data_2P20
# 
_entry.id   2P20 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2P20         pdb_00002p20 10.2210/pdb2p20/pdb 
RCSB  RCSB041867   ?            ?                   
WWPDB D_1000041867 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P2B . unspecified 
PDB 2P2F . unspecified 
PDB 2P2J . unspecified 
PDB 2P2M . unspecified 
PDB 2P2Q . unspecified 
# 
_pdbx_database_status.entry_id                        2P20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-06 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reger, A.S.'  1 ? 
primary 'Carney, J.M.' 2 ? 
primary 'Gulick, A.M.' 3 ? 
# 
_cell.entry_id           2P20 
_cell.length_a           91.837 
_cell.length_b           95.408 
_cell.length_c           164.708 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P20 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase'            72150.359 2   6.2.1.1 R584A ? ? 
2 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
3 water       nat water                                     18.015    600 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVAKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVAKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ALA n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'according to Biochemistry, 41, 2379.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P20 A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P20 B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P20 ALA A 584 ? UNP Q8ZKF6 ARG 584 'engineered mutation' 584 1 
2 2P20 ALA B 584 ? UNP Q8ZKF6 ARG 584 'engineered mutation' 584 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'      115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P' 389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P20 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.50 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Propyl-AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-07-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97930 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97930 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
# 
_reflns.entry_id                     2P20 
_reflns.d_resolution_high            2.220 
_reflns.d_resolution_low             66.227 
_reflns.number_obs                   67992 
_reflns.pdbx_Rmerge_I_obs            0.062 
_reflns.pdbx_netI_over_sigmaI        8.400 
_reflns.pdbx_Rsym_value              0.062 
_reflns.pdbx_redundancy              4.600 
_reflns.percent_possible_obs         92.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        26.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.220 
_reflns_shell.d_res_low              2.32 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    19336 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.314 
_reflns_shell.meanI_over_sigI_obs    0.9 
_reflns_shell.pdbx_Rsym_value        0.314 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        3.00 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6481 
_reflns_shell.percent_possible_all   61.60 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P20 
_refine.ls_d_res_high                            2.220 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    93.010 
_refine.ls_number_reflns_obs                     66709 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.179 
_refine.ls_R_factor_R_work                       0.176 
_refine.ls_R_factor_R_free                       0.230 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3366 
_refine.B_iso_mean                               18.929 
_refine.aniso_B[1][1]                            -0.400 
_refine.aniso_B[2][2]                            -0.080 
_refine.aniso_B[3][3]                            0.490 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.905 
_refine.pdbx_overall_ESU_R                       0.287 
_refine.pdbx_overall_ESU_R_Free                  0.217 
_refine.overall_SU_ML                            0.147 
_refine.overall_SU_B                             11.100 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1PG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9887 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             600 
_refine_hist.number_atoms_total               10539 
_refine_hist.d_res_high                       2.220 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10224 0.011  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      13954 1.245  1.948  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1276  6.029  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   451   37.255 24.080 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1583  14.244 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   56    19.223 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1525  0.082  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7866  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4735  0.194  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6908  0.302  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    698   0.150  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   32    0.166  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 19    0.175  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6509  0.504  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10230 0.835  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4347  1.434  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3723  2.291  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.220 
_refine_ls_shell.d_res_low                        2.272 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               59.500 
_refine_ls_shell.number_reflns_R_work             2490 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.280 
_refine_ls_shell.R_factor_R_free                  0.367 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2624 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P20 
_struct.title                     'Acetyl-CoA Synthetase, R584A mutation' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P20 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? LEU A 127 ? TYR A 110 LEU A 127 1 ? 18 
HELX_P HELX_P8  8  VAL A 142 ? ILE A 155 ? VAL A 142 ILE A 155 1 ? 14 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 PRO A 197 ? LYS A 207 ? PRO A 197 LYS A 207 1 ? 11 
HELX_P HELX_P11 11 TRP A 237 ? ALA A 244 ? TRP A 237 ALA A 244 1 ? 8  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? TYR A 315 ? TRP A 309 TYR A 315 1 ? 7  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? ALA A 366 ? ALA A 357 ALA A 366 1 ? 10 
HELX_P HELX_P17 17 GLU A 367 ? ILE A 372 ? GLU A 367 ILE A 372 5 ? 6  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? ALA A 538 ? THR A 529 ALA A 538 1 ? 10 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? ALA A 620 ? MET A 611 ALA A 620 1 ? 10 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 PRO B 197 ? LYS B 207 ? PRO B 197 LYS B 207 1 ? 11 
HELX_P HELX_P36 36 TRP B 237 ? LYS B 243 ? TRP B 237 LYS B 243 1 ? 7  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? LEU B 316 ? TRP B 309 LEU B 316 1 ? 8  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? ALA B 538 ? THR B 529 ALA B 538 1 ? 10 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 GLY B 636 ? ILE B 648 ? GLY B 636 ILE B 648 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 5.92 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 4.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 5 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 5 ? 
M ? 2 ? 
N ? 3 ? 
O ? 4 ? 
P ? 2 ? 
Q ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PHE A 260 ? THR A 264 ? PHE A 260 THR A 264 
D 7 LYS A 272 ? HIS A 276 ? LYS A 272 HIS A 276 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLY A 189 ? ARG A 191 ? GLY A 189 ARG A 191 
E 2 ARG A 194 ? ILE A 196 ? ARG A 194 ILE A 196 
F 1 PRO A 455 ? GLN A 456 ? PRO A 455 GLN A 456 
F 2 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 3 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 4 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 5 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? VAL B 386 ? ILE B 382 VAL B 386 
K 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
L 1 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 2 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 5 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
M 1 GLY B 189 ? ARG B 191 ? GLY B 189 ARG B 191 
M 2 ARG B 194 ? ILE B 196 ? ARG B 194 ILE B 196 
N 1 PHE B 260 ? THR B 264 ? PHE B 260 THR B 264 
N 2 LYS B 272 ? HIS B 276 ? LYS B 272 HIS B 276 
N 3 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
O 1 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
O 2 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
O 3 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
O 4 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
P 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
P 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
Q 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
Q 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
Q 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 61  ? N ALA A 61  O ASN A 64  ? O ASN A 64  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O ILE A 108 ? O ILE A 108 N ILE A 95  ? N ILE A 95  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O THR A 326 ? O THR A 326 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O TYR A 355 ? O TYR A 355 
C 5 6 N THR A 356 ? N THR A 356 O GLY A 384 ? O GLY A 384 
C 6 7 N SER A 385 ? N SER A 385 O VAL A 410 ? O VAL A 410 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N THR A 185 ? N THR A 185 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 262 ? N LEU A 262 O VAL A 274 ? O VAL A 274 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N ARG A 191 ? N ARG A 191 O ARG A 194 ? O ARG A 194 
F 1 2 O GLN A 456 ? O GLN A 456 N LEU A 448 ? N LEU A 448 
F 2 3 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 3 4 N ILE A 466 ? N ILE A 466 O TYR A 496 ? O TYR A 496 
F 4 5 N ARG A 503 ? N ARG A 503 O TRP A 511 ? O TRP A 511 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N ALA A 546 ? N ALA A 546 O TYR A 562 ? O TYR A 562 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N ASN B 57  ? N ASN B 57  O LYS B 68  ? O LYS B 68  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O ILE B 108 ? O ILE B 108 N ILE B 95  ? N ILE B 95  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O LEU B 328 ? O LEU B 328 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
K 5 6 N LEU B 354 ? N LEU B 354 O ILE B 382 ? O ILE B 382 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O SER B 160 ? O SER B 160 N VAL B 135 ? N VAL B 135 
L 2 3 N TYR B 138 ? N TYR B 138 O ILE B 184 ? O ILE B 184 
L 3 4 N THR B 185 ? N THR B 185 O ILE B 218 ? O ILE B 218 
L 4 5 N VAL B 219 ? N VAL B 219 O LEU B 235 ? O LEU B 235 
M 1 2 N ARG B 191 ? N ARG B 191 O ARG B 194 ? O ARG B 194 
N 1 2 N LEU B 262 ? N LEU B 262 O VAL B 274 ? O VAL B 274 
N 2 3 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
O 1 2 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
O 2 3 N LEU B 464 ? N LEU B 464 O ASP B 500 ? O ASP B 500 
O 3 4 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
P 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
Q 1 2 N ALA B 546 ? N ALA B 546 O TYR B 562 ? O TYR B 562 
Q 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PRX 999 ? 17 'BINDING SITE FOR RESIDUE PRX A 999' 
AC2 Software B PRX 998 ? 18 'BINDING SITE FOR RESIDUE PRX B 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 THR A 311 ? THR A 311  . ? 1_555 ? 
2  AC1 17 GLY A 387 ? GLY A 387  . ? 1_555 ? 
3  AC1 17 GLU A 388 ? GLU A 388  . ? 1_555 ? 
4  AC1 17 PRO A 389 ? PRO A 389  . ? 1_555 ? 
5  AC1 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
6  AC1 17 THR A 412 ? THR A 412  . ? 1_555 ? 
7  AC1 17 TRP A 413 ? TRP A 413  . ? 1_555 ? 
8  AC1 17 TRP A 414 ? TRP A 414  . ? 1_555 ? 
9  AC1 17 GLN A 415 ? GLN A 415  . ? 1_555 ? 
10 AC1 17 THR A 416 ? THR A 416  . ? 1_555 ? 
11 AC1 17 ASP A 500 ? ASP A 500  . ? 1_555 ? 
12 AC1 17 ILE A 512 ? ILE A 512  . ? 1_555 ? 
13 AC1 17 ARG A 515 ? ARG A 515  . ? 1_555 ? 
14 AC1 17 ARG A 526 ? ARG A 526  . ? 1_555 ? 
15 AC1 17 HOH E .   ? HOH A 1307 . ? 1_555 ? 
16 AC1 17 HOH E .   ? HOH A 1311 . ? 1_555 ? 
17 AC1 17 HOH E .   ? HOH A 1329 . ? 1_555 ? 
18 AC2 18 VAL B 310 ? VAL B 310  . ? 1_555 ? 
19 AC2 18 THR B 311 ? THR B 311  . ? 1_555 ? 
20 AC2 18 GLY B 387 ? GLY B 387  . ? 1_555 ? 
21 AC2 18 GLU B 388 ? GLU B 388  . ? 1_555 ? 
22 AC2 18 PRO B 389 ? PRO B 389  . ? 1_555 ? 
23 AC2 18 ASP B 411 ? ASP B 411  . ? 1_555 ? 
24 AC2 18 THR B 412 ? THR B 412  . ? 1_555 ? 
25 AC2 18 TRP B 413 ? TRP B 413  . ? 1_555 ? 
26 AC2 18 TRP B 414 ? TRP B 414  . ? 1_555 ? 
27 AC2 18 GLN B 415 ? GLN B 415  . ? 1_555 ? 
28 AC2 18 THR B 416 ? THR B 416  . ? 1_555 ? 
29 AC2 18 ASP B 500 ? ASP B 500  . ? 1_555 ? 
30 AC2 18 ILE B 512 ? ILE B 512  . ? 1_555 ? 
31 AC2 18 ARG B 515 ? ARG B 515  . ? 1_555 ? 
32 AC2 18 ARG B 526 ? ARG B 526  . ? 1_555 ? 
33 AC2 18 HOH F .   ? HOH B 1051 . ? 1_555 ? 
34 AC2 18 HOH F .   ? HOH B 1214 . ? 1_555 ? 
35 AC2 18 HOH F .   ? HOH B 1238 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P20 
_atom_sites.fract_transf_matrix[1][1]   0.010889 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010481 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006071 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . HIS A 1 5   ? -24.583 17.540  8.830   1.00 32.97  ? 5    HIS A N     1 
ATOM   2     C CA    . HIS A 1 5   ? -23.658 16.484  8.311   1.00 32.88  ? 5    HIS A CA    1 
ATOM   3     C C     . HIS A 1 5   ? -22.311 17.022  7.805   1.00 31.52  ? 5    HIS A C     1 
ATOM   4     O O     . HIS A 1 5   ? -21.937 18.159  8.084   1.00 31.44  ? 5    HIS A O     1 
ATOM   5     C CB    . HIS A 1 5   ? -24.348 15.669  7.217   1.00 33.85  ? 5    HIS A CB    1 
ATOM   6     C CG    . HIS A 1 5   ? -25.134 14.507  7.731   1.00 36.91  ? 5    HIS A CG    1 
ATOM   7     N ND1   . HIS A 1 5   ? -26.489 14.369  7.510   1.00 40.75  ? 5    HIS A ND1   1 
ATOM   8     C CD2   . HIS A 1 5   ? -24.759 13.423  8.455   1.00 40.31  ? 5    HIS A CD2   1 
ATOM   9     C CE1   . HIS A 1 5   ? -26.916 13.251  8.076   1.00 41.26  ? 5    HIS A CE1   1 
ATOM   10    N NE2   . HIS A 1 5   ? -25.886 12.658  8.654   1.00 41.96  ? 5    HIS A NE2   1 
ATOM   11    N N     . LYS A 1 6   ? -21.607 16.193  7.044   1.00 29.90  ? 6    LYS A N     1 
ATOM   12    C CA    . LYS A 1 6   ? -20.216 16.435  6.668   1.00 28.83  ? 6    LYS A CA    1 
ATOM   13    C C     . LYS A 1 6   ? -20.043 17.362  5.452   1.00 27.44  ? 6    LYS A C     1 
ATOM   14    O O     . LYS A 1 6   ? -20.946 17.502  4.633   1.00 27.43  ? 6    LYS A O     1 
ATOM   15    C CB    . LYS A 1 6   ? -19.518 15.093  6.401   1.00 28.90  ? 6    LYS A CB    1 
ATOM   16    C CG    . LYS A 1 6   ? -19.473 14.132  7.606   1.00 29.86  ? 6    LYS A CG    1 
ATOM   17    C CD    . LYS A 1 6   ? -18.876 12.775  7.218   1.00 29.92  ? 6    LYS A CD    1 
ATOM   18    C CE    . LYS A 1 6   ? -18.235 12.046  8.417   1.00 31.94  ? 6    LYS A CE    1 
ATOM   19    N NZ    . LYS A 1 6   ? -17.414 10.822  8.048   1.00 30.94  ? 6    LYS A NZ    1 
ATOM   20    N N     . HIS A 1 7   ? -18.880 18.005  5.356   1.00 25.52  ? 7    HIS A N     1 
ATOM   21    C CA    . HIS A 1 7   ? -18.460 18.650  4.123   1.00 23.47  ? 7    HIS A CA    1 
ATOM   22    C C     . HIS A 1 7   ? -17.436 17.748  3.439   1.00 22.94  ? 7    HIS A C     1 
ATOM   23    O O     . HIS A 1 7   ? -16.378 17.457  4.002   1.00 22.75  ? 7    HIS A O     1 
ATOM   24    C CB    . HIS A 1 7   ? -17.870 20.042  4.384   1.00 23.32  ? 7    HIS A CB    1 
ATOM   25    C CG    . HIS A 1 7   ? -18.903 21.086  4.677   1.00 22.29  ? 7    HIS A CG    1 
ATOM   26    N ND1   . HIS A 1 7   ? -19.455 21.882  3.698   1.00 21.61  ? 7    HIS A ND1   1 
ATOM   27    C CD2   . HIS A 1 7   ? -19.507 21.442  5.835   1.00 21.91  ? 7    HIS A CD2   1 
ATOM   28    C CE1   . HIS A 1 7   ? -20.345 22.695  4.243   1.00 21.93  ? 7    HIS A CE1   1 
ATOM   29    N NE2   . HIS A 1 7   ? -20.389 22.454  5.541   1.00 22.96  ? 7    HIS A NE2   1 
ATOM   30    N N     . ALA A 1 8   ? -17.774 17.284  2.237   1.00 21.32  ? 8    ALA A N     1 
ATOM   31    C CA    . ALA A 1 8   ? -16.826 16.556  1.399   1.00 20.71  ? 8    ALA A CA    1 
ATOM   32    C C     . ALA A 1 8   ? -15.615 17.408  1.029   1.00 19.89  ? 8    ALA A C     1 
ATOM   33    O O     . ALA A 1 8   ? -15.696 18.637  0.955   1.00 19.52  ? 8    ALA A O     1 
ATOM   34    C CB    . ALA A 1 8   ? -17.519 16.034  0.115   1.00 20.05  ? 8    ALA A CB    1 
ATOM   35    N N     . ILE A 1 9   ? -14.504 16.718  0.793   1.00 19.43  ? 9    ILE A N     1 
ATOM   36    C CA    . ILE A 1 9   ? -13.273 17.301  0.293   1.00 18.72  ? 9    ILE A CA    1 
ATOM   37    C C     . ILE A 1 9   ? -13.481 17.695  -1.161  1.00 18.43  ? 9    ILE A C     1 
ATOM   38    O O     . ILE A 1 9   ? -13.834 16.852  -1.979  1.00 18.78  ? 9    ILE A O     1 
ATOM   39    C CB    . ILE A 1 9   ? -12.117 16.272  0.426   1.00 18.85  ? 9    ILE A CB    1 
ATOM   40    C CG1   . ILE A 1 9   ? -11.954 15.871  1.899   1.00 19.04  ? 9    ILE A CG1   1 
ATOM   41    C CG2   . ILE A 1 9   ? -10.807 16.830  -0.140  1.00 18.81  ? 9    ILE A CG2   1 
ATOM   42    C CD1   . ILE A 1 9   ? -11.229 14.570  2.130   1.00 19.95  ? 9    ILE A CD1   1 
ATOM   43    N N     . PRO A 1 10  ? -13.284 18.985  -1.494  1.00 18.20  ? 10   PRO A N     1 
ATOM   44    C CA    . PRO A 1 10  ? -13.510 19.390  -2.889  1.00 17.76  ? 10   PRO A CA    1 
ATOM   45    C C     . PRO A 1 10  ? -12.461 18.830  -3.846  1.00 17.51  ? 10   PRO A C     1 
ATOM   46    O O     . PRO A 1 10  ? -11.393 18.399  -3.405  1.00 17.68  ? 10   PRO A O     1 
ATOM   47    C CB    . PRO A 1 10  ? -13.420 20.918  -2.835  1.00 17.70  ? 10   PRO A CB    1 
ATOM   48    C CG    . PRO A 1 10  ? -12.568 21.218  -1.611  1.00 17.57  ? 10   PRO A CG    1 
ATOM   49    C CD    . PRO A 1 10  ? -12.848 20.110  -0.636  1.00 18.23  ? 10   PRO A CD    1 
ATOM   50    N N     . ALA A 1 11  ? -12.755 18.872  -5.147  1.00 17.22  ? 11   ALA A N     1 
ATOM   51    C CA    . ALA A 1 11  ? -11.864 18.309  -6.175  1.00 16.98  ? 11   ALA A CA    1 
ATOM   52    C C     . ALA A 1 11  ? -10.518 19.035  -6.310  1.00 16.53  ? 11   ALA A C     1 
ATOM   53    O O     . ALA A 1 11  ? -9.476  18.390  -6.488  1.00 16.68  ? 11   ALA A O     1 
ATOM   54    C CB    . ALA A 1 11  ? -12.569 18.222  -7.524  1.00 16.70  ? 11   ALA A CB    1 
ATOM   55    N N     . ASN A 1 12  ? -10.530 20.360  -6.215  1.00 16.09  ? 12   ASN A N     1 
ATOM   56    C CA    . ASN A 1 12  ? -9.289  21.111  -6.352  1.00 16.09  ? 12   ASN A CA    1 
ATOM   57    C C     . ASN A 1 12  ? -8.296  20.741  -5.254  1.00 16.55  ? 12   ASN A C     1 
ATOM   58    O O     . ASN A 1 12  ? -7.084  20.718  -5.497  1.00 16.88  ? 12   ASN A O     1 
ATOM   59    C CB    . ASN A 1 12  ? -9.538  22.622  -6.337  1.00 16.18  ? 12   ASN A CB    1 
ATOM   60    C CG    . ASN A 1 12  ? -10.038 23.118  -4.988  1.00 14.53  ? 12   ASN A CG    1 
ATOM   61    O OD1   . ASN A 1 12  ? -11.058 22.652  -4.485  1.00 13.62  ? 12   ASN A OD1   1 
ATOM   62    N ND2   . ASN A 1 12  ? -9.321  24.068  -4.398  1.00 14.09  ? 12   ASN A ND2   1 
ATOM   63    N N     . ILE A 1 13  ? -8.818  20.448  -4.056  1.00 16.21  ? 13   ILE A N     1 
ATOM   64    C CA    . ILE A 1 13  ? -7.985  20.119  -2.908  1.00 16.23  ? 13   ILE A CA    1 
ATOM   65    C C     . ILE A 1 13  ? -7.486  18.676  -3.008  1.00 15.96  ? 13   ILE A C     1 
ATOM   66    O O     . ILE A 1 13  ? -6.302  18.422  -2.812  1.00 16.21  ? 13   ILE A O     1 
ATOM   67    C CB    . ILE A 1 13  ? -8.715  20.400  -1.550  1.00 16.39  ? 13   ILE A CB    1 
ATOM   68    C CG1   . ILE A 1 13  ? -9.100  21.891  -1.430  1.00 16.15  ? 13   ILE A CG1   1 
ATOM   69    C CG2   . ILE A 1 13  ? -7.840  20.000  -0.341  1.00 16.61  ? 13   ILE A CG2   1 
ATOM   70    C CD1   . ILE A 1 13  ? -7.902  22.888  -1.433  1.00 14.98  ? 13   ILE A CD1   1 
ATOM   71    N N     . ALA A 1 14  ? -8.380  17.743  -3.325  1.00 15.70  ? 14   ALA A N     1 
ATOM   72    C CA    . ALA A 1 14  ? -7.983  16.349  -3.587  1.00 15.87  ? 14   ALA A CA    1 
ATOM   73    C C     . ALA A 1 14  ? -6.843  16.234  -4.614  1.00 16.17  ? 14   ALA A C     1 
ATOM   74    O O     . ALA A 1 14  ? -5.963  15.394  -4.459  1.00 16.32  ? 14   ALA A O     1 
ATOM   75    C CB    . ALA A 1 14  ? -9.189  15.489  -4.006  1.00 14.65  ? 14   ALA A CB    1 
ATOM   76    N N     . ASP A 1 15  ? -6.857  17.082  -5.641  1.00 17.09  ? 15   ASP A N     1 
ATOM   77    C CA    . ASP A 1 15  ? -5.848  17.042  -6.713  1.00 18.19  ? 15   ASP A CA    1 
ATOM   78    C C     . ASP A 1 15  ? -4.470  17.576  -6.321  1.00 18.45  ? 15   ASP A C     1 
ATOM   79    O O     . ASP A 1 15  ? -3.476  17.261  -6.975  1.00 19.22  ? 15   ASP A O     1 
ATOM   80    C CB    . ASP A 1 15  ? -6.342  17.798  -7.949  1.00 18.49  ? 15   ASP A CB    1 
ATOM   81    C CG    . ASP A 1 15  ? -7.572  17.156  -8.581  1.00 20.48  ? 15   ASP A CG    1 
ATOM   82    O OD1   . ASP A 1 15  ? -7.915  16.008  -8.224  1.00 22.17  ? 15   ASP A OD1   1 
ATOM   83    O OD2   . ASP A 1 15  ? -8.208  17.810  -9.432  1.00 22.67  ? 15   ASP A OD2   1 
ATOM   84    N N     . ARG A 1 16  ? -4.407  18.389  -5.273  1.00 18.37  ? 16   ARG A N     1 
ATOM   85    C CA    . ARG A 1 16  ? -3.142  18.998  -4.878  1.00 18.39  ? 16   ARG A CA    1 
ATOM   86    C C     . ARG A 1 16  ? -2.638  18.562  -3.518  1.00 17.83  ? 16   ARG A C     1 
ATOM   87    O O     . ARG A 1 16  ? -1.467  18.785  -3.215  1.00 17.51  ? 16   ARG A O     1 
ATOM   88    C CB    . ARG A 1 16  ? -3.231  20.523  -4.930  1.00 18.55  ? 16   ARG A CB    1 
ATOM   89    C CG    . ARG A 1 16  ? -4.145  21.134  -3.886  1.00 21.48  ? 16   ARG A CG    1 
ATOM   90    C CD    . ARG A 1 16  ? -4.400  22.603  -4.190  1.00 25.32  ? 16   ARG A CD    1 
ATOM   91    N NE    . ARG A 1 16  ? -3.354  23.476  -3.670  1.00 26.33  ? 16   ARG A NE    1 
ATOM   92    C CZ    . ARG A 1 16  ? -2.474  24.150  -4.413  1.00 29.49  ? 16   ARG A CZ    1 
ATOM   93    N NH1   . ARG A 1 16  ? -2.485  24.057  -5.743  1.00 29.85  ? 16   ARG A NH1   1 
ATOM   94    N NH2   . ARG A 1 16  ? -1.574  24.930  -3.810  1.00 29.65  ? 16   ARG A NH2   1 
ATOM   95    N N     . CYS A 1 17  ? -3.504  17.917  -2.725  1.00 17.22  ? 17   CYS A N     1 
ATOM   96    C CA    . CYS A 1 17  ? -3.241  17.736  -1.296  1.00 16.76  ? 17   CYS A CA    1 
ATOM   97    C C     . CYS A 1 17  ? -2.016  16.906  -0.989  1.00 16.60  ? 17   CYS A C     1 
ATOM   98    O O     . CYS A 1 17  ? -1.725  15.919  -1.670  1.00 16.62  ? 17   CYS A O     1 
ATOM   99    C CB    . CYS A 1 17  ? -4.463  17.197  -0.536  1.00 16.88  ? 17   CYS A CB    1 
ATOM   100   S SG    . CYS A 1 17  ? -4.937  15.526  -0.947  1.00 16.27  ? 17   CYS A SG    1 
ATOM   101   N N     . LEU A 1 18  ? -1.313  17.314  0.061   1.00 15.98  ? 18   LEU A N     1 
ATOM   102   C CA    . LEU A 1 18  ? -0.118  16.619  0.473   1.00 15.46  ? 18   LEU A CA    1 
ATOM   103   C C     . LEU A 1 18  ? -0.453  15.341  1.210   1.00 15.34  ? 18   LEU A C     1 
ATOM   104   O O     . LEU A 1 18  ? 0.204   14.319  0.998   1.00 15.50  ? 18   LEU A O     1 
ATOM   105   C CB    . LEU A 1 18  ? 0.800   17.523  1.293   1.00 14.74  ? 18   LEU A CB    1 
ATOM   106   C CG    . LEU A 1 18  ? 1.296   18.794  0.592   1.00 14.93  ? 18   LEU A CG    1 
ATOM   107   C CD1   . LEU A 1 18  ? 2.037   19.677  1.590   1.00 12.83  ? 18   LEU A CD1   1 
ATOM   108   C CD2   . LEU A 1 18  ? 2.172   18.473  -0.630  1.00 13.72  ? 18   LEU A CD2   1 
ATOM   109   N N     . ILE A 1 19  ? -1.477  15.398  2.054   1.00 15.16  ? 19   ILE A N     1 
ATOM   110   C CA    . ILE A 1 19  ? -1.962  14.220  2.769   1.00 15.35  ? 19   ILE A CA    1 
ATOM   111   C C     . ILE A 1 19  ? -3.393  13.927  2.337   1.00 15.43  ? 19   ILE A C     1 
ATOM   112   O O     . ILE A 1 19  ? -4.278  14.780  2.505   1.00 15.37  ? 19   ILE A O     1 
ATOM   113   C CB    . ILE A 1 19  ? -1.968  14.409  4.322   1.00 15.69  ? 19   ILE A CB    1 
ATOM   114   C CG1   . ILE A 1 19  ? -0.631  14.953  4.866   1.00 14.52  ? 19   ILE A CG1   1 
ATOM   115   C CG2   . ILE A 1 19  ? -2.373  13.103  5.012   1.00 15.57  ? 19   ILE A CG2   1 
ATOM   116   C CD1   . ILE A 1 19  ? 0.600   14.087  4.555   1.00 15.21  ? 19   ILE A CD1   1 
ATOM   117   N N     . ASN A 1 20  ? -3.622  12.732  1.792   1.00 15.18  ? 20   ASN A N     1 
ATOM   118   C CA    . ASN A 1 20  ? -4.975  12.282  1.488   1.00 15.15  ? 20   ASN A CA    1 
ATOM   119   C C     . ASN A 1 20  ? -5.574  11.445  2.651   1.00 15.20  ? 20   ASN A C     1 
ATOM   120   O O     . ASN A 1 20  ? -4.927  11.312  3.700   1.00 14.28  ? 20   ASN A O     1 
ATOM   121   C CB    . ASN A 1 20  ? -5.044  11.607  0.100   1.00 15.69  ? 20   ASN A CB    1 
ATOM   122   C CG    . ASN A 1 20  ? -4.236  10.306  -0.005  1.00 16.22  ? 20   ASN A CG    1 
ATOM   123   O OD1   . ASN A 1 20  ? -4.066  9.565   0.961   1.00 16.50  ? 20   ASN A OD1   1 
ATOM   124   N ND2   . ASN A 1 20  ? -3.753  10.021  -1.219  1.00 17.51  ? 20   ASN A ND2   1 
ATOM   125   N N     . PRO A 1 21  ? -6.819  10.924  2.504   1.00 15.21  ? 21   PRO A N     1 
ATOM   126   C CA    . PRO A 1 21  ? -7.389  10.184  3.653   1.00 15.37  ? 21   PRO A CA    1 
ATOM   127   C C     . PRO A 1 21  ? -6.530  9.006   4.060   1.00 15.79  ? 21   PRO A C     1 
ATOM   128   O O     . PRO A 1 21  ? -6.285  8.785   5.248   1.00 15.59  ? 21   PRO A O     1 
ATOM   129   C CB    . PRO A 1 21  ? -8.755  9.703   3.130   1.00 15.63  ? 21   PRO A CB    1 
ATOM   130   C CG    . PRO A 1 21  ? -9.117  10.732  2.060   1.00 15.20  ? 21   PRO A CG    1 
ATOM   131   C CD    . PRO A 1 21  ? -7.779  11.012  1.382   1.00 14.70  ? 21   PRO A CD    1 
ATOM   132   N N     . GLU A 1 22  ? -6.022  8.304   3.057   1.00 16.12  ? 22   GLU A N     1 
ATOM   133   C CA    . GLU A 1 22  ? -5.267  7.078   3.252   1.00 16.89  ? 22   GLU A CA    1 
ATOM   134   C C     . GLU A 1 22  ? -3.891  7.337   3.867   1.00 16.39  ? 22   GLU A C     1 
ATOM   135   O O     . GLU A 1 22  ? -3.446  6.604   4.760   1.00 16.29  ? 22   GLU A O     1 
ATOM   136   C CB    . GLU A 1 22  ? -5.180  6.323   1.920   1.00 17.37  ? 22   GLU A CB    1 
ATOM   137   C CG    . GLU A 1 22  ? -6.550  5.733   1.427   1.00 21.06  ? 22   GLU A CG    1 
ATOM   138   C CD    . GLU A 1 22  ? -7.596  6.780   0.902   1.00 24.89  ? 22   GLU A CD    1 
ATOM   139   O OE1   . GLU A 1 22  ? -8.823  6.563   1.150   1.00 24.60  ? 22   GLU A OE1   1 
ATOM   140   O OE2   . GLU A 1 22  ? -7.203  7.792   0.236   1.00 23.61  ? 22   GLU A OE2   1 
ATOM   141   N N     . GLN A 1 23  ? -3.230  8.395   3.410   1.00 16.26  ? 23   GLN A N     1 
ATOM   142   C CA    . GLN A 1 23  ? -1.954  8.823   3.999   1.00 16.44  ? 23   GLN A CA    1 
ATOM   143   C C     . GLN A 1 23  ? -2.108  9.320   5.438   1.00 16.29  ? 23   GLN A C     1 
ATOM   144   O O     . GLN A 1 23  ? -1.182  9.185   6.245   1.00 15.58  ? 23   GLN A O     1 
ATOM   145   C CB    . GLN A 1 23  ? -1.299  9.908   3.128   1.00 16.21  ? 23   GLN A CB    1 
ATOM   146   C CG    . GLN A 1 23  ? -0.927  9.420   1.719   1.00 17.17  ? 23   GLN A CG    1 
ATOM   147   C CD    . GLN A 1 23  ? -0.585  10.552  0.773   1.00 17.69  ? 23   GLN A CD    1 
ATOM   148   O OE1   . GLN A 1 23  ? -1.339  11.515  0.633   1.00 17.67  ? 23   GLN A OE1   1 
ATOM   149   N NE2   . GLN A 1 23  ? 0.555   10.433  0.103   1.00 20.45  ? 23   GLN A NE2   1 
ATOM   150   N N     . TYR A 1 24  ? -3.266  9.909   5.754   1.00 15.99  ? 24   TYR A N     1 
ATOM   151   C CA    . TYR A 1 24  ? -3.507  10.355  7.116   1.00 16.43  ? 24   TYR A CA    1 
ATOM   152   C C     . TYR A 1 24  ? -3.579  9.119   8.013   1.00 16.72  ? 24   TYR A C     1 
ATOM   153   O O     . TYR A 1 24  ? -2.956  9.087   9.087   1.00 16.80  ? 24   TYR A O     1 
ATOM   154   C CB    . TYR A 1 24  ? -4.801  11.182  7.269   1.00 15.77  ? 24   TYR A CB    1 
ATOM   155   C CG    . TYR A 1 24  ? -5.166  11.295  8.733   1.00 15.84  ? 24   TYR A CG    1 
ATOM   156   C CD1   . TYR A 1 24  ? -4.584  12.274  9.534   1.00 14.70  ? 24   TYR A CD1   1 
ATOM   157   C CD2   . TYR A 1 24  ? -6.026  10.379  9.336   1.00 15.71  ? 24   TYR A CD2   1 
ATOM   158   C CE1   . TYR A 1 24  ? -4.871  12.358  10.888  1.00 17.42  ? 24   TYR A CE1   1 
ATOM   159   C CE2   . TYR A 1 24  ? -6.320  10.457  10.703  1.00 16.53  ? 24   TYR A CE2   1 
ATOM   160   C CZ    . TYR A 1 24  ? -5.735  11.452  11.469  1.00 15.84  ? 24   TYR A CZ    1 
ATOM   161   O OH    . TYR A 1 24  ? -5.997  11.563  12.810  1.00 15.37  ? 24   TYR A OH    1 
ATOM   162   N N     . GLU A 1 25  ? -4.348  8.125   7.569   1.00 16.68  ? 25   GLU A N     1 
ATOM   163   C CA    . GLU A 1 25  ? -4.515  6.870   8.305   1.00 17.74  ? 25   GLU A CA    1 
ATOM   164   C C     . GLU A 1 25  ? -3.181  6.160   8.515   1.00 16.96  ? 25   GLU A C     1 
ATOM   165   O O     . GLU A 1 25  ? -2.859  5.771   9.626   1.00 16.59  ? 25   GLU A O     1 
ATOM   166   C CB    . GLU A 1 25  ? -5.497  5.920   7.586   1.00 17.98  ? 25   GLU A CB    1 
ATOM   167   C CG    . GLU A 1 25  ? -6.971  6.373   7.562   1.00 21.49  ? 25   GLU A CG    1 
ATOM   168   C CD    . GLU A 1 25  ? -7.558  6.669   8.953   1.00 24.78  ? 25   GLU A CD    1 
ATOM   169   O OE1   . GLU A 1 25  ? -7.159  6.013   9.947   1.00 25.74  ? 25   GLU A OE1   1 
ATOM   170   O OE2   . GLU A 1 25  ? -8.433  7.563   9.050   1.00 26.45  ? 25   GLU A OE2   1 
ATOM   171   N N     . THR A 1 26  ? -2.425  6.007   7.431   1.00 17.01  ? 26   THR A N     1 
ATOM   172   C CA    . THR A 1 26  ? -1.121  5.362   7.466   1.00 16.95  ? 26   THR A CA    1 
ATOM   173   C C     . THR A 1 26  ? -0.148  6.125   8.368   1.00 16.89  ? 26   THR A C     1 
ATOM   174   O O     . THR A 1 26  ? 0.430   5.538   9.277   1.00 16.48  ? 26   THR A O     1 
ATOM   175   C CB    . THR A 1 26  ? -0.516  5.197   6.055   1.00 16.97  ? 26   THR A CB    1 
ATOM   176   O OG1   . THR A 1 26  ? -1.453  4.538   5.186   1.00 17.13  ? 26   THR A OG1   1 
ATOM   177   C CG2   . THR A 1 26  ? 0.775   4.383   6.110   1.00 17.77  ? 26   THR A CG2   1 
ATOM   178   N N     . LYS A 1 27  ? 0.040   7.420   8.123   1.00 16.88  ? 27   LYS A N     1 
ATOM   179   C CA    . LYS A 1 27  ? 0.963   8.203   8.956   1.00 17.58  ? 27   LYS A CA    1 
ATOM   180   C C     . LYS A 1 27  ? 0.528   8.238   10.423  1.00 17.35  ? 27   LYS A C     1 
ATOM   181   O O     . LYS A 1 27  ? 1.375   8.159   11.322  1.00 17.38  ? 27   LYS A O     1 
ATOM   182   C CB    . LYS A 1 27  ? 1.162   9.634   8.427   1.00 17.46  ? 27   LYS A CB    1 
ATOM   183   C CG    . LYS A 1 27  ? 1.917   9.748   7.097   1.00 18.47  ? 27   LYS A CG    1 
ATOM   184   C CD    . LYS A 1 27  ? 2.099   11.224  6.695   1.00 18.59  ? 27   LYS A CD    1 
ATOM   185   C CE    . LYS A 1 27  ? 3.101   11.383  5.550   1.00 20.58  ? 27   LYS A CE    1 
ATOM   186   N NZ    . LYS A 1 27  ? 4.457   10.861  5.905   1.00 20.42  ? 27   LYS A NZ    1 
ATOM   187   N N     . TYR A 1 28  ? -0.779  8.358   10.670  1.00 17.31  ? 28   TYR A N     1 
ATOM   188   C CA    . TYR A 1 28  ? -1.255  8.470   12.053  1.00 17.39  ? 28   TYR A CA    1 
ATOM   189   C C     . TYR A 1 28  ? -0.905  7.204   12.835  1.00 17.46  ? 28   TYR A C     1 
ATOM   190   O O     . TYR A 1 28  ? -0.430  7.287   13.975  1.00 17.38  ? 28   TYR A O     1 
ATOM   191   C CB    . TYR A 1 28  ? -2.762  8.746   12.177  1.00 17.28  ? 28   TYR A CB    1 
ATOM   192   C CG    . TYR A 1 28  ? -3.152  8.858   13.639  1.00 17.70  ? 28   TYR A CG    1 
ATOM   193   C CD1   . TYR A 1 28  ? -2.935  10.048  14.345  1.00 16.94  ? 28   TYR A CD1   1 
ATOM   194   C CD2   . TYR A 1 28  ? -3.644  7.750   14.344  1.00 18.04  ? 28   TYR A CD2   1 
ATOM   195   C CE1   . TYR A 1 28  ? -3.240  10.149  15.695  1.00 17.62  ? 28   TYR A CE1   1 
ATOM   196   C CE2   . TYR A 1 28  ? -3.954  7.843   15.701  1.00 18.18  ? 28   TYR A CE2   1 
ATOM   197   C CZ    . TYR A 1 28  ? -3.753  9.052   16.366  1.00 18.12  ? 28   TYR A CZ    1 
ATOM   198   O OH    . TYR A 1 28  ? -4.045  9.169   17.706  1.00 18.02  ? 28   TYR A OH    1 
ATOM   199   N N     . LYS A 1 29  ? -1.149  6.053   12.209  1.00 16.72  ? 29   LYS A N     1 
ATOM   200   C CA    . LYS A 1 29  ? -0.857  4.764   12.795  1.00 17.08  ? 29   LYS A CA    1 
ATOM   201   C C     . LYS A 1 29  ? 0.617   4.614   13.141  1.00 16.84  ? 29   LYS A C     1 
ATOM   202   O O     . LYS A 1 29  ? 0.946   4.170   14.237  1.00 16.62  ? 29   LYS A O     1 
ATOM   203   C CB    . LYS A 1 29  ? -1.277  3.628   11.850  1.00 17.42  ? 29   LYS A CB    1 
ATOM   204   C CG    . LYS A 1 29  ? -2.719  3.174   11.974  1.00 18.37  ? 29   LYS A CG    1 
ATOM   205   C CD    . LYS A 1 29  ? -2.901  1.830   11.257  1.00 20.31  ? 29   LYS A CD    1 
ATOM   206   N N     . GLN A 1 30  ? 1.495   4.968   12.206  1.00 16.91  ? 30   GLN A N     1 
ATOM   207   C CA    . GLN A 1 30  ? 2.930   4.837   12.429  1.00 17.60  ? 30   GLN A CA    1 
ATOM   208   C C     . GLN A 1 30  ? 3.439   5.792   13.507  1.00 17.97  ? 30   GLN A C     1 
ATOM   209   O O     . GLN A 1 30  ? 4.219   5.384   14.388  1.00 18.05  ? 30   GLN A O     1 
ATOM   210   C CB    . GLN A 1 30  ? 3.718   5.014   11.134  1.00 17.81  ? 30   GLN A CB    1 
ATOM   211   C CG    . GLN A 1 30  ? 5.166   4.523   11.251  1.00 17.92  ? 30   GLN A CG    1 
ATOM   212   C CD    . GLN A 1 30  ? 6.052   4.987   10.114  1.00 19.32  ? 30   GLN A CD    1 
ATOM   213   O OE1   . GLN A 1 30  ? 5.839   6.064   9.521   1.00 19.10  ? 30   GLN A OE1   1 
ATOM   214   N NE2   . GLN A 1 30  ? 7.051   4.176   9.792   1.00 17.17  ? 30   GLN A NE2   1 
ATOM   215   N N     . SER A 1 31  ? 2.986   7.049   13.449  1.00 18.02  ? 31   SER A N     1 
ATOM   216   C CA    . SER A 1 31  ? 3.293   8.040   14.487  1.00 17.98  ? 31   SER A CA    1 
ATOM   217   C C     . SER A 1 31  ? 3.006   7.490   15.885  1.00 18.45  ? 31   SER A C     1 
ATOM   218   O O     . SER A 1 31  ? 3.672   7.848   16.842  1.00 18.55  ? 31   SER A O     1 
ATOM   219   C CB    . SER A 1 31  ? 2.488   9.334   14.265  1.00 17.86  ? 31   SER A CB    1 
ATOM   220   O OG    . SER A 1 31  ? 1.130   9.167   14.626  1.00 15.77  ? 31   SER A OG    1 
ATOM   221   N N     . ILE A 1 32  ? 2.008   6.616   15.978  1.00 19.22  ? 32   ILE A N     1 
ATOM   222   C CA    . ILE A 1 32  ? 1.563   6.048   17.247  1.00 20.20  ? 32   ILE A CA    1 
ATOM   223   C C     . ILE A 1 32  ? 2.262   4.728   17.583  1.00 20.21  ? 32   ILE A C     1 
ATOM   224   O O     . ILE A 1 32  ? 2.636   4.506   18.737  1.00 20.32  ? 32   ILE A O     1 
ATOM   225   C CB    . ILE A 1 32  ? 0.009   5.903   17.283  1.00 20.35  ? 32   ILE A CB    1 
ATOM   226   C CG1   . ILE A 1 32  ? -0.662  7.280   17.224  1.00 20.29  ? 32   ILE A CG1   1 
ATOM   227   C CG2   . ILE A 1 32  ? -0.462  5.124   18.516  1.00 22.28  ? 32   ILE A CG2   1 
ATOM   228   C CD1   . ILE A 1 32  ? -0.018  8.361   18.108  1.00 21.71  ? 32   ILE A CD1   1 
ATOM   229   N N     . ASN A 1 33  ? 2.452   3.870   16.576  1.00 20.77  ? 33   ASN A N     1 
ATOM   230   C CA    . ASN A 1 33  ? 3.070   2.551   16.770  1.00 21.12  ? 33   ASN A CA    1 
ATOM   231   C C     . ASN A 1 33  ? 4.583   2.630   16.874  1.00 20.88  ? 33   ASN A C     1 
ATOM   232   O O     . ASN A 1 33  ? 5.210   1.837   17.567  1.00 20.41  ? 33   ASN A O     1 
ATOM   233   C CB    . ASN A 1 33  ? 2.718   1.604   15.620  1.00 21.61  ? 33   ASN A CB    1 
ATOM   234   C CG    . ASN A 1 33  ? 1.263   1.217   15.610  1.00 23.99  ? 33   ASN A CG    1 
ATOM   235   O OD1   . ASN A 1 33  ? 0.602   1.210   16.654  1.00 27.21  ? 33   ASN A OD1   1 
ATOM   236   N ND2   . ASN A 1 33  ? 0.744   0.888   14.425  1.00 25.91  ? 33   ASN A ND2   1 
ATOM   237   N N     . ASP A 1 34  ? 5.163   3.585   16.155  1.00 20.45  ? 34   ASP A N     1 
ATOM   238   C CA    . ASP A 1 34  ? 6.597   3.668   16.046  1.00 20.16  ? 34   ASP A CA    1 
ATOM   239   C C     . ASP A 1 34  ? 7.007   5.131   15.972  1.00 19.74  ? 34   ASP A C     1 
ATOM   240   O O     . ASP A 1 34  ? 7.364   5.615   14.899  1.00 19.97  ? 34   ASP A O     1 
ATOM   241   C CB    . ASP A 1 34  ? 7.061   2.867   14.821  1.00 20.37  ? 34   ASP A CB    1 
ATOM   242   C CG    . ASP A 1 34  ? 8.569   2.712   14.748  1.00 21.06  ? 34   ASP A CG    1 
ATOM   243   O OD1   . ASP A 1 34  ? 9.296   3.257   15.614  1.00 21.31  ? 34   ASP A OD1   1 
ATOM   244   O OD2   . ASP A 1 34  ? 9.033   2.036   13.803  1.00 21.49  ? 34   ASP A OD2   1 
ATOM   245   N N     . PRO A 1 35  ? 6.957   5.842   17.120  1.00 19.30  ? 35   PRO A N     1 
ATOM   246   C CA    . PRO A 1 35  ? 7.314   7.263   17.173  1.00 18.81  ? 35   PRO A CA    1 
ATOM   247   C C     . PRO A 1 35  ? 8.696   7.531   16.621  1.00 18.41  ? 35   PRO A C     1 
ATOM   248   O O     . PRO A 1 35  ? 8.899   8.507   15.904  1.00 18.27  ? 35   PRO A O     1 
ATOM   249   C CB    . PRO A 1 35  ? 7.314   7.571   18.667  1.00 18.95  ? 35   PRO A CB    1 
ATOM   250   C CG    . PRO A 1 35  ? 6.413   6.548   19.285  1.00 18.95  ? 35   PRO A CG    1 
ATOM   251   C CD    . PRO A 1 35  ? 6.557   5.322   18.447  1.00 19.39  ? 35   PRO A CD    1 
ATOM   252   N N     . ASP A 1 36  ? 9.635   6.657   16.950  1.00 18.64  ? 36   ASP A N     1 
ATOM   253   C CA    . ASP A 1 36  ? 11.042  6.861   16.620  1.00 18.87  ? 36   ASP A CA    1 
ATOM   254   C C     . ASP A 1 36  ? 11.321  6.841   15.125  1.00 18.14  ? 36   ASP A C     1 
ATOM   255   O O     . ASP A 1 36  ? 12.017  7.716   14.625  1.00 18.25  ? 36   ASP A O     1 
ATOM   256   C CB    . ASP A 1 36  ? 11.935  5.890   17.409  1.00 19.43  ? 36   ASP A CB    1 
ATOM   257   C CG    . ASP A 1 36  ? 12.040  6.282   18.892  1.00 21.45  ? 36   ASP A CG    1 
ATOM   258   O OD1   . ASP A 1 36  ? 12.332  5.422   19.749  1.00 24.48  ? 36   ASP A OD1   1 
ATOM   259   O OD2   . ASP A 1 36  ? 11.823  7.468   19.209  1.00 23.78  ? 36   ASP A OD2   1 
ATOM   260   N N     . THR A 1 37  ? 10.748  5.872   14.414  1.00 17.61  ? 37   THR A N     1 
ATOM   261   C CA    . THR A 1 37  ? 10.818  5.846   12.942  1.00 16.83  ? 37   THR A CA    1 
ATOM   262   C C     . THR A 1 37  ? 10.029  7.017   12.335  1.00 16.46  ? 37   THR A C     1 
ATOM   263   O O     . THR A 1 37  ? 10.511  7.689   11.414  1.00 16.33  ? 37   THR A O     1 
ATOM   264   C CB    . THR A 1 37  ? 10.289  4.520   12.368  1.00 16.52  ? 37   THR A CB    1 
ATOM   265   O OG1   . THR A 1 37  ? 10.974  3.431   12.987  1.00 16.28  ? 37   THR A OG1   1 
ATOM   266   C CG2   . THR A 1 37  ? 10.515  4.441   10.862  1.00 17.13  ? 37   THR A CG2   1 
ATOM   267   N N     . PHE A 1 38  ? 8.823   7.264   12.846  1.00 15.48  ? 38   PHE A N     1 
ATOM   268   C CA    . PHE A 1 38  ? 8.002   8.317   12.269  1.00 15.32  ? 38   PHE A CA    1 
ATOM   269   C C     . PHE A 1 38  ? 8.665   9.696   12.412  1.00 15.15  ? 38   PHE A C     1 
ATOM   270   O O     . PHE A 1 38  ? 8.943   10.377  11.418  1.00 15.21  ? 38   PHE A O     1 
ATOM   271   C CB    . PHE A 1 38  ? 6.578   8.346   12.839  1.00 14.91  ? 38   PHE A CB    1 
ATOM   272   C CG    . PHE A 1 38  ? 5.720   9.403   12.199  1.00 14.71  ? 38   PHE A CG    1 
ATOM   273   C CD1   . PHE A 1 38  ? 5.118   9.167   10.955  1.00 14.06  ? 38   PHE A CD1   1 
ATOM   274   C CD2   . PHE A 1 38  ? 5.576   10.658  12.794  1.00 15.79  ? 38   PHE A CD2   1 
ATOM   275   C CE1   . PHE A 1 38  ? 4.358   10.156  10.322  1.00 14.90  ? 38   PHE A CE1   1 
ATOM   276   C CE2   . PHE A 1 38  ? 4.818   11.668  12.172  1.00 15.78  ? 38   PHE A CE2   1 
ATOM   277   C CZ    . PHE A 1 38  ? 4.201   11.413  10.931  1.00 14.80  ? 38   PHE A CZ    1 
ATOM   278   N N     . TRP A 1 39  ? 8.901   10.103  13.655  1.00 14.93  ? 39   TRP A N     1 
ATOM   279   C CA    . TRP A 1 39  ? 9.511   11.396  13.928  1.00 15.15  ? 39   TRP A CA    1 
ATOM   280   C C     . TRP A 1 39  ? 10.992  11.473  13.542  1.00 15.63  ? 39   TRP A C     1 
ATOM   281   O O     . TRP A 1 39  ? 11.487  12.560  13.257  1.00 15.83  ? 39   TRP A O     1 
ATOM   282   C CB    . TRP A 1 39  ? 9.273   11.800  15.375  1.00 14.45  ? 39   TRP A CB    1 
ATOM   283   C CG    . TRP A 1 39  ? 7.820   12.107  15.640  1.00 14.83  ? 39   TRP A CG    1 
ATOM   284   C CD1   . TRP A 1 39  ? 6.944   11.390  16.432  1.00 14.34  ? 39   TRP A CD1   1 
ATOM   285   C CD2   . TRP A 1 39  ? 7.061   13.205  15.098  1.00 13.59  ? 39   TRP A CD2   1 
ATOM   286   N NE1   . TRP A 1 39  ? 5.693   11.995  16.422  1.00 13.95  ? 39   TRP A NE1   1 
ATOM   287   C CE2   . TRP A 1 39  ? 5.741   13.105  15.617  1.00 13.69  ? 39   TRP A CE2   1 
ATOM   288   C CE3   . TRP A 1 39  ? 7.369   14.262  14.226  1.00 12.71  ? 39   TRP A CE3   1 
ATOM   289   C CZ2   . TRP A 1 39  ? 4.734   14.025  15.291  1.00 14.39  ? 39   TRP A CZ2   1 
ATOM   290   C CZ3   . TRP A 1 39  ? 6.369   15.175  13.903  1.00 14.06  ? 39   TRP A CZ3   1 
ATOM   291   C CH2   . TRP A 1 39  ? 5.064   15.049  14.436  1.00 14.21  ? 39   TRP A CH2   1 
ATOM   292   N N     . GLY A 1 40  ? 11.682  10.325  13.526  1.00 15.96  ? 40   GLY A N     1 
ATOM   293   C CA    . GLY A 1 40  ? 13.050  10.229  12.999  1.00 16.86  ? 40   GLY A CA    1 
ATOM   294   C C     . GLY A 1 40  ? 13.139  10.671  11.549  1.00 17.26  ? 40   GLY A C     1 
ATOM   295   O O     . GLY A 1 40  ? 14.023  11.429  11.180  1.00 17.76  ? 40   GLY A O     1 
ATOM   296   N N     . GLU A 1 41  ? 12.205  10.199  10.729  1.00 17.78  ? 41   GLU A N     1 
ATOM   297   C CA    . GLU A 1 41  ? 12.096  10.619  9.334   1.00 18.46  ? 41   GLU A CA    1 
ATOM   298   C C     . GLU A 1 41  ? 11.518  12.029  9.190   1.00 17.92  ? 41   GLU A C     1 
ATOM   299   O O     . GLU A 1 41  ? 12.053  12.846  8.448   1.00 18.05  ? 41   GLU A O     1 
ATOM   300   C CB    . GLU A 1 41  ? 11.271  9.596   8.534   1.00 18.36  ? 41   GLU A CB    1 
ATOM   301   C CG    . GLU A 1 41  ? 12.075  8.344   8.140   1.00 20.35  ? 41   GLU A CG    1 
ATOM   302   C CD    . GLU A 1 41  ? 11.211  7.162   7.700   1.00 20.91  ? 41   GLU A CD    1 
ATOM   303   O OE1   . GLU A 1 41  ? 11.780  6.074   7.479   1.00 25.52  ? 41   GLU A OE1   1 
ATOM   304   O OE2   . GLU A 1 41  ? 9.974   7.301   7.570   1.00 24.89  ? 41   GLU A OE2   1 
ATOM   305   N N     . GLN A 1 42  ? 10.434  12.318  9.904   1.00 17.60  ? 42   GLN A N     1 
ATOM   306   C CA    . GLN A 1 42  ? 9.814   13.646  9.831   1.00 17.15  ? 42   GLN A CA    1 
ATOM   307   C C     . GLN A 1 42  ? 10.707  14.777  10.351  1.00 17.15  ? 42   GLN A C     1 
ATOM   308   O O     . GLN A 1 42  ? 10.605  15.925  9.880   1.00 17.44  ? 42   GLN A O     1 
ATOM   309   C CB    . GLN A 1 42  ? 8.443   13.658  10.524  1.00 16.91  ? 42   GLN A CB    1 
ATOM   310   C CG    . GLN A 1 42  ? 7.594   14.891  10.238  1.00 16.08  ? 42   GLN A CG    1 
ATOM   311   C CD    . GLN A 1 42  ? 7.608   15.320  8.756   1.00 16.96  ? 42   GLN A CD    1 
ATOM   312   O OE1   . GLN A 1 42  ? 7.709   16.503  8.445   1.00 18.70  ? 42   GLN A OE1   1 
ATOM   313   N NE2   . GLN A 1 42  ? 7.503   14.361  7.853   1.00 15.56  ? 42   GLN A NE2   1 
ATOM   314   N N     . GLY A 1 43  ? 11.577  14.461  11.309  1.00 16.82  ? 43   GLY A N     1 
ATOM   315   C CA    . GLY A 1 43  ? 12.584  15.406  11.797  1.00 16.58  ? 43   GLY A CA    1 
ATOM   316   C C     . GLY A 1 43  ? 13.449  16.027  10.715  1.00 16.61  ? 43   GLY A C     1 
ATOM   317   O O     . GLY A 1 43  ? 14.057  17.059  10.939  1.00 16.93  ? 43   GLY A O     1 
ATOM   318   N N     . LYS A 1 44  ? 13.500  15.401  9.535   1.00 17.17  ? 44   LYS A N     1 
ATOM   319   C CA    . LYS A 1 44  ? 14.337  15.867  8.413   1.00 16.82  ? 44   LYS A CA    1 
ATOM   320   C C     . LYS A 1 44  ? 13.741  17.050  7.629   1.00 16.61  ? 44   LYS A C     1 
ATOM   321   O O     . LYS A 1 44  ? 14.360  17.558  6.682   1.00 16.34  ? 44   LYS A O     1 
ATOM   322   C CB    . LYS A 1 44  ? 14.681  14.704  7.466   1.00 17.56  ? 44   LYS A CB    1 
ATOM   323   C CG    . LYS A 1 44  ? 15.373  13.474  8.136   1.00 17.90  ? 44   LYS A CG    1 
ATOM   324   C CD    . LYS A 1 44  ? 16.728  13.824  8.750   1.00 19.48  ? 44   LYS A CD    1 
ATOM   325   C CE    . LYS A 1 44  ? 17.338  12.654  9.574   1.00 21.36  ? 44   LYS A CE    1 
ATOM   326   N NZ    . LYS A 1 44  ? 17.797  11.482  8.747   1.00 22.39  ? 44   LYS A NZ    1 
ATOM   327   N N     . ILE A 1 45  ? 12.537  17.480  8.015   1.00 16.01  ? 45   ILE A N     1 
ATOM   328   C CA    . ILE A 1 45  ? 11.982  18.753  7.537   1.00 14.56  ? 45   ILE A CA    1 
ATOM   329   C C     . ILE A 1 45  ? 12.935  19.920  7.885   1.00 14.23  ? 45   ILE A C     1 
ATOM   330   O O     . ILE A 1 45  ? 12.950  20.949  7.205   1.00 13.86  ? 45   ILE A O     1 
ATOM   331   C CB    . ILE A 1 45  ? 10.539  18.990  8.093   1.00 14.67  ? 45   ILE A CB    1 
ATOM   332   C CG1   . ILE A 1 45  ? 9.803   20.084  7.289   1.00 14.16  ? 45   ILE A CG1   1 
ATOM   333   C CG2   . ILE A 1 45  ? 10.548  19.252  9.625   1.00 13.72  ? 45   ILE A CG2   1 
ATOM   334   C CD1   . ILE A 1 45  ? 8.287   20.122  7.533   1.00 14.07  ? 45   ILE A CD1   1 
ATOM   335   N N     . LEU A 1 46  ? 13.733  19.726  8.934   1.00 13.93  ? 46   LEU A N     1 
ATOM   336   C CA    . LEU A 1 46  ? 14.760  20.685  9.345   1.00 14.50  ? 46   LEU A CA    1 
ATOM   337   C C     . LEU A 1 46  ? 16.166  20.283  8.922   1.00 14.61  ? 46   LEU A C     1 
ATOM   338   O O     . LEU A 1 46  ? 16.432  19.106  8.664   1.00 14.21  ? 46   LEU A O     1 
ATOM   339   C CB    . LEU A 1 46  ? 14.740  20.879  10.866  1.00 14.56  ? 46   LEU A CB    1 
ATOM   340   C CG    . LEU A 1 46  ? 13.419  21.279  11.521  1.00 14.67  ? 46   LEU A CG    1 
ATOM   341   C CD1   . LEU A 1 46  ? 13.637  21.576  13.012  1.00 13.89  ? 46   LEU A CD1   1 
ATOM   342   C CD2   . LEU A 1 46  ? 12.809  22.465  10.779  1.00 14.58  ? 46   LEU A CD2   1 
ATOM   343   N N     . ASP A 1 47  ? 17.056  21.274  8.848   1.00 14.94  ? 47   ASP A N     1 
ATOM   344   C CA    . ASP A 1 47  ? 18.493  21.034  8.724   1.00 15.37  ? 47   ASP A CA    1 
ATOM   345   C C     . ASP A 1 47  ? 19.066  20.855  10.122  1.00 15.27  ? 47   ASP A C     1 
ATOM   346   O O     . ASP A 1 47  ? 18.794  21.651  11.024  1.00 15.00  ? 47   ASP A O     1 
ATOM   347   C CB    . ASP A 1 47  ? 19.206  22.232  8.089   1.00 15.85  ? 47   ASP A CB    1 
ATOM   348   C CG    . ASP A 1 47  ? 18.969  22.358  6.589   1.00 17.53  ? 47   ASP A CG    1 
ATOM   349   O OD1   . ASP A 1 47  ? 19.635  23.237  5.993   1.00 18.51  ? 47   ASP A OD1   1 
ATOM   350   O OD2   . ASP A 1 47  ? 18.146  21.604  6.009   1.00 19.08  ? 47   ASP A OD2   1 
ATOM   351   N N     . TRP A 1 48  ? 19.892  19.835  10.288  1.00 15.32  ? 48   TRP A N     1 
ATOM   352   C CA    . TRP A 1 48  ? 20.550  19.585  11.560  1.00 15.68  ? 48   TRP A CA    1 
ATOM   353   C C     . TRP A 1 48  ? 22.050  19.743  11.368  1.00 16.14  ? 48   TRP A C     1 
ATOM   354   O O     . TRP A 1 48  ? 22.583  19.296  10.363  1.00 16.21  ? 48   TRP A O     1 
ATOM   355   C CB    . TRP A 1 48  ? 20.175  18.189  12.064  1.00 15.22  ? 48   TRP A CB    1 
ATOM   356   C CG    . TRP A 1 48  ? 18.726  18.102  12.440  1.00 15.25  ? 48   TRP A CG    1 
ATOM   357   C CD1   . TRP A 1 48  ? 17.669  17.944  11.596  1.00 15.45  ? 48   TRP A CD1   1 
ATOM   358   C CD2   . TRP A 1 48  ? 18.174  18.205  13.758  1.00 14.52  ? 48   TRP A CD2   1 
ATOM   359   N NE1   . TRP A 1 48  ? 16.490  17.932  12.304  1.00 14.63  ? 48   TRP A NE1   1 
ATOM   360   C CE2   . TRP A 1 48  ? 16.772  18.107  13.633  1.00 14.31  ? 48   TRP A CE2   1 
ATOM   361   C CE3   . TRP A 1 48  ? 18.732  18.358  15.038  1.00 14.14  ? 48   TRP A CE3   1 
ATOM   362   C CZ2   . TRP A 1 48  ? 15.921  18.137  14.733  1.00 13.74  ? 48   TRP A CZ2   1 
ATOM   363   C CZ3   . TRP A 1 48  ? 17.886  18.408  16.129  1.00 14.27  ? 48   TRP A CZ3   1 
ATOM   364   C CH2   . TRP A 1 48  ? 16.494  18.300  15.970  1.00 15.06  ? 48   TRP A CH2   1 
ATOM   365   N N     . ILE A 1 49  ? 22.713  20.416  12.308  1.00 16.98  ? 49   ILE A N     1 
ATOM   366   C CA    . ILE A 1 49  ? 24.163  20.631  12.248  1.00 17.76  ? 49   ILE A CA    1 
ATOM   367   C C     . ILE A 1 49  ? 24.919  19.344  12.596  1.00 18.32  ? 49   ILE A C     1 
ATOM   368   O O     . ILE A 1 49  ? 25.737  18.868  11.811  1.00 18.44  ? 49   ILE A O     1 
ATOM   369   C CB    . ILE A 1 49  ? 24.602  21.824  13.142  1.00 18.09  ? 49   ILE A CB    1 
ATOM   370   C CG1   . ILE A 1 49  ? 24.013  23.134  12.585  1.00 17.45  ? 49   ILE A CG1   1 
ATOM   371   C CG2   . ILE A 1 49  ? 26.126  21.885  13.228  1.00 18.07  ? 49   ILE A CG2   1 
ATOM   372   C CD1   . ILE A 1 49  ? 23.842  24.294  13.582  1.00 17.53  ? 49   ILE A CD1   1 
ATOM   373   N N     . THR A 1 50  ? 24.646  18.773  13.766  1.00 19.35  ? 50   THR A N     1 
ATOM   374   C CA    . THR A 1 50  ? 24.953  17.357  13.974  1.00 19.81  ? 50   THR A CA    1 
ATOM   375   C C     . THR A 1 50  ? 23.647  16.595  14.164  1.00 20.35  ? 50   THR A C     1 
ATOM   376   O O     . THR A 1 50  ? 22.822  16.974  14.995  1.00 20.51  ? 50   THR A O     1 
ATOM   377   C CB    . THR A 1 50  ? 25.974  17.066  15.107  1.00 19.97  ? 50   THR A CB    1 
ATOM   378   O OG1   . THR A 1 50  ? 25.341  16.398  16.204  1.00 19.66  ? 50   THR A OG1   1 
ATOM   379   C CG2   . THR A 1 50  ? 26.677  18.329  15.562  1.00 19.85  ? 50   THR A CG2   1 
ATOM   380   N N     . PRO A 1 51  ? 23.445  15.544  13.351  1.00 20.97  ? 51   PRO A N     1 
ATOM   381   C CA    . PRO A 1 51  ? 22.245  14.703  13.343  1.00 21.09  ? 51   PRO A CA    1 
ATOM   382   C C     . PRO A 1 51  ? 21.940  14.044  14.682  1.00 20.67  ? 51   PRO A C     1 
ATOM   383   O O     . PRO A 1 51  ? 22.842  13.588  15.375  1.00 20.88  ? 51   PRO A O     1 
ATOM   384   C CB    . PRO A 1 51  ? 22.580  13.625  12.291  1.00 21.03  ? 51   PRO A CB    1 
ATOM   385   C CG    . PRO A 1 51  ? 24.090  13.639  12.205  1.00 21.53  ? 51   PRO A CG    1 
ATOM   386   C CD    . PRO A 1 51  ? 24.414  15.095  12.335  1.00 20.93  ? 51   PRO A CD    1 
ATOM   387   N N     . TYR A 1 52  ? 20.659  13.999  15.029  1.00 20.43  ? 52   TYR A N     1 
ATOM   388   C CA    . TYR A 1 52  ? 20.201  13.242  16.187  1.00 19.96  ? 52   TYR A CA    1 
ATOM   389   C C     . TYR A 1 52  ? 20.278  11.744  15.898  1.00 20.18  ? 52   TYR A C     1 
ATOM   390   O O     . TYR A 1 52  ? 20.289  11.321  14.737  1.00 19.69  ? 52   TYR A O     1 
ATOM   391   C CB    . TYR A 1 52  ? 18.769  13.643  16.574  1.00 19.39  ? 52   TYR A CB    1 
ATOM   392   C CG    . TYR A 1 52  ? 17.787  13.645  15.416  1.00 18.77  ? 52   TYR A CG    1 
ATOM   393   C CD1   . TYR A 1 52  ? 17.188  12.463  14.980  1.00 17.96  ? 52   TYR A CD1   1 
ATOM   394   C CD2   . TYR A 1 52  ? 17.459  14.827  14.756  1.00 18.04  ? 52   TYR A CD2   1 
ATOM   395   C CE1   . TYR A 1 52  ? 16.299  12.453  13.918  1.00 17.09  ? 52   TYR A CE1   1 
ATOM   396   C CE2   . TYR A 1 52  ? 16.547  14.829  13.698  1.00 16.81  ? 52   TYR A CE2   1 
ATOM   397   C CZ    . TYR A 1 52  ? 15.979  13.640  13.291  1.00 18.14  ? 52   TYR A CZ    1 
ATOM   398   O OH    . TYR A 1 52  ? 15.093  13.628  12.244  1.00 18.57  ? 52   TYR A OH    1 
ATOM   399   N N     . GLN A 1 53  ? 20.335  10.953  16.963  1.00 20.66  ? 53   GLN A N     1 
ATOM   400   C CA    . GLN A 1 53  ? 20.240  9.508   16.855  1.00 21.33  ? 53   GLN A CA    1 
ATOM   401   C C     . GLN A 1 53  ? 19.050  9.057   17.686  1.00 20.84  ? 53   GLN A C     1 
ATOM   402   O O     . GLN A 1 53  ? 18.245  8.238   17.238  1.00 21.39  ? 53   GLN A O     1 
ATOM   403   C CB    . GLN A 1 53  ? 21.535  8.845   17.322  1.00 21.61  ? 53   GLN A CB    1 
ATOM   404   C CG    . GLN A 1 53  ? 22.689  9.054   16.357  1.00 24.84  ? 53   GLN A CG    1 
ATOM   405   C CD    . GLN A 1 53  ? 24.036  9.177   17.062  1.00 29.23  ? 53   GLN A CD    1 
ATOM   406   O OE1   . GLN A 1 53  ? 24.786  8.200   17.165  1.00 29.80  ? 53   GLN A OE1   1 
ATOM   407   N NE2   . GLN A 1 53  ? 24.342  10.383  17.564  1.00 30.60  ? 53   GLN A NE2   1 
ATOM   408   N N     . LYS A 1 54  ? 18.947  9.602   18.894  1.00 20.05  ? 54   LYS A N     1 
ATOM   409   C CA    . LYS A 1 54  ? 17.770  9.426   19.730  1.00 19.28  ? 54   LYS A CA    1 
ATOM   410   C C     . LYS A 1 54  ? 16.643  10.271  19.150  1.00 18.28  ? 54   LYS A C     1 
ATOM   411   O O     . LYS A 1 54  ? 16.885  11.339  18.582  1.00 17.64  ? 54   LYS A O     1 
ATOM   412   C CB    . LYS A 1 54  ? 18.067  9.884   21.155  1.00 19.84  ? 54   LYS A CB    1 
ATOM   413   C CG    . LYS A 1 54  ? 19.088  9.038   21.912  1.00 21.66  ? 54   LYS A CG    1 
ATOM   414   C CD    . LYS A 1 54  ? 19.468  9.732   23.224  1.00 25.59  ? 54   LYS A CD    1 
ATOM   415   C CE    . LYS A 1 54  ? 20.238  8.815   24.171  1.00 27.20  ? 54   LYS A CE    1 
ATOM   416   N NZ    . LYS A 1 54  ? 21.623  8.521   23.703  1.00 27.60  ? 54   LYS A NZ    1 
ATOM   417   N N     . VAL A 1 55  ? 15.416  9.783   19.271  1.00 17.45  ? 55   VAL A N     1 
ATOM   418   C CA    . VAL A 1 55  ? 14.246  10.552  18.836  1.00 16.80  ? 55   VAL A CA    1 
ATOM   419   C C     . VAL A 1 55  ? 13.355  10.860  20.050  1.00 16.76  ? 55   VAL A C     1 
ATOM   420   O O     . VAL A 1 55  ? 13.440  11.959  20.602  1.00 16.51  ? 55   VAL A O     1 
ATOM   421   C CB    . VAL A 1 55  ? 13.480  9.874   17.651  1.00 16.56  ? 55   VAL A CB    1 
ATOM   422   C CG1   . VAL A 1 55  ? 12.162  10.588  17.350  1.00 15.23  ? 55   VAL A CG1   1 
