU B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 CYS 311 311 311 CYS CYS B . n 
B 2 312 GLN 312 312 312 GLN GLN B . n 
B 2 313 CYS 313 313 313 CYS CYS B . n 
B 2 314 PRO 314 314 314 PRO PRO B . n 
B 2 315 LYS 315 315 315 LYS LYS B . n 
B 2 316 LEU 316 316 316 LEU LEU B . n 
B 2 317 GLN 317 317 317 GLN GLN B . n 
B 2 318 ARG 318 318 318 ARG ARG B . n 
B 2 319 LEU 319 319 319 LEU LEU B . n 
B 2 320 TRP 320 320 320 TRP TRP B . n 
B 2 321 VAL 321 321 321 VAL VAL B . n 
B 2 322 LEU 322 322 322 LEU LEU B . n 
B 2 323 ASP 323 323 323 ASP ASP B . n 
B 2 324 TYR 324 324 324 TYR TYR B . n 
B 2 325 ILE 325 325 325 ILE ILE B . n 
B 2 326 GLU 326 326 326 GLU GLU B . n 
B 2 327 ASP 327 327 327 ASP ASP B . n 
B 2 328 ALA 328 328 328 ALA ALA B . n 
B 2 329 GLY 329 329 329 GLY GLY B . n 
B 2 330 LEU 330 330 330 LEU LEU B . n 
B 2 331 GLU 331 331 331 GLU GLU B . n 
B 2 332 VAL 332 332 332 VAL VAL B . n 
B 2 333 LEU 333 333 333 LEU LEU B . n 
B 2 334 ALA 334 334 334 ALA ALA B . n 
B 2 335 SER 335 335 335 SER SER B . n 
B 2 336 THR 336 336 336 THR THR B . n 
B 2 337 CYS 337 337 337 CYS CYS B . n 
B 2 338 LYS 338 338 338 LYS LYS B . n 
B 2 339 ASP 339 339 339 ASP ASP B . n 
B 2 340 LEU 340 340 340 LEU LEU B . n 
B 2 341 ARG 341 341 341 ARG ARG B . n 
B 2 342 GLU 342 342 342 GLU GLU B . n 
B 2 343 LEU 343 343 343 LEU LEU B . n 
B 2 344 ARG 344 344 344 ARG ARG B . n 
B 2 345 VAL 345 345 345 VAL VAL B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 PRO 347 347 347 PRO PRO B . n 
B 2 348 SER 348 348 348 SER SER B . n 
B 2 349 GLU 349 349 349 GLU GLU B . n 
B 2 350 PRO 350 350 350 PRO PRO B . n 
B 2 351 PHE 351 351 351 PHE PHE B . n 
B 2 352 VAL 352 352 352 VAL VAL B . n 
B 2 353 MET 353 353 353 MET MET B . n 
B 2 354 GLU 354 354 354 GLU GLU B . n 
B 2 355 PRO 355 355 355 PRO PRO B . n 
B 2 356 ASN 356 356 356 ASN ASN B . n 
B 2 357 VAL 357 357 357 VAL VAL B . n 
B 2 358 ALA 358 358 358 ALA ALA B . n 
B 2 359 LEU 359 359 359 LEU LEU B . n 
B 2 360 THR 360 360 360 THR THR B . n 
B 2 361 GLU 361 361 361 GLU GLU B . n 
B 2 362 GLN 362 362 362 GLN GLN B . n 
B 2 363 GLY 363 363 363 GLY GLY B . n 
B 2 364 LEU 364 364 364 LEU LEU B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 SER 366 366 366 SER SER B . n 
B 2 367 VAL 367 367 367 VAL VAL B . n 
B 2 368 SER 368 368 368 SER SER B . n 
B 2 369 MET 369 369 369 MET MET B . n 
B 2 370 GLY 370 370 370 GLY GLY B . n 
B 2 371 CYS 371 371 371 CYS CYS B . n 
B 2 372 PRO 372 372 372 PRO PRO B . n 
B 2 373 LYS 373 373 373 LYS LYS B . n 
B 2 374 LEU 374 374 374 LEU LEU B . n 
B 2 375 GLU 375 375 375 GLU GLU B . n 
B 2 376 SER 376 376 376 SER SER B . n 
B 2 377 VAL 377 377 377 VAL VAL B . n 
B 2 378 LEU 378 378 378 LEU LEU B . n 
B 2 379 TYR 379 379 379 TYR TYR B . n 
B 2 380 PHE 380 380 380 PHE PHE B . n 
B 2 381 CYS 381 381 381 CYS CYS B . n 
B 2 382 ARG 382 382 382 ARG ARG B . n 
B 2 383 GLN 383 383 383 GLN GLN B . n 
B 2 384 MET 384 384 384 MET MET B . n 
B 2 385 THR 385 385 385 THR THR B . n 
B 2 386 ASN 386 386 386 ASN ASN B . n 
B 2 387 ALA 387 387 387 ALA ALA B . n 
B 2 388 ALA 388 388 388 ALA ALA B . n 
B 2 389 LEU 389 389 389 LEU LEU B . n 
B 2 390 ILE 390 390 390 ILE ILE B . n 
B 2 391 THR 391 391 391 THR THR B . n 
B 2 392 ILE 392 392 392 ILE ILE B . n 
B 2 393 ALA 393 393 393 ALA ALA B . n 
B 2 394 ARG 394 394 394 ARG ARG B . n 
B 2 395 ASN 395 395 395 ASN ASN B . n 
B 2 396 ARG 396 396 396 ARG ARG B . n 
B 2 397 PRO 397 397 397 PRO PRO B . n 
B 2 398 ASN 398 398 398 ASN ASN B . n 
B 2 399 MET 399 399 399 MET MET B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 ARG 401 401 401 ARG ARG B . n 
B 2 402 PHE 402 402 402 PHE PHE B . n 
B 2 403 ARG 403 403 403 ARG ARG B . n 
B 2 404 LEU 404 404 404 LEU LEU B . n 
B 2 405 CYS 405 405 405 CYS CYS B . n 
B 2 406 ILE 406 406 406 ILE ILE B . n 
B 2 407 ILE 407 407 407 ILE ILE B . n 
B 2 408 GLU 408 408 408 GLU GLU B . n 
B 2 409 PRO 409 409 409 PRO PRO B . n 
B 2 410 LYS 410 410 410 LYS LYS B . n 
B 2 411 ALA 411 411 411 ALA ALA B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 ASP 413 413 413 ASP ASP B . n 
B 2 414 TYR 414 414 414 TYR TYR B . n 
B 2 415 LEU 415 415 415 LEU LEU B . n 
B 2 416 THR 416 416 416 THR THR B . n 
B 2 417 LEU 417 417 417 LEU LEU B . n 
B 2 418 GLU 418 418 418 GLU GLU B . n 
B 2 419 PRO 419 419 419 PRO PRO B . n 
B 2 420 LEU 420 420 420 LEU LEU B . n 
B 2 421 ASP 421 421 421 ASP ASP B . n 
B 2 422 ILE 422 422 422 ILE ILE B . n 
B 2 423 GLY 423 423 423 GLY GLY B . n 
B 2 424 PHE 424 424 424 PHE PHE B . n 
B 2 425 GLY 425 425 425 GLY GLY B . n 
B 2 426 ALA 426 426 426 ALA ALA B . n 
B 2 427 ILE 427 427 427 ILE ILE B . n 
B 2 428 VAL 428 428 428 VAL VAL B . n 
B 2 429 GLU 429 429 429 GLU GLU B . n 
B 2 430 HIS 430 430 430 HIS HIS B . n 
B 2 431 CYS 431 431 431 CYS CYS B . n 
B 2 432 LYS 432 432 432 LYS LYS B . n 
B 2 433 ASP 433 433 433 ASP ASP B . n 
B 2 434 LEU 434 434 434 LEU LEU B . n 
B 2 435 ARG 435 435 435 ARG ARG B . n 
B 2 436 ARG 436 436 436 ARG ARG B . n 
B 2 437 LEU 437 437 437 LEU LEU B . n 
B 2 438 SER 438 438 438 SER SER B . n 
B 2 439 LEU 439 439 439 LEU LEU B . n 
B 2 440 SER 440 440 440 SER SER B . n 
B 2 441 GLY 441 441 441 GLY GLY B . n 
B 2 442 LEU 442 442 442 LEU LEU B . n 
B 2 443 LEU 443 443 443 LEU LEU B . n 
B 2 444 THR 444 444 444 THR THR B . n 
B 2 445 ASP 445 445 445 ASP ASP B . n 
B 2 446 LYS 446 446 446 LYS LYS B . n 
B 2 447 VAL 447 447 447 VAL VAL B . n 
B 2 448 PHE 448 448 448 PHE PHE B . n 
B 2 449 GLU 449 449 449 GLU GLU B . n 
B 2 450 TYR 450 450 450 TYR TYR B . n 
B 2 451 ILE 451 451 451 ILE ILE B . n 
B 2 452 GLY 452 452 452 GLY GLY B . n 
B 2 453 THR 453 453 453 THR THR B . n 
B 2 454 TYR 454 454 454 TYR TYR B . n 
B 2 455 ALA 455 455 455 ALA ALA B . n 
B 2 456 LYS 456 456 456 LYS LYS B . n 
B 2 457 LYS 457 457 457 LYS LYS B . n 
B 2 458 MET 458 458 458 MET MET B . n 
B 2 459 GLU 459 459 459 GLU GLU B . n 
B 2 460 MET 460 460 460 MET MET B . n 
B 2 461 LEU 461 461 461 LEU LEU B . n 
B 2 462 SER 462 462 462 SER SER B . n 
B 2 463 VAL 463 463 463 VAL VAL B . n 
B 2 464 ALA 464 464 464 ALA ALA B . n 
B 2 465 PHE 465 465 465 PHE PHE B . n 
B 2 466 ALA 466 466 466 ALA ALA B . n 
B 2 467 GLY 467 467 467 GLY GLY B . n 
B 2 468 ASP 468 468 468 ASP ASP B . n 
B 2 469 SER 469 469 469 SER SER B . n 
B 2 470 ASP 470 470 470 ASP ASP B . n 
B 2 471 LEU 471 471 471 LEU LEU B . n 
B 2 472 GLY 472 472 472 GLY GLY B . n 
B 2 473 MET 473 473 473 MET MET B . n 
B 2 474 HIS 474 474 474 HIS HIS B . n 
B 2 475 HIS 475 475 475 HIS HIS B . n 
B 2 476 VAL 476 476 476 VAL VAL B . n 
B 2 477 LEU 477 477 477 LEU LEU B . n 
B 2 478 SER 478 478 478 SER SER B . n 
B 2 479 GLY 479 479 479 GLY GLY B . n 
B 2 480 CYS 480 480 480 CYS CYS B . n 
B 2 481 ASP 481 481 481 ASP ASP B . n 
B 2 482 SER 482 482 482 SER SER B . n 
B 2 483 LEU 483 483 483 LEU LEU B . n 
B 2 484 ARG 484 484 484 ARG ARG B . n 
B 2 485 LYS 485 485 485 LYS LYS B . n 
B 2 486 LEU 486 486 486 LEU LEU B . n 
B 2 487 GLU 487 487 487 GLU GLU B . n 
B 2 488 ILE 488 488 488 ILE ILE B . n 
B 2 489 ARG 489 489 489 ARG ARG B . n 
B 2 490 ASP 490 490 490 ASP ASP B . n 
B 2 491 CYS 491 491 491 CYS CYS B . n 
B 2 492 PRO 492 492 492 PRO PRO B . n 
B 2 493 PHE 493 493 493 PHE PHE B . n 
B 2 494 GLY 494 494 494 GLY GLY B . n 
B 2 495 ASP 495 495 495 ASP ASP B . n 
B 2 496 LYS 496 496 496 LYS LYS B . n 
B 2 497 ALA 497 497 497 ALA ALA B . n 
B 2 498 LEU 498 498 498 LEU LEU B . n 
B 2 499 LEU 499 499 499 LEU LEU B . n 
B 2 500 ALA 500 500 500 ALA ALA B . n 
B 2 501 ASN 501 501 501 ASN ASN B . n 
B 2 502 ALA 502 502 502 ALA ALA B . n 
B 2 503 SER 503 503 503 SER SER B . n 
B 2 504 LYS 504 504 504 LYS LYS B . n 
B 2 505 LEU 505 505 505 LEU LEU B . n 
B 2 506 GLU 506 506 506 GLU GLU B . n 
B 2 507 THR 507 507 507 THR THR B . n 
B 2 508 MET 508 508 508 MET MET B . n 
B 2 509 ARG 509 509 509 ARG ARG B . n 
B 2 510 SER 510 510 510 SER SER B . n 
B 2 511 LEU 511 511 511 LEU LEU B . n 
B 2 512 TRP 512 512 512 TRP TRP B . n 
B 2 513 MET 513 513 513 MET MET B . n 
B 2 514 SER 514 514 514 SER SER B . n 
B 2 515 SER 515 515 515 SER SER B . n 
B 2 516 CYS 516 516 516 CYS CYS B . n 
B 2 517 SER 517 517 517 SER SER B . n 
B 2 518 VAL 518 518 518 VAL VAL B . n 
B 2 519 SER 519 519 519 SER SER B . n 
B 2 520 PHE 520 520 520 PHE PHE B . n 
B 2 521 GLY 521 521 521 GLY GLY B . n 
B 2 522 ALA 522 522 522 ALA ALA B . n 
B 2 523 CYS 523 523 523 CYS CYS B . n 
B 2 524 LYS 524 524 524 LYS LYS B . n 
B 2 525 LEU 525 525 525 LEU LEU B . n 
B 2 526 LEU 526 526 526 LEU LEU B . n 
B 2 527 GLY 527 527 527 GLY GLY B . n 
B 2 528 GLN 528 528 528 GLN GLN B . n 
B 2 529 LYS 529 529 529 LYS LYS B . n 
B 2 530 MET 530 530 530 MET MET B . n 
B 2 531 PRO 531 531 531 PRO PRO B . n 
B 2 532 LYS 532 532 532 LYS LYS B . n 
B 2 533 LEU 533 533 533 LEU LEU B . n 
B 2 534 ASN 534 534 534 ASN ASN B . n 
B 2 535 VAL 535 535 535 VAL VAL B . n 
B 2 536 GLU 536 536 536 GLU GLU B . n 
B 2 537 VAL 537 537 537 VAL VAL B . n 
B 2 538 ILE 538 538 538 ILE ILE B . n 
B 2 539 ASP 539 539 539 ASP ASP B . n 
B 2 540 GLU 540 540 540 GLU GLU B . n 
B 2 541 ARG 541 541 541 ARG ARG B . n 
B 2 542 GLY 542 542 542 GLY GLY B . n 
B 2 543 ALA 543 543 543 ALA ALA B . n 
B 2 544 PRO 544 544 544 PRO PRO B . n 
B 2 545 ASP 545 545 545 ASP ASP B . n 
B 2 546 SER 546 546 546 SER SER B . n 
B 2 547 ARG 547 547 547 ARG ARG B . n 
B 2 548 PRO 548 548 548 PRO PRO B . n 
B 2 549 GLU 549 549 549 GLU GLU B . n 
B 2 550 SER 550 550 550 SER SER B . n 
B 2 551 CYS 551 551 551 CYS CYS B . n 
B 2 552 PRO 552 552 552 PRO PRO B . n 
B 2 553 VAL 553 553 553 VAL VAL B . n 
B 2 554 GLU 554 554 554 GLU GLU B . n 
B 2 555 ARG 555 555 555 ARG ARG B . n 
B 2 556 VAL 556 556 556 VAL VAL B . n 
B 2 557 PHE 557 557 557 PHE PHE B . n 
B 2 558 ILE 558 558 558 ILE ILE B . n 
B 2 559 TYR 559 559 559 TYR TYR B . n 
B 2 560 ARG 560 560 560 ARG ARG B . n 
B 2 561 THR 561 561 561 THR THR B . n 
B 2 562 VAL 562 562 562 VAL VAL B . n 
B 2 563 ALA 563 563 563 ALA ALA B . n 
B 2 564 GLY 564 564 564 GLY GLY B . n 
B 2 565 PRO 565 565 565 PRO PRO B . n 
B 2 566 ARG 566 566 566 ARG ARG B . n 
B 2 567 PHE 567 567 567 PHE PHE B . n 
B 2 568 ASP 568 568 568 ASP ASP B . n 
B 2 569 MET 569 569 569 MET MET B . n 
B 2 570 PRO 570 570 570 PRO PRO B . n 
B 2 571 GLY 571 571 571 GLY GLY B . n 
B 2 572 PHE 572 572 572 PHE PHE B . n 
B 2 573 VAL 573 573 573 VAL VAL B . n 
B 2 574 TRP 574 574 574 TRP TRP B . n 
B 2 575 ASN 575 575 575 ASN ASN B . n 
B 2 576 MET 576 576 576 MET MET B . n 
B 2 577 ASP 577 577 ?   ?   ?   B . n 
B 2 578 GLN 578 578 ?   ?   ?   B . n 
B 2 579 ASP 579 579 ?   ?   ?   B . n 
B 2 580 SER 580 580 ?   ?   ?   B . n 
B 2 581 THR 581 581 ?   ?   ?   B . n 
B 2 582 MET 582 582 ?   ?   ?   B . n 
B 2 583 ARG 583 583 ?   ?   ?   B . n 
B 2 584 PHE 584 584 ?   ?   ?   B . n 
B 2 585 SER 585 585 ?   ?   ?   B . n 
B 2 586 ARG 586 586 ?   ?   ?   B . n 
B 2 587 GLN 587 587 ?   ?   ?   B . n 
B 2 588 ILE 588 588 ?   ?   ?   B . n 
B 2 589 ILE 589 589 ?   ?   ?   B . n 
B 2 590 THR 590 590 ?   ?   ?   B . n 
B 2 591 THR 591 591 ?   ?   ?   B . n 
B 2 592 ASN 592 592 ?   ?   ?   B . n 
B 2 593 GLY 593 593 ?   ?   ?   B . n 
B 2 594 LEU 594 594 ?   ?   ?   B . n 
C 3 1   GLN 1   1   1   GLN GLN C . n 
C 3 2   VAL 2   2   2   VAL VAL C . n 
C 3 3   VAL 3   3   3   VAL VAL C . n 
C 3 4   GLY 4   4   4   GLY GLY C . n 
C 3 5   TRP 5   5   5   TRP TRP C . n 
C 3 6   PRO 6   6   6   PRO PRO C . n 
C 3 7   PRO 7   7   7   PRO PRO C . n 
C 3 8   VAL 8   8   8   VAL VAL C . n 
C 3 9   ARG 9   9   9   ARG ARG C . n 
C 3 10  ASN 10  10  10  ASN ASN C . n 
C 3 11  TYR 11  11  11  TYR TYR C . n 
C 3 12  ARG 12  12  12  ARG ARG C . n 
C 3 13  LYS 13  13  13  LYS LYS C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 IHP 1   801  801 IHP IHP B . 