ATOM   423   C CG2   . VAL A 1 55  ? 14.356  9.837   16.390  1.00 16.44  ? 55   VAL A CG2   1 
ATOM   424   N N     . LYS A 1 56  ? 12.550  9.882   20.483  1.00 16.38  ? 56   LYS A N     1 
ATOM   425   C CA    . LYS A 1 56  ? 11.597  10.081  21.582  1.00 16.16  ? 56   LYS A CA    1 
ATOM   426   C C     . LYS A 1 56  ? 12.146  9.601   22.944  1.00 16.23  ? 56   LYS A C     1 
ATOM   427   O O     . LYS A 1 56  ? 12.563  8.468   23.084  1.00 15.63  ? 56   LYS A O     1 
ATOM   428   C CB    . LYS A 1 56  ? 10.265  9.393   21.242  1.00 16.36  ? 56   LYS A CB    1 
ATOM   429   C CG    . LYS A 1 56  ? 9.188   9.484   22.321  1.00 16.11  ? 56   LYS A CG    1 
ATOM   430   C CD    . LYS A 1 56  ? 7.858   8.953   21.806  1.00 15.19  ? 56   LYS A CD    1 
ATOM   431   C CE    . LYS A 1 56  ? 6.714   9.183   22.796  1.00 14.42  ? 56   LYS A CE    1 
ATOM   432   N NZ    . LYS A 1 56  ? 6.828   8.325   24.004  1.00 13.39  ? 56   LYS A NZ    1 
ATOM   433   N N     . ASN A 1 57  ? 12.141  10.473  23.949  1.00 16.98  ? 57   ASN A N     1 
ATOM   434   C CA    . ASN A 1 57  ? 12.628  10.093  25.286  1.00 17.02  ? 57   ASN A CA    1 
ATOM   435   C C     . ASN A 1 57  ? 11.834  10.806  26.366  1.00 16.63  ? 57   ASN A C     1 
ATOM   436   O O     . ASN A 1 57  ? 12.277  11.808  26.936  1.00 16.16  ? 57   ASN A O     1 
ATOM   437   C CB    . ASN A 1 57  ? 14.130  10.371  25.417  1.00 17.80  ? 57   ASN A CB    1 
ATOM   438   C CG    . ASN A 1 57  ? 14.728  9.833   26.723  1.00 19.30  ? 57   ASN A CG    1 
ATOM   439   O OD1   . ASN A 1 57  ? 14.154  8.958   27.381  1.00 20.80  ? 57   ASN A OD1   1 
ATOM   440   N ND2   . ASN A 1 57  ? 15.903  10.351  27.090  1.00 20.54  ? 57   ASN A ND2   1 
ATOM   441   N N     . THR A 1 58  ? 10.641  10.284  26.627  1.00 16.38  ? 58   THR A N     1 
ATOM   442   C CA    . THR A 1 58  ? 9.659   11.014  27.429  1.00 16.53  ? 58   THR A CA    1 
ATOM   443   C C     . THR A 1 58  ? 8.949   10.153  28.463  1.00 16.66  ? 58   THR A C     1 
ATOM   444   O O     . THR A 1 58  ? 8.788   8.936   28.291  1.00 16.64  ? 58   THR A O     1 
ATOM   445   C CB    . THR A 1 58  ? 8.590   11.716  26.549  1.00 16.07  ? 58   THR A CB    1 
ATOM   446   O OG1   . THR A 1 58  ? 7.745   10.733  25.950  1.00 15.97  ? 58   THR A OG1   1 
ATOM   447   C CG2   . THR A 1 58  ? 9.250   12.547  25.452  1.00 15.59  ? 58   THR A CG2   1 
ATOM   448   N N     . SER A 1 59  ? 8.523   10.814  29.532  1.00 16.49  ? 59   SER A N     1 
ATOM   449   C CA    . SER A 1 59  ? 7.793   10.171  30.606  1.00 16.56  ? 59   SER A CA    1 
ATOM   450   C C     . SER A 1 59  ? 6.879   11.183  31.274  1.00 16.76  ? 59   SER A C     1 
ATOM   451   O O     . SER A 1 59  ? 7.278   12.338  31.511  1.00 17.30  ? 59   SER A O     1 
ATOM   452   C CB    . SER A 1 59  ? 8.779   9.581   31.623  1.00 16.35  ? 59   SER A CB    1 
ATOM   453   O OG    . SER A 1 59  ? 8.150   9.241   32.837  1.00 15.53  ? 59   SER A OG    1 
ATOM   454   N N     . PHE A 1 60  ? 5.658   10.747  31.567  1.00 16.84  ? 60   PHE A N     1 
ATOM   455   C CA    . PHE A 1 60  ? 4.703   11.550  32.333  1.00 17.25  ? 60   PHE A CA    1 
ATOM   456   C C     . PHE A 1 60  ? 4.529   10.977  33.739  1.00 17.89  ? 60   PHE A C     1 
ATOM   457   O O     . PHE A 1 60  ? 3.573   11.351  34.443  1.00 18.07  ? 60   PHE A O     1 
ATOM   458   C CB    . PHE A 1 60  ? 3.318   11.586  31.652  1.00 17.22  ? 60   PHE A CB    1 
ATOM   459   C CG    . PHE A 1 60  ? 3.268   12.316  30.307  1.00 17.58  ? 60   PHE A CG    1 
ATOM   460   C CD1   . PHE A 1 60  ? 2.106   12.233  29.522  1.00 16.81  ? 60   PHE A CD1   1 
ATOM   461   C CD2   . PHE A 1 60  ? 4.348   13.072  29.826  1.00 17.49  ? 60   PHE A CD2   1 
ATOM   462   C CE1   . PHE A 1 60  ? 2.011   12.884  28.306  1.00 16.81  ? 60   PHE A CE1   1 
ATOM   463   C CE2   . PHE A 1 60  ? 4.270   13.736  28.590  1.00 16.84  ? 60   PHE A CE2   1 
ATOM   464   C CZ    . PHE A 1 60  ? 3.103   13.641  27.827  1.00 17.83  ? 60   PHE A CZ    1 
ATOM   465   N N     . ALA A 1 61  ? 5.430   10.067  34.145  1.00 18.15  ? 61   ALA A N     1 
ATOM   466   C CA    . ALA A 1 61  ? 5.332   9.372   35.444  1.00 18.91  ? 61   ALA A CA    1 
ATOM   467   C C     . ALA A 1 61  ? 5.474   10.313  36.650  1.00 19.37  ? 61   ALA A C     1 
ATOM   468   O O     . ALA A 1 61  ? 6.308   11.221  36.620  1.00 19.44  ? 61   ALA A O     1 
ATOM   469   C CB    . ALA A 1 61  ? 6.364   8.224   35.531  1.00 18.41  ? 61   ALA A CB    1 
ATOM   470   N N     . PRO A 1 62  ? 4.640   10.120  37.703  1.00 20.01  ? 62   PRO A N     1 
ATOM   471   C CA    . PRO A 1 62  ? 4.774   10.868  38.974  1.00 20.51  ? 62   PRO A CA    1 
ATOM   472   C C     . PRO A 1 62  ? 6.244   11.007  39.426  1.00 20.71  ? 62   PRO A C     1 
ATOM   473   O O     . PRO A 1 62  ? 6.942   10.003  39.550  1.00 20.87  ? 62   PRO A O     1 
ATOM   474   C CB    . PRO A 1 62  ? 3.988   10.005  39.972  1.00 20.18  ? 62   PRO A CB    1 
ATOM   475   C CG    . PRO A 1 62  ? 2.939   9.343   39.135  1.00 20.22  ? 62   PRO A CG    1 
ATOM   476   C CD    . PRO A 1 62  ? 3.486   9.195   37.732  1.00 19.85  ? 62   PRO A CD    1 
ATOM   477   N N     . GLY A 1 63  ? 6.700   12.248  39.611  1.00 21.12  ? 63   GLY A N     1 
ATOM   478   C CA    . GLY A 1 63  ? 8.070   12.555  40.023  1.00 21.11  ? 63   GLY A CA    1 
ATOM   479   C C     . GLY A 1 63  ? 9.118   12.449  38.919  1.00 21.60  ? 63   GLY A C     1 
ATOM   480   O O     . GLY A 1 63  ? 10.293  12.801  39.127  1.00 21.86  ? 63   GLY A O     1 
ATOM   481   N N     . ASN A 1 64  ? 8.714   11.954  37.751  1.00 21.30  ? 64   ASN A N     1 
ATOM   482   C CA    . ASN A 1 64  ? 9.633   11.829  36.624  1.00 21.26  ? 64   ASN A CA    1 
ATOM   483   C C     . ASN A 1 64  ? 9.025   12.297  35.318  1.00 20.68  ? 64   ASN A C     1 
ATOM   484   O O     . ASN A 1 64  ? 9.114   11.615  34.298  1.00 20.54  ? 64   ASN A O     1 
ATOM   485   C CB    . ASN A 1 64  ? 10.155  10.398  36.494  1.00 21.88  ? 64   ASN A CB    1 
ATOM   486   C CG    . ASN A 1 64  ? 10.828  9.921   37.757  1.00 23.13  ? 64   ASN A CG    1 
ATOM   487   O OD1   . ASN A 1 64  ? 12.020  10.147  37.960  1.00 25.95  ? 64   ASN A OD1   1 
ATOM   488   N ND2   . ASN A 1 64  ? 10.062  9.272   38.625  1.00 24.53  ? 64   ASN A ND2   1 
ATOM   489   N N     . VAL A 1 65  ? 8.392   13.467  35.362  1.00 19.80  ? 65   VAL A N     1 
ATOM   490   C CA    . VAL A 1 65  ? 7.985   14.143  34.149  1.00 18.71  ? 65   VAL A CA    1 
ATOM   491   C C     . VAL A 1 65  ? 9.261   14.636  33.434  1.00 18.71  ? 65   VAL A C     1 
ATOM   492   O O     . VAL A 1 65  ? 9.983   15.503  33.933  1.00 18.37  ? 65   VAL A O     1 
ATOM   493   C CB    . VAL A 1 65  ? 6.991   15.282  34.463  1.00 18.54  ? 65   VAL A CB    1 
ATOM   494   C CG1   . VAL A 1 65  ? 6.630   16.053  33.199  1.00 17.51  ? 65   VAL A CG1   1 
ATOM   495   C CG2   . VAL A 1 65  ? 5.740   14.714  35.134  1.00 17.06  ? 65   VAL A CG2   1 
ATOM   496   N N     . SER A 1 66  ? 9.546   14.039  32.282  1.00 18.67  ? 66   SER A N     1 
ATOM   497   C CA    . SER A 1 66  ? 10.741  14.362  31.528  1.00 18.79  ? 66   SER A CA    1 
ATOM   498   C C     . SER A 1 66  ? 10.451  14.213  30.041  1.00 18.78  ? 66   SER A C     1 
ATOM   499   O O     . SER A 1 66  ? 10.119  13.121  29.564  1.00 18.57  ? 66   SER A O     1 
ATOM   500   C CB    . SER A 1 66  ? 11.911  13.457  31.961  1.00 19.61  ? 66   SER A CB    1 
ATOM   501   O OG    . SER A 1 66  ? 13.096  13.785  31.258  1.00 19.35  ? 66   SER A OG    1 
ATOM   502   N N     . ILE A 1 67  ? 10.564  15.327  29.318  1.00 18.44  ? 67   ILE A N     1 
ATOM   503   C CA    . ILE A 1 67  ? 10.222  15.381  27.902  1.00 18.20  ? 67   ILE A CA    1 
ATOM   504   C C     . ILE A 1 67  ? 11.460  15.766  27.094  1.00 18.03  ? 67   ILE A C     1 
ATOM   505   O O     . ILE A 1 67  ? 12.042  16.844  27.292  1.00 18.24  ? 67   ILE A O     1 
ATOM   506   C CB    . ILE A 1 67  ? 9.039   16.381  27.661  1.00 18.18  ? 67   ILE A CB    1 
ATOM   507   C CG1   . ILE A 1 67  ? 7.796   15.945  28.466  1.00 18.17  ? 67   ILE A CG1   1 
ATOM   508   C CG2   . ILE A 1 67  ? 8.691   16.479  26.184  1.00 17.93  ? 67   ILE A CG2   1 
ATOM   509   C CD1   . ILE A 1 67  ? 6.997   17.079  29.075  1.00 17.43  ? 67   ILE A CD1   1 
ATOM   510   N N     . LYS A 1 68  ? 11.868  14.873  26.196  1.00 17.74  ? 68   LYS A N     1 
ATOM   511   C CA    . LYS A 1 68  ? 13.034  15.097  25.346  1.00 17.74  ? 68   LYS A CA    1 
ATOM   512   C C     . LYS A 1 68  ? 12.845  14.453  23.976  1.00 17.44  ? 68   LYS A C     1 
ATOM   513   O O     . LYS A 1 68  ? 12.437  13.291  23.876  1.00 18.00  ? 68   LYS A O     1 
ATOM   514   C CB    . LYS A 1 68  ? 14.317  14.565  26.004  1.00 18.16  ? 68   LYS A CB    1 
ATOM   515   C CG    . LYS A 1 68  ? 14.857  15.418  27.139  1.00 18.81  ? 68   LYS A CG    1 
ATOM   516   C CD    . LYS A 1 68  ? 16.101  14.783  27.726  1.00 23.08  ? 68   LYS A CD    1 
ATOM   517   C CE    . LYS A 1 68  ? 16.385  15.305  29.134  1.00 24.37  ? 68   LYS A CE    1 
ATOM   518   N NZ    . LYS A 1 68  ? 17.597  14.618  29.671  1.00 26.67  ? 68   LYS A NZ    1 
ATOM   519   N N     . TRP A 1 69  ? 13.146  15.225  22.936  1.00 16.33  ? 69   TRP A N     1 
ATOM   520   C CA    . TRP A 1 69  ? 13.006  14.805  21.555  1.00 15.65  ? 69   TRP A CA    1 
ATOM   521   C C     . TRP A 1 69  ? 14.271  15.247  20.826  1.00 15.96  ? 69   TRP A C     1 
ATOM   522   O O     . TRP A 1 69  ? 14.774  16.363  21.050  1.00 16.22  ? 69   TRP A O     1 
ATOM   523   C CB    . TRP A 1 69  ? 11.780  15.464  20.916  1.00 14.60  ? 69   TRP A CB    1 
ATOM   524   C CG    . TRP A 1 69  ? 10.444  14.906  21.370  1.00 13.89  ? 69   TRP A CG    1 
ATOM   525   C CD1   . TRP A 1 69  ? 9.718   15.301  22.461  1.00 12.77  ? 69   TRP A CD1   1 
ATOM   526   C CD2   . TRP A 1 69  ? 9.677   13.864  20.735  1.00 11.92  ? 69   TRP A CD2   1 
ATOM   527   N NE1   . TRP A 1 69  ? 8.553   14.572  22.540  1.00 12.04  ? 69   TRP A NE1   1 
ATOM   528   C CE2   . TRP A 1 69  ? 8.501   13.689  21.493  1.00 11.67  ? 69   TRP A CE2   1 
ATOM   529   C CE3   . TRP A 1 69  ? 9.872   13.069  19.601  1.00 12.40  ? 69   TRP A CE3   1 
ATOM   530   C CZ2   . TRP A 1 69  ? 7.526   12.739  21.160  1.00 11.95  ? 69   TRP A CZ2   1 
ATOM   531   C CZ3   . TRP A 1 69  ? 8.899   12.133  19.260  1.00 12.31  ? 69   TRP A CZ3   1 
ATOM   532   C CH2   . TRP A 1 69  ? 7.741   11.974  20.040  1.00 12.17  ? 69   TRP A CH2   1 
ATOM   533   N N     . TYR A 1 70  ? 14.804  14.354  19.988  1.00 15.91  ? 70   TYR A N     1 
ATOM   534   C CA    . TYR A 1 70  ? 15.973  14.633  19.163  1.00 15.78  ? 70   TYR A CA    1 
ATOM   535   C C     . TYR A 1 70  ? 17.164  15.107  19.986  1.00 16.27  ? 70   TYR A C     1 
ATOM   536   O O     . TYR A 1 70  ? 17.966  15.914  19.514  1.00 16.00  ? 70   TYR A O     1 
ATOM   537   C CB    . TYR A 1 70  ? 15.631  15.709  18.139  1.00 14.98  ? 70   TYR A CB    1 
ATOM   538   C CG    . TYR A 1 70  ? 14.410  15.416  17.317  1.00 14.92  ? 70   TYR A CG    1 
ATOM   539   C CD1   . TYR A 1 70  ? 13.294  16.258  17.369  1.00 12.74  ? 70   TYR A CD1   1 
ATOM   540   C CD2   . TYR A 1 70  ? 14.366  14.295  16.478  1.00 13.45  ? 70   TYR A CD2   1 
ATOM   541   C CE1   . TYR A 1 70  ? 12.170  15.997  16.610  1.00 13.43  ? 70   TYR A CE1   1 
ATOM   542   C CE2   . TYR A 1 70  ? 13.251  14.028  15.718  1.00 13.97  ? 70   TYR A CE2   1 
ATOM   543   C CZ    . TYR A 1 70  ? 12.157  14.881  15.782  1.00 14.19  ? 70   TYR A CZ    1 
ATOM   544   O OH    . TYR A 1 70  ? 11.060  14.613  15.009  1.00 14.52  ? 70   TYR A OH    1 
ATOM   545   N N     . GLU A 1 71  ? 17.284  14.593  21.205  1.00 16.90  ? 71   GLU A N     1 
ATOM   546   C CA    . GLU A 1 71  ? 18.146  15.221  22.209  1.00 17.91  ? 71   GLU A CA    1 
ATOM   547   C C     . GLU A 1 71  ? 19.644  15.287  21.879  1.00 17.69  ? 71   GLU A C     1 
ATOM   548   O O     . GLU A 1 71  ? 20.318  16.231  22.292  1.00 17.92  ? 71   GLU A O     1 
ATOM   549   C CB    . GLU A 1 71  ? 17.913  14.610  23.599  1.00 18.14  ? 71   GLU A CB    1 
ATOM   550   C CG    . GLU A 1 71  ? 18.527  13.251  23.796  1.00 20.25  ? 71   GLU A CG    1 
ATOM   551   C CD    . GLU A 1 71  ? 17.990  12.560  25.019  1.00 22.63  ? 71   GLU A CD    1 
ATOM   552   O OE1   . GLU A 1 71  ? 16.877  12.009  24.941  1.00 23.07  ? 71   GLU A OE1   1 
ATOM   553   O OE2   . GLU A 1 71  ? 18.686  12.566  26.056  1.00 25.43  ? 71   GLU A OE2   1 
ATOM   554   N N     . ASP A 1 72  ? 20.170  14.309  21.152  1.00 17.52  ? 72   ASP A N     1 
ATOM   555   C CA    . ASP A 1 72  ? 21.616  14.306  20.902  1.00 17.97  ? 72   ASP A CA    1 
ATOM   556   C C     . ASP A 1 72  ? 21.965  15.053  19.621  1.00 17.82  ? 72   ASP A C     1 
ATOM   557   O O     . ASP A 1 72  ? 23.100  14.965  19.128  1.00 18.40  ? 72   ASP A O     1 
ATOM   558   C CB    . ASP A 1 72  ? 22.197  12.881  20.907  1.00 18.02  ? 72   ASP A CB    1 
ATOM   559   C CG    . ASP A 1 72  ? 21.416  11.915  20.020  1.00 18.72  ? 72   ASP A CG    1 
ATOM   560   O OD1   . ASP A 1 72  ? 20.429  12.326  19.392  1.00 18.29  ? 72   ASP A OD1   1 
ATOM   561   O OD2   . ASP A 1 72  ? 21.801  10.729  19.944  1.00 22.63  ? 72   ASP A OD2   1 
ATOM   562   N N     . GLY A 1 73  ? 20.972  15.766  19.087  1.00 17.37  ? 73   GLY A N     1 
ATOM   563   C CA    . GLY A 1 73  ? 21.112  16.538  17.869  1.00 16.48  ? 73   GLY A CA    1 
ATOM   564   C C     . GLY A 1 73  ? 21.268  18.021  18.158  1.00 16.38  ? 73   GLY A C     1 
ATOM   565   O O     . GLY A 1 73  ? 20.879  18.507  19.228  1.00 16.16  ? 73   GLY A O     1 
ATOM   566   N N     . THR A 1 74  ? 21.859  18.738  17.206  1.00 15.55  ? 74   THR A N     1 
ATOM   567   C CA    . THR A 1 74  ? 22.063  20.173  17.334  1.00 15.17  ? 74   THR A CA    1 
ATOM   568   C C     . THR A 1 74  ? 21.555  20.856  16.059  1.00 14.88  ? 74   THR A C     1 
ATOM   569   O O     . THR A 1 74  ? 21.530  20.237  14.989  1.00 14.81  ? 74   THR A O     1 
ATOM   570   C CB    . THR A 1 74  ? 23.559  20.541  17.570  1.00 15.41  ? 74   THR A CB    1 
ATOM   571   O OG1   . THR A 1 74  ? 24.317  20.308  16.376  1.00 14.58  ? 74   THR A OG1   1 
ATOM   572   C CG2   . THR A 1 74  ? 24.160  19.743  18.734  1.00 15.33  ? 74   THR A CG2   1 
ATOM   573   N N     . LEU A 1 75  ? 21.152  22.119  16.187  1.00 14.58  ? 75   LEU A N     1 
ATOM   574   C CA    . LEU A 1 75  ? 20.582  22.887  15.079  1.00 14.24  ? 75   LEU A CA    1 
ATOM   575   C C     . LEU A 1 75  ? 20.525  24.369  15.423  1.00 14.40  ? 75   LEU A C     1 
ATOM   576   O O     . LEU A 1 75  ? 20.801  24.765  16.553  1.00 14.06  ? 75   LEU A O     1 
ATOM   577   C CB    . LEU A 1 75  ? 19.165  22.399  14.774  1.00 14.00  ? 75   LEU A CB    1 
ATOM   578   C CG    . LEU A 1 75  ? 18.043  22.747  15.767  1.00 13.48  ? 75   LEU A CG    1 
ATOM   579   C CD1   . LEU A 1 75  ? 16.667  22.437  15.168  1.00 11.56  ? 75   LEU A CD1   1 
ATOM   580   C CD2   . LEU A 1 75  ? 18.210  22.022  17.139  1.00 14.48  ? 75   LEU A CD2   1 
ATOM   581   N N     . ASN A 1 76  ? 20.145  25.184  14.444  1.00 14.74  ? 76   ASN A N     1 
ATOM   582   C CA    . ASN A 1 76  ? 19.866  26.599  14.689  1.00 14.89  ? 76   ASN A CA    1 
ATOM   583   C C     . ASN A 1 76  ? 18.506  26.954  14.090  1.00 14.63  ? 76   ASN A C     1 
ATOM   584   O O     . ASN A 1 76  ? 18.277  26.767  12.891  1.00 15.05  ? 76   ASN A O     1 
ATOM   585   C CB    . ASN A 1 76  ? 20.991  27.476  14.103  1.00 14.67  ? 76   ASN A CB    1 
ATOM   586   C CG    . ASN A 1 76  ? 20.965  28.915  14.627  1.00 15.20  ? 76   ASN A CG    1 
ATOM   587   O OD1   . ASN A 1 76  ? 21.742  29.282  15.509  1.00 17.02  ? 76   ASN A OD1   1 
ATOM   588   N ND2   . ASN A 1 76  ? 20.091  29.736  14.069  1.00 15.26  ? 76   ASN A ND2   1 
ATOM   589   N N     . LEU A 1 77  ? 17.600  27.456  14.919  1.00 14.85  ? 77   LEU A N     1 
ATOM   590   C CA    . LEU A 1 77  ? 16.283  27.861  14.434  1.00 14.37  ? 77   LEU A CA    1 
ATOM   591   C C     . LEU A 1 77  ? 16.410  28.912  13.351  1.00 14.70  ? 77   LEU A C     1 
ATOM   592   O O     . LEU A 1 77  ? 15.735  28.837  12.311  1.00 14.82  ? 77   LEU A O     1 
ATOM   593   C CB    . LEU A 1 77  ? 15.394  28.378  15.578  1.00 14.42  ? 77   LEU A CB    1 
ATOM   594   C CG    . LEU A 1 77  ? 14.002  28.876  15.144  1.00 13.84  ? 77   LEU A CG    1 
ATOM   595   C CD1   . LEU A 1 77  ? 12.912  28.431  16.081  1.00 11.89  ? 77   LEU A CD1   1 
ATOM   596   C CD2   . LEU A 1 77  ? 13.991  30.380  14.963  1.00 13.92  ? 77   LEU A CD2   1 
ATOM   597   N N     . ALA A 1 78  ? 17.259  29.909  13.592  1.00 14.44  ? 78   ALA A N     1 
ATOM   598   C CA    . ALA A 1 78  ? 17.390  30.995  12.626  1.00 14.48  ? 78   ALA A CA    1 
ATOM   599   C C     . ALA A 1 78  ? 17.955  30.522  11.271  1.00 14.00  ? 78   ALA A C     1 
ATOM   600   O O     . ALA A 1 78  ? 17.517  30.996  10.232  1.00 14.41  ? 78   ALA A O     1 
ATOM   601   C CB    . ALA A 1 78  ? 18.184  32.166  13.207  1.00 14.24  ? 78   ALA A CB    1 
ATOM   602   N N     . ALA A 1 79  ? 18.894  29.576  11.276  1.00 13.83  ? 79   ALA A N     1 
ATOM   603   C CA    . ALA A 1 79  ? 19.379  28.996  10.016  1.00 13.58  ? 79   ALA A CA    1 
ATOM   604   C C     . ALA A 1 79  ? 18.266  28.275  9.239   1.00 13.62  ? 79   ALA A C     1 
ATOM   605   O O     . ALA A 1 79  ? 18.206  28.344  8.015   1.00 12.98  ? 79   ALA A O     1 
ATOM   606   C CB    . ALA A 1 79  ? 20.580  28.058  10.255  1.00 13.68  ? 79   ALA A CB    1 
ATOM   607   N N     . ASN A 1 80  ? 17.388  27.582  9.957   1.00 13.93  ? 80   ASN A N     1 
ATOM   608   C CA    . ASN A 1 80  ? 16.278  26.862  9.338   1.00 14.44  ? 80   ASN A CA    1 
ATOM   609   C C     . ASN A 1 80  ? 15.184  27.773  8.780   1.00 14.60  ? 80   ASN A C     1 
ATOM   610   O O     . ASN A 1 80  ? 14.440  27.386  7.866   1.00 14.56  ? 80   ASN A O     1 
ATOM   611   C CB    . ASN A 1 80  ? 15.673  25.863  10.332  1.00 14.48  ? 80   ASN A CB    1 
ATOM   612   C CG    . ASN A 1 80  ? 16.460  24.578  10.392  1.00 15.37  ? 80   ASN A CG    1 
ATOM   613   O OD1   . ASN A 1 80  ? 16.232  23.661  9.597   1.00 18.44  ? 80   ASN A OD1   1 
ATOM   614   N ND2   . ASN A 1 80  ? 17.417  24.511  11.308  1.00 13.01  ? 80   ASN A ND2   1 
ATOM   615   N N     . CYS A 1 81  ? 15.085  28.971  9.350   1.00 14.48  ? 81   CYS A N     1 
ATOM   616   C CA    . CYS A 1 81  ? 14.025  29.909  9.003   1.00 14.43  ? 81   CYS A CA    1 
ATOM   617   C C     . CYS A 1 81  ? 14.514  30.944  8.017   1.00 14.15  ? 81   CYS A C     1 
ATOM   618   O O     . CYS A 1 81  ? 13.705  31.653  7.438   1.00 14.17  ? 81   CYS A O     1 
ATOM   619   C CB    . CYS A 1 81  ? 13.495  30.611  10.253  1.00 14.41  ? 81   CYS A CB    1 
ATOM   620   S SG    . CYS A 1 81  ? 12.495  29.561  11.325  1.00 15.97  ? 81   CYS A SG    1 
ATOM   621   N N     . LEU A 1 82  ? 15.837  31.026  7.835   1.00 14.15  ? 82   LEU A N     1 
ATOM   622   C CA    . LEU A 1 82  ? 16.449  32.085  7.020   1.00 13.91  ? 82   LEU A CA    1 
ATOM   623   C C     . LEU A 1 82  ? 17.586  31.592  6.093   1.00 14.15  ? 82   LEU A C     1 
ATOM   624   O O     . LEU A 1 82  ? 17.418  31.560  4.868   1.00 13.80  ? 82   LEU A O     1 
ATOM   625   C CB    . LEU A 1 82  ? 16.922  33.236  7.921   1.00 13.54  ? 82   LEU A CB    1 
ATOM   626   C CG    . LEU A 1 82  ? 15.909  33.807  8.928   1.00 13.22  ? 82   LEU A CG    1 
ATOM   627   C CD1   . LEU A 1 82  ? 16.565  34.675  10.003  1.00 12.37  ? 82   LEU A CD1   1 
ATOM   628   C CD2   . LEU A 1 82  ? 14.902  34.601  8.188   1.00 10.74  ? 82   LEU A CD2   1 
ATOM   629   N N     . ASP A 1 83  ? 18.716  31.198  6.693   1.00 14.24  ? 83   ASP A N     1 
ATOM   630   C CA    . ASP A 1 83  ? 19.955  30.900  5.970   1.00 14.46  ? 83   ASP A CA    1 
ATOM   631   C C     . ASP A 1 83  ? 19.792  29.837  4.901   1.00 14.21  ? 83   ASP A C     1 
ATOM   632   O O     . ASP A 1 83  ? 20.320  29.992  3.813   1.00 14.15  ? 83   ASP A O     1 
ATOM   633   C CB    . ASP A 1 83  ? 21.069  30.483  6.934   1.00 14.38  ? 83   ASP A CB    1 
ATOM   634   C CG    . ASP A 1 83  ? 21.386  31.558  7.963   1.00 15.15  ? 83   ASP A CG    1 
ATOM   635   O OD1   . ASP A 1 83  ? 22.578  31.926  8.090   1.00 16.89  ? 83   ASP A OD1   1 
ATOM   636   O OD2   . ASP A 1 83  ? 20.450  32.042  8.631   1.00 13.64  ? 83   ASP A OD2   1 
ATOM   637   N N     . ARG A 1 84  ? 19.053  28.771  5.200   1.00 14.06  ? 84   ARG A N     1 
ATOM   638   C CA    . ARG A 1 84  ? 18.929  27.637  4.259   1.00 14.19  ? 84   ARG A CA    1 
ATOM   639   C C     . ARG A 1 84  ? 18.040  27.937  3.050   1.00 14.70  ? 84   ARG A C     1 
ATOM   640   O O     . ARG A 1 84  ? 18.074  27.225  2.043   1.00 14.92  ? 84   ARG A O     1 
ATOM   641   C CB    . ARG A 1 84  ? 18.454  26.384  4.972   1.00 13.82  ? 84   ARG A CB    1 
ATOM   642   C CG    . ARG A 1 84  ? 17.047  26.456  5.505   1.00 11.83  ? 84   ARG A CG    1 
ATOM   643   C CD    . ARG A 1 84  ? 16.618  25.084  5.922   1.00 9.52   ? 84   ARG A CD    1 
ATOM   644   N NE    . ARG A 1 84  ? 15.260  25.048  6.459   1.00 9.50   ? 84   ARG A NE    1 
ATOM   645   C CZ    . ARG A 1 84  ? 14.549  23.932  6.581   1.00 10.03  ? 84   ARG A CZ    1 
ATOM   646   N NH1   . ARG A 1 84  ? 15.051  22.767  6.198   1.00 8.92   ? 84   ARG A NH1   1 
ATOM   647   N NH2   . ARG A 1 84  ? 13.330  23.976  7.081   1.00 12.26  ? 84   ARG A NH2   1 
ATOM   648   N N     . HIS A 1 85  ? 17.266  29.012  3.156   1.00 14.84  ? 85   HIS A N     1 
ATOM   649   C CA    . HIS A 1 85  ? 16.403  29.440  2.091   1.00 15.35  ? 85   HIS A CA    1 
ATOM   650   C C     . HIS A 1 85  ? 17.143  30.380  1.123   1.00 15.91  ? 85   HIS A C     1 
ATOM   651   O O     . HIS A 1 85  ? 16.699  30.578  -0.001  1.00 15.91  ? 85   HIS A O     1 
ATOM   652   C CB    . HIS A 1 85  ? 15.123  30.091  2.671   1.00 15.25  ? 85   HIS A CB    1 
ATOM   653   C CG    . HIS A 1 85  ? 14.369  29.203  3.625   1.00 14.63  ? 85   HIS A CG    1 
ATOM   654   N ND1   . HIS A 1 85  ? 13.876  27.963  3.263   1.00 13.43  ? 85   HIS A ND1   1 
ATOM   655   C CD2   . HIS A 1 85  ? 14.031  29.376  4.927   1.00 14.61  ? 85   HIS A CD2   1 
ATOM   656   C CE1   . HIS A 1 85  ? 13.268  27.414  4.301   1.00 13.92  ? 85   HIS A CE1   1 
ATOM   657   N NE2   . HIS A 1 85  ? 13.353  28.247  5.325   1.00 14.60  ? 85   HIS A NE2   1 
ATOM   658   N N     . LEU A 1 86  ? 18.287  30.915  1.548   1.00 16.64  ? 86   LEU A N     1 
ATOM   659   C CA    . LEU A 1 86  ? 18.982  31.963  0.791   1.00 18.04  ? 86   LEU A CA    1 
ATOM   660   C C     . LEU A 1 86  ? 19.465  31.563  -0.609  1.00 18.69  ? 86   LEU A C     1 
ATOM   661   O O     . LEU A 1 86  ? 19.222  32.288  -1.577  1.00 18.42  ? 86   LEU A O     1 
ATOM   662   C CB    . LEU A 1 86  ? 20.151  32.552  1.607   1.00 18.12  ? 86   LEU A CB    1 
ATOM   663   C CG    . LEU A 1 86  ? 19.798  33.409  2.829   1.00 18.99  ? 86   LEU A CG    1 
ATOM   664   C CD1   . LEU A 1 86  ? 21.067  33.857  3.537   1.00 18.65  ? 86   LEU A CD1   1 
ATOM   665   C CD2   . LEU A 1 86  ? 18.956  34.613  2.406   1.00 20.30  ? 86   LEU A CD2   1 
ATOM   666   N N     . GLN A 1 87  ? 20.148  30.424  -0.722  1.00 19.49  ? 87   GLN A N     1 
ATOM   667   C CA    . GLN A 1 87  ? 20.775  30.097  -1.996  1.00 21.08  ? 87   GLN A CA    1 
ATOM   668   C C     . GLN A 1 87  ? 19.787  30.129  -3.147  1.00 21.46  ? 87   GLN A C     1 
ATOM   669   O O     . GLN A 1 87  ? 20.090  30.704  -4.207  1.00 22.19  ? 87   GLN A O     1 
ATOM   670   C CB    . GLN A 1 87  ? 21.509  28.757  -1.990  1.00 21.19  ? 87   GLN A CB    1 
ATOM   671   C CG    . GLN A 1 87  ? 22.405  28.601  -3.226  1.00 23.69  ? 87   GLN A CG    1 
ATOM   672   C CD    . GLN A 1 87  ? 22.740  27.172  -3.505  1.00 27.06  ? 87   GLN A CD    1 
ATOM   673   O OE1   . GLN A 1 87  ? 23.293  26.478  -2.650  1.00 28.80  ? 87   GLN A OE1   1 
ATOM   674   N NE2   . GLN A 1 87  ? 22.397  26.702  -4.706  1.00 28.24  ? 87   GLN A NE2   1 
ATOM   675   N N     . GLU A 1 88  ? 18.619  29.518  -2.946  1.00 21.48  ? 88   GLU A N     1 
ATOM   676   C CA    . GLU A 1 88  ? 17.647  29.369  -4.033  1.00 21.64  ? 88   GLU A CA    1 
ATOM   677   C C     . GLU A 1 88  ? 16.479  30.345  -3.961  1.00 20.89  ? 88   GLU A C     1 
ATOM   678   O O     . GLU A 1 88  ? 15.879  30.662  -5.001  1.00 20.56  ? 88   GLU A O     1 
ATOM   679   C CB    . GLU A 1 88  ? 17.135  27.929  -4.113  1.00 22.36  ? 88   GLU A CB    1 
ATOM   680   C CG    . GLU A 1 88  ? 18.224  26.887  -4.429  1.00 25.08  ? 88   GLU A CG    1 
ATOM   681   C CD    . GLU A 1 88  ? 18.759  27.015  -5.839  1.00 29.08  ? 88   GLU A CD    1 
ATOM   682   O OE1   . GLU A 1 88  ? 19.985  27.207  -5.996  1.00 31.40  ? 88   GLU A OE1   1 
ATOM   683   O OE2   . GLU A 1 88  ? 17.950  26.952  -6.794  1.00 31.45  ? 88   GLU A OE2   1 
ATOM   684   N N     . ASN A 1 89  ? 16.179  30.835  -2.751  1.00 19.86  ? 89   ASN A N     1 
ATOM   685   C CA    . ASN A 1 89  ? 14.990  31.668  -2.522  1.00 18.93  ? 89   ASN A CA    1 
ATOM   686   C C     . ASN A 1 89  ? 15.214  32.993  -1.794  1.00 18.79  ? 89   ASN A C     1 
ATOM   687   O O     . ASN A 1 89  ? 14.261  33.594  -1.280  1.00 18.20  ? 89   ASN A O     1 
ATOM   688   C CB    . ASN A 1 89  ? 13.909  30.845  -1.825  1.00 18.81  ? 89   ASN A CB    1 
ATOM   689   C CG    . ASN A 1 89  ? 13.318  29.793  -2.735  1.00 19.08  ? 89   ASN A CG    1 
ATOM   690   O OD1   . ASN A 1 89  ? 13.549  28.594  -2.543  1.00 20.66  ? 89   ASN A OD1   1 
ATOM   691   N ND2   . ASN A 1 89  ? 12.580  30.233  -3.753  1.00 15.15  ? 89   ASN A ND2   1 
ATOM   692   N N     . GLY A 1 90  ? 16.459  33.470  -1.800  1.00 18.22  ? 90   GLY A N     1 
ATOM   693   C CA    . GLY A 1 90  ? 16.821  34.700  -1.106  1.00 17.49  ? 90   GLY A CA    1 
ATOM   694   C C     . GLY A 1 90  ? 15.966  35.874  -1.518  1.00 17.38  ? 90   GLY A C     1 
ATOM   695   O O     . GLY A 1 90  ? 15.735  36.773  -0.717  1.00 17.41  ? 90   GLY A O     1 
ATOM   696   N N     . ASP A 1 91  ? 15.501  35.854  -2.771  1.00 17.35  ? 91   ASP A N     1 
ATOM   697   C CA    . ASP A 1 91  ? 14.682  36.917  -3.354  1.00 17.51  ? 91   ASP A CA    1 
ATOM   698   C C     . ASP A 1 91  ? 13.170  36.723  -3.187  1.00 17.29  ? 91   ASP A C     1 
ATOM   699   O O     . ASP A 1 91  ? 12.389  37.628  -3.506  1.00 17.02  ? 91   ASP A O     1 
ATOM   700   C CB    . ASP A 1 91  ? 15.010  37.094  -4.838  1.00 17.66  ? 91   ASP A CB    1 
ATOM   701   C CG    . ASP A 1 91  ? 16.420  37.628  -5.072  1.00 19.24  ? 91   ASP A CG    1 
ATOM   702   O OD1   . ASP A 1 91  ? 17.042  38.197  -4.143  1.00 20.82  ? 91   ASP A OD1   1 
ATOM   703   O OD2   . ASP A 1 91  ? 16.914  37.467  -6.200  1.00 20.92  ? 91   ASP A OD2   1 
ATOM   704   N N     . ARG A 1 92  ? 12.765  35.545  -2.711  1.00 17.13  ? 92   ARG A N     1 
ATOM   705   C CA    . ARG A 1 92  ? 11.373  35.305  -2.326  1.00 17.19  ? 92   ARG A CA    1 
ATOM   706   C C     . ARG A 1 92  ? 11.029  36.134  -1.081  1.00 16.89  ? 92   ARG A C     1 
ATOM   707   O O     . ARG A 1 92  ? 11.867  36.322  -0.181  1.00 16.82  ? 92   ARG A O     1 
ATOM   708   C CB    . ARG A 1 92  ? 11.132  33.815  -2.082  1.00 17.62  ? 92   ARG A CB    1 
ATOM   709   C CG    . ARG A 1 92  ? 9.720   33.454  -1.569  1.00 19.04  ? 92   ARG A CG    1 
ATOM   710   C CD    . ARG A 1 92  ? 9.654   31.997  -1.190  1.00 20.36  ? 92   ARG A CD    1 
ATOM   711   N NE    . ARG A 1 92  ? 9.613   31.097  -2.349  1.00 23.05  ? 92   ARG A NE    1 
ATOM   712   C CZ    . ARG A 1 92  ? 9.797   29.770  -2.285  1.00 25.90  ? 92   ARG A CZ    1 
ATOM   713   N NH1   . ARG A 1 92  ? 10.065  29.170  -1.115  1.00 25.09  ? 92   ARG A NH1   1 
ATOM   714   N NH2   . ARG A 1 92  ? 9.725   29.030  -3.398  1.00 24.85  ? 92   ARG A NH2   1 
ATOM   715   N N     . THR A 1 93  ? 9.816   36.668  -1.057  1.00 16.55  ? 93   THR A N     1 
ATOM   716   C CA    . THR A 1 93  ? 9.348   37.444  0.088   1.00 16.34  ? 93   THR A CA    1 
ATOM   717   C C     . THR A 1 93  ? 9.153   36.515  1.267   1.00 16.44  ? 93   THR A C     1 
ATOM   718   O O     . THR A 1 93  ? 8.475   35.494  1.149   1.00 17.05  ? 93   THR A O     1 
ATOM   719   C CB    . THR A 1 93  ? 8.024   38.161  -0.223  1.00 16.83  ? 93   THR A CB    1 
ATOM   720   O OG1   . THR A 1 93  ? 8.198   39.008  -1.368  1.00 16.31  ? 93   THR A OG1   1 
ATOM   721   C CG2   . THR A 1 93  ? 7.530   38.978  0.987   1.00 15.72  ? 93   THR A CG2   1 
ATOM   722   N N     . ALA A 1 94  ? 9.789   36.862  2.383   1.00 16.16  ? 94   ALA A N     1 
ATOM   723   C CA    . ALA A 1 94  ? 9.618   36.164  3.643   1.00 15.51  ? 94   ALA A CA    1 
ATOM   724   C C     . ALA A 1 94  ? 8.407   36.743  4.379   1.00 15.40  ? 94   ALA A C     1 
ATOM   725   O O     . ALA A 1 94  ? 7.549   35.996  4.858   1.00 14.85  ? 94   ALA A O     1 
ATOM   726   C CB    . ALA A 1 94  ? 10.866  36.301  4.486   1.00 14.98  ? 94   ALA A CB    1 
ATOM   727   N N     . ILE A 1 95  ? 8.348   38.073  4.472   1.00 15.01  ? 95   ILE A N     1 
ATOM   728   C CA    . ILE A 1 95  ? 7.258   38.736  5.205   1.00 15.02  ? 95   ILE A CA    1 
ATOM   729   C C     . ILE A 1 95  ? 6.655   39.821  4.348   1.00 14.67  ? 95   ILE A C     1 
ATOM   730   O O     . ILE A 1 95  ? 7.380   40.692  3.834   1.00 14.74  ? 95   ILE A O     1 
ATOM   731   C CB    . ILE A 1 95  ? 7.742   39.360  6.559   1.00 15.32  ? 95   ILE A CB    1 
ATOM   732   C CG1   . ILE A 1 95  ? 8.196   38.267  7.539   1.00 14.57  ? 95   ILE A CG1   1 
ATOM   733   C CG2   . ILE A 1 95  ? 6.642   40.277  7.210   1.00 14.99  ? 95   ILE A CG2   1 
ATOM   734   C CD1   . ILE A 1 95  ? 9.049   38.822  8.687   1.00 14.76  ? 95   ILE A CD1   1 
ATOM   735   N N     . ILE A 1 96  ? 5.338   39.742  4.165   1.00 13.92  ? 96   ILE A N     1 
ATOM   736   C CA    . ILE A 1 96  ? 4.564   40.874  3.646   1.00 13.37  ? 96   ILE A CA    1 
ATOM   737   C C     . ILE A 1 96  ? 4.050   41.629  4.863   1.00 13.18  ? 96   ILE A C     1 
ATOM   738   O O     . ILE A 1 96  ? 3.356   41.055  5.693   1.00 12.29  ? 96   ILE A O     1 
ATOM   739   C CB    . ILE A 1 96  ? 3.374   40.426  2.746   1.00 13.07  ? 96   ILE A CB    1 
ATOM   740   C CG1   . ILE A 1 96  ? 3.866   39.786  1.447   1.00 12.93  ? 96   ILE A CG1   1 
ATOM   741   C CG2   . ILE A 1 96  ? 2.453   41.600  2.438   1.00 13.28  ? 96   ILE A CG2   1 
ATOM   742   C CD1   . ILE A 1 96  ? 2.793   38.895  0.756   1.00 13.90  ? 96   ILE A CD1   1 
ATOM   743   N N     . TRP A 1 97  ? 4.424   42.899  4.992   1.00 13.35  ? 97   TRP A N     1 
ATOM   744   C CA    . TRP A 1 97  ? 3.916   43.730  6.083   1.00 13.77  ? 97   TRP A CA    1 
ATOM   745   C C     . TRP A 1 97  ? 2.861   44.712  5.545   1.00 14.08  ? 97   TRP A C     1 
ATOM   746   O O     . TRP A 1 97  ? 3.117   45.442  4.595   1.00 14.38  ? 97   TRP A O     1 
ATOM   747   C CB    . TRP A 1 97  ? 5.058   44.443  6.838   1.00 13.11  ? 97   TRP A CB    1 
ATOM   748   C CG    . TRP A 1 97  ? 4.556   45.282  7.993   1.00 13.40  ? 97   TRP A CG    1 
ATOM   749   C CD1   . TRP A 1 97  ? 4.104   44.832  9.200   1.00 13.03  ? 97   TRP A CD1   1 
ATOM   750   C CD2   . TRP A 1 97  ? 4.432   46.709  8.025   1.00 13.56  ? 97   TRP A CD2   1 
ATOM   751   N NE1   . TRP A 1 97  ? 3.711   45.891  9.989   1.00 14.58  ? 97   TRP A NE1   1 
ATOM   752   C CE2   . TRP A 1 97  ? 3.902   47.056  9.291   1.00 14.66  ? 97   TRP A CE2   1 
ATOM   753   C CE3   . TRP A 1 97  ? 4.730   47.734  7.107   1.00 12.62  ? 97   TRP A CE3   1 
ATOM   754   C CZ2   . TRP A 1 97  ? 3.654   48.384  9.665   1.00 13.07  ? 97   TRP A CZ2   1 
ATOM   755   C CZ3   . TRP A 1 97  ? 4.476   49.051  7.477   1.00 13.87  ? 97   TRP A CZ3   1 
ATOM   756   C CH2   . TRP A 1 97  ? 3.952   49.363  8.755   1.00 12.21  ? 97   TRP A CH2   1 
ATOM   757   N N     . GLU A 1 98  ? 1.666   44.676  6.139   1.00 14.28  ? 98   GLU A N     1 
ATOM   758   C CA    . GLU A 1 98  ? 0.552   45.548  5.772   1.00 13.70  ? 98   GLU A CA    1 
ATOM   759   C C     . GLU A 1 98  ? 0.294   46.475  6.963   1.00 13.44  ? 98   GLU A C     1 
ATOM   760   O O     . GLU A 1 98  ? 0.020   46.024  8.075   1.00 13.19  ? 98   GLU A O     1 
ATOM   761   C CB    . GLU A 1 98  ? -0.686  44.700  5.391   1.00 14.21  ? 98   GLU A CB    1 
ATOM   762   C CG    . GLU A 1 98  ? -2.037  45.442  5.163   1.00 13.77  ? 98   GLU A CG    1 
ATOM   763   C CD    . GLU A 1 98  ? -2.087  46.265  3.862   1.00 16.24  ? 98   GLU A CD    1 
ATOM   764   O OE1   . GLU A 1 98  ? -1.114  46.192  3.070   1.00 14.37  ? 98   GLU A OE1   1 
ATOM   765   O OE2   . GLU A 1 98  ? -3.110  46.983  3.637   1.00 13.82  ? 98   GLU A OE2   1 
ATOM   766   N N     . GLY A 1 99  ? 0.427   47.775  6.742   1.00 13.20  ? 99   GLY A N     1 
ATOM   767   C CA    . GLY A 1 99  ? 0.270   48.735  7.821   1.00 12.80  ? 99   GLY A CA    1 
ATOM   768   C C     . GLY A 1 99  ? -1.187  48.931  8.188   1.00 13.09  ? 99   GLY A C     1 
ATOM   769   O O     . GLY A 1 99  ? -2.081  48.625  7.378   1.00 12.46  ? 99   GLY A O     1 
ATOM   770   N N     . ASP A 1 100 ? -1.419  49.431  9.408   1.00 12.66  ? 100  ASP A N     1 
ATOM   771   C CA    . ASP A 1 100 ? -2.749  49.863  9.849   1.00 13.15  ? 100  ASP A CA    1 
ATOM   772   C C     . ASP A 1 100 ? -3.302  50.804  8.759   1.00 13.65  ? 100  ASP A C     1 
ATOM   773   O O     . ASP A 1 100 ? -4.452  50.674  8.311   1.00 13.61  ? 100  ASP A O     1 
ATOM   774   C CB    . ASP A 1 100 ? -2.636  50.563  11.211  1.00 13.03  ? 100  ASP A CB    1 
ATOM   775   C CG    . ASP A 1 100 ? -3.981  50.935  11.809  1.00 13.56  ? 100  ASP A CG    1 
ATOM   776   O OD1   . ASP A 1 100 ? -4.842  50.042  11.929  1.00 12.48  ? 100  ASP A OD1   1 
ATOM   777   O OD2   . ASP A 1 100 ? -4.162  52.123  12.191  1.00 11.96  ? 100  ASP A OD2   1 
ATOM   778   N N     . ASP A 1 101 ? -2.442  51.717  8.313   1.00 14.38  ? 101  ASP A N     1 
ATOM   779   C CA    . ASP A 1 101 ? -2.653  52.527  7.111   1.00 15.26  ? 101  ASP A CA    1 
ATOM   780   C C     . ASP A 1 101 ? -2.240  51.708  5.871   1.00 15.37  ? 101  ASP A C     1 
ATOM   781   O O     . ASP A 1 101 ? -1.069  51.344  5.725   1.00 14.87  ? 101  ASP A O     1 
ATOM   782   C CB    . ASP A 1 101 ? -1.794  53.788  7.219   1.00 15.62  ? 101  ASP A CB    1 
ATOM   783   C CG    . ASP A 1 101 ? -2.027  54.780  6.090   1.00 17.50  ? 101  ASP A CG    1 
ATOM   784   O OD1   . ASP A 1 101 ? -2.581  54.445  5.012   1.00 18.33  ? 101  ASP A OD1   1 
ATOM   785   O OD2   . ASP A 1 101 ? -1.620  55.931  6.296   1.00 20.65  ? 101  ASP A OD2   1 
ATOM   786   N N     . THR A 1 102 ? -3.202  51.417  4.991   1.00 15.32  ? 102  THR A N     1 
ATOM   787   C CA    . THR A 1 102 ? -2.927  50.576  3.835   1.00 15.76  ? 102  THR A CA    1 
ATOM   788   C C     . THR A 1 102 ? -1.905  51.181  2.847   1.00 16.49  ? 102  THR A C     1 
ATOM   789   O O     . THR A 1 102 ? -1.249  50.439  2.101   1.00 16.59  ? 102  THR A O     1 
ATOM   790   C CB    . THR A 1 102 ? -4.225  50.075  3.127   1.00 15.41  ? 102  THR A CB    1 
ATOM   791   O OG1   . THR A 1 102 ? -3.908  48.927  2.330   1.00 15.38  ? 102  THR A OG1   1 
ATOM   792   C CG2   . THR A 1 102 ? -4.850  51.150  2.244   1.00 15.32  ? 102  THR A CG2   1 
ATOM   793   N N     . SER A 1 103 ? -1.741  52.511  2.882   1.00 16.66  ? 103  SER A N     1 
ATOM   794   C CA    . SER A 1 103 ? -0.683  53.183  2.102   1.00 17.26  ? 103  SER A CA    1 
ATOM   795   C C     . SER A 1 103 ? 0.737   52.764  2.507   1.00 17.96  ? 103  SER A C     1 
ATOM   796   O O     . SER A 1 103 ? 1.692   53.003  1.765   1.00 18.33  ? 103  SER A O     1 
ATOM   797   C CB    . SER A 1 103 ? -0.824  54.714  2.157   1.00 17.27  ? 103  SER A CB    1 
ATOM   798   O OG    . SER A 1 103 ? -0.665  55.222  3.477   1.00 16.41  ? 103  SER A OG    1 
ATOM   799   N N     . GLN A 1 104 ? 0.856   52.140  3.678   1.00 18.35  ? 104  GLN A N     1 
ATOM   800   C CA    . GLN A 1 104 ? 2.122   51.658  4.199   1.00 19.34  ? 104  GLN A CA    1 
ATOM   801   C C     . GLN A 1 104 ? 2.203   50.134  4.113   1.00 19.40  ? 104  GLN A C     1 
ATOM   802   O O     . GLN A 1 104 ? 1.402   49.421  4.736   1.00 19.64  ? 104  GLN A O     1 
ATOM   803   C CB    . GLN A 1 104 ? 2.303   52.096  5.655   1.00 19.18  ? 104  GLN A CB    1 
ATOM   804   C CG    . GLN A 1 104 ? 2.156   53.594  5.911   1.00 20.19  ? 104  GLN A CG    1 
ATOM   805   C CD    . GLN A 1 104 ? 2.758   54.007  7.249   1.00 21.40  ? 104  GLN A CD    1 
ATOM   806   O OE1   . GLN A 1 104 ? 2.382   53.504  8.312   1.00 23.15  ? 104  GLN A OE1   1 
ATOM   807   N NE2   . GLN A 1 104 ? 3.716   54.917  7.197   1.00 25.42  ? 104  GLN A NE2   1 
ATOM   808   N N     . SER A 1 105 ? 3.161   49.639  3.336   1.00 19.24  ? 105  SER A N     1 
ATOM   809   C CA    . SER A 1 105 ? 3.419   48.201  3.231   1.00 19.81  ? 105  SER A CA    1 
ATOM   810   C C     . SER A 1 105 ? 4.874   47.900  2.842   1.00 19.64  ? 105  SER A C     1 
ATOM   811   O O     . SER A 1 105 ? 5.572   48.756  2.304   1.00 19.60  ? 105  SER A O     1 
ATOM   812   C CB    . SER A 1 105 ? 2.461   47.544  2.240   1.00 20.10  ? 105  SER A CB    1 
ATOM   813   O OG    . SER A 1 105 ? 2.735   48.006  0.934   1.00 21.19  ? 105  SER A OG    1 
ATOM   814   N N     . LYS A 1 106 ? 5.326   46.684  3.141   1.00 19.34  ? 106  LYS A N     1 
ATOM   815   C CA    . LYS A 1 106 ? 6.668   46.230  2.775   1.00 18.75  ? 106  LYS A CA    1 
ATOM   816   C C     . LYS A 1 106 ? 6.639   44.795  2.280   1.00 18.35  ? 106  LYS A C     1 
ATOM   817   O O     . LYS A 1 106 ? 5.843   43.974  2.746   1.00 17.81  ? 106  LYS A O     1 
ATOM   818   C CB    . LYS A 1 106 ? 7.598   46.249  3.991   1.00 18.85  ? 106  LYS A CB    1 
ATOM   819   C CG    . LYS A 1 106 ? 8.176   47.572  4.347   1.00 20.08  ? 106  LYS A CG    1 
ATOM   820   C CD    . LYS A 1 106 ? 9.134   47.380  5.502   1.00 20.46  ? 106  LYS A CD    1 
ATOM   821   C CE    . LYS A 1 106 ? 9.541   48.705  6.111   1.00 22.16  ? 106  LYS A CE    1 
ATOM   822   N NZ    . LYS A 1 106 ? 10.456  48.454  7.256   1.00 23.14  ? 106  LYS A NZ    1 
ATOM   823   N N     . HIS A 1 107 ? 7.534   44.492  1.353   1.00 17.57  ? 107  HIS A N     1 
ATOM   824   C CA    . HIS A 1 107 ? 7.817   43.124  1.008   1.00 17.40  ? 107  HIS A CA    1 
ATOM   825   C C     . HIS A 1 107 ? 9.252   42.902  1.410   1.00 17.23  ? 107  HIS A C     1 
ATOM   826   O O     . HIS A 1 107 ? 10.171  43.509  0.833   1.00 17.85  ? 107  HIS A O     1 
ATOM   827   C CB    . HIS A 1 107 ? 7.607   42.878  -0.480  1.00 17.43  ? 107  HIS A CB    1 
ATOM   828   C CG    . HIS A 1 107 ? 6.170   42.694  -0.866  1.00 17.62  ? 107  HIS A CG    1 
ATOM   829   N ND1   . HIS A 1 107 ? 5.240   43.710  -0.786  1.00 18.38  ? 107  HIS A ND1   1 
ATOM   830   C CD2   . HIS A 1 107 ? 5.510   41.622  -1.368  1.00 18.22  ? 107  HIS A CD2   1 
ATOM   831   C CE1   . HIS A 1 107 ? 4.067   43.267  -1.205  1.00 16.89  ? 107  HIS A CE1   1 
ATOM   832   N NE2   . HIS A 1 107 ? 4.201   42.001  -1.555  1.00 18.05  ? 107  HIS A NE2   1 
ATOM   833   N N     . ILE A 1 108 ? 9.444   42.079  2.433   1.00 16.66  ? 108  ILE A N     1 
ATOM   834   C CA    . ILE A 1 108 ? 10.788  41.807  2.954   1.00 16.65  ? 108  ILE A CA    1 
ATOM   835   C C     . ILE A 1 108 ? 11.251  40.427  2.546   1.00 15.95  ? 108  ILE A C     1 
ATOM   836   O O     . ILE A 1 108 ? 10.732  39.432  3.040   1.00 16.38  ? 108  ILE A O     1 
ATOM   837   C CB    . ILE A 1 108 ? 10.841  41.942  4.495   1.00 16.73  ? 108  ILE A CB    1 
ATOM   838   C CG1   . ILE A 1 108 ? 10.521  43.385  4.879   1.00 16.96  ? 108  ILE A CG1   1 
ATOM   839   C CG2   . ILE A 1 108 ? 12.223  41.531  5.043   1.00 15.65  ? 108  ILE A CG2   1 
ATOM   840   C CD1   . ILE A 1 108 ? 9.863   43.502  6.212   1.00 17.73  ? 108  ILE A CD1   1 
ATOM   841   N N     . SER A 1 109 ? 12.221  40.376  1.640   1.00 15.19  ? 109  SER A N     1 
ATOM   842   C CA    . SER A 1 109 ? 12.755  39.100  1.134   1.00 14.80  ? 109  SER A CA    1 
ATOM   843   C C     . SER A 1 109 ? 13.505  38.321  2.217   1.00 14.72  ? 109  SER A C     1 
ATOM   844   O O     . SER A 1 109 ? 13.874  38.884  3.263   1.00 14.06  ? 109  SER A O     1 
ATOM   845   C CB    . SER A 1 109 ? 13.691  39.355  -0.058  1.00 14.77  ? 109  SER A CB    1 
ATOM   846   O OG    . SER A 1 109 ? 14.929  39.877  0.386   1.00 14.36  ? 109  SER A OG    1 
ATOM   847   N N     . TYR A 1 110 ? 13.746  37.035  1.952   1.00 14.85  ? 110  TYR A N     1 
ATOM   848   C CA    . TYR A 1 110 ? 14.518  36.187  2.859   1.00 15.45  ? 110  TYR A CA    1 
ATOM   849   C C     . TYR A 1 110 ? 15.926  36.736  3.099   1.00 15.84  ? 110  TYR A C     1 
ATOM   850   O O     . TYR A 1 110 ? 16.416  36.739  4.223   1.00 15.72  ? 110  TYR A O     1 
ATOM   851   C CB    . TYR A 1 110 ? 14.553  34.740  2.352   1.00 15.65  ? 110  TYR A CB    1 
ATOM   852   C CG    . TYR A 1 110 ? 13.386  33.932  2.864   1.00 15.58  ? 110  TYR A CG    1 
ATOM   853   C CD1   . TYR A 1 110 ? 12.213  33.797  2.114   1.00 14.78  ? 110  TYR A CD1   1 
ATOM   854   C CD2   . TYR A 1 110 ? 13.448  33.331  4.120   1.00 15.56  ? 110  TYR A CD2   1 
ATOM   855   C CE1   . TYR A 1 110 ? 11.129  33.048  2.605   1.00 16.02  ? 110  TYR A CE1   1 
ATOM   856   C CE2   . TYR A 1 110 ? 12.378  32.603  4.632   1.00 16.90  ? 110  TYR A CE2   1 
ATOM   857   C CZ    . TYR A 1 110 ? 11.225  32.457  3.874   1.00 16.68  ? 110  TYR A CZ    1 
ATOM   858   O OH    . TYR A 1 110 ? 10.193  31.733  4.410   1.00 15.81  ? 110  TYR A OH    1 
ATOM   859   N N     . ARG A 1 111 ? 16.536  37.233  2.028   1.00 16.59  ? 111  ARG A N     1 
ATOM   860   C CA    . ARG A 1 111 ? 17.853  37.862  2.064   1.00 17.08  ? 111  ARG A CA    1 
ATOM   861   C C     . ARG A 1 111 ? 17.839  39.137  2.899   1.00 16.28  ? 111  ARG A C     1 
ATOM   862   O O     . ARG A 1 111 ? 18.689  39.301  3.780   1.00 16.51  ? 111  ARG A O     1 
ATOM   863   C CB    . ARG A 1 111 ? 18.345  38.117  0.636   1.00 17.44  ? 111  ARG A CB    1 
ATOM   864   C CG    . ARG A 1 111 ? 19.711  38.799  0.530   1.00 20.30  ? 111  ARG A CG    1 
ATOM   865   C CD    . ARG A 1 111 ? 20.427  38.446  -0.769  1.00 22.88  ? 111  ARG A CD    1 
ATOM   866   N NE    . ARG A 1 111 ? 21.065  37.131  -0.672  1.00 25.68  ? 111  ARG A NE    1 
ATOM   867   C CZ    . ARG A 1 111 ? 20.846  36.103  -1.490  1.00 25.71  ? 111  ARG A CZ    1 
ATOM   868   N NH1   . ARG A 1 111 ? 19.998  36.202  -2.516  1.00 26.41  ? 111  ARG A NH1   1 
ATOM   869   N NH2   . ARG A 1 111 ? 21.494  34.966  -1.276  1.00 25.98  ? 111  ARG A NH2   1 
ATOM   870   N N     . GLU A 1 112 ? 16.868  40.017  2.642   1.00 15.85  ? 112  GLU A N     1 
ATOM   871   C CA    . GLU A 1 112 ? 16.651  41.213  3.481   1.00 15.70  ? 112  GLU A CA    1 
ATOM   872   C C     . GLU A 1 112 ? 16.452  40.875  4.963   1.00 15.01  ? 112  GLU A C     1 
ATOM   873   O O     . GLU A 1 112 ? 17.090  41.463  5.833   1.00 15.01  ? 112  GLU A O     1 
ATOM   874   C CB    . GLU A 1 112 ? 15.479  42.056  2.955   1.00 15.77  ? 112  GLU A CB    1 
ATOM   875   C CG    . GLU A 1 112 ? 15.839  42.848  1.701   1.00 18.89  ? 112  GLU A CG    1 
ATOM   876   C CD    . GLU A 1 112 ? 14.651  43.234  0.816   1.00 22.32  ? 112  GLU A CD    1 
ATOM   877   O OE1   . GLU A 1 112 ? 13.494  42.943  1.157   1.00 21.56  ? 112  GLU A OE1   1 
ATOM   878   O OE2   . GLU A 1 112 ? 14.894  43.848  -0.254  1.00 25.82  ? 112  GLU A OE2   1 
ATOM   879   N N     . LEU A 1 113 ? 15.575  39.919  5.253   1.00 14.23  ? 113  LEU A N     1 
ATOM   880   C CA    . LEU A 1 113 ? 15.296  39.575  6.636   1.00 13.76  ? 113  LEU A CA    1 
ATOM   881   C C     . LEU A 1 113 ? 16.522  38.962  7.317   1.00 13.92  ? 113  LEU A C     1 
ATOM   882   O O     . LEU A 1 113 ? 16.846  39.321  8.437   1.00 13.81  ? 113  LEU A O     1 
ATOM   883   C CB    . LEU A 1 113 ? 14.094  38.637  6.721   1.00 13.54  ? 113  LEU A CB    1 
ATOM   884   C CG    . LEU A 1 113 ? 13.736  38.047  8.073   1.00 12.81  ? 113  LEU A CG    1 
ATOM   885   C CD1   . LEU A 1 113 ? 13.182  39.117  9.020   1.00 10.32  ? 113  LEU A CD1   1 
ATOM   886   C CD2   . LEU A 1 113 ? 12.715  36.959  7.814   1.00 14.33  ? 113  LEU A CD2   1 
ATOM   887   N N     . HIS A 1 114 ? 17.200  38.055  6.621   1.00 14.04  ? 114  HIS A N     1 
ATOM   888   C CA    . HIS A 1 114 ? 18.454  37.468  7.103   1.00 14.43  ? 114  HIS A CA    1 
ATOM   889   C C     . HIS A 1 114 ? 19.501  38.538  7.496   1.00 14.39  ? 114  HIS A C     1 
ATOM   890   O O     . HIS A 1 114 ? 20.091  38.479  8.571   1.00 14.24  ? 114  HIS A O     1 
ATOM   891   C CB    . HIS A 1 114 ? 18.998  36.530  6.027   1.00 14.11  ? 114  HIS A CB    1 
ATOM   892   C CG    . HIS A 1 114 ? 20.326  35.922  6.351   1.00 15.94  ? 114  HIS A CG    1 
ATOM   893   N ND1   . HIS A 1 114 ? 21.515  36.450  5.893   1.00 18.02  ? 114  HIS A ND1   1 
ATOM   894   C CD2   . HIS A 1 114 ? 20.654  34.824  7.074   1.00 16.74  ? 114  HIS A CD2   1 
ATOM   895   C CE1   . HIS A 1 114 ? 22.518  35.698  6.311   1.00 18.51  ? 114  HIS A CE1   1 
ATOM   896   N NE2   . HIS A 1 114 ? 22.023  34.709  7.035   1.00 19.39  ? 114  HIS A NE2   1 
ATOM   897   N N     . ARG A 1 115 ? 19.715  39.517  6.625   1.00 14.43  ? 115  ARG A N     1 
ATOM   898   C CA    . ARG A 1 115 ? 20.708  40.544  6.871   1.00 15.34  ? 115  ARG A CA    1 
ATOM   899   C C     . ARG A 1 115 ? 20.436  41.271  8.194   1.00 15.14  ? 115  ARG A C     1 
ATOM   900   O O     . ARG A 1 115 ? 21.338  41.413  9.025   1.00 14.61  ? 115  ARG A O     1 
ATOM   901   C CB    . ARG A 1 115 ? 20.764  41.530  5.702   1.00 14.96  ? 115  ARG A CB    1 
ATOM   902   C CG    . ARG A 1 115 ? 21.804  42.640  5.886   1.00 17.52  ? 115  ARG A CG    1 
ATOM   903   C CD    . ARG A 1 115 ? 21.902  43.581  4.671   1.00 18.30  ? 115  ARG A CD    1 
ATOM   904   N NE    . ARG A 1 115 ? 22.564  44.840  5.053   1.00 25.16  ? 115  ARG A NE    1 
ATOM   905   C CZ    . ARG A 1 115 ? 23.823  45.159  4.750   1.00 26.73  ? 115  ARG A CZ    1 
ATOM   906   N NH1   . ARG A 1 115 ? 24.578  44.323  4.034   1.00 27.61  ? 115  ARG A NH1   1 
ATOM   907   N NH2   . ARG A 1 115 ? 24.330  46.323  5.157   1.00 27.70  ? 115  ARG A NH2   1 
ATOM   908   N N     . ASP A 1 116 ? 19.193  41.717  8.382   1.00 15.31  ? 116  ASP A N     1 
ATOM   909   C CA    . ASP A 1 116 ? 18.814  42.427  9.599   1.00 16.39  ? 116  ASP A CA    1 
ATOM   910   C C     . ASP A 1 116 ? 18.811  41.547  10.848  1.00 15.99  ? 116  ASP A C     1 
ATOM   911   O O     . ASP A 1 116 ? 19.136  42.012  11.940  1.00 15.97  ? 116  ASP A O     1 
ATOM   912   C CB    . ASP A 1 116 ? 17.486  43.163  9.416   1.00 16.40  ? 116  ASP A CB    1 
ATOM   913   C CG    . ASP A 1 116 ? 17.678  44.531  8.795   1.00 19.10  ? 116  ASP A CG    1 
ATOM   914   O OD1   . ASP A 1 116 ? 18.858  44.958  8.638   1.00 19.63  ? 116  ASP A OD1   1 
ATOM   915   O OD2   . ASP A 1 116 ? 16.657  45.190  8.468   1.00 21.95  ? 116  ASP A OD2   1 
ATOM   916   N N     . VAL A 1 117 ? 18.493  40.268  10.674  1.00 16.05  ? 117  VAL A N     1 
ATOM   917   C CA    . VAL A 1 117 ? 18.570  39.318  11.783  1.00 16.07  ? 117  VAL A CA    1 
ATOM   918   C C     . VAL A 1 117 ? 20.031  39.149  12.236  1.00 16.46  ? 117  VAL A C     1 
ATOM   919   O O     . VAL A 1 117 ? 20.315  39.167  13.439  1.00 17.24  ? 117  VAL A O     1 
ATOM   920   C CB    . VAL A 1 117 ? 17.900  37.965  11.445  1.00 15.88  ? 117  VAL A CB    1 
ATOM   921   C CG1   . VAL A 1 117 ? 18.307  36.881  12.452  1.00 15.44  ? 117  VAL A CG1   1 
ATOM   922   C CG2   . VAL A 1 117 ? 16.375  38.119  11.374  1.00 14.10  ? 117  VAL A CG2   1 
ATOM   923   N N     . CYS A 1 118 ? 20.949  39.025  11.276  1.00 16.52  ? 118  CYS A N     1 
ATOM   924   C CA    . CYS A 1 118 ? 22.386  38.971  11.578  1.00 16.46  ? 118  CYS A CA    1 
ATOM   925   C C     . CYS A 1 118 ? 22.894  40.244  12.257  1.00 16.78  ? 118  CYS A C     1 
ATOM   926   O O     . CYS A 1 118 ? 23.641  40.166  13.232  1.00 17.02  ? 118  CYS A O     1 
ATOM   927   C CB    . CYS A 1 118 ? 23.203  38.691  10.313  1.00 16.49  ? 118  CYS A CB    1 
ATOM   928   S SG    . CYS A 1 118 ? 22.947  37.032  9.607   1.00 16.13  ? 118  CYS A SG    1 
ATOM   929   N N     . ARG A 1 119 ? 22.500  41.412  11.745  1.00 16.94  ? 119  ARG A N     1 
ATOM   930   C CA    . ARG A 1 119 ? 22.912  42.686  12.343  1.00 17.21  ? 119  ARG A CA    1 
ATOM   931   C C     . ARG A 1 119 ? 22.414  42.770  13.779  1.00 17.00  ? 119  ARG A C     1 
ATOM   932   O O     . ARG A 1 119 ? 23.170  43.158  14.664  1.00 17.69  ? 119  ARG A O     1 
ATOM   933   C CB    . ARG A 1 119 ? 22.405  43.904  11.555  1.00 16.96  ? 119  ARG A CB    1 
ATOM   934   C CG    . ARG A 1 119 ? 23.016  44.082  10.185  1.00 17.41  ? 119  ARG A CG    1 
ATOM   935   C CD    . ARG A 1 119 ? 22.937  45.534  9.717   1.00 18.49  ? 119  ARG A CD    1 
ATOM   936   N NE    . ARG A 1 119 ? 21.575  45.960  9.401   1.00 19.41  ? 119  ARG A NE    1 
ATOM   937   C CZ    . ARG A 1 119 ? 21.251  47.184  8.988   1.00 21.91  ? 119  ARG A CZ    1 
ATOM   938   N NH1   . ARG A 1 119 ? 22.195  48.106  8.838   1.00 23.29  ? 119  ARG A NH1   1 
ATOM   939   N NH2   . ARG A 1 119 ? 19.987  47.494  8.714   1.00 20.72  ? 119  ARG A NH2   1 
ATOM   940   N N     . PHE A 1 120 ? 21.154  42.387  14.005  1.00 16.71  ? 120  PHE A N     1 
ATOM   941   C CA    . PHE A 1 120 ? 20.551  42.471  15.341  1.00 15.81  ? 120  PHE A CA    1 
ATOM   942   C C     . PHE A 1 120 ? 21.108  41.441  16.318  1.00 15.46  ? 120  PHE A C     1 
ATOM   943   O O     . PHE A 1 120 ? 21.218  41.710  17.514  1.00 15.22  ? 120  PHE A O     1 
ATOM   944   C CB    . PHE A 1 120 ? 19.015  42.418  15.301  1.00 15.56  ? 120  PHE A CB    1 
ATOM   945   C CG    . PHE A 1 120 ? 18.377  43.011  16.531  1.00 15.69  ? 120  PHE A CG    1 
ATOM   946   C CD1   . PHE A 1 120 ? 18.445  44.387  16.771  1.00 15.54  ? 120  PHE A CD1   1 
ATOM   947   C CD2   . PHE A 1 120 ? 17.778  42.195  17.487  1.00 15.10  ? 120  PHE A CD2   1 
ATOM   948   C CE1   . PHE A 1 120 ? 17.891  44.937  17.934  1.00 14.86  ? 120  PHE A CE1   1 
ATOM   949   C CE2   . PHE A 1 120 ? 17.222  42.731  18.649  1.00 14.04  ? 120  PHE A CE2   1 
ATOM   950   C CZ    . PHE A 1 120 ? 17.276  44.103  18.870  1.00 14.85  ? 120  PHE A CZ    1 
ATOM   951   N N     . ALA A 1 121 ? 21.447  40.262  15.795  1.00 15.52  ? 121  ALA A N     1 
ATOM   952   C CA    . ALA A 1 121 ? 22.163  39.244  16.556  1.00 15.14  ? 121  ALA A CA    1 
ATOM   953   C C     . ALA A 1 121 ? 23.486  39.811  17.067  1.00 15.03  ? 121  ALA A C     1 
ATOM   954   O O     . ALA A 1 121 ? 23.803  39.674  18.250  1.00 14.83  ? 121  ALA A O     1 
ATOM   955   C CB    . ALA A 1 121 ? 22.407  38.019  15.702  1.00 15.25  ? 121  ALA A CB    1 
ATOM   956   N N     . ASN A 1 122 ? 24.256  40.439  16.174  1.00 14.85  ? 122  ASN A N     1 
ATOM   957   C CA    . ASN A 1 122 ? 25.498  41.117  16.581  1.00 15.38  ? 122  ASN A CA    1 
ATOM   958   C C     . ASN A 1 122 ? 25.218  42.265  17.556  1.00 15.29  ? 122  ASN A C     1 
ATOM   959   O O     . ASN A 1 122 ? 25.944  42.437  18.537  1.00 15.07  ? 122  ASN A O     1 
ATOM   960   C CB    . ASN A 1 122 ? 26.326  41.595  15.374  1.00 14.96  ? 122  ASN A CB    1 
ATOM   961   C CG    . ASN A 1 122 ? 27.048  40.439  14.662  1.00 16.31  ? 122  ASN A CG    1 
ATOM   962   O OD1   . ASN A 1 122 ? 27.536  39.506  15.303  1.00 17.58  ? 122  ASN A OD1   1 
ATOM   963   N ND2   . ASN A 1 122 ? 27.103  40.497  13.342  1.00 16.09  ? 122  ASN A ND2   1 
ATOM   964   N N     . THR A 1 123 ? 24.148  43.019  17.295  1.00 15.05  ? 123  THR A N     1 
ATOM   965   C CA    . THR A 1 123 ? 23.726  44.091  18.205  1.00 15.70  ? 123  THR A CA    1 
ATOM   966   C C     . THR A 1 123 ? 23.525  43.572  19.623  1.00 15.58  ? 123  THR A C     1 
ATOM   967   O O     . THR A 1 123 ? 24.016  44.173  20.585  1.00 16.27  ? 123  THR A O     1 
ATOM   968   C CB    . THR A 1 123 ? 22.453  44.797  17.701  1.00 15.40  ? 123  THR A CB    1 
ATOM   969   O OG1   . THR A 1 123 ? 22.791  45.578  16.555  1.00 16.64  ? 123  THR A OG1   1 
ATOM   970   C CG2   . THR A 1 123 ? 21.877  45.707  18.770  1.00 15.52  ? 123  THR A CG2   1 
ATOM   971   N N     . LEU A 1 124 ? 22.833  42.437  19.734  1.00 15.69  ? 124  LEU A N     1 
ATOM   972   C CA    . LEU A 1 124 ? 22.552  41.794  21.020  1.00 15.73  ? 124  LEU A CA    1 
ATOM   973   C C     . LEU A 1 124 ? 23.814  41.300  21.731  1.00 16.07  ? 124  LEU A C     1 
ATOM   974   O O     . LEU A 1 124 ? 23.979  41.496  22.952  1.00 15.95  ? 124  LEU A O     1 
ATOM   975   C CB    . LEU A 1 124 ? 21.565  40.633  20.823  1.00 15.66  ? 124  LEU A CB    1 
ATOM   976   C CG    . LEU A 1 124 ? 20.085  40.968  20.565  1.00 15.22  ? 124  LEU A CG    1 
ATOM   977   C CD1   . LEU A 1 124 ? 19.309  39.736  20.091  1.00 13.46  ? 124  LEU A CD1   1 
ATOM   978   C CD2   . LEU A 1 124 ? 19.423  41.582  21.806  1.00 11.77  ? 124  LEU A CD2   1 
ATOM   979   N N     . LEU A 1 125 ? 24.687  40.651  20.967  1.00 16.10  ? 125  LEU A N     1 
ATOM   980   C CA    . LEU A 1 125 ? 25.977  40.171  21.475  1.00 16.50  ? 125  LEU A CA    1 
ATOM   981   C C     . LEU A 1 125 ? 26.855  41.298  21.997  1.00 16.80  ? 125  LEU A C     1 
ATOM   982   O O     . LEU A 1 125 ? 27.491  41.156  23.046  1.00 16.82  ? 125  LEU A O     1 
ATOM   983   C CB    . LEU A 1 125 ? 26.731  39.377  20.398  1.00 15.78  ? 125  LEU A CB    1 
ATOM   984   C CG    . LEU A 1 125 ? 26.092  38.036  19.997  1.00 16.49  ? 125  LEU A CG    1 
ATOM   985   C CD1   . LEU A 1 125 ? 26.701  37.487  18.686  1.00 13.76  ? 125  LEU A CD1   1 
ATOM   986   C CD2   . LEU A 1 125 ? 26.126  36.999  21.132  1.00 13.86  ? 125  LEU A CD2   1 
ATOM   987   N N     . ASP A 1 126 ? 26.877  42.416  21.274  1.00 17.40  ? 126  ASP A N     1 