E 5 IAC 1   901  901 IAC IAA B . 
F 6 HOH 1   161  40  HOH HOH A . 
F 6 HOH 2   162  58  HOH HOH A . 
F 6 HOH 3   163  127 HOH HOH A . 
F 6 HOH 4   164  132 HOH HOH A . 
F 6 HOH 5   165  164 HOH HOH A . 
F 6 HOH 6   166  168 HOH HOH A . 
F 6 HOH 7   167  169 HOH HOH A . 
F 6 HOH 8   168  174 HOH HOH A . 
F 6 HOH 9   169  176 HOH HOH A . 
F 6 HOH 10  170  179 HOH HOH A . 
F 6 HOH 11  171  185 HOH HOH A . 
F 6 HOH 12  172  196 HOH HOH A . 
F 6 HOH 13  173  198 HOH HOH A . 
F 6 HOH 14  174  199 HOH HOH A . 
F 6 HOH 15  175  202 HOH HOH A . 
F 6 HOH 16  176  203 HOH HOH A . 
F 6 HOH 17  177  224 HOH HOH A . 
F 6 HOH 18  178  236 HOH HOH A . 
F 6 HOH 19  179  237 HOH HOH A . 
F 6 HOH 20  180  240 HOH HOH A . 
F 6 HOH 21  181  245 HOH HOH A . 
F 6 HOH 22  182  256 HOH HOH A . 
F 6 HOH 23  183  268 HOH HOH A . 
F 6 HOH 24  184  269 HOH HOH A . 
F 6 HOH 25  185  289 HOH HOH A . 
F 6 HOH 26  186  290 HOH HOH A . 
F 6 HOH 27  187  307 HOH HOH A . 
F 6 HOH 28  188  312 HOH HOH A . 
F 6 HOH 29  189  330 HOH HOH A . 
F 6 HOH 30  190  332 HOH HOH A . 
F 6 HOH 31  191  338 HOH HOH A . 
F 6 HOH 32  192  340 HOH HOH A . 
F 6 HOH 33  193  366 HOH HOH A . 
F 6 HOH 34  194  379 HOH HOH A . 
F 6 HOH 35  195  382 HOH HOH A . 
F 6 HOH 36  196  395 HOH HOH A . 
F 6 HOH 37  197  397 HOH HOH A . 
F 6 HOH 38  198  419 HOH HOH A . 
F 6 HOH 39  199  422 HOH HOH A . 
F 6 HOH 40  200  443 HOH HOH A . 
F 6 HOH 41  201  451 HOH HOH A . 
F 6 HOH 42  202  452 HOH HOH A . 
F 6 HOH 43  203  455 HOH HOH A . 
F 6 HOH 44  204  481 HOH HOH A . 
F 6 HOH 45  205  482 HOH HOH A . 
F 6 HOH 46  206  489 HOH HOH A . 
F 6 HOH 47  207  492 HOH HOH A . 
F 6 HOH 48  208  495 HOH HOH A . 
F 6 HOH 49  209  506 HOH HOH A . 
F 6 HOH 50  210  508 HOH HOH A . 
F 6 HOH 51  211  510 HOH HOH A . 
F 6 HOH 52  212  514 HOH HOH A . 
F 6 HOH 53  213  515 HOH HOH A . 
F 6 HOH 54  214  516 HOH HOH A . 
F 6 HOH 55  215  522 HOH HOH A . 
F 6 HOH 56  216  523 HOH HOH A . 
F 6 HOH 57  217  532 HOH HOH A . 
F 6 HOH 58  218  533 HOH HOH A . 
F 6 HOH 59  219  537 HOH HOH A . 
F 6 HOH 60  220  540 HOH HOH A . 
F 6 HOH 61  221  552 HOH HOH A . 
F 6 HOH 62  222  563 HOH HOH A . 
F 6 HOH 63  223  584 HOH HOH A . 
F 6 HOH 64  224  591 HOH HOH A . 
F 6 HOH 65  225  592 HOH HOH A . 
F 6 HOH 66  226  594 HOH HOH A . 
F 6 HOH 67  227  619 HOH HOH A . 
F 6 HOH 68  228  623 HOH HOH A . 
F 6 HOH 69  229  629 HOH HOH A . 
F 6 HOH 70  230  634 HOH HOH A . 
F 6 HOH 71  231  638 HOH HOH A . 
F 6 HOH 72  232  660 HOH HOH A . 
F 6 HOH 73  233  667 HOH HOH A . 
F 6 HOH 74  234  668 HOH HOH A . 
F 6 HOH 75  235  674 HOH HOH A . 
F 6 HOH 76  236  711 HOH HOH A . 
F 6 HOH 77  237  713 HOH HOH A . 
F 6 HOH 78  238  716 HOH HOH A . 
F 6 HOH 79  239  718 HOH HOH A . 
F 6 HOH 80  240  720 HOH HOH A . 
F 6 HOH 81  241  729 HOH HOH A . 
F 6 HOH 82  242  735 HOH HOH A . 
F 6 HOH 83  243  745 HOH HOH A . 
F 6 HOH 84  244  748 HOH HOH A . 
F 6 HOH 85  245  751 HOH HOH A . 
F 6 HOH 86  246  758 HOH HOH A . 
F 6 HOH 87  247  761 HOH HOH A . 
G 6 HOH 1   902  1   HOH HOH B . 
G 6 HOH 2   903  2   HOH HOH B . 
G 6 HOH 3   904  3   HOH HOH B . 
G 6 HOH 4   905  4   HOH HOH B . 
G 6 HOH 5   906  5   HOH HOH B . 
G 6 HOH 6   907  6   HOH HOH B . 
G 6 HOH 7   908  7   HOH HOH B . 
G 6 HOH 8   909  8   HOH HOH B . 
G 6 HOH 9   910  9   HOH HOH B . 
G 6 HOH 10  911  10  HOH HOH B . 
G 6 HOH 11  912  11  HOH HOH B . 
G 6 HOH 12  913  12  HOH HOH B . 
G 6 HOH 13  914  13  HOH HOH B . 
G 6 HOH 14  915  14  HOH HOH B . 
G 6 HOH 15  916  15  HOH HOH B . 
G 6 HOH 16  917  16  HOH HOH B . 
G 6 HOH 17  918  17  HOH HOH B . 
G 6 HOH 18  919  18  HOH HOH B . 
G 6 HOH 19  920  19  HOH HOH B . 
G 6 HOH 20  921  20  HOH HOH B . 
G 6 HOH 21  922  21  HOH HOH B . 
G 6 HOH 22  923  22  HOH HOH B . 
G 6 HOH 23  924  23  HOH HOH B . 
G 6 HOH 24  925  24  HOH HOH B . 
G 6 HOH 25  926  25  HOH HOH B . 
G 6 HOH 26  927  26  HOH HOH B . 
G 6 HOH 27  928  27  HOH HOH B . 
G 6 HOH 28  929  28  HOH HOH B . 
G 6 HOH 29  930  29  HOH HOH B . 
G 6 HOH 30  931  30  HOH HOH B . 
G 6 HOH 31  932  31  HOH HOH B . 
G 6 HOH 32  933  32  HOH HOH B . 
G 6 HOH 33  934  33  HOH HOH B . 
G 6 HOH 34  935  34  HOH HOH B . 
G 6 HOH 35  936  35  HOH HOH B . 
G 6 HOH 36  937  36  HOH HOH B . 
G 6 HOH 37  938  37  HOH HOH B . 
G 6 HOH 38  939  38  HOH HOH B . 
G 6 HOH 39  940  39  HOH HOH B . 
G 6 HOH 40  941  41  HOH HOH B . 
G 6 HOH 41  942  42  HOH HOH B . 
G 6 HOH 42  943  43  HOH HOH B . 
G 6 HOH 43  944  44  HOH HOH B . 
G 6 HOH 44  945  45  HOH HOH B . 
G 6 HOH 45  946  46  HOH HOH B . 
G 6 HOH 46  947  47  HOH HOH B . 
G 6 HOH 47  948  48  HOH HOH B . 
G 6 HOH 48  949  49  HOH HOH B . 
G 6 HOH 49  950  50  HOH HOH B . 
G 6 HOH 50  951  51  HOH HOH B . 
G 6 HOH 51  952  53  HOH HOH B . 
G 6 HOH 52  953  54  HOH HOH B . 
G 6 HOH 53  954  55  HOH HOH B . 
G 6 HOH 54  955  56  HOH HOH B . 
G 6 HOH 55  956  57  HOH HOH B . 
G 6 HOH 56  957  59  HOH HOH B . 
G 6 HOH 57  958  60  HOH HOH B . 
G 6 HOH 58  959  61  HOH HOH B . 
G 6 HOH 59  960  62  HOH HOH B . 
G 6 HOH 60  961  63  HOH HOH B . 
G 6 HOH 61  962  64  HOH HOH B . 
G 6 HOH 62  963  65  HOH HOH B . 
G 6 HOH 63  964  66  HOH HOH B . 
G 6 HOH 64  965  67  HOH HOH B . 
G 6 HOH 65  966  68  HOH HOH B . 
G 6 HOH 66  967  69  HOH HOH B . 
G 6 HOH 67  968  70  HOH HOH B . 
G 6 HOH 68  969  71  HOH HOH B . 
G 6 HOH 69  970  72  HOH HOH B . 
G 6 HOH 70  971  73  HOH HOH B . 
G 6 HOH 71  972  74  HOH HOH B . 
G 6 HOH 72  973  75  HOH HOH B . 
G 6 HOH 73  974  76  HOH HOH B . 
G 6 HOH 74  975  77  HOH HOH B . 
G 6 HOH 75  976  78  HOH HOH B . 
G 6 HOH 76  977  79  HOH HOH B . 
G 6 HOH 77  978  80  HOH HOH B . 
G 6 HOH 78  979  81  HOH HOH B . 
G 6 HOH 79  980  82  HOH HOH B . 
G 6 HOH 80  981  83  HOH HOH B . 
G 6 HOH 81  982  84  HOH HOH B . 
G 6 HOH 82  983  85  HOH HOH B . 
G 6 HOH 83  984  86  HOH HOH B . 
G 6 HOH 84  985  87  HOH HOH B . 
G 6 HOH 85  986  88  HOH HOH B . 
G 6 HOH 86  987  89  HOH HOH B . 
G 6 HOH 87  988  90  HOH HOH B . 
G 6 HOH 88  989  91  HOH HOH B . 
G 6 HOH 89  990  92  HOH HOH B . 
G 6 HOH 90  991  93  HOH HOH B . 
G 6 HOH 91  992  94  HOH HOH B . 
G 6 HOH 92  993  95  HOH HOH B . 
G 6 HOH 93  994  96  HOH HOH B . 
G 6 HOH 94  995  97  HOH HOH B . 
G 6 HOH 95  996  98  HOH HOH B . 
G 6 HOH 96  997  99  HOH HOH B . 
G 6 HOH 97  998  100 HOH HOH B . 
G 6 HOH 98  999  101 HOH HOH B . 
G 6 HOH 99  1000 102 HOH HOH B . 
G 6 HOH 100 1001 103 HOH HOH B . 
G 6 HOH 101 1002 104 HOH HOH B . 
G 6 HOH 102 1003 105 HOH HOH B . 
G 6 HOH 103 1004 106 HOH HOH B . 
G 6 HOH 104 1005 108 HOH HOH B . 
G 6 HOH 105 1006 109 HOH HOH B . 
G 6 HOH 106 1007 110 HOH HOH B . 
G 6 HOH 107 1008 111 HOH HOH B . 
G 6 HOH 108 1009 112 HOH HOH B . 
G 6 HOH 109 1010 113 HOH HOH B . 
G 6 HOH 110 1011 114 HOH HOH B . 
G 6 HOH 111 1012 115 HOH HOH B . 
G 6 HOH 112 1013 116 HOH HOH B . 
G 6 HOH 113 1014 117 HOH HOH B . 
G 6 HOH 114 1015 118 HOH HOH B . 
G 6 HOH 115 1016 119 HOH HOH B . 
G 6 HOH 116 1017 120 HOH HOH B . 
G 6 HOH 117 1018 121 HOH HOH B . 
G 6 HOH 118 1019 122 HOH HOH B . 
G 6 HOH 119 1020 123 HOH HOH B . 
G 6 HOH 120 1021 124 HOH HOH B . 
G 6 HOH 121 1022 125 HOH HOH B . 
G 6 HOH 122 1023 126 HOH HOH B . 
G 6 HOH 123 1024 128 HOH HOH B . 
G 6 HOH 124 1025 129 HOH HOH B . 
G 6 HOH 125 1026 130 HOH HOH B . 
G 6 HOH 126 1027 131 HOH HOH B . 
G 6 HOH 127 1028 133 HOH HOH B . 
G 6 HOH 128 1029 134 HOH HOH B . 
G 6 HOH 129 1030 135 HOH HOH B . 
G 6 HOH 130 1031 136 HOH HOH B . 
G 6 HOH 131 1032 137 HOH HOH B . 
G 6 HOH 132 1033 138 HOH HOH B . 
G 6 HOH 133 1034 139 HOH HOH B . 
G 6 HOH 134 1035 140 HOH HOH B . 
G 6 HOH 135 1036 141 HOH HOH B . 
G 6 HOH 136 1037 142 HOH HOH B . 
G 6 HOH 137 1038 143 HOH HOH B . 
G 6 HOH 138 1039 144 HOH HOH B . 
G 6 HOH 139 1040 145 HOH HOH B . 
G 6 HOH 140 1041 146 HOH HOH B . 
G 6 HOH 141 1042 147 HOH HOH B . 
G 6 HOH 142 1043 148 HOH HOH B . 
G 6 HOH 143 1044 149 HOH HOH B . 
G 6 HOH 144 1045 150 HOH HOH B . 
G 6 HOH 145 1046 151 HOH HOH B . 
G 6 HOH 146 1047 152 HOH HOH B . 
G 6 HOH 147 1048 153 HOH HOH B . 
G 6 HOH 148 1049 154 HOH HOH B . 
G 6 HOH 149 1050 155 HOH HOH B . 
G 6 HOH 150 1051 156 HOH HOH B . 
G 6 HOH 151 1052 157 HOH HOH B . 
G 6 HOH 152 1053 158 HOH HOH B . 
G 6 HOH 153 1054 159 HOH HOH B . 
G 6 HOH 154 1055 160 HOH HOH B . 
G 6 HOH 155 1056 161 HOH HOH B . 
G 6 HOH 156 1057 162 HOH HOH B . 
G 6 HOH 157 1058 163 HOH HOH B . 
G 6 HOH 158 1059 165 HOH HOH B . 
G 6 HOH 159 1060 166 HOH HOH B . 
G 6 HOH 160 1061 167 HOH HOH B . 
G 6 HOH 161 1062 170 HOH HOH B . 
G 6 HOH 162 1063 171 HOH HOH B . 
G 6 HOH 163 1064 172 HOH HOH B . 
G 6 HOH 164 1065 173 HOH HOH B . 
G 6 HOH 165 1066 175 HOH HOH B . 
G 6 HOH 166 1067 177 HOH HOH B . 
G 6 HOH 167 1068 178 HOH HOH B . 
G 6 HOH 168 1069 180 HOH HOH B . 
G 6 HOH 169 1070 181 HOH HOH B . 
G 6 HOH 170 1071 182 HOH HOH B . 
G 6 HOH 171 1072 183 HOH HOH B . 
G 6 HOH 172 1073 184 HOH HOH B . 
G 6 HOH 173 1074 186 HOH HOH B . 
G 6 HOH 174 1075 187 HOH HOH B . 
G 6 HOH 175 1076 188 HOH HOH B . 
G 6 HOH 176 1077 189 HOH HOH B . 
G 6 HOH 177 1078 190 HOH HOH B . 
G 6 HOH 178 1079 191 HOH HOH B . 
G 6 HOH 179 1080 192 HOH HOH B . 
G 6 HOH 180 1081 193 HOH HOH B . 
G 6 HOH 181 1082 194 HOH HOH B . 
G 6 HOH 182 1083 195 HOH HOH B . 
G 6 HOH 183 1084 197 HOH HOH B . 
G 6 HOH 184 1085 200 HOH HOH B . 
G 6 HOH 185 1086 201 HOH HOH B . 
G 6 HOH 186 1087 204 HOH HOH B . 
G 6 HOH 187 1088 205 HOH HOH B . 
G 6 HOH 188 1089 206 HOH HOH B . 
G 6 HOH 189 1090 207 HOH HOH B . 
G 6 HOH 190 1091 208 HOH HOH B . 
G 6 HOH 191 1092 209 HOH HOH B . 
G 6 HOH 192 1093 210 HOH HOH B . 
G 6 HOH 193 1094 211 HOH HOH B . 
G 6 HOH 194 1095 212 HOH HOH B . 
G 6 HOH 195 1096 213 HOH HOH B . 
G 6 HOH 196 1097 214 HOH HOH B . 
G 6 HOH 197 1098 215 HOH HOH B . 