ATOM   988   C CA    . ASP A 1 126 ? 27.712  43.558  21.654  1.00 18.41  ? 126  ASP A CA    1 
ATOM   989   C C     . ASP A 1 126 ? 27.188  44.271  22.892  1.00 18.79  ? 126  ASP A C     1 
ATOM   990   O O     . ASP A 1 126 ? 27.938  44.934  23.606  1.00 18.83  ? 126  ASP A O     1 
ATOM   991   C CB    . ASP A 1 126 ? 27.832  44.542  20.497  1.00 18.67  ? 126  ASP A CB    1 
ATOM   992   C CG    . ASP A 1 126 ? 28.760  44.047  19.396  1.00 20.27  ? 126  ASP A CG    1 
ATOM   993   O OD1   . ASP A 1 126 ? 29.497  43.039  19.588  1.00 20.38  ? 126  ASP A OD1   1 
ATOM   994   O OD2   . ASP A 1 126 ? 28.755  44.687  18.325  1.00 21.87  ? 126  ASP A OD2   1 
ATOM   995   N N     . LEU A 1 127 ? 25.892  44.121  23.148  1.00 19.54  ? 127  LEU A N     1 
ATOM   996   C CA    . LEU A 1 127 ? 25.269  44.727  24.321  1.00 19.77  ? 127  LEU A CA    1 
ATOM   997   C C     . LEU A 1 127 ? 25.518  43.855  25.556  1.00 19.59  ? 127  LEU A C     1 
ATOM   998   O O     . LEU A 1 127 ? 25.166  44.239  26.676  1.00 19.84  ? 127  LEU A O     1 
ATOM   999   C CB    . LEU A 1 127 ? 23.774  44.912  24.065  1.00 19.64  ? 127  LEU A CB    1 
ATOM   1000  C CG    . LEU A 1 127 ? 23.051  46.183  24.507  1.00 21.06  ? 127  LEU A CG    1 
ATOM   1001  C CD1   . LEU A 1 127 ? 23.984  47.384  24.712  1.00 20.32  ? 127  LEU A CD1   1 
ATOM   1002  C CD2   . LEU A 1 127 ? 21.949  46.509  23.504  1.00 21.10  ? 127  LEU A CD2   1 
ATOM   1003  N N     . GLY A 1 128 ? 26.122  42.684  25.330  1.00 19.24  ? 128  GLY A N     1 
ATOM   1004  C CA    . GLY A 1 128 ? 26.459  41.742  26.389  1.00 18.45  ? 128  GLY A CA    1 
ATOM   1005  C C     . GLY A 1 128 ? 25.455  40.613  26.590  1.00 18.64  ? 128  GLY A C     1 
ATOM   1006  O O     . GLY A 1 128 ? 25.566  39.851  27.564  1.00 18.46  ? 128  GLY A O     1 
ATOM   1007  N N     . ILE A 1 129 ? 24.469  40.496  25.698  1.00 18.04  ? 129  ILE A N     1 
ATOM   1008  C CA    . ILE A 1 129 ? 23.478  39.416  25.808  1.00 17.68  ? 129  ILE A CA    1 
ATOM   1009  C C     . ILE A 1 129 ? 24.161  38.107  25.410  1.00 18.13  ? 129  ILE A C     1 
ATOM   1010  O O     . ILE A 1 129 ? 24.901  38.064  24.414  1.00 17.73  ? 129  ILE A O     1 
ATOM   1011  C CB    . ILE A 1 129 ? 22.206  39.672  24.945  1.00 17.60  ? 129  ILE A CB    1 
ATOM   1012  C CG1   . ILE A 1 129 ? 21.491  40.976  25.361  1.00 17.35  ? 129  ILE A CG1   1 
ATOM   1013  C CG2   . ILE A 1 129 ? 21.257  38.450  24.928  1.00 16.69  ? 129  ILE A CG2   1 
ATOM   1014  C CD1   . ILE A 1 129 ? 20.931  41.018  26.789  1.00 17.80  ? 129  ILE A CD1   1 
ATOM   1015  N N     . LYS A 1 130 ? 23.920  37.057  26.202  1.00 18.09  ? 130  LYS A N     1 
ATOM   1016  C CA    . LYS A 1 130 ? 24.553  35.761  26.005  1.00 18.59  ? 130  LYS A CA    1 
ATOM   1017  C C     . LYS A 1 130 ? 23.517  34.663  25.830  1.00 18.13  ? 130  LYS A C     1 
ATOM   1018  O O     . LYS A 1 130 ? 22.347  34.844  26.159  1.00 17.97  ? 130  LYS A O     1 
ATOM   1019  C CB    . LYS A 1 130 ? 25.473  35.431  27.193  1.00 19.52  ? 130  LYS A CB    1 
ATOM   1020  C CG    . LYS A 1 130 ? 26.487  36.546  27.517  1.00 21.91  ? 130  LYS A CG    1 
ATOM   1021  C CD    . LYS A 1 130 ? 27.791  36.032  28.113  1.00 24.75  ? 130  LYS A CD    1 
ATOM   1022  C CE    . LYS A 1 130 ? 28.846  35.781  27.027  1.00 26.47  ? 130  LYS A CE    1 
ATOM   1023  N N     . LYS A 1 131 ? 23.949  33.523  25.303  1.00 17.69  ? 131  LYS A N     1 
ATOM   1024  C CA    . LYS A 1 131 ? 23.089  32.354  25.215  1.00 17.41  ? 131  LYS A CA    1 
ATOM   1025  C C     . LYS A 1 131 ? 22.449  32.113  26.585  1.00 16.81  ? 131  LYS A C     1 
ATOM   1026  O O     . LYS A 1 131 ? 23.125  32.141  27.604  1.00 16.40  ? 131  LYS A O     1 
ATOM   1027  C CB    . LYS A 1 131 ? 23.903  31.126  24.781  1.00 17.33  ? 131  LYS A CB    1 
ATOM   1028  C CG    . LYS A 1 131 ? 23.127  29.806  24.846  1.00 17.59  ? 131  LYS A CG    1 
ATOM   1029  C CD    . LYS A 1 131 ? 23.910  28.665  24.245  1.00 17.94  ? 131  LYS A CD    1 
ATOM   1030  C CE    . LYS A 1 131 ? 23.090  27.385  24.262  1.00 18.64  ? 131  LYS A CE    1 
ATOM   1031  N NZ    . LYS A 1 131 ? 23.899  26.196  23.859  1.00 18.57  ? 131  LYS A NZ    1 
ATOM   1032  N N     . GLY A 1 132 ? 21.144  31.891  26.605  1.00 16.81  ? 132  GLY A N     1 
ATOM   1033  C CA    . GLY A 1 132 ? 20.441  31.606  27.852  1.00 16.61  ? 132  GLY A CA    1 
ATOM   1034  C C     . GLY A 1 132 ? 19.857  32.817  28.562  1.00 16.54  ? 132  GLY A C     1 
ATOM   1035  O O     . GLY A 1 132 ? 18.960  32.665  29.384  1.00 17.03  ? 132  GLY A O     1 
ATOM   1036  N N     . ASP A 1 133 ? 20.367  34.017  28.287  1.00 16.18  ? 133  ASP A N     1 
ATOM   1037  C CA    . ASP A 1 133 ? 19.725  35.225  28.813  1.00 15.99  ? 133  ASP A CA    1 
ATOM   1038  C C     . ASP A 1 133 ? 18.304  35.353  28.264  1.00 15.72  ? 133  ASP A C     1 
ATOM   1039  O O     . ASP A 1 133 ? 18.063  35.066  27.085  1.00 15.44  ? 133  ASP A O     1 
ATOM   1040  C CB    . ASP A 1 133 ? 20.515  36.486  28.459  1.00 16.38  ? 133  ASP A CB    1 
ATOM   1041  C CG    . ASP A 1 133 ? 21.863  36.551  29.142  1.00 16.60  ? 133  ASP A CG    1 
ATOM   1042  O OD1   . ASP A 1 133 ? 22.162  35.709  30.009  1.00 17.26  ? 133  ASP A OD1   1 
ATOM   1043  O OD2   . ASP A 1 133 ? 22.635  37.463  28.794  1.00 19.59  ? 133  ASP A OD2   1 
ATOM   1044  N N     . VAL A 1 134 ? 17.374  35.746  29.137  1.00 15.12  ? 134  VAL A N     1 
ATOM   1045  C CA    . VAL A 1 134 ? 16.013  36.080  28.742  1.00 15.10  ? 134  VAL A CA    1 
ATOM   1046  C C     . VAL A 1 134 ? 15.931  37.523  28.227  1.00 14.96  ? 134  VAL A C     1 
ATOM   1047  O O     . VAL A 1 134 ? 16.401  38.472  28.882  1.00 14.52  ? 134  VAL A O     1 
ATOM   1048  C CB    . VAL A 1 134 ? 15.001  35.882  29.905  1.00 15.72  ? 134  VAL A CB    1 
ATOM   1049  C CG1   . VAL A 1 134 ? 13.553  36.115  29.414  1.00 15.39  ? 134  VAL A CG1   1 
ATOM   1050  C CG2   . VAL A 1 134 ? 15.137  34.484  30.522  1.00 15.20  ? 134  VAL A CG2   1 
ATOM   1051  N N     . VAL A 1 135 ? 15.354  37.680  27.039  1.00 14.44  ? 135  VAL A N     1 
ATOM   1052  C CA    . VAL A 1 135 ? 15.114  39.008  26.472  1.00 13.90  ? 135  VAL A CA    1 
ATOM   1053  C C     . VAL A 1 135 ? 13.601  39.274  26.405  1.00 14.40  ? 135  VAL A C     1 
ATOM   1054  O O     . VAL A 1 135 ? 12.855  38.467  25.837  1.00 13.97  ? 135  VAL A O     1 
ATOM   1055  C CB    . VAL A 1 135 ? 15.748  39.144  25.059  1.00 14.19  ? 135  VAL A CB    1 
ATOM   1056  C CG1   . VAL A 1 135 ? 15.517  40.539  24.471  1.00 12.14  ? 135  VAL A CG1   1 
ATOM   1057  C CG2   . VAL A 1 135 ? 17.236  38.791  25.087  1.00 12.43  ? 135  VAL A CG2   1 
ATOM   1058  N N     . ALA A 1 136 ? 13.158  40.388  26.994  1.00 13.89  ? 136  ALA A N     1 
ATOM   1059  C CA    . ALA A 1 136 ? 11.753  40.784  26.955  1.00 14.15  ? 136  ALA A CA    1 
ATOM   1060  C C     . ALA A 1 136 ? 11.442  41.612  25.717  1.00 14.77  ? 136  ALA A C     1 
ATOM   1061  O O     . ALA A 1 136 ? 12.096  42.632  25.440  1.00 14.97  ? 136  ALA A O     1 
ATOM   1062  C CB    . ALA A 1 136 ? 11.373  41.551  28.202  1.00 14.30  ? 136  ALA A CB    1 
ATOM   1063  N N     . ILE A 1 137 ? 10.446  41.161  24.958  1.00 14.53  ? 137  ILE A N     1 
ATOM   1064  C CA    . ILE A 1 137 ? 10.027  41.856  23.759  1.00 14.53  ? 137  ILE A CA    1 
ATOM   1065  C C     . ILE A 1 137 ? 8.594   42.369  23.933  1.00 14.61  ? 137  ILE A C     1 
ATOM   1066  O O     . ILE A 1 137 ? 7.675   41.584  24.149  1.00 14.68  ? 137  ILE A O     1 
ATOM   1067  C CB    . ILE A 1 137 ? 10.177  40.954  22.523  1.00 14.47  ? 137  ILE A CB    1 
ATOM   1068  C CG1   . ILE A 1 137 ? 11.643  40.495  22.401  1.00 14.10  ? 137  ILE A CG1   1 
ATOM   1069  C CG2   . ILE A 1 137 ? 9.714   41.696  21.276  1.00 13.79  ? 137  ILE A CG2   1 
ATOM   1070  C CD1   . ILE A 1 137 ? 11.900  39.392  21.376  1.00 14.92  ? 137  ILE A CD1   1 
ATOM   1071  N N     . TYR A 1 138 ? 8.429   43.691  23.863  1.00 14.43  ? 138  TYR A N     1 
ATOM   1072  C CA    . TYR A 1 138 ? 7.130   44.355  24.057  1.00 14.59  ? 138  TYR A CA    1 
ATOM   1073  C C     . TYR A 1 138 ? 6.860   45.271  22.842  1.00 14.82  ? 138  TYR A C     1 
ATOM   1074  O O     . TYR A 1 138 ? 7.077   46.504  22.862  1.00 14.84  ? 138  TYR A O     1 
ATOM   1075  C CB    . TYR A 1 138 ? 7.142   45.093  25.403  1.00 14.49  ? 138  TYR A CB    1 
ATOM   1076  C CG    . TYR A 1 138 ? 5.857   45.730  25.870  1.00 14.94  ? 138  TYR A CG    1 
ATOM   1077  C CD1   . TYR A 1 138 ? 4.689   44.978  26.092  1.00 15.12  ? 138  TYR A CD1   1 
ATOM   1078  C CD2   . TYR A 1 138 ? 5.822   47.088  26.150  1.00 14.91  ? 138  TYR A CD2   1 
ATOM   1079  C CE1   . TYR A 1 138 ? 3.510   45.595  26.542  1.00 13.74  ? 138  TYR A CE1   1 
ATOM   1080  C CE2   . TYR A 1 138 ? 4.667   47.712  26.607  1.00 15.20  ? 138  TYR A CE2   1 
ATOM   1081  C CZ    . TYR A 1 138 ? 3.509   46.980  26.802  1.00 15.68  ? 138  TYR A CZ    1 
ATOM   1082  O OH    . TYR A 1 138 ? 2.386   47.670  27.285  1.00 11.94  ? 138  TYR A OH    1 
ATOM   1083  N N     . MET A 1 139 ? 6.384   44.647  21.773  1.00 14.57  ? 139  MET A N     1 
ATOM   1084  C CA    . MET A 1 139 ? 6.401   45.264  20.456  1.00 15.25  ? 139  MET A CA    1 
ATOM   1085  C C     . MET A 1 139 ? 5.022   45.261  19.813  1.00 15.00  ? 139  MET A C     1 
ATOM   1086  O O     . MET A 1 139 ? 4.199   44.416  20.144  1.00 15.52  ? 139  MET A O     1 
ATOM   1087  C CB    . MET A 1 139 ? 7.366   44.486  19.550  1.00 15.48  ? 139  MET A CB    1 
ATOM   1088  C CG    . MET A 1 139 ? 8.845   44.662  19.881  1.00 17.99  ? 139  MET A CG    1 
ATOM   1089  S SD    . MET A 1 139 ? 9.408   46.276  19.329  1.00 23.08  ? 139  MET A SD    1 
ATOM   1090  C CE    . MET A 1 139 ? 10.003  45.887  17.694  1.00 17.18  ? 139  MET A CE    1 
ATOM   1091  N N     . PRO A 1 140 ? 4.773   46.201  18.873  1.00 14.80  ? 140  PRO A N     1 
ATOM   1092  C CA    . PRO A 1 140 ? 3.566   46.118  18.053  1.00 14.10  ? 140  PRO A CA    1 
ATOM   1093  C C     . PRO A 1 140 ? 3.828   45.197  16.859  1.00 13.38  ? 140  PRO A C     1 
ATOM   1094  O O     . PRO A 1 140 ? 4.938   44.650  16.740  1.00 13.21  ? 140  PRO A O     1 
ATOM   1095  C CB    . PRO A 1 140 ? 3.356   47.562  17.584  1.00 14.63  ? 140  PRO A CB    1 
ATOM   1096  C CG    . PRO A 1 140 ? 4.724   48.194  17.603  1.00 13.98  ? 140  PRO A CG    1 
ATOM   1097  C CD    . PRO A 1 140 ? 5.624   47.354  18.501  1.00 14.61  ? 140  PRO A CD    1 
ATOM   1098  N N     . MET A 1 141 ? 2.828   45.040  15.984  1.00 12.48  ? 141  MET A N     1 
ATOM   1099  C CA    . MET A 1 141 ? 2.908   44.120  14.850  1.00 11.46  ? 141  MET A CA    1 
ATOM   1100  C C     . MET A 1 141 ? 3.646   44.773  13.697  1.00 11.47  ? 141  MET A C     1 
ATOM   1101  O O     . MET A 1 141 ? 3.045   45.195  12.694  1.00 10.63  ? 141  MET A O     1 
ATOM   1102  C CB    . MET A 1 141 ? 1.519   43.606  14.434  1.00 11.61  ? 141  MET A CB    1 
ATOM   1103  C CG    . MET A 1 141 ? 0.928   42.561  15.402  1.00 11.12  ? 141  MET A CG    1 
ATOM   1104  S SD    . MET A 1 141 ? 1.675   40.938  15.131  1.00 13.71  ? 141  MET A SD    1 
ATOM   1105  C CE    . MET A 1 141 ? 0.682   40.350  13.768  1.00 11.64  ? 141  MET A CE    1 
ATOM   1106  N N     . VAL A 1 142 ? 4.967   44.847  13.866  1.00 11.59  ? 142  VAL A N     1 
ATOM   1107  C CA    . VAL A 1 142 ? 5.876   45.405  12.871  1.00 12.46  ? 142  VAL A CA    1 
ATOM   1108  C C     . VAL A 1 142 ? 6.984   44.359  12.654  1.00 13.15  ? 142  VAL A C     1 
ATOM   1109  O O     . VAL A 1 142 ? 7.258   43.560  13.552  1.00 13.76  ? 142  VAL A O     1 
ATOM   1110  C CB    . VAL A 1 142 ? 6.494   46.738  13.351  1.00 12.50  ? 142  VAL A CB    1 
ATOM   1111  C CG1   . VAL A 1 142 ? 5.434   47.853  13.428  1.00 11.35  ? 142  VAL A CG1   1 
ATOM   1112  C CG2   . VAL A 1 142 ? 7.233   46.542  14.720  1.00 10.89  ? 142  VAL A CG2   1 
ATOM   1113  N N     . PRO A 1 143 ? 7.616   44.353  11.466  1.00 13.43  ? 143  PRO A N     1 
ATOM   1114  C CA    . PRO A 1 143 ? 8.620   43.314  11.109  1.00 13.56  ? 143  PRO A CA    1 
ATOM   1115  C C     . PRO A 1 143 ? 9.806   43.229  12.066  1.00 13.59  ? 143  PRO A C     1 
ATOM   1116  O O     . PRO A 1 143 ? 10.362  42.154  12.267  1.00 13.94  ? 143  PRO A O     1 
ATOM   1117  C CB    . PRO A 1 143 ? 9.105   43.762  9.716   1.00 13.64  ? 143  PRO A CB    1 
ATOM   1118  C CG    . PRO A 1 143 ? 8.008   44.613  9.186   1.00 13.56  ? 143  PRO A CG    1 
ATOM   1119  C CD    . PRO A 1 143 ? 7.432   45.329  10.376  1.00 12.30  ? 143  PRO A CD    1 
ATOM   1120  N N     . GLU A 1 144 ? 10.176  44.349  12.681  1.00 14.16  ? 144  GLU A N     1 
ATOM   1121  C CA    . GLU A 1 144 ? 11.264  44.361  13.669  1.00 13.63  ? 144  GLU A CA    1 
ATOM   1122  C C     . GLU A 1 144 ? 11.022  43.424  14.866  1.00 13.69  ? 144  GLU A C     1 
ATOM   1123  O O     . GLU A 1 144 ? 11.976  42.914  15.440  1.00 13.89  ? 144  GLU A O     1 
ATOM   1124  C CB    . GLU A 1 144 ? 11.537  45.787  14.158  1.00 13.70  ? 144  GLU A CB    1 
ATOM   1125  C CG    . GLU A 1 144 ? 12.103  46.722  13.094  1.00 13.85  ? 144  GLU A CG    1 
ATOM   1126  C CD    . GLU A 1 144 ? 11.034  47.394  12.245  1.00 17.29  ? 144  GLU A CD    1 
ATOM   1127  O OE1   . GLU A 1 144 ? 9.824   47.103  12.394  1.00 18.83  ? 144  GLU A OE1   1 
ATOM   1128  O OE2   . GLU A 1 144 ? 11.411  48.240  11.411  1.00 20.93  ? 144  GLU A OE2   1 
ATOM   1129  N N     . ALA A 1 145 ? 9.761   43.203  15.250  1.00 13.31  ? 145  ALA A N     1 
ATOM   1130  C CA    . ALA A 1 145 ? 9.443   42.224  16.321  1.00 12.58  ? 145  ALA A CA    1 
ATOM   1131  C C     . ALA A 1 145 ? 9.930   40.822  15.936  1.00 12.06  ? 145  ALA A C     1 
ATOM   1132  O O     . ALA A 1 145 ? 10.453  40.071  16.772  1.00 12.09  ? 145  ALA A O     1 
ATOM   1133  C CB    . ALA A 1 145 ? 7.953   42.203  16.616  1.00 11.59  ? 145  ALA A CB    1 
ATOM   1134  N N     . ALA A 1 146 ? 9.751   40.484  14.660  1.00 11.90  ? 146  ALA A N     1 
ATOM   1135  C CA    . ALA A 1 146 ? 10.173  39.189  14.116  1.00 11.79  ? 146  ALA A CA    1 
ATOM   1136  C C     . ALA A 1 146 ? 11.684  39.135  14.086  1.00 11.72  ? 146  ALA A C     1 
ATOM   1137  O O     . ALA A 1 146 ? 12.287  38.141  14.516  1.00 12.17  ? 146  ALA A O     1 
ATOM   1138  C CB    . ALA A 1 146 ? 9.592   38.991  12.716  1.00 11.61  ? 146  ALA A CB    1 
ATOM   1139  N N     . VAL A 1 147 ? 12.289  40.225  13.603  1.00 11.69  ? 147  VAL A N     1 
ATOM   1140  C CA    . VAL A 1 147 ? 13.740  40.381  13.579  1.00 11.59  ? 147  VAL A CA    1 
ATOM   1141  C C     . VAL A 1 147 ? 14.295  40.164  14.978  1.00 12.09  ? 147  VAL A C     1 
ATOM   1142  O O     . VAL A 1 147 ? 15.228  39.390  15.153  1.00 12.13  ? 147  VAL A O     1 
ATOM   1143  C CB    . VAL A 1 147 ? 14.171  41.775  13.032  1.00 11.99  ? 147  VAL A CB    1 
ATOM   1144  C CG1   . VAL A 1 147 ? 15.693  42.017  13.244  1.00 10.59  ? 147  VAL A CG1   1 
ATOM   1145  C CG2   . VAL A 1 147 ? 13.800  41.925  11.543  1.00 10.54  ? 147  VAL A CG2   1 
ATOM   1146  N N     . ALA A 1 148 ? 13.715  40.846  15.964  1.00 12.17  ? 148  ALA A N     1 
ATOM   1147  C CA    . ALA A 1 148 ? 14.114  40.693  17.362  1.00 13.24  ? 148  ALA A CA    1 
ATOM   1148  C C     . ALA A 1 148 ? 13.994  39.248  17.871  1.00 13.39  ? 148  ALA A C     1 
ATOM   1149  O O     . ALA A 1 148 ? 14.915  38.731  18.501  1.00 13.99  ? 148  ALA A O     1 
ATOM   1150  C CB    . ALA A 1 148 ? 13.306  41.654  18.264  1.00 13.18  ? 148  ALA A CB    1 
ATOM   1151  N N     . MET A 1 149 ? 12.861  38.601  17.605  1.00 13.79  ? 149  MET A N     1 
ATOM   1152  C CA    . MET A 1 149 ? 12.649  37.190  18.005  1.00 14.23  ? 149  MET A CA    1 
ATOM   1153  C C     . MET A 1 149 ? 13.618  36.207  17.317  1.00 13.99  ? 149  MET A C     1 
ATOM   1154  O O     . MET A 1 149 ? 14.234  35.359  17.970  1.00 13.92  ? 149  MET A O     1 
ATOM   1155  C CB    . MET A 1 149 ? 11.202  36.773  17.723  1.00 14.35  ? 149  MET A CB    1 
ATOM   1156  C CG    . MET A 1 149 ? 10.189  37.387  18.646  1.00 12.57  ? 149  MET A CG    1 
ATOM   1157  S SD    . MET A 1 149 ? 8.537   37.188  18.005  1.00 15.43  ? 149  MET A SD    1 
ATOM   1158  C CE    . MET A 1 149 ? 8.172   35.464  18.362  1.00 15.28  ? 149  MET A CE    1 
ATOM   1159  N N     . LEU A 1 150 ? 13.753  36.328  16.000  1.00 14.19  ? 150  LEU A N     1 
ATOM   1160  C CA    . LEU A 1 150 ? 14.684  35.476  15.234  1.00 14.33  ? 150  LEU A CA    1 
ATOM   1161  C C     . LEU A 1 150 ? 16.153  35.669  15.616  1.00 14.59  ? 150  LEU A C     1 
ATOM   1162  O O     . LEU A 1 150 ? 16.932  34.699  15.670  1.00 15.63  ? 150  LEU A O     1 
ATOM   1163  C CB    . LEU A 1 150 ? 14.505  35.688  13.733  1.00 14.04  ? 150  LEU A CB    1 
ATOM   1164  C CG    . LEU A 1 150 ? 13.208  35.133  13.123  1.00 14.20  ? 150  LEU A CG    1 
ATOM   1165  C CD1   . LEU A 1 150 ? 12.808  35.971  11.888  1.00 12.58  ? 150  LEU A CD1   1 
ATOM   1166  C CD2   . LEU A 1 150 ? 13.332  33.636  12.794  1.00 12.15  ? 150  LEU A CD2   1 
ATOM   1167  N N     . ALA A 1 151 ? 16.534  36.908  15.900  1.00 14.45  ? 151  ALA A N     1 
ATOM   1168  C CA    . ALA A 1 151 ? 17.892  37.185  16.366  1.00 14.32  ? 151  ALA A CA    1 
ATOM   1169  C C     . ALA A 1 151 ? 18.180  36.613  17.768  1.00 14.20  ? 151  ALA A C     1 
ATOM   1170  O O     . ALA A 1 151 ? 19.277  36.131  18.025  1.00 14.37  ? 151  ALA A O     1 
ATOM   1171  C CB    . ALA A 1 151 ? 18.188  38.664  16.287  1.00 14.13  ? 151  ALA A CB    1 
ATOM   1172  N N     . CYS A 1 152 ? 17.199  36.644  18.666  1.00 14.27  ? 152  CYS A N     1 
ATOM   1173  C CA    . CYS A 1 152 ? 17.350  35.979  19.969  1.00 14.80  ? 152  CYS A CA    1 
ATOM   1174  C C     . CYS A 1 152 ? 17.578  34.466  19.810  1.00 14.53  ? 152  CYS A C     1 
ATOM   1175  O O     . CYS A 1 152 ? 18.476  33.881  20.429  1.00 14.32  ? 152  CYS A O     1 
ATOM   1176  C CB    . CYS A 1 152 ? 16.135  36.245  20.867  1.00 14.98  ? 152  CYS A CB    1 
ATOM   1177  S SG    . CYS A 1 152 ? 16.069  37.919  21.550  1.00 16.59  ? 152  CYS A SG    1 
ATOM   1178  N N     . ALA A 1 153 ? 16.778  33.851  18.948  1.00 14.84  ? 153  ALA A N     1 
ATOM   1179  C CA    . ALA A 1 153 ? 16.863  32.423  18.676  1.00 14.63  ? 153  ALA A CA    1 
ATOM   1180  C C     . ALA A 1 153 ? 18.178  32.024  17.995  1.00 15.05  ? 153  ALA A C     1 
ATOM   1181  O O     . ALA A 1 153 ? 18.694  30.912  18.203  1.00 15.00  ? 153  ALA A O     1 
ATOM   1182  C CB    . ALA A 1 153 ? 15.677  31.994  17.830  1.00 14.33  ? 153  ALA A CB    1 
ATOM   1183  N N     . ARG A 1 154 ? 18.707  32.920  17.163  1.00 15.25  ? 154  ARG A N     1 
ATOM   1184  C CA    . ARG A 1 154 ? 19.963  32.669  16.467  1.00 15.52  ? 154  ARG A CA    1 
ATOM   1185  C C     . ARG A 1 154 ? 21.131  32.503  17.440  1.00 15.82  ? 154  ARG A C     1 
ATOM   1186  O O     . ARG A 1 154 ? 21.971  31.608  17.264  1.00 16.46  ? 154  ARG A O     1 
ATOM   1187  C CB    . ARG A 1 154 ? 20.250  33.795  15.473  1.00 15.62  ? 154  ARG A CB    1 
ATOM   1188  C CG    . ARG A 1 154 ? 21.410  33.526  14.539  1.00 15.48  ? 154  ARG A CG    1 
ATOM   1189  C CD    . ARG A 1 154 ? 21.562  34.654  13.546  1.00 14.96  ? 154  ARG A CD    1 
ATOM   1190  N NE    . ARG A 1 154 ? 22.556  34.391  12.497  1.00 15.98  ? 154  ARG A NE    1 
ATOM   1191  C CZ    . ARG A 1 154 ? 22.288  33.793  11.336  1.00 16.59  ? 154  ARG A CZ    1 
ATOM   1192  N NH1   . ARG A 1 154 ? 21.061  33.345  11.064  1.00 17.05  ? 154  ARG A NH1   1 
ATOM   1193  N NH2   . ARG A 1 154 ? 23.249  33.639  10.440  1.00 15.72  ? 154  ARG A NH2   1 
ATOM   1194  N N     . ILE A 1 155 ? 21.172  33.358  18.461  1.00 15.31  ? 155  ILE A N     1 
ATOM   1195  C CA    . ILE A 1 155 ? 22.280  33.394  19.415  1.00 14.86  ? 155  ILE A CA    1 
ATOM   1196  C C     . ILE A 1 155 ? 21.981  32.573  20.685  1.00 14.86  ? 155  ILE A C     1 
ATOM   1197  O O     . ILE A 1 155 ? 22.760  32.582  21.629  1.00 14.34  ? 155  ILE A O     1 
ATOM   1198  C CB    . ILE A 1 155 ? 22.702  34.880  19.755  1.00 15.22  ? 155  ILE A CB    1 
ATOM   1199  C CG1   . ILE A 1 155 ? 21.641  35.583  20.624  1.00 15.25  ? 155  ILE A CG1   1 
ATOM   1200  C CG2   . ILE A 1 155 ? 22.952  35.671  18.454  1.00 13.84  ? 155  ILE A CG2   1 
ATOM   1201  C CD1   . ILE A 1 155 ? 22.025  36.947  21.134  1.00 14.10  ? 155  ILE A CD1   1 
ATOM   1202  N N     . GLY A 1 156 ? 20.853  31.863  20.696  1.00 14.77  ? 156  GLY A N     1 
ATOM   1203  C CA    . GLY A 1 156 ? 20.473  31.042  21.839  1.00 14.39  ? 156  GLY A CA    1 
ATOM   1204  C C     . GLY A 1 156 ? 20.056  31.830  23.074  1.00 14.90  ? 156  GLY A C     1 
ATOM   1205  O O     . GLY A 1 156 ? 20.108  31.305  24.197  1.00 14.93  ? 156  GLY A O     1 
ATOM   1206  N N     . ALA A 1 157 ? 19.672  33.096  22.890  1.00 14.42  ? 157  ALA A N     1 
ATOM   1207  C CA    . ALA A 1 157 ? 18.991  33.836  23.965  1.00 14.15  ? 157  ALA A CA    1 
ATOM   1208  C C     . ALA A 1 157 ? 17.562  33.347  23.968  1.00 14.24  ? 157  ALA A C     1 
ATOM   1209  O O     . ALA A 1 157 ? 17.087  32.766  22.980  1.00 15.76  ? 157  ALA A O     1 
ATOM   1210  C CB    . ALA A 1 157 ? 19.043  35.327  23.746  1.00 13.56  ? 157  ALA A CB    1 
ATOM   1211  N N     . VAL A 1 158 ? 16.881  33.573  25.076  1.00 13.71  ? 158  VAL A N     1 
ATOM   1212  C CA    . VAL A 1 158 ? 15.556  33.028  25.312  1.00 12.92  ? 158  VAL A CA    1 
ATOM   1213  C C     . VAL A 1 158 ? 14.616  34.210  25.323  1.00 12.56  ? 158  VAL A C     1 
ATOM   1214  O O     . VAL A 1 158 ? 14.598  34.951  26.286  1.00 13.39  ? 158  VAL A O     1 
ATOM   1215  C CB    . VAL A 1 158 ? 15.524  32.301  26.688  1.00 12.62  ? 158  VAL A CB    1 
ATOM   1216  C CG1   . VAL A 1 158 ? 14.119  31.749  27.012  1.00 12.28  ? 158  VAL A CG1   1 
ATOM   1217  C CG2   . VAL A 1 158 ? 16.571  31.204  26.717  1.00 10.61  ? 158  VAL A CG2   1 
ATOM   1218  N N     . HIS A 1 159 ? 13.856  34.420  24.249  1.00 12.31  ? 159  HIS A N     1 
ATOM   1219  C CA    . HIS A 1 159 ? 12.979  35.585  24.218  1.00 11.67  ? 159  HIS A CA    1 
ATOM   1220  C C     . HIS A 1 159 ? 11.718  35.331  25.018  1.00 11.96  ? 159  HIS A C     1 
ATOM   1221  O O     . HIS A 1 159 ? 11.258  34.195  25.128  1.00 11.65  ? 159  HIS A O     1 
ATOM   1222  C CB    . HIS A 1 159 ? 12.672  36.095  22.800  1.00 10.85  ? 159  HIS A CB    1 
ATOM   1223  C CG    . HIS A 1 159 ? 11.888  35.142  21.939  1.00 10.24  ? 159  HIS A CG    1 
ATOM   1224  N ND1   . HIS A 1 159 ? 10.581  34.789  22.206  1.00 7.01   ? 159  HIS A ND1   1 
ATOM   1225  C CD2   . HIS A 1 159 ? 12.221  34.504  20.788  1.00 8.31   ? 159  HIS A CD2   1 
ATOM   1226  C CE1   . HIS A 1 159 ? 10.147  33.965  21.266  1.00 6.75   ? 159  HIS A CE1   1 
ATOM   1227  N NE2   . HIS A 1 159 ? 11.125  33.770  20.398  1.00 9.15   ? 159  HIS A NE2   1 
ATOM   1228  N N     . SER A 1 160 ? 11.186  36.410  25.583  1.00 12.12  ? 160  SER A N     1 
ATOM   1229  C CA    . SER A 1 160 ? 9.939   36.385  26.284  1.00 12.43  ? 160  SER A CA    1 
ATOM   1230  C C     . SER A 1 160 ? 9.104   37.540  25.745  1.00 12.73  ? 160  SER A C     1 
ATOM   1231  O O     . SER A 1 160 ? 9.278   38.702  26.160  1.00 12.03  ? 160  SER A O     1 
ATOM   1232  C CB    . SER A 1 160 ? 10.155  36.538  27.786  1.00 12.33  ? 160  SER A CB    1 
ATOM   1233  O OG    . SER A 1 160 ? 8.900   36.464  28.464  1.00 14.26  ? 160  SER A OG    1 
ATOM   1234  N N     . VAL A 1 161 ? 8.203   37.216  24.819  1.00 12.37  ? 161  VAL A N     1 
ATOM   1235  C CA    . VAL A 1 161 ? 7.397   38.236  24.143  1.00 12.64  ? 161  VAL A CA    1 
ATOM   1236  C C     . VAL A 1 161 ? 6.206   38.591  25.017  1.00 12.85  ? 161  VAL A C     1 
ATOM   1237  O O     . VAL A 1 161 ? 5.540   37.707  25.558  1.00 13.45  ? 161  VAL A O     1 
ATOM   1238  C CB    . VAL A 1 161 ? 6.916   37.787  22.732  1.00 12.10  ? 161  VAL A CB    1 
ATOM   1239  C CG1   . VAL A 1 161 ? 6.147   38.905  22.064  1.00 12.36  ? 161  VAL A CG1   1 
ATOM   1240  C CG2   . VAL A 1 161 ? 8.111   37.384  21.849  1.00 11.44  ? 161  VAL A CG2   1 
ATOM   1241  N N     . ILE A 1 162 ? 5.958   39.884  25.172  1.00 12.84  ? 162  ILE A N     1 
ATOM   1242  C CA    . ILE A 1 162 ? 4.896   40.371  26.056  1.00 12.95  ? 162  ILE A CA    1 
ATOM   1243  C C     . ILE A 1 162 ? 3.880   41.108  25.184  1.00 12.70  ? 162  ILE A C     1 
ATOM   1244  O O     . ILE A 1 162 ? 4.191   42.120  24.543  1.00 12.59  ? 162  ILE A O     1 
ATOM   1245  C CB    . ILE A 1 162 ? 5.470   41.274  27.208  1.00 13.49  ? 162  ILE A CB    1 
ATOM   1246  C CG1   . ILE A 1 162 ? 6.576   40.535  27.985  1.00 12.85  ? 162  ILE A CG1   1 
ATOM   1247  C CG2   . ILE A 1 162 ? 4.363   41.756  28.161  1.00 13.43  ? 162  ILE A CG2   1 
ATOM   1248  C CD1   . ILE A 1 162 ? 7.313   41.387  28.979  1.00 12.52  ? 162  ILE A CD1   1 
ATOM   1249  N N     . PHE A 1 163 ? 2.680   40.549  25.105  1.00 12.82  ? 163  PHE A N     1 
ATOM   1250  C CA    . PHE A 1 163 ? 1.594   41.149  24.335  1.00 12.57  ? 163  PHE A CA    1 
ATOM   1251  C C     . PHE A 1 163 ? 1.481   42.634  24.610  1.00 12.51  ? 163  PHE A C     1 
ATOM   1252  O O     . PHE A 1 163 ? 1.416   43.061  25.780  1.00 12.12  ? 163  PHE A O     1 
ATOM   1253  C CB    . PHE A 1 163 ? 0.271   40.439  24.652  1.00 12.80  ? 163  PHE A CB    1 
ATOM   1254  C CG    . PHE A 1 163 ? -0.932  41.087  24.039  1.00 12.73  ? 163  PHE A CG    1 
ATOM   1255  C CD1   . PHE A 1 163 ? -1.046  41.215  22.660  1.00 14.04  ? 163  PHE A CD1   1 
ATOM   1256  C CD2   . PHE A 1 163 ? -1.964  41.557  24.848  1.00 13.16  ? 163  PHE A CD2   1 
ATOM   1257  C CE1   . PHE A 1 163 ? -2.186  41.806  22.079  1.00 16.19  ? 163  PHE A CE1   1 
ATOM   1258  C CE2   . PHE A 1 163 ? -3.107  42.146  24.291  1.00 15.12  ? 163  PHE A CE2   1 
ATOM   1259  C CZ    . PHE A 1 163 ? -3.214  42.280  22.898  1.00 15.01  ? 163  PHE A CZ    1 
ATOM   1260  N N     . GLY A 1 164 ? 1.439   43.410  23.521  1.00 13.16  ? 164  GLY A N     1 
ATOM   1261  C CA    . GLY A 1 164 ? 1.422   44.875  23.566  1.00 13.42  ? 164  GLY A CA    1 
ATOM   1262  C C     . GLY A 1 164 ? 0.305   45.484  24.409  1.00 14.06  ? 164  GLY A C     1 
ATOM   1263  O O     . GLY A 1 164 ? 0.454   46.578  24.954  1.00 14.42  ? 164  GLY A O     1 
ATOM   1264  N N     . GLY A 1 165 ? -0.813  44.777  24.519  1.00 13.91  ? 165  GLY A N     1 
ATOM   1265  C CA    . GLY A 1 165 ? -1.935  45.260  25.319  1.00 14.35  ? 165  GLY A CA    1 
ATOM   1266  C C     . GLY A 1 165 ? -1.835  45.032  26.820  1.00 14.02  ? 165  GLY A C     1 
ATOM   1267  O O     . GLY A 1 165 ? -2.757  45.410  27.553  1.00 14.22  ? 165  GLY A O     1 
ATOM   1268  N N     . PHE A 1 166 ? -0.743  44.424  27.291  1.00 13.50  ? 166  PHE A N     1 
ATOM   1269  C CA    . PHE A 1 166 ? -0.538  44.314  28.742  1.00 13.90  ? 166  PHE A CA    1 
ATOM   1270  C C     . PHE A 1 166 ? -0.176  45.644  29.394  1.00 14.10  ? 166  PHE A C     1 
ATOM   1271  O O     . PHE A 1 166 ? 0.517   46.476  28.797  1.00 13.68  ? 166  PHE A O     1 
ATOM   1272  C CB    . PHE A 1 166 ? 0.485   43.226  29.113  1.00 13.53  ? 166  PHE A CB    1 
ATOM   1273  C CG    . PHE A 1 166 ? -0.102  41.837  29.126  1.00 13.01  ? 166  PHE A CG    1 
ATOM   1274  C CD1   . PHE A 1 166 ? -1.237  41.557  29.886  1.00 13.59  ? 166  PHE A CD1   1 
ATOM   1275  C CD2   . PHE A 1 166 ? 0.467   40.823  28.381  1.00 13.70  ? 166  PHE A CD2   1 
ATOM   1276  C CE1   . PHE A 1 166 ? -1.804  40.273  29.898  1.00 13.44  ? 166  PHE A CE1   1 
ATOM   1277  C CE2   . PHE A 1 166 ? -0.091  39.535  28.372  1.00 13.65  ? 166  PHE A CE2   1 
ATOM   1278  C CZ    . PHE A 1 166 ? -1.226  39.262  29.130  1.00 13.56  ? 166  PHE A CZ    1 
ATOM   1279  N N     . SER A 1 167 ? -0.651  45.824  30.622  1.00 14.99  ? 167  SER A N     1 
ATOM   1280  C CA    . SER A 1 167 ? -0.375  47.017  31.431  1.00 15.82  ? 167  SER A CA    1 
ATOM   1281  C C     . SER A 1 167 ? 1.083   47.056  31.923  1.00 16.07  ? 167  SER A C     1 
ATOM   1282  O O     . SER A 1 167 ? 1.754   46.007  31.954  1.00 16.85  ? 167  SER A O     1 
ATOM   1283  C CB    . SER A 1 167 ? -1.343  47.055  32.626  1.00 16.44  ? 167  SER A CB    1 
ATOM   1284  O OG    . SER A 1 167 ? -0.865  46.289  33.743  1.00 17.81  ? 167  SER A OG    1 
ATOM   1285  N N     . PRO A 1 168 ? 1.594   48.255  32.293  1.00 15.97  ? 168  PRO A N     1 
ATOM   1286  C CA    . PRO A 1 168 ? 2.930   48.349  32.931  1.00 16.13  ? 168  PRO A CA    1 
ATOM   1287  C C     . PRO A 1 168 ? 3.129   47.392  34.118  1.00 16.28  ? 168  PRO A C     1 
ATOM   1288  O O     . PRO A 1 168 ? 4.200   46.800  34.266  1.00 16.42  ? 168  PRO A O     1 
ATOM   1289  C CB    . PRO A 1 168 ? 2.997   49.810  33.408  1.00 15.69  ? 168  PRO A CB    1 
ATOM   1290  C CG    . PRO A 1 168 ? 2.126   50.545  32.483  1.00 15.90  ? 168  PRO A CG    1 
ATOM   1291  C CD    . PRO A 1 168 ? 1.000   49.588  32.080  1.00 15.71  ? 168  PRO A CD    1 
ATOM   1292  N N     . GLU A 1 169 ? 2.103   47.249  34.950  1.00 16.64  ? 169  GLU A N     1 
ATOM   1293  C CA    . GLU A 1 169 ? 2.123   46.295  36.051  1.00 16.73  ? 169  GLU A CA    1 
ATOM   1294  C C     . GLU A 1 169 ? 2.324   44.838  35.582  1.00 16.44  ? 169  GLU A C     1 
ATOM   1295  O O     . GLU A 1 169 ? 3.121   44.096  36.173  1.00 16.83  ? 169  GLU A O     1 
ATOM   1296  C CB    . GLU A 1 169 ? 0.856   46.458  36.896  1.00 17.26  ? 169  GLU A CB    1 
ATOM   1297  C CG    . GLU A 1 169 ? 0.730   45.488  38.092  1.00 20.54  ? 169  GLU A CG    1 
ATOM   1298  C CD    . GLU A 1 169 ? 1.709   45.765  39.232  1.00 25.82  ? 169  GLU A CD    1 
ATOM   1299  O OE1   . GLU A 1 169 ? 2.073   46.946  39.480  1.00 27.41  ? 169  GLU A OE1   1 
ATOM   1300  O OE2   . GLU A 1 169 ? 2.096   44.784  39.903  1.00 28.12  ? 169  GLU A OE2   1 
ATOM   1301  N N     . ALA A 1 170 ? 1.615   44.442  34.520  1.00 15.67  ? 170  ALA A N     1 
ATOM   1302  C CA    . ALA A 1 170 ? 1.726   43.109  33.943  1.00 14.82  ? 170  ALA A CA    1 
ATOM   1303  C C     . ALA A 1 170 ? 3.101   42.878  33.298  1.00 14.56  ? 170  ALA A C     1 
ATOM   1304  O O     . ALA A 1 170 ? 3.685   41.809  33.443  1.00 14.49  ? 170  ALA A O     1 
ATOM   1305  C CB    . ALA A 1 170 ? 0.607   42.863  32.936  1.00 14.77  ? 170  ALA A CB    1 
ATOM   1306  N N     . VAL A 1 171 ? 3.612   43.887  32.598  1.00 13.96  ? 171  VAL A N     1 
ATOM   1307  C CA    . VAL A 1 171 ? 4.979   43.865  32.083  1.00 13.55  ? 171  VAL A CA    1 
ATOM   1308  C C     . VAL A 1 171 ? 6.013   43.655  33.211  1.00 13.56  ? 171  VAL A C     1 
ATOM   1309  O O     . VAL A 1 171 ? 6.877   42.777  33.113  1.00 13.04  ? 171  VAL A O     1 
ATOM   1310  C CB    . VAL A 1 171 ? 5.279   45.147  31.278  1.00 13.90  ? 171  VAL A CB    1 
ATOM   1311  C CG1   . VAL A 1 171 ? 6.717   45.199  30.841  1.00 13.23  ? 171  VAL A CG1   1 
ATOM   1312  C CG2   . VAL A 1 171 ? 4.333   45.246  30.071  1.00 12.62  ? 171  VAL A CG2   1 
ATOM   1313  N N     . ALA A 1 172 ? 5.914   44.444  34.283  1.00 13.69  ? 172  ALA A N     1 
ATOM   1314  C CA    . ALA A 1 172 ? 6.842   44.326  35.417  1.00 13.71  ? 172  ALA A CA    1 
ATOM   1315  C C     . ALA A 1 172 ? 6.901   42.881  35.903  1.00 13.88  ? 172  ALA A C     1 
ATOM   1316  O O     . ALA A 1 172 ? 7.985   42.301  36.022  1.00 13.67  ? 172  ALA A O     1 
ATOM   1317  C CB    . ALA A 1 172 ? 6.429   45.267  36.565  1.00 13.91  ? 172  ALA A CB    1 
ATOM   1318  N N     . GLY A 1 173 ? 5.715   42.310  36.134  1.00 14.47  ? 173  GLY A N     1 
ATOM   1319  C CA    . GLY A 1 173 ? 5.544   40.941  36.597  1.00 14.78  ? 173  GLY A CA    1 
ATOM   1320  C C     . GLY A 1 173 ? 6.273   39.924  35.749  1.00 15.91  ? 173  GLY A C     1 
ATOM   1321  O O     . GLY A 1 173 ? 6.985   39.067  36.284  1.00 16.49  ? 173  GLY A O     1 
ATOM   1322  N N     . ARG A 1 174 ? 6.116   40.016  34.432  1.00 15.71  ? 174  ARG A N     1 
ATOM   1323  C CA    . ARG A 1 174 ? 6.815   39.102  33.517  1.00 16.21  ? 174  ARG A CA    1 
ATOM   1324  C C     . ARG A 1 174 ? 8.338   39.290  33.533  1.00 16.41  ? 174  ARG A C     1 
ATOM   1325  O O     . ARG A 1 174 ? 9.087   38.312  33.488  1.00 16.60  ? 174  ARG A O     1 
ATOM   1326  C CB    . ARG A 1 174 ? 6.236   39.209  32.098  1.00 16.07  ? 174  ARG A CB    1 
ATOM   1327  C CG    . ARG A 1 174 ? 4.833   38.629  32.032  1.00 16.16  ? 174  ARG A CG    1 
ATOM   1328  C CD    . ARG A 1 174 ? 3.978   39.134  30.867  1.00 15.64  ? 174  ARG A CD    1 
ATOM   1329  N NE    . ARG A 1 174 ? 2.741   38.353  30.795  1.00 14.82  ? 174  ARG A NE    1 
ATOM   1330  C CZ    . ARG A 1 174 ? 1.682   38.539  31.585  1.00 13.95  ? 174  ARG A CZ    1 
ATOM   1331  N NH1   . ARG A 1 174 ? 1.670   39.502  32.491  1.00 13.08  ? 174  ARG A NH1   1 
ATOM   1332  N NH2   . ARG A 1 174 ? 0.628   37.760  31.473  1.00 15.52  ? 174  ARG A NH2   1 
ATOM   1333  N N     . ILE A 1 175 ? 8.779   40.545  33.618  1.00 16.79  ? 175  ILE A N     1 
ATOM   1334  C CA    . ILE A 1 175 ? 10.205  40.891  33.648  1.00 16.42  ? 175  ILE A CA    1 
ATOM   1335  C C     . ILE A 1 175 ? 10.853  40.402  34.922  1.00 17.19  ? 175  ILE A C     1 
ATOM   1336  O O     . ILE A 1 175 ? 11.985  39.907  34.889  1.00 17.19  ? 175  ILE A O     1 
ATOM   1337  C CB    . ILE A 1 175 ? 10.441  42.411  33.479  1.00 16.69  ? 175  ILE A CB    1 
ATOM   1338  C CG1   . ILE A 1 175 ? 10.159  42.839  32.029  1.00 15.68  ? 175  ILE A CG1   1 
ATOM   1339  C CG2   . ILE A 1 175 ? 11.864  42.813  33.911  1.00 14.92  ? 175  ILE A CG2   1 
ATOM   1340  C CD1   . ILE A 1 175 ? 10.187  44.358  31.799  1.00 16.34  ? 175  ILE A CD1   1 
ATOM   1341  N N     . ILE A 1 176 ? 10.130  40.541  36.037  1.00 18.06  ? 176  ILE A N     1 
ATOM   1342  C CA    . ILE A 1 176 ? 10.607  40.094  37.346  1.00 18.77  ? 176  ILE A CA    1 
ATOM   1343  C C     . ILE A 1 176 ? 10.760  38.578  37.423  1.00 19.43  ? 176  ILE A C     1 
ATOM   1344  O O     . ILE A 1 176 ? 11.838  38.089  37.759  1.00 19.50  ? 176  ILE A O     1 
ATOM   1345  C CB    . ILE A 1 176 ? 9.701   40.602  38.508  1.00 19.20  ? 176  ILE A CB    1 
ATOM   1346  C CG1   . ILE A 1 176 ? 9.896   42.109  38.705  1.00 19.15  ? 176  ILE A CG1   1 
ATOM   1347  C CG2   . ILE A 1 176 ? 10.020  39.870  39.814  1.00 18.55  ? 176  ILE A CG2   1 
ATOM   1348  C CD1   . ILE A 1 176 ? 8.761   42.793  39.433  1.00 18.97  ? 176  ILE A CD1   1 
ATOM   1349  N N     . ASP A 1 177 ? 9.688   37.837  37.124  1.00 20.26  ? 177  ASP A N     1 
ATOM   1350  C CA    . ASP A 1 177 ? 9.750   36.374  37.136  1.00 21.08  ? 177  ASP A CA    1 
ATOM   1351  C C     . ASP A 1 177 ? 10.858  35.822  36.253  1.00 21.05  ? 177  ASP A C     1 
ATOM   1352  O O     . ASP A 1 177 ? 11.458  34.804  36.594  1.00 21.16  ? 177  ASP A O     1 
ATOM   1353  C CB    . ASP A 1 177 ? 8.440   35.739  36.693  1.00 21.39  ? 177  ASP A CB    1 
ATOM   1354  C CG    . ASP A 1 177 ? 8.462   34.206  36.843  1.00 23.68  ? 177  ASP A CG    1 
ATOM   1355  O OD1   . ASP A 1 177 ? 8.778   33.497  35.850  1.00 23.28  ? 177  ASP A OD1   1 
ATOM   1356  O OD2   . ASP A 1 177 ? 8.194   33.717  37.971  1.00 24.60  ? 177  ASP A OD2   1 
ATOM   1357  N N     . SER A 1 178 ? 11.122  36.485  35.123  1.00 20.66  ? 178  SER A N     1 
ATOM   1358  C CA    . SER A 1 178 ? 12.061  35.956  34.123  1.00 20.34  ? 178  SER A CA    1 
ATOM   1359  C C     . SER A 1 178 ? 13.487  36.486  34.225  1.00 20.13  ? 178  SER A C     1 
ATOM   1360  O O     . SER A 1 178 ? 14.388  35.942  33.596  1.00 20.34  ? 178  SER A O     1 
ATOM   1361  C CB    . SER A 1 178 ? 11.526  36.156  32.696  1.00 20.18  ? 178  SER A CB    1 
ATOM   1362  O OG    . SER A 1 178 ? 11.514  37.528  32.324  1.00 19.41  ? 178  SER A OG    1 
ATOM   1363  N N     . SER A 1 179 ? 13.691  37.538  35.014  1.00 20.52  ? 179  SER A N     1 
ATOM   1364  C CA    . SER A 1 179 ? 15.003  38.189  35.139  1.00 20.71  ? 179  SER A CA    1 
ATOM   1365  C C     . SER A 1 179 ? 15.519  38.654  33.765  1.00 20.72  ? 179  SER A C     1 
ATOM   1366  O O     . SER A 1 179 ? 16.687  38.442  33.415  1.00 20.37  ? 179  SER A O     1 
ATOM   1367  C CB    . SER A 1 179 ? 16.020  37.264  35.832  1.00 21.09  ? 179  SER A CB    1 
ATOM   1368  O OG    . SER A 1 179 ? 15.717  37.082  37.216  1.00 22.68  ? 179  SER A OG    1 
ATOM   1369  N N     . SER A 1 180 ? 14.622  39.262  32.986  1.00 20.70  ? 180  SER A N     1 
ATOM   1370  C CA    . SER A 1 180 ? 14.940  39.732  31.636  1.00 20.58  ? 180  SER A CA    1 
ATOM   1371  C C     . SER A 1 180 ? 15.998  40.817  31.753  1.00 20.58  ? 180  SER A C     1 
ATOM   1372  O O     . SER A 1 180 ? 15.882  41.738  32.583  1.00 19.64  ? 180  SER A O     1 
ATOM   1373  C CB    . SER A 1 180 ? 13.699  40.292  30.934  1.00 20.55  ? 180  SER A CB    1 
ATOM   1374  O OG    . SER A 1 180 ? 12.676  39.309  30.777  1.00 21.12  ? 180  SER A OG    1 
ATOM   1375  N N     . ARG A 1 181 ? 17.029  40.676  30.923  1.00 20.45  ? 181  ARG A N     1 
ATOM   1376  C CA    . ARG A 1 181 ? 18.216  41.531  30.953  1.00 20.60  ? 181  ARG A CA    1 
ATOM   1377  C C     . ARG A 1 181 ? 18.027  42.785  30.092  1.00 19.52  ? 181  ARG A C     1 
ATOM   1378  O O     . ARG A 1 181 ? 18.714  43.797  30.270  1.00 18.73  ? 181  ARG A O     1 
ATOM   1379  C CB    . ARG A 1 181 ? 19.423  40.711  30.459  1.00 21.04  ? 181  ARG A CB    1 
ATOM   1380  C CG    . ARG A 1 181 ? 19.759  39.510  31.361  1.00 23.88  ? 181  ARG A CG    1 
ATOM   1381  C CD    . ARG A 1 181 ? 20.768  39.903  32.436  1.00 30.09  ? 181  ARG A CD    1 
ATOM   1382  N NE    . ARG A 1 181 ? 20.335  39.544  33.793  1.00 34.45  ? 181  ARG A NE    1 
ATOM   1383  C CZ    . ARG A 1 181 ? 20.914  39.993  34.910  1.00 36.53  ? 181  ARG A CZ    1 
ATOM   1384  N NH1   . ARG A 1 181 ? 21.950  40.823  34.849  1.00 37.07  ? 181  ARG A NH1   1 
ATOM   1385  N NH2   . ARG A 1 181 ? 20.456  39.625  36.100  1.00 37.83  ? 181  ARG A NH2   1 
ATOM   1386  N N     . LEU A 1 182 ? 17.079  42.688  29.163  1.00 18.57  ? 182  LEU A N     1 
ATOM   1387  C CA    . LEU A 1 182 ? 16.827  43.696  28.137  1.00 17.71  ? 182  LEU A CA    1 
ATOM   1388  C C     . LEU A 1 182 ? 15.339  43.714  27.796  1.00 16.87  ? 182  LEU A C     1 
ATOM   1389  O O     . LEU A 1 182 ? 14.667  42.685  27.824  1.00 16.32  ? 182  LEU A O     1 
ATOM   1390  C CB    . LEU A 1 182 ? 17.638  43.350  26.876  1.00 17.67  ? 182  LEU A CB    1 
ATOM   1391  C CG    . LEU A 1 182 ? 17.494  44.136  25.568  1.00 18.00  ? 182  LEU A CG    1 
ATOM   1392  C CD1   . LEU A 1 182 ? 18.299  45.416  25.597  1.00 18.97  ? 182  LEU A CD1   1 
ATOM   1393  C CD2   . LEU A 1 182 ? 17.952  43.287  24.411  1.00 17.95  ? 182  LEU A CD2   1 
ATOM   1394  N N     . VAL A 1 183 ? 14.828  44.903  27.503  1.00 15.95  ? 183  VAL A N     1 
ATOM   1395  C CA    . VAL A 1 183 ? 13.494  45.057  26.966  1.00 14.55  ? 183  VAL A CA    1 
ATOM   1396  C C     . VAL A 1 183 ? 13.622  45.660  25.561  1.00 14.59  ? 183  VAL A C     1 
ATOM   1397  O O     . VAL A 1 183 ? 14.356  46.627  25.373  1.00 14.06  ? 183  VAL A O     1 
ATOM   1398  C CB    . VAL A 1 183 ? 12.637  45.964  27.874  1.00 14.78  ? 183  VAL A CB    1 
ATOM   1399  C CG1   . VAL A 1 183 ? 11.216  46.085  27.322  1.00 13.61  ? 183  VAL A CG1   1 
ATOM   1400  C CG2   . VAL A 1 183 ? 12.623  45.432  29.312  1.00 13.36  ? 183  VAL A CG2   1 
ATOM   1401  N N     . ILE A 1 184 ? 12.936  45.069  24.579  1.00 14.24  ? 184  ILE A N     1 
ATOM   1402  C CA    . ILE A 1 184 ? 12.887  45.621  23.230  1.00 13.94  ? 184  ILE A CA    1 
ATOM   1403  C C     . ILE A 1 184 ? 11.462  46.106  22.979  1.00 13.83  ? 184  ILE A C     1 
ATOM   1404  O O     . ILE A 1 184 ? 10.496  45.367  23.155  1.00 14.51  ? 184  ILE A O     1 
ATOM   1405  C CB    . ILE A 1 184 ? 13.324  44.596  22.130  1.00 14.41  ? 184  ILE A CB    1 
ATOM   1406  C CG1   . ILE A 1 184 ? 14.690  43.977  22.461  1.00 13.97  ? 184  ILE A CG1   1 
ATOM   1407  C CG2   . ILE A 1 184 ? 13.337  45.253  20.723  1.00 12.84  ? 184  ILE A CG2   1 
ATOM   1408  C CD1   . ILE A 1 184 ? 15.056  42.815  21.553  1.00 13.42  ? 184  ILE A CD1   1 
ATOM   1409  N N     . THR A 1 185 ? 11.332  47.358  22.584  1.00 13.18  ? 185  THR A N     1 
ATOM   1410  C CA    . THR A 1 185 ? 10.014  47.945  22.468  1.00 12.92  ? 185  THR A CA    1 
ATOM   1411  C C     . THR A 1 185 ? 9.999   48.987  21.364  1.00 12.91  ? 185  THR A C     1 
ATOM   1412  O O     . THR A 1 185 ? 10.974  49.105  20.619  1.00 12.63  ? 185  THR A O     1 
ATOM   1413  C CB    . THR A 1 185 ? 9.487   48.492  23.842  1.00 12.96  ? 185  THR A CB    1 
ATOM   1414  O OG1   . THR A 1 185 ? 8.102   48.849  23.718  1.00 13.09  ? 185  THR A OG1   1 
ATOM   1415  C CG2   . THR A 1 185 ? 10.291  49.704  24.321  1.00 11.10  ? 185  THR A CG2   1 
ATOM   1416  N N     . ALA A 1 186 ? 8.883   49.705  21.235  1.00 13.37  ? 186  ALA A N     1 
ATOM   1417  C CA    . ALA A 1 186 ? 8.784   50.809  20.287  1.00 14.15  ? 186  ALA A CA    1 
ATOM   1418  C C     . ALA A 1 186 ? 8.239   52.024  21.015  1.00 14.58  ? 186  ALA A C     1 
ATOM   1419  O O     . ALA A 1 186 ? 7.663   51.881  22.089  1.00 14.65  ? 186  ALA A O     1 
ATOM   1420  C CB    . ALA A 1 186 ? 7.890   50.436  19.111  1.00 13.87  ? 186  ALA A CB    1 
ATOM   1421  N N     . ASP A 1 187 ? 8.431   53.215  20.448  1.00 15.34  ? 187  ASP A N     1 
ATOM   1422  C CA    . ASP A 1 187 ? 7.870   54.436  21.034  1.00 16.09  ? 187  ASP A CA    1 
ATOM   1423  C C     . ASP A 1 187 ? 6.346   54.326  21.195  1.00 16.59  ? 187  ASP A C     1 
ATOM   1424  O O     . ASP A 1 187 ? 5.818   54.504  22.300  1.00 16.64  ? 187  ASP A O     1 
ATOM   1425  C CB    . ASP A 1 187 ? 8.296   55.707  20.256  1.00 16.51  ? 187  ASP A CB    1 
ATOM   1426  C CG    . ASP A 1 187 ? 8.062   55.609  18.745  1.00 16.15  ? 187  ASP A CG    1 
ATOM   1427  O OD1   . ASP A 1 187 ? 7.355   54.696  18.268  1.00 16.13  ? 187  ASP A OD1   1 
ATOM   1428  O OD2   . ASP A 1 187 ? 8.577   56.494  18.029  1.00 16.78  ? 187  ASP A OD2   1 
ATOM   1429  N N     . GLU A 1 188 ? 5.656   53.984  20.106  1.00 16.78  ? 188  GLU A N     1 
ATOM   1430  C CA    . GLU A 1 188 ? 4.210   53.728  20.126  1.00 17.41  ? 188  GLU A CA    1 
ATOM   1431  C C     . GLU A 1 188 ? 3.873   52.639  19.115  1.00 17.52  ? 188  GLU A C     1 
ATOM   1432  O O     . GLU A 1 188 ? 4.574   52.490  18.133  1.00 17.41  ? 188  GLU A O     1 
ATOM   1433  C CB    . GLU A 1 188 ? 3.413   54.985  19.748  1.00 16.57  ? 188  GLU A CB    1 
ATOM   1434  C CG    . GLU A 1 188 ? 3.464   56.112  20.761  1.00 18.09  ? 188  GLU A CG    1 
ATOM   1435  C CD    . GLU A 1 188 ? 2.823   57.410  20.271  1.00 18.53  ? 188  GLU A CD    1 
ATOM   1436  O OE1   . GLU A 1 188 ? 2.913   57.742  19.059  1.00 19.62  ? 188  GLU A OE1   1 
ATOM   1437  O OE2   . GLU A 1 188 ? 2.236   58.117  21.117  1.00 21.45  ? 188  GLU A OE2   1 
ATOM   1438  N N     . GLY A 1 189 ? 2.802   51.887  19.356  1.00 18.21  ? 189  GLY A N     1 
ATOM   1439  C CA    . GLY A 1 189 ? 2.185   51.072  18.303  1.00 19.13  ? 189  GLY A CA    1 
ATOM   1440  C C     . GLY A 1 189 ? 1.061   51.846  17.635  1.00 20.16  ? 189  GLY A C     1 
ATOM   1441  O O     . GLY A 1 189 ? 0.467   52.735  18.256  1.00 20.41  ? 189  GLY A O     1 
ATOM   1442  N N     . VAL A 1 190 ? 0.782   51.529  16.366  1.00 20.93  ? 190  VAL A N     1 
ATOM   1443  C CA    . VAL A 1 190 ? -0.340  52.125  15.623  1.00 21.23  ? 190  VAL A CA    1 
ATOM   1444  C C     . VAL A 1 190 ? -1.413  51.064  15.406  1.00 21.91  ? 190  VAL A C     1 
ATOM   1445  O O     . VAL A 1 190 ? -1.153  50.022  14.808  1.00 21.95  ? 190  VAL A O     1 
ATOM   1446  C CB    . VAL A 1 190 ? 0.088   52.671  14.244  1.00 21.41  ? 190  VAL A CB    1 
ATOM   1447  C CG1   . VAL A 1 190 ? -1.128  53.167  13.463  1.00 20.88  ? 190  VAL A CG1   1 
ATOM   1448  C CG2   . VAL A 1 190 ? 1.123   53.798  14.390  1.00 21.18  ? 190  VAL A CG2   1 
ATOM   1449  N N     . ARG A 1 191 ? -2.619  51.327  15.889  1.00 22.04  ? 191  ARG A N     1 
ATOM   1450  C CA    . ARG A 1 191 ? -3.708  50.377  15.746  1.00 23.02  ? 191  ARG A CA    1 
ATOM   1451  C C     . ARG A 1 191 ? -5.038  51.102  15.620  1.00 22.96  ? 191  ARG A C     1 
ATOM   1452  O O     . ARG A 1 191 ? -5.424  51.867  16.520  1.00 22.58  ? 191  ARG A O     1 
ATOM   1453  C CB    . ARG A 1 191 ? -3.740  49.430  16.936  1.00 23.34  ? 191  ARG A CB    1 
ATOM   1454  C CG    . ARG A 1 191 ? -4.603  48.210  16.736  1.00 26.07  ? 191  ARG A CG    1 
ATOM   1455  C CD    . ARG A 1 191 ? -4.796  47.499  18.075  1.00 31.49  ? 191  ARG A CD    1 
ATOM   1456  N NE    . ARG A 1 191 ? -5.212  46.100  17.930  1.00 33.96  ? 191  ARG A NE    1 
ATOM   1457  C CZ    . ARG A 1 191 ? -6.339  45.601  18.424  1.00 35.85  ? 191  ARG A CZ    1 
ATOM   1458  N NH1   . ARG A 1 191 ? -7.188  46.379  19.093  1.00 36.56  ? 191  ARG A NH1   1 
ATOM   1459  N NH2   . ARG A 1 191 ? -6.626  44.319  18.242  1.00 37.63  ? 191  ARG A NH2   1 
ATOM   1460  N N     . ALA A 1 192 ? -5.718  50.852  14.498  1.00 22.63  ? 192  ALA A N     1 
ATOM   1461  C CA    . ALA A 1 192 ? -7.007  51.469  14.171  1.00 22.63  ? 192  ALA A CA    1 
ATOM   1462  C C     . ALA A 1 192 ? -6.975  53.001  14.194  1.00 22.82  ? 192  ALA A C     1 
ATOM   1463  O O     . ALA A 1 192 ? -7.868  53.631  14.767  1.00 22.95  ? 192  ALA A O     1 
ATOM   1464  C CB    . ALA A 1 192 ? -8.115  50.929  15.080  1.00 22.59  ? 192  ALA A CB    1 
ATOM   1465  N N     . GLY A 1 193 ? -5.946  53.590  13.580  1.00 22.74  ? 193  GLY A N     1 
ATOM   1466  C CA    . GLY A 1 193 ? -5.837  55.047  13.451  1.00 23.07  ? 193  GLY A CA    1 
ATOM   1467  C C     . GLY A 1 193 ? -5.410  55.780  14.718  1.00 23.82  ? 193  GLY A C     1 
ATOM   1468  O O     . GLY A 1 193 ? -5.403  57.014  14.746  1.00 23.04  ? 193  GLY A O     1 
ATOM   1469  N N     . ARG A 1 194 ? -5.030  55.000  15.735  1.00 24.98  ? 194  ARG A N     1 
ATOM   1470  C CA    . ARG A 1 194 ? -4.668  55.449  17.085  1.00 26.44  ? 194  ARG A CA    1 
ATOM   1471  C C     . ARG A 1 194 ? -3.292  54.928  17.515  1.00 26.44  ? 194  ARG A C     1 
ATOM   1472  O O     . ARG A 1 194 ? -2.918  53.818  17.151  1.00 25.95  ? 194  ARG A O     1 
ATOM   1473  C CB    . ARG A 1 194 ? -5.622  54.831  18.110  1.00 26.64  ? 194  ARG A CB    1 
ATOM   1474  C CG    . ARG A 1 194 ? -6.964  55.454  18.315  1.00 30.01  ? 194  ARG A CG    1 
ATOM   1475  C CD    . ARG A 1 194 ? -7.560  54.746  19.520  1.00 35.27  ? 194  ARG A CD    1 
ATOM   1476  N NE    . ARG A 1 194 ? -8.994  54.927  19.647  1.00 40.22  ? 194  ARG A NE    1 
ATOM   1477  C CZ    . ARG A 1 194 ? -9.903  54.163  19.047  1.00 44.96  ? 194  ARG A CZ    1 
ATOM   1478  N NH1   . ARG A 1 194 ? -9.524  53.159  18.252  1.00 46.51  ? 194  ARG A NH1   1 
ATOM   1479  N NH2   . ARG A 1 194 ? -11.203 54.412  19.230  1.00 46.67  ? 194  ARG A NH2   1 
ATOM   1480  N N     . SER A 1 195 ? -2.605  55.710  18.359  1.00 26.87  ? 195  SER A N     1 
ATOM   1481  C CA    . SER A 1 195 ? -1.374  55.312  19.073  1.00 27.32  ? 195  SER A CA    1 
ATOM   1482  C C     . SER A 1 195 ? -1.603  54.451  20.318  1.00 27.03  ? 195  SER A C     1 
ATOM   1483  O O     . SER A 1 195 ? -2.609  54.593  21.008  1.00 27.37  ? 195  SER A O     1 
ATOM   1484  C CB    . SER A 1 195 ? -0.622  56.555  19.529  1.00 27.34  ? 195  SER A CB    1 
ATOM   1485  O OG    . SER A 1 195 ? -0.087  57.241  18.421  1.00 30.20  ? 195  SER A OG    1 
ATOM   1486  N N     . ILE A 1 196 ? -0.637  53.582  20.598  1.00 26.60  ? 196  ILE A N     1 
ATOM   1487  C CA    . ILE A 1 196 ? -0.565  52.777  21.814  1.00 26.33  ? 196  ILE A CA    1 
ATOM   1488  C C     . ILE A 1 196 ? 0.766   53.136  22.498  1.00 25.71  ? 196  ILE A C     1 
ATOM   1489  O O     . ILE A 1 196 ? 1.821   53.014  21.880  1.00 25.39  ? 196  ILE A O     1 
ATOM   1490  C CB    . ILE A 1 196 ? -0.573  51.259  21.470  1.00 27.19  ? 196  ILE A CB    1 
ATOM   1491  C CG1   . ILE A 1 196 ? -1.814  50.873  20.633  1.00 27.98  ? 196  ILE A CG1   1 
ATOM   1492  C CG2   . ILE A 1 196 ? -0.385  50.379  22.732  1.00 27.04  ? 196  ILE A CG2   1 
ATOM   1493  C CD1   . ILE A 1 196 ? -3.169  51.342  21.206  1.00 29.86  ? 196  ILE A CD1   1 
ATOM   1494  N N     . PRO A 1 197 ? 0.726   53.575  23.772  1.00 24.97  ? 197  PRO A N     1 
ATOM   1495  C CA    . PRO A 1 197 ? 1.955   54.084  24.390  1.00 24.20  ? 197  PRO A CA    1 
ATOM   1496  C C     . PRO A 1 197 ? 2.896   53.006  24.961  1.00 23.37  ? 197  PRO A C     1 
ATOM   1497  O O     . PRO A 1 197 ? 3.034   52.883  26.183  1.00 24.09  ? 197  PRO A O     1 
ATOM   1498  C CB    . PRO A 1 197 ? 1.429   55.003  25.500  1.00 24.09  ? 197  PRO A CB    1 
ATOM   1499  C CG    . PRO A 1 197 ? 0.115   54.371  25.915  1.00 25.10  ? 197  PRO A CG    1 
ATOM   1500  C CD    . PRO A 1 197 ? -0.430  53.631  24.695  1.00 25.02  ? 197  PRO A CD    1 
ATOM   1501  N N     . LEU A 1 198 ? 3.588   52.285  24.081  1.00 21.77  ? 198  LEU A N     1 
ATOM   1502  C CA    . LEU A 1 198 ? 4.460   51.176  24.484  1.00 20.04  ? 198  LEU A CA    1 
ATOM   1503  C C     . LEU A 1 198 ? 5.657   51.550  25.371  1.00 19.36  ? 198  LEU A C     1 
ATOM   1504  O O     . LEU A 1 198 ? 5.755   51.054  26.497  1.00 18.51  ? 198  LEU A O     1 
ATOM   1505  C CB    . LEU A 1 198 ? 4.887   50.363  23.259  1.00 19.76  ? 198  LEU A CB    1 
ATOM   1506  C CG    . LEU A 1 198 ? 3.738   49.633  22.541  1.00 19.43  ? 198  LEU A CG    1 
ATOM   1507  C CD1   . LEU A 1 198 ? 4.226   48.973  21.259  1.00 17.36  ? 198  LEU A CD1   1 
ATOM   1508  C CD2   . LEU A 1 198 ? 3.039   48.605  23.470  1.00 16.41  ? 198  LEU A CD2   1 
ATOM   1509  N N     . LYS A 1 199 ? 6.543   52.428  24.875  1.00 18.60  ? 199  LYS A N     1 
ATOM   1510  C CA    . LYS A 1 199 ? 7.753   52.834  25.607  1.00 18.25  ? 199  LYS A CA    1 
ATOM   1511  C C     . LYS A 1 199 ? 7.414   53.485  26.947  1.00 17.64  ? 199  LYS A C     1 
ATOM   1512  O O     . LYS A 1 199 ? 8.029   53.171  27.964  1.00 17.53  ? 199  LYS A O     1 
ATOM   1513  C CB    . LYS A 1 199 ? 8.662   53.749  24.759  1.00 18.13  ? 199  LYS A CB    1 
ATOM   1514  C CG    . LYS A 1 199 ? 9.699   54.596  25.554  1.00 19.00  ? 199  LYS A CG    1 
ATOM   1515  C CD    . LYS A 1 199 ? 10.841  53.776  26.135  1.00 18.85  ? 199  LYS A CD    1 
ATOM   1516  C CE    . LYS A 1 199 ? 12.092  54.637  26.385  1.00 18.21  ? 199  LYS A CE    1 
ATOM   1517  N NZ    . LYS A 1 199 ? 12.073  55.372  27.691  1.00 19.49  ? 199  LYS A NZ    1 
ATOM   1518  N N     . LYS A 1 200 ? 6.432   54.379  26.936  1.00 17.21  ? 200  LYS A N     1 
ATOM   1519  C CA    . LYS A 1 200 ? 5.900   54.963  28.163  1.00 17.37  ? 200  LYS A CA    1 
ATOM   1520  C C     . LYS A 1 200 ? 5.487   53.913  29.195  1.00 16.78  ? 200  LYS A C     1 
ATOM   1521  O O     . LYS A 1 200 ? 5.785   54.065  30.392  1.00 16.61  ? 200  LYS A O     1 
ATOM   1522  C CB    . LYS A 1 200 ? 4.718   55.879  27.854  1.00 17.95  ? 200  LYS A CB    1 
ATOM   1523  C CG    . LYS A 1 200 ? 4.157   56.567  29.075  1.00 19.19  ? 200  LYS A CG    1 
ATOM   1524  C CD    . LYS A 1 200 ? 3.315   57.784  28.732  1.00 21.88  ? 200  LYS A CD    1 
ATOM   1525  C CE    . LYS A 1 200 ? 2.736   58.392  30.008  1.00 23.04  ? 200  LYS A CE    1 
ATOM   1526  N NZ    . LYS A 1 200 ? 3.825   58.849  30.942  1.00 25.56  ? 200  LYS A NZ    1 
ATOM   1527  N N     . ASN A 1 201 ? 4.809   52.861  28.725  1.00 16.16  ? 201  ASN A N     1 
ATOM   1528  C CA    . ASN A 1 201 ? 4.405   51.719  29.562  1.00 15.76  ? 201  ASN A CA    1 
ATOM   1529  C C     . ASN A 1 201 ? 5.616   50.982  30.121  1.00 15.55  ? 201  ASN A C     1 
ATOM   1530  O O     . ASN A 1 201 ? 5.599   50.500  31.259  1.00 15.94  ? 201  ASN A O     1 
ATOM   1531  C CB    . ASN A 1 201 ? 3.546   50.724  28.764  1.00 14.71  ? 201  ASN A CB    1 
ATOM   1532  C CG    . ASN A 1 201 ? 2.089   51.136  28.650  1.00 14.70  ? 201  ASN A CG    1 
ATOM   1533  O OD1   . ASN A 1 201 ? 1.653   52.141  29.216  1.00 14.96  ? 201  ASN A OD1   1 
ATOM   1534  N ND2   . ASN A 1 201 ? 1.312   50.336  27.917  1.00 13.71  ? 201  ASN A ND2   1 
ATOM   1535  N N     . VAL A 1 202 ? 6.661   50.890  29.307  1.00 15.52  ? 202  VAL A N     1 
ATOM   1536  C CA    . VAL A 1 202 ? 7.927   50.261  29.715  1.00 15.46  ? 202  VAL A CA    1 
ATOM   1537  C C     . VAL A 1 202 ? 8.618   51.085  30.821  1.00 15.99  ? 202  VAL A C     1 
ATOM   1538  O O     . VAL A 1 202 ? 9.064   50.520  31.818  1.00 16.12  ? 202  VAL A O     1 
ATOM   1539  C CB    . VAL A 1 202 ? 8.860   49.982  28.496  1.00 14.88  ? 202  VAL A CB    1 
ATOM   1540  C CG1   . VAL A 1 202 ? 10.248  49.520  28.935  1.00 13.72  ? 202  VAL A CG1   1 
ATOM   1541  C CG2   . VAL A 1 202 ? 8.235   48.908  27.591  1.00 14.83  ? 202  VAL A CG2   1 
ATOM   1542  N N     . ASP A 1 203 ? 8.680   52.408  30.651  1.00 16.40  ? 203  ASP A N     1 
ATOM   1543  C CA    . ASP A 1 203 ? 9.193   53.301  31.704  1.00 17.19  ? 203  ASP A CA    1 
ATOM   1544  C C     . ASP A 1 203 ? 8.515   53.064  33.044  1.00 17.07  ? 203  ASP A C     1 
ATOM   1545  O O     . ASP A 1 203 ? 9.192   52.923  34.056  1.00 17.45  ? 203  ASP A O     1 
ATOM   1546  C CB    . ASP A 1 203 ? 9.025   54.781  31.324  1.00 16.79  ? 203  ASP A CB    1 
ATOM   1547  C CG    . ASP A 1 203 ? 9.879   55.179  30.157  1.00 16.54  ? 203  ASP A CG    1 
ATOM   1548  O OD1   . ASP A 1 203 ? 10.796  54.425  29.803  1.00 16.43  ? 203  ASP A OD1   1 
ATOM   1549  O OD2   . ASP A 1 203 ? 9.635   56.257  29.590  1.00 16.82  ? 203  ASP A OD2   1 
ATOM   1550  N N     . ASP A 1 204 ? 7.182   53.052  33.040  1.00 17.48  ? 204  ASP A N     1 
ATOM   1551  C CA    . ASP A 1 204 ? 6.387   52.846  34.268  1.00 17.76  ? 204  ASP A CA    1 