G 6 HOH 198 1099 216 HOH HOH B . 
G 6 HOH 199 1100 217 HOH HOH B . 
G 6 HOH 200 1101 218 HOH HOH B . 
G 6 HOH 201 1102 219 HOH HOH B . 
G 6 HOH 202 1103 220 HOH HOH B . 
G 6 HOH 203 1104 221 HOH HOH B . 
G 6 HOH 204 1105 222 HOH HOH B . 
G 6 HOH 205 1106 223 HOH HOH B . 
G 6 HOH 206 1107 225 HOH HOH B . 
G 6 HOH 207 1108 226 HOH HOH B . 
G 6 HOH 208 1109 227 HOH HOH B . 
G 6 HOH 209 1110 228 HOH HOH B . 
G 6 HOH 210 1111 229 HOH HOH B . 
G 6 HOH 211 1112 230 HOH HOH B . 
G 6 HOH 212 1113 231 HOH HOH B . 
G 6 HOH 213 1114 232 HOH HOH B . 
G 6 HOH 214 1115 233 HOH HOH B . 
G 6 HOH 215 1116 234 HOH HOH B . 
G 6 HOH 216 1117 235 HOH HOH B . 
G 6 HOH 217 1118 238 HOH HOH B . 
G 6 HOH 218 1119 239 HOH HOH B . 
G 6 HOH 219 1120 241 HOH HOH B . 
G 6 HOH 220 1121 242 HOH HOH B . 
G 6 HOH 221 1122 243 HOH HOH B . 
G 6 HOH 222 1123 246 HOH HOH B . 
G 6 HOH 223 1124 247 HOH HOH B . 
G 6 HOH 224 1125 248 HOH HOH B . 
G 6 HOH 225 1126 249 HOH HOH B . 
G 6 HOH 226 1127 250 HOH HOH B . 
G 6 HOH 227 1128 251 HOH HOH B . 
G 6 HOH 228 1129 252 HOH HOH B . 
G 6 HOH 229 1130 253 HOH HOH B . 
G 6 HOH 230 1131 254 HOH HOH B . 
G 6 HOH 231 1132 255 HOH HOH B . 
G 6 HOH 232 1133 257 HOH HOH B . 
G 6 HOH 233 1134 258 HOH HOH B . 
G 6 HOH 234 1135 259 HOH HOH B . 
G 6 HOH 235 1136 260 HOH HOH B . 
G 6 HOH 236 1137 261 HOH HOH B . 
G 6 HOH 237 1138 262 HOH HOH B . 
G 6 HOH 238 1139 263 HOH HOH B . 
G 6 HOH 239 1140 264 HOH HOH B . 
G 6 HOH 240 1141 265 HOH HOH B . 
G 6 HOH 241 1142 266 HOH HOH B . 
G 6 HOH 242 1143 267 HOH HOH B . 
G 6 HOH 243 1144 270 HOH HOH B . 
G 6 HOH 244 1145 271 HOH HOH B . 
G 6 HOH 245 1146 272 HOH HOH B . 
G 6 HOH 246 1147 273 HOH HOH B . 
G 6 HOH 247 1148 274 HOH HOH B . 
G 6 HOH 248 1149 275 HOH HOH B . 
G 6 HOH 249 1150 276 HOH HOH B . 
G 6 HOH 250 1151 277 HOH HOH B . 
G 6 HOH 251 1152 278 HOH HOH B . 
G 6 HOH 252 1153 279 HOH HOH B . 
G 6 HOH 253 1154 280 HOH HOH B . 
G 6 HOH 254 1155 281 HOH HOH B . 
G 6 HOH 255 1156 282 HOH HOH B . 
G 6 HOH 256 1157 283 HOH HOH B . 
G 6 HOH 257 1158 284 HOH HOH B . 
G 6 HOH 258 1159 285 HOH HOH B . 
G 6 HOH 259 1160 286 HOH HOH B . 
G 6 HOH 260 1161 287 HOH HOH B . 
G 6 HOH 261 1162 288 HOH HOH B . 
G 6 HOH 262 1163 291 HOH HOH B . 
G 6 HOH 263 1164 292 HOH HOH B . 
G 6 HOH 264 1165 293 HOH HOH B . 
G 6 HOH 265 1166 294 HOH HOH B . 
G 6 HOH 266 1167 295 HOH HOH B . 
G 6 HOH 267 1168 296 HOH HOH B . 
G 6 HOH 268 1169 297 HOH HOH B . 
G 6 HOH 269 1170 298 HOH HOH B . 
G 6 HOH 270 1171 299 HOH HOH B . 
G 6 HOH 271 1172 300 HOH HOH B . 
G 6 HOH 272 1173 301 HOH HOH B . 
G 6 HOH 273 1174 302 HOH HOH B . 
G 6 HOH 274 1175 303 HOH HOH B . 
G 6 HOH 275 1176 304 HOH HOH B . 
G 6 HOH 276 1177 305 HOH HOH B . 
G 6 HOH 277 1178 306 HOH HOH B . 
G 6 HOH 278 1179 308 HOH HOH B . 
G 6 HOH 279 1180 309 HOH HOH B . 
G 6 HOH 280 1181 310 HOH HOH B . 
G 6 HOH 281 1182 313 HOH HOH B . 
G 6 HOH 282 1183 314 HOH HOH B . 
G 6 HOH 283 1184 315 HOH HOH B . 
G 6 HOH 284 1185 316 HOH HOH B . 
G 6 HOH 285 1186 317 HOH HOH B . 
G 6 HOH 286 1187 318 HOH HOH B . 
G 6 HOH 287 1188 319 HOH HOH B . 
G 6 HOH 288 1189 320 HOH HOH B . 
G 6 HOH 289 1190 321 HOH HOH B . 
G 6 HOH 290 1191 322 HOH HOH B . 
G 6 HOH 291 1192 323 HOH HOH B . 
G 6 HOH 292 1193 324 HOH HOH B . 
G 6 HOH 293 1194 325 HOH HOH B . 
G 6 HOH 294 1195 326 HOH HOH B . 
G 6 HOH 295 1196 327 HOH HOH B . 
G 6 HOH 296 1197 328 HOH HOH B . 
G 6 HOH 297 1198 329 HOH HOH B . 
G 6 HOH 298 1199 331 HOH HOH B . 
G 6 HOH 299 1200 333 HOH HOH B . 
G 6 HOH 300 1201 334 HOH HOH B . 
G 6 HOH 301 1202 335 HOH HOH B . 
G 6 HOH 302 1203 336 HOH HOH B . 
G 6 HOH 303 1204 337 HOH HOH B . 
G 6 HOH 304 1205 339 HOH HOH B . 
G 6 HOH 305 1206 341 HOH HOH B . 
G 6 HOH 306 1207 343 HOH HOH B . 
G 6 HOH 307 1208 344 HOH HOH B . 
G 6 HOH 308 1209 345 HOH HOH B . 
G 6 HOH 309 1210 346 HOH HOH B . 
G 6 HOH 310 1211 347 HOH HOH B . 
G 6 HOH 311 1212 348 HOH HOH B . 
G 6 HOH 312 1213 349 HOH HOH B . 
G 6 HOH 313 1214 350 HOH HOH B . 
G 6 HOH 314 1215 351 HOH HOH B . 
G 6 HOH 315 1216 352 HOH HOH B . 
G 6 HOH 316 1217 353 HOH HOH B . 
G 6 HOH 317 1218 355 HOH HOH B . 
G 6 HOH 318 1219 356 HOH HOH B . 
G 6 HOH 319 1220 357 HOH HOH B . 
G 6 HOH 320 1221 358 HOH HOH B . 
G 6 HOH 321 1222 359 HOH HOH B . 
G 6 HOH 322 1223 360 HOH HOH B . 
G 6 HOH 323 1224 361 HOH HOH B . 
G 6 HOH 324 1225 362 HOH HOH B . 
G 6 HOH 325 1226 363 HOH HOH B . 
G 6 HOH 326 1227 364 HOH HOH B . 
G 6 HOH 327 1228 365 HOH HOH B . 
G 6 HOH 328 1229 367 HOH HOH B . 
G 6 HOH 329 1230 368 HOH HOH B . 
G 6 HOH 330 1231 369 HOH HOH B . 
G 6 HOH 331 1232 370 HOH HOH B . 
G 6 HOH 332 1233 371 HOH HOH B . 
G 6 HOH 333 1234 372 HOH HOH B . 
G 6 HOH 334 1235 373 HOH HOH B . 
G 6 HOH 335 1236 374 HOH HOH B . 
G 6 HOH 336 1237 375 HOH HOH B . 
G 6 HOH 337 1238 376 HOH HOH B . 
G 6 HOH 338 1239 377 HOH HOH B . 
G 6 HOH 339 1240 378 HOH HOH B . 
G 6 HOH 340 1241 380 HOH HOH B . 
G 6 HOH 341 1242 381 HOH HOH B . 
G 6 HOH 342 1243 383 HOH HOH B . 
G 6 HOH 343 1244 384 HOH HOH B . 
G 6 HOH 344 1245 386 HOH HOH B . 
G 6 HOH 345 1246 387 HOH HOH B . 
G 6 HOH 346 1247 388 HOH HOH B . 
G 6 HOH 347 1248 389 HOH HOH B . 
G 6 HOH 348 1249 390 HOH HOH B . 
G 6 HOH 349 1250 391 HOH HOH B . 
G 6 HOH 350 1251 392 HOH HOH B . 
G 6 HOH 351 1252 393 HOH HOH B . 
G 6 HOH 352 1253 394 HOH HOH B . 
G 6 HOH 353 1254 396 HOH HOH B . 
G 6 HOH 354 1255 398 HOH HOH B . 
G 6 HOH 355 1256 399 HOH HOH B . 
G 6 HOH 356 1257 400 HOH HOH B . 
G 6 HOH 357 1258 401 HOH HOH B . 
G 6 HOH 358 1259 402 HOH HOH B . 
G 6 HOH 359 1260 403 HOH HOH B . 
G 6 HOH 360 1261 404 HOH HOH B . 
G 6 HOH 361 1262 405 HOH HOH B . 
G 6 HOH 362 1263 406 HOH HOH B . 
G 6 HOH 363 1264 407 HOH HOH B . 
G 6 HOH 364 1265 408 HOH HOH B . 
G 6 HOH 365 1266 409 HOH HOH B . 
G 6 HOH 366 1267 411 HOH HOH B . 
G 6 HOH 367 1268 412 HOH HOH B . 
G 6 HOH 368 1269 413 HOH HOH B . 
G 6 HOH 369 1270 414 HOH HOH B . 
G 6 HOH 370 1271 415 HOH HOH B . 
G 6 HOH 371 1272 416 HOH HOH B . 
G 6 HOH 372 1273 417 HOH HOH B . 
G 6 HOH 373 1274 418 HOH HOH B . 
G 6 HOH 374 1275 420 HOH HOH B . 
G 6 HOH 375 1276 421 HOH HOH B . 
G 6 HOH 376 1277 424 HOH HOH B . 
G 6 HOH 377 1278 425 HOH HOH B . 
G 6 HOH 378 1279 426 HOH HOH B . 
G 6 HOH 379 1280 427 HOH HOH B . 
G 6 HOH 380 1281 428 HOH HOH B . 
G 6 HOH 381 1282 429 HOH HOH B . 
G 6 HOH 382 1283 430 HOH HOH B . 
G 6 HOH 383 1284 431 HOH HOH B . 
G 6 HOH 384 1285 432 HOH HOH B . 
G 6 HOH 385 1286 433 HOH HOH B . 
G 6 HOH 386 1287 434 HOH HOH B . 
G 6 HOH 387 1288 435 HOH HOH B . 
G 6 HOH 388 1289 436 HOH HOH B . 
G 6 HOH 389 1290 437 HOH HOH B . 
G 6 HOH 390 1291 438 HOH HOH B . 
G 6 HOH 391 1292 439 HOH HOH B . 
G 6 HOH 392 1293 440 HOH HOH B . 
G 6 HOH 393 1294 441 HOH HOH B . 
G 6 HOH 394 1295 442 HOH HOH B . 
G 6 HOH 395 1296 444 HOH HOH B . 
G 6 HOH 396 1297 445 HOH HOH B . 
G 6 HOH 397 1298 446 HOH HOH B . 
G 6 HOH 398 1299 447 HOH HOH B . 
G 6 HOH 399 1300 448 HOH HOH B . 
G 6 HOH 400 1301 449 HOH HOH B . 
G 6 HOH 401 1302 450 HOH HOH B . 
G 6 HOH 402 1303 453 HOH HOH B . 
G 6 HOH 403 1304 454 HOH HOH B . 
G 6 HOH 404 1305 456 HOH HOH B . 
G 6 HOH 405 1306 457 HOH HOH B . 
G 6 HOH 406 1307 458 HOH HOH B . 
G 6 HOH 407 1308 459 HOH HOH B . 
G 6 HOH 408 1309 460 HOH HOH B . 
G 6 HOH 409 1310 461 HOH HOH B . 
G 6 HOH 410 1311 462 HOH HOH B . 
G 6 HOH 411 1312 463 HOH HOH B . 
G 6 HOH 412 1313 464 HOH HOH B . 
G 6 HOH 413 1314 465 HOH HOH B . 
G 6 HOH 414 1315 466 HOH HOH B . 
G 6 HOH 415 1316 467 HOH HOH B . 
G 6 HOH 416 1317 468 HOH HOH B . 
G 6 HOH 417 1318 469 HOH HOH B . 
G 6 HOH 418 1319 470 HOH HOH B . 
G 6 HOH 419 1320 471 HOH HOH B . 
G 6 HOH 420 1321 472 HOH HOH B . 
G 6 HOH 421 1322 473 HOH HOH B . 
G 6 HOH 422 1323 474 HOH HOH B . 
G 6 HOH 423 1324 475 HOH HOH B . 
G 6 HOH 424 1325 477 HOH HOH B . 
G 6 HOH 425 1326 478 HOH HOH B . 
G 6 HOH 426 1327 479 HOH HOH B . 
G 6 HOH 427 1328 480 HOH HOH B . 
G 6 HOH 428 1329 483 HOH HOH B . 
G 6 HOH 429 1330 484 HOH HOH B . 
G 6 HOH 430 1331 485 HOH HOH B . 
G 6 HOH 431 1332 486 HOH HOH B . 
G 6 HOH 432 1333 487 HOH HOH B . 
G 6 HOH 433 1334 488 HOH HOH B . 
G 6 HOH 434 1335 490 HOH HOH B . 
G 6 HOH 435 1336 491 HOH HOH B . 
G 6 HOH 436 1337 493 HOH HOH B . 
G 6 HOH 437 1338 494 HOH HOH B . 
G 6 HOH 438 1339 496 HOH HOH B . 
G 6 HOH 439 1340 497 HOH HOH B . 
G 6 HOH 440 1341 498 HOH HOH B . 
G 6 HOH 441 1342 499 HOH HOH B . 
G 6 HOH 442 1343 500 HOH HOH B . 
G 6 HOH 443 1344 501 HOH HOH B . 
G 6 HOH 444 1345 502 HOH HOH B . 
G 6 HOH 445 1346 503 HOH HOH B . 
G 6 HOH 446 1347 504 HOH HOH B . 
G 6 HOH 447 1348 505 HOH HOH B . 
G 6 HOH 448 1349 507 HOH HOH B . 
G 6 HOH 449 1350 511 HOH HOH B . 
G 6 HOH 450 1351 512 HOH HOH B . 
G 6 HOH 451 1352 513 HOH HOH B . 
G 6 HOH 452 1353 517 HOH HOH B . 
G 6 HOH 453 1354 518 HOH HOH B . 
G 6 HOH 454 1355 519 HOH HOH B . 
G 6 HOH 455 1356 520 HOH HOH B . 
G 6 HOH 456 1357 521 HOH HOH B . 
G 6 HOH 457 1358 524 HOH HOH B . 
G 6 HOH 458 1359 525 HOH HOH B . 
G 6 HOH 459 1360 526 HOH HOH B . 
G 6 HOH 460 1361 527 HOH HOH B . 
G 6 HOH 461 1362 528 HOH HOH B . 
G 6 HOH 462 1363 529 HOH HOH B . 
G 6 HOH 463 1364 530 HOH HOH B . 
G 6 HOH 464 1365 531 HOH HOH B . 
G 6 HOH 465 1366 534 HOH HOH B . 
G 6 HOH 466 1367 535 HOH HOH B . 
G 6 HOH 467 1368 536 HOH HOH B . 
G 6 HOH 468 1369 538 HOH HOH B . 
G 6 HOH 469 1370 539 HOH HOH B . 
G 6 HOH 470 1371 541 HOH HOH B . 
G 6 HOH 471 1372 542 HOH HOH B . 
G 6 HOH 472 1373 543 HOH HOH B . 
G 6 HOH 473 1374 544 HOH HOH B . 
G 6 HOH 474 1375 545 HOH HOH B . 
G 6 HOH 475 1376 546 HOH HOH B . 
G 6 HOH 476 1377 547 HOH HOH B . 
G 6 HOH 477 1378 548 HOH HOH B . 
G 6 HOH 478 1379 549 HOH HOH B . 
G 6 HOH 479 1380 550 HOH HOH B . 
G 6 HOH 480 1381 551 HOH HOH B . 
G 6 HOH 481 1382 553 HOH HOH B . 
G 6 HOH 482 1383 554 HOH HOH B . 
G 6 HOH 483 1384 555 HOH HOH B . 
G 6 HOH 484 1385 556 HOH HOH B . 
G 6 HOH 485 1386 557 HOH HOH B . 
G 6 HOH 486 1387 558 HOH HOH B . 
G 6 HOH 487 1388 559 HOH HOH B . 
G 6 HOH 488 1389 560 HOH HOH B . 
G 6 HOH 489 1390 562 HOH HOH B . 
G 6 HOH 490 1391 564 HOH HOH B . 
G 6 HOH 491 1392 565 HOH HOH B . 