ATOM   1552  C C     . ASP A 1 204 ? 6.678   51.499  34.928  1.00 17.37  ? 204  ASP A C     1 
ATOM   1553  O O     . ASP A 1 204 ? 6.866   51.420  36.142  1.00 17.26  ? 204  ASP A O     1 
ATOM   1554  C CB    . ASP A 1 204 ? 4.887   53.003  33.990  1.00 17.53  ? 204  ASP A CB    1 
ATOM   1555  C CG    . ASP A 1 204 ? 4.492   54.451  33.675  1.00 19.45  ? 204  ASP A CG    1 
ATOM   1556  O OD1   . ASP A 1 204 ? 3.313   54.686  33.339  1.00 22.02  ? 204  ASP A OD1   1 
ATOM   1557  O OD2   . ASP A 1 204 ? 5.348   55.356  33.758  1.00 19.96  ? 204  ASP A OD2   1 
ATOM   1558  N N     . ALA A 1 205 ? 6.746   50.457  34.105  1.00 17.21  ? 205  ALA A N     1 
ATOM   1559  C CA    . ALA A 1 205 ? 7.073   49.107  34.542  1.00 17.32  ? 205  ALA A CA    1 
ATOM   1560  C C     . ALA A 1 205 ? 8.420   49.059  35.240  1.00 17.95  ? 205  ALA A C     1 
ATOM   1561  O O     . ALA A 1 205 ? 8.569   48.406  36.280  1.00 18.26  ? 205  ALA A O     1 
ATOM   1562  C CB    . ALA A 1 205 ? 7.078   48.153  33.338  1.00 16.70  ? 205  ALA A CB    1 
ATOM   1563  N N     . LEU A 1 206 ? 9.396   49.755  34.659  1.00 18.22  ? 206  LEU A N     1 
ATOM   1564  C CA    . LEU A 1 206 ? 10.767  49.717  35.147  1.00 18.99  ? 206  LEU A CA    1 
ATOM   1565  C C     . LEU A 1 206 ? 10.982  50.543  36.417  1.00 19.46  ? 206  LEU A C     1 
ATOM   1566  O O     . LEU A 1 206 ? 12.036  50.455  37.048  1.00 20.21  ? 206  LEU A O     1 
ATOM   1567  C CB    . LEU A 1 206 ? 11.739  50.136  34.041  1.00 18.81  ? 206  LEU A CB    1 
ATOM   1568  C CG    . LEU A 1 206 ? 11.919  49.123  32.904  1.00 18.98  ? 206  LEU A CG    1 
ATOM   1569  C CD1   . LEU A 1 206 ? 12.958  49.631  31.946  1.00 18.55  ? 206  LEU A CD1   1 
ATOM   1570  C CD2   . LEU A 1 206 ? 12.317  47.743  33.430  1.00 18.45  ? 206  LEU A CD2   1 
ATOM   1571  N N     . LYS A 1 207 ? 9.983   51.328  36.799  1.00 20.04  ? 207  LYS A N     1 
ATOM   1572  C CA    . LYS A 1 207 ? 10.010  52.038  38.084  1.00 20.60  ? 207  LYS A CA    1 
ATOM   1573  C C     . LYS A 1 207 ? 9.614   51.122  39.243  1.00 20.85  ? 207  LYS A C     1 
ATOM   1574  O O     . LYS A 1 207 ? 9.724   51.515  40.412  1.00 20.90  ? 207  LYS A O     1 
ATOM   1575  C CB    . LYS A 1 207 ? 9.068   53.239  38.044  1.00 20.69  ? 207  LYS A CB    1 
ATOM   1576  C CG    . LYS A 1 207 ? 9.619   54.428  37.283  1.00 23.13  ? 207  LYS A CG    1 
ATOM   1577  C CD    . LYS A 1 207 ? 8.485   55.362  36.928  1.00 27.44  ? 207  LYS A CD    1 
ATOM   1578  C CE    . LYS A 1 207 ? 8.941   56.457  35.979  1.00 29.87  ? 207  LYS A CE    1 
ATOM   1579  N NZ    . LYS A 1 207 ? 7.792   56.972  35.170  1.00 31.89  ? 207  LYS A NZ    1 
ATOM   1580  N N     . ASN A 1 208 ? 9.130   49.918  38.918  1.00 20.86  ? 208  ASN A N     1 
ATOM   1581  C CA    . ASN A 1 208 ? 8.775   48.923  39.927  1.00 20.95  ? 208  ASN A CA    1 
ATOM   1582  C C     . ASN A 1 208 ? 10.045  48.526  40.657  1.00 21.15  ? 208  ASN A C     1 
ATOM   1583  O O     . ASN A 1 208 ? 10.985  48.042  40.034  1.00 20.99  ? 208  ASN A O     1 
ATOM   1584  C CB    . ASN A 1 208 ? 8.071   47.705  39.298  1.00 20.88  ? 208  ASN A CB    1 
ATOM   1585  C CG    . ASN A 1 208 ? 7.538   46.709  40.341  1.00 20.56  ? 208  ASN A CG    1 
ATOM   1586  O OD1   . ASN A 1 208 ? 8.256   46.295  41.255  1.00 20.59  ? 208  ASN A OD1   1 
ATOM   1587  N ND2   . ASN A 1 208 ? 6.281   46.301  40.180  1.00 19.68  ? 208  ASN A ND2   1 
ATOM   1588  N N     . PRO A 1 209 ? 10.084  48.761  41.983  1.00 21.68  ? 209  PRO A N     1 
ATOM   1589  C CA    . PRO A 1 209 ? 11.325  48.584  42.763  1.00 21.83  ? 209  PRO A CA    1 
ATOM   1590  C C     . PRO A 1 209 ? 11.868  47.157  42.706  1.00 21.92  ? 209  PRO A C     1 
ATOM   1591  O O     . PRO A 1 209 ? 13.063  46.940  42.916  1.00 21.38  ? 209  PRO A O     1 
ATOM   1592  C CB    . PRO A 1 209 ? 10.909  48.961  44.199  1.00 21.66  ? 209  PRO A CB    1 
ATOM   1593  C CG    . PRO A 1 209 ? 9.399   48.884  44.211  1.00 22.05  ? 209  PRO A CG    1 
ATOM   1594  C CD    . PRO A 1 209 ? 8.952   49.214  42.819  1.00 21.52  ? 209  PRO A CD    1 
ATOM   1595  N N     . ASN A 1 210 ? 10.985  46.203  42.405  1.00 22.21  ? 210  ASN A N     1 
ATOM   1596  C CA    . ASN A 1 210 ? 11.350  44.794  42.331  1.00 22.65  ? 210  ASN A CA    1 
ATOM   1597  C C     . ASN A 1 210 ? 11.956  44.395  40.983  1.00 22.63  ? 210  ASN A C     1 
ATOM   1598  O O     . ASN A 1 210 ? 12.406  43.259  40.816  1.00 23.13  ? 210  ASN A O     1 
ATOM   1599  C CB    . ASN A 1 210 ? 10.143  43.902  42.689  1.00 22.82  ? 210  ASN A CB    1 
ATOM   1600  C CG    . ASN A 1 210 ? 9.709   44.056  44.149  1.00 23.41  ? 210  ASN A CG    1 
ATOM   1601  O OD1   . ASN A 1 210 ? 10.447  43.713  45.068  1.00 23.87  ? 210  ASN A OD1   1 
ATOM   1602  N ND2   . ASN A 1 210 ? 8.503   44.572  44.358  1.00 23.00  ? 210  ASN A ND2   1 
ATOM   1603  N N     . VAL A 1 211 ? 11.966  45.318  40.021  1.00 22.82  ? 211  VAL A N     1 
ATOM   1604  C CA    . VAL A 1 211 ? 12.662  45.088  38.746  1.00 22.78  ? 211  VAL A CA    1 
ATOM   1605  C C     . VAL A 1 211 ? 14.142  45.439  38.934  1.00 22.82  ? 211  VAL A C     1 
ATOM   1606  O O     . VAL A 1 211 ? 14.479  46.601  39.177  1.00 23.16  ? 211  VAL A O     1 
ATOM   1607  C CB    . VAL A 1 211 ? 12.067  45.928  37.584  1.00 22.78  ? 211  VAL A CB    1 
ATOM   1608  C CG1   . VAL A 1 211 ? 12.934  45.804  36.317  1.00 22.48  ? 211  VAL A CG1   1 
ATOM   1609  C CG2   . VAL A 1 211 ? 10.635  45.502  37.277  1.00 23.29  ? 211  VAL A CG2   1 
ATOM   1610  N N     . THR A 1 212 ? 15.014  44.439  38.819  1.00 22.63  ? 212  THR A N     1 
ATOM   1611  C CA    . THR A 1 212 ? 16.431  44.598  39.151  1.00 22.39  ? 212  THR A CA    1 
ATOM   1612  C C     . THR A 1 212 ? 17.384  44.131  38.039  1.00 22.40  ? 212  THR A C     1 
ATOM   1613  O O     . THR A 1 212 ? 18.604  44.353  38.117  1.00 22.23  ? 212  THR A O     1 
ATOM   1614  C CB    . THR A 1 212 ? 16.800  43.843  40.464  1.00 22.33  ? 212  THR A CB    1 
ATOM   1615  O OG1   . THR A 1 212 ? 16.643  42.433  40.277  1.00 22.11  ? 212  THR A OG1   1 
ATOM   1616  C CG2   . THR A 1 212 ? 15.933  44.294  41.633  1.00 22.94  ? 212  THR A CG2   1 
ATOM   1617  N N     . SER A 1 213 ? 16.822  43.498  37.009  1.00 21.88  ? 213  SER A N     1 
ATOM   1618  C CA    . SER A 1 213 ? 17.598  42.741  36.028  1.00 21.28  ? 213  SER A CA    1 
ATOM   1619  C C     . SER A 1 213 ? 17.768  43.428  34.671  1.00 21.37  ? 213  SER A C     1 
ATOM   1620  O O     . SER A 1 213 ? 18.600  43.015  33.866  1.00 21.22  ? 213  SER A O     1 
ATOM   1621  C CB    . SER A 1 213 ? 16.915  41.400  35.807  1.00 21.33  ? 213  SER A CB    1 
ATOM   1622  O OG    . SER A 1 213 ? 15.591  41.616  35.337  1.00 20.67  ? 213  SER A OG    1 
ATOM   1623  N N     . VAL A 1 214 ? 16.975  44.459  34.398  1.00 21.36  ? 214  VAL A N     1 
ATOM   1624  C CA    . VAL A 1 214 ? 17.029  45.087  33.072  1.00 21.30  ? 214  VAL A CA    1 
ATOM   1625  C C     . VAL A 1 214 ? 18.148  46.119  33.011  1.00 21.15  ? 214  VAL A C     1 
ATOM   1626  O O     . VAL A 1 214 ? 18.244  47.004  33.870  1.00 20.70  ? 214  VAL A O     1 
ATOM   1627  C CB    . VAL A 1 214 ? 15.672  45.700  32.655  1.00 21.24  ? 214  VAL A CB    1 
ATOM   1628  C CG1   . VAL A 1 214 ? 15.764  46.343  31.261  1.00 21.11  ? 214  VAL A CG1   1 
ATOM   1629  C CG2   . VAL A 1 214 ? 14.606  44.617  32.648  1.00 21.33  ? 214  VAL A CG2   1 
ATOM   1630  N N     . GLU A 1 215 ? 18.990  45.994  31.994  1.00 20.92  ? 215  GLU A N     1 
ATOM   1631  C CA    . GLU A 1 215 ? 20.155  46.866  31.860  1.00 21.22  ? 215  GLU A CA    1 
ATOM   1632  C C     . GLU A 1 215 ? 19.937  47.907  30.781  1.00 20.61  ? 215  GLU A C     1 
ATOM   1633  O O     . GLU A 1 215 ? 20.369  49.055  30.929  1.00 20.67  ? 215  GLU A O     1 
ATOM   1634  C CB    . GLU A 1 215 ? 21.418  46.040  31.603  1.00 21.56  ? 215  GLU A CB    1 
ATOM   1635  C CG    . GLU A 1 215 ? 21.851  45.226  32.836  1.00 24.21  ? 215  GLU A CG    1 
ATOM   1636  C CD    . GLU A 1 215 ? 22.690  43.985  32.503  1.00 28.71  ? 215  GLU A CD    1 
ATOM   1637  O OE1   . GLU A 1 215 ? 22.938  43.182  33.434  1.00 29.54  ? 215  GLU A OE1   1 
ATOM   1638  O OE2   . GLU A 1 215 ? 23.100  43.799  31.328  1.00 30.72  ? 215  GLU A OE2   1 
ATOM   1639  N N     . HIS A 1 216 ? 19.237  47.512  29.717  1.00 19.35  ? 216  HIS A N     1 
ATOM   1640  C CA    . HIS A 1 216 ? 18.951  48.401  28.611  1.00 18.56  ? 216  HIS A CA    1 
ATOM   1641  C C     . HIS A 1 216 ? 17.537  48.240  28.079  1.00 17.97  ? 216  HIS A C     1 
ATOM   1642  O O     . HIS A 1 216 ? 16.933  47.169  28.179  1.00 17.36  ? 216  HIS A O     1 
ATOM   1643  C CB    . HIS A 1 216 ? 19.945  48.182  27.461  1.00 18.91  ? 216  HIS A CB    1 
ATOM   1644  C CG    . HIS A 1 216 ? 21.342  48.602  27.785  1.00 19.90  ? 216  HIS A CG    1 
ATOM   1645  N ND1   . HIS A 1 216 ? 21.710  49.927  27.912  1.00 20.71  ? 216  HIS A ND1   1 
ATOM   1646  C CD2   . HIS A 1 216 ? 22.463  47.875  28.008  1.00 20.09  ? 216  HIS A CD2   1 
ATOM   1647  C CE1   . HIS A 1 216 ? 22.995  49.997  28.214  1.00 20.54  ? 216  HIS A CE1   1 
ATOM   1648  N NE2   . HIS A 1 216 ? 23.478  48.768  28.264  1.00 20.60  ? 216  HIS A NE2   1 
ATOM   1649  N N     . VAL A 1 217 ? 17.025  49.320  27.498  1.00 17.17  ? 217  VAL A N     1 
ATOM   1650  C CA    . VAL A 1 217 ? 15.809  49.253  26.714  1.00 16.31  ? 217  VAL A CA    1 
ATOM   1651  C C     . VAL A 1 217 ? 16.200  49.654  25.297  1.00 16.44  ? 217  VAL A C     1 
ATOM   1652  O O     . VAL A 1 217 ? 16.823  50.701  25.088  1.00 16.50  ? 217  VAL A O     1 
ATOM   1653  C CB    . VAL A 1 217 ? 14.666  50.168  27.292  1.00 16.53  ? 217  VAL A CB    1 
ATOM   1654  C CG1   . VAL A 1 217 ? 13.360  49.997  26.495  1.00 14.69  ? 217  VAL A CG1   1 
ATOM   1655  C CG2   . VAL A 1 217 ? 14.417  49.854  28.742  1.00 13.70  ? 217  VAL A CG2   1 
ATOM   1656  N N     . ILE A 1 218 ? 15.879  48.793  24.335  1.00 16.18  ? 218  ILE A N     1 
ATOM   1657  C CA    . ILE A 1 218 ? 16.063  49.114  22.920  1.00 16.33  ? 218  ILE A CA    1 
ATOM   1658  C C     . ILE A 1 218 ? 14.723  49.583  22.381  1.00 16.47  ? 218  ILE A C     1 
ATOM   1659  O O     . ILE A 1 218 ? 13.717  48.871  22.525  1.00 16.89  ? 218  ILE A O     1 
ATOM   1660  C CB    . ILE A 1 218 ? 16.536  47.887  22.113  1.00 16.23  ? 218  ILE A CB    1 
ATOM   1661  C CG1   . ILE A 1 218 ? 17.912  47.424  22.599  1.00 16.19  ? 218  ILE A CG1   1 
ATOM   1662  C CG2   . ILE A 1 218 ? 16.518  48.177  20.593  1.00 16.76  ? 218  ILE A CG2   1 
ATOM   1663  C CD1   . ILE A 1 218 ? 18.506  46.267  21.794  1.00 16.44  ? 218  ILE A CD1   1 
ATOM   1664  N N     . VAL A 1 219 ? 14.706  50.772  21.770  1.00 16.28  ? 219  VAL A N     1 
ATOM   1665  C CA    . VAL A 1 219 ? 13.453  51.413  21.354  1.00 16.27  ? 219  VAL A CA    1 
ATOM   1666  C C     . VAL A 1 219 ? 13.359  51.629  19.847  1.00 16.38  ? 219  VAL A C     1 
ATOM   1667  O O     . VAL A 1 219 ? 14.167  52.355  19.277  1.00 16.94  ? 219  VAL A O     1 
ATOM   1668  C CB    . VAL A 1 219 ? 13.255  52.790  22.030  1.00 16.49  ? 219  VAL A CB    1 
ATOM   1669  C CG1   . VAL A 1 219 ? 11.828  53.328  21.756  1.00 16.70  ? 219  VAL A CG1   1 
ATOM   1670  C CG2   . VAL A 1 219 ? 13.544  52.724  23.533  1.00 15.24  ? 219  VAL A CG2   1 
ATOM   1671  N N     . LEU A 1 220 ? 12.354  51.032  19.208  1.00 16.20  ? 220  LEU A N     1 
ATOM   1672  C CA    . LEU A 1 220 ? 12.087  51.323  17.806  1.00 16.24  ? 220  LEU A CA    1 
ATOM   1673  C C     . LEU A 1 220 ? 11.299  52.633  17.644  1.00 16.80  ? 220  LEU A C     1 
ATOM   1674  O O     . LEU A 1 220 ? 10.241  52.816  18.251  1.00 16.46  ? 220  LEU A O     1 
ATOM   1675  C CB    . LEU A 1 220 ? 11.375  50.154  17.116  1.00 15.49  ? 220  LEU A CB    1 
ATOM   1676  C CG    . LEU A 1 220 ? 11.026  50.342  15.635  1.00 16.30  ? 220  LEU A CG    1 
ATOM   1677  C CD1   . LEU A 1 220 ? 12.273  50.267  14.741  1.00 15.74  ? 220  LEU A CD1   1 
ATOM   1678  C CD2   . LEU A 1 220 ? 9.963   49.351  15.162  1.00 15.64  ? 220  LEU A CD2   1 
ATOM   1679  N N     . LYS A 1 221 ? 11.823  53.542  16.819  1.00 17.49  ? 221  LYS A N     1 
ATOM   1680  C CA    . LYS A 1 221 ? 11.111  54.777  16.492  1.00 18.05  ? 221  LYS A CA    1 
ATOM   1681  C C     . LYS A 1 221 ? 10.066  54.505  15.413  1.00 18.39  ? 221  LYS A C     1 
ATOM   1682  O O     . LYS A 1 221 ? 10.297  54.760  14.229  1.00 18.23  ? 221  LYS A O     1 
ATOM   1683  C CB    . LYS A 1 221 ? 12.065  55.892  16.027  1.00 18.09  ? 221  LYS A CB    1 
ATOM   1684  C CG    . LYS A 1 221 ? 11.418  57.274  16.098  1.00 19.00  ? 221  LYS A CG    1 
ATOM   1685  C CD    . LYS A 1 221 ? 12.090  58.321  15.210  1.00 22.31  ? 221  LYS A CD    1 
ATOM   1686  C CE    . LYS A 1 221 ? 13.378  58.845  15.837  1.00 24.88  ? 221  LYS A CE    1 
ATOM   1687  N NZ    . LYS A 1 221 ? 13.130  59.229  17.260  1.00 27.03  ? 221  LYS A NZ    1 
ATOM   1688  N N     . ARG A 1 222 ? 8.919   53.979  15.832  1.00 18.68  ? 222  ARG A N     1 
ATOM   1689  C CA    . ARG A 1 222 ? 7.840   53.651  14.908  1.00 18.81  ? 222  ARG A CA    1 
ATOM   1690  C C     . ARG A 1 222 ? 7.053   54.900  14.486  1.00 19.09  ? 222  ARG A C     1 
ATOM   1691  O O     . ARG A 1 222 ? 6.798   55.098  13.288  1.00 18.35  ? 222  ARG A O     1 
ATOM   1692  C CB    . ARG A 1 222 ? 6.908   52.616  15.541  1.00 19.10  ? 222  ARG A CB    1 
ATOM   1693  C CG    . ARG A 1 222 ? 5.583   52.436  14.826  1.00 18.80  ? 222  ARG A CG    1 
ATOM   1694  C CD    . ARG A 1 222 ? 5.772   51.765  13.474  1.00 19.74  ? 222  ARG A CD    1 
ATOM   1695  N NE    . ARG A 1 222 ? 4.497   51.657  12.768  1.00 20.44  ? 222  ARG A NE    1 
ATOM   1696  C CZ    . ARG A 1 222 ? 4.021   52.574  11.936  1.00 20.43  ? 222  ARG A CZ    1 
ATOM   1697  N NH1   . ARG A 1 222 ? 4.736   53.674  11.682  1.00 20.77  ? 222  ARG A NH1   1 
ATOM   1698  N NH2   . ARG A 1 222 ? 2.842   52.383  11.350  1.00 18.61  ? 222  ARG A NH2   1 
ATOM   1699  N N     . THR A 1 223 ? 6.665   55.729  15.465  1.00 19.09  ? 223  THR A N     1 
ATOM   1700  C CA    . THR A 1 223 ? 5.840   56.909  15.185  1.00 19.66  ? 223  THR A CA    1 
ATOM   1701  C C     . THR A 1 223 ? 6.622   58.213  15.197  1.00 20.36  ? 223  THR A C     1 
ATOM   1702  O O     . THR A 1 223 ? 6.252   59.163  14.490  1.00 20.03  ? 223  THR A O     1 
ATOM   1703  C CB    . THR A 1 223 ? 4.667   57.074  16.184  1.00 19.73  ? 223  THR A CB    1 
ATOM   1704  O OG1   . THR A 1 223 ? 5.192   57.178  17.511  1.00 19.69  ? 223  THR A OG1   1 
ATOM   1705  C CG2   . THR A 1 223 ? 3.671   55.905  16.084  1.00 18.72  ? 223  THR A CG2   1 
ATOM   1706  N N     . GLY A 1 224 ? 7.682   58.252  16.011  1.00 21.05  ? 224  GLY A N     1 
ATOM   1707  C CA    . GLY A 1 224 ? 8.495   59.454  16.203  1.00 22.29  ? 224  GLY A CA    1 
ATOM   1708  C C     . GLY A 1 224 ? 7.912   60.398  17.245  1.00 23.06  ? 224  GLY A C     1 
ATOM   1709  O O     . GLY A 1 224 ? 8.336   61.538  17.361  1.00 23.03  ? 224  GLY A O     1 
ATOM   1710  N N     . SER A 1 225 ? 6.933   59.913  18.003  1.00 23.78  ? 225  SER A N     1 
ATOM   1711  C CA    . SER A 1 225 ? 6.337   60.676  19.086  1.00 24.49  ? 225  SER A CA    1 
ATOM   1712  C C     . SER A 1 225 ? 7.312   61.094  20.172  1.00 24.80  ? 225  SER A C     1 
ATOM   1713  O O     . SER A 1 225 ? 8.331   60.444  20.390  1.00 24.67  ? 225  SER A O     1 
ATOM   1714  C CB    . SER A 1 225 ? 5.207   59.886  19.716  1.00 24.63  ? 225  SER A CB    1 
ATOM   1715  O OG    . SER A 1 225 ? 3.985   60.287  19.132  1.00 26.70  ? 225  SER A OG    1 
ATOM   1716  N N     . ASP A 1 226 ? 6.992   62.204  20.835  1.00 25.25  ? 226  ASP A N     1 
ATOM   1717  C CA    . ASP A 1 226 ? 7.738   62.640  22.003  1.00 26.00  ? 226  ASP A CA    1 
ATOM   1718  C C     . ASP A 1 226 ? 7.566   61.586  23.063  1.00 25.57  ? 226  ASP A C     1 
ATOM   1719  O O     . ASP A 1 226 ? 6.432   61.188  23.369  1.00 26.13  ? 226  ASP A O     1 
ATOM   1720  C CB    . ASP A 1 226 ? 7.228   63.988  22.510  1.00 26.53  ? 226  ASP A CB    1 
ATOM   1721  C CG    . ASP A 1 226 ? 7.695   65.152  21.646  1.00 29.27  ? 226  ASP A CG    1 
ATOM   1722  O OD1   . ASP A 1 226 ? 8.225   64.901  20.532  1.00 31.73  ? 226  ASP A OD1   1 
ATOM   1723  O OD2   . ASP A 1 226 ? 7.539   66.321  22.084  1.00 32.07  ? 226  ASP A OD2   1 
ATOM   1724  N N     . ILE A 1 227 ? 8.693   61.085  23.564  1.00 24.80  ? 227  ILE A N     1 
ATOM   1725  C CA    . ILE A 1 227 ? 8.715   60.118  24.662  1.00 24.08  ? 227  ILE A CA    1 
ATOM   1726  C C     . ILE A 1 227 ? 9.811   60.543  25.621  1.00 24.06  ? 227  ILE A C     1 
ATOM   1727  O O     . ILE A 1 227 ? 10.683  61.332  25.248  1.00 23.76  ? 227  ILE A O     1 
ATOM   1728  C CB    . ILE A 1 227 ? 8.979   58.657  24.181  1.00 23.90  ? 227  ILE A CB    1 
ATOM   1729  C CG1   . ILE A 1 227 ? 10.357  58.528  23.511  1.00 23.78  ? 227  ILE A CG1   1 
ATOM   1730  C CG2   . ILE A 1 227 ? 7.851   58.172  23.262  1.00 23.14  ? 227  ILE A CG2   1 
ATOM   1731  C CD1   . ILE A 1 227 ? 10.782  57.085  23.220  1.00 23.36  ? 227  ILE A CD1   1 
ATOM   1732  N N     . ASP A 1 228 ? 9.768   60.022  26.844  1.00 23.85  ? 228  ASP A N     1 
ATOM   1733  C CA    . ASP A 1 228 ? 10.865  60.208  27.797  1.00 23.62  ? 228  ASP A CA    1 
ATOM   1734  C C     . ASP A 1 228 ? 12.038  59.302  27.429  1.00 23.16  ? 228  ASP A C     1 
ATOM   1735  O O     . ASP A 1 228 ? 11.841  58.209  26.896  1.00 23.04  ? 228  ASP A O     1 
ATOM   1736  C CB    . ASP A 1 228 ? 10.392  59.925  29.226  1.00 23.77  ? 228  ASP A CB    1 
ATOM   1737  C CG    . ASP A 1 228 ? 9.214   60.800  29.635  1.00 24.85  ? 228  ASP A CG    1 
ATOM   1738  O OD1   . ASP A 1 228 ? 8.248   60.275  30.232  1.00 26.24  ? 228  ASP A OD1   1 
ATOM   1739  O OD2   . ASP A 1 228 ? 9.247   62.016  29.346  1.00 26.18  ? 228  ASP A OD2   1 
ATOM   1740  N N     . TRP A 1 229 ? 13.249  59.762  27.722  1.00 22.84  ? 229  TRP A N     1 
ATOM   1741  C CA    . TRP A 1 229 ? 14.469  59.007  27.445  1.00 22.82  ? 229  TRP A CA    1 
ATOM   1742  C C     . TRP A 1 229 ? 15.342  58.997  28.694  1.00 22.91  ? 229  TRP A C     1 
ATOM   1743  O O     . TRP A 1 229 ? 15.594  60.050  29.284  1.00 23.07  ? 229  TRP A O     1 
ATOM   1744  C CB    . TRP A 1 229 ? 15.225  59.651  26.277  1.00 22.59  ? 229  TRP A CB    1 
ATOM   1745  C CG    . TRP A 1 229 ? 16.157  58.736  25.512  1.00 22.01  ? 229  TRP A CG    1 
ATOM   1746  C CD1   . TRP A 1 229 ? 17.520  58.767  25.512  1.00 21.11  ? 229  TRP A CD1   1 
ATOM   1747  C CD2   . TRP A 1 229 ? 15.778  57.673  24.612  1.00 22.51  ? 229  TRP A CD2   1 
ATOM   1748  N NE1   . TRP A 1 229 ? 18.020  57.785  24.672  1.00 22.04  ? 229  TRP A NE1   1 
ATOM   1749  C CE2   . TRP A 1 229 ? 16.975  57.104  24.107  1.00 21.86  ? 229  TRP A CE2   1 
ATOM   1750  C CE3   . TRP A 1 229 ? 14.546  57.154  24.180  1.00 21.21  ? 229  TRP A CE3   1 
ATOM   1751  C CZ2   . TRP A 1 229 ? 16.975  56.032  23.200  1.00 22.45  ? 229  TRP A CZ2   1 
ATOM   1752  C CZ3   . TRP A 1 229 ? 14.547  56.095  23.280  1.00 21.84  ? 229  TRP A CZ3   1 
ATOM   1753  C CH2   . TRP A 1 229 ? 15.758  55.540  22.802  1.00 21.64  ? 229  TRP A CH2   1 
ATOM   1754  N N     . GLN A 1 230 ? 15.770  57.808  29.115  1.00 22.95  ? 230  GLN A N     1 
ATOM   1755  C CA    . GLN A 1 230 ? 16.752  57.676  30.185  1.00 23.30  ? 230  GLN A CA    1 
ATOM   1756  C C     . GLN A 1 230 ? 18.120  57.421  29.558  1.00 23.25  ? 230  GLN A C     1 
ATOM   1757  O O     . GLN A 1 230 ? 18.351  56.378  28.939  1.00 23.12  ? 230  GLN A O     1 
ATOM   1758  C CB    . GLN A 1 230 ? 16.387  56.549  31.144  1.00 23.39  ? 230  GLN A CB    1 
ATOM   1759  C CG    . GLN A 1 230 ? 17.156  56.578  32.462  1.00 23.27  ? 230  GLN A CG    1 
ATOM   1760  C CD    . GLN A 1 230 ? 16.696  55.492  33.422  1.00 24.00  ? 230  GLN A CD    1 
ATOM   1761  O OE1   . GLN A 1 230 ? 15.563  55.515  33.917  1.00 25.01  ? 230  GLN A OE1   1 
ATOM   1762  N NE2   . GLN A 1 230 ? 17.573  54.539  33.692  1.00 23.42  ? 230  GLN A NE2   1 
ATOM   1763  N N     . GLU A 1 231 ? 19.008  58.402  29.700  1.00 23.03  ? 231  GLU A N     1 
ATOM   1764  C CA    . GLU A 1 231 ? 20.350  58.332  29.144  1.00 22.91  ? 231  GLU A CA    1 
ATOM   1765  C C     . GLU A 1 231 ? 21.101  57.167  29.754  1.00 22.19  ? 231  GLU A C     1 
ATOM   1766  O O     . GLU A 1 231 ? 21.031  56.945  30.969  1.00 21.81  ? 231  GLU A O     1 
ATOM   1767  C CB    . GLU A 1 231 ? 21.108  59.635  29.421  1.00 23.64  ? 231  GLU A CB    1 
ATOM   1768  C CG    . GLU A 1 231 ? 22.066  60.035  28.316  1.00 26.21  ? 231  GLU A CG    1 
ATOM   1769  C CD    . GLU A 1 231 ? 21.356  60.203  26.977  1.00 28.78  ? 231  GLU A CD    1 
ATOM   1770  O OE1   . GLU A 1 231 ? 20.344  60.947  26.927  1.00 29.20  ? 231  GLU A OE1   1 
ATOM   1771  O OE2   . GLU A 1 231 ? 21.813  59.588  25.985  1.00 29.87  ? 231  GLU A OE2   1 
ATOM   1772  N N     . GLY A 1 232 ? 21.812  56.426  28.902  1.00 21.57  ? 232  GLY A N     1 
ATOM   1773  C CA    . GLY A 1 232 ? 22.572  55.248  29.322  1.00 20.81  ? 232  GLY A CA    1 
ATOM   1774  C C     . GLY A 1 232 ? 21.778  53.976  29.105  1.00 20.54  ? 232  GLY A C     1 
ATOM   1775  O O     . GLY A 1 232 ? 22.235  53.062  28.406  1.00 20.96  ? 232  GLY A O     1 
ATOM   1776  N N     . ARG A 1 233 ? 20.583  53.930  29.696  1.00 19.45  ? 233  ARG A N     1 
ATOM   1777  C CA    . ARG A 1 233 ? 19.694  52.770  29.617  1.00 18.45  ? 233  ARG A CA    1 
ATOM   1778  C C     . ARG A 1 233 ? 19.034  52.622  28.238  1.00 18.18  ? 233  ARG A C     1 
ATOM   1779  O O     . ARG A 1 233 ? 19.081  51.550  27.641  1.00 18.20  ? 233  ARG A O     1 
ATOM   1780  C CB    . ARG A 1 233 ? 18.618  52.859  30.705  1.00 17.90  ? 233  ARG A CB    1 
ATOM   1781  C CG    . ARG A 1 233 ? 17.771  51.609  30.853  1.00 17.22  ? 233  ARG A CG    1 
ATOM   1782  C CD    . ARG A 1 233 ? 16.505  51.888  31.640  1.00 16.36  ? 233  ARG A CD    1 
ATOM   1783  N NE    . ARG A 1 233 ? 15.601  52.808  30.949  1.00 14.62  ? 233  ARG A NE    1 
ATOM   1784  C CZ    . ARG A 1 233 ? 14.452  53.249  31.453  1.00 16.18  ? 233  ARG A CZ    1 
ATOM   1785  N NH1   . ARG A 1 233 ? 14.052  52.859  32.668  1.00 13.44  ? 233  ARG A NH1   1 
ATOM   1786  N NH2   . ARG A 1 233 ? 13.693  54.082  30.736  1.00 15.15  ? 233  ARG A NH2   1 
ATOM   1787  N N     . ASP A 1 234 ? 18.437  53.702  27.737  1.00 17.79  ? 234  ASP A N     1 
ATOM   1788  C CA    . ASP A 1 234 ? 17.664  53.664  26.495  1.00 17.43  ? 234  ASP A CA    1 
ATOM   1789  C C     . ASP A 1 234 ? 18.516  53.840  25.255  1.00 17.01  ? 234  ASP A C     1 
ATOM   1790  O O     . ASP A 1 234 ? 19.377  54.729  25.190  1.00 17.05  ? 234  ASP A O     1 
ATOM   1791  C CB    . ASP A 1 234 ? 16.546  54.708  26.523  1.00 17.48  ? 234  ASP A CB    1 
ATOM   1792  C CG    . ASP A 1 234 ? 15.574  54.477  27.648  1.00 18.38  ? 234  ASP A CG    1 
ATOM   1793  O OD1   . ASP A 1 234 ? 15.529  53.346  28.170  1.00 20.33  ? 234  ASP A OD1   1 
ATOM   1794  O OD2   . ASP A 1 234 ? 14.852  55.424  28.018  1.00 19.77  ? 234  ASP A OD2   1 
ATOM   1795  N N     . LEU A 1 235 ? 18.251  52.990  24.270  1.00 16.31  ? 235  LEU A N     1 
ATOM   1796  C CA    . LEU A 1 235 ? 19.001  52.958  23.026  1.00 15.50  ? 235  LEU A CA    1 
ATOM   1797  C C     . LEU A 1 235 ? 18.039  52.877  21.827  1.00 15.63  ? 235  LEU A C     1 
ATOM   1798  O O     . LEU A 1 235 ? 17.061  52.125  21.854  1.00 15.09  ? 235  LEU A O     1 
ATOM   1799  C CB    . LEU A 1 235 ? 19.968  51.768  23.030  1.00 15.17  ? 235  LEU A CB    1 
ATOM   1800  C CG    . LEU A 1 235 ? 21.043  51.645  24.125  1.00 15.65  ? 235  LEU A CG    1 
ATOM   1801  C CD1   . LEU A 1 235 ? 21.613  50.232  24.154  1.00 15.15  ? 235  LEU A CD1   1 
ATOM   1802  C CD2   . LEU A 1 235 ? 22.194  52.677  24.011  1.00 15.10  ? 235  LEU A CD2   1 
ATOM   1803  N N     . TRP A 1 236 ? 18.303  53.667  20.786  1.00 15.45  ? 236  TRP A N     1 
ATOM   1804  C CA    . TRP A 1 236 ? 17.461  53.633  19.592  1.00 15.47  ? 236  TRP A CA    1 
ATOM   1805  C C     . TRP A 1 236 ? 17.811  52.429  18.748  1.00 15.68  ? 236  TRP A C     1 
ATOM   1806  O O     . TRP A 1 236 ? 18.983  52.101  18.571  1.00 16.12  ? 236  TRP A O     1 
ATOM   1807  C CB    . TRP A 1 236 ? 17.625  54.887  18.744  1.00 15.08  ? 236  TRP A CB    1 
ATOM   1808  C CG    . TRP A 1 236 ? 16.991  56.103  19.293  1.00 14.89  ? 236  TRP A CG    1 
ATOM   1809  C CD1   . TRP A 1 236 ? 17.630  57.248  19.700  1.00 14.04  ? 236  TRP A CD1   1 
ATOM   1810  C CD2   . TRP A 1 236 ? 15.590  56.330  19.498  1.00 14.34  ? 236  TRP A CD2   1 
ATOM   1811  N NE1   . TRP A 1 236 ? 16.711  58.167  20.147  1.00 14.67  ? 236  TRP A NE1   1 
ATOM   1812  C CE2   . TRP A 1 236 ? 15.453  57.629  20.042  1.00 14.84  ? 236  TRP A CE2   1 
ATOM   1813  C CE3   . TRP A 1 236 ? 14.437  55.564  19.278  1.00 14.30  ? 236  TRP A CE3   1 
ATOM   1814  C CZ2   . TRP A 1 236 ? 14.207  58.179  20.359  1.00 15.59  ? 236  TRP A CZ2   1 
ATOM   1815  C CZ3   . TRP A 1 236 ? 13.202  56.106  19.602  1.00 14.02  ? 236  TRP A CZ3   1 
ATOM   1816  C CH2   . TRP A 1 236 ? 13.094  57.400  20.128  1.00 15.11  ? 236  TRP A CH2   1 
ATOM   1817  N N     . TRP A 1 237 ? 16.781  51.779  18.218  1.00 16.09  ? 237  TRP A N     1 
ATOM   1818  C CA    . TRP A 1 237 ? 16.944  50.602  17.379  1.00 15.95  ? 237  TRP A CA    1 
ATOM   1819  C C     . TRP A 1 237 ? 17.850  50.890  16.188  1.00 16.58  ? 237  TRP A C     1 
ATOM   1820  O O     . TRP A 1 237 ? 18.812  50.157  15.964  1.00 17.10  ? 237  TRP A O     1 
ATOM   1821  C CB    . TRP A 1 237 ? 15.571  50.113  16.903  1.00 15.84  ? 237  TRP A CB    1 
ATOM   1822  C CG    . TRP A 1 237 ? 15.619  48.993  15.909  1.00 14.43  ? 237  TRP A CG    1 
ATOM   1823  C CD1   . TRP A 1 237 ? 15.982  49.072  14.591  1.00 14.22  ? 237  TRP A CD1   1 
ATOM   1824  C CD2   . TRP A 1 237 ? 15.266  47.630  16.146  1.00 14.45  ? 237  TRP A CD2   1 
ATOM   1825  N NE1   . TRP A 1 237 ? 15.892  47.833  13.997  1.00 13.76  ? 237  TRP A NE1   1 
ATOM   1826  C CE2   . TRP A 1 237 ? 15.439  46.933  14.924  1.00 13.41  ? 237  TRP A CE2   1 
ATOM   1827  C CE3   . TRP A 1 237 ? 14.812  46.927  17.272  1.00 13.92  ? 237  TRP A CE3   1 
ATOM   1828  C CZ2   . TRP A 1 237 ? 15.190  45.564  14.799  1.00 14.96  ? 237  TRP A CZ2   1 
ATOM   1829  C CZ3   . TRP A 1 237 ? 14.561  45.565  17.144  1.00 14.78  ? 237  TRP A CZ3   1 
ATOM   1830  C CH2   . TRP A 1 237 ? 14.752  44.895  15.916  1.00 14.32  ? 237  TRP A CH2   1 
ATOM   1831  N N     . ARG A 1 238 ? 17.545  51.942  15.429  1.00 17.08  ? 238  ARG A N     1 
ATOM   1832  C CA    . ARG A 1 238 ? 18.338  52.293  14.242  1.00 18.22  ? 238  ARG A CA    1 
ATOM   1833  C C     . ARG A 1 238 ? 19.819  52.608  14.579  1.00 19.07  ? 238  ARG A C     1 
ATOM   1834  O O     . ARG A 1 238 ? 20.737  52.104  13.924  1.00 18.74  ? 238  ARG A O     1 
ATOM   1835  C CB    . ARG A 1 238 ? 17.695  53.446  13.455  1.00 17.93  ? 238  ARG A CB    1 
ATOM   1836  C CG    . ARG A 1 238 ? 18.415  53.710  12.107  1.00 19.10  ? 238  ARG A CG    1 
ATOM   1837  C CD    . ARG A 1 238 ? 17.836  54.856  11.270  1.00 19.24  ? 238  ARG A CD    1 
ATOM   1838  N NE    . ARG A 1 238 ? 18.858  55.363  10.344  1.00 20.19  ? 238  ARG A NE    1 
ATOM   1839  C CZ    . ARG A 1 238 ? 19.052  54.953  9.086   1.00 19.80  ? 238  ARG A CZ    1 
ATOM   1840  N NH1   . ARG A 1 238 ? 18.269  54.024  8.527   1.00 18.59  ? 238  ARG A NH1   1 
ATOM   1841  N NH2   . ARG A 1 238 ? 20.041  55.486  8.378   1.00 18.34  ? 238  ARG A NH2   1 
ATOM   1842  N N     . ASP A 1 239 ? 20.039  53.450  15.596  1.00 19.67  ? 239  ASP A N     1 
ATOM   1843  C CA    . ASP A 1 239 ? 21.380  53.747  16.075  1.00 20.23  ? 239  ASP A CA    1 
ATOM   1844  C C     . ASP A 1 239 ? 22.211  52.479  16.263  1.00 20.56  ? 239  ASP A C     1 
ATOM   1845  O O     . ASP A 1 239 ? 23.370  52.434  15.854  1.00 21.12  ? 239  ASP A O     1 
ATOM   1846  C CB    . ASP A 1 239 ? 21.330  54.534  17.393  1.00 20.39  ? 239  ASP A CB    1 
ATOM   1847  C CG    . ASP A 1 239 ? 20.895  55.978  17.209  1.00 22.07  ? 239  ASP A CG    1 
ATOM   1848  O OD1   . ASP A 1 239 ? 20.606  56.385  16.056  1.00 24.36  ? 239  ASP A OD1   1 
ATOM   1849  O OD2   . ASP A 1 239 ? 20.851  56.716  18.226  1.00 22.17  ? 239  ASP A OD2   1 
ATOM   1850  N N     . LEU A 1 240 ? 21.633  51.454  16.889  1.00 20.95  ? 240  LEU A N     1 
ATOM   1851  C CA    . LEU A 1 240 ? 22.362  50.203  17.128  1.00 20.98  ? 240  LEU A CA    1 
ATOM   1852  C C     . LEU A 1 240 ? 22.555  49.359  15.870  1.00 21.33  ? 240  LEU A C     1 
ATOM   1853  O O     . LEU A 1 240 ? 23.666  48.904  15.580  1.00 21.87  ? 240  LEU A O     1 
ATOM   1854  C CB    . LEU A 1 240 ? 21.687  49.358  18.213  1.00 20.72  ? 240  LEU A CB    1 
ATOM   1855  C CG    . LEU A 1 240 ? 21.664  49.876  19.657  1.00 19.92  ? 240  LEU A CG    1 
ATOM   1856  C CD1   . LEU A 1 240 ? 20.841  48.928  20.509  1.00 17.76  ? 240  LEU A CD1   1 
ATOM   1857  C CD2   . LEU A 1 240 ? 23.073  50.046  20.235  1.00 17.81  ? 240  LEU A CD2   1 
ATOM   1858  N N     . ILE A 1 241 ? 21.481  49.147  15.125  1.00 21.36  ? 241  ILE A N     1 
ATOM   1859  C CA    . ILE A 1 241 ? 21.539  48.207  14.010  1.00 21.56  ? 241  ILE A CA    1 
ATOM   1860  C C     . ILE A 1 241 ? 22.414  48.717  12.857  1.00 21.94  ? 241  ILE A C     1 
ATOM   1861  O O     . ILE A 1 241 ? 23.098  47.930  12.195  1.00 22.07  ? 241  ILE A O     1 
ATOM   1862  C CB    . ILE A 1 241 ? 20.121  47.752  13.562  1.00 21.33  ? 241  ILE A CB    1 
ATOM   1863  C CG1   . ILE A 1 241 ? 20.172  46.331  12.984  1.00 21.38  ? 241  ILE A CG1   1 
ATOM   1864  C CG2   . ILE A 1 241 ? 19.471  48.769  12.612  1.00 20.66  ? 241  ILE A CG2   1 
ATOM   1865  C CD1   . ILE A 1 241 ? 18.832  45.596  12.993  1.00 18.83  ? 241  ILE A CD1   1 
ATOM   1866  N N     . GLU A 1 242 ? 22.421  50.033  12.646  1.00 22.24  ? 242  GLU A N     1 
ATOM   1867  C CA    . GLU A 1 242 ? 23.279  50.641  11.629  1.00 22.84  ? 242  GLU A CA    1 
ATOM   1868  C C     . GLU A 1 242 ? 24.761  50.489  11.962  1.00 22.56  ? 242  GLU A C     1 
ATOM   1869  O O     . GLU A 1 242 ? 25.596  50.510  11.057  1.00 22.60  ? 242  GLU A O     1 
ATOM   1870  C CB    . GLU A 1 242 ? 22.925  52.114  11.382  1.00 23.04  ? 242  GLU A CB    1 
ATOM   1871  C CG    . GLU A 1 242 ? 21.549  52.322  10.736  1.00 25.49  ? 242  GLU A CG    1 
ATOM   1872  C CD    . GLU A 1 242 ? 21.320  51.476  9.478   1.00 28.08  ? 242  GLU A CD    1 
ATOM   1873  O OE1   . GLU A 1 242 ? 20.391  50.633  9.480   1.00 29.45  ? 242  GLU A OE1   1 
ATOM   1874  O OE2   . GLU A 1 242 ? 22.069  51.657  8.492   1.00 29.44  ? 242  GLU A OE2   1 
ATOM   1875  N N     . LYS A 1 243 ? 25.081  50.342  13.252  1.00 21.99  ? 243  LYS A N     1 
ATOM   1876  C CA    . LYS A 1 243 ? 26.469  50.143  13.690  1.00 21.53  ? 243  LYS A CA    1 
ATOM   1877  C C     . LYS A 1 243 ? 26.933  48.680  13.593  1.00 20.92  ? 243  LYS A C     1 
ATOM   1878  O O     . LYS A 1 243 ? 28.135  48.396  13.626  1.00 20.38  ? 243  LYS A O     1 
ATOM   1879  C CB    . LYS A 1 243 ? 26.667  50.692  15.110  1.00 21.96  ? 243  LYS A CB    1 
ATOM   1880  N N     . ALA A 1 244 ? 25.969  47.769  13.439  1.00 20.17  ? 244  ALA A N     1 
ATOM   1881  C CA    . ALA A 1 244 ? 26.201  46.328  13.519  1.00 19.51  ? 244  ALA A CA    1 
ATOM   1882  C C     . ALA A 1 244 ? 26.660  45.708  12.203  1.00 19.37  ? 244  ALA A C     1 
ATOM   1883  O O     . ALA A 1 244 ? 26.320  46.185  11.120  1.00 19.41  ? 244  ALA A O     1 
ATOM   1884  C CB    . ALA A 1 244 ? 24.954  45.624  14.010  1.00 19.32  ? 244  ALA A CB    1 
ATOM   1885  N N     . SER A 1 245 ? 27.435  44.633  12.316  1.00 18.82  ? 245  SER A N     1 
ATOM   1886  C CA    . SER A 1 245 ? 27.867  43.875  11.162  1.00 18.40  ? 245  SER A CA    1 
ATOM   1887  C C     . SER A 1 245 ? 26.735  42.976  10.658  1.00 18.48  ? 245  SER A C     1 
ATOM   1888  O O     . SER A 1 245 ? 26.073  42.289  11.455  1.00 18.44  ? 245  SER A O     1 
ATOM   1889  C CB    . SER A 1 245 ? 29.082  43.027  11.521  1.00 18.13  ? 245  SER A CB    1 
ATOM   1890  O OG    . SER A 1 245 ? 29.431  42.166  10.450  1.00 19.27  ? 245  SER A OG    1 
ATOM   1891  N N     . PRO A 1 246 ? 26.509  42.979  9.332   1.00 18.51  ? 246  PRO A N     1 
ATOM   1892  C CA    . PRO A 1 246 ? 25.572  42.065  8.654   1.00 18.52  ? 246  PRO A CA    1 
ATOM   1893  C C     . PRO A 1 246 ? 26.098  40.630  8.539   1.00 18.96  ? 246  PRO A C     1 
ATOM   1894  O O     . PRO A 1 246 ? 25.397  39.761  8.016   1.00 18.90  ? 246  PRO A O     1 
ATOM   1895  C CB    . PRO A 1 246 ? 25.439  42.683  7.258   1.00 18.50  ? 246  PRO A CB    1 
ATOM   1896  C CG    . PRO A 1 246 ? 26.743  43.360  7.027   1.00 17.91  ? 246  PRO A CG    1 
ATOM   1897  C CD    . PRO A 1 246 ? 27.153  43.910  8.380   1.00 18.37  ? 246  PRO A CD    1 
ATOM   1898  N N     . GLU A 1 247 ? 27.327  40.396  9.007   1.00 19.55  ? 247  GLU A N     1 
ATOM   1899  C CA    . GLU A 1 247 ? 27.928  39.060  8.996   1.00 19.65  ? 247  GLU A CA    1 
ATOM   1900  C C     . GLU A 1 247 ? 27.797  38.405  10.364  1.00 18.70  ? 247  GLU A C     1 
ATOM   1901  O O     . GLU A 1 247 ? 28.325  38.899  11.356  1.00 18.22  ? 247  GLU A O     1 
ATOM   1902  C CB    . GLU A 1 247 ? 29.409  39.109  8.607   1.00 19.82  ? 247  GLU A CB    1 
ATOM   1903  C CG    . GLU A 1 247 ? 29.819  40.233  7.664   1.00 24.24  ? 247  GLU A CG    1 
ATOM   1904  C CD    . GLU A 1 247 ? 29.644  39.891  6.192   1.00 29.55  ? 247  GLU A CD    1 
ATOM   1905  O OE1   . GLU A 1 247 ? 30.618  40.090  5.416   1.00 31.25  ? 247  GLU A OE1   1 
ATOM   1906  O OE2   . GLU A 1 247 ? 28.538  39.438  5.809   1.00 31.02  ? 247  GLU A OE2   1 
ATOM   1907  N N     . HIS A 1 248 ? 27.087  37.287  10.404  1.00 18.50  ? 248  HIS A N     1 
ATOM   1908  C CA    . HIS A 1 248 ? 26.955  36.511  11.622  1.00 18.62  ? 248  HIS A CA    1 
ATOM   1909  C C     . HIS A 1 248 ? 26.750  35.058  11.271  1.00 19.01  ? 248  HIS A C     1 
ATOM   1910  O O     . HIS A 1 248 ? 25.834  34.717  10.521  1.00 19.07  ? 248  HIS A O     1 
ATOM   1911  C CB    . HIS A 1 248 ? 25.822  37.022  12.517  1.00 18.18  ? 248  HIS A CB    1 
ATOM   1912  C CG    . HIS A 1 248 ? 25.729  36.288  13.816  1.00 18.47  ? 248  HIS A CG    1 
ATOM   1913  N ND1   . HIS A 1 248 ? 25.099  35.068  13.935  1.00 18.22  ? 248  HIS A ND1   1 
ATOM   1914  C CD2   . HIS A 1 248 ? 26.227  36.576  15.042  1.00 18.34  ? 248  HIS A CD2   1 
ATOM   1915  C CE1   . HIS A 1 248 ? 25.201  34.643  15.181  1.00 18.32  ? 248  HIS A CE1   1 
ATOM   1916  N NE2   . HIS A 1 248 ? 25.883  35.539  15.873  1.00 18.54  ? 248  HIS A NE2   1 
ATOM   1917  N N     . GLN A 1 249 ? 27.636  34.208  11.793  1.00 20.16  ? 249  GLN A N     1 
ATOM   1918  C CA    . GLN A 1 249 ? 27.575  32.771  11.550  1.00 21.21  ? 249  GLN A CA    1 
ATOM   1919  C C     . GLN A 1 249 ? 26.861  32.082  12.717  1.00 20.92  ? 249  GLN A C     1 
ATOM   1920  O O     . GLN A 1 249 ? 27.265  32.237  13.879  1.00 20.68  ? 249  GLN A O     1 
ATOM   1921  C CB    . GLN A 1 249 ? 28.971  32.170  11.324  1.00 21.66  ? 249  GLN A CB    1 
ATOM   1922  C CG    . GLN A 1 249 ? 29.902  32.968  10.391  1.00 24.91  ? 249  GLN A CG    1 
ATOM   1923  C CD    . GLN A 1 249 ? 29.338  33.198  8.970   1.00 29.11  ? 249  GLN A CD    1 
ATOM   1924  O OE1   . GLN A 1 249 ? 29.496  34.289  8.394   1.00 30.13  ? 249  GLN A OE1   1 
ATOM   1925  N NE2   . GLN A 1 249 ? 28.683  32.172  8.406   1.00 29.90  ? 249  GLN A NE2   1 
ATOM   1926  N N     . PRO A 1 250 ? 25.787  31.321  12.410  1.00 20.93  ? 250  PRO A N     1 
ATOM   1927  C CA    . PRO A 1 250 ? 24.970  30.679  13.447  1.00 20.85  ? 250  PRO A CA    1 
ATOM   1928  C C     . PRO A 1 250 ? 25.700  29.523  14.119  1.00 21.19  ? 250  PRO A C     1 
ATOM   1929  O O     . PRO A 1 250 ? 26.404  28.758  13.450  1.00 21.30  ? 250  PRO A O     1 
ATOM   1930  C CB    . PRO A 1 250 ? 23.763  30.161  12.670  1.00 20.40  ? 250  PRO A CB    1 
ATOM   1931  C CG    . PRO A 1 250 ? 24.286  29.938  11.292  1.00 21.48  ? 250  PRO A CG    1 
ATOM   1932  C CD    . PRO A 1 250 ? 25.303  31.010  11.052  1.00 20.66  ? 250  PRO A CD    1 
ATOM   1933  N N     . GLU A 1 251 ? 25.535  29.414  15.435  1.00 21.64  ? 251  GLU A N     1 
ATOM   1934  C CA    . GLU A 1 251 ? 26.138  28.338  16.218  1.00 22.29  ? 251  GLU A CA    1 
ATOM   1935  C C     . GLU A 1 251 ? 25.117  27.246  16.491  1.00 21.54  ? 251  GLU A C     1 
ATOM   1936  O O     . GLU A 1 251 ? 23.915  27.506  16.578  1.00 21.68  ? 251  GLU A O     1 
ATOM   1937  C CB    . GLU A 1 251 ? 26.644  28.867  17.559  1.00 23.33  ? 251  GLU A CB    1 
ATOM   1938  C CG    . GLU A 1 251 ? 27.407  30.178  17.480  1.00 26.38  ? 251  GLU A CG    1 
ATOM   1939  C CD    . GLU A 1 251 ? 28.892  29.984  17.541  1.00 30.81  ? 251  GLU A CD    1 
ATOM   1940  O OE1   . GLU A 1 251 ? 29.437  29.240  16.694  1.00 32.69  ? 251  GLU A OE1   1 
ATOM   1941  O OE2   . GLU A 1 251 ? 29.511  30.588  18.443  1.00 33.10  ? 251  GLU A OE2   1 
ATOM   1942  N N     . ALA A 1 252 ? 25.609  26.026  16.637  1.00 20.81  ? 252  ALA A N     1 
ATOM   1943  C CA    . ALA A 1 252 ? 24.776  24.878  16.963  1.00 19.98  ? 252  ALA A CA    1 
ATOM   1944  C C     . ALA A 1 252 ? 24.171  25.016  18.356  1.00 19.32  ? 252  ALA A C     1 
ATOM   1945  O O     . ALA A 1 252 ? 24.885  25.243  19.332  1.00 19.90  ? 252  ALA A O     1 
ATOM   1946  C CB    . ALA A 1 252 ? 25.605  23.604  16.875  1.00 19.59  ? 252  ALA A CB    1 
ATOM   1947  N N     . MET A 1 253 ? 22.858  24.875  18.451  1.00 18.22  ? 253  MET A N     1 
ATOM   1948  C CA    . MET A 1 253 ? 22.207  24.765  19.751  1.00 17.21  ? 253  MET A CA    1 
ATOM   1949  C C     . MET A 1 253 ? 21.777  23.313  19.913  1.00 16.33  ? 253  MET A C     1 
ATOM   1950  O O     . MET A 1 253 ? 21.494  22.643  18.922  1.00 16.63  ? 253  MET A O     1 
ATOM   1951  C CB    . MET A 1 253 ? 20.984  25.703  19.828  1.00 17.61  ? 253  MET A CB    1 
ATOM   1952  C CG    . MET A 1 253 ? 21.278  27.152  19.411  1.00 17.55  ? 253  MET A CG    1 
ATOM   1953  S SD    . MET A 1 253 ? 22.327  27.964  20.629  1.00 17.81  ? 253  MET A SD    1 
ATOM   1954  C CE    . MET A 1 253 ? 23.118  29.238  19.649  1.00 18.48  ? 253  MET A CE    1 
ATOM   1955  N N     A ASN A 1 254 ? 21.718  22.831  21.147  0.50 15.89  ? 254  ASN A N     1 
ATOM   1956  N N     B ASN A 1 254 ? 21.752  22.816  21.149  0.50 15.71  ? 254  ASN A N     1 
ATOM   1957  C CA    A ASN A 1 254 ? 21.202  21.490  21.406  0.50 15.57  ? 254  ASN A CA    1 
ATOM   1958  C CA    B ASN A 1 254 ? 21.168  21.499  21.399  0.50 15.26  ? 254  ASN A CA    1 
ATOM   1959  C C     A ASN A 1 254 ? 19.675  21.468  21.312  0.50 15.60  ? 254  ASN A C     1 
ATOM   1960  C C     B ASN A 1 254 ? 19.675  21.542  21.128  0.50 15.39  ? 254  ASN A C     1 
ATOM   1961  O O     A ASN A 1 254 ? 19.009  22.410  21.754  0.50 15.85  ? 254  ASN A O     1 
ATOM   1962  O O     B ASN A 1 254 ? 19.034  22.589  21.279  0.50 15.66  ? 254  ASN A O     1 
ATOM   1963  C CB    A ASN A 1 254 ? 21.687  20.990  22.770  0.50 15.42  ? 254  ASN A CB    1 
ATOM   1964  C CB    B ASN A 1 254 ? 21.409  21.005  22.833  0.50 14.83  ? 254  ASN A CB    1 
ATOM   1965  C CG    A ASN A 1 254 ? 23.181  21.218  22.972  0.50 14.55  ? 254  ASN A CG    1 
ATOM   1966  C CG    B ASN A 1 254 ? 21.024  19.537  23.018  0.50 13.60  ? 254  ASN A CG    1 
ATOM   1967  O OD1   A ASN A 1 254 ? 24.012  20.633  22.282  0.50 13.48  ? 254  ASN A OD1   1 
ATOM   1968  O OD1   B ASN A 1 254 ? 19.940  19.217  23.525  0.50 10.82  ? 254  ASN A OD1   1 
ATOM   1969  N ND2   A ASN A 1 254 ? 23.521  22.087  23.912  0.50 14.84  ? 254  ASN A ND2   1 
ATOM   1970  N ND2   B ASN A 1 254 ? 21.907  18.636  22.582  0.50 12.39  ? 254  ASN A ND2   1 
ATOM   1971  N N     . ALA A 1 255 ? 19.133  20.397  20.729  1.00 15.48  ? 255  ALA A N     1 
ATOM   1972  C CA    . ALA A 1 255 ? 17.689  20.241  20.509  1.00 14.96  ? 255  ALA A CA    1 
ATOM   1973  C C     . ALA A 1 255 ? 16.851  20.712  21.693  1.00 14.52  ? 255  ALA A C     1 
ATOM   1974  O O     . ALA A 1 255 ? 15.742  21.238  21.506  1.00 14.42  ? 255  ALA A O     1 
ATOM   1975  C CB    . ALA A 1 255 ? 17.370  18.808  20.209  1.00 14.42  ? 255  ALA A CB    1 
ATOM   1976  N N     . GLU A 1 256 ? 17.406  20.532  22.891  1.00 13.78  ? 256  GLU A N     1 
ATOM   1977  C CA    . GLU A 1 256 ? 16.714  20.796  24.155  1.00 14.14  ? 256  GLU A CA    1 
ATOM   1978  C C     . GLU A 1 256 ? 17.163  22.081  24.851  1.00 13.95  ? 256  GLU A C     1 
ATOM   1979  O O     . GLU A 1 256 ? 16.819  22.290  26.019  1.00 14.60  ? 256  GLU A O     1 
ATOM   1980  C CB    . GLU A 1 256 ? 16.843  19.600  25.128  1.00 13.88  ? 256  GLU A CB    1 
ATOM   1981  C CG    . GLU A 1 256 ? 16.017  18.339  24.754  1.00 13.78  ? 256  GLU A CG    1 
ATOM   1982  C CD    . GLU A 1 256 ? 14.499  18.598  24.610  1.00 15.55  ? 256  GLU A CD    1 
ATOM   1983  O OE1   . GLU A 1 256 ? 13.909  19.353  25.421  1.00 15.85  ? 256  GLU A OE1   1 
ATOM   1984  O OE2   . GLU A 1 256 ? 13.883  18.023  23.690  1.00 15.42  ? 256  GLU A OE2   1 
ATOM   1985  N N     . ASP A 1 257 ? 17.936  22.923  24.154  1.00 13.37  ? 257  ASP A N     1 
ATOM   1986  C CA    . ASP A 1 257 ? 18.225  24.291  24.623  1.00 13.26  ? 257  ASP A CA    1 
ATOM   1987  C C     . ASP A 1 257 ? 16.926  25.128  24.611  1.00 13.32  ? 257  ASP A C     1 
ATOM   1988  O O     . ASP A 1 257 ? 16.180  25.128  23.611  1.00 12.89  ? 257  ASP A O     1 
ATOM   1989  C CB    . ASP A 1 257 ? 19.311  24.999  23.769  1.00 13.05  ? 257  ASP A CB    1 
ATOM   1990  C CG    . ASP A 1 257 ? 20.745  24.529  24.086  1.00 13.60  ? 257  ASP A CG    1 
ATOM   1991  O OD1   . ASP A 1 257 ? 21.006  24.061  25.224  1.00 13.19  ? 257  ASP A OD1   1 
ATOM   1992  O OD2   . ASP A 1 257 ? 21.631  24.640  23.195  1.00 13.58  ? 257  ASP A OD2   1 
ATOM   1993  N N     . PRO A 1 258 ? 16.652  25.847  25.713  1.00 13.34  ? 258  PRO A N     1 
ATOM   1994  C CA    . PRO A 1 258 ? 15.432  26.674  25.758  1.00 13.52  ? 258  PRO A CA    1 
ATOM   1995  C C     . PRO A 1 258 ? 15.407  27.680  24.623  1.00 13.40  ? 258  PRO A C     1 
ATOM   1996  O O     . PRO A 1 258 ? 16.460  28.195  24.226  1.00 12.91  ? 258  PRO A O     1 
ATOM   1997  C CB    . PRO A 1 258 ? 15.517  27.390  27.109  1.00 13.24  ? 258  PRO A CB    1 
ATOM   1998  C CG    . PRO A 1 258 ? 16.960  27.202  27.573  1.00 14.94  ? 258  PRO A CG    1 
ATOM   1999  C CD    . PRO A 1 258 ? 17.432  25.918  26.959  1.00 13.36  ? 258  PRO A CD    1 
ATOM   2000  N N     . LEU A 1 259 ? 14.217  27.931  24.087  1.00 13.39  ? 259  LEU A N     1 
ATOM   2001  C CA    . LEU A 1 259 ? 14.079  28.770  22.897  1.00 13.72  ? 259  LEU A CA    1 
ATOM   2002  C C     . LEU A 1 259 ? 13.287  30.020  23.242  1.00 13.50  ? 259  LEU A C     1 
ATOM   2003  O O     . LEU A 1 259 ? 13.741  31.134  22.980  1.00 14.57  ? 259  LEU A O     1 
ATOM   2004  C CB    . LEU A 1 259 ? 13.424  28.001  21.733  1.00 13.12  ? 259  LEU A CB    1 
ATOM   2005  C CG    . LEU A 1 259 ? 12.963  28.861  20.543  1.00 14.49  ? 259  LEU A CG    1 
ATOM   2006  C CD1   . LEU A 1 259 ? 14.140  29.219  19.620  1.00 14.36  ? 259  LEU A CD1   1 
ATOM   2007  C CD2   . LEU A 1 259 ? 11.822  28.206  19.739  1.00 13.49  ? 259  LEU A CD2   1 
ATOM   2008  N N     . PHE A 1 260 ? 12.103  29.834  23.812  1.00 13.54  ? 260  PHE A N     1 
ATOM   2009  C CA    . PHE A 1 260 ? 11.337  30.946  24.355  1.00 13.41  ? 260  PHE A CA    1 
ATOM   2010  C C     . PHE A 1 260 ? 10.515  30.580  25.598  1.00 14.12  ? 260  PHE A C     1 
ATOM   2011  O O     . PHE A 1 260 ? 10.363  29.405  25.944  1.00 13.68  ? 260  PHE A O     1 
ATOM   2012  C CB    . PHE A 1 260 ? 10.470  31.607  23.270  1.00 13.22  ? 260  PHE A CB    1 
ATOM   2013  C CG    . PHE A 1 260 ? 9.356   30.733  22.717  1.00 12.88  ? 260  PHE A CG    1 
ATOM   2014  C CD1   . PHE A 1 260 ? 8.105   30.669  23.344  1.00 13.20  ? 260  PHE A CD1   1 
ATOM   2015  C CD2   . PHE A 1 260 ? 9.545   30.005  21.554  1.00 12.82  ? 260  PHE A CD2   1 
ATOM   2016  C CE1   . PHE A 1 260 ? 7.073   29.873  22.828  1.00 12.05  ? 260  PHE A CE1   1 
ATOM   2017  C CE2   . PHE A 1 260 ? 8.522   29.200  21.021  1.00 11.44  ? 260  PHE A CE2   1 
ATOM   2018  C CZ    . PHE A 1 260 ? 7.283   29.138  21.647  1.00 12.02  ? 260  PHE A CZ    1 
ATOM   2019  N N     . ILE A 1 261 ? 10.039  31.620  26.285  1.00 15.16  ? 261  ILE A N     1 
ATOM   2020  C CA    . ILE A 1 261 ? 9.076   31.514  27.382  1.00 15.86  ? 261  ILE A CA    1 
ATOM   2021  C C     . ILE A 1 261 ? 7.877   32.358  26.984  1.00 15.55  ? 261  ILE A C     1 
ATOM   2022  O O     . ILE A 1 261 ? 8.038   33.419  26.360  1.00 15.19  ? 261  ILE A O     1 
ATOM   2023  C CB    . ILE A 1 261 ? 9.630   32.121  28.680  1.00 16.29  ? 261  ILE A CB    1 
ATOM   2024  C CG1   . ILE A 1 261 ? 10.923  31.444  29.107  1.00 17.92  ? 261  ILE A CG1   1 
ATOM   2025  C CG2   . ILE A 1 261 ? 8.623   32.019  29.807  1.00 17.95  ? 261  ILE A CG2   1 
ATOM   2026  C CD1   . ILE A 1 261 ? 11.681  32.319  30.117  1.00 23.40  ? 261  ILE A CD1   1 
ATOM   2027  N N     . LEU A 1 262 ? 6.681   31.886  27.332  1.00 15.27  ? 262  LEU A N     1 
ATOM   2028  C CA    . LEU A 1 262 ? 5.473   32.658  27.126  1.00 15.45  ? 262  LEU A CA    1 
ATOM   2029  C C     . LEU A 1 262 ? 4.602   32.617  28.355  1.00 15.33  ? 262  LEU A C     1 
ATOM   2030  O O     . LEU A 1 262 ? 4.081   31.563  28.732  1.00 14.62  ? 262  LEU A O     1 
ATOM   2031  C CB    . LEU A 1 262 ? 4.672   32.160  25.917  1.00 15.56  ? 262  LEU A CB    1 
ATOM   2032  C CG    . LEU A 1 262 ? 4.657   32.944  24.596  1.00 16.72  ? 262  LEU A CG    1 
ATOM   2033  C CD1   . LEU A 1 262 ? 3.627   32.304  23.685  1.00 15.85  ? 262  LEU A CD1   1 
ATOM   2034  C CD2   . LEU A 1 262 ? 4.356   34.449  24.757  1.00 13.06  ? 262  LEU A CD2   1 
ATOM   2035  N N     . TYR A 1 263 ? 4.411   33.778  28.964  1.00 15.44  ? 263  TYR A N     1 
ATOM   2036  C CA    . TYR A 1 263 ? 3.518   33.850  30.094  1.00 15.87  ? 263  TYR A CA    1 
ATOM   2037  C C     . TYR A 1 263 ? 2.084   33.493  29.675  1.00 16.48  ? 263  TYR A C     1 
ATOM   2038  O O     . TYR A 1 263 ? 1.569   33.931  28.610  1.00 16.41  ? 263  TYR A O     1 
ATOM   2039  C CB    . TYR A 1 263 ? 3.705   35.158  30.878  1.00 16.12  ? 263  TYR A CB    1 
ATOM   2040  C CG    . TYR A 1 263 ? 5.037   35.081  31.613  1.00 16.80  ? 263  TYR A CG    1 
ATOM   2041  C CD1   . TYR A 1 263 ? 6.226   35.461  30.991  1.00 15.98  ? 263  TYR A CD1   1 
ATOM   2042  C CD2   . TYR A 1 263 ? 5.112   34.550  32.908  1.00 16.60  ? 263  TYR A CD2   1 
ATOM   2043  C CE1   . TYR A 1 263 ? 7.456   35.339  31.652  1.00 16.27  ? 263  TYR A CE1   1 
ATOM   2044  C CE2   . TYR A 1 263 ? 6.323   34.431  33.568  1.00 16.08  ? 263  TYR A CE2   1 
ATOM   2045  C CZ    . TYR A 1 263 ? 7.492   34.824  32.930  1.00 16.21  ? 263  TYR A CZ    1 
ATOM   2046  O OH    . TYR A 1 263 ? 8.697   34.698  33.585  1.00 16.93  ? 263  TYR A OH    1 
ATOM   2047  N N     . THR A 1 264 ? 1.499   32.598  30.473  1.00 15.87  ? 264  THR A N     1 
ATOM   2048  C CA    . THR A 1 264 ? 0.204   32.017  30.192  1.00 15.31  ? 264  THR A CA    1 
ATOM   2049  C C     . THR A 1 264 ? -0.575  31.920  31.494  1.00 15.56  ? 264  THR A C     1 
ATOM   2050  O O     . THR A 1 264 ? -0.036  31.490  32.522  1.00 14.56  ? 264  THR A O     1 
ATOM   2051  C CB    . THR A 1 264 ? 0.352   30.608  29.579  1.00 15.72  ? 264  THR A CB    1 
ATOM   2052  O OG1   . THR A 1 264 ? 1.309   30.650  28.512  1.00 14.65  ? 264  THR A OG1   1 
ATOM   2053  C CG2   . THR A 1 264 ? -0.989  30.105  29.043  1.00 14.16  ? 264  THR A CG2   1 
ATOM   2054  N N     . SER A 1 265 ? -1.839  32.337  31.435  1.00 16.06  ? 265  SER A N     1 
ATOM   2055  C CA    . SER A 1 265 ? -2.747  32.300  32.579  1.00 17.22  ? 265  SER A CA    1 
ATOM   2056  C C     . SER A 1 265 ? -3.153  30.878  32.950  1.00 17.82  ? 265  SER A C     1 
ATOM   2057  O O     . SER A 1 265 ? -3.446  30.056  32.080  1.00 17.78  ? 265  SER A O     1 
ATOM   2058  C CB    . SER A 1 265 ? -4.008  33.099  32.288  1.00 16.91  ? 265  SER A CB    1 
ATOM   2059  O OG    . SER A 1 265 ? -3.710  34.458  32.128  1.00 16.76  ? 265  SER A OG    1 
ATOM   2060  N N     . GLY A 1 266 ? -3.211  30.615  34.253  1.00 18.68  ? 266  GLY A N     1 
ATOM   2061  C CA    . GLY A 1 266 ? -3.621  29.304  34.748  1.00 19.14  ? 266  GLY A CA    1 
ATOM   2062  C C     . GLY A 1 266 ? -4.834  29.343  35.662  1.00 20.25  ? 266  GLY A C     1 
ATOM   2063  O O     . GLY A 1 266 ? -5.407  30.412  35.931  1.00 19.52  ? 266  GLY A O     1 
ATOM   2064  N N     . SER A 1 267 ? -5.221  28.152  36.119  1.00 21.12  ? 267  SER A N     1 
ATOM   2065  C CA    . SER A 1 267 ? -6.336  27.971  37.039  1.00 22.22  ? 267  SER A CA    1 
ATOM   2066  C C     . SER A 1 267 ? -5.987  28.508  38.428  1.00 22.35  ? 267  SER A C     1 
ATOM   2067  O O     . SER A 1 267 ? -6.855  28.998  39.144  1.00 22.38  ? 267  SER A O     1 
ATOM   2068  C CB    . SER A 1 267 ? -6.698  26.492  37.131  1.00 22.47  ? 267  SER A CB    1 
ATOM   2069  O OG    . SER A 1 267 ? -8.052  26.346  37.505  1.00 25.48  ? 267  SER A OG    1 
ATOM   2070  N N     . THR A 1 268 ? -4.705  28.427  38.782  1.00 22.37  ? 268  THR A N     1 
ATOM   2071  C CA    . THR A 1 268 ? -4.203  28.945  40.051  1.00 22.73  ? 268  THR A CA    1 
ATOM   2072  C C     . THR A 1 268 ? -3.191  30.046  39.771  1.00 22.43  ? 268  THR A C     1 
ATOM   2073  O O     . THR A 1 268 ? -2.365  29.913  38.874  1.00 22.78  ? 268  THR A O     1 
ATOM   2074  C CB    . THR A 1 268 ? -3.507  27.822  40.881  1.00 22.68  ? 268  THR A CB    1 
ATOM   2075  O OG1   . THR A 1 268 ? -4.394  26.705  41.012  1.00 22.52  ? 268  THR A OG1   1 
ATOM   2076  C CG2   . THR A 1 268 ? -3.129  28.307  42.272  1.00 24.08  ? 268  THR A CG2   1 
ATOM   2077  N N     . GLY A 1 269 ? -3.275  31.133  40.527  1.00 22.58  ? 269  GLY A N     1 
ATOM   2078  C CA    . GLY A 1 269 ? -2.184  32.109  40.613  1.00 22.14  ? 269  GLY A CA    1 
ATOM   2079  C C     . GLY A 1 269 ? -2.051  33.072  39.444  1.00 21.83  ? 269  GLY A C     1 
ATOM   2080  O O     . GLY A 1 269 ? -2.979  33.242  38.641  1.00 21.64  ? 269  GLY A O     1 
ATOM   2081  N N     . LYS A 1 270 ? -0.892  33.717  39.374  1.00 20.91  ? 270  LYS A N     1 
ATOM   2082  C CA    . LYS A 1 270 ? -0.576  34.617  38.291  1.00 21.00  ? 270  LYS A CA    1 
ATOM   2083  C C     . LYS A 1 270 ? 0.012   33.821  37.119  1.00 19.82  ? 270  LYS A C     1 
ATOM   2084  O O     . LYS A 1 270 ? 0.340   32.650  37.279  1.00 19.18  ? 270  LYS A O     1 
ATOM   2085  C CB    . LYS A 1 270 ? 0.356   35.731  38.778  1.00 21.41  ? 270  LYS A CB    1 
ATOM   2086  C CG    . LYS A 1 270 ? -0.387  36.834  39.585  1.00 23.06  ? 270  LYS A CG    1 
ATOM   2087  C CD    . LYS A 1 270 ? 0.500   38.066  39.789  1.00 22.93  ? 270  LYS A CD    1 
ATOM   2088  C CE    . LYS A 1 270 ? -0.293  39.224  40.367  1.00 27.37  ? 270  LYS A CE    1 
ATOM   2089  N NZ    . LYS A 1 270 ? -0.784  38.956  41.766  1.00 28.86  ? 270  LYS A NZ    1 
ATOM   2090  N N     . PRO A 1 271 ? 0.077   34.434  35.923  1.00 19.10  ? 271  PRO A N     1 
ATOM   2091  C CA    . PRO A 1 271 ? 0.609   33.734  34.757  1.00 18.51  ? 271  PRO A CA    1 
ATOM   2092  C C     . PRO A 1 271 ? 2.020   33.172  34.950  1.00 18.49  ? 271  PRO A C     1 
ATOM   2093  O O     . PRO A 1 271 ? 2.865   33.794  35.619  1.00 17.84  ? 271  PRO A O     1 
ATOM   2094  C CB    . PRO A 1 271 ? 0.595   34.820  33.683  1.00 18.12  ? 271  PRO A CB    1 
ATOM   2095  C CG    . PRO A 1 271 ? -0.560  35.687  34.086  1.00 18.04  ? 271  PRO A CG    1 
ATOM   2096  C CD    . PRO A 1 271 ? -0.386  35.789  35.560  1.00 18.71  ? 271  PRO A CD    1 
ATOM   2097  N N     . LYS A 1 272 ? 2.252   32.001  34.353  1.00 18.35  ? 272  LYS A N     1 
ATOM   2098  C CA    . LYS A 1 272 ? 3.559   31.350  34.383  1.00 18.17  ? 272  LYS A CA    1 
ATOM   2099  C C     . LYS A 1 272 ? 4.194   31.267  32.998  1.00 17.35  ? 272  LYS A C     1 
ATOM   2100  O O     . LYS A 1 272 ? 3.513   31.259  31.972  1.00 16.51  ? 272  LYS A O     1 
ATOM   2101  C CB    . LYS A 1 272 ? 3.481   29.951  35.022  1.00 18.51  ? 272  LYS A CB    1 
ATOM   2102  C CG    . LYS A 1 272 ? 2.796   29.904  36.385  1.00 20.13  ? 272  LYS A CG    1 
ATOM   2103  C CD    . LYS A 1 272 ? 3.508   30.795  37.397  1.00 25.03  ? 272  LYS A CD    1 
ATOM   2104  C CE    . LYS A 1 272 ? 3.063   30.474  38.826  1.00 28.70  ? 272  LYS A CE    1 
ATOM   2105  N NZ    . LYS A 1 272 ? 3.941   31.160  39.837  1.00 32.58  ? 272  LYS A NZ    1 
ATOM   2106  N N     . GLY A 1 273 ? 5.517   31.199  32.998  1.00 16.29  ? 273  GLY A N     1 
ATOM   2107  C CA    . GLY A 1 273 ? 6.264   31.147  31.780  1.00 16.14  ? 273  GLY A CA    1 
ATOM   2108  C C     . GLY A 1 273 ? 6.334   29.746  31.238  1.00 15.44  ? 273  GLY A C     1 
ATOM   2109  O O     . GLY A 1 273 ? 7.147   28.947  31.682  1.00 15.86  ? 273  GLY A O     1 
ATOM   2110  N N     . VAL A 1 274 ? 5.470   29.454  30.278  1.00 14.94  ? 274  VAL A N     1 
ATOM   2111  C CA    . VAL A 1 274 ? 5.533   28.200  29.545  1.00 14.19  ? 274  VAL A CA    1 
ATOM   2112  C C     . VAL A 1 274 ? 6.775   28.234  28.663  1.00 14.33  ? 274  VAL A C     1 
ATOM   2113  O O     . VAL A 1 274 ? 6.965   29.173  27.879  1.00 14.07  ? 274  VAL A O     1 
ATOM   2114  C CB    . VAL A 1 274 ? 4.252   27.985  28.697  1.00 14.27  ? 274  VAL A CB    1 
ATOM   2115  C CG1   . VAL A 1 274 ? 4.332   26.687  27.904  1.00 13.17  ? 274  VAL A CG1   1 
ATOM   2116  C CG2   . VAL A 1 274 ? 3.019   28.002  29.596  1.00 12.01  ? 274  VAL A CG2   1 
ATOM   2117  N N     . LEU A 1 275 ? 7.607   27.200  28.793  1.00 14.06  ? 275  LEU A N     1 
ATOM   2118  C CA    . LEU A 1 275 ? 8.902   27.141  28.128  1.00 13.80  ? 275  LEU A CA    1 
ATOM   2119  C C     . LEU A 1 275 ? 8.943   26.094  27.027  1.00 13.81  ? 275  LEU A C     1 
ATOM   2120  O O     . LEU A 1 275 ? 8.577   24.932  27.229  1.00 14.16  ? 275  LEU A O     1 
ATOM   2121  C CB    . LEU A 1 275 ? 10.031  26.904  29.157  1.00 13.68  ? 275  LEU A CB    1 
ATOM   2122  C CG    . LEU A 1 275 ? 11.503  27.055  28.741  1.00 13.58  ? 275  LEU A CG    1 
ATOM   2123  C CD1   . LEU A 1 275 ? 12.351  27.452  29.930  1.00 12.45  ? 275  LEU A CD1   1 
ATOM   2124  C CD2   . LEU A 1 275 ? 12.055  25.770  28.108  1.00 13.84  ? 275  LEU A CD2   1 
ATOM   2125  N N     . HIS A 1 276 ? 9.403   26.526  25.857  1.00 13.69  ? 276  HIS A N     1 
ATOM   2126  C CA    . HIS A 1 276 ? 9.673   25.636  24.746  1.00 13.38  ? 276  HIS A CA    1 
ATOM   2127  C C     . HIS A 1 276 ? 11.156  25.538  24.459  1.00 13.37  ? 276  HIS A C     1 
ATOM   2128  O O     . HIS A 1 276 ? 11.890  26.531  24.530  1.00 13.57  ? 276  HIS A O     1 
ATOM   2129  C CB    . HIS A 1 276 ? 8.893   26.079  23.496  1.00 13.66  ? 276  HIS A CB    1 
ATOM   2130  C CG    . HIS A 1 276 ? 7.432   25.758  23.587  1.00 13.97  ? 276  HIS A CG    1 
ATOM   2131  N ND1   . HIS A 1 276 ? 6.921   24.526  23.235  1.00 13.54  ? 276  HIS A ND1   1 
ATOM   2132  C CD2   . HIS A 1 276 ? 6.391   26.472  24.078  1.00 12.30  ? 276  HIS A CD2   1 
ATOM   2133  C CE1   . HIS A 1 276 ? 5.621   24.513  23.466  1.00 13.00  ? 276  HIS A CE1   1 
ATOM   2134  N NE2   . HIS A 1 276 ? 5.276   25.679  23.981  1.00 11.98  ? 276  HIS A NE2   1 
ATOM   2135  N N     . THR A 1 277 ? 11.603  24.329  24.147  1.00 13.50  ? 277  THR A N     1 
ATOM   2136  C CA    . THR A 1 277 ? 12.947  24.163  23.642  1.00 13.10  ? 277  THR A CA    1 
ATOM   2137  C C     . THR A 1 277 ? 12.925  24.288  22.117  1.00 13.52  ? 277  THR A C     1 
ATOM   2138  O O     . THR A 1 277 ? 11.992  24.880  21.552  1.00 13.61  ? 277  THR A O     1 
ATOM   2139  C CB    . THR A 1 277 ? 13.641  22.901  24.188  1.00 13.19  ? 277  THR A CB    1 
ATOM   2140  O OG1   . THR A 1 277 ? 12.875  21.743  23.858  1.00 13.33  ? 277  THR A OG1   1 
ATOM   2141  C CG2   . THR A 1 277 ? 13.771  22.994  25.721  1.00 12.68  ? 277  THR A CG2   1 
ATOM   2142  N N     . THR A 1 278 ? 13.945  23.746  21.464  1.00 13.56  ? 278  THR A N     1 
ATOM   2143  C CA    . THR A 1 278 ? 14.281  24.131  20.112  1.00 14.09  ? 278  THR A CA    1 
ATOM   2144  C C     . THR A 1 278 ? 13.879  23.111  19.039  1.00 14.44  ? 278  THR A C     1 
ATOM   2145  O O     . THR A 1 278 ? 13.061  23.438  18.165  1.00 14.99  ? 278  THR A O     1 
ATOM   2146  C CB    . THR A 1 278 ? 15.780  24.533  20.016  1.00 14.20  ? 278  THR A CB    1 
ATOM   2147  O OG1   . THR A 1 278 ? 16.041  25.580  20.958  1.00 13.37  ? 278  THR A OG1   1 
ATOM   2148  C CG2   . THR A 1 278 ? 16.141  25.017  18.615  1.00 14.63  ? 278  THR A CG2   1 
ATOM   2149  N N     . GLY A 1 279 ? 14.421  21.893  19.112  1.00 14.55  ? 279  GLY A N     1 
ATOM   2150  C CA    . GLY A 1 279 ? 14.282  20.906  18.033  1.00 14.41  ? 279  GLY A CA    1 
ATOM   2151  C C     . GLY A 1 279 ? 12.875  20.373  17.789  1.00 14.86  ? 279  GLY A C     1 
ATOM   2152  O O     . GLY A 1 279 ? 12.312  20.533  16.696  1.00 14.46  ? 279  GLY A O     1 
ATOM   2153  N N     . GLY A 1 280 ? 12.309  19.728  18.807  1.00 14.59  ? 280  GLY A N     1 
ATOM   2154  C CA    . GLY A 1 280 ? 10.964  19.184  18.727  1.00 14.05  ? 280  GLY A CA    1 
ATOM   2155  C C     . GLY A 1 280 ? 9.943   20.256  18.411  1.00 14.24  ? 280  GLY A C     1 
ATOM   2156  O O     . GLY A 1 280 ? 9.043   20.044  17.587  1.00 14.00  ? 280  GLY A O     1 
ATOM   2157  N N     . TYR A 1 281 ? 10.084  21.407  19.070  1.00 14.31  ? 281  TYR A N     1 
ATOM   2158  C CA    . TYR A 1 281 ? 9.205   22.548  18.834  1.00 14.48  ? 281  TYR A CA    1 
ATOM   2159  C C     . TYR A 1 281 ? 9.173   22.943  17.355  1.00 14.32  ? 281  TYR A C     1 
ATOM   2160  O O     . TYR A 1 281 ? 8.102   23.004  16.741  1.00 14.88  ? 281  TYR A O     1 
ATOM   2161  C CB    . TYR A 1 281 ? 9.598   23.774  19.681  1.00 15.00  ? 281  TYR A CB    1 
ATOM   2162  C CG    . TYR A 1 281 ? 8.848   25.009  19.205  1.00 15.56  ? 281  TYR A CG    1 
ATOM   2163  C CD1   . TYR A 1 281 ? 7.510   25.222  19.570  1.00 14.96  ? 281  TYR A CD1   1 
ATOM   2164  C CD2   . TYR A 1 281 ? 9.452   25.922  18.335  1.00 14.55  ? 281  TYR A CD2   1 
ATOM   2165  C CE1   . TYR A 1 281 ? 6.801   26.339  19.096  1.00 16.99  ? 281  TYR A CE1   1 
ATOM   2166  C CE2   . TYR A 1 281 ? 8.752   27.038  17.850  1.00 16.31  ? 281  TYR A CE2   1 
ATOM   2167  C CZ    . TYR A 1 281 ? 7.432   27.237  18.241  1.00 16.47  ? 281  TYR A CZ    1 
ATOM   2168  O OH    . TYR A 1 281 ? 6.744   28.332  17.768  1.00 17.46  ? 281  TYR A OH    1 
ATOM   2169  N N     . LEU A 1 282 ? 10.345  23.216  16.795  1.00 14.04  ? 282  LEU A N     1 
ATOM   2170  C CA    . LEU A 1 282 ? 10.455  23.638  15.403  1.00 13.96  ? 282  LEU A CA    1 
ATOM   2171  C C     . LEU A 1 282 ? 10.071  22.547  14.406  1.00 14.12  ? 282  LEU A C     1 
ATOM   2172  O O     . LEU A 1 282 ? 9.416   22.830  13.411  1.00 14.78  ? 282  LEU A O     1 
ATOM   2173  C CB    . LEU A 1 282 ? 11.849  24.210  15.105  1.00 14.25  ? 282  LEU A CB    1 
ATOM   2174  C CG    . LEU A 1 282 ? 11.969  24.985  13.776  1.00 14.63  ? 282  LEU A CG    1 
ATOM   2175  C CD1   . LEU A 1 282 ? 10.949  26.151  13.693  1.00 14.99  ? 282  LEU A CD1   1 
ATOM   2176  C CD2   . LEU A 1 282 ? 13.397  25.464  13.505  1.00 12.49  ? 282  LEU A CD2   1 
ATOM   2177  N N     . VAL A 1 283 ? 10.460  21.299  14.660  1.00 14.89  ? 283  VAL A N     1 
ATOM   2178  C CA    . VAL A 1 283 ? 9.982   20.183  13.820  1.00 14.89  ? 283  VAL A CA    1 
ATOM   2179  C C     . VAL A 1 283 ? 8.443   20.146  13.780  1.00 15.90  ? 283  VAL A C     1 
ATOM   2180  O O     . VAL A 1 283 ? 7.830   19.993  12.700  1.00 16.79  ? 283  VAL A O     1 
ATOM   2181  C CB    . VAL A 1 283 ? 10.472  18.805  14.320  1.00 14.75  ? 283  VAL A CB    1 
ATOM   2182  C CG1   . VAL A 1 283 ? 9.648   17.669  13.672  1.00 13.50  ? 283  VAL A CG1   1 
ATOM   2183  C CG2   . VAL A 1 283 ? 11.947  18.635  14.045  1.00 13.69  ? 283  VAL A CG2   1 
ATOM   2184  N N     . TYR A 1 284 ? 7.831   20.272  14.958  1.00 15.10  ? 284  TYR A N     1 
ATOM   2185  C CA    . TYR A 1 284 ? 6.386   20.171  15.081  1.00 14.76  ? 284  TYR A CA    1 
ATOM   2186  C C     . TYR A 1 284 ? 5.666   21.359  14.433  1.00 15.03  ? 284  TYR A C     1 
ATOM   2187  O O     . TYR A 1 284 ? 4.655   21.171  13.726  1.00 15.15  ? 284  TYR A O     1 
ATOM   2188  C CB    . TYR A 1 284 ? 5.984   19.985  16.550  1.00 13.90  ? 284  TYR A CB    1 
ATOM   2189  C CG    . TYR A 1 284 ? 4.625   19.353  16.726  1.00 13.43  ? 284  TYR A CG    1 
ATOM   2190  C CD1   . TYR A 1 284 ? 3.546   20.105  17.201  1.00 11.75  ? 284  TYR A CD1   1 
ATOM   2191  C CD2   . TYR A 1 284 ? 4.416   18.004  16.422  1.00 10.79  ? 284  TYR A CD2   1 
ATOM   2192  C CE1   . TYR A 1 284 ? 2.306   19.532  17.364  1.00 11.03  ? 284  TYR A CE1   1 
ATOM   2193  C CE2   . TYR A 1 284 ? 3.173   17.424  16.578  1.00 10.89  ? 284  TYR A CE2   1 
ATOM   2194  C CZ    . TYR A 1 284 ? 2.119   18.199  17.041  1.00 11.30  ? 284  TYR A CZ    1 
ATOM   2195  O OH    . TYR A 1 284 ? 0.874   17.642  17.194  1.00 10.43  ? 284  TYR A OH    1 
ATOM   2196  N N     . ALA A 1 285 ? 6.199   22.566  14.639  1.00 14.59  ? 285  ALA A N     1 
ATOM   2197  C CA    . ALA A 1 285 ? 5.637   23.771  14.014  1.00 14.47  ? 285  ALA A CA    1 
ATOM   2198  C C     . ALA A 1 285 ? 5.676   23.694  12.484  1.00 14.49  ? 285  ALA A C     1 
ATOM   2199  O O     . ALA A 1 285 ? 4.678   24.001  11.831  1.00 14.63  ? 285  ALA A O     1 
ATOM   2200  C CB    . ALA A 1 285 ? 6.340   25.057  14.519  1.00 14.43  ? 285  ALA A CB    1 
ATOM   2201  N N     . ALA A 1 286 ? 6.812   23.270  11.919  1.00 14.14  ? 286  ALA A N     1 
ATOM   2202  C CA    . ALA A 1 286 ? 6.971   23.171  10.458  1.00 13.51  ? 286  ALA A CA    1 
ATOM   2203  C C     . ALA A 1 286 ? 6.084   22.086  9.824   1.00 13.65  ? 286  ALA A C     1 
ATOM   2204  O O     . ALA A 1 286 ? 5.520   22.273  8.730   1.00 13.64  ? 286  ALA A O     1 
ATOM   2205  C CB    . ALA A 1 286 ? 8.423   22.942  10.097  1.00 13.06  ? 286  ALA A CB    1 
ATOM   2206  N N     . THR A 1 287 ? 5.995   20.954  10.513  1.00 13.22  ? 287  THR A N     1 
ATOM   2207  C CA    . THR A 1 287 ? 5.194   19.808  10.098  1.00 13.11  ? 287  THR A CA    1 
ATOM   2208  C C     . THR A 1 287 ? 3.687   20.116  10.135  1.00 13.16  ? 287  THR A C     1 
ATOM   2209  O O     . THR A 1 287 ? 2.964   19.852  9.171   1.00 13.64  ? 287  THR A O     1 
ATOM   2210  C CB    . THR A 1 287 ? 5.526   18.579  11.004  1.00 12.88  ? 287  THR A CB    1 
ATOM   2211  O OG1   . THR A 1 287 ? 6.925   18.296  10.893  1.00 13.27  ? 287  THR A OG1   1 
ATOM   2212  C CG2   . THR A 1 287 ? 4.713   17.329  10.607  1.00 11.98  ? 287  THR A CG2   1 
ATOM   2213  N N     . THR A 1 288 ? 3.216   20.646  11.260  1.00 12.94  ? 288  THR A N     1 
ATOM   2214  C CA    . THR A 1 288 ? 1.808   21.018  11.390  1.00 12.97  ? 288  THR A CA    1 
ATOM   2215  C C     . THR A 1 288 ? 1.428   22.087  10.383  1.00 13.54  ? 288  THR A C     1 
ATOM   2216  O O     . THR A 1 288 ? 0.440   21.934  9.661   1.00 14.19  ? 288  THR A O     1 
ATOM   2217  C CB    . THR A 1 288 ? 1.448   21.450  12.825  1.00 13.02  ? 288  THR A CB    1 
ATOM   2218  O OG1   . THR A 1 288 ? 2.425   22.371  13.305  1.00 10.85  ? 288  THR A OG1   1 
ATOM   2219  C CG2   . THR A 1 288 ? 1.431   20.232  13.745  1.00 11.79  ? 288  THR A CG2   1 
ATOM   2220  N N     . PHE A 1 289 ? 2.226   23.146  10.298  1.00 13.45  ? 289  PHE A N     1 
ATOM   2221  C CA    . PHE A 1 289 ? 1.985   24.179  9.300   1.00 14.06  ? 289  PHE A CA    1 
ATOM   2222  C C     . PHE A 1 289 ? 1.800   23.581  7.888   1.00 14.69  ? 289  PHE A C     1 
ATOM   2223  O O     . PHE A 1 289 ? 0.755   23.776  7.256   1.00 14.57  ? 289  PHE A O     1 
ATOM   2224  C CB    . PHE A 1 289 ? 3.121   25.210  9.285   1.00 13.75  ? 289  PHE A CB    1 
ATOM   2225  C CG    . PHE A 1 289 ? 3.033   26.180  8.136   1.00 13.81  ? 289  PHE A CG    1 
ATOM   2226  C CD1   . PHE A 1 289 ? 2.215   27.304  8.222   1.00 13.02  ? 289  PHE A CD1   1 
ATOM   2227  C CD2   . PHE A 1 289 ? 3.760   25.959  6.956   1.00 14.72  ? 289  PHE A CD2   1 
ATOM   2228  C CE1   . PHE A 1 289 ? 2.127   28.201  7.147   1.00 13.41  ? 289  PHE A CE1   1 
ATOM   2229  C CE2   . PHE A 1 289 ? 3.677   26.847  5.891   1.00 13.54  ? 289  PHE A CE2   1 
ATOM   2230  C CZ    . PHE A 1 289 ? 2.847   27.963  5.983   1.00 12.80  ? 289  PHE A CZ    1 
ATOM   2231  N N     . LYS A 1 290 ? 2.819   22.849  7.419   1.00 14.89  ? 290  LYS A N     1 
ATOM   2232  C CA    . LYS A 1 290 ? 2.810   22.302  6.084   1.00 15.74  ? 290  LYS A CA    1 
ATOM   2233  C C     . LYS A 1 290 ? 1.594   21.431  5.790   1.00 15.82  ? 290  LYS A C     1 
ATOM   2234  O O     . LYS A 1 290 ? 0.928   21.631  4.780   1.00 16.26  ? 290  LYS A O     1 
ATOM   2235  C CB    . LYS A 1 290 ? 4.099   21.538  5.790   1.00 15.75  ? 290  LYS A CB    1 
ATOM   2236  C CG    . LYS A 1 290 ? 4.121   20.934  4.387   1.00 18.19  ? 290  LYS A CG    1 
ATOM   2237  C CD    . LYS A 1 290 ? 5.517   20.926  3.773   1.00 21.18  ? 290  LYS A CD    1 
ATOM   2238  C CE    . LYS A 1 290 ? 6.317   19.757  4.276   1.00 22.49  ? 290  LYS A CE    1 
ATOM   2239  N NZ    . LYS A 1 290 ? 7.650   19.641  3.602   1.00 25.85  ? 290  LYS A NZ    1 
ATOM   2240  N N     . TYR A 1 291 ? 1.318   20.455  6.652   1.00 16.13  ? 291  TYR A N     1 
ATOM   2241  C CA    . TYR A 1 291 ? 0.282   19.460  6.346   1.00 16.11  ? 291  TYR A CA    1 
ATOM   2242  C C     . TYR A 1 291 ? -1.143  20.005  6.516   1.00 15.85  ? 291  TYR A C     1 
ATOM   2243  O O     . TYR A 1 291 ? -2.045  19.727  5.704   1.00 15.73  ? 291  TYR A O     1 
ATOM   2244  C CB    . TYR A 1 291 ? 0.501   18.195  7.182   1.00 16.25  ? 291  TYR A CB    1 
ATOM   2245  C CG    . TYR A 1 291 ? 1.709   17.354  6.757   1.00 18.25  ? 291  TYR A CG    1 
ATOM   2246  C CD1   . TYR A 1 291 ? 2.412   16.575  7.698   1.00 18.89  ? 291  TYR A CD1   1 
ATOM   2247  C CD2   . TYR A 1 291 ? 2.153   17.339  5.425   1.00 16.81  ? 291  TYR A CD2   1 
ATOM   2248  C CE1   . TYR A 1 291 ? 3.519   15.797  7.317   1.00 19.68  ? 291  TYR A CE1   1 
ATOM   2249  C CE2   . TYR A 1 291 ? 3.262   16.575  5.038   1.00 18.57  ? 291  TYR A CE2   1 
ATOM   2250  C CZ    . TYR A 1 291 ? 3.937   15.796  5.986   1.00 19.00  ? 291  TYR A CZ    1 
ATOM   2251  O OH    . TYR A 1 291 ? 5.016   15.014  5.599   1.00 18.44  ? 291  TYR A OH    1 
ATOM   2252  N N     . VAL A 1 292 ? -1.336  20.792  7.568   1.00 15.29  ? 292  VAL A N     1 
ATOM   2253  C CA    . VAL A 1 292 ? -2.670  21.319  7.924   1.00 14.96  ? 292  VAL A CA    1 
ATOM   2254  C C     . VAL A 1 292 ? -3.134  22.469  7.021   1.00 15.02  ? 292  VAL A C     1 
ATOM   2255  O O     . VAL A 1 292 ? -4.320  22.549  6.682   1.00 15.35  ? 292  VAL A O     1 
ATOM   2256  C CB    . VAL A 1 292 ? -2.723  21.703  9.419   1.00 14.86  ? 292  VAL A CB    1 
ATOM   2257  C CG1   . VAL A 1 292 ? -3.988  22.530  9.777   1.00 14.26  ? 292  VAL A CG1   1 
ATOM   2258  C CG2   . VAL A 1 292 ? -2.595  20.449  10.279  1.00 12.90  ? 292  VAL A CG2   1 
ATOM   2259  N N     . PHE A 1 293 ? -2.219  23.355  6.628   1.00 14.69  ? 293  PHE A N     1 
ATOM   2260  C CA    . PHE A 1 293 ? -2.575  24.404  5.665   1.00 14.57  ? 293  PHE A CA    1 
ATOM   2261  C C     . PHE A 1 293 ? -2.302  23.976  4.223   1.00 14.85  ? 293  PHE A C     1 
ATOM   2262  O O     . PHE A 1 293 ? -2.505  24.763  3.300   1.00 14.66  ? 293  PHE A O     1 
ATOM   2263  C CB    . PHE A 1 293 ? -1.881  25.726  5.995   1.00 14.01  ? 293  PHE A CB    1 
ATOM   2264  C CG    . PHE A 1 293 ? -2.256  26.281  7.357   1.00 15.10  ? 293  PHE A CG    1 
ATOM   2265  C CD1   . PHE A 1 293 ? -1.314  26.364  8.376   1.00 14.65  ? 293  PHE A CD1   1 
ATOM   2266  C CD2   . PHE A 1 293 ? -3.551  26.702  7.619   1.00 11.68  ? 293  PHE A CD2   1 
ATOM   2267  C CE1   . PHE A 1 293 ? -1.662  26.866  9.628   1.00 15.34  ? 293  PHE A CE1   1 
ATOM   2268  C CE2   . PHE A 1 293 ? -3.897  27.203  8.869   1.00 14.00  ? 293  PHE A CE2   1 
ATOM   2269  C CZ    . PHE A 1 293 ? -2.954  27.282  9.873   1.00 14.34  ? 293  PHE A CZ    1 
ATOM   2270  N N     . ASP A 1 294 ? -1.849  22.725  4.045   1.00 14.97  ? 294  ASP A N     1 
ATOM   2271  C CA    . ASP A 1 294 ? -1.535  22.161  2.735   1.00 15.21  ? 294  ASP A CA    1 
ATOM   2272  C C     . ASP A 1 294 ? -0.587  23.077  1.960   1.00 15.54  ? 294  ASP A C     1 
ATOM   2273  O O     . ASP A 1 294 ? -0.759  23.315  0.758   1.00 15.12  ? 294  ASP A O     1 
ATOM   2274  C CB    . ASP A 1 294 ? -2.822  21.887  1.942   1.00 15.38  ? 294  ASP A CB    1 
ATOM   2275  C CG    . ASP A 1 294 ? -2.618  20.903  0.793   1.00 15.12  ? 294  ASP A CG    1 
ATOM   2276  O OD1   . ASP A 1 294 ? -3.093  21.200  -0.332  1.00 13.76  ? 294  ASP A OD1   1 
ATOM   2277  O OD2   . ASP A 1 294 ? -2.001  19.839  1.019   1.00 14.49  ? 294  ASP A OD2   1 
ATOM   2278  N N     . TYR A 1 295 ? 0.439   23.564  2.650   1.00 15.87  ? 295  TYR A N     1 
ATOM   2279  C CA    . TYR A 1 295 ? 1.355   24.528  2.055   1.00 16.66  ? 295  TYR A CA    1 
ATOM   2280  C C     . TYR A 1 295 ? 2.128   24.005  0.841   1.00 17.19  ? 295  TYR A C     1 
ATOM   2281  O O     . TYR A 1 295 ? 2.892   23.047  0.963   1.00 16.76  ? 295  TYR A O     1 
ATOM   2282  C CB    . TYR A 1 295 ? 2.339   25.078  3.093   1.00 17.29  ? 295  TYR A CB    1 
ATOM   2283  C CG    . TYR A 1 295 ? 3.372   25.926  2.437   1.00 18.28  ? 295  TYR A CG    1 
ATOM   2284  C CD1   . TYR A 1 295 ? 3.101   27.261  2.112   1.00 19.35  ? 295  TYR A CD1   1 
ATOM   2285  C CD2   . TYR A 1 295 ? 4.604   25.387  2.070   1.00 18.32  ? 295  TYR A CD2   1 
ATOM   2286  C CE1   . TYR A 1 295 ? 4.045   28.040  1.466   1.00 18.99  ? 295  TYR A CE1   1 
ATOM   2287  C CE2   . TYR A 1 295 ? 5.550   26.153  1.420   1.00 18.30  ? 295  TYR A CE2   1 
ATOM   2288  C CZ    . TYR A 1 295 ? 5.264   27.480  1.119   1.00 19.23  ? 295  TYR A CZ    1 
ATOM   2289  O OH    . TYR A 1 295 ? 6.221   28.243  0.464   1.00 20.78  ? 295  TYR A OH    1 
ATOM   2290  N N     . HIS A 1 296 ? 1.923   24.659  -0.314  1.00 17.12  ? 296  HIS A N     1 
ATOM   2291  C CA    . HIS A 1 296 ? 2.726   24.457  -1.523  1.00 17.47  ? 296  HIS A CA    1 
ATOM   2292  C C     . HIS A 1 296 ? 3.548   25.734  -1.788  1.00 17.38  ? 296  HIS A C     1 
ATOM   2293  O O     . HIS A 1 296 ? 3.039   26.836  -1.571  1.00 17.77  ? 296  HIS A O     1 
ATOM   2294  C CB    . HIS A 1 296 ? 1.827   24.194  -2.752  1.00 17.55  ? 296  HIS A CB    1 
ATOM   2295  C CG    . HIS A 1 296 ? 1.101   22.884  -2.727  1.00 17.17  ? 296  HIS A CG    1 
ATOM   2296  N ND1   . HIS A 1 296 ? 0.202   22.545  -1.739  1.00 17.34  ? 296  HIS A ND1   1 
ATOM   2297  C CD2   . HIS A 1 296 ? 1.106   21.849  -3.599  1.00 17.63  ? 296  HIS A CD2   1 
ATOM   2298  C CE1   . HIS A 1 296 ? -0.290  21.344  -1.986  1.00 17.09  ? 296  HIS A CE1   1 
ATOM   2299  N NE2   . HIS A 1 296 ? 0.241   20.900  -3.109  1.00 18.23  ? 296  HIS A NE2   1 
ATOM   2300  N N     . PRO A 1 297 ? 4.816   25.596  -2.249  1.00 17.47  ? 297  PRO A N     1 
ATOM   2301  C CA    . PRO A 1 297 ? 5.617   26.785  -2.626  1.00 17.26  ? 297  PRO A CA    1 
ATOM   2302  C C     . PRO A 1 297 ? 4.835   27.804  -3.458  1.00 17.15  ? 297  PRO A C     1 
ATOM   2303  O O     . PRO A 1 297 ? 4.150   27.444  -4.413  1.00 16.10  ? 297  PRO A O     1 
ATOM   2304  C CB    . PRO A 1 297 ? 6.778   26.194  -3.443  1.00 17.00  ? 297  PRO A CB    1 
ATOM   2305  C CG    . PRO A 1 297 ? 6.980   24.818  -2.840  1.00 17.55  ? 297  PRO A CG    1 
ATOM   2306  C CD    . PRO A 1 297 ? 5.585   24.336  -2.433  1.00 17.37  ? 297  PRO A CD    1 
ATOM   2307  N N     . GLY A 1 298 ? 4.912   29.069  -3.059  1.00 17.37  ? 298  GLY A N     1 
ATOM   2308  C CA    . GLY A 1 298 ? 4.186   30.122  -3.768  1.00 18.16  ? 298  GLY A CA    1 
ATOM   2309  C C     . GLY A 1 298 ? 2.894   30.567  -3.102  1.00 18.27  ? 298  GLY A C     1 
ATOM   2310  O O     . GLY A 1 298 ? 2.341   31.606  -3.471  1.00 19.03  ? 298  GLY A O     1 
ATOM   2311  N N     . ASP A 1 299 ? 2.404   29.770  -2.151  1.00 17.72  ? 299  ASP A N     1 
ATOM   2312  C CA    . ASP A 1 299 ? 1.176   30.075  -1.413  1.00 17.54  ? 299  ASP A CA    1 
ATOM   2313  C C     . ASP A 1 299 ? 1.422   31.266  -0.482  1.00 16.92  ? 299  ASP A C     1 
ATOM   2314  O O     . ASP A 1 299 ? 2.379   31.256  0.307   1.00 17.55  ? 299  ASP A O     1 
ATOM   2315  C CB    . ASP A 1 299 ? 0.715   28.848  -0.588  1.00 17.14  ? 299  ASP A CB    1 
ATOM   2316  C CG    . ASP A 1 299 ? 0.087   27.748  -1.448  1.00 17.78  ? 299  ASP A CG    1 
ATOM   2317  O OD1   . ASP A 1 299 ? -0.099  27.956  -2.669  1.00 18.90  ? 299  ASP A OD1   1 
ATOM   2318  O OD2   . ASP A 1 299 ? -0.239  26.673  -0.900  1.00 16.83  ? 299  ASP A OD2   1 
ATOM   2319  N N     . ILE A 1 300 ? 0.590   32.296  -0.604  1.00 15.66  ? 300  ILE A N     1 
ATOM   2320  C CA    . ILE A 1 300 ? 0.660   33.450  0.281   1.00 14.34  ? 300  ILE A CA    1 
ATOM   2321  C C     . ILE A 1 300 ? -0.194  33.119  1.493   1.00 13.53  ? 300  ILE A C     1 
ATOM   2322  O O     . ILE A 1 300 ? -1.386  32.798  1.361   1.00 12.54  ? 300  ILE A O     1 
ATOM   2323  C CB    . ILE A 1 300 ? 0.149   34.735  -0.394  1.00 14.59  ? 300  ILE A CB    1 
ATOM   2324  C CG1   . ILE A 1 300 ? 0.800   34.925  -1.780  1.00 16.46  ? 300  ILE A CG1   1 
ATOM   2325  C CG2   . ILE A 1 300 ? 0.305   35.981  0.544   1.00 14.74  ? 300  ILE A CG2   1 
ATOM   2326  C CD1   . ILE A 1 300 ? 2.337   35.045  -1.800  1.00 17.38  ? 300  ILE A CD1   1 
ATOM   2327  N N     . TYR A 1 301 ? 0.427   33.201  2.671   1.00 12.47  ? 301  TYR A N     1 
ATOM   2328  C CA    . TYR A 1 301 ? -0.181  32.731  3.901   1.00 11.91  ? 301  TYR A CA    1 
ATOM   2329  C C     . TYR A 1 301 ? -0.336  33.884  4.912   1.00 12.07  ? 301  TYR A C     1 
ATOM   2330  O O     . TYR A 1 301 ? 0.614   34.672  5.107   1.00 11.50  ? 301  TYR A O     1 
ATOM   2331  C CB    . TYR A 1 301 ? 0.658   31.586  4.487   1.00 11.77  ? 301  TYR A CB    1 
ATOM   2332  C CG    . TYR A 1 301 ? 0.346   31.250  5.939   1.00 12.18  ? 301  TYR A CG    1 
ATOM   2333  C CD1   . TYR A 1 301 ? 1.071   31.835  6.986   1.00 13.38  ? 301  TYR A CD1   1 
ATOM   2334  C CD2   . TYR A 1 301 ? -0.692  30.360  6.258   1.00 11.85  ? 301  TYR A CD2   1 
ATOM   2335  C CE1   . TYR A 1 301 ? 0.783   31.529  8.323   1.00 12.19  ? 301  TYR A CE1   1 
ATOM   2336  C CE2   . TYR A 1 301 ? -1.003  30.052  7.574   1.00 12.60  ? 301  TYR A CE2   1 
ATOM   2337  C CZ    . TYR A 1 301 ? -0.265  30.622  8.600   1.00 13.06  ? 301  TYR A CZ    1 
ATOM   2338  O OH    . TYR A 1 301 ? -0.576  30.285  9.887   1.00 12.10  ? 301  TYR A OH    1 
ATOM   2339  N N     . TRP A 1 302 ? -1.522  33.969  5.539   1.00 11.60  ? 302  TRP A N     1 
ATOM   2340  C CA    . TRP A 1 302 ? -1.819  35.020  6.519   1.00 11.75  ? 302  TRP A CA    1 
ATOM   2341  C C     . TRP A 1 302 ? -2.497  34.471  7.770   1.00 12.49  ? 302  TRP A C     1 
ATOM   2342  O O     . TRP A 1 302 ? -3.679  34.052  7.772   1.00 12.73  ? 302  TRP A O     1 
ATOM   2343  C CB    . TRP A 1 302 ? -2.610  36.184  5.884   1.00 11.53  ? 302  TRP A CB    1 
ATOM   2344  C CG    . TRP A 1 302 ? -2.976  37.355  6.818   1.00 10.92  ? 302  TRP A CG    1 
ATOM   2345  C CD1   . TRP A 1 302 ? -2.297  37.776  7.928   1.00 10.90  ? 302  TRP A CD1   1 
ATOM   2346  C CD2   . TRP A 1 302 ? -4.088  38.256  6.678   1.00 11.18  ? 302  TRP A CD2   1 
ATOM   2347  N NE1   . TRP A 1 302 ? -2.919  38.866  8.497   1.00 8.67   ? 302  TRP A NE1   1 
ATOM   2348  C CE2   . TRP A 1 302 ? -4.020  39.182  7.751   1.00 9.98   ? 302  TRP A CE2   1 
ATOM   2349  C CE3   . TRP A 1 302 ? -5.135  38.370  5.758   1.00 9.53   ? 302  TRP A CE3   1 
ATOM   2350  C CZ2   . TRP A 1 302 ? -4.966  40.200  7.927   1.00 11.82  ? 302  TRP A CZ2   1 
ATOM   2351  C CZ3   . TRP A 1 302 ? -6.098  39.391  5.951   1.00 10.24  ? 302  TRP A CZ3   1 
ATOM   2352  C CH2   . TRP A 1 302 ? -5.990  40.290  7.009   1.00 10.42  ? 302  TRP A CH2   1 
ATOM   2353  N N     . CYS A 1 303 ? -1.710  34.441  8.835   1.00 12.95  ? 303  CYS A N     1 
ATOM   2354  C CA    . CYS A 1 303 ? -2.220  34.221  10.174  1.00 13.02  ? 303  CYS A CA    1 
ATOM   2355  C C     . CYS A 1 303 ? -2.491  35.569  10.854  1.00 12.76  ? 303  CYS A C     1 
ATOM   2356  O O     . CYS A 1 303 ? -1.599  36.408  10.939  1.00 12.54  ? 303  CYS A O     1 
ATOM   2357  C CB    . CYS A 1 303 ? -1.191  33.419  10.968  1.00 13.40  ? 303  CYS A CB    1 
ATOM   2358  S SG    . CYS A 1 303 ? -1.524  33.403  12.720  1.00 14.27  ? 303  CYS A SG    1 
ATOM   2359  N N     . THR A 1 304 ? -3.707  35.780  11.365  1.00 12.87  ? 304  THR A N     1 
ATOM   2360  C CA    . THR A 1 304 ? -4.043  37.097  11.917  1.00 12.56  ? 304  THR A CA    1 
ATOM   2361  C C     . THR A 1 304 ? -3.574  37.328  13.358  1.00 13.18  ? 304  THR A C     1 
ATOM   2362  O O     . THR A 1 304 ? -3.676  38.442  13.872  1.00 12.74  ? 304  THR A O     1 
ATOM   2363  C CB    . THR A 1 304 ? -5.558  37.426  11.790  1.00 12.97  ? 304  THR A CB    1 
ATOM   2364  O OG1   . THR A 1 304 ? -6.312  36.490  12.568  1.00 11.62  ? 304  THR A OG1   1 
ATOM   2365  C CG2   . THR A 1 304 ? -5.997  37.383  10.310  1.00 11.75  ? 304  THR A CG2   1 
ATOM   2366  N N     . ALA A 1 305 ? -3.049  36.282  13.997  1.00 13.05  ? 305  ALA A N     1 
ATOM   2367  C CA    . ALA A 1 305 ? -2.743  36.334  15.423  1.00 13.02  ? 305  ALA A CA    1 
ATOM   2368  C C     . ALA A 1 305 ? -1.563  37.231  15.755  1.00 13.32  ? 305  ALA A C     1 
ATOM   2369  O O     . ALA A 1 305 ? -0.571  37.296  15.012  1.00 13.44  ? 305  ALA A O     1 
ATOM   2370  C CB    . ALA A 1 305 ? -2.512  34.929  15.979  1.00 12.22  ? 305  ALA A CB    1 
ATOM   2371  N N     . ASP A 1 306 ? -1.686  37.918  16.890  1.00 13.45  ? 306  ASP A N     1 
ATOM   2372  C CA    . ASP A 1 306 ? -0.614  38.755  17.420  1.00 13.70  ? 306  ASP A CA    1 
ATOM   2373  C C     . ASP A 1 306 ? 0.621   37.925  17.797  1.00 14.17  ? 306  ASP A C     1 
ATOM   2374  O O     . ASP A 1 306 ? 0.538   36.808  18.358  1.00 13.26  ? 306  ASP A O     1 
ATOM   2375  C CB    . ASP A 1 306 ? -1.093  39.550  18.628  1.00 13.36  ? 306  ASP A CB    1 
ATOM   2376  C CG    . ASP A 1 306 ? -0.141  40.679  18.994  1.00 14.43  ? 306  ASP A CG    1 
ATOM   2377  O OD1   . ASP A 1 306 ? 0.777   40.469  19.825  1.00 16.71  ? 306  ASP A OD1   1 
ATOM   2378  O OD2   . ASP A 1 306 ? -0.299  41.776  18.445  1.00 13.29  ? 306  ASP A OD2   1 
ATOM   2379  N N     . VAL A 1 307 ? 1.770   38.503  17.464  1.00 14.55  ? 307  VAL A N     1 
ATOM   2380  C CA    . VAL A 1 307 ? 3.082   37.994  17.851  1.00 13.98  ? 307  VAL A CA    1 
ATOM   2381  C C     . VAL A 1 307 ? 3.236   37.686  19.357  1.00 14.01  ? 307  VAL A C     1 
ATOM   2382  O O     . VAL A 1 307 ? 4.033   36.821  19.727  1.00 14.40  ? 307  VAL A O     1 
ATOM   2383  C CB    . VAL A 1 307 ? 4.176   38.980  17.356  1.00 14.75  ? 307  VAL A CB    1 
ATOM   2384  C CG1   . VAL A 1 307 ? 4.338   40.210  18.305  1.00 12.74  ? 307  VAL A CG1   1 
ATOM   2385  C CG2   . VAL A 1 307 ? 5.475   38.251  17.120  1.00 13.87  ? 307  VAL A CG2   1 
ATOM   2386  N N     . GLY A 1 308 ? 2.489   38.383  20.222  1.00 13.61  ? 308  GLY A N     1 
ATOM   2387  C CA    . GLY A 1 308 ? 2.592   38.162  21.677  1.00 13.41  ? 308  GLY A CA    1 
ATOM   2388  C C     . GLY A 1 308 ? 1.887   36.908  22.188  1.00 13.63  ? 308  GLY A C     1 
ATOM   2389  O O     . GLY A 1 308 ? 1.910   36.623  23.393  1.00 13.80  ? 308  GLY A O     1 
ATOM   2390  N N     . TRP A 1 309 ? 1.264   36.164  21.271  1.00 13.58  ? 309  TRP A N     1 
ATOM   2391  C CA    . TRP A 1 309 ? 0.584   34.907  21.578  1.00 13.93  ? 309  TRP A CA    1 
ATOM   2392  C C     . TRP A 1 309 ? 1.265   33.744  20.857  1.00 13.41  ? 309  TRP A C     1 
ATOM   2393  O O     . TRP A 1 309 ? 1.918   33.932  19.834  1.00 13.12  ? 309  TRP A O     1 
ATOM   2394  C CB    . TRP A 1 309 ? -0.903  34.968  21.198  1.00 13.67  ? 309  TRP A CB    1 
ATOM   2395  C CG    . TRP A 1 309 ? -1.667  36.164  21.810  1.00 15.49  ? 309  TRP A CG    1 
ATOM   2396  C CD1   . TRP A 1 309 ? -2.431  37.081  21.128  1.00 15.93  ? 309  TRP A CD1   1 
ATOM   2397  C CD2   . TRP A 1 309 ? -1.714  36.565  23.198  1.00 14.83  ? 309  TRP A CD2   1 
ATOM   2398  N NE1   . TRP A 1 309 ? -2.943  38.006  22.000  1.00 16.70  ? 309  TRP A NE1   1 
ATOM   2399  C CE2   . TRP A 1 309 ? -2.513  37.722  23.269  1.00 14.42  ? 309  TRP A CE2   1 
ATOM   2400  C CE3   . TRP A 1 309 ? -1.149  36.057  24.385  1.00 15.14  ? 309  TRP A CE3   1 
ATOM   2401  C CZ2   . TRP A 1 309 ? -2.791  38.373  24.483  1.00 15.92  ? 309  TRP A CZ2   1 
ATOM   2402  C CZ3   . TRP A 1 309 ? -1.405  36.710  25.586  1.00 14.87  ? 309  TRP A CZ3   1 
ATOM   2403  C CH2   . TRP A 1 309 ? -2.233  37.851  25.631  1.00 15.15  ? 309  TRP A CH2   1 
ATOM   2404  N N     . VAL A 1 310 ? 1.106   32.543  21.395  1.00 13.07  ? 310  VAL A N     1 
ATOM   2405  C CA    . VAL A 1 310 ? 1.751   31.351  20.831  1.00 13.17  ? 310  VAL A CA    1 
ATOM   2406  C C     . VAL A 1 310 ? 1.364   31.115  19.351  1.00 12.98  ? 310  VAL A C     1 
ATOM   2407  O O     . VAL A 1 310 ? 2.177   30.652  18.565  1.00 13.19  ? 310  VAL A O     1 
ATOM   2408  C CB    . VAL A 1 310 ? 1.506   30.086  21.747  1.00 12.96  ? 310  VAL A CB    1 
ATOM   2409  C CG1   . VAL A 1 310 ? 0.035   29.644  21.694  1.00 11.85  ? 310  VAL A CG1   1 
ATOM   2410  C CG2   . VAL A 1 310 ? 2.492   28.945  21.401  1.00 13.32  ? 310  VAL A CG2   1 
ATOM   2411  N N     . THR A 1 311 ? 0.138   31.462  18.964  1.00 12.83  ? 311  THR A N     1 
ATOM   2412  C CA    . THR A 1 311 ? -0.261  31.300  17.559  1.00 13.30  ? 311  THR A CA    1 
ATOM   2413  C C     . THR A 1 311 ? 0.624   32.181  16.655  1.00 12.76  ? 311  THR A C     1 
ATOM   2414  O O     . THR A 1 311 ? 0.982   31.782  15.537  1.00 12.56  ? 311  THR A O     1 
ATOM   2415  C CB    . THR A 1 311 ? -1.760  31.608  17.329  1.00 13.12  ? 311  THR A CB    1 
ATOM   2416  O OG1   . THR A 1 311 ? -2.552  30.864  18.254  1.00 14.64  ? 311  THR A OG1   1 
ATOM   2417  C CG2   . THR A 1 311 ? -2.180  31.212  15.941  1.00 14.28  ? 311  THR A CG2   1 
ATOM   2418  N N     . GLY A 1 312 ? 0.993   33.355  17.160  1.00 12.27  ? 312  GLY A N     1 
ATOM   2419  C CA    . GLY A 1 312 ? 1.899   34.249  16.449  1.00 12.92  ? 312  GLY A CA    1 
ATOM   2420  C C     . GLY A 1 312 ? 3.328   33.741  16.415  1.00 13.82  ? 312  GLY A C     1 
ATOM   2421  O O     . GLY A 1 312 ? 4.052   34.006  15.457  1.00 14.48  ? 312  GLY A O     1 
ATOM   2422  N N     . HIS A 1 313 ? 3.737   33.002  17.451  1.00 13.33  ? 313  HIS A N     1 
ATOM   2423  C CA    . HIS A 1 313 ? 5.058   32.372  17.475  1.00 12.65  ? 313  HIS A CA    1 
ATOM   2424  C C     . HIS A 1 313 ? 5.098   31.227  16.477  1.00 12.73  ? 313  HIS A C     1 
ATOM   2425  O O     . HIS A 1 313 ? 5.913   31.221  15.581  1.00 12.59  ? 313  HIS A O     1 
ATOM   2426  C CB    . HIS A 1 313 ? 5.387   31.834  18.876  1.00 11.75  ? 313  HIS A CB    1 
ATOM   2427  C CG    . HIS A 1 313 ? 5.571   32.905  19.901  1.00 11.01  ? 313  HIS A CG    1 
ATOM   2428  N ND1   . HIS A 1 313 ? 6.508   32.815  20.907  1.00 12.19  ? 313  HIS A ND1   1 
ATOM   2429  C CD2   . HIS A 1 313 ? 4.950   34.100  20.067  1.00 9.57   ? 313  HIS A CD2   1 
ATOM   2430  C CE1   . HIS A 1 313 ? 6.447   33.904  21.661  1.00 12.25  ? 313  HIS A CE1   1 
ATOM   2431  N NE2   . HIS A 1 313 ? 5.512   34.700  21.170  1.00 11.92  ? 313  HIS A NE2   1 
ATOM   2432  N N     . SER A 1 314 ? 4.218   30.250  16.660  1.00 13.29  ? 314  SER A N     1 
ATOM   2433  C CA    . SER A 1 314 ? 4.248   29.034  15.851  1.00 13.92  ? 314  SER A CA    1 
ATOM   2434  C C     . SER A 1 314 ? 3.778   29.229  14.416  1.00 13.45  ? 314  SER A C     1 
ATOM   2435  O O     . SER A 1 314 ? 4.356   28.626  13.506  1.00 12.97  ? 314  SER A O     1 
ATOM   2436  C CB    . SER A 1 314 ? 3.442   27.910  16.524  1.00 13.95  ? 314  SER A CB    1 
ATOM   2437  O OG    . SER A 1 314 ? 3.903   27.659  17.842  1.00 15.30  ? 314  SER A OG    1 
ATOM   2438  N N     . TYR A 1 315 ? 2.726   30.039  14.221  1.00 13.22  ? 315  TYR A N     1 
ATOM   2439  C CA    . TYR A 1 315 ? 2.019   30.068  12.933  1.00 13.71  ? 315  TYR A CA    1 
ATOM   2440  C C     . TYR A 1 315 ? 2.003   31.397  12.179  1.00 14.99  ? 315  TYR A C     1 
ATOM   2441  O O     . TYR A 1 315 ? 1.525   31.453  11.064  1.00 16.06  ? 315  TYR A O     1 
ATOM   2442  C CB    . TYR A 1 315 ? 0.631   29.388  13.025  1.00 12.75  ? 315  TYR A CB    1 
ATOM   2443  C CG    . TYR A 1 315 ? 0.782   27.950  13.495  1.00 11.73  ? 315  TYR A CG    1 
ATOM   2444  C CD1   . TYR A 1 315 ? 0.536   27.606  14.809  1.00 10.31  ? 315  TYR A CD1   1 
ATOM   2445  C CD2   . TYR A 1 315 ? 1.263   26.952  12.629  1.00 12.11  ? 315  TYR A CD2   1 
ATOM   2446  C CE1   . TYR A 1 315 ? 0.735   26.303  15.271  1.00 10.02  ? 315  TYR A CE1   1 
ATOM   2447  C CE2   . TYR A 1 315 ? 1.463   25.649  13.075  1.00 11.16  ? 315  TYR A CE2   1 
ATOM   2448  C CZ    . TYR A 1 315 ? 1.198   25.343  14.403  1.00 11.87  ? 315  TYR A CZ    1 
ATOM   2449  O OH    . TYR A 1 315 ? 1.374   24.071  14.857  1.00 11.89  ? 315  TYR A OH    1 
ATOM   2450  N N     . LEU A 1 316 ? 2.539   32.456  12.772  1.00 15.85  ? 316  LEU A N     1 
ATOM   2451  C CA    . LEU A 1 316 ? 2.878   33.637  12.005  1.00 16.77  ? 316  LEU A CA    1 
ATOM   2452  C C     . LEU A 1 316 ? 4.332   33.549  11.542  1.00 17.04  ? 316  LEU A C     1 
ATOM   2453  O O     . LEU A 1 316 ? 4.640   33.768  10.364  1.00 17.63  ? 316  LEU A O     1 
ATOM   2454  C CB    . LEU A 1 316 ? 2.642   34.895  12.827  1.00 16.92  ? 316  LEU A CB    1 
ATOM   2455  C CG    . LEU A 1 316 ? 3.277   36.228  12.415  1.00 18.93  ? 316  LEU A CG    1 
ATOM   2456  C CD1   . LEU A 1 316 ? 2.598   36.798  11.194  1.00 17.91  ? 316  LEU A CD1   1 
ATOM   2457  C CD2   . LEU A 1 316 ? 3.168   37.218  13.564  1.00 17.39  ? 316  LEU A CD2   1 
ATOM   2458  N N     . LEU A 1 317 ? 5.214   33.172  12.464  1.00 17.16  ? 317  LEU A N     1 
ATOM   2459  C CA    . LEU A 1 317 ? 6.647   33.217  12.226  1.00 16.42  ? 317  LEU A CA    1 
ATOM   2460  C C     . LEU A 1 317 ? 7.333   31.878  12.019  1.00 15.49  ? 317  LEU A C     1 
ATOM   2461  O O     . LEU A 1 317 ? 7.780   31.596  10.906  1.00 15.39  ? 317  LEU A O     1 
ATOM   2462  C CB    . LEU A 1 317 ? 7.342   33.995  13.346  1.00 16.82  ? 317  LEU A CB    1 
ATOM   2463  C CG    . LEU A 1 317 ? 7.059   35.487  13.251  1.00 19.95  ? 317  LEU A CG    1 
ATOM   2464  C CD1   . LEU A 1 317 ? 7.712   36.267  14.412  1.00 19.62  ? 317  LEU A CD1   1 
ATOM   2465  C CD2   . LEU A 1 317 ? 7.511   36.027  11.863  1.00 20.85  ? 317  LEU A CD2   1 
ATOM   2466  N N     . TYR A 1 318 ? 7.442   31.061  13.069  1.00 14.34  ? 318  TYR A N     1 
ATOM   2467  C CA    . TYR A 1 318 ? 8.363   29.917  13.018  1.00 13.83  ? 318  TYR A CA    1 
ATOM   2468  C C     . TYR A 1 318 ? 8.008   28.822  12.026  1.00 13.61  ? 318  TYR A C     1 
ATOM   2469  O O     . TYR A 1 318 ? 8.846   28.442  11.210  1.00 13.12  ? 318  TYR A O     1 
ATOM   2470  C CB    . TYR A 1 318 ? 8.665   29.358  14.426  1.00 13.76  ? 318  TYR A CB    1 
ATOM   2471  C CG    . TYR A 1 318 ? 9.397   30.364  15.283  1.00 13.20  ? 318  TYR A CG    1 
ATOM   2472  C CD1   . TYR A 1 318 ? 10.340  31.204  14.720  1.00 12.52  ? 318  TYR A CD1   1 
ATOM   2473  C CD2   . TYR A 1 318 ? 9.110   30.516  16.645  1.00 14.02  ? 318  TYR A CD2   1 
ATOM   2474  C CE1   . TYR A 1 318 ? 10.993  32.151  15.469  1.00 13.24  ? 318  TYR A CE1   1 
ATOM   2475  C CE2   . TYR A 1 318 ? 9.783   31.453  17.417  1.00 11.82  ? 318  TYR A CE2   1 
ATOM   2476  C CZ    . TYR A 1 318 ? 10.725  32.270  16.813  1.00 14.06  ? 318  TYR A CZ    1 
ATOM   2477  O OH    . TYR A 1 318 ? 11.419  33.218  17.530  1.00 14.82  ? 318  TYR A OH    1 
ATOM   2478  N N     . GLY A 1 319 ? 6.776   28.308  12.101  1.00 13.96  ? 319  GLY A N     1 
ATOM   2479  C CA    . GLY A 1 319 ? 6.289   27.277  11.153  1.00 13.53  ? 319  GLY A CA    1 
ATOM   2480  C C     . GLY A 1 319 ? 6.406   27.682  9.682   1.00 13.33  ? 319  GLY A C     1 
ATOM   2481  O O     . GLY A 1 319 ? 6.984   26.950  8.882   1.00 12.31  ? 319  GLY A O     1 
ATOM   2482  N N     . PRO A 1 320 ? 5.824   28.846  9.317   1.00 13.66  ? 320  PRO A N     1 
ATOM   2483  C CA    . PRO A 1 320 ? 5.876   29.360  7.945   1.00 13.73  ? 320  PRO A CA    1 
ATOM   2484  C C     . PRO A 1 320 ? 7.288   29.583  7.414   1.00 13.97  ? 320  PRO A C     1 
ATOM   2485  O O     . PRO A 1 320 ? 7.617   29.090  6.320   1.00 14.63  ? 320  PRO A O     1 
ATOM   2486  C CB    . PRO A 1 320 ? 5.060   30.671  8.026   1.00 13.71  ? 320  PRO A CB    1 
ATOM   2487  C CG    . PRO A 1 320 ? 4.093   30.411  9.147   1.00 13.58  ? 320  PRO A CG    1 
ATOM   2488  C CD    . PRO A 1 320 ? 4.980   29.707  10.170  1.00 13.53  ? 320  PRO A CD    1 
ATOM   2489  N N     . LEU A 1 321 ? 8.126   30.277  8.180   1.00 14.07  ? 321  LEU A N     1 
ATOM   2490  C CA    . LEU A 1 321 ? 9.475   30.579  7.704   1.00 14.12  ? 321  LEU A CA    1 
ATOM   2491  C C     . LEU A 1 321 ? 10.373  29.348  7.648   1.00 14.11  ? 321  LEU A C     1 
ATOM   2492  O O     . LEU A 1 321 ? 11.224  29.262  6.779   1.00 14.72  ? 321  LEU A O     1 
ATOM   2493  C CB    . LEU A 1 321 ? 10.130  31.704  8.509   1.00 13.95  ? 321  LEU A CB    1 
ATOM   2494  C CG    . LEU A 1 321 ? 9.508   33.105  8.506   1.00 13.77  ? 321  LEU A CG    1 
ATOM   2495  C CD1   . LEU A 1 321 ? 10.138  33.975  9.611   1.00 12.02  ? 321  LEU A CD1   1 
ATOM   2496  C CD2   . LEU A 1 321 ? 9.631   33.789  7.140   1.00 13.78  ? 321  LEU A CD2   1 
ATOM   2497  N N     . ALA A 1 322 ? 10.198  28.394  8.554   1.00 13.62  ? 322  ALA A N     1 
ATOM   2498  C CA    . ALA A 1 322 ? 10.958  27.160  8.447   1.00 13.39  ? 322  ALA A CA    1 
ATOM   2499  C C     . ALA A 1 322 ? 10.626  26.464  7.124   1.00 13.88  ? 322  ALA A C     1 
ATOM   2500  O O     . ALA A 1 322 ? 11.482  25.774  6.544   1.00 13.67  ? 322  ALA A O     1 
ATOM   2501  C CB    . ALA A 1 322 ? 10.692  26.220  9.625   1.00 13.46  ? 322  ALA A CB    1 
ATOM   2502  N N     . CYS A 1 323 ? 9.390   26.645  6.651   1.00 13.65  ? 323  CYS A N     1 
ATOM   2503  C CA    . CYS A 1 323 ? 8.958   26.027  5.392   1.00 13.65  ? 323  CYS A CA    1 
ATOM   2504  C C     . CYS A 1 323 ? 9.251   26.843  4.120   1.00 13.32  ? 323  CYS A C     1 
ATOM   2505  O O     . CYS A 1 323 ? 8.929   26.397  3.015   1.00 13.37  ? 323  CYS A O     1 
ATOM   2506  C CB    . CYS A 1 323 ? 7.477   25.663  5.458   1.00 13.46  ? 323  CYS A CB    1 
ATOM   2507  S SG    . CYS A 1 323 ? 7.162   24.328  6.608   1.00 15.14  ? 323  CYS A SG    1 
ATOM   2508  N N     . GLY A 1 324 ? 9.858   28.020  4.269   1.00 13.25  ? 324  GLY A N     1 
ATOM   2509  C CA    . GLY A 1 324 ? 10.203  28.871  3.111   1.00 12.94  ? 324  GLY A CA    1 
ATOM   2510  C C     . GLY A 1 324 ? 9.008   29.623  2.531   1.00 13.31  ? 324  GLY A C     1 
ATOM   2511  O O     . GLY A 1 324 ? 9.026   30.045  1.364   1.00 12.69  ? 324  GLY A O     1 
ATOM   2512  N N     . ALA A 1 325 ? 7.978   29.812  3.355   1.00 13.40  ? 325  ALA A N     1 
ATOM   2513  C CA    . ALA A 1 325 ? 6.716   30.435  2.915   1.00 13.06  ? 325  ALA A CA    1 
ATOM   2514  C C     . ALA A 1 325 ? 6.774   31.953  2.928   1.00 12.91  ? 325  ALA A C     1 
ATOM   2515  O O     . ALA A 1 325 ? 7.653   32.539  3.529   1.00 13.05  ? 325  ALA A O     1 
ATOM   2516  C CB    . ALA A 1 325 ? 5.553   29.956  3.799   1.00 12.78  ? 325  ALA A CB    1 
ATOM   2517  N N     . THR A 1 326 ? 5.817   32.586  2.258   1.00 13.08  ? 326  THR A N     1 
ATOM   2518  C CA    . THR A 1 326 ? 5.591   34.006  2.413   1.00 12.46  ? 326  THR A CA    1 
ATOM   2519  C C     . THR A 1 326 ? 4.512   34.122  3.450   1.00 12.42  ? 326  THR A C     1 
ATOM   2520  O O     . THR A 1 326 ? 3.408   33.604  3.270   1.00 12.74  ? 326  THR A O     1 
ATOM   2521  C CB    . THR A 1 326 ? 5.108   34.678  1.113   1.00 12.19  ? 326  THR A CB    1 
ATOM   2522  O OG1   . THR A 1 326 ? 6.092   34.512  0.101   1.00 12.63  ? 326  THR A OG1   1 
ATOM   2523  C CG2   . THR A 1 326 ? 4.903   36.146  1.334   1.00 12.67  ? 326  THR A CG2   1 
ATOM   2524  N N     . THR A 1 327 ? 4.836   34.790  4.550   1.00 12.18  ? 327  THR A N     1 
ATOM   2525  C CA    . THR A 1 327 ? 3.881   34.964  5.634   1.00 11.74  ? 327  THR A CA    1 
ATOM   2526  C C     . THR A 1 327 ? 3.522   36.443  5.731   1.00 11.57  ? 327  THR A C     1 
ATOM   2527  O O     . THR A 1 327 ? 4.363   37.305  5.476   1.00 12.05  ? 327  THR A O     1 
ATOM   2528  C CB    . THR A 1 327 ? 4.427   34.370  6.969   1.00 11.81  ? 327  THR A CB    1 
ATOM   2529  O OG1   . THR A 1 327 ? 3.376   34.284  7.932   1.00 11.12  ? 327  THR A OG1   1 
ATOM   2530  C CG2   . THR A 1 327 ? 5.582   35.198  7.540   1.00 10.72  ? 327  THR A CG2   1 
ATOM   2531  N N     . LEU A 1 328 ? 2.273   36.742  6.059   1.00 11.15  ? 328  LEU A N     1 
ATOM   2532  C CA    . LEU A 1 328 ? 1.835   38.131  6.106   1.00 10.96  ? 328  LEU A CA    1 
ATOM   2533  C C     . LEU A 1 328 ? 1.653   38.610  7.533   1.00 12.03  ? 328  LEU A C     1 
ATOM   2534  O O     . LEU A 1 328 ? 0.983   37.965  8.353   1.00 11.92  ? 328  LEU A O     1 
ATOM   2535  C CB    . LEU A 1 328 ? 0.554   38.325  5.304   1.00 10.43  ? 328  LEU A CB    1 
ATOM   2536  C CG    . LEU A 1 328 ? 0.059   39.719  4.922   1.00 9.89   ? 328  LEU A CG    1 
ATOM   2537  C CD1   . LEU A 1 328 ? -0.923  39.558  3.780   1.00 11.13  ? 328  LEU A CD1   1 
ATOM   2538  C CD2   . LEU A 1 328 ? -0.601  40.484  6.066   1.00 8.73   ? 328  LEU A CD2   1 
ATOM   2539  N N     . MET A 1 329 ? 2.259   39.757  7.821   1.00 13.07  ? 329  MET A N     1 
ATOM   2540  C CA    . MET A 1 329 ? 2.079   40.420  9.095   1.00 14.65  ? 329  MET A CA    1 
ATOM   2541  C C     . MET A 1 329 ? 1.309   41.738  8.919   1.00 13.90  ? 329  MET A C     1 
ATOM   2542  O O     . MET A 1 329 ? 1.758   42.656  8.239   1.00 14.36  ? 329  MET A O     1 
ATOM   2543  C CB    . MET A 1 329 ? 3.423   40.624  9.785   1.00 14.33  ? 329  MET A CB    1 
ATOM   2544  C CG    . MET A 1 329 ? 3.309   41.282  11.167  1.00 15.97  ? 329  MET A CG    1 
ATOM   2545  S SD    . MET A 1 329 ? 4.925   41.789  11.789  1.00 18.56  ? 329  MET A SD    1 
ATOM   2546  C CE    . MET A 1 329 ? 5.383   40.338  12.730  1.00 18.44  ? 329  MET A CE    1 
ATOM   2547  N N     . PHE A 1 330 ? 0.144   41.806  9.553   1.00 13.84  ? 330  PHE A N     1 
ATOM   2548  C CA    . PHE A 1 330 ? -0.767  42.928  9.451   1.00 13.62  ? 330  PHE A CA    1 
ATOM   2549  C C     . PHE A 1 330 ? -0.682  43.724  10.752  1.00 14.28  ? 330  PHE A C     1 
ATOM   2550  O O     . PHE A 1 330 ? -0.822  43.164  11.847  1.00 14.27  ? 330  PHE A O     1 
ATOM   2551  C CB    . PHE A 1 330 ? -2.185  42.380  9.217   1.00 13.82  ? 330  PHE A CB    1 
ATOM   2552  C CG    . PHE A 1 330 ? -3.274  43.431  9.196   1.00 13.99  ? 330  PHE A CG    1 
ATOM   2553  C CD1   . PHE A 1 330 ? -3.122  44.616  8.473   1.00 13.46  ? 330  PHE A CD1   1 
ATOM   2554  C CD2   . PHE A 1 330 ? -4.476  43.209  9.872   1.00 15.31  ? 330  PHE A CD2   1 
ATOM   2555  C CE1   . PHE A 1 330 ? -4.145  45.574  8.445   1.00 14.35  ? 330  PHE A CE1   1 
ATOM   2556  C CE2   . PHE A 1 330 ? -5.495  44.158  9.851   1.00 13.89  ? 330  PHE A CE2   1 
ATOM   2557  C CZ    . PHE A 1 330 ? -5.328  45.345  9.146   1.00 13.83  ? 330  PHE A CZ    1 
ATOM   2558  N N     . GLU A 1 331 ? -0.428  45.022  10.640  1.00 14.67  ? 331  GLU A N     1 
ATOM   2559  C CA    . GLU A 1 331 ? -0.258  45.879  11.812  1.00 15.40  ? 331  GLU A CA    1 
ATOM   2560  C C     . GLU A 1 331 ? -1.567  46.177  12.553  1.00 16.04  ? 331  GLU A C     1 
ATOM   2561  O O     . GLU A 1 331 ? -1.557  46.373  13.773  1.00 16.38  ? 331  GLU A O     1 
ATOM   2562  C CB    . GLU A 1 331 ? 0.412   47.192  11.396  1.00 15.54  ? 331  GLU A CB    1 
ATOM   2563  C CG    . GLU A 1 331 ? 0.737   48.178  12.536  1.00 15.74  ? 331  GLU A CG    1 
ATOM   2564  C CD    . GLU A 1 331 ? 1.329   49.496  12.023  1.00 15.56  ? 331  GLU A CD    1 
ATOM   2565  O OE1   . GLU A 1 331 ? 0.834   50.040  11.001  1.00 15.72  ? 331  GLU A OE1   1 
ATOM   2566  O OE2   . GLU A 1 331 ? 2.286   49.995  12.654  1.00 15.95  ? 331  GLU A OE2   1 
ATOM   2567  N N     . GLY A 1 332 ? -2.689  46.218  11.834  1.00 16.13  ? 332  GLY A N     1 
ATOM   2568  C CA    . GLY A 1 332 ? -3.937  46.728  12.414  1.00 16.52  ? 332  GLY A CA    1 
ATOM   2569  C C     . GLY A 1 332 ? -4.949  45.692  12.870  1.00 17.22  ? 332  GLY A C     1 
ATOM   2570  O O     . GLY A 1 332 ? -4.576  44.651  13.417  1.00 16.90  ? 332  GLY A O     1 
ATOM   2571  N N     . VAL A 1 333 ? -6.233  45.994  12.628  1.00 17.70  ? 333  VAL A N     1 
ATOM   2572  C CA    . VAL A 1 333 ? -7.360  45.119  12.974  1.00 17.99  ? 333  VAL A CA    1 
ATOM   2573  C C     . VAL A 1 333 ? -8.251  44.817  11.751  1.00 17.83  ? 333  VAL A C     1 
ATOM   2574  O O     . VAL A 1 333 ? -8.378  45.640  10.849  1.00 17.42  ? 333  VAL A O     1 
ATOM   2575  C CB    . VAL A 1 333 ? -8.219  45.694  14.152  1.00 18.40  ? 333  VAL A CB    1 
ATOM   2576  C CG1   . VAL A 1 333 ? -7.388  45.793  15.408  1.00 19.22  ? 333  VAL A CG1   1 
ATOM   2577  C CG2   . VAL A 1 333 ? -8.771  47.045  13.825  1.00 19.43  ? 333  VAL A CG2   1 
ATOM   2578  N N     . PRO A 1 334 ? -8.886  43.636  11.730  1.00 17.95  ? 334  PRO A N     1 
ATOM   2579  C CA    . PRO A 1 334 ? -9.561  43.145  10.513  1.00 18.11  ? 334  PRO A CA    1 
ATOM   2580  C C     . PRO A 1 334 ? -10.801 43.939  10.114  1.00 17.71  ? 334  PRO A C     1 
ATOM   2581  O O     . PRO A 1 334 ? -11.363 43.682  9.061   1.00 17.11  ? 334  PRO A O     1 
ATOM   2582  C CB    . PRO A 1 334 ? -9.974  41.717  10.882  1.00 18.73  ? 334  PRO A CB    1 
ATOM   2583  C CG    . PRO A 1 334 ? -9.275  41.403  12.190  1.00 19.27  ? 334  PRO A CG    1 
ATOM   2584  C CD    . PRO A 1 334 ? -9.038  42.707  12.861  1.00 18.05  ? 334  PRO A CD    1 
ATOM   2585  N N     . ASN A 1 335 ? -11.221 44.887  10.951  1.00 17.48  ? 335  ASN A N     1 
ATOM   2586  C CA    . ASN A 1 335 ? -12.406 45.707  10.673  1.00 17.71  ? 335  ASN A CA    1 
ATOM   2587  C C     . ASN A 1 335 ? -12.163 47.206  10.761  1.00 17.18  ? 335  ASN A C     1 
ATOM   2588  O O     . ASN A 1 335 ? -13.084 47.955  11.030  1.00 17.75  ? 335  ASN A O     1 
ATOM   2589  C CB    . ASN A 1 335 ? -13.588 45.320  11.592  1.00 17.91  ? 335  ASN A CB    1 
ATOM   2590  C CG    . ASN A 1 335 ? -13.254 45.437  13.096  1.00 19.71  ? 335  ASN A CG    1 
ATOM   2591  O OD1   . ASN A 1 335 ? -14.062 45.049  13.949  1.00 22.47  ? 335  ASN A OD1   1 
ATOM   2592  N ND2   . ASN A 1 335 ? -12.078 45.948  13.419  1.00 18.18  ? 335  ASN A ND2   1 
ATOM   2593  N N     . TRP A 1 336 ? -10.929 47.648  10.556  1.00 16.92  ? 336  TRP A N     1 
ATOM   2594  C CA    . TRP A 1 336 ? -10.658 49.082  10.504  1.00 16.58  ? 336  TRP A CA    1 
ATOM   2595  C C     . TRP A 1 336 ? -9.819  49.421  9.271   1.00 15.85  ? 336  TRP A C     1 
ATOM   2596  O O     . TRP A 1 336 ? -8.806  48.777  9.032   1.00 15.81  ? 336  TRP A O     1 
ATOM   2597  C CB    . TRP A 1 336 ? -9.998  49.569  11.806  1.00 16.86  ? 336  TRP A CB    1 
ATOM   2598  C CG    . TRP A 1 336 ? -9.973  51.067  11.909  1.00 17.43  ? 336  TRP A CG    1 
ATOM   2599  C CD1   . TRP A 1 336 ? -10.877 51.866  12.555  1.00 16.95  ? 336  TRP A CD1   1 
ATOM   2600  C CD2   . TRP A 1 336 ? -9.013  51.947  11.307  1.00 17.67  ? 336  TRP A CD2   1 
ATOM   2601  N NE1   . TRP A 1 336 ? -10.529 53.187  12.399  1.00 18.07  ? 336  TRP A NE1   1 
ATOM   2602  C CE2   . TRP A 1 336 ? -9.392  53.261  11.634  1.00 17.69  ? 336  TRP A CE2   1 
ATOM   2603  C CE3   . TRP A 1 336 ? -7.875  51.747  10.523  1.00 17.52  ? 336  TRP A CE3   1 
ATOM   2604  C CZ2   . TRP A 1 336 ? -8.672  54.364  11.206  1.00 18.02  ? 336  TRP A CZ2   1 
ATOM   2605  C CZ3   . TRP A 1 336 ? -7.157  52.844  10.104  1.00 17.94  ? 336  TRP A CZ3   1 
ATOM   2606  C CH2   . TRP A 1 336 ? -7.553  54.135  10.442  1.00 17.10  ? 336  TRP A CH2   1 
ATOM   2607  N N     . PRO A 1 337 ? -10.227 50.442  8.487   1.00 15.48  ? 337  PRO A N     1 
ATOM   2608  C CA    . PRO A 1 337 ? -11.338 51.388  8.710   1.00 15.37  ? 337  PRO A CA    1 
ATOM   2609  C C     . PRO A 1 337 ? -12.751 50.785  8.647   1.00 15.17  ? 337  PRO A C     1 
ATOM   2610  O O     . PRO A 1 337 ? -13.634 51.243  9.368   1.00 14.90  ? 337  PRO A O     1 
ATOM   2611  C CB    . PRO A 1 337 ? -11.150 52.447  7.603   1.00 15.23  ? 337  PRO A CB    1 
ATOM   2612  C CG    . PRO A 1 337 ? -9.857  52.157  6.944   1.00 15.02  ? 337  PRO A CG    1 
ATOM   2613  C CD    . PRO A 1 337 ? -9.509  50.726  7.235   1.00 14.99  ? 337  PRO A CD    1 
ATOM   2614  N N     . THR A 1 338 ? -12.954 49.773  7.798   1.00 14.96  ? 338  THR A N     1 
ATOM   2615  C CA    . THR A 1 338 ? -14.286 49.199  7.564   1.00 13.88  ? 338  THR A CA    1 
ATOM   2616  C C     . THR A 1 338 ? -14.253 47.690  7.792   1.00 13.30  ? 338  THR A C     1 
ATOM   2617  O O     . THR A 1 338 ? -13.173 47.091  7.776   1.00 13.42  ? 338  THR A O     1 
ATOM   2618  C CB    . THR A 1 338 ? -14.798 49.450  6.108   1.00 14.09  ? 338  THR A CB    1 
ATOM   2619  O OG1   . THR A 1 338 ? -14.102 48.577  5.201   1.00 15.11  ? 338  THR A OG1   1 
ATOM   2620  C CG2   . THR A 1 338 ? -14.639 50.918  5.672   1.00 12.93  ? 338  THR A CG2   1 
ATOM   2621  N N     . PRO A 1 339 ? -15.440 47.061  7.989   1.00 12.68  ? 339  PRO A N     1 
ATOM   2622  C CA    . PRO A 1 339 ? -15.504 45.593  8.175   1.00 11.73  ? 339  PRO A CA    1 
ATOM   2623  C C     . PRO A 1 339 ? -14.889 44.813  7.017   1.00 11.03  ? 339  PRO A C     1 
ATOM   2624  O O     . PRO A 1 339 ? -14.518 43.658  7.189   1.00 11.12  ? 339  PRO A O     1 
ATOM   2625  C CB    . PRO A 1 339 ? -17.004 45.310  8.288   1.00 11.68  ? 339  PRO A CB    1 
ATOM   2626  C CG    . PRO A 1 339 ? -17.593 46.657  8.774   1.00 12.89  ? 339  PRO A CG    1 
ATOM   2627  C CD    . PRO A 1 339 ? -16.774 47.699  8.091   1.00 12.12  ? 339  PRO A CD    1 
ATOM   2628  N N     . ALA A 1 340 ? -14.756 45.447  5.856   1.00 10.37  ? 340  ALA A N     1 
ATOM   2629  C CA    . ALA A 1 340 ? -14.202 44.789  4.674   1.00 10.15  ? 340  ALA A CA    1 
ATOM   2630  C C     . ALA A 1 340 ? -12.667 44.660  4.716   1.00 10.25  ? 340  ALA A C     1 
ATOM   2631  O O     . ALA A 1 340 ? -12.074 44.027  3.838   1.00 10.09  ? 340  ALA A O     1 
ATOM   2632  C CB    . ALA A 1 340 ? -14.665 45.522  3.393   1.00 9.94   ? 340  ALA A CB    1 
ATOM   2633  N N     . ARG A 1 341 ? -12.028 45.233  5.737   1.00 10.06  ? 341  ARG A N     1 
ATOM   2634  C CA    . ARG A 1 341 ? -10.573 45.361  5.737   1.00 10.66  ? 341  ARG A CA    1 
ATOM   2635  C C     . ARG A 1 341 ? -9.889  44.000  5.570   1.00 11.01  ? 341  ARG A C     1 
ATOM   2636  O O     . ARG A 1 341 ? -8.991  43.839  4.742   1.00 11.59  ? 341  ARG A O     1 
ATOM   2637  C CB    . ARG A 1 341 ? -10.053 46.068  6.994   1.00 10.56  ? 341  ARG A CB    1 
ATOM   2638  C CG    . ARG A 1 341 ? -8.527  46.275  6.974   1.00 10.81  ? 341  ARG A CG    1 
ATOM   2639  C CD    . ARG A 1 341 ? -8.144  47.293  5.902   1.00 10.09  ? 341  ARG A CD    1 
ATOM   2640  N NE    . ARG A 1 341 ? -6.697  47.408  5.661   1.00 9.33   ? 341  ARG A NE    1 
ATOM   2641  C CZ    . ARG A 1 341 ? -5.879  48.138  6.414   1.00 7.11   ? 341  ARG A CZ    1 
ATOM   2642  N NH1   . ARG A 1 341 ? -6.346  48.788  7.466   1.00 4.97   ? 341  ARG A NH1   1 
ATOM   2643  N NH2   . ARG A 1 341 ? -4.590  48.204  6.123   1.00 8.41   ? 341  ARG A NH2   1 
ATOM   2644  N N     . MET A 1 342 ? -10.325 43.021  6.345   1.00 11.18  ? 342  MET A N     1 
ATOM   2645  C CA    . MET A 1 342 ? -9.720  41.720  6.269   1.00 11.83  ? 342  MET A CA    1 
ATOM   2646  C C     . MET A 1 342 ? -9.703  41.212  4.833   1.00 11.80  ? 342  MET A C     1 
ATOM   2647  O O     . MET A 1 342 ? -8.640  40.821  4.342   1.00 12.00  ? 342  MET A O     1 
ATOM   2648  C CB    . MET A 1 342 ? -10.379 40.722  7.207   1.00 11.79  ? 342  MET A CB    1 
ATOM   2649  C CG    . MET A 1 342 ? -9.573  39.412  7.309   1.00 10.90  ? 342  MET A CG    1 
ATOM   2650  S SD    . MET A 1 342 ? -10.477 38.137  8.200   1.00 13.34  ? 342  MET A SD    1 
ATOM   2651  C CE    . MET A 1 342 ? -11.686 37.631  6.985   1.00 11.78  ? 342  MET A CE    1 
ATOM   2652  N N     . CYS A 1 343 ? -10.848 41.268  4.149   1.00 11.51  ? 343  CYS A N     1 
ATOM   2653  C CA    . CYS A 1 343 ? -10.930 40.751  2.775   1.00 11.44  ? 343  CYS A CA    1 
ATOM   2654  C C     . CYS A 1 343 ? -10.235 41.650  1.734   1.00 10.93  ? 343  CYS A C     1 
ATOM   2655  O O     . CYS A 1 343 ? -9.818  41.177  0.672   1.00 11.07  ? 343  CYS A O     1 
ATOM   2656  C CB    . CYS A 1 343 ? -12.378 40.424  2.390   1.00 11.89  ? 343  CYS A CB    1 
ATOM   2657  S SG    . CYS A 1 343 ? -13.064 39.005  3.316   1.00 12.62  ? 343  CYS A SG    1 
ATOM   2658  N N     . GLN A 1 344 ? -10.097 42.935  2.059   1.00 10.82  ? 344  GLN A N     1 
ATOM   2659  C CA    . GLN A 1 344 ? -9.259  43.879  1.289   1.00 10.52  ? 344  GLN A CA    1 
ATOM   2660  C C     . GLN A 1 344 ? -7.787  43.493  1.345   1.00 10.17  ? 344  GLN A C     1 
ATOM   2661  O O     . GLN A 1 344 ? -7.094  43.584  0.337   1.00 10.92  ? 344  GLN A O     1 
ATOM   2662  C CB    . GLN A 1 344 ? -9.446  45.325  1.774   1.00 10.60  ? 344  GLN A CB    1 
ATOM   2663  C CG    . GLN A 1 344 ? -10.768 45.968  1.314   1.00 10.86  ? 344  GLN A CG    1 
ATOM   2664  C CD    . GLN A 1 344 ? -11.160 47.225  2.107   1.00 10.82  ? 344  GLN A CD    1 
ATOM   2665  O OE1   . GLN A 1 344 ? -12.231 47.804  1.882   1.00 13.09  ? 344  GLN A OE1   1 
ATOM   2666  N NE2   . GLN A 1 344 ? -10.312 47.638  3.038   1.00 11.20  ? 344  GLN A NE2   1 
ATOM   2667  N N     . VAL A 1 345 ? -7.318  43.048  2.516   1.00 9.76   ? 345  VAL A N     1 
ATOM   2668  C CA    . VAL A 1 345 ? -5.938  42.596  2.682   1.00 8.61   ? 345  VAL A CA    1 
ATOM   2669  C C     . VAL A 1 345 ? -5.734  41.330  1.862   1.00 8.76   ? 345  VAL A C     1 
ATOM   2670  O O     . VAL A 1 345 ? -4.752  41.213  1.134   1.00 8.76   ? 345  VAL A O     1 
ATOM   2671  C CB    . VAL A 1 345 ? -5.544  42.345  4.192   1.00 9.11   ? 345  VAL A CB    1 
ATOM   2672  C CG1   . VAL A 1 345 ? -4.098  41.859  4.308   1.00 6.79   ? 345  VAL A CG1   1 
ATOM   2673  C CG2   . VAL A 1 345 ? -5.732  43.596  5.050   1.00 8.13   ? 345  VAL A CG2   1 
ATOM   2674  N N     . VAL A 1 346 ? -6.682  40.391  1.971   1.00 8.71   ? 346  VAL A N     1 
ATOM   2675  C CA    . VAL A 1 346 ? -6.679  39.150  1.172   1.00 7.80   ? 346  VAL A CA    1 
ATOM   2676  C C     . VAL A 1 346 ? -6.546  39.445  -0.322  1.00 9.12   ? 346  VAL A C     1 
ATOM   2677  O O     . VAL A 1 346 ? -5.665  38.894  -0.992  1.00 9.96   ? 346  VAL A O     1 
ATOM   2678  C CB    . VAL A 1 346 ? -7.937  38.303  1.455   1.00 7.53   ? 346  VAL A CB    1 
ATOM   2679  C CG1   . VAL A 1 346 ? -8.178  37.244  0.361   1.00 6.55   ? 346  VAL A CG1   1 