G 6 HOH 492 1393 566 HOH HOH B . 
G 6 HOH 493 1394 567 HOH HOH B . 
G 6 HOH 494 1395 568 HOH HOH B . 
G 6 HOH 495 1396 569 HOH HOH B . 
G 6 HOH 496 1397 570 HOH HOH B . 
G 6 HOH 497 1398 571 HOH HOH B . 
G 6 HOH 498 1399 572 HOH HOH B . 
G 6 HOH 499 1400 573 HOH HOH B . 
G 6 HOH 500 1401 574 HOH HOH B . 
G 6 HOH 501 1402 575 HOH HOH B . 
G 6 HOH 502 1403 576 HOH HOH B . 
G 6 HOH 503 1404 577 HOH HOH B . 
G 6 HOH 504 1405 578 HOH HOH B . 
G 6 HOH 505 1406 579 HOH HOH B . 
G 6 HOH 506 1407 580 HOH HOH B . 
G 6 HOH 507 1408 581 HOH HOH B . 
G 6 HOH 508 1409 582 HOH HOH B . 
G 6 HOH 509 1410 583 HOH HOH B . 
G 6 HOH 510 1411 585 HOH HOH B . 
G 6 HOH 511 1412 586 HOH HOH B . 
G 6 HOH 512 1413 587 HOH HOH B . 
G 6 HOH 513 1414 588 HOH HOH B . 
G 6 HOH 514 1415 589 HOH HOH B . 
G 6 HOH 515 1416 590 HOH HOH B . 
G 6 HOH 516 1417 593 HOH HOH B . 
G 6 HOH 517 1418 595 HOH HOH B . 
G 6 HOH 518 1419 596 HOH HOH B . 
G 6 HOH 519 1420 597 HOH HOH B . 
G 6 HOH 520 1421 598 HOH HOH B . 
G 6 HOH 521 1422 599 HOH HOH B . 
G 6 HOH 522 1423 600 HOH HOH B . 
G 6 HOH 523 1424 601 HOH HOH B . 
G 6 HOH 524 1425 602 HOH HOH B . 
G 6 HOH 525 1426 603 HOH HOH B . 
G 6 HOH 526 1427 604 HOH HOH B . 
G 6 HOH 527 1428 605 HOH HOH B . 
G 6 HOH 528 1429 606 HOH HOH B . 
G 6 HOH 529 1430 607 HOH HOH B . 
G 6 HOH 530 1431 608 HOH HOH B . 
G 6 HOH 531 1432 609 HOH HOH B . 
G 6 HOH 532 1433 610 HOH HOH B . 
G 6 HOH 533 1434 611 HOH HOH B . 
G 6 HOH 534 1435 612 HOH HOH B . 
G 6 HOH 535 1436 613 HOH HOH B . 
G 6 HOH 536 1437 614 HOH HOH B . 
G 6 HOH 537 1438 615 HOH HOH B . 
G 6 HOH 538 1439 616 HOH HOH B . 
G 6 HOH 539 1440 617 HOH HOH B . 
G 6 HOH 540 1441 618 HOH HOH B . 
G 6 HOH 541 1442 620 HOH HOH B . 
G 6 HOH 542 1443 621 HOH HOH B . 
G 6 HOH 543 1444 622 HOH HOH B . 
G 6 HOH 544 1445 624 HOH HOH B . 
G 6 HOH 545 1446 625 HOH HOH B . 
G 6 HOH 546 1447 626 HOH HOH B . 
G 6 HOH 547 1448 627 HOH HOH B . 
G 6 HOH 548 1449 628 HOH HOH B . 
G 6 HOH 549 1450 630 HOH HOH B . 
G 6 HOH 550 1451 631 HOH HOH B . 
G 6 HOH 551 1452 632 HOH HOH B . 
G 6 HOH 552 1453 633 HOH HOH B . 
G 6 HOH 553 1454 635 HOH HOH B . 
G 6 HOH 554 1455 636 HOH HOH B . 
G 6 HOH 555 1456 637 HOH HOH B . 
G 6 HOH 556 1457 639 HOH HOH B . 
G 6 HOH 557 1458 640 HOH HOH B . 
G 6 HOH 558 1459 641 HOH HOH B . 
G 6 HOH 559 1460 642 HOH HOH B . 
G 6 HOH 560 1461 643 HOH HOH B . 
G 6 HOH 561 1462 644 HOH HOH B . 
G 6 HOH 562 1463 645 HOH HOH B . 
G 6 HOH 563 1464 646 HOH HOH B . 
G 6 HOH 564 1465 647 HOH HOH B . 
G 6 HOH 565 1466 648 HOH HOH B . 
G 6 HOH 566 1467 650 HOH HOH B . 
G 6 HOH 567 1468 651 HOH HOH B . 
G 6 HOH 568 1469 652 HOH HOH B . 
G 6 HOH 569 1470 653 HOH HOH B . 
G 6 HOH 570 1471 654 HOH HOH B . 
G 6 HOH 571 1472 655 HOH HOH B . 
G 6 HOH 572 1473 656 HOH HOH B . 
G 6 HOH 573 1474 657 HOH HOH B . 
G 6 HOH 574 1475 658 HOH HOH B . 
G 6 HOH 575 1476 661 HOH HOH B . 
G 6 HOH 576 1477 662 HOH HOH B . 
G 6 HOH 577 1478 663 HOH HOH B . 
G 6 HOH 578 1479 664 HOH HOH B . 
G 6 HOH 579 1480 665 HOH HOH B . 
G 6 HOH 580 1481 666 HOH HOH B . 
G 6 HOH 581 1482 669 HOH HOH B . 
G 6 HOH 582 1483 670 HOH HOH B . 
G 6 HOH 583 1484 671 HOH HOH B . 
G 6 HOH 584 1485 672 HOH HOH B . 
G 6 HOH 585 1486 673 HOH HOH B . 
G 6 HOH 586 1487 675 HOH HOH B . 
G 6 HOH 587 1488 676 HOH HOH B . 
G 6 HOH 588 1489 677 HOH HOH B . 
G 6 HOH 589 1490 678 HOH HOH B . 
G 6 HOH 590 1491 679 HOH HOH B . 
G 6 HOH 591 1492 680 HOH HOH B . 
G 6 HOH 592 1493 681 HOH HOH B . 
G 6 HOH 593 1494 682 HOH HOH B . 
G 6 HOH 594 1495 683 HOH HOH B . 
G 6 HOH 595 1496 684 HOH HOH B . 
G 6 HOH 596 1497 685 HOH HOH B . 
G 6 HOH 597 1498 686 HOH HOH B . 
G 6 HOH 598 1499 687 HOH HOH B . 
G 6 HOH 599 1500 688 HOH HOH B . 
G 6 HOH 600 1501 689 HOH HOH B . 
G 6 HOH 601 1502 690 HOH HOH B . 
G 6 HOH 602 1503 691 HOH HOH B . 
G 6 HOH 603 1504 692 HOH HOH B . 
G 6 HOH 604 1505 693 HOH HOH B . 
G 6 HOH 605 1506 695 HOH HOH B . 
G 6 HOH 606 1507 696 HOH HOH B . 
G 6 HOH 607 1508 697 HOH HOH B . 
G 6 HOH 608 1509 698 HOH HOH B . 
G 6 HOH 609 1510 699 HOH HOH B . 
G 6 HOH 610 1511 700 HOH HOH B . 
G 6 HOH 611 1512 701 HOH HOH B . 
G 6 HOH 612 1513 702 HOH HOH B . 
G 6 HOH 613 1514 703 HOH HOH B . 
G 6 HOH 614 1515 704 HOH HOH B . 
G 6 HOH 615 1516 705 HOH HOH B . 
G 6 HOH 616 1517 706 HOH HOH B . 
G 6 HOH 617 1518 707 HOH HOH B . 
G 6 HOH 618 1519 708 HOH HOH B . 
G 6 HOH 619 1520 709 HOH HOH B . 
G 6 HOH 620 1521 710 HOH HOH B . 
G 6 HOH 621 1522 712 HOH HOH B . 
G 6 HOH 622 1523 714 HOH HOH B . 
G 6 HOH 623 1524 715 HOH HOH B . 
G 6 HOH 624 1525 717 HOH HOH B . 
G 6 HOH 625 1526 719 HOH HOH B . 
G 6 HOH 626 1527 721 HOH HOH B . 
G 6 HOH 627 1528 722 HOH HOH B . 
G 6 HOH 628 1529 723 HOH HOH B . 
G 6 HOH 629 1530 724 HOH HOH B . 
G 6 HOH 630 1531 725 HOH HOH B . 
G 6 HOH 631 1532 727 HOH HOH B . 
G 6 HOH 632 1533 728 HOH HOH B . 
G 6 HOH 633 1534 730 HOH HOH B . 
G 6 HOH 634 1535 731 HOH HOH B . 
G 6 HOH 635 1536 732 HOH HOH B . 
G 6 HOH 636 1537 733 HOH HOH B . 
G 6 HOH 637 1538 734 HOH HOH B . 
G 6 HOH 638 1539 736 HOH HOH B . 