ATOM   2680  C CG2   . VAL A 1 346 ? -7.870  37.656  2.881   1.00 5.26   ? 346  VAL A CG2   1 
ATOM   2681  N N     . ASP A 1 347 ? -7.429  40.299  -0.844  1.00 9.56   ? 347  ASP A N     1 
ATOM   2682  C CA    . ASP A 1 347 ? -7.364  40.726  -2.252  1.00 9.69   ? 347  ASP A CA    1 
ATOM   2683  C C     . ASP A 1 347 ? -6.028  41.400  -2.560  1.00 9.70   ? 347  ASP A C     1 
ATOM   2684  O O     . ASP A 1 347 ? -5.342  40.999  -3.490  1.00 9.04   ? 347  ASP A O     1 
ATOM   2685  C CB    . ASP A 1 347 ? -8.516  41.675  -2.591  1.00 9.23   ? 347  ASP A CB    1 
ATOM   2686  C CG    . ASP A 1 347 ? -9.852  40.960  -2.762  1.00 11.54  ? 347  ASP A CG    1 
ATOM   2687  O OD1   . ASP A 1 347 ? -9.892  39.714  -2.697  1.00 11.19  ? 347  ASP A OD1   1 
ATOM   2688  O OD2   . ASP A 1 347 ? -10.873 41.659  -3.005  1.00 14.82  ? 347  ASP A OD2   1 
ATOM   2689  N N     . LYS A 1 348 ? -5.646  42.391  -1.749  1.00 10.12  ? 348  LYS A N     1 
ATOM   2690  C CA    . LYS A 1 348 ? -4.442  43.171  -2.026  1.00 10.64  ? 348  LYS A CA    1 
ATOM   2691  C C     . LYS A 1 348 ? -3.193  42.305  -2.155  1.00 11.41  ? 348  LYS A C     1 
ATOM   2692  O O     . LYS A 1 348 ? -2.400  42.531  -3.063  1.00 12.32  ? 348  LYS A O     1 
ATOM   2693  C CB    . LYS A 1 348 ? -4.228  44.263  -0.984  1.00 10.80  ? 348  LYS A CB    1 
ATOM   2694  C CG    . LYS A 1 348 ? -3.112  45.270  -1.327  1.00 10.79  ? 348  LYS A CG    1 
ATOM   2695  C CD    . LYS A 1 348 ? -2.878  46.218  -0.151  1.00 10.18  ? 348  LYS A CD    1 
ATOM   2696  C CE    . LYS A 1 348 ? -1.573  47.029  -0.284  1.00 9.98   ? 348  LYS A CE    1 
ATOM   2697  N NZ    . LYS A 1 348 ? -1.401  47.879  0.959   1.00 9.66   ? 348  LYS A NZ    1 
ATOM   2698  N N     . HIS A 1 349 ? -3.015  41.320  -1.273  1.00 11.39  ? 349  HIS A N     1 
ATOM   2699  C CA    . HIS A 1 349 ? -1.803  40.484  -1.302  1.00 11.80  ? 349  HIS A CA    1 
ATOM   2700  C C     . HIS A 1 349 ? -2.062  39.078  -1.836  1.00 11.82  ? 349  HIS A C     1 
ATOM   2701  O O     . HIS A 1 349 ? -1.212  38.189  -1.708  1.00 12.44  ? 349  HIS A O     1 
ATOM   2702  C CB    . HIS A 1 349 ? -1.134  40.460  0.079   1.00 11.50  ? 349  HIS A CB    1 
ATOM   2703  C CG    . HIS A 1 349 ? -0.803  41.834  0.594   1.00 14.02  ? 349  HIS A CG    1 
ATOM   2704  N ND1   . HIS A 1 349 ? 0.133   42.655  -0.009  1.00 13.75  ? 349  HIS A ND1   1 
ATOM   2705  C CD2   . HIS A 1 349 ? -1.321  42.550  1.620   1.00 14.13  ? 349  HIS A CD2   1 
ATOM   2706  C CE1   . HIS A 1 349 ? 0.191   43.802  0.644   1.00 14.10  ? 349  HIS A CE1   1 
ATOM   2707  N NE2   . HIS A 1 349 ? -0.679  43.764  1.636   1.00 12.17  ? 349  HIS A NE2   1 
ATOM   2708  N N     . GLN A 1 350 ? -3.243  38.886  -2.433  1.00 11.57  ? 350  GLN A N     1 
ATOM   2709  C CA    . GLN A 1 350 ? -3.616  37.614  -3.063  1.00 11.31  ? 350  GLN A CA    1 
ATOM   2710  C C     . GLN A 1 350 ? -3.332  36.448  -2.098  1.00 10.85  ? 350  GLN A C     1 
ATOM   2711  O O     . GLN A 1 350 ? -2.650  35.477  -2.433  1.00 10.47  ? 350  GLN A O     1 
ATOM   2712  C CB    . GLN A 1 350 ? -2.893  37.449  -4.410  1.00 11.57  ? 350  GLN A CB    1 
ATOM   2713  C CG    . GLN A 1 350 ? -3.309  38.492  -5.460  1.00 11.89  ? 350  GLN A CG    1 
ATOM   2714  C CD    . GLN A 1 350 ? -4.736  38.247  -5.956  1.00 14.84  ? 350  GLN A CD    1 
ATOM   2715  O OE1   . GLN A 1 350 ? -5.678  38.989  -5.614  1.00 13.63  ? 350  GLN A OE1   1 
ATOM   2716  N NE2   . GLN A 1 350 ? -4.909  37.183  -6.735  1.00 12.21  ? 350  GLN A NE2   1 
ATOM   2717  N N     . VAL A 1 351 ? -3.834  36.596  -0.875  1.00 10.29  ? 351  VAL A N     1 
ATOM   2718  C CA    . VAL A 1 351 ? -3.699  35.570  0.171   1.00 9.12   ? 351  VAL A CA    1 
ATOM   2719  C C     . VAL A 1 351 ? -4.411  34.286  -0.252  1.00 8.98   ? 351  VAL A C     1 
ATOM   2720  O O     . VAL A 1 351 ? -5.580  34.327  -0.640  1.00 8.40   ? 351  VAL A O     1 
ATOM   2721  C CB    . VAL A 1 351 ? -4.278  36.084  1.493   1.00 8.92   ? 351  VAL A CB    1 
ATOM   2722  C CG1   . VAL A 1 351 ? -4.461  34.929  2.540   1.00 9.39   ? 351  VAL A CG1   1 
ATOM   2723  C CG2   . VAL A 1 351 ? -3.431  37.258  2.034   1.00 7.55   ? 351  VAL A CG2   1 
ATOM   2724  N N     . ASN A 1 352 ? -3.702  33.159  -0.173  1.00 9.37   ? 352  ASN A N     1 
ATOM   2725  C CA    . ASN A 1 352 ? -4.266  31.844  -0.529  1.00 9.82   ? 352  ASN A CA    1 
ATOM   2726  C C     . ASN A 1 352 ? -4.713  31.038  0.684   1.00 9.59   ? 352  ASN A C     1 
ATOM   2727  O O     . ASN A 1 352 ? -5.542  30.126  0.568   1.00 8.95   ? 352  ASN A O     1 
ATOM   2728  C CB    . ASN A 1 352 ? -3.263  31.013  -1.337  1.00 9.77   ? 352  ASN A CB    1 
ATOM   2729  C CG    . ASN A 1 352 ? -2.735  31.747  -2.555  1.00 10.92  ? 352  ASN A CG    1 
ATOM   2730  O OD1   . ASN A 1 352 ? -1.531  31.930  -2.696  1.00 10.85  ? 352  ASN A OD1   1 
ATOM   2731  N ND2   . ASN A 1 352 ? -3.633  32.184  -3.432  1.00 12.26  ? 352  ASN A ND2   1 
ATOM   2732  N N     . ILE A 1 353 ? -4.115  31.352  1.828   1.00 9.85   ? 353  ILE A N     1 
ATOM   2733  C CA    . ILE A 1 353 ? -4.414  30.689  3.100   1.00 9.91   ? 353  ILE A CA    1 
ATOM   2734  C C     . ILE A 1 353 ? -4.662  31.736  4.175   1.00 10.00  ? 353  ILE A C     1 
ATOM   2735  O O     . ILE A 1 353 ? -3.796  32.585  4.420   1.00 10.30  ? 353  ILE A O     1 
ATOM   2736  C CB    . ILE A 1 353 ? -3.253  29.796  3.570   1.00 9.94   ? 353  ILE A CB    1 
ATOM   2737  C CG1   . ILE A 1 353 ? -2.825  28.830  2.457   1.00 10.42  ? 353  ILE A CG1   1 
ATOM   2738  C CG2   . ILE A 1 353 ? -3.665  29.029  4.828   1.00 7.63   ? 353  ILE A CG2   1 
ATOM   2739  C CD1   . ILE A 1 353 ? -1.333  28.413  2.555   1.00 11.65  ? 353  ILE A CD1   1 
ATOM   2740  N N     . LEU A 1 354 ? -5.840  31.683  4.797   1.00 9.66   ? 354  LEU A N     1 
ATOM   2741  C CA    . LEU A 1 354 ? -6.183  32.607  5.884   1.00 9.29   ? 354  LEU A CA    1 
ATOM   2742  C C     . LEU A 1 354 ? -6.475  31.853  7.188   1.00 9.60   ? 354  LEU A C     1 
ATOM   2743  O O     . LEU A 1 354 ? -7.280  30.913  7.209   1.00 9.46   ? 354  LEU A O     1 
ATOM   2744  C CB    . LEU A 1 354 ? -7.399  33.445  5.504   1.00 9.07   ? 354  LEU A CB    1 
ATOM   2745  C CG    . LEU A 1 354 ? -8.039  34.352  6.563   1.00 8.18   ? 354  LEU A CG    1 
ATOM   2746  C CD1   . LEU A 1 354 ? -7.070  35.466  7.050   1.00 6.78   ? 354  LEU A CD1   1 
ATOM   2747  C CD2   . LEU A 1 354 ? -9.335  34.946  5.983   1.00 8.89   ? 354  LEU A CD2   1 
ATOM   2748  N N     . TYR A 1 355 ? -5.848  32.306  8.270   1.00 9.65   ? 355  TYR A N     1 
ATOM   2749  C CA    . TYR A 1 355 ? -5.933  31.638  9.557   1.00 9.45   ? 355  TYR A CA    1 
ATOM   2750  C C     . TYR A 1 355 ? -6.282  32.695  10.600  1.00 9.98   ? 355  TYR A C     1 
ATOM   2751  O O     . TYR A 1 355 ? -5.461  33.542  10.929  1.00 9.75   ? 355  TYR A O     1 
ATOM   2752  C CB    . TYR A 1 355 ? -4.595  30.987  9.861   1.00 8.91   ? 355  TYR A CB    1 
ATOM   2753  C CG    . TYR A 1 355 ? -4.505  30.140  11.119  1.00 8.87   ? 355  TYR A CG    1 
ATOM   2754  C CD1   . TYR A 1 355 ? -5.508  29.214  11.460  1.00 7.08   ? 355  TYR A CD1   1 
ATOM   2755  C CD2   . TYR A 1 355 ? -3.361  30.219  11.952  1.00 10.72  ? 355  TYR A CD2   1 
ATOM   2756  C CE1   . TYR A 1 355 ? -5.373  28.383  12.627  1.00 8.49   ? 355  TYR A CE1   1 
ATOM   2757  C CE2   . TYR A 1 355 ? -3.217  29.387  13.116  1.00 8.56   ? 355  TYR A CE2   1 
ATOM   2758  C CZ    . TYR A 1 355 ? -4.226  28.490  13.442  1.00 9.55   ? 355  TYR A CZ    1 
ATOM   2759  O OH    . TYR A 1 355 ? -4.086  27.704  14.595  1.00 11.21  ? 355  TYR A OH    1 
ATOM   2760  N N     . THR A 1 356 ? -7.504  32.645  11.109  1.00 10.58  ? 356  THR A N     1 
ATOM   2761  C CA    . THR A 1 356 ? -7.951  33.683  12.037  1.00 12.30  ? 356  THR A CA    1 
ATOM   2762  C C     . THR A 1 356 ? -8.688  33.097  13.257  1.00 12.58  ? 356  THR A C     1 
ATOM   2763  O O     . THR A 1 356 ? -8.583  31.893  13.509  1.00 13.36  ? 356  THR A O     1 
ATOM   2764  C CB    . THR A 1 356 ? -8.735  34.845  11.315  1.00 11.82  ? 356  THR A CB    1 
ATOM   2765  O OG1   . THR A 1 356 ? -8.867  35.961  12.214  1.00 13.80  ? 356  THR A OG1   1 
ATOM   2766  C CG2   . THR A 1 356 ? -10.112 34.388  10.856  1.00 12.20  ? 356  THR A CG2   1 
ATOM   2767  N N     . ALA A 1 357 ? -9.397  33.952  13.991  1.00 12.88  ? 357  ALA A N     1 
ATOM   2768  C CA    . ALA A 1 357 ? -9.991  33.635  15.299  1.00 12.86  ? 357  ALA A CA    1 
ATOM   2769  C C     . ALA A 1 357 ? -11.500 33.815  15.253  1.00 12.76  ? 357  ALA A C     1 
ATOM   2770  O O     . ALA A 1 357 ? -11.972 34.767  14.646  1.00 12.71  ? 357  ALA A O     1 
ATOM   2771  C CB    . ALA A 1 357 ? -9.390  34.584  16.391  1.00 12.38  ? 357  ALA A CB    1 
ATOM   2772  N N     . PRO A 1 358 ? -12.263 32.916  15.900  1.00 13.14  ? 358  PRO A N     1 
ATOM   2773  C CA    . PRO A 1 358 ? -13.725 33.055  15.940  1.00 13.69  ? 358  PRO A CA    1 
ATOM   2774  C C     . PRO A 1 358 ? -14.259 34.399  16.462  1.00 13.71  ? 358  PRO A C     1 
ATOM   2775  O O     . PRO A 1 358 ? -15.308 34.820  16.011  1.00 14.77  ? 358  PRO A O     1 
ATOM   2776  C CB    . PRO A 1 358 ? -14.173 31.879  16.852  1.00 13.73  ? 358  PRO A CB    1 
ATOM   2777  C CG    . PRO A 1 358 ? -13.089 30.862  16.704  1.00 13.06  ? 358  PRO A CG    1 
ATOM   2778  C CD    . PRO A 1 358 ? -11.818 31.689  16.589  1.00 13.11  ? 358  PRO A CD    1 
ATOM   2779  N N     . THR A 1 359 ? -13.564 35.058  17.391  1.00 14.40  ? 359  THR A N     1 
ATOM   2780  C CA    . THR A 1 359 ? -13.970 36.400  17.838  1.00 15.02  ? 359  THR A CA    1 
ATOM   2781  C C     . THR A 1 359 ? -14.000 37.365  16.644  1.00 14.73  ? 359  THR A C     1 
ATOM   2782  O O     . THR A 1 359 ? -14.990 38.080  16.439  1.00 14.95  ? 359  THR A O     1 
ATOM   2783  C CB    . THR A 1 359 ? -13.081 36.943  19.012  1.00 15.30  ? 359  THR A CB    1 
ATOM   2784  O OG1   . THR A 1 359 ? -13.312 36.144  20.175  1.00 16.79  ? 359  THR A OG1   1 
ATOM   2785  C CG2   . THR A 1 359 ? -13.449 38.390  19.374  1.00 16.30  ? 359  THR A CG2   1 
ATOM   2786  N N     . ALA A 1 360 ? -12.936 37.359  15.843  1.00 13.85  ? 360  ALA A N     1 
ATOM   2787  C CA    . ALA A 1 360 ? -12.938 38.114  14.588  1.00 13.36  ? 360  ALA A CA    1 
ATOM   2788  C C     . ALA A 1 360 ? -14.087 37.698  13.655  1.00 13.19  ? 360  ALA A C     1 
ATOM   2789  O O     . ALA A 1 360 ? -14.861 38.541  13.216  1.00 12.55  ? 360  ALA A O     1 
ATOM   2790  C CB    . ALA A 1 360 ? -11.594 37.999  13.873  1.00 13.44  ? 360  ALA A CB    1 
ATOM   2791  N N     . ILE A 1 361 ? -14.208 36.404  13.369  1.00 13.32  ? 361  ILE A N     1 
ATOM   2792  C CA    . ILE A 1 361 ? -15.305 35.906  12.496  1.00 13.30  ? 361  ILE A CA    1 
ATOM   2793  C C     . ILE A 1 361 ? -16.676 36.411  12.959  1.00 14.28  ? 361  ILE A C     1 
ATOM   2794  O O     . ILE A 1 361 ? -17.496 36.851  12.135  1.00 15.52  ? 361  ILE A O     1 
ATOM   2795  C CB    . ILE A 1 361 ? -15.286 34.351  12.377  1.00 13.06  ? 361  ILE A CB    1 
ATOM   2796  C CG1   . ILE A 1 361 ? -13.953 33.892  11.774  1.00 12.38  ? 361  ILE A CG1   1 
ATOM   2797  C CG2   . ILE A 1 361 ? -16.514 33.818  11.577  1.00 13.29  ? 361  ILE A CG2   1 
ATOM   2798  C CD1   . ILE A 1 361 ? -13.600 32.416  11.984  1.00 12.68  ? 361  ILE A CD1   1 
ATOM   2799  N N     . ARG A 1 362 ? -16.923 36.362  14.270  1.00 14.84  ? 362  ARG A N     1 
ATOM   2800  C CA    . ARG A 1 362 ? -18.201 36.813  14.841  1.00 15.02  ? 362  ARG A CA    1 
ATOM   2801  C C     . ARG A 1 362 ? -18.374 38.325  14.683  1.00 15.06  ? 362  ARG A C     1 
ATOM   2802  O O     . ARG A 1 362 ? -19.482 38.824  14.415  1.00 15.45  ? 362  ARG A O     1 
ATOM   2803  C CB    . ARG A 1 362 ? -18.293 36.438  16.329  1.00 14.56  ? 362  ARG A CB    1 
ATOM   2804  C CG    . ARG A 1 362 ? -18.588 34.943  16.599  1.00 14.85  ? 362  ARG A CG    1 
ATOM   2805  C CD    . ARG A 1 362 ? -18.913 34.663  18.083  1.00 15.38  ? 362  ARG A CD    1 
ATOM   2806  N NE    . ARG A 1 362 ? -17.878 35.164  19.015  1.00 17.67  ? 362  ARG A NE    1 
ATOM   2807  C CZ    . ARG A 1 362 ? -16.846 34.443  19.456  1.00 17.81  ? 362  ARG A CZ    1 
ATOM   2808  N NH1   . ARG A 1 362 ? -16.703 33.187  19.066  1.00 14.97  ? 362  ARG A NH1   1 
ATOM   2809  N NH2   . ARG A 1 362 ? -15.956 34.982  20.296  1.00 18.45  ? 362  ARG A NH2   1 
ATOM   2810  N N     . ALA A 1 363 ? -17.273 39.052  14.854  1.00 14.53  ? 363  ALA A N     1 
ATOM   2811  C CA    . ALA A 1 363 ? -17.281 40.485  14.641  1.00 15.14  ? 363  ALA A CA    1 
ATOM   2812  C C     . ALA A 1 363 ? -17.641 40.849  13.192  1.00 14.93  ? 363  ALA A C     1 
ATOM   2813  O O     . ALA A 1 363 ? -18.432 41.754  12.975  1.00 15.59  ? 363  ALA A O     1 
ATOM   2814  C CB    . ALA A 1 363 ? -15.934 41.124  15.079  1.00 14.51  ? 363  ALA A CB    1 
ATOM   2815  N N     . LEU A 1 364 ? -17.085 40.142  12.214  1.00 15.28  ? 364  LEU A N     1 
ATOM   2816  C CA    . LEU A 1 364 ? -17.391 40.428  10.798  1.00 15.93  ? 364  LEU A CA    1 
ATOM   2817  C C     . LEU A 1 364 ? -18.777 39.933  10.371  1.00 16.21  ? 364  LEU A C     1 
ATOM   2818  O O     . LEU A 1 364 ? -19.451 40.583  9.575   1.00 17.18  ? 364  LEU A O     1 
ATOM   2819  C CB    . LEU A 1 364 ? -16.330 39.831  9.873   1.00 15.29  ? 364  LEU A CB    1 
ATOM   2820  C CG    . LEU A 1 364 ? -14.853 40.214  10.050  1.00 16.46  ? 364  LEU A CG    1 
ATOM   2821  C CD1   . LEU A 1 364 ? -14.016 39.412  9.071   1.00 13.14  ? 364  LEU A CD1   1 
ATOM   2822  C CD2   . LEU A 1 364 ? -14.610 41.721  9.867   1.00 16.51  ? 364  LEU A CD2   1 
ATOM   2823  N N     . MET A 1 365 ? -19.170 38.767  10.875  1.00 16.25  ? 365  MET A N     1 
ATOM   2824  C CA    . MET A 1 365 ? -20.507 38.207  10.652  1.00 16.70  ? 365  MET A CA    1 
ATOM   2825  C C     . MET A 1 365 ? -21.642 39.145  11.127  1.00 15.21  ? 365  MET A C     1 
ATOM   2826  O O     . MET A 1 365 ? -22.666 39.289  10.441  1.00 14.55  ? 365  MET A O     1 
ATOM   2827  C CB    . MET A 1 365 ? -20.617 36.841  11.349  1.00 16.74  ? 365  MET A CB    1 
ATOM   2828  C CG    . MET A 1 365 ? -21.947 36.138  11.116  1.00 19.39  ? 365  MET A CG    1 
ATOM   2829  S SD    . MET A 1 365 ? -21.986 34.486  11.789  1.00 19.69  ? 365  MET A SD    1 
ATOM   2830  C CE    . MET A 1 365 ? -20.868 34.695  13.154  1.00 19.67  ? 365  MET A CE    1 
ATOM   2831  N N     . ALA A 1 366 ? -21.453 39.775  12.289  1.00 14.28  ? 366  ALA A N     1 
ATOM   2832  C CA    . ALA A 1 366 ? -22.402 40.786  12.801  1.00 13.54  ? 366  ALA A CA    1 
ATOM   2833  C C     . ALA A 1 366 ? -22.655 41.930  11.815  1.00 13.25  ? 366  ALA A C     1 
ATOM   2834  O O     . ALA A 1 366 ? -23.721 42.546  11.828  1.00 12.09  ? 366  ALA A O     1 
ATOM   2835  C CB    . ALA A 1 366 ? -21.930 41.346  14.142  1.00 13.73  ? 366  ALA A CB    1 
ATOM   2836  N N     . GLU A 1 367 ? -21.658 42.200  10.971  1.00 12.90  ? 367  GLU A N     1 
ATOM   2837  C CA    . GLU A 1 367 ? -21.752 43.234  9.951   1.00 13.23  ? 367  GLU A CA    1 
ATOM   2838  C C     . GLU A 1 367 ? -22.274 42.690  8.624   1.00 12.65  ? 367  GLU A C     1 
ATOM   2839  O O     . GLU A 1 367 ? -22.532 43.457  7.712   1.00 12.23  ? 367  GLU A O     1 
ATOM   2840  C CB    . GLU A 1 367 ? -20.395 43.918  9.735   1.00 13.72  ? 367  GLU A CB    1 
ATOM   2841  C CG    . GLU A 1 367 ? -19.753 44.475  10.998  1.00 16.27  ? 367  GLU A CG    1 
ATOM   2842  C CD    . GLU A 1 367 ? -20.686 45.396  11.781  1.00 21.90  ? 367  GLU A CD    1 
ATOM   2843  O OE1   . GLU A 1 367 ? -21.396 46.215  11.150  1.00 21.89  ? 367  GLU A OE1   1 
ATOM   2844  O OE2   . GLU A 1 367 ? -20.709 45.291  13.038  1.00 24.81  ? 367  GLU A OE2   1 
ATOM   2845  N N     . GLY A 1 368 ? -22.448 41.371  8.536   1.00 12.46  ? 368  GLY A N     1 
ATOM   2846  C CA    . GLY A 1 368 ? -22.991 40.728  7.332   1.00 12.19  ? 368  GLY A CA    1 
ATOM   2847  C C     . GLY A 1 368 ? -22.129 40.961  6.103   1.00 12.76  ? 368  GLY A C     1 
ATOM   2848  O O     . GLY A 1 368 ? -20.904 40.851  6.173   1.00 12.28  ? 368  GLY A O     1 
ATOM   2849  N N     . ASP A 1 369 ? -22.772 41.292  4.979   1.00 12.77  ? 369  ASP A N     1 
ATOM   2850  C CA    . ASP A 1 369 ? -22.076 41.481  3.702   1.00 13.26  ? 369  ASP A CA    1 
ATOM   2851  C C     . ASP A 1 369 ? -21.177 42.725  3.646   1.00 13.65  ? 369  ASP A C     1 
ATOM   2852  O O     . ASP A 1 369 ? -20.453 42.922  2.658   1.00 14.10  ? 369  ASP A O     1 
ATOM   2853  C CB    . ASP A 1 369 ? -23.061 41.478  2.525   1.00 12.90  ? 369  ASP A CB    1 
ATOM   2854  C CG    . ASP A 1 369 ? -23.544 40.089  2.175   1.00 13.87  ? 369  ASP A CG    1 
ATOM   2855  O OD1   . ASP A 1 369 ? -23.081 39.079  2.795   1.00 15.01  ? 369  ASP A OD1   1 
ATOM   2856  O OD2   . ASP A 1 369 ? -24.411 40.000  1.283   1.00 16.79  ? 369  ASP A OD2   1 
ATOM   2857  N N     . LYS A 1 370 ? -21.232 43.554  4.695   1.00 12.91  ? 370  LYS A N     1 
ATOM   2858  C CA    . LYS A 1 370 ? -20.295 44.660  4.866   1.00 12.54  ? 370  LYS A CA    1 
ATOM   2859  C C     . LYS A 1 370 ? -18.858 44.147  5.019   1.00 12.32  ? 370  LYS A C     1 
ATOM   2860  O O     . LYS A 1 370 ? -17.897 44.829  4.629   1.00 11.77  ? 370  LYS A O     1 
ATOM   2861  C CB    . LYS A 1 370 ? -20.693 45.549  6.062   1.00 12.33  ? 370  LYS A CB    1 
ATOM   2862  C CG    . LYS A 1 370 ? -21.892 46.471  5.799   1.00 13.27  ? 370  LYS A CG    1 
ATOM   2863  C CD    . LYS A 1 370 ? -21.595 47.476  4.674   1.00 14.03  ? 370  LYS A CD    1 
ATOM   2864  C CE    . LYS A 1 370 ? -22.803 48.393  4.328   1.00 15.47  ? 370  LYS A CE    1 
ATOM   2865  N NZ    . LYS A 1 370 ? -22.650 49.091  2.992   1.00 13.41  ? 370  LYS A NZ    1 
ATOM   2866  N N     . ALA A 1 371 ? -18.728 42.949  5.587   1.00 12.03  ? 371  ALA A N     1 
ATOM   2867  C CA    . ALA A 1 371 ? -17.442 42.256  5.683   1.00 12.88  ? 371  ALA A CA    1 
ATOM   2868  C C     . ALA A 1 371 ? -16.832 41.856  4.318   1.00 12.88  ? 371  ALA A C     1 
ATOM   2869  O O     . ALA A 1 371 ? -15.642 41.573  4.229   1.00 13.25  ? 371  ALA A O     1 
ATOM   2870  C CB    . ALA A 1 371 ? -17.581 40.991  6.604   1.00 12.50  ? 371  ALA A CB    1 
ATOM   2871  N N     . ILE A 1 372 ? -17.633 41.860  3.255   1.00 13.38  ? 372  ILE A N     1 
ATOM   2872  C CA    . ILE A 1 372 ? -17.163 41.360  1.956   1.00 13.29  ? 372  ILE A CA    1 
ATOM   2873  C C     . ILE A 1 372 ? -17.432 42.307  0.777   1.00 13.98  ? 372  ILE A C     1 
ATOM   2874  O O     . ILE A 1 372 ? -16.967 42.065  -0.339  1.00 14.09  ? 372  ILE A O     1 
ATOM   2875  C CB    . ILE A 1 372 ? -17.716 39.940  1.661   1.00 13.37  ? 372  ILE A CB    1 
ATOM   2876  C CG1   . ILE A 1 372 ? -19.239 39.962  1.482   1.00 13.68  ? 372  ILE A CG1   1 
ATOM   2877  C CG2   . ILE A 1 372 ? -17.314 38.949  2.779   1.00 11.17  ? 372  ILE A CG2   1 
ATOM   2878  C CD1   . ILE A 1 372 ? -19.804 38.698  0.768   1.00 13.28  ? 372  ILE A CD1   1 
ATOM   2879  N N     . GLU A 1 373 ? -18.162 43.394  1.028   1.00 13.95  ? 373  GLU A N     1 
ATOM   2880  C CA    . GLU A 1 373 ? -18.555 44.298  -0.029  1.00 14.39  ? 373  GLU A CA    1 
ATOM   2881  C C     . GLU A 1 373 ? -17.355 44.887  -0.788  1.00 13.95  ? 373  GLU A C     1 
ATOM   2882  O O     . GLU A 1 373 ? -16.360 45.304  -0.197  1.00 13.32  ? 373  GLU A O     1 
ATOM   2883  C CB    . GLU A 1 373 ? -19.475 45.372  0.530   1.00 15.10  ? 373  GLU A CB    1 
ATOM   2884  C CG    . GLU A 1 373 ? -19.701 46.555  -0.347  1.00 17.68  ? 373  GLU A CG    1 
ATOM   2885  C CD    . GLU A 1 373 ? -20.465 47.643  0.388   1.00 22.89  ? 373  GLU A CD    1 
ATOM   2886  O OE1   . GLU A 1 373 ? -21.564 47.340  0.900   1.00 25.18  ? 373  GLU A OE1   1 
ATOM   2887  O OE2   . GLU A 1 373 ? -19.966 48.791  0.465   1.00 24.31  ? 373  GLU A OE2   1 
ATOM   2888  N N     . GLY A 1 374 ? -17.463 44.882  -2.115  1.00 13.56  ? 374  GLY A N     1 
ATOM   2889  C CA    . GLY A 1 374 ? -16.397 45.381  -2.988  1.00 13.27  ? 374  GLY A CA    1 
ATOM   2890  C C     . GLY A 1 374 ? -15.166 44.476  -3.032  1.00 12.72  ? 374  GLY A C     1 
ATOM   2891  O O     . GLY A 1 374 ? -14.143 44.869  -3.595  1.00 12.25  ? 374  GLY A O     1 
ATOM   2892  N N     . THR A 1 375 ? -15.231 43.291  -2.406  1.00 11.98  ? 375  THR A N     1 
ATOM   2893  C CA    . THR A 1 375 ? -14.074 42.387  -2.432  1.00 11.04  ? 375  THR A CA    1 
ATOM   2894  C C     . THR A 1 375 ? -14.312 41.122  -3.241  1.00 11.90  ? 375  THR A C     1 
ATOM   2895  O O     . THR A 1 375 ? -15.451 40.687  -3.452  1.00 10.82  ? 375  THR A O     1 
ATOM   2896  C CB    . THR A 1 375 ? -13.547 41.977  -1.034  1.00 11.19  ? 375  THR A CB    1 
ATOM   2897  O OG1   . THR A 1 375 ? -14.442 41.021  -0.436  1.00 8.73   ? 375  THR A OG1   1 
ATOM   2898  C CG2   . THR A 1 375 ? -13.319 43.194  -0.140  1.00 9.63   ? 375  THR A CG2   1 
ATOM   2899  N N     . ASP A 1 376 ? -13.197 40.524  -3.645  1.00 12.74  ? 376  ASP A N     1 
ATOM   2900  C CA    . ASP A 1 376 ? -13.175 39.406  -4.553  1.00 13.45  ? 376  ASP A CA    1 
ATOM   2901  C C     . ASP A 1 376 ? -13.059 38.090  -3.800  1.00 13.24  ? 376  ASP A C     1 
ATOM   2902  O O     . ASP A 1 376 ? -13.944 37.246  -3.912  1.00 13.93  ? 376  ASP A O     1 
ATOM   2903  C CB    . ASP A 1 376 ? -11.992 39.573  -5.516  1.00 14.21  ? 376  ASP A CB    1 
ATOM   2904  C CG    . ASP A 1 376 ? -11.997 38.557  -6.622  1.00 15.28  ? 376  ASP A CG    1 
ATOM   2905  O OD1   . ASP A 1 376 ? -11.787 37.360  -6.360  1.00 16.01  ? 376  ASP A OD1   1 
ATOM   2906  O OD2   . ASP A 1 376 ? -12.196 38.964  -7.777  1.00 20.80  ? 376  ASP A OD2   1 
ATOM   2907  N N     . ARG A 1 377 ? -11.948 37.922  -3.076  1.00 12.94  ? 377  ARG A N     1 
ATOM   2908  C CA    . ARG A 1 377 ? -11.631 36.740  -2.253  1.00 12.60  ? 377  ARG A CA    1 
ATOM   2909  C C     . ARG A 1 377 ? -11.221 35.464  -3.017  1.00 12.93  ? 377  ARG A C     1 
ATOM   2910  O O     . ARG A 1 377 ? -10.961 34.430  -2.371  1.00 12.89  ? 377  ARG A O     1 
ATOM   2911  C CB    . ARG A 1 377 ? -12.778 36.411  -1.287  1.00 12.76  ? 377  ARG A CB    1 
ATOM   2912  C CG    . ARG A 1 377 ? -12.970 37.427  -0.138  1.00 12.84  ? 377  ARG A CG    1 
ATOM   2913  C CD    . ARG A 1 377 ? -14.447 37.566  0.251   1.00 10.78  ? 377  ARG A CD    1 
ATOM   2914  N NE    . ARG A 1 377 ? -15.186 38.284  -0.803  1.00 10.96  ? 377  ARG A NE    1 
ATOM   2915  C CZ    . ARG A 1 377 ? -16.319 37.862  -1.354  1.00 9.01   ? 377  ARG A CZ    1 
ATOM   2916  N NH1   . ARG A 1 377 ? -16.906 36.746  -0.938  1.00 8.51   ? 377  ARG A NH1   1 
ATOM   2917  N NH2   . ARG A 1 377 ? -16.887 38.586  -2.299  1.00 10.86  ? 377  ARG A NH2   1 
ATOM   2918  N N     . SER A 1 378 ? -11.174 35.523  -4.355  1.00 12.02  ? 378  SER A N     1 
ATOM   2919  C CA    . SER A 1 378 ? -10.931 34.324  -5.192  1.00 12.44  ? 378  SER A CA    1 
ATOM   2920  C C     . SER A 1 378 ? -9.561  33.678  -5.033  1.00 12.38  ? 378  SER A C     1 
ATOM   2921  O O     . SER A 1 378 ? -9.377  32.551  -5.477  1.00 13.34  ? 378  SER A O     1 
ATOM   2922  C CB    . SER A 1 378 ? -11.133 34.603  -6.691  1.00 12.47  ? 378  SER A CB    1 
ATOM   2923  O OG    . SER A 1 378 ? -12.427 35.111  -6.971  1.00 13.97  ? 378  SER A OG    1 
ATOM   2924  N N     . SER A 1 379 ? -8.588  34.381  -4.461  1.00 11.55  ? 379  SER A N     1 
ATOM   2925  C CA    . SER A 1 379 ? -7.256  33.797  -4.295  1.00 10.80  ? 379  SER A CA    1 
ATOM   2926  C C     . SER A 1 379 ? -7.216  32.719  -3.206  1.00 11.17  ? 379  SER A C     1 
ATOM   2927  O O     . SER A 1 379 ? -6.360  31.848  -3.256  1.00 11.66  ? 379  SER A O     1 
ATOM   2928  C CB    . SER A 1 379 ? -6.188  34.882  -4.035  1.00 11.03  ? 379  SER A CB    1 
ATOM   2929  O OG    . SER A 1 379 ? -6.524  35.725  -2.924  1.00 8.96   ? 379  SER A OG    1 
ATOM   2930  N N     . LEU A 1 380 ? -8.137  32.789  -2.242  1.00 10.73  ? 380  LEU A N     1 
ATOM   2931  C CA    . LEU A 1 380 ? -8.212  31.858  -1.109  1.00 11.29  ? 380  LEU A CA    1 
ATOM   2932  C C     . LEU A 1 380 ? -8.503  30.417  -1.523  1.00 11.84  ? 380  LEU A C     1 
ATOM   2933  O O     . LEU A 1 380 ? -9.438  30.152  -2.306  1.00 11.50  ? 380  LEU A O     1 
ATOM   2934  C CB    . LEU A 1 380 ? -9.290  32.308  -0.096  1.00 10.91  ? 380  LEU A CB    1 
ATOM   2935  C CG    . LEU A 1 380 ? -9.004  33.537  0.784   1.00 11.13  ? 380  LEU A CG    1 
ATOM   2936  C CD1   . LEU A 1 380 ? -10.246 33.983  1.580   1.00 9.20   ? 380  LEU A CD1   1 
ATOM   2937  C CD2   . LEU A 1 380 ? -7.854  33.284  1.728   1.00 11.54  ? 380  LEU A CD2   1 
ATOM   2938  N N     . ARG A 1 381 ? -7.703  29.501  -0.979  1.00 12.01  ? 381  ARG A N     1 
ATOM   2939  C CA    . ARG A 1 381 ? -7.912  28.065  -1.132  1.00 12.31  ? 381  ARG A CA    1 
ATOM   2940  C C     . ARG A 1 381 ? -8.171  27.351  0.204   1.00 11.79  ? 381  ARG A C     1 
ATOM   2941  O O     . ARG A 1 381 ? -8.869  26.329  0.237   1.00 11.80  ? 381  ARG A O     1 
ATOM   2942  C CB    . ARG A 1 381 ? -6.726  27.421  -1.846  1.00 12.27  ? 381  ARG A CB    1 
ATOM   2943  C CG    . ARG A 1 381 ? -6.702  27.709  -3.336  1.00 13.83  ? 381  ARG A CG    1 
ATOM   2944  C CD    . ARG A 1 381 ? -5.508  27.068  -4.041  1.00 13.79  ? 381  ARG A CD    1 
ATOM   2945  N NE    . ARG A 1 381 ? -4.202  27.623  -3.648  1.00 15.68  ? 381  ARG A NE    1 
ATOM   2946  C CZ    . ARG A 1 381 ? -3.513  28.521  -4.356  1.00 16.14  ? 381  ARG A CZ    1 
ATOM   2947  N NH1   . ARG A 1 381 ? -4.000  29.004  -5.499  1.00 15.92  ? 381  ARG A NH1   1 
ATOM   2948  N NH2   . ARG A 1 381 ? -2.327  28.928  -3.921  1.00 15.20  ? 381  ARG A NH2   1 
ATOM   2949  N N     . ILE A 1 382 ? -7.628  27.895  1.298   1.00 11.87  ? 382  ILE A N     1 
ATOM   2950  C CA    . ILE A 1 382 ? -7.776  27.302  2.642   1.00 11.49  ? 382  ILE A CA    1 
ATOM   2951  C C     . ILE A 1 382 ? -8.121  28.363  3.685   1.00 11.99  ? 382  ILE A C     1 
ATOM   2952  O O     . ILE A 1 382 ? -7.557  29.461  3.677   1.00 12.51  ? 382  ILE A O     1 
ATOM   2953  C CB    . ILE A 1 382 ? -6.461  26.598  3.118   1.00 11.55  ? 382  ILE A CB    1 
ATOM   2954  C CG1   . ILE A 1 382 ? -5.944  25.571  2.092   1.00 11.21  ? 382  ILE A CG1   1 
ATOM   2955  C CG2   . ILE A 1 382 ? -6.619  25.973  4.529   1.00 10.66  ? 382  ILE A CG2   1 
ATOM   2956  C CD1   . ILE A 1 382 ? -6.772  24.266  1.998   1.00 11.03  ? 382  ILE A CD1   1 
ATOM   2957  N N     . LEU A 1 383 ? -9.019  28.000  4.600   1.00 12.20  ? 383  LEU A N     1 
ATOM   2958  C CA    . LEU A 1 383 ? -9.356  28.796  5.765   1.00 12.33  ? 383  LEU A CA    1 
ATOM   2959  C C     . LEU A 1 383 ? -9.010  28.021  7.033   1.00 12.53  ? 383  LEU A C     1 
ATOM   2960  O O     . LEU A 1 383 ? -9.053  26.780  7.043   1.00 12.34  ? 383  LEU A O     1 
ATOM   2961  C CB    . LEU A 1 383 ? -10.845 29.163  5.765   1.00 12.42  ? 383  LEU A CB    1 
ATOM   2962  C CG    . LEU A 1 383 ? -11.387 29.961  4.569   1.00 13.55  ? 383  LEU A CG    1 
ATOM   2963  C CD1   . LEU A 1 383 ? -12.910 30.108  4.680   1.00 10.47  ? 383  LEU A CD1   1 
ATOM   2964  C CD2   . LEU A 1 383 ? -10.705 31.346  4.456   1.00 12.61  ? 383  LEU A CD2   1 
ATOM   2965  N N     . GLY A 1 384 ? -8.639  28.759  8.087   1.00 11.98  ? 384  GLY A N     1 
ATOM   2966  C CA    . GLY A 1 384 ? -8.388  28.196  9.390   1.00 11.62  ? 384  GLY A CA    1 
ATOM   2967  C C     . GLY A 1 384 ? -8.997  29.012  10.516  1.00 12.21  ? 384  GLY A C     1 
ATOM   2968  O O     . GLY A 1 384 ? -9.213  30.225  10.397  1.00 12.20  ? 384  GLY A O     1 
ATOM   2969  N N     . SER A 1 385 ? -9.263  28.328  11.623  1.00 12.45  ? 385  SER A N     1 
ATOM   2970  C CA    . SER A 1 385 ? -9.861  28.913  12.807  1.00 12.68  ? 385  SER A CA    1 
ATOM   2971  C C     . SER A 1 385 ? -9.119  28.408  14.025  1.00 12.77  ? 385  SER A C     1 
ATOM   2972  O O     . SER A 1 385 ? -8.741  27.236  14.073  1.00 12.51  ? 385  SER A O     1 
ATOM   2973  C CB    . SER A 1 385 ? -11.324 28.509  12.920  1.00 12.59  ? 385  SER A CB    1 
ATOM   2974  O OG    . SER A 1 385 ? -11.875 29.124  14.075  1.00 13.49  ? 385  SER A OG    1 
ATOM   2975  N N     . VAL A 1 386 ? -8.915  29.288  15.003  1.00 12.58  ? 386  VAL A N     1 
ATOM   2976  C CA    . VAL A 1 386 ? -8.124  28.955  16.190  1.00 12.70  ? 386  VAL A CA    1 
ATOM   2977  C C     . VAL A 1 386 ? -8.541  29.718  17.446  1.00 13.33  ? 386  VAL A C     1 
ATOM   2978  O O     . VAL A 1 386 ? -8.956  30.869  17.371  1.00 13.12  ? 386  VAL A O     1 
ATOM   2979  C CB    . VAL A 1 386 ? -6.586  29.180  15.948  1.00 12.96  ? 386  VAL A CB    1 
ATOM   2980  C CG1   . VAL A 1 386 ? -6.226  30.671  15.667  1.00 10.47  ? 386  VAL A CG1   1 
ATOM   2981  C CG2   . VAL A 1 386 ? -5.758  28.638  17.123  1.00 12.93  ? 386  VAL A CG2   1 
ATOM   2982  N N     . GLY A 1 387 ? -8.427  29.056  18.594  1.00 14.17  ? 387  GLY A N     1 
ATOM   2983  C CA    . GLY A 1 387 ? -8.291  29.740  19.873  1.00 15.56  ? 387  GLY A CA    1 
ATOM   2984  C C     . GLY A 1 387 ? -9.501  29.668  20.769  1.00 15.98  ? 387  GLY A C     1 
ATOM   2985  O O     . GLY A 1 387 ? -9.438  30.026  21.948  1.00 16.01  ? 387  GLY A O     1 
ATOM   2986  N N     . GLU A 1 388 ? -10.616 29.242  20.205  1.00 16.12  ? 388  GLU A N     1 
ATOM   2987  C CA    . GLU A 1 388 ? -11.850 29.183  20.960  1.00 17.74  ? 388  GLU A CA    1 
ATOM   2988  C C     . GLU A 1 388 ? -12.839 28.338  20.198  1.00 17.95  ? 388  GLU A C     1 
ATOM   2989  O O     . GLU A 1 388 ? -12.706 28.171  18.982  1.00 18.56  ? 388  GLU A O     1 
ATOM   2990  C CB    . GLU A 1 388 ? -12.419 30.599  21.238  1.00 17.61  ? 388  GLU A CB    1 
ATOM   2991  C CG    . GLU A 1 388 ? -12.460 31.477  20.025  1.00 18.12  ? 388  GLU A CG    1 
ATOM   2992  C CD    . GLU A 1 388 ? -12.872 32.921  20.284  1.00 18.48  ? 388  GLU A CD    1 
ATOM   2993  O OE1   . GLU A 1 388 ? -13.907 33.144  20.968  1.00 19.08  ? 388  GLU A OE1   1 
ATOM   2994  O OE2   . GLU A 1 388 ? -12.185 33.819  19.723  1.00 16.22  ? 388  GLU A OE2   1 
ATOM   2995  N N     . PRO A 1 389 ? -13.851 27.802  20.900  1.00 18.49  ? 389  PRO A N     1 
ATOM   2996  C CA    . PRO A 1 389 ? -14.809 27.008  20.150  1.00 18.60  ? 389  PRO A CA    1 
ATOM   2997  C C     . PRO A 1 389 ? -15.456 27.933  19.153  1.00 18.35  ? 389  PRO A C     1 
ATOM   2998  O O     . PRO A 1 389 ? -15.638 29.116  19.442  1.00 18.28  ? 389  PRO A O     1 
ATOM   2999  C CB    . PRO A 1 389 ? -15.837 26.589  21.211  1.00 18.26  ? 389  PRO A CB    1 
ATOM   3000  C CG    . PRO A 1 389 ? -15.140 26.713  22.481  1.00 18.57  ? 389  PRO A CG    1 
ATOM   3001  C CD    . PRO A 1 389 ? -14.198 27.870  22.325  1.00 18.70  ? 389  PRO A CD    1 
ATOM   3002  N N     . ILE A 1 390 ? -15.769 27.396  17.982  1.00 18.65  ? 390  ILE A N     1 
ATOM   3003  C CA    . ILE A 1 390 ? -16.517 28.130  16.982  1.00 18.09  ? 390  ILE A CA    1 
ATOM   3004  C C     . ILE A 1 390 ? -17.877 27.464  16.819  1.00 18.54  ? 390  ILE A C     1 
ATOM   3005  O O     . ILE A 1 390 ? -17.973 26.271  16.521  1.00 18.31  ? 390  ILE A O     1 
ATOM   3006  C CB    . ILE A 1 390 ? -15.708 28.260  15.644  1.00 18.39  ? 390  ILE A CB    1 
ATOM   3007  C CG1   . ILE A 1 390 ? -16.379 29.265  14.691  1.00 18.32  ? 390  ILE A CG1   1 
ATOM   3008  C CG2   . ILE A 1 390 ? -15.408 26.891  15.003  1.00 17.61  ? 390  ILE A CG2   1 
ATOM   3009  C CD1   . ILE A 1 390 ? -15.671 29.414  13.332  1.00 17.50  ? 390  ILE A CD1   1 
ATOM   3010  N N     . ASN A 1 391 ? -18.934 28.234  17.044  1.00 18.93  ? 391  ASN A N     1 
ATOM   3011  C CA    . ASN A 1 391 ? -20.280 27.739  16.809  1.00 19.31  ? 391  ASN A CA    1 
ATOM   3012  C C     . ASN A 1 391 ? -20.512 27.424  15.331  1.00 18.79  ? 391  ASN A C     1 
ATOM   3013  O O     . ASN A 1 391 ? -19.981 28.136  14.455  1.00 19.08  ? 391  ASN A O     1 
ATOM   3014  C CB    . ASN A 1 391 ? -21.317 28.724  17.375  1.00 20.55  ? 391  ASN A CB    1 
ATOM   3015  C CG    . ASN A 1 391 ? -22.357 29.145  16.353  1.00 22.68  ? 391  ASN A CG    1 
ATOM   3016  O OD1   . ASN A 1 391 ? -22.069 29.948  15.462  1.00 25.42  ? 391  ASN A OD1   1 
ATOM   3017  N ND2   . ASN A 1 391 ? -23.565 28.618  16.478  1.00 24.52  ? 391  ASN A ND2   1 
ATOM   3018  N N     . PRO A 1 392 ? -21.282 26.348  15.042  1.00 18.37  ? 392  PRO A N     1 
ATOM   3019  C CA    . PRO A 1 392 ? -21.611 25.922  13.676  1.00 17.99  ? 392  PRO A CA    1 
ATOM   3020  C C     . PRO A 1 392 ? -22.032 27.032  12.719  1.00 18.04  ? 392  PRO A C     1 
ATOM   3021  O O     . PRO A 1 392 ? -21.681 26.977  11.537  1.00 18.09  ? 392  PRO A O     1 
ATOM   3022  C CB    . PRO A 1 392 ? -22.780 24.943  13.888  1.00 17.93  ? 392  PRO A CB    1 
ATOM   3023  C CG    . PRO A 1 392 ? -22.481 24.312  15.187  1.00 18.08  ? 392  PRO A CG    1 
ATOM   3024  C CD    . PRO A 1 392 ? -21.853 25.417  16.039  1.00 18.27  ? 392  PRO A CD    1 
ATOM   3025  N N     . GLU A 1 393 ? -22.785 28.013  13.222  1.00 17.92  ? 393  GLU A N     1 
ATOM   3026  C CA    . GLU A 1 393 ? -23.389 29.054  12.391  1.00 17.59  ? 393  GLU A CA    1 
ATOM   3027  C C     . GLU A 1 393 ? -22.313 30.042  11.953  1.00 16.51  ? 393  GLU A C     1 
ATOM   3028  O O     . GLU A 1 393 ? -22.297 30.502  10.798  1.00 16.37  ? 393  GLU A O     1 
ATOM   3029  C CB    . GLU A 1 393 ? -24.534 29.770  13.139  1.00 17.80  ? 393  GLU A CB    1 
ATOM   3030  C CG    . GLU A 1 393 ? -25.759 28.864  13.478  1.00 19.50  ? 393  GLU A CG    1 
ATOM   3031  C CD    . GLU A 1 393 ? -26.923 29.582  14.194  1.00 20.31  ? 393  GLU A CD    1 
ATOM   3032  O OE1   . GLU A 1 393 ? -26.698 30.585  14.926  1.00 26.25  ? 393  GLU A OE1   1 
ATOM   3033  O OE2   . GLU A 1 393 ? -28.076 29.118  14.050  1.00 23.76  ? 393  GLU A OE2   1 
ATOM   3034  N N     . ALA A 1 394 ? -21.404 30.346  12.872  1.00 15.17  ? 394  ALA A N     1 
ATOM   3035  C CA    . ALA A 1 394 ? -20.231 31.160  12.573  1.00 14.28  ? 394  ALA A CA    1 
ATOM   3036  C C     . ALA A 1 394 ? -19.336 30.441  11.553  1.00 13.33  ? 394  ALA A C     1 
ATOM   3037  O O     . ALA A 1 394 ? -18.837 31.045  10.616  1.00 13.15  ? 394  ALA A O     1 
ATOM   3038  C CB    . ALA A 1 394 ? -19.446 31.460  13.865  1.00 13.76  ? 394  ALA A CB    1 
ATOM   3039  N N     . TRP A 1 395 ? -19.147 29.143  11.755  1.00 12.84  ? 395  TRP A N     1 
ATOM   3040  C CA    . TRP A 1 395 ? -18.310 28.322  10.887  1.00 12.33  ? 395  TRP A CA    1 
ATOM   3041  C C     . TRP A 1 395 ? -18.927 28.337  9.487   1.00 12.53  ? 395  TRP A C     1 
ATOM   3042  O O     . TRP A 1 395 ? -18.219 28.582  8.487   1.00 12.33  ? 395  TRP A O     1 
ATOM   3043  C CB    . TRP A 1 395 ? -18.214 26.913  11.486  1.00 11.64  ? 395  TRP A CB    1 
ATOM   3044  C CG    . TRP A 1 395 ? -17.282 25.923  10.817  1.00 12.65  ? 395  TRP A CG    1 
ATOM   3045  C CD1   . TRP A 1 395 ? -16.129 25.396  11.352  1.00 12.67  ? 395  TRP A CD1   1 
ATOM   3046  C CD2   . TRP A 1 395 ? -17.444 25.302  9.528   1.00 10.28  ? 395  TRP A CD2   1 
ATOM   3047  N NE1   . TRP A 1 395 ? -15.569 24.505  10.472  1.00 12.86  ? 395  TRP A NE1   1 
ATOM   3048  C CE2   . TRP A 1 395 ? -16.350 24.432  9.345   1.00 11.92  ? 395  TRP A CE2   1 
ATOM   3049  C CE3   . TRP A 1 395 ? -18.406 25.404  8.509   1.00 10.19  ? 395  TRP A CE3   1 
ATOM   3050  C CZ2   . TRP A 1 395 ? -16.193 23.646  8.181   1.00 11.43  ? 395  TRP A CZ2   1 
ATOM   3051  C CZ3   . TRP A 1 395 ? -18.246 24.640  7.352   1.00 11.05  ? 395  TRP A CZ3   1 
ATOM   3052  C CH2   . TRP A 1 395 ? -17.142 23.772  7.198   1.00 11.31  ? 395  TRP A CH2   1 
ATOM   3053  N N     . GLU A 1 396 ? -20.247 28.127  9.405   1.00 11.97  ? 396  GLU A N     1 
ATOM   3054  C CA    . GLU A 1 396 ? -20.923 28.136  8.085   1.00 11.89  ? 396  GLU A CA    1 
ATOM   3055  C C     . GLU A 1 396 ? -20.802 29.479  7.355   1.00 11.61  ? 396  GLU A C     1 
ATOM   3056  O O     . GLU A 1 396 ? -20.617 29.512  6.130   1.00 11.17  ? 396  GLU A O     1 
ATOM   3057  C CB    . GLU A 1 396 ? -22.397 27.719  8.203   1.00 11.80  ? 396  GLU A CB    1 
ATOM   3058  C CG    . GLU A 1 396 ? -22.608 26.227  8.486   1.00 12.67  ? 396  GLU A CG    1 
ATOM   3059  C CD    . GLU A 1 396 ? -22.216 25.333  7.310   1.00 14.23  ? 396  GLU A CD    1 
ATOM   3060  O OE1   . GLU A 1 396 ? -22.117 25.838  6.175   1.00 12.76  ? 396  GLU A OE1   1 
ATOM   3061  O OE2   . GLU A 1 396 ? -22.006 24.114  7.527   1.00 18.20  ? 396  GLU A OE2   1 
ATOM   3062  N N     . TRP A 1 397 ? -20.900 30.577  8.110   1.00 10.73  ? 397  TRP A N     1 
ATOM   3063  C CA    . TRP A 1 397 ? -20.837 31.931  7.544   1.00 10.20  ? 397  TRP A CA    1 
ATOM   3064  C C     . TRP A 1 397 ? -19.442 32.199  7.010   1.00 10.40  ? 397  TRP A C     1 
ATOM   3065  O O     . TRP A 1 397 ? -19.269 32.783  5.937   1.00 10.16  ? 397  TRP A O     1 
ATOM   3066  C CB    . TRP A 1 397 ? -21.218 32.991  8.604   1.00 10.09  ? 397  TRP A CB    1 
ATOM   3067  C CG    . TRP A 1 397 ? -21.231 34.405  8.065   1.00 9.19   ? 397  TRP A CG    1 
ATOM   3068  C CD1   . TRP A 1 397 ? -22.310 35.091  7.554   1.00 9.07   ? 397  TRP A CD1   1 
ATOM   3069  C CD2   . TRP A 1 397 ? -20.115 35.302  7.996   1.00 8.47   ? 397  TRP A CD2   1 
ATOM   3070  N NE1   . TRP A 1 397 ? -21.922 36.352  7.155   1.00 9.46   ? 397  TRP A NE1   1 
ATOM   3071  C CE2   . TRP A 1 397 ? -20.576 36.500  7.400   1.00 9.11   ? 397  TRP A CE2   1 
ATOM   3072  C CE3   . TRP A 1 397 ? -18.757 35.192  8.340   1.00 9.73   ? 397  TRP A CE3   1 
ATOM   3073  C CZ2   . TRP A 1 397 ? -19.731 37.590  7.158   1.00 8.30   ? 397  TRP A CZ2   1 
ATOM   3074  C CZ3   . TRP A 1 397 ? -17.915 36.279  8.111   1.00 9.10   ? 397  TRP A CZ3   1 
ATOM   3075  C CH2   . TRP A 1 397 ? -18.412 37.462  7.526   1.00 9.73   ? 397  TRP A CH2   1 
ATOM   3076  N N     . TYR A 1 398 ? -18.446 31.767  7.784   1.00 10.66  ? 398  TYR A N     1 
ATOM   3077  C CA    . TYR A 1 398 ? -17.032 31.900  7.425   1.00 10.31  ? 398  TYR A CA    1 
ATOM   3078  C C     . TYR A 1 398 ? -16.740 31.065  6.148   1.00 10.40  ? 398  TYR A C     1 
ATOM   3079  O O     . TYR A 1 398 ? -16.147 31.568  5.176   1.00 9.62   ? 398  TYR A O     1 
ATOM   3080  C CB    . TYR A 1 398 ? -16.186 31.459  8.628   1.00 9.52   ? 398  TYR A CB    1 
ATOM   3081  C CG    . TYR A 1 398 ? -14.668 31.535  8.517   1.00 9.89   ? 398  TYR A CG    1 
ATOM   3082  C CD1   . TYR A 1 398 ? -14.011 32.691  8.054   1.00 8.38   ? 398  TYR A CD1   1 
ATOM   3083  C CD2   . TYR A 1 398 ? -13.882 30.474  8.966   1.00 10.25  ? 398  TYR A CD2   1 
ATOM   3084  C CE1   . TYR A 1 398 ? -12.604 32.756  8.007   1.00 8.16   ? 398  TYR A CE1   1 
ATOM   3085  C CE2   . TYR A 1 398 ? -12.475 30.523  8.923   1.00 8.58   ? 398  TYR A CE2   1 
ATOM   3086  C CZ    . TYR A 1 398 ? -11.839 31.657  8.440   1.00 9.12   ? 398  TYR A CZ    1 
ATOM   3087  O OH    . TYR A 1 398 ? -10.445 31.684  8.405   1.00 8.71   ? 398  TYR A OH    1 
ATOM   3088  N N     . TRP A 1 399 ? -17.158 29.802  6.161   1.00 10.60  ? 399  TRP A N     1 
ATOM   3089  C CA    . TRP A 1 399 ? -17.010 28.907  5.002   1.00 11.63  ? 399  TRP A CA    1 
ATOM   3090  C C     . TRP A 1 399 ? -17.687 29.463  3.737   1.00 11.96  ? 399  TRP A C     1 
ATOM   3091  O O     . TRP A 1 399 ? -17.160 29.356  2.619   1.00 12.12  ? 399  TRP A O     1 
ATOM   3092  C CB    . TRP A 1 399 ? -17.575 27.527  5.359   1.00 12.16  ? 399  TRP A CB    1 
ATOM   3093  C CG    . TRP A 1 399 ? -17.466 26.461  4.300   1.00 12.77  ? 399  TRP A CG    1 
ATOM   3094  C CD1   . TRP A 1 399 ? -16.382 25.657  4.039   1.00 12.26  ? 399  TRP A CD1   1 
ATOM   3095  C CD2   . TRP A 1 399 ? -18.500 26.050  3.394   1.00 12.94  ? 399  TRP A CD2   1 
ATOM   3096  N NE1   . TRP A 1 399 ? -16.681 24.782  3.019   1.00 12.81  ? 399  TRP A NE1   1 
ATOM   3097  C CE2   . TRP A 1 399 ? -17.971 25.004  2.603   1.00 13.16  ? 399  TRP A CE2   1 
ATOM   3098  C CE3   . TRP A 1 399 ? -19.825 26.470  3.174   1.00 13.69  ? 399  TRP A CE3   1 
ATOM   3099  C CZ2   . TRP A 1 399 ? -18.715 24.376  1.594   1.00 13.62  ? 399  TRP A CZ2   1 
ATOM   3100  C CZ3   . TRP A 1 399 ? -20.566 25.851  2.166   1.00 13.66  ? 399  TRP A CZ3   1 
ATOM   3101  C CH2   . TRP A 1 399 ? -20.007 24.808  1.389   1.00 12.96  ? 399  TRP A CH2   1 
ATOM   3102  N N     . LYS A 1 400 ? -18.845 30.087  3.925   1.00 11.84  ? 400  LYS A N     1 
ATOM   3103  C CA    . LYS A 1 400 ? -19.651 30.535  2.801   1.00 12.15  ? 400  LYS A CA    1 
ATOM   3104  C C     . LYS A 1 400 ? -19.217 31.896  2.254   1.00 12.20  ? 400  LYS A C     1 
ATOM   3105  O O     . LYS A 1 400 ? -19.138 32.082  1.043   1.00 11.85  ? 400  LYS A O     1 
ATOM   3106  C CB    . LYS A 1 400 ? -21.142 30.530  3.161   1.00 11.53  ? 400  LYS A CB    1 
ATOM   3107  C CG    . LYS A 1 400 ? -22.041 31.138  2.096   1.00 12.87  ? 400  LYS A CG    1 
ATOM   3108  C CD    . LYS A 1 400 ? -23.455 31.337  2.601   1.00 14.14  ? 400  LYS A CD    1 
ATOM   3109  C CE    . LYS A 1 400 ? -24.350 31.976  1.529   1.00 15.73  ? 400  LYS A CE    1 
ATOM   3110  N NZ    . LYS A 1 400 ? -25.765 31.957  1.975   1.00 15.30  ? 400  LYS A NZ    1 
ATOM   3111  N N     . LYS A 1 401 ? -18.913 32.824  3.148   1.00 12.19  ? 401  LYS A N     1 
ATOM   3112  C CA    . LYS A 1 401 ? -18.788 34.222  2.775   1.00 12.74  ? 401  LYS A CA    1 
ATOM   3113  C C     . LYS A 1 401 ? -17.346 34.600  2.479   1.00 12.98  ? 401  LYS A C     1 
ATOM   3114  O O     . LYS A 1 401 ? -17.085 35.294  1.503   1.00 13.10  ? 401  LYS A O     1 
ATOM   3115  C CB    . LYS A 1 401 ? -19.367 35.126  3.868   1.00 12.76  ? 401  LYS A CB    1 
ATOM   3116  C CG    . LYS A 1 401 ? -20.871 34.966  4.070   1.00 13.51  ? 401  LYS A CG    1 
ATOM   3117  C CD    . LYS A 1 401 ? -21.615 35.730  2.999   1.00 14.25  ? 401  LYS A CD    1 
ATOM   3118  C CE    . LYS A 1 401 ? -23.118 35.577  3.140   1.00 13.51  ? 401  LYS A CE    1 
ATOM   3119  N NZ    . LYS A 1 401 ? -23.780 36.308  2.028   1.00 12.87  ? 401  LYS A NZ    1 
ATOM   3120  N N     . ILE A 1 402 ? -16.430 34.139  3.331   1.00 12.96  ? 402  ILE A N     1 
ATOM   3121  C CA    . ILE A 1 402 ? -15.001 34.363  3.140   1.00 12.61  ? 402  ILE A CA    1 
ATOM   3122  C C     . ILE A 1 402 ? -14.413 33.333  2.149   1.00 13.19  ? 402  ILE A C     1 
ATOM   3123  O O     . ILE A 1 402 ? -13.667 33.709  1.225   1.00 12.79  ? 402  ILE A O     1 
ATOM   3124  C CB    . ILE A 1 402 ? -14.233 34.325  4.478   1.00 12.14  ? 402  ILE A CB    1 
ATOM   3125  C CG1   . ILE A 1 402 ? -14.979 35.140  5.552   1.00 11.91  ? 402  ILE A CG1   1 
ATOM   3126  C CG2   . ILE A 1 402 ? -12.772 34.801  4.302   1.00 10.53  ? 402  ILE A CG2   1 
ATOM   3127  C CD1   . ILE A 1 402 ? -15.123 36.638  5.275   1.00 9.44   ? 402  ILE A CD1   1 
ATOM   3128  N N     . GLY A 1 403 ? -14.773 32.061  2.330   1.00 12.65  ? 403  GLY A N     1 
ATOM   3129  C CA    . GLY A 1 403 ? -14.273 30.984  1.496   1.00 13.08  ? 403  GLY A CA    1 
ATOM   3130  C C     . GLY A 1 403 ? -15.053 30.729  0.219   1.00 13.83  ? 403  GLY A C     1 
ATOM   3131  O O     . GLY A 1 403 ? -14.661 29.885  -0.572  1.00 13.38  ? 403  GLY A O     1 
ATOM   3132  N N     . LYS A 1 404 ? -16.151 31.458  0.022   1.00 14.60  ? 404  LYS A N     1 
ATOM   3133  C CA    . LYS A 1 404 ? -17.038 31.305  -1.156  1.00 15.39  ? 404  LYS A CA    1 
ATOM   3134  C C     . LYS A 1 404 ? -17.497 29.857  -1.362  1.00 15.54  ? 404  LYS A C     1 
ATOM   3135  O O     . LYS A 1 404 ? -17.773 29.416  -2.479  1.00 15.81  ? 404  LYS A O     1 
ATOM   3136  C CB    . LYS A 1 404 ? -16.408 31.925  -2.420  1.00 15.38  ? 404  LYS A CB    1 
ATOM   3137  C CG    . LYS A 1 404 ? -16.035 33.429  -2.257  1.00 16.21  ? 404  LYS A CG    1 
ATOM   3138  C CD    . LYS A 1 404 ? -15.219 34.009  -3.465  1.00 16.55  ? 404  LYS A CD    1 
ATOM   3139  C CE    . LYS A 1 404 ? -16.092 34.238  -4.696  1.00 20.17  ? 404  LYS A CE    1 
ATOM   3140  N NZ    . LYS A 1 404 ? -15.473 35.178  -5.696  1.00 22.64  ? 404  LYS A NZ    1 
ATOM   3141  N N     . GLU A 1 405 ? -17.571 29.118  -0.254  1.00 16.20  ? 405  GLU A N     1 
ATOM   3142  C CA    . GLU A 1 405 ? -18.026 27.735  -0.249  1.00 16.73  ? 405  GLU A CA    1 
ATOM   3143  C C     . GLU A 1 405 ? -17.032 26.831  -0.985  1.00 16.36  ? 405  GLU A C     1 
ATOM   3144  O O     . GLU A 1 405 ? -17.366 25.711  -1.367  1.00 16.55  ? 405  GLU A O     1 
ATOM   3145  C CB    . GLU A 1 405 ? -19.433 27.624  -0.861  1.00 17.10  ? 405  GLU A CB    1 
ATOM   3146  C CG    . GLU A 1 405 ? -20.424 28.719  -0.437  1.00 17.85  ? 405  GLU A CG    1 
ATOM   3147  C CD    . GLU A 1 405 ? -21.817 28.508  -1.012  1.00 18.95  ? 405  GLU A CD    1 
ATOM   3148  O OE1   . GLU A 1 405 ? -22.436 29.498  -1.483  1.00 22.96  ? 405  GLU A OE1   1 
ATOM   3149  O OE2   . GLU A 1 405 ? -22.291 27.352  -1.008  1.00 20.10  ? 405  GLU A OE2   1 
ATOM   3150  N N     . LYS A 1 406 ? -15.806 27.320  -1.169  1.00 15.98  ? 406  LYS A N     1 
ATOM   3151  C CA    . LYS A 1 406 ? -14.775 26.609  -1.934  1.00 16.55  ? 406  LYS A CA    1 
ATOM   3152  C C     . LYS A 1 406 ? -13.569 26.167  -1.092  1.00 15.33  ? 406  LYS A C     1 
ATOM   3153  O O     . LYS A 1 406 ? -12.729 25.376  -1.552  1.00 14.47  ? 406  LYS A O     1 
ATOM   3154  C CB    . LYS A 1 406 ? -14.291 27.478  -3.108  1.00 16.43  ? 406  LYS A CB    1 
ATOM   3155  C CG    . LYS A 1 406 ? -15.296 27.630  -4.244  1.00 17.91  ? 406  LYS A CG    1 
ATOM   3156  C CD    . LYS A 1 406 ? -14.731 28.467  -5.389  1.00 19.36  ? 406  LYS A CD    1 
ATOM   3157  C CE    . LYS A 1 406 ? -15.866 29.024  -6.264  1.00 25.38  ? 406  LYS A CE    1 
ATOM   3158  N NZ    . LYS A 1 406 ? -15.579 28.963  -7.750  1.00 26.86  ? 406  LYS A NZ    1 
ATOM   3159  N N     . CYS A 1 407 ? -13.481 26.695  0.128   1.00 14.60  ? 407  CYS A N     1 
ATOM   3160  C CA    . CYS A 1 407 ? -12.294 26.500  0.956   1.00 14.35  ? 407  CYS A CA    1 
ATOM   3161  C C     . CYS A 1 407 ? -12.559 25.621  2.165   1.00 14.15  ? 407  CYS A C     1 
ATOM   3162  O O     . CYS A 1 407 ? -13.418 25.947  2.984   1.00 14.76  ? 407  CYS A O     1 
ATOM   3163  C CB    . CYS A 1 407 ? -11.747 27.860  1.413   1.00 14.19  ? 407  CYS A CB    1 
ATOM   3164  S SG    . CYS A 1 407 ? -11.301 28.934  0.040   1.00 13.14  ? 407  CYS A SG    1 
ATOM   3165  N N     . PRO A 1 408 ? -11.810 24.511  2.304   1.00 14.16  ? 408  PRO A N     1 
ATOM   3166  C CA    . PRO A 1 408 ? -11.845 23.807  3.595   1.00 13.74  ? 408  PRO A CA    1 
ATOM   3167  C C     . PRO A 1 408 ? -11.517 24.751  4.760   1.00 14.05  ? 408  PRO A C     1 
ATOM   3168  O O     . PRO A 1 408 ? -10.710 25.684  4.611   1.00 13.52  ? 408  PRO A O     1 
ATOM   3169  C CB    . PRO A 1 408 ? -10.754 22.750  3.446   1.00 13.77  ? 408  PRO A CB    1 
ATOM   3170  C CG    . PRO A 1 408 ? -10.701 22.488  1.969   1.00 13.24  ? 408  PRO A CG    1 
ATOM   3171  C CD    . PRO A 1 408 ? -10.936 23.827  1.331   1.00 13.92  ? 408  PRO A CD    1 
ATOM   3172  N N     . VAL A 1 409 ? -12.162 24.513  5.897   1.00 13.85  ? 409  VAL A N     1 
ATOM   3173  C CA    . VAL A 1 409 ? -11.866 25.246  7.116   1.00 13.80  ? 409  VAL A CA    1 
ATOM   3174  C C     . VAL A 1 409 ? -11.154 24.297  8.073   1.00 14.06  ? 409  VAL A C     1 
ATOM   3175  O O     . VAL A 1 409 ? -11.692 23.237  8.390   1.00 14.22  ? 409  VAL A O     1 
ATOM   3176  C CB    . VAL A 1 409 ? -13.175 25.791  7.785   1.00 13.89  ? 409  VAL A CB    1 
ATOM   3177  C CG1   . VAL A 1 409 ? -12.891 26.332  9.213   1.00 12.28  ? 409  VAL A CG1   1 
ATOM   3178  C CG2   . VAL A 1 409 ? -13.816 26.854  6.906   1.00 11.15  ? 409  VAL A CG2   1 
ATOM   3179  N N     . VAL A 1 410 ? -9.947  24.660  8.509   1.00 13.88  ? 410  VAL A N     1 
ATOM   3180  C CA    . VAL A 1 410 ? -9.262  23.873  9.542   1.00 14.01  ? 410  VAL A CA    1 
ATOM   3181  C C     . VAL A 1 410 ? -9.424  24.515  10.922  1.00 14.18  ? 410  VAL A C     1 
ATOM   3182  O O     . VAL A 1 410 ? -8.887  25.588  11.176  1.00 14.02  ? 410  VAL A O     1 
ATOM   3183  C CB    . VAL A 1 410 ? -7.744  23.520  9.211   1.00 14.23  ? 410  VAL A CB    1 
ATOM   3184  C CG1   . VAL A 1 410 ? -7.651  22.619  7.988   1.00 13.84  ? 410  VAL A CG1   1 
ATOM   3185  C CG2   . VAL A 1 410 ? -6.850  24.759  9.040   1.00 13.65  ? 410  VAL A CG2   1 
ATOM   3186  N N     . ASP A 1 411 ? -10.208 23.865  11.784  1.00 14.16  ? 411  ASP A N     1 
ATOM   3187  C CA    . ASP A 1 411 ? -10.422 24.317  13.148  1.00 14.09  ? 411  ASP A CA    1 
ATOM   3188  C C     . ASP A 1 411 ? -9.367  23.618  13.986  1.00 14.26  ? 411  ASP A C     1 
ATOM   3189  O O     . ASP A 1 411 ? -9.474  22.432  14.262  1.00 14.63  ? 411  ASP A O     1 
ATOM   3190  C CB    . ASP A 1 411 ? -11.835 23.925  13.593  1.00 14.22  ? 411  ASP A CB    1 
ATOM   3191  C CG    . ASP A 1 411 ? -12.160 24.319  15.051  1.00 13.72  ? 411  ASP A CG    1 
ATOM   3192  O OD1   . ASP A 1 411 ? -11.392 25.050  15.749  1.00 12.03  ? 411  ASP A OD1   1 
ATOM   3193  O OD2   . ASP A 1 411 ? -13.243 23.878  15.487  1.00 13.38  ? 411  ASP A OD2   1 
ATOM   3194  N N     . THR A 1 412 ? -8.330  24.356  14.365  1.00 13.81  ? 412  THR A N     1 
ATOM   3195  C CA    . THR A 1 412 ? -7.178  23.769  15.026  1.00 13.24  ? 412  THR A CA    1 
ATOM   3196  C C     . THR A 1 412 ? -7.261  23.944  16.547  1.00 13.00  ? 412  THR A C     1 
ATOM   3197  O O     . THR A 1 412 ? -7.097  25.057  17.053  1.00 12.77  ? 412  THR A O     1 
ATOM   3198  C CB    . THR A 1 412 ? -5.873  24.420  14.524  1.00 13.37  ? 412  THR A CB    1 
ATOM   3199  O OG1   . THR A 1 412 ? -5.941  25.837  14.758  1.00 12.80  ? 412  THR A OG1   1 
ATOM   3200  C CG2   . THR A 1 412 ? -5.644  24.150  13.025  1.00 11.99  ? 412  THR A CG2   1 
ATOM   3201  N N     . TRP A 1 413 ? -7.504  22.847  17.272  1.00 12.75  ? 413  TRP A N     1 
ATOM   3202  C CA    . TRP A 1 413 ? -7.364  22.871  18.726  1.00 11.86  ? 413  TRP A CA    1 
ATOM   3203  C C     . TRP A 1 413 ? -5.926  22.590  19.168  1.00 12.06  ? 413  TRP A C     1 
ATOM   3204  O O     . TRP A 1 413 ? -5.288  21.635  18.711  1.00 11.72  ? 413  TRP A O     1 
ATOM   3205  C CB    . TRP A 1 413 ? -8.343  21.930  19.441  1.00 11.69  ? 413  TRP A CB    1 
ATOM   3206  C CG    . TRP A 1 413 ? -8.131  21.969  20.931  1.00 11.21  ? 413  TRP A CG    1 
ATOM   3207  C CD1   . TRP A 1 413 ? -8.626  22.898  21.821  1.00 11.48  ? 413  TRP A CD1   1 
ATOM   3208  C CD2   . TRP A 1 413 ? -7.316  21.079  21.695  1.00 10.69  ? 413  TRP A CD2   1 
ATOM   3209  N NE1   . TRP A 1 413 ? -8.169  22.627  23.096  1.00 10.26  ? 413  TRP A NE1   1 
ATOM   3210  C CE2   . TRP A 1 413 ? -7.363  21.518  23.044  1.00 10.97  ? 413  TRP A CE2   1 
ATOM   3211  C CE3   . TRP A 1 413 ? -6.545  19.952  21.372  1.00 11.71  ? 413  TRP A CE3   1 
ATOM   3212  C CZ2   . TRP A 1 413 ? -6.684  20.852  24.073  1.00 11.53  ? 413  TRP A CZ2   1 
ATOM   3213  C CZ3   . TRP A 1 413 ? -5.867  19.291  22.399  1.00 11.77  ? 413  TRP A CZ3   1 
ATOM   3214  C CH2   . TRP A 1 413 ? -5.941  19.751  23.733  1.00 11.73  ? 413  TRP A CH2   1 
ATOM   3215  N N     . TRP A 1 414 ? -5.440  23.441  20.082  1.00 12.33  ? 414  TRP A N     1 
ATOM   3216  C CA    . TRP A 1 414 ? -4.144  23.288  20.738  1.00 11.51  ? 414  TRP A CA    1 
ATOM   3217  C C     . TRP A 1 414 ? -4.023  24.368  21.829  1.00 12.11  ? 414  TRP A C     1 
ATOM   3218  O O     . TRP A 1 414 ? -5.016  25.019  22.172  1.00 11.83  ? 414  TRP A O     1 
ATOM   3219  C CB    . TRP A 1 414 ? -2.982  23.324  19.725  1.00 11.64  ? 414  TRP A CB    1 
ATOM   3220  C CG    . TRP A 1 414 ? -2.862  24.583  18.898  1.00 10.62  ? 414  TRP A CG    1 
ATOM   3221  C CD1   . TRP A 1 414 ? -3.751  25.049  17.970  1.00 11.11  ? 414  TRP A CD1   1 
ATOM   3222  C CD2   . TRP A 1 414 ? -1.773  25.521  18.915  1.00 11.51  ? 414  TRP A CD2   1 
ATOM   3223  N NE1   . TRP A 1 414 ? -3.291  26.224  17.410  1.00 9.81   ? 414  TRP A NE1   1 
ATOM   3224  C CE2   . TRP A 1 414 ? -2.082  26.540  17.973  1.00 11.96  ? 414  TRP A CE2   1 
ATOM   3225  C CE3   . TRP A 1 414 ? -0.573  25.617  19.654  1.00 11.51  ? 414  TRP A CE3   1 
ATOM   3226  C CZ2   . TRP A 1 414 ? -1.237  27.647  17.756  1.00 12.73  ? 414  TRP A CZ2   1 
ATOM   3227  C CZ3   . TRP A 1 414 ? 0.275   26.703  19.426  1.00 10.50  ? 414  TRP A CZ3   1 
ATOM   3228  C CH2   . TRP A 1 414 ? -0.062  27.706  18.491  1.00 11.54  ? 414  TRP A CH2   1 
ATOM   3229  N N     . GLN A 1 415 ? -2.816  24.550  22.376  1.00 12.31  ? 415  GLN A N     1 
ATOM   3230  C CA    . GLN A 1 415 ? -2.595  25.418  23.540  1.00 12.73  ? 415  GLN A CA    1 
ATOM   3231  C C     . GLN A 1 415 ? -1.143  25.852  23.577  1.00 12.69  ? 415  GLN A C     1 
ATOM   3232  O O     . GLN A 1 415 ? -0.305  25.202  22.977  1.00 12.44  ? 415  GLN A O     1 
ATOM   3233  C CB    . GLN A 1 415 ? -2.833  24.649  24.844  1.00 12.72  ? 415  GLN A CB    1 
ATOM   3234  C CG    . GLN A 1 415 ? -4.082  23.815  24.926  1.00 14.49  ? 415  GLN A CG    1 
ATOM   3235  C CD    . GLN A 1 415 ? -4.136  23.076  26.246  1.00 14.72  ? 415  GLN A CD    1 
ATOM   3236  O OE1   . GLN A 1 415 ? -3.346  22.158  26.481  1.00 13.69  ? 415  GLN A OE1   1 
ATOM   3237  N NE2   . GLN A 1 415 ? -5.041  23.501  27.130  1.00 13.49  ? 415  GLN A NE2   1 
ATOM   3238  N N     . THR A 1 416 ? -0.833  26.895  24.348  1.00 13.01  ? 416  THR A N     1 
ATOM   3239  C CA    . THR A 1 416 ? 0.547   27.339  24.521  1.00 13.27  ? 416  THR A CA    1 
ATOM   3240  C C     . THR A 1 416 ? 1.449   26.142  24.881  1.00 13.63  ? 416  THR A C     1 
ATOM   3241  O O     . THR A 1 416 ? 2.557   25.990  24.342  1.00 13.73  ? 416  THR A O     1 
ATOM   3242  C CB    . THR A 1 416 ? 0.632   28.425  25.629  1.00 13.74  ? 416  THR A CB    1 
ATOM   3243  O OG1   . THR A 1 416 ? -0.349  29.435  25.372  1.00 14.03  ? 416  THR A OG1   1 
ATOM   3244  C CG2   . THR A 1 416 ? 2.011   29.069  25.659  1.00 12.96  ? 416  THR A CG2   1 
ATOM   3245  N N     . GLU A 1 417 ? 0.926   25.281  25.754  1.00 13.32  ? 417  GLU A N     1 
ATOM   3246  C CA    . GLU A 1 417 ? 1.640   24.138  26.314  1.00 13.45  ? 417  GLU A CA    1 
ATOM   3247  C C     . GLU A 1 417 ? 1.940   23.032  25.305  1.00 13.61  ? 417  GLU A C     1 
ATOM   3248  O O     . GLU A 1 417 ? 2.754   22.150  25.578  1.00 13.78  ? 417  GLU A O     1 
ATOM   3249  C CB    . GLU A 1 417 ? 0.830   23.547  27.473  1.00 13.48  ? 417  GLU A CB    1 
ATOM   3250  C CG    . GLU A 1 417 ? 0.681   24.476  28.719  1.00 14.01  ? 417  GLU A CG    1 
ATOM   3251  C CD    . GLU A 1 417 ? -0.519  25.425  28.669  1.00 15.93  ? 417  GLU A CD    1 
ATOM   3252  O OE1   . GLU A 1 417 ? -1.017  25.721  27.551  1.00 16.48  ? 417  GLU A OE1   1 
ATOM   3253  O OE2   . GLU A 1 417 ? -0.956  25.906  29.760  1.00 16.60  ? 417  GLU A OE2   1 
ATOM   3254  N N     . THR A 1 418 ? 1.269   23.060  24.156  1.00 12.99  ? 418  THR A N     1 
ATOM   3255  C CA    . THR A 1 418 ? 1.405   21.982  23.190  1.00 12.91  ? 418  THR A CA    1 
ATOM   3256  C C     . THR A 1 418 ? 2.304   22.364  22.012  1.00 13.21  ? 418  THR A C     1 
ATOM   3257  O O     . THR A 1 418 ? 2.669   21.502  21.214  1.00 13.86  ? 418  THR A O     1 
ATOM   3258  C CB    . THR A 1 418 ? 0.022   21.456  22.676  1.00 13.08  ? 418  THR A CB    1 
ATOM   3259  O OG1   . THR A 1 418 ? -0.606  22.424  21.822  1.00 10.92  ? 418  THR A OG1   1 
ATOM   3260  C CG2   . THR A 1 418 ? -0.910  21.133  23.839  1.00 11.09  ? 418  THR A CG2   1 
ATOM   3261  N N     . GLY A 1 419 ? 2.630   23.652  21.891  1.00 12.95  ? 419  GLY A N     1 
ATOM   3262  C CA    . GLY A 1 419 ? 3.551   24.127  20.867  1.00 12.37  ? 419  GLY A CA    1 
ATOM   3263  C C     . GLY A 1 419 ? 3.041   24.188  19.437  1.00 12.65  ? 419  GLY A C     1 
ATOM   3264  O O     . GLY A 1 419 ? 3.439   25.089  18.678  1.00 13.17  ? 419  GLY A O     1 
ATOM   3265  N N     . GLY A 1 420 ? 2.187   23.242  19.048  1.00 10.96  ? 420  GLY A N     1 
ATOM   3266  C CA    . GLY A 1 420 ? 1.526   23.320  17.757  1.00 10.23  ? 420  GLY A CA    1 
ATOM   3267  C C     . GLY A 1 420 ? 0.243   22.498  17.716  1.00 10.64  ? 420  GLY A C     1 
ATOM   3268  O O     . GLY A 1 420 ? -0.185  21.950  18.746  1.00 9.32   ? 420  GLY A O     1 
ATOM   3269  N N     . PHE A 1 421 ? -0.377  22.414  16.533  1.00 10.49  ? 421  PHE A N     1 
ATOM   3270  C CA    . PHE A 1 421 ? -1.720  21.780  16.381  1.00 11.29  ? 421  PHE A CA    1 
ATOM   3271  C C     . PHE A 1 421 ? -1.799  20.396  17.010  1.00 11.42  ? 421  PHE A C     1 
ATOM   3272  O O     . PHE A 1 421 ? -0.842  19.628  16.935  1.00 11.32  ? 421  PHE A O     1 
ATOM   3273  C CB    . PHE A 1 421 ? -2.139  21.704  14.901  1.00 10.96  ? 421  PHE A CB    1 
ATOM   3274  C CG    . PHE A 1 421 ? -2.108  23.038  14.195  1.00 11.41  ? 421  PHE A CG    1 
ATOM   3275  C CD1   . PHE A 1 421 ? -1.900  23.104  12.823  1.00 11.15  ? 421  PHE A CD1   1 
ATOM   3276  C CD2   . PHE A 1 421 ? -2.269  24.226  14.909  1.00 10.29  ? 421  PHE A CD2   1 
ATOM   3277  C CE1   . PHE A 1 421 ? -1.862  24.331  12.158  1.00 12.06  ? 421  PHE A CE1   1 
ATOM   3278  C CE2   . PHE A 1 421 ? -2.226  25.453  14.249  1.00 13.05  ? 421  PHE A CE2   1 
ATOM   3279  C CZ    . PHE A 1 421 ? -2.014  25.500  12.864  1.00 10.33  ? 421  PHE A CZ    1 
ATOM   3280  N N     . MET A 1 422 ? -2.932  20.097  17.641  1.00 12.12  ? 422  MET A N     1 
ATOM   3281  C CA    . MET A 1 422 ? -3.123  18.825  18.364  1.00 12.00  ? 422  MET A CA    1 
ATOM   3282  C C     . MET A 1 422 ? -4.276  18.026  17.771  1.00 12.35  ? 422  MET A C     1 
ATOM   3283  O O     . MET A 1 422 ? -4.147  16.836  17.498  1.00 12.40  ? 422  MET A O     1 
ATOM   3284  C CB    . MET A 1 422 ? -3.361  19.075  19.863  1.00 11.80  ? 422  MET A CB    1 
ATOM   3285  C CG    . MET A 1 422 ? -2.170  19.716  20.574  1.00 11.27  ? 422  MET A CG    1 
ATOM   3286  S SD    . MET A 1 422 ? -0.711  18.621  20.587  1.00 14.44  ? 422  MET A SD    1 
ATOM   3287  C CE    . MET A 1 422 ? -1.229  17.576  21.956  1.00 9.00   ? 422  MET A CE    1 
ATOM   3288  N N     . ILE A 1 423 ? -5.407  18.695  17.565  1.00 12.46  ? 423  ILE A N     1 
ATOM   3289  C CA    . ILE A 1 423 ? -6.595  18.061  17.006  1.00 12.42  ? 423  ILE A CA    1 
ATOM   3290  C C     . ILE A 1 423 ? -7.095  19.004  15.958  1.00 12.44  ? 423  ILE A C     1 
ATOM   3291  O O     . ILE A 1 423 ? -7.381  20.163  16.256  1.00 13.56  ? 423  ILE A O     1 
ATOM   3292  C CB    . ILE A 1 423 ? -7.697  17.794  18.068  1.00 12.04  ? 423  ILE A CB    1 
ATOM   3293  C CG1   . ILE A 1 423 ? -7.186  16.812  19.128  1.00 11.50  ? 423  ILE A CG1   1 
ATOM   3294  C CG2   . ILE A 1 423 ? -8.987  17.268  17.391  1.00 13.29  ? 423  ILE A CG2   1 
ATOM   3295  C CD1   . ILE A 1 423 ? -8.139  16.612  20.288  1.00 11.97  ? 423  ILE A CD1   1 
ATOM   3296  N N     . THR A 1 424 ? -7.198  18.507  14.730  1.00 12.94  ? 424  THR A N     1 
ATOM   3297  C CA    . THR A 1 424 ? -7.378  19.372  13.573  1.00 12.73  ? 424  THR A CA    1 
ATOM   3298  C C     . THR A 1 424 ? -7.724  18.575  12.314  1.00 13.05  ? 424  THR A C     1 
ATOM   3299  O O     . THR A 1 424 ? -7.230  17.444  12.123  1.00 13.05  ? 424  THR A O     1 
ATOM   3300  C CB    . THR A 1 424 ? -6.086  20.250  13.319  1.00 12.80  ? 424  THR A CB    1 
ATOM   3301  O OG1   . THR A 1 424 ? -6.290  21.093  12.182  1.00 11.25  ? 424  THR A OG1   1 
ATOM   3302  C CG2   . THR A 1 424 ? -4.837  19.375  13.081  1.00 11.70  ? 424  THR A CG2   1 
ATOM   3303  N N     . PRO A 1 425 ? -8.542  19.173  11.422  1.00 13.09  ? 425  PRO A N     1 
ATOM   3304  C CA    . PRO A 1 425 ? -8.673  18.543  10.093  1.00 12.22  ? 425  PRO A CA    1 
ATOM   3305  C C     . PRO A 1 425 ? -7.403  18.705  9.263   1.00 11.93  ? 425  PRO A C     1 
ATOM   3306  O O     . PRO A 1 425 ? -6.586  19.597  9.517   1.00 11.13  ? 425  PRO A O     1 
ATOM   3307  C CB    . PRO A 1 425 ? -9.817  19.314  9.429   1.00 12.39  ? 425  PRO A CB    1 
ATOM   3308  C CG    . PRO A 1 425 ? -10.392 20.247  10.524  1.00 13.28  ? 425  PRO A CG    1 
ATOM   3309  C CD    . PRO A 1 425 ? -9.329  20.415  11.546  1.00 12.82  ? 425  PRO A CD    1 
ATOM   3310  N N     . LEU A 1 426 ? -7.225  17.808  8.299   1.00 11.85  ? 426  LEU A N     1 
ATOM   3311  C CA    . LEU A 1 426 ? -6.250  17.997  7.257   1.00 11.96  ? 426  LEU A CA    1 
ATOM   3312  C C     . LEU A 1 426 ? -7.122  18.131  6.030   1.00 11.59  ? 426  LEU A C     1 
ATOM   3313  O O     . LEU A 1 426 ? -7.983  17.282  5.791   1.00 11.82  ? 426  LEU A O     1 
ATOM   3314  C CB    . LEU A 1 426 ? -5.274  16.819  7.146   1.00 12.50  ? 426  LEU A CB    1 
ATOM   3315  C CG    . LEU A 1 426 ? -4.139  16.791  8.184   1.00 12.97  ? 426  LEU A CG    1 
ATOM   3316  C CD1   . LEU A 1 426 ? -4.664  16.385  9.541   1.00 13.51  ? 426  LEU A CD1   1 
ATOM   3317  C CD2   . LEU A 1 426 ? -3.005  15.857  7.781   1.00 12.31  ? 426  LEU A CD2   1 
ATOM   3318  N N     . PRO A 1 427 ? -6.937  19.226  5.280   1.00 11.11  ? 427  PRO A N     1 
ATOM   3319  C CA    . PRO A 1 427 ? -7.902  19.671  4.272   1.00 10.73  ? 427  PRO A CA    1 
ATOM   3320  C C     . PRO A 1 427 ? -8.190  18.654  3.165   1.00 11.31  ? 427  PRO A C     1 
ATOM   3321  O O     . PRO A 1 427 ? -9.326  18.598  2.686   1.00 11.02  ? 427  PRO A O     1 
ATOM   3322  C CB    . PRO A 1 427 ? -7.280  20.964  3.708   1.00 10.69  ? 427  PRO A CB    1 
ATOM   3323  C CG    . PRO A 1 427 ? -5.879  20.996  4.174   1.00 10.51  ? 427  PRO A CG    1 
ATOM   3324  C CD    . PRO A 1 427 ? -5.777  20.135  5.397   1.00 11.00  ? 427  PRO A CD    1 
ATOM   3325  N N     . GLY A 1 428 ? -7.186  17.872  2.765   1.00 11.29  ? 428  GLY A N     1 
ATOM   3326  C CA    . GLY A 1 428 ? -7.380  16.840  1.740   1.00 12.14  ? 428  GLY A CA    1 
ATOM   3327  C C     . GLY A 1 428 ? -7.595  15.438  2.291   1.00 12.47  ? 428  GLY A C     1 
ATOM   3328  O O     . GLY A 1 428 ? -7.671  14.469  1.528   1.00 12.19  ? 428  GLY A O     1 
ATOM   3329  N N     . ALA A 1 429 ? -7.689  15.312  3.610   1.00 12.16  ? 429  ALA A N     1 
ATOM   3330  C CA    . ALA A 1 429 ? -7.784  13.988  4.214   1.00 12.49  ? 429  ALA A CA    1 
ATOM   3331  C C     . ALA A 1 429 ? -9.100  13.759  4.939   1.00 12.91  ? 429  ALA A C     1 
ATOM   3332  O O     . ALA A 1 429 ? -9.653  12.661  4.882   1.00 13.59  ? 429  ALA A O     1 
ATOM   3333  C CB    . ALA A 1 429 ? -6.625  13.746  5.148   1.00 11.71  ? 429  ALA A CB    1 
ATOM   3334  N N     . ILE A 1 430 ? -9.601  14.805  5.593   1.00 13.24  ? 430  ILE A N     1 
ATOM   3335  C CA    . ILE A 1 430 ? -10.660 14.692  6.586   1.00 13.56  ? 430  ILE A CA    1 
ATOM   3336  C C     . ILE A 1 430 ? -11.857 15.547  6.182   1.00 13.65  ? 430  ILE A C     1 
ATOM   3337  O O     . ILE A 1 430 ? -11.716 16.744  5.944   1.00 14.22  ? 430  ILE A O     1 
ATOM   3338  C CB    . ILE A 1 430 ? -10.113 15.066  8.035   1.00 13.77  ? 430  ILE A CB    1 
ATOM   3339  C CG1   . ILE A 1 430 ? -9.114  13.996  8.518   1.00 13.45  ? 430  ILE A CG1   1 
ATOM   3340  C CG2   . ILE A 1 430 ? -11.251 15.238  9.068   1.00 12.96  ? 430  ILE A CG2   1 
ATOM   3341  C CD1   . ILE A 1 430 ? -8.199  14.447  9.652   1.00 13.35  ? 430  ILE A CD1   1 
ATOM   3342  N N     . GLU A 1 431 ? -13.031 14.918  6.097   1.00 13.81  ? 431  GLU A N     1 
ATOM   3343  C CA    . GLU A 1 431 ? -14.297 15.613  5.817   1.00 13.71  ? 431  GLU A CA    1 
ATOM   3344  C C     . GLU A 1 431 ? -14.718 16.404  7.024   1.00 13.13  ? 431  GLU A C     1 
ATOM   3345  O O     . GLU A 1 431 ? -14.528 15.948  8.133   1.00 13.57  ? 431  GLU A O     1 
ATOM   3346  C CB    . GLU A 1 431 ? -15.395 14.609  5.514   1.00 13.70  ? 431  GLU A CB    1 
ATOM   3347  C CG    . GLU A 1 431 ? -15.216 13.913  4.203   1.00 15.30  ? 431  GLU A CG    1 
ATOM   3348  C CD    . GLU A 1 431 ? -16.183 12.782  4.054   1.00 16.55  ? 431  GLU A CD    1 
ATOM   3349  O OE1   . GLU A 1 431 ? -16.227 11.905  4.959   1.00 18.50  ? 431  GLU A OE1   1 
ATOM   3350  O OE2   . GLU A 1 431 ? -16.898 12.787  3.039   1.00 15.22  ? 431  GLU A OE2   1 
ATOM   3351  N N     . LEU A 1 432 ? -15.317 17.569  6.816   1.00 12.85  ? 432  LEU A N     1 
ATOM   3352  C CA    . LEU A 1 432 ? -15.483 18.525  7.916   1.00 12.93  ? 432  LEU A CA    1 
ATOM   3353  C C     . LEU A 1 432 ? -16.864 18.513  8.537   1.00 12.93  ? 432  LEU A C     1 
ATOM   3354  O O     . LEU A 1 432 ? -17.858 18.351  7.840   1.00 13.37  ? 432  LEU A O     1 
ATOM   3355  C CB    . LEU A 1 432 ? -15.151 19.950  7.453   1.00 12.35  ? 432  LEU A CB    1 
ATOM   3356  C CG    . LEU A 1 432 ? -13.877 20.157  6.632   1.00 12.07  ? 432  LEU A CG    1 
ATOM   3357  C CD1   . LEU A 1 432 ? -13.773 21.590  6.097   1.00 11.24  ? 432  LEU A CD1   1 
ATOM   3358  C CD2   . LEU A 1 432 ? -12.661 19.785  7.467   1.00 11.33  ? 432  LEU A CD2   1 
ATOM   3359  N N     . LYS A 1 433 ? -16.907 18.700  9.855   1.00 12.98  ? 433  LYS A N     1 
ATOM   3360  C CA    . LYS A 1 433 ? -18.145 18.996  10.565  1.00 13.25  ? 433  LYS A CA    1 
ATOM   3361  C C     . LYS A 1 433 ? -18.044 20.388  11.189  1.00 13.37  ? 433  LYS A C     1 
ATOM   3362  O O     . LYS A 1 433 ? -17.121 20.655  11.975  1.00 13.83  ? 433  LYS A O     1 
ATOM   3363  C CB    . LYS A 1 433 ? -18.432 17.939  11.647  1.00 12.39  ? 433  LYS A CB    1 
ATOM   3364  C CG    . LYS A 1 433 ? -18.769 16.555  11.098  1.00 13.13  ? 433  LYS A CG    1 
ATOM   3365  C CD    . LYS A 1 433 ? -18.963 15.542  12.235  1.00 13.68  ? 433  LYS A CD    1 
ATOM   3366  C CE    . LYS A 1 433 ? -18.808 14.106  11.765  1.00 14.12  ? 433  LYS A CE    1 
ATOM   3367  N NZ    . LYS A 1 433 ? -19.623 13.231  12.665  1.00 14.87  ? 433  LYS A NZ    1 
ATOM   3368  N N     . ALA A 1 434 ? -18.988 21.261  10.848  1.00 13.23  ? 434  ALA A N     1 
ATOM   3369  C CA    . ALA A 1 434 ? -19.025 22.611  11.392  1.00 13.67  ? 434  ALA A CA    1 
ATOM   3370  C C     . ALA A 1 434 ? -19.022 22.610  12.926  1.00 13.71  ? 434  ALA A C     1 
ATOM   3371  O O     . ALA A 1 434 ? -19.936 22.063  13.572  1.00 13.54  ? 434  ALA A O     1 
ATOM   3372  C CB    . ALA A 1 434 ? -20.262 23.362  10.848  1.00 14.31  ? 434  ALA A CB    1 
ATOM   3373  N N     . GLY A 1 435 ? -17.986 23.208  13.511  1.00 13.77  ? 435  GLY A N     1 
ATOM   3374  C CA    . GLY A 1 435 ? -17.837 23.231  14.971  1.00 13.66  ? 435  GLY A CA    1 
ATOM   3375  C C     . GLY A 1 435 ? -16.878 22.190  15.557  1.00 13.94  ? 435  GLY A C     1 
ATOM   3376  O O     . GLY A 1 435 ? -16.494 22.287  16.734  1.00 14.14  ? 435  GLY A O     1 
ATOM   3377  N N     . SER A 1 436 ? -16.485 21.201  14.750  1.00 13.33  ? 436  SER A N     1 
ATOM   3378  C CA    . SER A 1 436 ? -15.603 20.134  15.211  1.00 12.87  ? 436  SER A CA    1 
ATOM   3379  C C     . SER A 1 436 ? -14.139 20.321  14.814  1.00 12.72  ? 436  SER A C     1 
ATOM   3380  O O     . SER A 1 436 ? -13.844 20.624  13.650  1.00 13.35  ? 436  SER A O     1 
ATOM   3381  C CB    . SER A 1 436 ? -16.061 18.777  14.669  1.00 12.91  ? 436  SER A CB    1 
ATOM   3382  O OG    . SER A 1 436 ? -15.205 17.756  15.174  1.00 12.10  ? 436  SER A OG    1 
ATOM   3383  N N     . ALA A 1 437 ? -13.223 20.074  15.751  1.00 11.30  ? 437  ALA A N     1 
ATOM   3384  C CA    . ALA A 1 437 ? -11.810 20.101  15.413  1.00 11.09  ? 437  ALA A CA    1 
ATOM   3385  C C     . ALA A 1 437 ? -11.407 18.790  14.736  1.00 10.92  ? 437  ALA A C     1 
ATOM   3386  O O     . ALA A 1 437 ? -10.307 18.690  14.195  1.00 10.66  ? 437  ALA A O     1 
ATOM   3387  C CB    . ALA A 1 437 ? -10.940 20.366  16.641  1.00 10.34  ? 437  ALA A CB    1 
ATOM   3388  N N     . THR A 1 438 ? -12.307 17.803  14.795  1.00 11.02  ? 438  THR A N     1 
ATOM   3389  C CA    . THR A 1 438 ? -12.149 16.456  14.185  1.00 11.03  ? 438  THR A CA    1 
ATOM   3390  C C     . THR A 1 438 ? -11.114 15.532  14.869  1.00 11.36  ? 438  THR A C     1 
ATOM   3391  O O     . THR A 1 438 ? -11.322 15.095  16.009  1.00 11.69  ? 438  THR A O     1 
ATOM   3392  C CB    . THR A 1 438 ? -11.888 16.517  12.644  1.00 10.23  ? 438  THR A CB    1 
ATOM   3393  O OG1   . THR A 1 438 ? -10.532 16.910  12.430  1.00 10.61  ? 438  THR A OG1   1 
ATOM   3394  C CG2   . THR A 1 438 ? -12.816 17.540  11.957  1.00 10.27  ? 438  THR A CG2   1 
ATOM   3395  N N     . ARG A 1 439 ? -10.008 15.238  14.176  1.00 11.72  ? 439  ARG A N     1 
ATOM   3396  C CA    . ARG A 1 439 ? -9.143  14.102  14.535  1.00 12.51  ? 439  ARG A CA    1 
ATOM   3397  C C     . ARG A 1 439 ? -7.772  14.532  15.056  1.00 12.81  ? 439  ARG A C     1 
ATOM   3398  O O     . ARG A 1 439 ? -7.276  15.589  14.657  1.00 13.42  ? 439  ARG A O     1 
ATOM   3399  C CB    . ARG A 1 439 ? -8.950  13.165  13.326  1.00 12.28  ? 439  ARG A CB    1 
ATOM   3400  C CG    . ARG A 1 439 ? -10.219 12.500  12.811  1.00 12.86  ? 439  ARG A CG    1 
ATOM   3401  C CD    . ARG A 1 439 ? -9.877  11.274  11.961  1.00 13.64  ? 439  ARG A CD    1 
ATOM   3402  N NE    . ARG A 1 439 ? -11.056 10.628  11.369  1.00 14.35  ? 439  ARG A NE    1 
ATOM   3403  C CZ    . ARG A 1 439 ? -11.943 9.892   12.044  1.00 14.84  ? 439  ARG A CZ    1 
ATOM   3404  N NH1   . ARG A 1 439 ? -11.818 9.696   13.359  1.00 12.50  ? 439  ARG A NH1   1 
ATOM   3405  N NH2   . ARG A 1 439 ? -12.976 9.355   11.400  1.00 15.47  ? 439  ARG A NH2   1 
ATOM   3406  N N     . PRO A 1 440 ? -7.129  13.689  15.908  1.00 13.20  ? 440  PRO A N     1 
ATOM   3407  C CA    . PRO A 1 440 ? -5.788  14.056  16.393  1.00 13.34  ? 440  PRO A CA    1 
ATOM   3408  C C     . PRO A 1 440 ? -4.772  14.140  15.266  1.00 13.93  ? 440  PRO A C     1 
ATOM   3409  O O     . PRO A 1 440 ? -4.926  13.464  14.242  1.00 13.98  ? 440  PRO A O     1 
ATOM   3410  C CB    . PRO A 1 440 ? -5.413  12.923  17.345  1.00 13.10  ? 440  PRO A CB    1 
ATOM   3411  C CG    . PRO A 1 440 ? -6.337  11.792  17.024  1.00 13.28  ? 440  PRO A CG    1 
ATOM   3412  C CD    . PRO A 1 440 ? -7.594  12.399  16.464  1.00 12.61  ? 440  PRO A CD    1 
ATOM   3413  N N     . PHE A 1 441 ? -3.750  14.968  15.464  1.00 13.97  ? 441  PHE A N     1 
ATOM   3414  C CA    . PHE A 1 441 ? -2.641  15.056  14.529  1.00 14.64  ? 441  PHE A CA    1 
ATOM   3415  C C     . PHE A 1 441 ? -1.699  13.866  14.744  1.00 15.07  ? 441  PHE A C     1 
ATOM   3416  O O     . PHE A 1 441 ? -1.808  13.163  15.752  1.00 15.39  ? 441  PHE A O     1 
ATOM   3417  C CB    . PHE A 1 441 ? -1.889  16.390  14.692  1.00 15.06  ? 441  PHE A CB    1 
ATOM   3418  C CG    . PHE A 1 441 ? -0.936  16.694  13.550  1.00 15.82  ? 441  PHE A CG    1 
ATOM   3419  C CD1   . PHE A 1 441 ? -1.420  17.057  12.305  1.00 14.70  ? 441  PHE A CD1   1 
ATOM   3420  C CD2   . PHE A 1 441 ? 0.449   16.576  13.728  1.00 15.96  ? 441  PHE A CD2   1 
ATOM   3421  C CE1   . PHE A 1 441 ? -0.531  17.325  11.242  1.00 16.63  ? 441  PHE A CE1   1 
ATOM   3422  C CE2   . PHE A 1 441 ? 1.330   16.825  12.683  1.00 16.31  ? 441  PHE A CE2   1 
ATOM   3423  C CZ    . PHE A 1 441 ? 0.847   17.203  11.441  1.00 15.27  ? 441  PHE A CZ    1 
ATOM   3424  N N     . PHE A 1 442 ? -0.802  13.619  13.790  1.00 14.97  ? 442  PHE A N     1 
ATOM   3425  C CA    . PHE A 1 442 ? 0.260   12.620  13.957  1.00 15.26  ? 442  PHE A CA    1 
ATOM   3426  C C     . PHE A 1 442 ? 1.003   12.857  15.264  1.00 15.42  ? 442  PHE A C     1 
ATOM   3427  O O     . PHE A 1 442 ? 1.386   13.995  15.551  1.00 16.11  ? 442  PHE A O     1 
ATOM   3428  C CB    . PHE A 1 442 ? 1.255   12.684  12.786  1.00 15.00  ? 442  PHE A CB    1 
ATOM   3429  C CG    . PHE A 1 442 ? 0.598   12.741  11.437  1.00 14.59  ? 442  PHE A CG    1 
ATOM   3430  C CD1   . PHE A 1 442 ? 1.069   13.615  10.464  1.00 12.43  ? 442  PHE A CD1   1 
ATOM   3431  C CD2   . PHE A 1 442 ? -0.514  11.926  11.147  1.00 14.78  ? 442  PHE A CD2   1 
ATOM   3432  C CE1   . PHE A 1 442 ? 0.458   13.679  9.218   1.00 13.94  ? 442  PHE A CE1   1 
ATOM   3433  C CE2   . PHE A 1 442 ? -1.143  11.982  9.907   1.00 13.95  ? 442  PHE A CE2   1 
ATOM   3434  C CZ    . PHE A 1 442 ? -0.656  12.857  8.930   1.00 14.35  ? 442  PHE A CZ    1 
ATOM   3435  N N     . GLY A 1 443 ? 1.166   11.789  16.054  1.00 15.29  ? 443  GLY A N     1 
ATOM   3436  C CA    . GLY A 1 443 ? 1.877   11.824  17.337  1.00 15.05  ? 443  GLY A CA    1 
ATOM   3437  C C     . GLY A 1 443 ? 1.007   12.081  18.555  1.00 15.33  ? 443  GLY A C     1 
ATOM   3438  O O     . GLY A 1 443 ? 1.468   11.945  19.689  1.00 15.69  ? 443  GLY A O     1 
ATOM   3439  N N     . VAL A 1 444 ? -0.259  12.428  18.326  1.00 15.43  ? 444  VAL A N     1 
ATOM   3440  C CA    . VAL A 1 444 ? -1.147  12.913  19.387  1.00 15.61  ? 444  VAL A CA    1 
ATOM   3441  C C     . VAL A 1 444 ? -2.163  11.854  19.809  1.00 16.08  ? 444  VAL A C     1 
ATOM   3442  O O     . VAL A 1 444 ? -2.954  11.404  19.009  1.00 16.00  ? 444  VAL A O     1 
ATOM   3443  C CB    . VAL A 1 444 ? -1.852  14.238  18.963  1.00 15.56  ? 444  VAL A CB    1 
ATOM   3444  C CG1   . VAL A 1 444 ? -2.914  14.650  19.981  1.00 15.19  ? 444  VAL A CG1   1 
ATOM   3445  C CG2   . VAL A 1 444 ? -0.808  15.343  18.742  1.00 14.32  ? 444  VAL A CG2   1 
ATOM   3446  N N     . GLN A 1 445 ? -2.110  11.460  21.076  1.00 16.79  ? 445  GLN A N     1 
ATOM   3447  C CA    . GLN A 1 445 ? -2.983  10.426  21.631  1.00 17.48  ? 445  GLN A CA    1 
ATOM   3448  C C     . GLN A 1 445 ? -3.939  11.041  22.669  1.00 16.94  ? 445  GLN A C     1 
ATOM   3449  O O     . GLN A 1 445 ? -3.628  11.078  23.877  1.00 17.05  ? 445  GLN A O     1 
ATOM   3450  C CB    . GLN A 1 445 ? -2.140  9.300   22.258  1.00 17.07  ? 445  GLN A CB    1 
ATOM   3451  C CG    . GLN A 1 445 ? -1.542  8.339   21.230  1.00 19.76  ? 445  GLN A CG    1 
ATOM   3452  C CD    . GLN A 1 445 ? -0.530  7.355   21.821  1.00 19.86  ? 445  GLN A CD    1 
ATOM   3453  O OE1   . GLN A 1 445 ? -0.901  6.385   22.477  1.00 22.51  ? 445  GLN A OE1   1 
ATOM   3454  N NE2   . GLN A 1 445 ? 0.757   7.608   21.583  1.00 22.81  ? 445  GLN A NE2   1 
ATOM   3455  N N     . PRO A 1 446 ? -5.111  11.524  22.207  1.00 16.55  ? 446  PRO A N     1 
ATOM   3456  C CA    . PRO A 1 446 ? -6.077  12.081  23.147  1.00 16.10  ? 446  PRO A CA    1 
ATOM   3457  C C     . PRO A 1 446 ? -6.921  10.996  23.824  1.00 15.86  ? 446  PRO A C     1 
ATOM   3458  O O     . PRO A 1 446 ? -7.085  9.895   23.275  1.00 15.70  ? 446  PRO A O     1 
ATOM   3459  C CB    . PRO A 1 446 ? -6.969  12.935  22.247  1.00 16.12  ? 446  PRO A CB    1 
ATOM   3460  C CG    . PRO A 1 446 ? -6.971  12.214  20.940  1.00 16.69  ? 446  PRO A CG    1 
ATOM   3461  C CD    . PRO A 1 446 ? -5.617  11.545  20.818  1.00 16.15  ? 446  PRO A CD    1 
ATOM   3462  N N     . ALA A 1 447 ? -7.458  11.311  25.003  1.00 15.16  ? 447  ALA A N     1 
ATOM   3463  C CA    . ALA A 1 447 ? -8.469  10.480  25.634  1.00 14.79  ? 447  ALA A CA    1 
ATOM   3464  C C     . ALA A 1 447 ? -9.400  11.374  26.432  1.00 15.13  ? 447  ALA A C     1 
ATOM   3465  O O     . ALA A 1 447 ? -9.059  12.522  26.743  1.00 14.75  ? 447  ALA A O     1 
ATOM   3466  C CB    . ALA A 1 447 ? -7.838  9.401   26.532  1.00 13.95  ? 447  ALA A CB    1 
ATOM   3467  N N     . LEU A 1 448 ? -10.580 10.837  26.743  1.00 15.13  ? 448  LEU A N     1 
ATOM   3468  C CA    . LEU A 1 448 ? -11.540 11.498  27.600  1.00 15.47  ? 448  LEU A CA    1 
ATOM   3469  C C     . LEU A 1 448 ? -11.687 10.692  28.877  1.00 16.17  ? 448  LEU A C     1 
ATOM   3470  O O     . LEU A 1 448 ? -11.931 9.485   28.827  1.00 16.34  ? 448  LEU A O     1 
ATOM   3471  C CB    . LEU A 1 448 ? -12.885 11.624  26.895  1.00 15.17  ? 448  LEU A CB    1 
ATOM   3472  C CG    . LEU A 1 448 ? -12.895 12.392  25.572  1.00 13.82  ? 448  LEU A CG    1 
ATOM   3473  C CD1   . LEU A 1 448 ? -14.234 12.225  24.911  1.00 14.12  ? 448  LEU A CD1   1 
ATOM   3474  C CD2   . LEU A 1 448 ? -12.542 13.879  25.747  1.00 13.24  ? 448  LEU A CD2   1 
ATOM   3475  N N     . VAL A 1 449 ? -11.510 11.360  30.013  1.00 16.48  ? 449  VAL A N     1 
ATOM   3476  C CA    . VAL A 1 449 ? -11.652 10.729  31.325  1.00 17.35  ? 449  VAL A CA    1 
ATOM   3477  C C     . VAL A 1 449 ? -12.701 11.467  32.165  1.00 17.84  ? 449  VAL A C     1 
ATOM   3478  O O     . VAL A 1 449 ? -12.924 12.677  31.983  1.00 18.49  ? 449  VAL A O     1 
ATOM   3479  C CB    . VAL A 1 449 ? -10.279 10.651  32.070  1.00 17.55  ? 449  VAL A CB    1 
ATOM   3480  C CG1   . VAL A 1 449 ? -9.247  9.888   31.223  1.00 17.29  ? 449  VAL A CG1   1 
ATOM   3481  C CG2   . VAL A 1 449 ? -9.732  12.044  32.420  1.00 17.20  ? 449  VAL A CG2   1 
ATOM   3482  N N     . ASP A 1 450 ? -13.361 10.757  33.075  1.00 18.56  ? 450  ASP A N     1 
ATOM   3483  C CA    . ASP A 1 450 ? -14.269 11.436  34.008  1.00 18.61  ? 450  ASP A CA    1 
ATOM   3484  C C     . ASP A 1 450 ? -13.486 12.123  35.125  1.00 18.64  ? 450  ASP A C     1 
ATOM   3485  O O     . ASP A 1 450 ? -12.251 12.102  35.114  1.00 17.60  ? 450  ASP A O     1 
ATOM   3486  C CB    . ASP A 1 450 ? -15.376 10.517  34.540  1.00 18.59  ? 450  ASP A CB    1 
ATOM   3487  C CG    . ASP A 1 450 ? -14.847 9.310   35.317  1.00 18.38  ? 450  ASP A CG    1 
ATOM   3488  O OD1   . ASP A 1 450 ? -13.721 9.334   35.871  1.00 16.33  ? 450  ASP A OD1   1 
ATOM   3489  O OD2   . ASP A 1 450 ? -15.608 8.323   35.372  1.00 18.37  ? 450  ASP A OD2   1 
ATOM   3490  N N     . ASN A 1 451 ? -14.207 12.729  36.070  1.00 19.19  ? 451  ASN A N     1 
ATOM   3491  C CA    . ASN A 1 451 ? -13.586 13.515  37.135  1.00 20.38  ? 451  ASN A CA    1 
ATOM   3492  C C     . ASN A 1 451 ? -12.710 12.672  38.064  1.00 20.59  ? 451  ASN A C     1 
ATOM   3493  O O     . ASN A 1 451 ? -11.892 13.205  38.810  1.00 20.34  ? 451  ASN A O     1 
ATOM   3494  C CB    . ASN A 1 451 ? -14.653 14.287  37.935  1.00 20.54  ? 451  ASN A CB    1 
ATOM   3495  C CG    . ASN A 1 451 ? -15.204 15.511  37.176  1.00 21.90  ? 451  ASN A CG    1 
ATOM   3496  O OD1   . ASN A 1 451 ? -14.607 15.991  36.193  1.00 22.09  ? 451  ASN A OD1   1 
ATOM   3497  N ND2   . ASN A 1 451 ? -16.341 16.026  37.647  1.00 20.96  ? 451  ASN A ND2   1 
ATOM   3498  N N     . GLU A 1 452 ? -12.890 11.357  37.989  1.00 21.20  ? 452  GLU A N     1 
ATOM   3499  C CA    . GLU A 1 452 ? -12.156 10.401  38.815  1.00 22.61  ? 452  GLU A CA    1 
ATOM   3500  C C     . GLU A 1 452 ? -11.008 9.793   37.998  1.00 22.63  ? 452  GLU A C     1 
ATOM   3501  O O     . GLU A 1 452 ? -10.162 9.072   38.523  1.00 22.32  ? 452  GLU A O     1 
ATOM   3502  C CB    . GLU A 1 452 ? -13.111 9.317   39.360  1.00 22.57  ? 452  GLU A CB    1 
ATOM   3503  C CG    . GLU A 1 452 ? -14.157 9.820   40.396  1.00 24.64  ? 452  GLU A CG    1 
ATOM   3504  C CD    . GLU A 1 452 ? -15.243 10.756  39.824  1.00 29.27  ? 452  GLU A CD    1 
ATOM   3505  O OE1   . GLU A 1 452 ? -15.755 10.525  38.697  1.00 29.81  ? 452  GLU A OE1   1 
ATOM   3506  O OE2   . GLU A 1 452 ? -15.608 11.733  40.524  1.00 31.46  ? 452  GLU A OE2   1 
ATOM   3507  N N     . GLY A 1 453 ? -10.983 10.102  36.705  1.00 22.92  ? 453  GLY A N     1 
ATOM   3508  C CA    . GLY A 1 453 ? -9.899  9.654   35.836  1.00 23.43  ? 453  GLY A CA    1 
ATOM   3509  C C     . GLY A 1 453 ? -10.087 8.312   35.146  1.00 23.69  ? 453  GLY A C     1 
ATOM   3510  O O     . GLY A 1 453 ? -9.134  7.780   34.586  1.00 23.64  ? 453  GLY A O     1 
ATOM   3511  N N     . HIS A 1 454 ? -11.303 7.767   35.179  1.00 24.08  ? 454  HIS A N     1 
ATOM   3512  C CA    . HIS A 1 454 ? -11.647 6.582   34.387  1.00 24.49  ? 454  HIS A CA    1 
ATOM   3513  C C     . HIS A 1 454 ? -11.832 6.982   32.934  1.00 24.46  ? 454  HIS A C     1 
ATOM   3514  O O     . HIS A 1 454 ? -12.674 7.830   32.647  1.00 24.25  ? 454  HIS A O     1 
ATOM   3515  C CB    . HIS A 1 454 ? -12.977 5.979   34.827  1.00 24.73  ? 454  HIS A CB    1 
ATOM   3516  C CG    . HIS A 1 454 ? -13.125 5.813   36.305  1.00 26.83  ? 454  HIS A CG    1 
ATOM   3517  N ND1   . HIS A 1 454 ? -14.222 6.284   36.997  1.00 27.94  ? 454  HIS A ND1   1 
ATOM   3518  C CD2   . HIS A 1 454 ? -12.329 5.210   37.220  1.00 27.08  ? 454  HIS A CD2   1 
ATOM   3519  C CE1   . HIS A 1 454 ? -14.097 5.976   38.275  1.00 28.58  ? 454  HIS A CE1   1 
ATOM   3520  N NE2   . HIS A 1 454 ? -12.954 5.330   38.437  1.00 29.73  ? 454  HIS A NE2   1 
ATOM   3521  N N     . PRO A 1 455 ? -11.082 6.345   32.011  1.00 24.64  ? 455  PRO A N     1 
ATOM   3522  C CA    . PRO A 1 455 ? -11.187 6.639   30.573  1.00 24.47  ? 455  PRO A CA    1 
ATOM   3523  C C     . PRO A 1 455 ? -12.563 6.282   30.027  1.00 24.39  ? 455  PRO A C     1 
ATOM   3524  O O     . PRO A 1 455 ? -13.114 5.238   30.372  1.00 24.63  ? 455  PRO A O     1 
ATOM   3525  C CB    . PRO A 1 455 ? -10.116 5.735   29.941  1.00 24.60  ? 455  PRO A CB    1 
ATOM   3526  C CG    . PRO A 1 455 ? -9.165  5.398   31.090  1.00 24.84  ? 455  PRO A CG    1 
ATOM   3527  C CD    . PRO A 1 455 ? -10.076 5.298   32.282  1.00 24.63  ? 455  PRO A CD    1 
ATOM   3528  N N     . GLN A 1 456 ? -13.105 7.161   29.190  1.00 24.03  ? 456  GLN A N     1 
ATOM   3529  C CA    . GLN A 1 456 ? -14.433 6.999   28.606  1.00 23.94  ? 456  GLN A CA    1 
ATOM   3530  C C     . GLN A 1 456 ? -14.301 6.621   27.124  1.00 23.98  ? 456  GLN A C     1 
ATOM   3531  O O     . GLN A 1 456 ? -13.654 7.332   26.342  1.00 23.86  ? 456  GLN A O     1 
ATOM   3532  C CB    . GLN A 1 456 ? -15.237 8.299   28.756  1.00 23.92  ? 456  GLN A CB    1 
ATOM   3533  C CG    . GLN A 1 456 ? -15.362 8.854   30.191  1.00 24.18  ? 456  GLN A CG    1 
ATOM   3534  C CD    . GLN A 1 456 ? -16.069 7.894   31.146  1.00 25.02  ? 456  GLN A CD    1 
ATOM   3535  O OE1   . GLN A 1 456 ? -15.476 7.400   32.112  1.00 24.99  ? 456  GLN A OE1   1 
ATOM   3536  N NE2   . GLN A 1 456 ? -17.341 7.627   30.876  1.00 25.75  ? 456  GLN A NE2   1 
ATOM   3537  N N     . GLU A 1 457 ? -14.896 5.493   26.745  1.00 23.70  ? 457  GLU A N     1 
ATOM   3538  C CA    . GLU A 1 457 ? -14.747 4.969   25.383  1.00 23.44  ? 457  GLU A CA    1 
ATOM   3539  C C     . GLU A 1 457 ? -16.021 5.190   24.577  1.00 22.24  ? 457  GLU A C     1 
ATOM   3540  O O     . GLU A 1 457 ? -17.096 5.366   25.141  1.00 21.83  ? 457  GLU A O     1 
ATOM   3541  C CB    . GLU A 1 457 ? -14.382 3.474   25.388  1.00 23.83  ? 457  GLU A CB    1 
ATOM   3542  C CG    . GLU A 1 457 ? -13.552 3.002   26.588  1.00 26.39  ? 457  GLU A CG    1 
ATOM   3543  C CD    . GLU A 1 457 ? -12.033 3.131   26.411  1.00 29.80  ? 457  GLU A CD    1 
ATOM   3544  O OE1   . GLU A 1 457 ? -11.552 4.031   25.672  1.00 28.53  ? 457  GLU A OE1   1 
ATOM   3545  O OE2   . GLU A 1 457 ? -11.315 2.316   27.052  1.00 32.45  ? 457  GLU A OE2   1 
ATOM   3546  N N     . GLY A 1 458 ? -15.890 5.169   23.256  1.00 21.24  ? 458  GLY A N     1 
ATOM   3547  C CA    . GLY A 1 458 ? -17.026 5.381   22.372  1.00 20.37  ? 458  GLY A CA    1 
ATOM   3548  C C     . GLY A 1 458 ? -17.407 6.846   22.301  1.00 19.83  ? 458  GLY A C     1 
ATOM   3549  O O     . GLY A 1 458 ? -16.611 7.722   22.659  1.00 19.57  ? 458  GLY A O     1 
ATOM   3550  N N     . ALA A 1 459 ? -18.622 7.105   21.824  1.00 19.22  ? 459  ALA A N     1 
ATOM   3551  C CA    . ALA A 1 459 ? -19.170 8.443   21.795  1.00 18.94  ? 459  ALA A CA    1 
ATOM   3552  C C     . ALA A 1 459 ? -19.489 8.839   23.228  1.00 19.03  ? 459  ALA A C     1 
ATOM   3553  O O     . ALA A 1 459 ? -20.336 8.235   23.891  1.00 19.22  ? 459  ALA A O     1 
ATOM   3554  C CB    . ALA A 1 459 ? -20.412 8.512   20.914  1.00 18.97  ? 459  ALA A CB    1 
ATOM   3555  N N     . THR A 1 460 ? -18.781 9.844   23.713  1.00 18.85  ? 460  THR A N     1 
ATOM   3556  C CA    . THR A 1 460 ? -18.865 10.205  25.117  1.00 18.72  ? 460  THR A CA    1 
ATOM   3557  C C     . THR A 1 460 ? -18.325 11.610  25.332  1.00 18.82  ? 460  THR A C     1 
ATOM   3558  O O     . THR A 1 460 ? -17.961 12.283  24.374  1.00 18.39  ? 460  THR A O     1 
ATOM   3559  C CB    . THR A 1 460 ? -18.154 9.131   26.015  1.00 18.81  ? 460  THR A CB    1 
ATOM   3560  O OG1   . THR A 1 460 ? -18.468 9.358   27.394  1.00 18.53  ? 460  THR A OG1   1 
ATOM   3561  C CG2   . THR A 1 460 ? -16.640 9.111   25.798  1.00 17.49  ? 460  THR A CG2   1 
ATOM   3562  N N     . GLU A 1 461 ? -18.314 12.069  26.581  1.00 19.23  ? 461  GLU A N     1 
ATOM   3563  C CA    . GLU A 1 461 ? -17.657 13.324  26.923  1.00 20.04  ? 461  GLU A CA    1 
ATOM   3564  C C     . GLU A 1 461 ? -16.899 13.214  28.238  1.00 19.00  ? 461  GLU A C     1 
ATOM   3565  O O     . GLU A 1 461 ? -17.212 12.368  29.093  1.00 19.09  ? 461  GLU A O     1 
ATOM   3566  C CB    . GLU A 1 461 ? -18.636 14.507  26.911  1.00 19.74  ? 461  GLU A CB    1 
ATOM   3567  C CG    . GLU A 1 461 ? -19.810 14.397  27.867  1.00 22.81  ? 461  GLU A CG    1 
ATOM   3568  C CD    . GLU A 1 461 ? -20.941 15.405  27.568  1.00 23.92  ? 461  GLU A CD    1 
ATOM   3569  O OE1   . GLU A 1 461 ? -20.816 16.247  26.633  1.00 29.23  ? 461  GLU A OE1   1 
ATOM   3570  O OE2   . GLU A 1 461 ? -21.975 15.346  28.281  1.00 28.98  ? 461  GLU A OE2   1 
ATOM   3571  N N     . GLY A 1 462 ? -15.875 14.043  28.381  1.00 18.31  ? 462  GLY A N     1 
ATOM   3572  C CA    . GLY A 1 462 ? -15.113 14.096  29.619  1.00 17.38  ? 462  GLY A CA    1 
ATOM   3573  C C     . GLY A 1 462 ? -13.983 15.097  29.546  1.00 17.09  ? 462  GLY A C     1 
ATOM   3574  O O     . GLY A 1 462 ? -13.942 15.956  28.657  1.00 16.94  ? 462  GLY A O     1 
ATOM   3575  N N     . ASN A 1 463 ? -13.065 14.972  30.497  1.00 16.77  ? 463  ASN A N     1 
ATOM   3576  C CA    . ASN A 1 463 ? -11.876 15.796  30.570  1.00 16.11  ? 463  ASN A CA    1 
ATOM   3577  C C     . ASN A 1 463 ? -10.898 15.366  29.498  1.00 15.48  ? 463  ASN A C     1 
ATOM   3578  O O     . ASN A 1 463 ? -10.601 14.192  29.349  1.00 15.55  ? 463  ASN A O     1 
ATOM   3579  C CB    . ASN A 1 463 ? -11.271 15.682  31.970  1.00 16.27  ? 463  ASN A CB    1 
ATOM   3580  C CG    . ASN A 1 463 ? -12.257 16.081  33.051  1.00 16.73  ? 463  ASN A CG    1 
ATOM   3581  O OD1   . ASN A 1 463 ? -12.692 17.228  33.102  1.00 18.18  ? 463  ASN A OD1   1 
ATOM   3582  N ND2   . ASN A 1 463 ? -12.633 15.131  33.910  1.00 17.29  ? 463  ASN A ND2   1 
ATOM   3583  N N     . LEU A 1 464 ? -10.415 16.323  28.717  1.00 15.36  ? 464  LEU A N     1 
ATOM   3584  C CA    . LEU A 1 464 ? -9.537  16.003  27.611  1.00 14.00  ? 464  LEU A CA    1 
ATOM   3585  C C     . LEU A 1 464 ? -8.105  15.864  28.106  1.00 14.14  ? 464  LEU A C     1 
ATOM   3586  O O     . LEU A 1 464 ? -7.547  16.824  28.631  1.00 14.11  ? 464  LEU A O     1 
ATOM   3587  C CB    . LEU A 1 464 ? -9.638  17.097  26.549  1.00 14.17  ? 464  LEU A CB    1 
ATOM   3588  C CG    . LEU A 1 464 ? -8.775  17.039  25.288  1.00 13.14  ? 464  LEU A CG    1 
ATOM   3589  C CD1   . LEU A 1 464 ? -8.804  15.654  24.632  1.00 11.02  ? 464  LEU A CD1   1 
ATOM   3590  C CD2   . LEU A 1 464 ? -9.244  18.145  24.316  1.00 12.89  ? 464  LEU A CD2   1 
ATOM   3591  N N     . VAL A 1 465 ? -7.530  14.667  27.946  1.00 14.17  ? 465  VAL A N     1 
ATOM   3592  C CA    . VAL A 1 465 ? -6.132  14.391  28.307  1.00 13.91  ? 465  VAL A CA    1 
ATOM   3593  C C     . VAL A 1 465 ? -5.330  13.936  27.086  1.00 14.48  ? 465  VAL A C     1 
ATOM   3594  O O     . VAL A 1 465 ? -5.901  13.484  26.081  1.00 14.15  ? 465  VAL A O     1 
ATOM   3595  C CB    . VAL A 1 465 ? -5.983  13.328  29.445  1.00 14.48  ? 465  VAL A CB    1 
ATOM   3596  C CG1   . VAL A 1 465 ? -6.444  13.894  30.789  1.00 14.32  ? 465  VAL A CG1   1 
ATOM   3597  C CG2   . VAL A 1 465 ? -6.708  12.006  29.105  1.00 13.96  ? 465  VAL A CG2   1 
ATOM   3598  N N     . ILE A 1 466 ? -4.009  14.092  27.157  1.00 13.94  ? 466  ILE A N     1 
ATOM   3599  C CA    . ILE A 1 466 ? -3.132  13.522  26.154  1.00 14.24  ? 466  ILE A CA    1 
ATOM   3600  C C     . ILE A 1 466 ? -2.202  12.553  26.868  1.00 14.72  ? 466  ILE A C     1 
ATOM   3601  O O     . ILE A 1 466 ? -1.563  12.914  27.869  1.00 14.76  ? 466  ILE A O     1 
ATOM   3602  C CB    . ILE A 1 466 ? -2.344  14.593  25.344  1.00 14.21  ? 466  ILE A CB    1 
ATOM   3603  C CG1   . ILE A 1 466 ? -3.254  15.760  24.906  1.00 13.63  ? 466  ILE A CG1   1 
ATOM   3604  C CG2   . ILE A 1 466 ? -1.632  13.925  24.148  1.00 13.54  ? 466  ILE A CG2   1 
ATOM   3605  C CD1   . ILE A 1 466 ? -4.472  15.395  23.993  1.00 14.62  ? 466  ILE A CD1   1 
ATOM   3606  N N     . THR A 1 467 ? -2.151  11.324  26.359  1.00 15.07  ? 467  THR A N     1 
ATOM   3607  C CA    . THR A 1 467 ? -1.633  10.168  27.112  1.00 15.77  ? 467  THR A CA    1 
ATOM   3608  C C     . THR A 1 467 ? -0.176  9.822   26.805  1.00 15.61  ? 467  THR A C     1 
ATOM   3609  O O     . THR A 1 467 ? 0.371   8.867   27.370  1.00 15.72  ? 467  THR A O     1 
ATOM   3610  C CB    . THR A 1 467 ? -2.482  8.900   26.856  1.00 15.75  ? 467  THR A CB    1 
ATOM   3611  O OG1   . THR A 1 467 ? -2.418  8.557   25.468  1.00 17.56  ? 467  THR A OG1   1 
ATOM   3612  C CG2   . THR A 1 467 ? -3.934  9.124   27.236  1.00 17.24  ? 467  THR A CG2   1 
ATOM   3613  N N     . ASP A 1 468 ? 0.442   10.590  25.915  1.00 15.62  ? 468  ASP A N     1 
ATOM   3614  C CA    . ASP A 1 468 ? 1.866   10.452  25.578  1.00 15.89  ? 468  ASP A CA    1 
ATOM   3615  C C     . ASP A 1 468 ? 2.360   11.772  24.988  1.00 15.92  ? 468  ASP A C     1 
ATOM   3616  O O     . ASP A 1 468 ? 1.556   12.654  24.654  1.00 15.52  ? 468  ASP A O     1 
ATOM   3617  C CB    . ASP A 1 468 ? 2.084   9.322   24.565  1.00 15.90  ? 468  ASP A CB    1 
ATOM   3618  C CG    . ASP A 1 468 ? 3.444   8.651   24.705  1.00 18.17  ? 468  ASP A CG    1 
ATOM   3619  O OD1   . ASP A 1 468 ? 4.368   9.242   25.322  1.00 21.23  ? 468  ASP A OD1   1 
ATOM   3620  O OD2   . ASP A 1 468 ? 3.595   7.517   24.196  1.00 19.76  ? 468  ASP A OD2   1 
ATOM   3621  N N     . SER A 1 469 ? 3.678   11.895  24.851  1.00 15.64  ? 469  SER A N     1 
ATOM   3622  C CA    . SER A 1 469 ? 4.295   13.120  24.359  1.00 15.17  ? 469  SER A CA    1 
ATOM   3623  C C     . SER A 1 469 ? 4.258   13.220  22.833  1.00 15.28  ? 469  SER A C     1 
ATOM   3624  O O     . SER A 1 469 ? 3.920   12.258  22.141  1.00 15.28  ? 469  SER A O     1 
ATOM   3625  C CB    . SER A 1 469 ? 5.739   13.203  24.858  1.00 15.35  ? 469  SER A CB    1 
ATOM   3626  O OG    . SER A 1 469 ? 6.227   14.532  24.826  1.00 14.82  ? 469  SER A OG    1 
ATOM   3627  N N     . TRP A 1 470 ? 4.584   14.411  22.336  1.00 14.83  ? 470  TRP A N     1 
ATOM   3628  C CA    . TRP A 1 470 ? 4.651   14.737  20.920  1.00 14.50  ? 470  TRP A CA    1 
ATOM   3629  C C     . TRP A 1 470 ? 5.780   15.794  20.843  1.00 14.82  ? 470  TRP A C     1 
ATOM   3630  O O     . TRP A 1 470 ? 6.039   16.481  21.833  1.00 15.22  ? 470  TRP A O     1 
ATOM   3631  C CB    . TRP A 1 470 ? 3.289   15.281  20.436  1.00 14.13  ? 470  TRP A CB    1 
ATOM   3632  C CG    . TRP A 1 470 ? 2.861   16.527  21.186  1.00 14.26  ? 470  TRP A CG    1 
ATOM   3633  C CD1   . TRP A 1 470 ? 3.034   17.829  20.789  1.00 13.42  ? 470  TRP A CD1   1 
ATOM   3634  C CD2   . TRP A 1 470 ? 2.245   16.584  22.485  1.00 14.50  ? 470  TRP A CD2   1 
ATOM   3635  N NE1   . TRP A 1 470 ? 2.546   18.690  21.753  1.00 12.84  ? 470  TRP A NE1   1 
ATOM   3636  C CE2   . TRP A 1 470 ? 2.064   17.952  22.805  1.00 13.58  ? 470  TRP A CE2   1 
ATOM   3637  C CE3   . TRP A 1 470 ? 1.817   15.610  23.404  1.00 14.06  ? 470  TRP A CE3   1 
ATOM   3638  C CZ2   . TRP A 1 470 ? 1.484   18.366  24.003  1.00 14.35  ? 470  TRP A CZ2   1 
ATOM   3639  C CZ3   . TRP A 1 470 ? 1.245   16.021  24.590  1.00 12.72  ? 470  TRP A CZ3   1 
ATOM   3640  C CH2   . TRP A 1 470 ? 1.073   17.391  24.879  1.00 14.84  ? 470  TRP A CH2   1 
ATOM   3641  N N     . PRO A 1 471 ? 6.487   15.899  19.699  1.00 15.25  ? 471  PRO A N     1 
ATOM   3642  C CA    . PRO A 1 471 ? 7.670   16.769  19.610  1.00 15.43  ? 471  PRO A CA    1 
ATOM   3643  C C     . PRO A 1 471 ? 7.509   18.216  20.097  1.00 15.78  ? 471  PRO A C     1 
ATOM   3644  O O     . PRO A 1 471 ? 8.470   18.788  20.629  1.00 16.24  ? 471  PRO A O     1 
ATOM   3645  C CB    . PRO A 1 471 ? 8.000   16.736  18.113  1.00 15.69  ? 471  PRO A CB    1 
ATOM   3646  C CG    . PRO A 1 471 ? 7.560   15.350  17.705  1.00 15.34  ? 471  PRO A CG    1 
ATOM   3647  C CD    . PRO A 1 471 ? 6.264   15.175  18.430  1.00 15.31  ? 471  PRO A CD    1 
ATOM   3648  N N     . GLY A 1 472 ? 6.321   18.794  19.935  1.00 15.18  ? 472  GLY A N     1 
ATOM   3649  C CA    . GLY A 1 472 ? 6.120   20.210  20.230  1.00 15.03  ? 472  GLY A CA    1 
ATOM   3650  C C     . GLY A 1 472 ? 5.759   20.571  21.659  1.00 14.78  ? 472  GLY A C     1 
ATOM   3651  O O     . GLY A 1 472 ? 5.553   21.745  21.963  1.00 15.65  ? 472  GLY A O     1 
ATOM   3652  N N     . GLN A 1 473 ? 5.710   19.579  22.541  1.00 14.06  ? 473  GLN A N     1 
ATOM   3653  C CA    . GLN A 1 473 ? 5.226   19.770  23.897  1.00 13.65  ? 473  GLN A CA    1 
ATOM   3654  C C     . GLN A 1 473 ? 6.115   20.696  24.720  1.00 13.83  ? 473  GLN A C     1 
ATOM   3655  O O     . GLN A 1 473 ? 7.337   20.559  24.718  1.00 13.70  ? 473  GLN A O     1 
ATOM   3656  C CB    . GLN A 1 473 ? 5.100   18.412  24.601  1.00 13.46  ? 473  GLN A CB    1 
ATOM   3657  C CG    . GLN A 1 473 ? 4.437   18.506  25.974  1.00 12.97  ? 473  GLN A CG    1 
ATOM   3658  C CD    . GLN A 1 473 ? 4.177   17.170  26.617  1.00 12.98  ? 473  GLN A CD    1 
ATOM   3659  O OE1   . GLN A 1 473 ? 4.578   16.113  26.103  1.00 11.79  ? 473  GLN A OE1   1 
ATOM   3660  N NE2   . GLN A 1 473 ? 3.510   17.202  27.759  1.00 9.36   ? 473  GLN A NE2   1 
ATOM   3661  N N     . ALA A 1 474 ? 5.494   21.629  25.444  1.00 13.92  ? 474  ALA A N     1 
ATOM   3662  C CA    . ALA A 1 474 ? 6.231   22.449  26.411  1.00 13.52  ? 474  ALA A CA    1 
ATOM   3663  C C     . ALA A 1 474 ? 6.962   21.545  27.401  1.00 13.72  ? 474  ALA A C     1 
ATOM   3664  O O     . ALA A 1 474 ? 6.428   20.500  27.827  1.00 13.35  ? 474  ALA A O     1 
ATOM   3665  C CB    . ALA A 1 474 ? 5.311   23.409  27.132  1.00 13.43  ? 474  ALA A CB    1 
ATOM   3666  N N     . ARG A 1 475 ? 8.178   21.961  27.760  1.00 13.76  ? 475  ARG A N     1 
ATOM   3667  C CA    . ARG A 1 475 ? 9.104   21.126  28.533  1.00 13.63  ? 475  ARG A CA    1 
ATOM   3668  C C     . ARG A 1 475 ? 9.069   21.412  30.027  1.00 13.97  ? 475  ARG A C     1 
ATOM   3669  O O     . ARG A 1 475 ? 9.413   20.546  30.832  1.00 14.10  ? 475  ARG A O     1 
ATOM   3670  C CB    . ARG A 1 475 ? 10.544  21.298  28.024  1.00 13.80  ? 475  ARG A CB    1 
ATOM   3671  C CG    . ARG A 1 475 ? 10.763  20.965  26.551  1.00 12.34  ? 475  ARG A CG    1 
ATOM   3672  C CD    . ARG A 1 475 ? 10.318  19.577  26.191  1.00 12.11  ? 475  ARG A CD    1 
ATOM   3673  N NE    . ARG A 1 475 ? 11.065  19.062  25.046  1.00 13.80  ? 475  ARG A NE    1 
ATOM   3674  C CZ    . ARG A 1 475 ? 10.593  18.905  23.803  1.00 14.71  ? 475  ARG A CZ    1 
ATOM   3675  N NH1   . ARG A 1 475 ? 9.326   19.187  23.489  1.00 12.30  ? 475  ARG A NH1   1 
ATOM   3676  N NH2   . ARG A 1 475 ? 11.408  18.441  22.865  1.00 14.31  ? 475  ARG A NH2   1 
ATOM   3677  N N     . THR A 1 476 ? 8.656   22.627  30.391  1.00 13.74  ? 476  THR A N     1 
ATOM   3678  C CA    . THR A 1 476 ? 8.653   23.052  31.784  1.00 13.77  ? 476  THR A CA    1 
ATOM   3679  C C     . THR A 1 476 ? 7.918   24.395  31.967  1.00 13.83  ? 476  THR A C     1 
ATOM   3680  O O     . THR A 1 476 ? 7.473   25.008  30.992  1.00 13.61  ? 476  THR A O     1 
ATOM   3681  C CB    . THR A 1 476 ? 10.124  23.111  32.351  1.00 14.22  ? 476  THR A CB    1 
ATOM   3682  O OG1   . THR A 1 476 ? 10.092  23.213  33.773  1.00 12.72  ? 476  THR A OG1   1 
ATOM   3683  C CG2   . THR A 1 476 ? 10.928  24.275  31.754  1.00 13.05  ? 476  THR A CG2   1 
ATOM   3684  N N     . LEU A 1 477 ? 7.774   24.817  33.222  1.00 14.48  ? 477  LEU A N     1 
ATOM   3685  C CA    . LEU A 1 477 ? 7.465   26.206  33.561  1.00 14.45  ? 477  LEU A CA    1 
ATOM   3686  C C     . LEU A 1 477 ? 8.757   26.839  34.025  1.00 15.09  ? 477  LEU A C     1 
ATOM   3687  O O     . LEU A 1 477 ? 9.464   26.294  34.890  1.00 15.61  ? 477  LEU A O     1 
ATOM   3688  C CB    . LEU A 1 477 ? 6.409   26.290  34.663  1.00 14.19  ? 477  LEU A CB    1 
ATOM   3689  C CG    . LEU A 1 477 ? 5.082   25.612  34.311  1.00 13.80  ? 477  LEU A CG    1 
ATOM   3690  C CD1   . LEU A 1 477 ? 4.165   25.537  35.522  1.00 11.28  ? 477  LEU A CD1   1 
ATOM   3691  C CD2   . LEU A 1 477 ? 4.400   26.318  33.105  1.00 10.38  ? 477  LEU A CD2   1 
ATOM   3692  N N     . PHE A 1 478 ? 9.077   27.988  33.448  1.00 15.61  ? 478  PHE A N     1 
ATOM   3693  C CA    . PHE A 1 478 ? 10.331  28.649  33.745  1.00 15.74  ? 478  PHE A CA    1 
ATOM   3694  C C     . PHE A 1 478 ? 10.629  28.686  35.242  1.00 15.85  ? 478  PHE A C     1 
ATOM   3695  O O     . PHE A 1 478 ? 9.864   29.253  36.032  1.00 15.43  ? 478  PHE A O     1 
ATOM   3696  C CB    . PHE A 1 478 ? 10.350  30.060  33.172  1.00 16.35  ? 478  PHE A CB    1 
ATOM   3697  C CG    . PHE A 1 478 ? 11.640  30.776  33.409  1.00 16.98  ? 478  PHE A CG    1 
ATOM   3698  C CD1   . PHE A 1 478 ? 12.771  30.454  32.673  1.00 17.67  ? 478  PHE A CD1   1 
ATOM   3699  C CD2   . PHE A 1 478 ? 11.737  31.751  34.398  1.00 18.80  ? 478  PHE A CD2   1 
ATOM   3700  C CE1   . PHE A 1 478 ? 13.977  31.108  32.907  1.00 17.96  ? 478  PHE A CE1   1 
ATOM   3701  C CE2   . PHE A 1 478 ? 12.941  32.407  34.626  1.00 19.09  ? 478  PHE A CE2   1 
ATOM   3702  C CZ    . PHE A 1 478 ? 14.052  32.081  33.881  1.00 17.59  ? 478  PHE A CZ    1 
ATOM   3703  N N     . GLY A 1 479 ? 11.759  28.081  35.612  1.00 15.66  ? 479  GLY A N     1 
ATOM   3704  C CA    . GLY A 1 479 ? 12.249  28.107  36.976  1.00 15.67  ? 479  GLY A CA    1 
ATOM   3705  C C     . GLY A 1 479 ? 11.436  27.268  37.949  1.00 16.11  ? 479  GLY A C     1 
ATOM   3706  O O     . GLY A 1 479 ? 11.668  27.355  39.150  1.00 16.72  ? 479  GLY A O     1 
ATOM   3707  N N     . ASP A 1 480 ? 10.476  26.476  37.454  1.00 15.94  ? 480  ASP A N     1 
ATOM   3708  C CA    . ASP A 1 480 ? 9.587   25.709  38.342  1.00 15.86  ? 480  ASP A CA    1 
ATOM   3709  C C     . ASP A 1 480 ? 9.018   24.429  37.724  1.00 15.63  ? 480  ASP A C     1 
ATOM   3710  O O     . ASP A 1 480 ? 7.822   24.332  37.456  1.00 14.89  ? 480  ASP A O     1 
ATOM   3711  C CB    . ASP A 1 480 ? 8.445   26.595  38.866  1.00 15.90  ? 480  ASP A CB    1 
ATOM   3712  C CG    . ASP A 1 480 ? 7.890   26.116  40.197  1.00 15.94  ? 480  ASP A CG    1 
ATOM   3713  O OD1   . ASP A 1 480 ? 8.091   24.925  40.547  1.00 16.77  ? 480  ASP A OD1   1 
ATOM   3714  O OD2   . ASP A 1 480 ? 7.241   26.937  40.897  1.00 14.86  ? 480  ASP A OD2   1 
ATOM   3715  N N     . HIS A 1 481 ? 9.894   23.447  37.532  1.00 16.09  ? 481  HIS A N     1 
ATOM   3716  C CA    . HIS A 1 481 ? 9.521   22.137  37.015  1.00 16.37  ? 481  HIS A CA    1 
ATOM   3717  C C     . HIS A 1 481 ? 8.571   21.367  37.911  1.00 16.84  ? 481  HIS A C     1 
ATOM   3718  O O     . HIS A 1 481 ? 7.785   20.550  37.417  1.00 17.15  ? 481  HIS A O     1 
ATOM   3719  C CB    . HIS A 1 481 ? 10.751  21.270  36.774  1.00 16.26  ? 481  HIS A CB    1 
ATOM   3720  C CG    . HIS A 1 481 ? 10.474  20.094  35.890  1.00 16.67  ? 481  HIS A CG    1 
ATOM   3721  N ND1   . HIS A 1 481 ? 10.322  20.213  34.525  1.00 16.33  ? 481  HIS A ND1   1 
ATOM   3722  C CD2   . HIS A 1 481 ? 10.291  18.783  36.178  1.00 17.01  ? 481  HIS A CD2   1 
ATOM   3723  C CE1   . HIS A 1 481 ? 10.084  19.021  34.008  1.00 16.98  ? 481  HIS A CE1   1 
ATOM   3724  N NE2   . HIS A 1 481 ? 10.064  18.135  34.989  1.00 17.92  ? 481  HIS A NE2   1 
ATOM   3725  N N     . GLU A 1 482 ? 8.650   21.604  39.217  1.00 16.98  ? 482  GLU A N     1 
ATOM   3726  C CA    . GLU A 1 482 ? 7.738   20.949  40.157  1.00 17.85  ? 482  GLU A CA    1 
ATOM   3727  C C     . GLU A 1 482 ? 6.295   21.426  39.989  1.00 17.55  ? 482  GLU A C     1 
ATOM   3728  O O     . GLU A 1 482 ? 5.369   20.635  40.097  1.00 17.76  ? 482  GLU A O     1 
ATOM   3729  C CB    . GLU A 1 482 ? 8.219   21.126  41.603  1.00 17.71  ? 482  GLU A CB    1 
ATOM   3730  C CG    . GLU A 1 482 ? 9.518   20.352  41.911  1.00 19.05  ? 482  GLU A CG    1 
ATOM   3731  C CD    . GLU A 1 482 ? 9.900   20.401  43.369  1.00 19.33  ? 482  GLU A CD    1 
ATOM   3732  O OE1   . GLU A 1 482 ? 8.993   20.370  44.232  1.00 20.22  ? 482  GLU A OE1   1 
ATOM   3733  O OE2   . GLU A 1 482 ? 11.117  20.470  43.660  1.00 22.97  ? 482  GLU A OE2   1 
ATOM   3734  N N     . ARG A 1 483 ? 6.114   22.715  39.711  1.00 17.71  ? 483  ARG A N     1 
ATOM   3735  C CA    . ARG A 1 483 ? 4.792   23.288  39.466  1.00 17.65  ? 483  ARG A CA    1 
ATOM   3736  C C     . ARG A 1 483 ? 4.278   22.844  38.102  1.00 17.52  ? 483  ARG A C     1 
ATOM   3737  O O     . ARG A 1 483 ? 3.071   22.699  37.914  1.00 18.02  ? 483  ARG A O     1 
ATOM   3738  C CB    . ARG A 1 483 ? 4.847   24.815  39.569  1.00 18.09  ? 483  ARG A CB    1 
ATOM   3739  C CG    . ARG A 1 483 ? 3.550   25.594  39.294  1.00 20.27  ? 483  ARG A CG    1 
ATOM   3740  C CD    . ARG A 1 483 ? 2.480   25.395  40.378  1.00 27.76  ? 483  ARG A CD    1 
ATOM   3741  N NE    . ARG A 1 483 ? 2.846   25.936  41.696  1.00 31.84  ? 483  ARG A NE    1 
ATOM   3742  C CZ    . ARG A 1 483 ? 2.837   25.233  42.829  1.00 34.23  ? 483  ARG A CZ    1 
ATOM   3743  N NH1   . ARG A 1 483 ? 2.463   23.953  42.831  1.00 35.29  ? 483  ARG A NH1   1 
ATOM   3744  N NH2   . ARG A 1 483 ? 3.194   25.810  43.970  1.00 34.94  ? 483  ARG A NH2   1 
ATOM   3745  N N     . PHE A 1 484 ? 5.197   22.640  37.155  1.00 16.71  ? 484  PHE A N     1 
ATOM   3746  C CA    . PHE A 1 484 ? 4.880   22.069  35.844  1.00 15.52  ? 484  PHE A CA    1 
ATOM   3747  C C     . PHE A 1 484 ? 4.236   20.684  35.985  1.00 15.46  ? 484  PHE A C     1 
ATOM   3748  O O     . PHE A 1 484 ? 3.183   20.418  35.391  1.00 14.73  ? 484  PHE A O     1 
ATOM   3749  C CB    . PHE A 1 484 ? 6.157   22.013  34.998  1.00 15.08  ? 484  PHE A CB    1 
ATOM   3750  C CG    . PHE A 1 484 ? 5.981   21.404  33.608  1.00 14.99  ? 484  PHE A CG    1 
ATOM   3751  C CD1   . PHE A 1 484 ? 5.262   22.079  32.609  1.00 15.43  ? 484  PHE A CD1   1 
ATOM   3752  C CD2   . PHE A 1 484 ? 6.603   20.195  33.286  1.00 12.99  ? 484  PHE A CD2   1 
ATOM   3753  C CE1   . PHE A 1 484 ? 5.132   21.533  31.313  1.00 16.62  ? 484  PHE A CE1   1 
ATOM   3754  C CE2   . PHE A 1 484 ? 6.487   19.634  31.999  1.00 14.34  ? 484  PHE A CE2   1 
ATOM   3755  C CZ    . PHE A 1 484 ? 5.755   20.303  31.009  1.00 15.05  ? 484  PHE A CZ    1 
ATOM   3756  N N     . GLU A 1 485 ? 4.863   19.812  36.778  1.00 14.91  ? 485  GLU A N     1 
ATOM   3757  C CA    . GLU A 1 485 ? 4.295   18.492  37.040  1.00 15.25  ? 485  GLU A CA    1 
ATOM   3758  C C     . GLU A 1 485 ? 2.972   18.588  37.775  1.00 15.16  ? 485  GLU A C     1 
ATOM   3759  O O     . GLU A 1 485 ? 2.014   17.912  37.405  1.00 14.91  ? 485  GLU A O     1 
ATOM   3760  C CB    . GLU A 1 485 ? 5.246   17.583  37.842  1.00 15.22  ? 485  GLU A CB    1 
ATOM   3761  C CG    . GLU A 1 485 ? 4.539   16.275  38.271  1.00 14.70  ? 485  GLU A CG    1 
ATOM   3762  C CD    . GLU A 1 485 ? 5.410   15.331  39.085  1.00 16.41  ? 485  GLU A CD    1 
ATOM   3763  O OE1   . GLU A 1 485 ? 6.646   15.558  39.152  1.00 17.48  ? 485  GLU A OE1   1 
ATOM   3764  O OE2   . GLU A 1 485 ? 4.845   14.363  39.657  1.00 15.66  ? 485  GLU A OE2   1 
ATOM   3765  N N     . GLN A 1 486 ? 2.915   19.406  38.825  1.00 15.59  ? 486  GLN A N     1 
ATOM   3766  C CA    . GLN A 1 486 ? 1.683   19.511  39.603  1.00 16.81  ? 486  GLN A CA    1 
ATOM   3767  C C     . GLN A 1 486 ? 0.546   20.082  38.770  1.00 16.56  ? 486  GLN A C     1 
ATOM   3768  O O     . GLN A 1 486 ? -0.570  19.560  38.795  1.00 16.70  ? 486  GLN A O     1 
ATOM   3769  C CB    . GLN A 1 486 ? 1.886   20.314  40.890  1.00 17.21  ? 486  GLN A CB    1 
ATOM   3770  C CG    . GLN A 1 486 ? 2.813   19.592  41.894  1.00 21.67  ? 486  GLN A CG    1 
ATOM   3771  C CD    . GLN A 1 486 ? 2.339   18.176  42.236  1.00 24.59  ? 486  GLN A CD    1 
ATOM   3772  O OE1   . GLN A 1 486 ? 3.043   17.188  41.988  1.00 25.58  ? 486  GLN A OE1   1 
ATOM   3773  N NE2   . GLN A 1 486 ? 1.136   18.078  42.804  1.00 26.22  ? 486  GLN A NE2   1 
ATOM   3774  N N     . THR A 1 487 ? 0.839   21.133  38.010  1.00 16.39  ? 487  THR A N     1 
ATOM   3775  C CA    . THR A 1 487 ? -0.191  21.799  37.219  1.00 16.27  ? 487  THR A CA    1 
ATOM   3776  C C     . THR A 1 487 ? -0.841  20.901  36.157  1.00 15.89  ? 487  THR A C     1 
ATOM   3777  O O     . THR A 1 487 ? -2.057  20.940  36.013  1.00 16.35  ? 487  THR A O     1 
ATOM   3778  C CB    . THR A 1 487 ? 0.330   23.085  36.589  1.00 16.05  ? 487  THR A CB    1 
ATOM   3779  O OG1   . THR A 1 487 ? 0.837   23.925  37.625  1.00 16.76  ? 487  THR A OG1   1 
ATOM   3780  C CG2   . THR A 1 487 ? -0.788  23.828  35.837  1.00 17.45  ? 487  THR A CG2   1 
ATOM   3781  N N     . TYR A 1 488 ? -0.047  20.080  35.463  1.00 15.46  ? 488  TYR A N     1 
ATOM   3782  C CA    . TYR A 1 488 ? -0.495  19.367  34.258  1.00 14.75  ? 488  TYR A CA    1 
ATOM   3783  C C     . TYR A 1 488 ? -0.538  17.859  34.373  1.00 15.01  ? 488  TYR A C     1 
ATOM   3784  O O     . TYR A 1 488 ? -1.250  17.204  33.609  1.00 14.64  ? 488  TYR A O     1 
ATOM   3785  C CB    . TYR A 1 488 ? 0.403   19.717  33.068  1.00 14.67  ? 488  TYR A CB    1 
ATOM   3786  C CG    . TYR A 1 488 ? 0.422   21.194  32.746  1.00 15.18  ? 488  TYR A CG    1 
ATOM   3787  C CD1   . TYR A 1 488 ? 1.494   21.990  33.130  1.00 13.98  ? 488  TYR A CD1   1 
ATOM   3788  C CD2   . TYR A 1 488 ? -0.648  21.798  32.079  1.00 12.44  ? 488  TYR A CD2   1 
ATOM   3789  C CE1   . TYR A 1 488 ? 1.510   23.344  32.850  1.00 14.11  ? 488  TYR A CE1   1 
ATOM   3790  C CE2   . TYR A 1 488 ? -0.644  23.146  31.802  1.00 13.77  ? 488  TYR A CE2   1 
ATOM   3791  C CZ    . TYR A 1 488 ? 0.432   23.919  32.199  1.00 14.63  ? 488  TYR A CZ    1 
ATOM   3792  O OH    . TYR A 1 488 ? 0.449   25.271  31.917  1.00 14.89  ? 488  TYR A OH    1 
ATOM   3793  N N     . PHE A 1 489 ? 0.232   17.307  35.313  1.00 14.86  ? 489  PHE A N     1 
ATOM   3794  C CA    . PHE A 1 489 ? 0.475   15.859  35.370  1.00 15.39  ? 489  PHE A CA    1 
ATOM   3795  C C     . PHE A 1 489 ? 0.075   15.201  36.708  1.00 15.76  ? 489  PHE A C     1 
ATOM   3796  O O     . PHE A 1 489 ? 0.424   14.042  36.942  1.00 16.50  ? 489  PHE A O     1 
ATOM   3797  C CB    . PHE A 1 489 ? 1.957   15.551  35.059  1.00 14.57  ? 489  PHE A CB    1 
ATOM   3798  C CG    . PHE A 1 489 ? 2.403   16.020  33.695  1.00 14.47  ? 489  PHE A CG    1 
ATOM   3799  C CD1   . PHE A 1 489 ? 3.002   17.276  33.532  1.00 12.94  ? 489  PHE A CD1   1 
ATOM   3800  C CD2   . PHE A 1 489 ? 2.234   15.204  32.569  1.00 13.57  ? 489  PHE A CD2   1 
ATOM   3801  C CE1   . PHE A 1 489 ? 3.411   17.728  32.263  1.00 14.18  ? 489  PHE A CE1   1 
ATOM   3802  C CE2   . PHE A 1 489 ? 2.635   15.650  31.286  1.00 14.93  ? 489  PHE A CE2   1 
ATOM   3803  C CZ    . PHE A 1 489 ? 3.226   16.914  31.135  1.00 13.52  ? 489  PHE A CZ    1 
ATOM   3804  N N     . SER A 1 490 ? -0.662  15.923  37.563  1.00 15.87  ? 490  SER A N     1 
ATOM   3805  C CA    . SER A 1 490 ? -1.041  15.425  38.894  1.00 15.75  ? 490  SER A CA    1 
ATOM   3806  C C     . SER A 1 490 ? -2.519  15.067  39.073  1.00 15.80  ? 490  SER A C     1 
ATOM   3807  O O     . SER A 1 490 ? -2.857  14.251  39.924  1.00 16.10  ? 490  SER A O     1 
ATOM   3808  C CB    . SER A 1 490 ? -0.625  16.423  39.986  1.00 16.19  ? 490  SER A CB    1 