G 6 HOH 639 1540 737 HOH HOH B . 
G 6 HOH 640 1541 738 HOH HOH B . 
G 6 HOH 641 1542 739 HOH HOH B . 
G 6 HOH 642 1543 740 HOH HOH B . 
G 6 HOH 643 1544 741 HOH HOH B . 
G 6 HOH 644 1545 742 HOH HOH B . 
G 6 HOH 645 1546 743 HOH HOH B . 
G 6 HOH 646 1547 744 HOH HOH B . 
G 6 HOH 647 1548 746 HOH HOH B . 
G 6 HOH 648 1549 747 HOH HOH B . 
G 6 HOH 649 1550 750 HOH HOH B . 
G 6 HOH 650 1551 752 HOH HOH B . 
G 6 HOH 651 1552 753 HOH HOH B . 
G 6 HOH 652 1553 754 HOH HOH B . 
G 6 HOH 653 1554 755 HOH HOH B . 
G 6 HOH 654 1555 756 HOH HOH B . 
G 6 HOH 655 1556 757 HOH HOH B . 
G 6 HOH 656 1557 759 HOH HOH B . 
G 6 HOH 657 1558 760 HOH HOH B . 
G 6 HOH 658 1559 762 HOH HOH B . 
G 6 HOH 659 1560 763 HOH HOH B . 
G 6 HOH 660 1561 764 HOH HOH B . 
G 6 HOH 661 1562 765 HOH HOH B . 
G 6 HOH 662 1563 766 HOH HOH B . 
G 6 HOH 663 1564 767 HOH HOH B . 
G 6 HOH 664 1565 768 HOH HOH B . 
G 6 HOH 665 1566 769 HOH HOH B . 
G 6 HOH 666 1567 770 HOH HOH B . 
H 6 HOH 1   53   52  HOH HOH C . 
H 6 HOH 2   108  107 HOH HOH C . 
H 6 HOH 3   245  244 HOH HOH C . 
H 6 HOH 4   312  311 HOH HOH C . 
H 6 HOH 5   343  342 HOH HOH C . 
H 6 HOH 6   355  354 HOH HOH C . 
H 6 HOH 7   386  385 HOH HOH C . 
H 6 HOH 8   411  410 HOH HOH C . 
H 6 HOH 9   424  423 HOH HOH C . 
H 6 HOH 10  477  476 HOH HOH C . 
H 6 HOH 11  510  509 HOH HOH C . 
H 6 HOH 12  562  561 HOH HOH C . 
H 6 HOH 13  650  649 HOH HOH C . 
H 6 HOH 14  660  659 HOH HOH C . 
H 6 HOH 15  695  694 HOH HOH C . 
H 6 HOH 16  727  726 HOH HOH C . 
H 6 HOH 17  750  749 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric  3 
2 software_defined_assembly            PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H 
2 1,2 A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5880  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  29070 ? 
2 'ABSA (A^2)' 13330 ? 
2 MORE         -83   ? 
2 'SSA (A^2)'  56580 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 2_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 30.3589349995 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -121.3119444849 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1423 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   G 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-10-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp   
2 4 'Structure model' struct_site 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_chem_comp.pdbx_synonyms'       
2 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 
3 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 
4 4 'Structure model' '_struct_site.pdbx_auth_seq_id'  
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement        5.2.0005 ? 1 
HKL-2000 'data collection' .        ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
PHASER   phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B CYS 288  ? ? O B GLN 312  ? ? 1.93 
2 1 O   B HOH 1384 ? ? O B HOH 1565 ? ? 2.01 
3 1 O44 B IHP 801  ? ? O B HOH 1564 ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE A LYS 60 ? ? NZ  A LYS 60 ? ? 1.952 1.486 0.466 0.025 N 
2 1 CD A GLN 95 ? ? OE1 A GLN 95 ? ? 1.413 1.235 0.178 0.022 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CD A LYS 60  ? ? CE A LYS 60  ? ? NZ  A LYS 60  ? ? 91.32  111.70 -20.38 2.30 N 
2 1 NE B ARG 27  ? ? CZ B ARG 27  ? ? NH2 B ARG 27  ? ? 115.26 120.30 -5.04  0.50 N 
3 1 NE B ARG 111 ? ? CZ B ARG 111 ? ? NH1 B ARG 111 ? ? 116.33 120.30 -3.97  0.50 N 
4 1 CB B VAL 321 ? ? CA B VAL 321 ? ? C   B VAL 321 ? ? 99.50  111.40 -11.90 1.90 N 
5 1 CB B LEU 533 ? ? CG B LEU 533 ? ? CD1 B LEU 533 ? ? 121.28 111.00 10.28  1.70 N 
6 1 NE B ARG 541 ? ? CZ B ARG 541 ? ? NH2 B ARG 541 ? ? 116.32 120.30 -3.98  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR B 104 ? ? -96.44  56.79   
2 1 SER B 172 ? ? 174.89  136.45  
3 1 ASP B 275 ? ? 59.81   19.55   
4 1 CYS B 288 ? ? -95.64  36.23   
5 1 THR B 300 ? ? -97.26  40.98   
6 1 CYS B 313 ? ? -117.91 63.72   
7 1 GLU B 326 ? ? 63.78   171.69  
8 1 CYS B 337 ? ? -106.84 77.57   
9 1 CYS B 516 ? ? -101.84 -155.30 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A GLU 34  ? A GLU 34  
6  1 Y 1 A ASP 35  ? A ASP 35  
7  1 Y 1 A ASP 36  ? A ASP 36  
8  1 Y 1 A CYS 37  ? A CYS 37  
9  1 Y 1 A VAL 38  ? A VAL 38  
10 1 Y 1 A VAL 63  ? A VAL 63  
11 1 Y 1 A GLU 64  ? A GLU 64  
12 1 Y 1 A ALA 65  ? A ALA 65  
13 1 Y 1 A ALA 66  ? A ALA 66  
14 1 Y 1 A ALA 67  ? A ALA 67  
15 1 Y 1 A SER 68  ? A SER 68  
16 1 Y 1 A LYS 69  ? A LYS 69  
17 1 Y 1 A ALA 70  ? A ALA 70  
18 1 Y 1 A GLU 71  ? A GLU 71  
19 1 Y 1 A ALA 72  ? A ALA 72  
20 1 Y 1 A VAL 73  ? A VAL 73  
21 1 Y 1 A GLU 74  ? A GLU 74  
22 1 Y 1 A GLY 75  ? A GLY 75  
23 1 Y 1 A ALA 76  ? A ALA 76  
24 1 Y 1 A ALA 77  ? A ALA 77  
25 1 Y 1 A THR 78  ? A THR 78  
26 1 Y 1 A SER 79  ? A SER 79  
27 1 Y 1 A ASP 80  ? A ASP 80  
28 1 Y 1 A ASP 81  ? A ASP 81  
29 1 Y 1 A ASP 82  ? A ASP 82  
30 1 Y 1 A LEU 83  ? A LEU 83  
31 1 Y 1 A LYS 84  ? A LYS 84  
32 1 Y 1 A ALA 85  ? A ALA 85  
33 1 Y 1 A TRP 86  ? A TRP 86  
34 1 Y 1 A ASP 87  ? A ASP 87  
35 1 Y 1 A ALA 88  ? A ALA 88  
36 1 Y 1 A ASP 89  ? A ASP 89  
37 1 Y 1 B MET 1   ? B MET 1   
38 1 Y 1 B GLN 2   ? B GLN 2   
39 1 Y 1 B LYS 3   ? B LYS 3   
40 1 Y 1 B ARG 4   ? B ARG 4   
41 1 Y 1 B ILE 5   ? B ILE 5   
42 1 Y 1 B ALA 6   ? B ALA 6   
43 1 Y 1 B LEU 7   ? B LEU 7   
44 1 Y 1 B SER 8   ? B SER 8   
45 1 Y 1 B ASP 577 ? B ASP 577 
46 1 Y 1 B GLN 578 ? B GLN 578 
47 1 Y 1 B ASP 579 ? B ASP 579 
48 1 Y 1 B SER 580 ? B SER 580 
49 1 Y 1 B THR 581 ? B THR 581 
50 1 Y 1 B MET 582 ? B MET 582 
51 1 Y 1 B ARG 583 ? B ARG 583 
52 1 Y 1 B PHE 584 ? B PHE 584 
53 1 Y 1 B SER 585 ? B SER 585 
54 1 Y 1 B ARG 586 ? B ARG 586 
55 1 Y 1 B GLN 587 ? B GLN 587 
56 1 Y 1 B ILE 588 ? B ILE 588 
57 1 Y 1 B ILE 589 ? B ILE 589 
58 1 Y 1 B THR 590 ? B THR 590 
59 1 Y 1 B THR 591 ? B THR 591 
60 1 Y 1 B ASN 592 ? B ASN 592 
61 1 Y 1 B GLY 593 ? B GLY 593 
62 1 Y 1 B LEU 594 ? B LEU 594 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'INOSITOL HEXAKISPHOSPHATE' IHP 
5 '1H-INDOL-3-YLACETIC ACID'  IAC 
6 water                       HOH 
#