ATOM   3809  O OG    . SER A 1 490 ? -1.459  17.574  40.000  1.00 16.14  ? 490  SER A OG    1 
ATOM   3810  N N     . THR A 1 491 ? -3.398  15.701  38.304  1.00 16.11  ? 491  THR A N     1 
ATOM   3811  C CA    . THR A 1 491 ? -4.841  15.417  38.351  1.00 16.15  ? 491  THR A CA    1 
ATOM   3812  C C     . THR A 1 491 ? -5.155  13.994  37.882  1.00 15.75  ? 491  THR A C     1 
ATOM   3813  O O     . THR A 1 491 ? -5.880  13.248  38.536  1.00 15.44  ? 491  THR A O     1 
ATOM   3814  C CB    . THR A 1 491 ? -5.615  16.434  37.464  1.00 16.71  ? 491  THR A CB    1 
ATOM   3815  O OG1   . THR A 1 491 ? -5.192  17.765  37.803  1.00 16.89  ? 491  THR A OG1   1 
ATOM   3816  C CG2   . THR A 1 491 ? -7.128  16.294  37.651  1.00 16.46  ? 491  THR A CG2   1 
ATOM   3817  N N     . PHE A 1 492 ? -4.605  13.644  36.726  1.00 15.91  ? 492  PHE A N     1 
ATOM   3818  C CA    . PHE A 1 492 ? -4.792  12.350  36.118  1.00 15.98  ? 492  PHE A CA    1 
ATOM   3819  C C     . PHE A 1 492 ? -3.392  11.804  35.857  1.00 17.03  ? 492  PHE A C     1 
ATOM   3820  O O     . PHE A 1 492 ? -2.739  12.153  34.870  1.00 17.12  ? 492  PHE A O     1 
ATOM   3821  C CB    . PHE A 1 492 ? -5.610  12.483  34.832  1.00 15.63  ? 492  PHE A CB    1 
ATOM   3822  C CG    . PHE A 1 492 ? -6.933  13.199  35.009  1.00 14.74  ? 492  PHE A CG    1 
ATOM   3823  C CD1   . PHE A 1 492 ? -7.165  14.421  34.378  1.00 13.81  ? 492  PHE A CD1   1 
ATOM   3824  C CD2   . PHE A 1 492 ? -7.951  12.649  35.789  1.00 14.03  ? 492  PHE A CD2   1 
ATOM   3825  C CE1   . PHE A 1 492 ? -8.389  15.096  34.511  1.00 11.35  ? 492  PHE A CE1   1 
ATOM   3826  C CE2   . PHE A 1 492 ? -9.177  13.313  35.945  1.00 13.64  ? 492  PHE A CE2   1 
ATOM   3827  C CZ    . PHE A 1 492 ? -9.395  14.548  35.284  1.00 13.92  ? 492  PHE A CZ    1 
ATOM   3828  N N     . LYS A 1 493 ? -2.924  10.977  36.787  1.00 18.12  ? 493  LYS A N     1 
ATOM   3829  C CA    . LYS A 1 493 ? -1.552  10.488  36.818  1.00 19.10  ? 493  LYS A CA    1 
ATOM   3830  C C     . LYS A 1 493 ? -1.143  9.840   35.503  1.00 19.41  ? 493  LYS A C     1 
ATOM   3831  O O     . LYS A 1 493 ? -1.898  9.059   34.921  1.00 19.34  ? 493  LYS A O     1 
ATOM   3832  C CB    . LYS A 1 493 ? -1.391  9.490   37.974  1.00 19.80  ? 493  LYS A CB    1 
ATOM   3833  C CG    . LYS A 1 493 ? -0.835  10.085  39.291  1.00 21.14  ? 493  LYS A CG    1 
ATOM   3834  C CD    . LYS A 1 493 ? -1.636  11.282  39.821  1.00 22.30  ? 493  LYS A CD    1 
ATOM   3835  C CE    . LYS A 1 493 ? -1.167  11.733  41.223  1.00 22.53  ? 493  LYS A CE    1 
ATOM   3836  N NZ    . LYS A 1 493 ? 0.178   12.412  41.223  1.00 23.53  ? 493  LYS A NZ    1 
ATOM   3837  N N     . ASN A 1 494 ? 0.049   10.185  35.028  1.00 19.74  ? 494  ASN A N     1 
ATOM   3838  C CA    . ASN A 1 494 ? 0.581   9.608   33.796  1.00 19.92  ? 494  ASN A CA    1 
ATOM   3839  C C     . ASN A 1 494 ? -0.034  10.140  32.511  1.00 19.42  ? 494  ASN A C     1 
ATOM   3840  O O     . ASN A 1 494 ? 0.199   9.596   31.425  1.00 18.68  ? 494  ASN A O     1 
ATOM   3841  C CB    . ASN A 1 494 ? 0.470   8.088   33.834  1.00 20.18  ? 494  ASN A CB    1 
ATOM   3842  C CG    . ASN A 1 494 ? 1.787   7.445   34.020  1.00 22.52  ? 494  ASN A CG    1 
ATOM   3843  O OD1   . ASN A 1 494 ? 2.659   7.558   33.149  1.00 25.47  ? 494  ASN A OD1   1 
ATOM   3844  N ND2   . ASN A 1 494 ? 1.976   6.776   35.168  1.00 23.61  ? 494  ASN A ND2   1 
ATOM   3845  N N     . MET A 1 495 ? -0.831  11.191  32.650  1.00 19.42  ? 495  MET A N     1 
ATOM   3846  C CA    . MET A 1 495 ? -1.455  11.849  31.515  1.00 20.02  ? 495  MET A CA    1 
ATOM   3847  C C     . MET A 1 495 ? -1.187  13.353  31.560  1.00 18.89  ? 495  MET A C     1 
ATOM   3848  O O     . MET A 1 495 ? -1.032  13.928  32.645  1.00 19.15  ? 495  MET A O     1 
ATOM   3849  C CB    . MET A 1 495 ? -2.960  11.579  31.518  1.00 19.73  ? 495  MET A CB    1 
ATOM   3850  C CG    . MET A 1 495 ? -3.340  10.118  31.375  1.00 20.73  ? 495  MET A CG    1 
ATOM   3851  S SD    . MET A 1 495 ? -5.072  9.858   31.817  1.00 23.34  ? 495  MET A SD    1 
ATOM   3852  C CE    . MET A 1 495 ? -4.958  9.127   33.462  1.00 26.09  ? 495  MET A CE    1 
ATOM   3853  N N     . TYR A 1 496 ? -1.115  13.974  30.383  1.00 17.81  ? 496  TYR A N     1 
ATOM   3854  C CA    . TYR A 1 496 ? -1.143  15.430  30.261  1.00 17.18  ? 496  TYR A CA    1 
ATOM   3855  C C     . TYR A 1 496 ? -2.600  15.903  30.284  1.00 16.68  ? 496  TYR A C     1 
ATOM   3856  O O     . TYR A 1 496 ? -3.365  15.564  29.379  1.00 16.42  ? 496  TYR A O     1 
ATOM   3857  C CB    . TYR A 1 496 ? -0.457  15.918  28.960  1.00 16.73  ? 496  TYR A CB    1 
ATOM   3858  C CG    . TYR A 1 496 ? -0.680  17.391  28.720  1.00 17.20  ? 496  TYR A CG    1 
ATOM   3859  C CD1   . TYR A 1 496 ? 0.052   18.349  29.431  1.00 18.16  ? 496  TYR A CD1   1 
ATOM   3860  C CD2   . TYR A 1 496 ? -1.648  17.845  27.811  1.00 16.33  ? 496  TYR A CD2   1 
ATOM   3861  C CE1   . TYR A 1 496 ? -0.160  19.723  29.233  1.00 18.41  ? 496  TYR A CE1   1 
ATOM   3862  C CE2   . TYR A 1 496 ? -1.867  19.211  27.619  1.00 16.02  ? 496  TYR A CE2   1 
ATOM   3863  C CZ    . TYR A 1 496 ? -1.111  20.143  28.333  1.00 17.89  ? 496  TYR A CZ    1 
ATOM   3864  O OH    . TYR A 1 496 ? -1.312  21.503  28.161  1.00 17.41  ? 496  TYR A OH    1 
ATOM   3865  N N     . PHE A 1 497 ? -2.975  16.689  31.294  1.00 15.85  ? 497  PHE A N     1 
ATOM   3866  C CA    . PHE A 1 497 ? -4.328  17.230  31.371  1.00 15.89  ? 497  PHE A CA    1 
ATOM   3867  C C     . PHE A 1 497 ? -4.392  18.647  30.801  1.00 16.02  ? 497  PHE A C     1 
ATOM   3868  O O     . PHE A 1 497 ? -3.657  19.536  31.226  1.00 16.28  ? 497  PHE A O     1 
ATOM   3869  C CB    . PHE A 1 497 ? -4.878  17.169  32.805  1.00 16.31  ? 497  PHE A CB    1 
ATOM   3870  C CG    . PHE A 1 497 ? -6.258  17.762  32.961  1.00 16.33  ? 497  PHE A CG    1 
ATOM   3871  C CD1   . PHE A 1 497 ? -7.252  17.524  32.014  1.00 16.05  ? 497  PHE A CD1   1 
ATOM   3872  C CD2   . PHE A 1 497 ? -6.560  18.550  34.061  1.00 17.01  ? 497  PHE A CD2   1 
ATOM   3873  C CE1   . PHE A 1 497 ? -8.529  18.075  32.148  1.00 16.48  ? 497  PHE A CE1   1 
ATOM   3874  C CE2   . PHE A 1 497 ? -7.847  19.115  34.213  1.00 18.89  ? 497  PHE A CE2   1 
ATOM   3875  C CZ    . PHE A 1 497 ? -8.830  18.863  33.247  1.00 17.38  ? 497  PHE A CZ    1 
ATOM   3876  N N     . SER A 1 498 ? -5.263  18.846  29.822  1.00 15.64  ? 498  SER A N     1 
ATOM   3877  C CA    . SER A 1 498 ? -5.338  20.120  29.109  1.00 15.58  ? 498  SER A CA    1 
ATOM   3878  C C     . SER A 1 498 ? -6.167  21.195  29.818  1.00 15.51  ? 498  SER A C     1 
ATOM   3879  O O     . SER A 1 498 ? -6.002  22.390  29.539  1.00 15.87  ? 498  SER A O     1 
ATOM   3880  C CB    . SER A 1 498 ? -5.892  19.881  27.713  1.00 15.05  ? 498  SER A CB    1 
ATOM   3881  O OG    . SER A 1 498 ? -7.229  19.444  27.827  1.00 15.67  ? 498  SER A OG    1 
ATOM   3882  N N     . GLY A 1 499 ? -7.065  20.783  30.714  1.00 15.13  ? 499  GLY A N     1 
ATOM   3883  C CA    . GLY A 1 499 ? -7.964  21.721  31.373  1.00 15.23  ? 499  GLY A CA    1 
ATOM   3884  C C     . GLY A 1 499 ? -9.212  22.015  30.557  1.00 15.49  ? 499  GLY A C     1 
ATOM   3885  O O     . GLY A 1 499 ? -10.072 22.796  30.981  1.00 15.77  ? 499  GLY A O     1 
ATOM   3886  N N     . ASP A 1 500 ? -9.309  21.374  29.391  1.00 15.27  ? 500  ASP A N     1 
ATOM   3887  C CA    . ASP A 1 500 ? -10.486 21.434  28.517  1.00 14.67  ? 500  ASP A CA    1 
ATOM   3888  C C     . ASP A 1 500 ? -11.398 20.241  28.707  1.00 14.51  ? 500  ASP A C     1 
ATOM   3889  O O     . ASP A 1 500 ? -10.947 19.155  29.071  1.00 13.99  ? 500  ASP A O     1 
ATOM   3890  C CB    . ASP A 1 500 ? -10.060 21.459  27.042  1.00 14.22  ? 500  ASP A CB    1 
ATOM   3891  C CG    . ASP A 1 500 ? -9.599  22.826  26.598  1.00 14.57  ? 500  ASP A CG    1 
ATOM   3892  O OD1   . ASP A 1 500 ? -10.247 23.845  26.962  1.00 15.02  ? 500  ASP A OD1   1 
ATOM   3893  O OD2   . ASP A 1 500 ? -8.568  22.879  25.904  1.00 13.34  ? 500  ASP A OD2   1 
ATOM   3894  N N     . GLY A 1 501 ? -12.680 20.453  28.418  1.00 14.22  ? 501  GLY A N     1 
ATOM   3895  C CA    . GLY A 1 501 ? -13.624 19.361  28.217  1.00 14.09  ? 501  GLY A CA    1 
ATOM   3896  C C     . GLY A 1 501 ? -13.883 19.168  26.728  1.00 14.16  ? 501  GLY A C     1 
ATOM   3897  O O     . GLY A 1 501 ? -13.791 20.118  25.934  1.00 14.55  ? 501  GLY A O     1 
ATOM   3898  N N     . ALA A 1 502 ? -14.201 17.941  26.339  1.00 14.04  ? 502  ALA A N     1 
ATOM   3899  C CA    . ALA A 1 502 ? -14.579 17.653  24.955  1.00 14.45  ? 502  ALA A CA    1 
ATOM   3900  C C     . ALA A 1 502 ? -15.557 16.509  24.877  1.00 14.74  ? 502  ALA A C     1 
ATOM   3901  O O     . ALA A 1 502 ? -15.668 15.721  25.810  1.00 15.11  ? 502  ALA A O     1 
ATOM   3902  C CB    . ALA A 1 502 ? -13.346 17.334  24.106  1.00 13.90  ? 502  ALA A CB    1 
ATOM   3903  N N     . ARG A 1 503 ? -16.272 16.426  23.764  1.00 15.38  ? 503  ARG A N     1 
ATOM   3904  C CA    A ARG A 1 503 ? -17.014 15.211  23.444  0.50 15.98  ? 503  ARG A CA    1 
ATOM   3905  C CA    B ARG A 1 503 ? -17.034 15.221  23.438  0.50 15.65  ? 503  ARG A CA    1 
ATOM   3906  C C     . ARG A 1 503 ? -16.455 14.563  22.183  1.00 15.84  ? 503  ARG A C     1 
ATOM   3907  O O     . ARG A 1 503 ? -15.887 15.241  21.318  1.00 16.14  ? 503  ARG A O     1 
ATOM   3908  C CB    A ARG A 1 503 ? -18.531 15.454  23.351  0.50 15.83  ? 503  ARG A CB    1 
ATOM   3909  C CB    B ARG A 1 503 ? -18.542 15.512  23.298  0.50 15.52  ? 503  ARG A CB    1 
ATOM   3910  C CG    A ARG A 1 503 ? -18.985 16.306  22.206  0.50 16.70  ? 503  ARG A CG    1 
ATOM   3911  C CG    B ARG A 1 503 ? -19.100 15.414  21.897  0.50 15.85  ? 503  ARG A CG    1 
ATOM   3912  C CD    A ARG A 1 503 ? -20.501 16.477  22.215  0.50 16.89  ? 503  ARG A CD    1 
ATOM   3913  C CD    B ARG A 1 503 ? -20.612 15.593  21.863  0.50 15.66  ? 503  ARG A CD    1 
ATOM   3914  N NE    A ARG A 1 503 ? -20.949 17.285  21.081  0.50 18.66  ? 503  ARG A NE    1 
ATOM   3915  N NE    B ARG A 1 503 ? -21.008 16.259  20.625  0.50 15.85  ? 503  ARG A NE    1 
ATOM   3916  C CZ    A ARG A 1 503 ? -20.924 18.615  21.044  0.50 18.30  ? 503  ARG A CZ    1 
ATOM   3917  C CZ    B ARG A 1 503 ? -21.354 15.638  19.505  0.50 15.91  ? 503  ARG A CZ    1 
ATOM   3918  N NH1   A ARG A 1 503 ? -20.474 19.304  22.089  0.50 18.60  ? 503  ARG A NH1   1 
ATOM   3919  N NH1   B ARG A 1 503 ? -21.376 14.309  19.457  0.50 15.96  ? 503  ARG A NH1   1 
ATOM   3920  N NH2   A ARG A 1 503 ? -21.358 19.257  19.960  0.50 17.25  ? 503  ARG A NH2   1 
ATOM   3921  N NH2   B ARG A 1 503 ? -21.687 16.351  18.436  0.50 14.20  ? 503  ARG A NH2   1 
ATOM   3922  N N     . ARG A 1 504 ? -16.573 13.245  22.107  1.00 15.89  ? 504  ARG A N     1 
ATOM   3923  C CA    . ARG A 1 504 ? -16.146 12.503  20.932  1.00 16.13  ? 504  ARG A CA    1 
ATOM   3924  C C     . ARG A 1 504 ? -17.406 11.875  20.398  1.00 16.45  ? 504  ARG A C     1 
ATOM   3925  O O     . ARG A 1 504 ? -18.185 11.321  21.179  1.00 16.43  ? 504  ARG A O     1 
ATOM   3926  C CB    . ARG A 1 504 ? -15.119 11.429  21.301  1.00 15.93  ? 504  ARG A CB    1 
ATOM   3927  C CG    . ARG A 1 504 ? -14.523 10.690  20.084  1.00 16.22  ? 504  ARG A CG    1 
ATOM   3928  C CD    . ARG A 1 504 ? -13.413 9.706   20.484  1.00 16.15  ? 504  ARG A CD    1 
ATOM   3929  N NE    . ARG A 1 504 ? -13.834 8.852   21.587  1.00 15.14  ? 504  ARG A NE    1 
ATOM   3930  C CZ    . ARG A 1 504 ? -13.209 8.724   22.758  1.00 14.99  ? 504  ARG A CZ    1 
ATOM   3931  N NH1   . ARG A 1 504 ? -12.066 9.356   23.013  1.00 13.07  ? 504  ARG A NH1   1 
ATOM   3932  N NH2   . ARG A 1 504 ? -13.735 7.932   23.674  1.00 13.13  ? 504  ARG A NH2   1 
ATOM   3933  N N     . ASP A 1 505 ? -17.635 11.998  19.091  1.00 16.53  ? 505  ASP A N     1 
ATOM   3934  C CA    . ASP A 1 505 ? -18.840 11.429  18.479  1.00 16.82  ? 505  ASP A CA    1 
ATOM   3935  C C     . ASP A 1 505 ? -18.575 10.028  17.915  1.00 17.08  ? 505  ASP A C     1 
ATOM   3936  O O     . ASP A 1 505 ? -17.477 9.496   18.068  1.00 17.21  ? 505  ASP A O     1 
ATOM   3937  C CB    . ASP A 1 505 ? -19.433 12.383  17.416  1.00 16.59  ? 505  ASP A CB    1 
ATOM   3938  C CG    . ASP A 1 505 ? -18.533 12.554  16.183  1.00 16.91  ? 505  ASP A CG    1 
ATOM   3939  O OD1   . ASP A 1 505 ? -17.606 11.741  15.979  1.00 15.48  ? 505  ASP A OD1   1 
ATOM   3940  O OD2   . ASP A 1 505 ? -18.777 13.498  15.394  1.00 15.65  ? 505  ASP A OD2   1 
ATOM   3941  N N     . GLU A 1 506 ? -19.579 9.448   17.262  1.00 17.59  ? 506  GLU A N     1 
ATOM   3942  C CA    . GLU A 1 506 ? -19.504 8.092   16.708  1.00 18.35  ? 506  GLU A CA    1 
ATOM   3943  C C     . GLU A 1 506 ? -18.410 7.902   15.657  1.00 18.08  ? 506  GLU A C     1 
ATOM   3944  O O     . GLU A 1 506 ? -17.953 6.779   15.430  1.00 18.27  ? 506  GLU A O     1 
ATOM   3945  C CB    . GLU A 1 506 ? -20.852 7.675   16.121  1.00 18.66  ? 506  GLU A CB    1 
ATOM   3946  C CG    . GLU A 1 506 ? -21.985 7.533   17.142  1.00 22.41  ? 506  GLU A CG    1 
ATOM   3947  C CD    . GLU A 1 506 ? -22.551 8.886   17.612  1.00 29.06  ? 506  GLU A CD    1 
ATOM   3948  O OE1   . GLU A 1 506 ? -23.031 8.951   18.769  1.00 31.26  ? 506  GLU A OE1   1 
ATOM   3949  O OE2   . GLU A 1 506 ? -22.515 9.883   16.832  1.00 31.42  ? 506  GLU A OE2   1 
ATOM   3950  N N     . ASP A 1 507 ? -17.995 8.996   15.016  1.00 17.95  ? 507  ASP A N     1 
ATOM   3951  C CA    . ASP A 1 507 ? -16.962 8.947   13.989  1.00 17.45  ? 507  ASP A CA    1 
ATOM   3952  C C     . ASP A 1 507 ? -15.577 9.092   14.585  1.00 17.21  ? 507  ASP A C     1 
ATOM   3953  O O     . ASP A 1 507 ? -14.575 8.935   13.886  1.00 17.51  ? 507  ASP A O     1 
ATOM   3954  C CB    . ASP A 1 507 ? -17.194 10.045  12.940  1.00 17.68  ? 507  ASP A CB    1 
ATOM   3955  C CG    . ASP A 1 507 ? -18.206 9.636   11.897  1.00 18.42  ? 507  ASP A CG    1 
ATOM   3956  O OD1   . ASP A 1 507 ? -18.071 8.523   11.364  1.00 20.23  ? 507  ASP A OD1   1 
ATOM   3957  O OD2   . ASP A 1 507 ? -19.135 10.414  11.611  1.00 19.76  ? 507  ASP A OD2   1 
ATOM   3958  N N     . GLY A 1 508 ? -15.514 9.386   15.878  1.00 16.98  ? 508  GLY A N     1 
ATOM   3959  C CA    . GLY A 1 508 ? -14.225 9.640   16.527  1.00 16.78  ? 508  GLY A CA    1 
ATOM   3960  C C     . GLY A 1 508 ? -13.808 11.097  16.428  1.00 16.38  ? 508  GLY A C     1 
ATOM   3961  O O     . GLY A 1 508 ? -12.679 11.442  16.777  1.00 16.62  ? 508  GLY A O     1 
ATOM   3962  N N     . TYR A 1 509 ? -14.716 11.954  15.955  1.00 15.67  ? 509  TYR A N     1 
ATOM   3963  C CA    . TYR A 1 509 ? -14.446 13.393  15.858  1.00 15.73  ? 509  TYR A CA    1 
ATOM   3964  C C     . TYR A 1 509 ? -14.611 14.037  17.228  1.00 16.09  ? 509  TYR A C     1 
ATOM   3965  O O     . TYR A 1 509 ? -15.592 13.767  17.927  1.00 16.62  ? 509  TYR A O     1 
ATOM   3966  C CB    . TYR A 1 509 ? -15.417 14.068  14.881  1.00 15.39  ? 509  TYR A CB    1 
ATOM   3967  C CG    . TYR A 1 509 ? -15.096 13.940  13.406  1.00 14.79  ? 509  TYR A CG    1 
ATOM   3968  C CD1   . TYR A 1 509 ? -14.592 12.752  12.872  1.00 14.73  ? 509  TYR A CD1   1 
ATOM   3969  C CD2   . TYR A 1 509 ? -15.321 15.022  12.534  1.00 14.87  ? 509  TYR A CD2   1 
ATOM   3970  C CE1   . TYR A 1 509 ? -14.323 12.629  11.500  1.00 16.11  ? 509  TYR A CE1   1 
ATOM   3971  C CE2   . TYR A 1 509 ? -15.052 14.929  11.175  1.00 14.76  ? 509  TYR A CE2   1 
ATOM   3972  C CZ    . TYR A 1 509 ? -14.554 13.726  10.662  1.00 16.44  ? 509  TYR A CZ    1 
ATOM   3973  O OH    . TYR A 1 509 ? -14.291 13.623  9.328   1.00 15.20  ? 509  TYR A OH    1 
ATOM   3974  N N     . TYR A 1 510 ? -13.666 14.902  17.597  1.00 15.77  ? 510  TYR A N     1 
ATOM   3975  C CA    . TYR A 1 510 ? -13.719 15.623  18.861  1.00 15.08  ? 510  TYR A CA    1 
ATOM   3976  C C     . TYR A 1 510 ? -14.368 17.000  18.725  1.00 15.17  ? 510  TYR A C     1 
ATOM   3977  O O     . TYR A 1 510 ? -14.093 17.758  17.776  1.00 15.45  ? 510  TYR A O     1 
ATOM   3978  C CB    . TYR A 1 510 ? -12.317 15.766  19.453  1.00 15.00  ? 510  TYR A CB    1 
ATOM   3979  C CG    . TYR A 1 510 ? -11.736 14.474  19.982  1.00 13.99  ? 510  TYR A CG    1 
ATOM   3980  C CD1   . TYR A 1 510 ? -11.024 13.605  19.151  1.00 11.89  ? 510  TYR A CD1   1 
ATOM   3981  C CD2   . TYR A 1 510 ? -11.907 14.123  21.320  1.00 14.52  ? 510  TYR A CD2   1 
ATOM   3982  C CE1   . TYR A 1 510 ? -10.490 12.420  19.643  1.00 12.95  ? 510  TYR A CE1   1 
ATOM   3983  C CE2   . TYR A 1 510 ? -11.388 12.930  21.833  1.00 13.56  ? 510  TYR A CE2   1 
ATOM   3984  C CZ    . TYR A 1 510 ? -10.687 12.088  20.996  1.00 14.18  ? 510  TYR A CZ    1 
ATOM   3985  O OH    . TYR A 1 510 ? -10.176 10.936  21.526  1.00 14.13  ? 510  TYR A OH    1 
ATOM   3986  N N     . TRP A 1 511 ? -15.214 17.320  19.690  1.00 14.39  ? 511  TRP A N     1 
ATOM   3987  C CA    . TRP A 1 511 ? -15.849 18.611  19.776  1.00 14.36  ? 511  TRP A CA    1 
ATOM   3988  C C     . TRP A 1 511 ? -15.401 19.211  21.110  1.00 15.15  ? 511  TRP A C     1 
ATOM   3989  O O     . TRP A 1 511 ? -15.777 18.719  22.184  1.00 14.65  ? 511  TRP A O     1 
ATOM   3990  C CB    . TRP A 1 511 ? -17.376 18.446  19.737  1.00 13.54  ? 511  TRP A CB    1 
ATOM   3991  C CG    . TRP A 1 511 ? -17.907 17.792  18.497  1.00 12.48  ? 511  TRP A CG    1 
ATOM   3992  C CD1   . TRP A 1 511 ? -17.820 16.470  18.167  1.00 12.30  ? 511  TRP A CD1   1 
ATOM   3993  C CD2   . TRP A 1 511 ? -18.619 18.426  17.429  1.00 12.47  ? 511  TRP A CD2   1 
ATOM   3994  N NE1   . TRP A 1 511 ? -18.428 16.236  16.956  1.00 13.01  ? 511  TRP A NE1   1 
ATOM   3995  C CE2   . TRP A 1 511 ? -18.926 17.419  16.474  1.00 13.09  ? 511  TRP A CE2   1 
ATOM   3996  C CE3   . TRP A 1 511 ? -19.020 19.750  17.173  1.00 12.83  ? 511  TRP A CE3   1 
ATOM   3997  C CZ2   . TRP A 1 511 ? -19.621 17.692  15.278  1.00 10.88  ? 511  TRP A CZ2   1 
ATOM   3998  C CZ3   . TRP A 1 511 ? -19.720 20.023  15.976  1.00 13.00  ? 511  TRP A CZ3   1 
ATOM   3999  C CH2   . TRP A 1 511 ? -20.015 18.986  15.049  1.00 11.52  ? 511  TRP A CH2   1 
ATOM   4000  N N     . ILE A 1 512 ? -14.571 20.250  21.048  1.00 15.98  ? 512  ILE A N     1 
ATOM   4001  C CA    . ILE A 1 512 ? -14.003 20.853  22.267  1.00 16.39  ? 512  ILE A CA    1 
ATOM   4002  C C     . ILE A 1 512 ? -14.954 21.903  22.840  1.00 17.63  ? 512  ILE A C     1 
ATOM   4003  O O     . ILE A 1 512 ? -15.286 22.886  22.167  1.00 17.81  ? 512  ILE A O     1 
ATOM   4004  C CB    . ILE A 1 512 ? -12.590 21.476  22.033  1.00 16.38  ? 512  ILE A CB    1 
ATOM   4005  C CG1   . ILE A 1 512 ? -11.526 20.400  21.798  1.00 16.57  ? 512  ILE A CG1   1 
ATOM   4006  C CG2   . ILE A 1 512 ? -12.156 22.325  23.246  1.00 15.60  ? 512  ILE A CG2   1 
ATOM   4007  C CD1   . ILE A 1 512 ? -11.511 19.821  20.408  1.00 21.56  ? 512  ILE A CD1   1 
ATOM   4008  N N     . THR A 1 513 ? -15.362 21.710  24.093  1.00 18.08  ? 513  THR A N     1 
ATOM   4009  C CA    . THR A 1 513 ? -16.369 22.563  24.689  1.00 19.28  ? 513  THR A CA    1 
ATOM   4010  C C     . THR A 1 513 ? -15.797 23.708  25.545  1.00 19.39  ? 513  THR A C     1 
ATOM   4011  O O     . THR A 1 513 ? -16.527 24.612  25.932  1.00 20.48  ? 513  THR A O     1 
ATOM   4012  C CB    . THR A 1 513 ? -17.383 21.733  25.484  1.00 19.43  ? 513  THR A CB    1 
ATOM   4013  O OG1   . THR A 1 513 ? -16.676 20.849  26.357  1.00 21.55  ? 513  THR A OG1   1 
ATOM   4014  C CG2   . THR A 1 513 ? -18.227 20.891  24.522  1.00 20.08  ? 513  THR A CG2   1 
ATOM   4015  N N     . GLY A 1 514 ? -14.498 23.692  25.813  1.00 19.03  ? 514  GLY A N     1 
ATOM   4016  C CA    . GLY A 1 514 ? -13.891 24.768  26.574  1.00 18.81  ? 514  GLY A CA    1 
ATOM   4017  C C     . GLY A 1 514 ? -13.321 24.336  27.912  1.00 18.49  ? 514  GLY A C     1 
ATOM   4018  O O     . GLY A 1 514 ? -13.343 23.154  28.274  1.00 18.86  ? 514  GLY A O     1 
ATOM   4019  N N     . ARG A 1 515 ? -12.809 25.308  28.654  1.00 17.87  ? 515  ARG A N     1 
ATOM   4020  C CA    . ARG A 1 515 ? -12.124 25.023  29.898  1.00 16.78  ? 515  ARG A CA    1 
ATOM   4021  C C     . ARG A 1 515 ? -13.084 24.427  30.926  1.00 16.91  ? 515  ARG A C     1 
ATOM   4022  O O     . ARG A 1 515 ? -14.249 24.847  31.021  1.00 16.44  ? 515  ARG A O     1 
ATOM   4023  C CB    . ARG A 1 515 ? -11.471 26.287  30.444  1.00 16.89  ? 515  ARG A CB    1 
ATOM   4024  C CG    . ARG A 1 515 ? -10.506 26.997  29.502  1.00 16.39  ? 515  ARG A CG    1 
ATOM   4025  C CD    . ARG A 1 515 ? -9.258  26.161  29.161  1.00 17.76  ? 515  ARG A CD    1 
ATOM   4026  N NE    . ARG A 1 515 ? -8.402  25.895  30.316  1.00 18.51  ? 515  ARG A NE    1 
ATOM   4027  C CZ    . ARG A 1 515 ? -7.083  25.748  30.247  1.00 18.07  ? 515  ARG A CZ    1 
ATOM   4028  N NH1   . ARG A 1 515 ? -6.467  25.872  29.076  1.00 18.69  ? 515  ARG A NH1   1 
ATOM   4029  N NH2   . ARG A 1 515 ? -6.376  25.499  31.347  1.00 17.89  ? 515  ARG A NH2   1 
ATOM   4030  N N     . VAL A 1 516 ? -12.598 23.431  31.674  1.00 16.39  ? 516  VAL A N     1 
ATOM   4031  C CA    . VAL A 1 516 ? -13.358 22.869  32.805  1.00 15.78  ? 516  VAL A CA    1 
ATOM   4032  C C     . VAL A 1 516 ? -12.737 23.373  34.102  1.00 15.72  ? 516  VAL A C     1 
ATOM   4033  O O     . VAL A 1 516 ? -13.268 23.146  35.183  1.00 15.62  ? 516  VAL A O     1 
ATOM   4034  C CB    . VAL A 1 516 ? -13.421 21.293  32.800  1.00 15.22  ? 516  VAL A CB    1 
ATOM   4035  C CG1   . VAL A 1 516 ? -14.301 20.777  31.672  1.00 14.81  ? 516  VAL A CG1   1 
ATOM   4036  C CG2   . VAL A 1 516 ? -12.021 20.670  32.713  1.00 14.33  ? 516  VAL A CG2   1 
ATOM   4037  N N     . ASP A 1 517 ? -11.599 24.051  33.991  1.00 16.20  ? 517  ASP A N     1 
ATOM   4038  C CA    . ASP A 1 517 ? -10.988 24.663  35.157  1.00 16.40  ? 517  ASP A CA    1 
ATOM   4039  C C     . ASP A 1 517 ? -11.408 26.137  35.296  1.00 16.95  ? 517  ASP A C     1 
ATOM   4040  O O     . ASP A 1 517 ? -12.335 26.593  34.611  1.00 17.07  ? 517  ASP A O     1 
ATOM   4041  C CB    . ASP A 1 517 ? -9.474  24.456  35.147  1.00 16.76  ? 517  ASP A CB    1 
ATOM   4042  C CG    . ASP A 1 517 ? -8.816  24.920  33.869  1.00 16.73  ? 517  ASP A CG    1 
ATOM   4043  O OD1   . ASP A 1 517 ? -7.614  24.680  33.735  1.00 16.65  ? 517  ASP A OD1   1 
ATOM   4044  O OD2   . ASP A 1 517 ? -9.472  25.528  32.997  1.00 20.25  ? 517  ASP A OD2   1 
ATOM   4045  N N     . ASP A 1 518 ? -10.765 26.882  36.190  1.00 17.10  ? 518  ASP A N     1 
ATOM   4046  C CA    . ASP A 1 518 ? -11.181 28.261  36.446  1.00 17.08  ? 518  ASP A CA    1 
ATOM   4047  C C     . ASP A 1 518 ? -10.476 29.229  35.491  1.00 16.75  ? 518  ASP A C     1 
ATOM   4048  O O     . ASP A 1 518 ? -9.879  30.210  35.918  1.00 17.58  ? 518  ASP A O     1 
ATOM   4049  C CB    . ASP A 1 518 ? -10.933 28.623  37.919  1.00 17.80  ? 518  ASP A CB    1 
ATOM   4050  C CG    . ASP A 1 518 ? -11.743 27.734  38.897  1.00 20.25  ? 518  ASP A CG    1 
ATOM   4051  O OD1   . ASP A 1 518 ? -12.975 27.578  38.715  1.00 21.53  ? 518  ASP A OD1   1 
ATOM   4052  O OD2   . ASP A 1 518 ? -11.139 27.189  39.854  1.00 23.08  ? 518  ASP A OD2   1 
ATOM   4053  N N     . VAL A 1 519 ? -10.532 28.921  34.195  1.00 16.08  ? 519  VAL A N     1 
ATOM   4054  C CA    . VAL A 1 519 ? -9.836  29.686  33.168  1.00 15.07  ? 519  VAL A CA    1 
ATOM   4055  C C     . VAL A 1 519 ? -10.864 30.167  32.167  1.00 14.55  ? 519  VAL A C     1 
ATOM   4056  O O     . VAL A 1 519 ? -11.703 29.397  31.711  1.00 14.10  ? 519  VAL A O     1 
ATOM   4057  C CB    . VAL A 1 519 ? -8.686  28.878  32.468  1.00 14.80  ? 519  VAL A CB    1 
ATOM   4058  C CG1   . VAL A 1 519 ? -8.078  29.671  31.309  1.00 14.90  ? 519  VAL A CG1   1 
ATOM   4059  C CG2   . VAL A 1 519 ? -7.594  28.510  33.451  1.00 14.00  ? 519  VAL A CG2   1 
ATOM   4060  N N     . LEU A 1 520 ? -10.807 31.458  31.866  1.00 14.95  ? 520  LEU A N     1 
ATOM   4061  C CA    . LEU A 1 520 ? -11.736 32.108  30.933  1.00 15.41  ? 520  LEU A CA    1 
ATOM   4062  C C     . LEU A 1 520 ? -11.206 32.234  29.509  1.00 15.16  ? 520  LEU A C     1 
ATOM   4063  O O     . LEU A 1 520 ? -10.009 32.115  29.251  1.00 14.75  ? 520  LEU A O     1 
ATOM   4064  C CB    . LEU A 1 520 ? -12.136 33.489  31.447  1.00 15.38  ? 520  LEU A CB    1 
ATOM   4065  C CG    . LEU A 1 520 ? -12.985 33.524  32.723  1.00 18.06  ? 520  LEU A CG    1 
ATOM   4066  C CD1   . LEU A 1 520 ? -13.623 34.896  32.886  1.00 19.33  ? 520  LEU A CD1   1 
ATOM   4067  C CD2   . LEU A 1 520 ? -14.057 32.409  32.770  1.00 17.37  ? 520  LEU A CD2   1 
ATOM   4068  N N     . ASN A 1 521 ? -12.127 32.475  28.590  1.00 15.28  ? 521  ASN A N     1 
ATOM   4069  C CA    . ASN A 1 521 ? -11.774 32.745  27.216  1.00 15.84  ? 521  ASN A CA    1 
ATOM   4070  C C     . ASN A 1 521 ? -12.552 33.979  26.749  1.00 15.31  ? 521  ASN A C     1 
ATOM   4071  O O     . ASN A 1 521 ? -13.742 33.907  26.425  1.00 15.56  ? 521  ASN A O     1 
ATOM   4072  C CB    . ASN A 1 521 ? -12.016 31.515  26.335  1.00 16.29  ? 521  ASN A CB    1 
ATOM   4073  C CG    . ASN A 1 521 ? -11.337 31.621  24.945  1.00 18.93  ? 521  ASN A CG    1 
ATOM   4074  O OD1   . ASN A 1 521 ? -10.899 30.617  24.363  1.00 19.13  ? 521  ASN A OD1   1 
ATOM   4075  N ND2   . ASN A 1 521 ? -11.271 32.837  24.411  1.00 21.29  ? 521  ASN A ND2   1 
ATOM   4076  N N     . VAL A 1 522 ? -11.873 35.114  26.764  1.00 14.49  ? 522  VAL A N     1 
ATOM   4077  C CA    . VAL A 1 522 ? -12.518 36.397  26.545  1.00 15.00  ? 522  VAL A CA    1 
ATOM   4078  C C     . VAL A 1 522 ? -11.921 37.012  25.287  1.00 15.01  ? 522  VAL A C     1 
ATOM   4079  O O     . VAL A 1 522 ? -10.730 37.349  25.261  1.00 14.62  ? 522  VAL A O     1 
ATOM   4080  C CB    . VAL A 1 522 ? -12.341 37.330  27.770  1.00 14.66  ? 522  VAL A CB    1 
ATOM   4081  C CG1   . VAL A 1 522 ? -13.174 38.599  27.602  1.00 16.18  ? 522  VAL A CG1   1 
ATOM   4082  C CG2   . VAL A 1 522 ? -12.737 36.596  29.069  1.00 14.30  ? 522  VAL A CG2   1 
ATOM   4083  N N     . SER A 1 523 ? -12.738 37.103  24.233  1.00 14.82  ? 523  SER A N     1 
ATOM   4084  C CA    . SER A 1 523 ? -12.279 37.582  22.933  1.00 14.97  ? 523  SER A CA    1 
ATOM   4085  C C     . SER A 1 523 ? -11.039 36.821  22.474  1.00 15.66  ? 523  SER A C     1 
ATOM   4086  O O     . SER A 1 523 ? -10.150 37.392  21.836  1.00 15.52  ? 523  SER A O     1 
ATOM   4087  C CB    . SER A 1 523 ? -11.950 39.073  23.004  1.00 15.13  ? 523  SER A CB    1 
ATOM   4088  O OG    . SER A 1 523 ? -13.114 39.817  23.224  1.00 16.34  ? 523  SER A OG    1 
ATOM   4089  N N     . GLY A 1 524 ? -10.957 35.543  22.838  1.00 16.02  ? 524  GLY A N     1 
ATOM   4090  C CA    . GLY A 1 524 ? -9.823  34.723  22.449  1.00 16.29  ? 524  GLY A CA    1 
ATOM   4091  C C     . GLY A 1 524 ? -8.650  34.816  23.396  1.00 16.42  ? 524  GLY A C     1 
ATOM   4092  O O     . GLY A 1 524 ? -7.579  34.278  23.114  1.00 17.29  ? 524  GLY A O     1 
ATOM   4093  N N     . HIS A 1 525 ? -8.832  35.486  24.523  1.00 15.94  ? 525  HIS A N     1 
ATOM   4094  C CA    . HIS A 1 525 ? -7.735  35.622  25.468  1.00 15.50  ? 525  HIS A CA    1 
ATOM   4095  C C     . HIS A 1 525 ? -7.962  34.698  26.642  1.00 14.68  ? 525  HIS A C     1 
ATOM   4096  O O     . HIS A 1 525 ? -9.060  34.654  27.209  1.00 15.24  ? 525  HIS A O     1 
ATOM   4097  C CB    . HIS A 1 525 ? -7.529  37.085  25.885  1.00 15.85  ? 525  HIS A CB    1 
ATOM   4098  C CG    . HIS A 1 525 ? -7.227  37.994  24.725  1.00 18.84  ? 525  HIS A CG    1 
ATOM   4099  N ND1   . HIS A 1 525 ? -8.003  39.091  24.409  1.00 20.32  ? 525  HIS A ND1   1 
ATOM   4100  C CD2   . HIS A 1 525 ? -6.268  37.926  23.766  1.00 20.85  ? 525  HIS A CD2   1 
ATOM   4101  C CE1   . HIS A 1 525 ? -7.521  39.674  23.325  1.00 20.98  ? 525  HIS A CE1   1 
ATOM   4102  N NE2   . HIS A 1 525 ? -6.469  38.988  22.915  1.00 22.21  ? 525  HIS A NE2   1 
ATOM   4103  N N     . ARG A 1 526 ? -6.924  33.931  26.963  1.00 12.94  ? 526  ARG A N     1 
ATOM   4104  C CA    . ARG A 1 526 ? -6.926  33.033  28.088  1.00 12.10  ? 526  ARG A CA    1 
ATOM   4105  C C     . ARG A 1 526 ? -6.557  33.839  29.337  1.00 12.39  ? 526  ARG A C     1 
ATOM   4106  O O     . ARG A 1 526 ? -5.474  34.440  29.401  1.00 12.23  ? 526  ARG A O     1 
ATOM   4107  C CB    . ARG A 1 526 ? -5.927  31.911  27.819  1.00 11.67  ? 526  ARG A CB    1 
ATOM   4108  C CG    . ARG A 1 526 ? -5.697  30.921  28.950  1.00 10.23  ? 526  ARG A CG    1 
ATOM   4109  C CD    . ARG A 1 526 ? -4.762  29.830  28.455  1.00 6.12   ? 526  ARG A CD    1 
ATOM   4110  N NE    . ARG A 1 526 ? -4.173  29.057  29.540  1.00 5.04   ? 526  ARG A NE    1 
ATOM   4111  C CZ    . ARG A 1 526 ? -3.420  27.969  29.363  1.00 4.93   ? 526  ARG A CZ    1 
ATOM   4112  N NH1   . ARG A 1 526 ? -3.161  27.502  28.141  1.00 2.00   ? 526  ARG A NH1   1 
ATOM   4113  N NH2   . ARG A 1 526 ? -2.921  27.343  30.413  1.00 4.68   ? 526  ARG A NH2   1 
ATOM   4114  N N     . LEU A 1 527 ? -7.471  33.858  30.309  1.00 12.11  ? 527  LEU A N     1 
ATOM   4115  C CA    . LEU A 1 527 ? -7.297  34.595  31.589  1.00 12.55  ? 527  LEU A CA    1 
ATOM   4116  C C     . LEU A 1 527 ? -7.823  33.766  32.751  1.00 12.60  ? 527  LEU A C     1 
ATOM   4117  O O     . LEU A 1 527 ? -8.839  33.099  32.618  1.00 13.26  ? 527  LEU A O     1 
ATOM   4118  C CB    . LEU A 1 527 ? -8.073  35.913  31.559  1.00 12.40  ? 527  LEU A CB    1 
ATOM   4119  C CG    . LEU A 1 527 ? -7.655  36.914  30.479  1.00 13.00  ? 527  LEU A CG    1 
ATOM   4120  C CD1   . LEU A 1 527 ? -8.780  37.889  30.222  1.00 14.39  ? 527  LEU A CD1   1 
ATOM   4121  C CD2   . LEU A 1 527 ? -6.357  37.614  30.886  1.00 12.56  ? 527  LEU A CD2   1 
ATOM   4122  N N     . GLY A 1 528 ? -7.157  33.812  33.896  1.00 12.38  ? 528  GLY A N     1 
ATOM   4123  C CA    . GLY A 1 528 ? -7.625  33.024  35.035  1.00 12.72  ? 528  GLY A CA    1 
ATOM   4124  C C     . GLY A 1 528 ? -8.557  33.878  35.848  1.00 13.19  ? 528  GLY A C     1 
ATOM   4125  O O     . GLY A 1 528 ? -8.346  35.083  35.936  1.00 13.69  ? 528  GLY A O     1 
ATOM   4126  N N     . THR A 1 529 ? -9.595  33.275  36.424  1.00 13.72  ? 529  THR A N     1 
ATOM   4127  C CA    . THR A 1 529 ? -10.559 34.022  37.258  1.00 14.09  ? 529  THR A CA    1 
ATOM   4128  C C     . THR A 1 529 ? -9.865  34.531  38.509  1.00 13.99  ? 529  THR A C     1 
ATOM   4129  O O     . THR A 1 529 ? -10.077 35.672  38.918  1.00 13.57  ? 529  THR A O     1 
ATOM   4130  C CB    . THR A 1 529 ? -11.782 33.157  37.675  1.00 14.45  ? 529  THR A CB    1 
ATOM   4131  O OG1   . THR A 1 529 ? -11.321 31.918  38.219  1.00 15.05  ? 529  THR A OG1   1 
ATOM   4132  C CG2   . THR A 1 529 ? -12.676 32.865  36.482  1.00 14.94  ? 529  THR A CG2   1 
ATOM   4133  N N     . ALA A 1 530 ? -8.999  33.686  39.080  1.00 14.31  ? 530  ALA A N     1 
ATOM   4134  C CA    . ALA A 1 530 ? -8.183  34.049  40.241  1.00 14.80  ? 530  ALA A CA    1 
ATOM   4135  C C     . ALA A 1 530 ? -7.315  35.296  40.050  1.00 15.56  ? 530  ALA A C     1 
ATOM   4136  O O     . ALA A 1 530 ? -7.200  36.095  40.983  1.00 15.94  ? 530  ALA A O     1 
ATOM   4137  C CB    . ALA A 1 530 ? -7.308  32.840  40.705  1.00 14.67  ? 530  ALA A CB    1 
ATOM   4138  N N     . GLU A 1 531 ? -6.694  35.473  38.877  1.00 15.73  ? 531  GLU A N     1 
ATOM   4139  C CA    . GLU A 1 531 ? -5.834  36.654  38.665  1.00 16.69  ? 531  GLU A CA    1 
ATOM   4140  C C     . GLU A 1 531 ? -6.661  37.940  38.546  1.00 16.40  ? 531  GLU A C     1 
ATOM   4141  O O     . GLU A 1 531 ? -6.196  39.032  38.888  1.00 16.65  ? 531  GLU A O     1 
ATOM   4142  C CB    . GLU A 1 531 ? -4.857  36.472  37.488  1.00 16.62  ? 531  GLU A CB    1 
ATOM   4143  C CG    . GLU A 1 531 ? -5.457  36.596  36.073  1.00 18.70  ? 531  GLU A CG    1 
ATOM   4144  C CD    . GLU A 1 531 ? -4.445  36.222  34.965  1.00 18.20  ? 531  GLU A CD    1 
ATOM   4145  O OE1   . GLU A 1 531 ? -3.487  36.995  34.733  1.00 19.92  ? 531  GLU A OE1   1 
ATOM   4146  O OE2   . GLU A 1 531 ? -4.611  35.160  34.318  1.00 18.27  ? 531  GLU A OE2   1 
ATOM   4147  N N     . ILE A 1 532 ? -7.901  37.798  38.079  1.00 16.56  ? 532  ILE A N     1 
ATOM   4148  C CA    . ILE A 1 532 ? -8.821  38.916  38.024  1.00 15.68  ? 532  ILE A CA    1 
ATOM   4149  C C     . ILE A 1 532 ? -9.260  39.234  39.457  1.00 15.73  ? 532  ILE A C     1 
ATOM   4150  O O     . ILE A 1 532 ? -9.296  40.402  39.852  1.00 14.58  ? 532  ILE A O     1 
ATOM   4151  C CB    . ILE A 1 532 ? -10.002 38.646  37.064  1.00 16.12  ? 532  ILE A CB    1 
ATOM   4152  C CG1   . ILE A 1 532 ? -9.453  38.249  35.689  1.00 16.20  ? 532  ILE A CG1   1 
ATOM   4153  C CG2   . ILE A 1 532 ? -10.932 39.907  36.949  1.00 14.75  ? 532  ILE A CG2   1 
ATOM   4154  C CD1   . ILE A 1 532 ? -10.494 37.986  34.609  1.00 15.64  ? 532  ILE A CD1   1 
ATOM   4155  N N     . GLU A 1 533 ? -9.525  38.181  40.242  1.00 15.69  ? 533  GLU A N     1 
ATOM   4156  C CA    . GLU A 1 533 ? -9.919  38.336  41.646  1.00 15.53  ? 533  GLU A CA    1 
ATOM   4157  C C     . GLU A 1 533 ? -8.866  39.055  42.504  1.00 15.78  ? 533  GLU A C     1 
ATOM   4158  O O     . GLU A 1 533 ? -9.200  40.011  43.221  1.00 15.53  ? 533  GLU A O     1 
ATOM   4159  C CB    . GLU A 1 533 ? -10.308 36.987  42.252  1.00 15.71  ? 533  GLU A CB    1 
ATOM   4160  C CG    . GLU A 1 533 ? -11.605 36.411  41.684  1.00 16.02  ? 533  GLU A CG    1 
ATOM   4161  C CD    . GLU A 1 533 ? -11.865 34.963  42.091  1.00 15.79  ? 533  GLU A CD    1 
ATOM   4162  O OE1   . GLU A 1 533 ? -11.046 34.388  42.826  1.00 18.14  ? 533  GLU A OE1   1 
ATOM   4163  O OE2   . GLU A 1 533 ? -12.898 34.401  41.684  1.00 13.98  ? 533  GLU A OE2   1 
ATOM   4164  N N     . SER A 1 534 ? -7.609  38.613  42.414  1.00 15.94  ? 534  SER A N     1 
ATOM   4165  C CA    . SER A 1 534 ? -6.473  39.272  43.076  1.00 16.89  ? 534  SER A CA    1 
ATOM   4166  C C     . SER A 1 534 ? -6.350  40.746  42.683  1.00 16.58  ? 534  SER A C     1 
ATOM   4167  O O     . SER A 1 534 ? -6.144  41.607  43.533  1.00 16.17  ? 534  SER A O     1 
ATOM   4168  C CB    . SER A 1 534 ? -5.156  38.574  42.727  1.00 16.98  ? 534  SER A CB    1 
ATOM   4169  O OG    . SER A 1 534 ? -5.219  37.202  43.048  1.00 19.84  ? 534  SER A OG    1 
ATOM   4170  N N     . ALA A 1 535 ? -6.449  41.012  41.385  1.00 16.68  ? 535  ALA A N     1 
ATOM   4171  C CA    . ALA A 1 535 ? -6.409  42.382  40.864  1.00 16.48  ? 535  ALA A CA    1 
ATOM   4172  C C     . ALA A 1 535 ? -7.523  43.225  41.471  1.00 16.42  ? 535  ALA A C     1 
ATOM   4173  O O     . ALA A 1 535 ? -7.284  44.358  41.904  1.00 16.11  ? 535  ALA A O     1 
ATOM   4174  C CB    . ALA A 1 535 ? -6.506  42.387  39.353  1.00 16.52  ? 535  ALA A CB    1 
ATOM   4175  N N     . LEU A 1 536 ? -8.730  42.665  41.523  1.00 16.03  ? 536  LEU A N     1 
ATOM   4176  C CA    . LEU A 1 536 ? -9.851  43.341  42.193  1.00 16.08  ? 536  LEU A CA    1 
ATOM   4177  C C     . LEU A 1 536 ? -9.607  43.610  43.672  1.00 16.37  ? 536  LEU A C     1 
ATOM   4178  O O     . LEU A 1 536 ? -9.887  44.710  44.153  1.00 16.94  ? 536  LEU A O     1 
ATOM   4179  C CB    . LEU A 1 536 ? -11.147 42.552  42.027  1.00 16.23  ? 536  LEU A CB    1 
ATOM   4180  C CG    . LEU A 1 536 ? -11.847 42.646  40.664  1.00 15.36  ? 536  LEU A CG    1 
ATOM   4181  C CD1   . LEU A 1 536 ? -12.808 41.497  40.478  1.00 12.89  ? 536  LEU A CD1   1 
ATOM   4182  C CD2   . LEU A 1 536 ? -12.560 43.980  40.495  1.00 13.14  ? 536  LEU A CD2   1 
ATOM   4183  N N     . VAL A 1 537 ? -9.090  42.611  44.392  1.00 16.12  ? 537  VAL A N     1 
ATOM   4184  C CA    . VAL A 1 537 ? -8.927  42.711  45.839  1.00 15.69  ? 537  VAL A CA    1 
ATOM   4185  C C     . VAL A 1 537 ? -7.766  43.657  46.208  1.00 15.83  ? 537  VAL A C     1 
ATOM   4186  O O     . VAL A 1 537 ? -7.755  44.223  47.291  1.00 15.21  ? 537  VAL A O     1 
ATOM   4187  C CB    . VAL A 1 537 ? -8.801  41.303  46.511  1.00 15.85  ? 537  VAL A CB    1 
ATOM   4188  C CG1   . VAL A 1 537 ? -8.515  41.421  48.005  1.00 16.18  ? 537  VAL A CG1   1 
ATOM   4189  C CG2   . VAL A 1 537 ? -10.089 40.502  46.324  1.00 15.51  ? 537  VAL A CG2   1 
ATOM   4190  N N     . ALA A 1 538 ? -6.808  43.834  45.300  1.00 15.86  ? 538  ALA A N     1 
ATOM   4191  C CA    . ALA A 1 538 ? -5.727  44.811  45.481  1.00 16.32  ? 538  ALA A CA    1 
ATOM   4192  C C     . ALA A 1 538 ? -6.267  46.252  45.581  1.00 16.94  ? 538  ALA A C     1 
ATOM   4193  O O     . ALA A 1 538 ? -5.560  47.165  46.014  1.00 16.84  ? 538  ALA A O     1 
ATOM   4194  C CB    . ALA A 1 538 ? -4.731  44.706  44.347  1.00 15.64  ? 538  ALA A CB    1 
ATOM   4195  N N     . HIS A 1 539 ? -7.518  46.447  45.164  1.00 17.40  ? 539  HIS A N     1 
ATOM   4196  C CA    . HIS A 1 539 ? -8.158  47.761  45.260  1.00 17.77  ? 539  HIS A CA    1 
ATOM   4197  C C     . HIS A 1 539 ? -8.513  48.080  46.704  1.00 17.58  ? 539  HIS A C     1 
ATOM   4198  O O     . HIS A 1 539 ? -9.141  47.263  47.372  1.00 17.50  ? 539  HIS A O     1 
ATOM   4199  C CB    . HIS A 1 539 ? -9.414  47.817  44.388  1.00 17.89  ? 539  HIS A CB    1 
ATOM   4200  C CG    . HIS A 1 539 ? -10.000 49.184  44.282  1.00 18.16  ? 539  HIS A CG    1 
ATOM   4201  N ND1   . HIS A 1 539 ? -10.737 49.756  45.296  1.00 19.21  ? 539  HIS A ND1   1 
ATOM   4202  C CD2   . HIS A 1 539 ? -9.939  50.103  43.292  1.00 19.10  ? 539  HIS A CD2   1 
ATOM   4203  C CE1   . HIS A 1 539 ? -11.106 50.972  44.936  1.00 20.38  ? 539  HIS A CE1   1 
ATOM   4204  N NE2   . HIS A 1 539 ? -10.631 51.208  43.726  1.00 20.89  ? 539  HIS A NE2   1 
ATOM   4205  N N     . PRO A 1 540 ? -8.121  49.279  47.188  1.00 17.79  ? 540  PRO A N     1 
ATOM   4206  C CA    . PRO A 1 540 ? -8.276  49.590  48.622  1.00 17.60  ? 540  PRO A CA    1 
ATOM   4207  C C     . PRO A 1 540 ? -9.715  49.734  49.155  1.00 17.79  ? 540  PRO A C     1 
ATOM   4208  O O     . PRO A 1 540 ? -9.897  49.838  50.366  1.00 17.17  ? 540  PRO A O     1 
ATOM   4209  C CB    . PRO A 1 540 ? -7.477  50.891  48.804  1.00 17.46  ? 540  PRO A CB    1 
ATOM   4210  C CG    . PRO A 1 540 ? -7.421  51.509  47.441  1.00 18.33  ? 540  PRO A CG    1 
ATOM   4211  C CD    . PRO A 1 540 ? -7.502  50.387  46.428  1.00 17.19  ? 540  PRO A CD    1 
ATOM   4212  N N     . LYS A 1 541 ? -10.719 49.715  48.275  1.00 17.99  ? 541  LYS A N     1 
ATOM   4213  C CA    . LYS A 1 541 ? -12.125 49.711  48.717  1.00 18.12  ? 541  LYS A CA    1 
ATOM   4214  C C     . LYS A 1 541 ? -12.733 48.315  48.677  1.00 17.55  ? 541  LYS A C     1 
ATOM   4215  O O     . LYS A 1 541 ? -13.814 48.093  49.237  1.00 18.03  ? 541  LYS A O     1 
ATOM   4216  C CB    . LYS A 1 541 ? -13.000 50.639  47.867  1.00 17.92  ? 541  LYS A CB    1 
ATOM   4217  C CG    . LYS A 1 541 ? -12.928 52.126  48.210  1.00 19.03  ? 541  LYS A CG    1 
ATOM   4218  C CD    . LYS A 1 541 ? -13.737 52.921  47.175  1.00 19.47  ? 541  LYS A CD    1 
ATOM   4219  C CE    . LYS A 1 541 ? -13.481 54.429  47.233  1.00 23.57  ? 541  LYS A CE    1 
ATOM   4220  N NZ    . LYS A 1 541 ? -13.499 55.008  45.839  1.00 25.54  ? 541  LYS A NZ    1 
ATOM   4221  N N     . ILE A 1 542 ? -12.057 47.386  48.007  1.00 16.60  ? 542  ILE A N     1 
ATOM   4222  C CA    . ILE A 1 542 ? -12.605 46.044  47.781  1.00 16.39  ? 542  ILE A CA    1 
ATOM   4223  C C     . ILE A 1 542 ? -12.092 45.050  48.819  1.00 16.67  ? 542  ILE A C     1 
ATOM   4224  O O     . ILE A 1 542 ? -10.887 44.977  49.083  1.00 16.55  ? 542  ILE A O     1 
ATOM   4225  C CB    . ILE A 1 542 ? -12.326 45.521  46.331  1.00 16.26  ? 542  ILE A CB    1 
ATOM   4226  C CG1   . ILE A 1 542 ? -13.075 46.373  45.292  1.00 15.86  ? 542  ILE A CG1   1 
ATOM   4227  C CG2   . ILE A 1 542 ? -12.699 44.035  46.207  1.00 15.67  ? 542  ILE A CG2   1 
ATOM   4228  C CD1   . ILE A 1 542 ? -12.764 46.065  43.833  1.00 16.11  ? 542  ILE A CD1   1 
ATOM   4229  N N     . ALA A 1 543 ? -13.028 44.301  49.406  1.00 16.87  ? 543  ALA A N     1 
ATOM   4230  C CA    . ALA A 1 543 ? -12.739 43.292  50.418  1.00 16.70  ? 543  ALA A CA    1 
ATOM   4231  C C     . ALA A 1 543 ? -12.594 41.903  49.814  1.00 16.96  ? 543  ALA A C     1 
ATOM   4232  O O     . ALA A 1 543 ? -11.623 41.187  50.091  1.00 17.12  ? 543  ALA A O     1 
ATOM   4233  C CB    . ALA A 1 543 ? -13.843 43.285  51.488  1.00 16.72  ? 543  ALA A CB    1 
ATOM   4234  N N     . GLU A 1 544 ? -13.590 41.511  49.022  1.00 17.17  ? 544  GLU A N     1 
ATOM   4235  C CA    . GLU A 1 544 ? -13.640 40.194  48.394  1.00 17.47  ? 544  GLU A CA    1 
ATOM   4236  C C     . GLU A 1 544 ? -14.198 40.311  46.974  1.00 17.36  ? 544  GLU A C     1 
ATOM   4237  O O     . GLU A 1 544 ? -14.969 41.226  46.671  1.00 16.67  ? 544  GLU A O     1 
ATOM   4238  C CB    . GLU A 1 544 ? -14.510 39.219  49.204  1.00 17.14  ? 544  GLU A CB    1 
ATOM   4239  C CG    . GLU A 1 544 ? -14.049 38.954  50.624  1.00 18.22  ? 544  GLU A CG    1 
ATOM   4240  C CD    . GLU A 1 544 ? -14.936 37.939  51.338  1.00 18.72  ? 544  GLU A CD    1 
ATOM   4241  O OE1   . GLU A 1 544 ? -15.750 38.339  52.190  1.00 17.94  ? 544  GLU A OE1   1 
ATOM   4242  O OE2   . GLU A 1 544 ? -14.829 36.740  51.025  1.00 20.92  ? 544  GLU A OE2   1 
ATOM   4243  N N     . ALA A 1 545 ? -13.791 39.371  46.122  1.00 17.33  ? 545  ALA A N     1 
ATOM   4244  C CA    . ALA A 1 545 ? -14.278 39.271  44.752  1.00 17.70  ? 545  ALA A CA    1 
ATOM   4245  C C     . ALA A 1 545 ? -14.435 37.812  44.347  1.00 17.34  ? 545  ALA A C     1 
ATOM   4246  O O     . ALA A 1 545 ? -13.672 36.963  44.787  1.00 17.60  ? 545  ALA A O     1 
ATOM   4247  C CB    . ALA A 1 545 ? -13.341 40.011  43.762  1.00 17.25  ? 545  ALA A CB    1 
ATOM   4248  N N     . ALA A 1 546 ? -15.431 37.540  43.509  1.00 17.08  ? 546  ALA A N     1 
ATOM   4249  C CA    . ALA A 1 546 ? -15.600 36.231  42.887  1.00 16.76  ? 546  ALA A CA    1 
ATOM   4250  C C     . ALA A 1 546 ? -15.893 36.463  41.423  1.00 16.60  ? 546  ALA A C     1 
ATOM   4251  O O     . ALA A 1 546 ? -16.877 37.116  41.075  1.00 16.94  ? 546  ALA A O     1 
ATOM   4252  C CB    . ALA A 1 546 ? -16.732 35.467  43.530  1.00 16.70  ? 546  ALA A CB    1 
ATOM   4253  N N     . VAL A 1 547 ? -15.028 35.941  40.567  1.00 16.01  ? 547  VAL A N     1 
ATOM   4254  C CA    . VAL A 1 547 ? -15.132 36.206  39.139  1.00 15.78  ? 547  VAL A CA    1 
ATOM   4255  C C     . VAL A 1 547 ? -15.558 34.942  38.437  1.00 15.40  ? 547  VAL A C     1 
ATOM   4256  O O     . VAL A 1 547 ? -15.008 33.881  38.682  1.00 15.95  ? 547  VAL A O     1 
ATOM   4257  C CB    . VAL A 1 547 ? -13.796 36.766  38.567  1.00 15.48  ? 547  VAL A CB    1 
ATOM   4258  C CG1   . VAL A 1 547 ? -13.875 36.964  37.062  1.00 15.12  ? 547  VAL A CG1   1 
ATOM   4259  C CG2   . VAL A 1 547 ? -13.448 38.085  39.260  1.00 15.34  ? 547  VAL A CG2   1 
ATOM   4260  N N     . VAL A 1 548 ? -16.573 35.064  37.591  1.00 15.71  ? 548  VAL A N     1 
ATOM   4261  C CA    . VAL A 1 548 ? -17.031 33.977  36.727  1.00 14.66  ? 548  VAL A CA    1 
ATOM   4262  C C     . VAL A 1 548 ? -17.128 34.496  35.289  1.00 14.41  ? 548  VAL A C     1 
ATOM   4263  O O     . VAL A 1 548 ? -17.160 35.718  35.065  1.00 14.95  ? 548  VAL A O     1 
ATOM   4264  C CB    . VAL A 1 548 ? -18.422 33.396  37.189  1.00 14.80  ? 548  VAL A CB    1 
ATOM   4265  C CG1   . VAL A 1 548 ? -18.341 32.779  38.583  1.00 15.14  ? 548  VAL A CG1   1 
ATOM   4266  C CG2   . VAL A 1 548 ? -19.516 34.436  37.147  1.00 13.19  ? 548  VAL A CG2   1 
ATOM   4267  N N     . GLY A 1 549 ? -17.181 33.576  34.321  1.00 14.00  ? 549  GLY A N     1 
ATOM   4268  C CA    . GLY A 1 549 ? -17.462 33.917  32.928  1.00 13.78  ? 549  GLY A CA    1 
ATOM   4269  C C     . GLY A 1 549 ? -18.924 33.711  32.554  1.00 14.37  ? 549  GLY A C     1 
ATOM   4270  O O     . GLY A 1 549 ? -19.598 32.822  33.085  1.00 13.03  ? 549  GLY A O     1 
ATOM   4271  N N     . ILE A 1 550 ? -19.434 34.552  31.654  1.00 14.90  ? 550  ILE A N     1 
ATOM   4272  C CA    . ILE A 1 550 ? -20.792 34.367  31.153  1.00 16.01  ? 550  ILE A CA    1 
ATOM   4273  C C     . ILE A 1 550 ? -20.746 34.332  29.640  1.00 16.38  ? 550  ILE A C     1 
ATOM   4274  O O     . ILE A 1 550 ? -19.846 34.948  29.065  1.00 16.87  ? 550  ILE A O     1 
ATOM   4275  C CB    . ILE A 1 550 ? -21.772 35.461  31.666  1.00 16.28  ? 550  ILE A CB    1 
ATOM   4276  C CG1   . ILE A 1 550 ? -21.287 36.878  31.303  1.00 16.87  ? 550  ILE A CG1   1 
ATOM   4277  C CG2   . ILE A 1 550 ? -21.962 35.314  33.166  1.00 17.00  ? 550  ILE A CG2   1 
ATOM   4278  C CD1   . ILE A 1 550 ? -22.375 37.978  31.437  1.00 15.97  ? 550  ILE A CD1   1 
ATOM   4279  N N     . PRO A 1 551 ? -21.702 33.629  28.986  1.00 16.44  ? 551  PRO A N     1 
ATOM   4280  C CA    . PRO A 1 551 ? -21.662 33.613  27.517  1.00 16.77  ? 551  PRO A CA    1 
ATOM   4281  C C     . PRO A 1 551 ? -21.812 35.021  26.959  1.00 17.35  ? 551  PRO A C     1 
ATOM   4282  O O     . PRO A 1 551 ? -22.490 35.864  27.573  1.00 18.07  ? 551  PRO A O     1 
ATOM   4283  C CB    . PRO A 1 551 ? -22.886 32.763  27.140  1.00 16.69  ? 551  PRO A CB    1 
ATOM   4284  C CG    . PRO A 1 551 ? -23.187 31.944  28.386  1.00 16.37  ? 551  PRO A CG    1 
ATOM   4285  C CD    . PRO A 1 551 ? -22.846 32.850  29.512  1.00 16.54  ? 551  PRO A CD    1 
ATOM   4286  N N     . HIS A 1 552 ? -21.158 35.287  25.835  1.00 17.58  ? 552  HIS A N     1 
ATOM   4287  C CA    . HIS A 1 552 ? -21.209 36.599  25.202  1.00 17.87  ? 552  HIS A CA    1 
ATOM   4288  C C     . HIS A 1 552 ? -21.182 36.399  23.704  1.00 17.96  ? 552  HIS A C     1 
ATOM   4289  O O     . HIS A 1 552 ? -20.317 35.695  23.187  1.00 18.31  ? 552  HIS A O     1 
ATOM   4290  C CB    . HIS A 1 552 ? -20.038 37.482  25.655  1.00 18.48  ? 552  HIS A CB    1 
ATOM   4291  C CG    . HIS A 1 552 ? -20.134 38.896  25.169  1.00 19.67  ? 552  HIS A CG    1 
ATOM   4292  N ND1   . HIS A 1 552 ? -20.523 39.937  25.981  1.00 21.27  ? 552  HIS A ND1   1 
ATOM   4293  C CD2   . HIS A 1 552 ? -19.926 39.434  23.942  1.00 21.42  ? 552  HIS A CD2   1 
ATOM   4294  C CE1   . HIS A 1 552 ? -20.551 41.055  25.277  1.00 22.26  ? 552  HIS A CE1   1 
ATOM   4295  N NE2   . HIS A 1 552 ? -20.191 40.778  24.037  1.00 21.66  ? 552  HIS A NE2   1 
ATOM   4296  N N     . ALA A 1 553 ? -22.133 37.006  23.000  1.00 17.84  ? 553  ALA A N     1 
ATOM   4297  C CA    . ALA A 1 553 ? -22.324 36.709  21.582  1.00 17.98  ? 553  ALA A CA    1 
ATOM   4298  C C     . ALA A 1 553 ? -21.085 37.067  20.763  1.00 18.11  ? 553  ALA A C     1 
ATOM   4299  O O     . ALA A 1 553 ? -20.774 36.411  19.772  1.00 18.81  ? 553  ALA A O     1 
ATOM   4300  C CB    . ALA A 1 553 ? -23.564 37.431  21.036  1.00 17.46  ? 553  ALA A CB    1 
ATOM   4301  N N     . ILE A 1 554 ? -20.391 38.109  21.192  1.00 18.71  ? 554  ILE A N     1 
ATOM   4302  C CA    . ILE A 1 554 ? -19.209 38.611  20.492  1.00 19.70  ? 554  ILE A CA    1 
ATOM   4303  C C     . ILE A 1 554 ? -17.892 38.068  21.084  1.00 19.41  ? 554  ILE A C     1 
ATOM   4304  O O     . ILE A 1 554 ? -17.104 37.431  20.357  1.00 19.63  ? 554  ILE A O     1 
ATOM   4305  C CB    . ILE A 1 554 ? -19.224 40.167  20.417  1.00 20.06  ? 554  ILE A CB    1 
ATOM   4306  C CG1   . ILE A 1 554 ? -20.296 40.644  19.419  1.00 21.06  ? 554  ILE A CG1   1 
ATOM   4307  C CG2   . ILE A 1 554 ? -17.843 40.733  19.999  1.00 22.07  ? 554  ILE A CG2   1 
ATOM   4308  C CD1   . ILE A 1 554 ? -20.097 40.104  17.935  1.00 21.83  ? 554  ILE A CD1   1 
ATOM   4309  N N     . LYS A 1 555 ? -17.688 38.295  22.385  1.00 18.58  ? 555  LYS A N     1 
ATOM   4310  C CA    . LYS A 1 555 ? -16.446 37.930  23.078  1.00 19.06  ? 555  LYS A CA    1 
ATOM   4311  C C     . LYS A 1 555 ? -16.331 36.432  23.385  1.00 18.83  ? 555  LYS A C     1 
ATOM   4312  O O     . LYS A 1 555 ? -15.263 35.966  23.789  1.00 19.36  ? 555  LYS A O     1 
ATOM   4313  C CB    . LYS A 1 555 ? -16.294 38.711  24.388  1.00 18.98  ? 555  LYS A CB    1 
ATOM   4314  C CG    . LYS A 1 555 ? -16.389 40.224  24.261  1.00 19.00  ? 555  LYS A CG    1 
ATOM   4315  C CD    . LYS A 1 555 ? -16.076 40.900  25.585  1.00 19.71  ? 555  LYS A CD    1 
ATOM   4316  C CE    . LYS A 1 555 ? -16.298 42.395  25.486  1.00 23.25  ? 555  LYS A CE    1 
ATOM   4317  N NZ    . LYS A 1 555 ? -15.731 43.123  26.640  1.00 24.87  ? 555  LYS A NZ    1 
ATOM   4318  N N     . GLY A 1 556 ? -17.422 35.689  23.203  1.00 18.47  ? 556  GLY A N     1 
ATOM   4319  C CA    . GLY A 1 556 ? -17.469 34.266  23.575  1.00 18.24  ? 556  GLY A CA    1 
ATOM   4320  C C     . GLY A 1 556 ? -17.796 34.062  25.046  1.00 17.98  ? 556  GLY A C     1 
ATOM   4321  O O     . GLY A 1 556 ? -18.738 33.344  25.381  1.00 18.41  ? 556  GLY A O     1 
ATOM   4322  N N     . GLN A 1 557 ? -16.992 34.674  25.918  1.00 17.53  ? 557  GLN A N     1 
ATOM   4323  C CA    . GLN A 1 557 ? -17.298 34.807  27.349  1.00 17.04  ? 557  GLN A CA    1 
ATOM   4324  C C     . GLN A 1 557 ? -17.025 36.222  27.760  1.00 16.98  ? 557  GLN A C     1 
ATOM   4325  O O     . GLN A 1 557 ? -16.058 36.840  27.310  1.00 16.81  ? 557  GLN A O     1 
ATOM   4326  C CB    . GLN A 1 557 ? -16.427 33.916  28.230  1.00 16.94  ? 557  GLN A CB    1 
ATOM   4327  C CG    . GLN A 1 557 ? -16.951 32.530  28.421  1.00 17.68  ? 557  GLN A CG    1 
ATOM   4328  C CD    . GLN A 1 557 ? -16.170 31.756  29.464  1.00 18.85  ? 557  GLN A CD    1 
ATOM   4329  O OE1   . GLN A 1 557 ? -14.942 31.845  29.526  1.00 20.99  ? 557  GLN A OE1   1 
ATOM   4330  N NE2   . GLN A 1 557 ? -16.882 30.982  30.288  1.00 16.62  ? 557  GLN A NE2   1 
ATOM   4331  N N     . ALA A 1 558 ? -17.872 36.737  28.632  1.00 17.04  ? 558  ALA A N     1 
ATOM   4332  C CA    . ALA A 1 558 ? -17.640 38.043  29.231  1.00 16.83  ? 558  ALA A CA    1 
ATOM   4333  C C     . ALA A 1 558 ? -17.218 37.803  30.683  1.00 16.55  ? 558  ALA A C     1 
ATOM   4334  O O     . ALA A 1 558 ? -17.472 36.756  31.232  1.00 16.10  ? 558  ALA A O     1 
ATOM   4335  C CB    . ALA A 1 558 ? -18.913 38.880  29.166  1.00 16.60  ? 558  ALA A CB    1 
ATOM   4336  N N     . ILE A 1 559 ? -16.579 38.789  31.290  1.00 16.83  ? 559  ILE A N     1 
ATOM   4337  C CA    . ILE A 1 559 ? -16.117 38.667  32.655  1.00 16.76  ? 559  ILE A CA    1 
ATOM   4338  C C     . ILE A 1 559 ? -17.150 39.248  33.591  1.00 17.16  ? 559  ILE A C     1 
ATOM   4339  O O     . ILE A 1 559 ? -17.532 40.411  33.448  1.00 16.92  ? 559  ILE A O     1 
ATOM   4340  C CB    . ILE A 1 559 ? -14.773 39.405  32.871  1.00 16.98  ? 559  ILE A CB    1 
ATOM   4341  C CG1   . ILE A 1 559 ? -13.700 38.846  31.920  1.00 16.62  ? 559  ILE A CG1   1 
ATOM   4342  C CG2   . ILE A 1 559 ? -14.370 39.358  34.374  1.00 15.35  ? 559  ILE A CG2   1 
ATOM   4343  C CD1   . ILE A 1 559 ? -12.414 39.672  31.821  1.00 16.33  ? 559  ILE A CD1   1 
ATOM   4344  N N     . TYR A 1 560 ? -17.576 38.432  34.560  1.00 17.91  ? 560  TYR A N     1 
ATOM   4345  C CA    . TYR A 1 560 ? -18.596 38.839  35.519  1.00 17.59  ? 560  TYR A CA    1 
ATOM   4346  C C     . TYR A 1 560 ? -18.003 38.765  36.911  1.00 17.54  ? 560  TYR A C     1 
ATOM   4347  O O     . TYR A 1 560 ? -17.616 37.683  37.387  1.00 17.83  ? 560  TYR A O     1 
ATOM   4348  C CB    . TYR A 1 560 ? -19.814 37.932  35.375  1.00 17.90  ? 560  TYR A CB    1 
ATOM   4349  C CG    . TYR A 1 560 ? -21.072 38.364  36.113  1.00 18.02  ? 560  TYR A CG    1 
ATOM   4350  C CD1   . TYR A 1 560 ? -21.145 38.308  37.501  1.00 18.84  ? 560  TYR A CD1   1 
ATOM   4351  C CD2   . TYR A 1 560 ? -22.208 38.789  35.412  1.00 18.65  ? 560  TYR A CD2   1 
ATOM   4352  C CE1   . TYR A 1 560 ? -22.300 38.688  38.170  1.00 19.49  ? 560  TYR A CE1   1 
ATOM   4353  C CE2   . TYR A 1 560 ? -23.369 39.170  36.076  1.00 17.35  ? 560  TYR A CE2   1 
ATOM   4354  C CZ    . TYR A 1 560 ? -23.409 39.113  37.453  1.00 18.54  ? 560  TYR A CZ    1 
ATOM   4355  O OH    . TYR A 1 560 ? -24.554 39.484  38.134  1.00 18.60  ? 560  TYR A OH    1 
ATOM   4356  N N     . ALA A 1 561 ? -17.931 39.912  37.575  1.00 17.59  ? 561  ALA A N     1 
ATOM   4357  C CA    . ALA A 1 561 ? -17.278 39.989  38.887  1.00 17.30  ? 561  ALA A CA    1 
ATOM   4358  C C     . ALA A 1 561 ? -18.228 40.341  40.031  1.00 17.25  ? 561  ALA A C     1 
ATOM   4359  O O     . ALA A 1 561 ? -18.842 41.417  40.041  1.00 17.31  ? 561  ALA A O     1 
ATOM   4360  C CB    . ALA A 1 561 ? -16.112 40.976  38.839  1.00 17.59  ? 561  ALA A CB    1 
ATOM   4361  N N     . TYR A 1 562 ? -18.356 39.425  40.997  1.00 17.10  ? 562  TYR A N     1 
ATOM   4362  C CA    . TYR A 1 562 ? -19.064 39.717  42.257  1.00 16.72  ? 562  TYR A CA    1 
ATOM   4363  C C     . TYR A 1 562 ? -18.067 40.367  43.195  1.00 17.04  ? 562  TYR A C     1 
ATOM   4364  O O     . TYR A 1 562 ? -16.988 39.821  43.424  1.00 17.20  ? 562  TYR A O     1 
ATOM   4365  C CB    . TYR A 1 562 ? -19.590 38.443  42.922  1.00 16.26  ? 562  TYR A CB    1 
ATOM   4366  C CG    . TYR A 1 562 ? -20.655 37.694  42.147  1.00 15.90  ? 562  TYR A CG    1 
ATOM   4367  C CD1   . TYR A 1 562 ? -20.310 36.812  41.116  1.00 14.78  ? 562  TYR A CD1   1 
ATOM   4368  C CD2   . TYR A 1 562 ? -22.008 37.851  42.467  1.00 14.98  ? 562  TYR A CD2   1 
ATOM   4369  C CE1   . TYR A 1 562 ? -21.295 36.114  40.413  1.00 17.50  ? 562  TYR A CE1   1 
ATOM   4370  C CE2   . TYR A 1 562 ? -23.004 37.156  41.779  1.00 15.62  ? 562  TYR A CE2   1 
ATOM   4371  C CZ    . TYR A 1 562 ? -22.646 36.289  40.758  1.00 16.22  ? 562  TYR A CZ    1 
ATOM   4372  O OH    . TYR A 1 562 ? -23.630 35.616  40.081  1.00 14.16  ? 562  TYR A OH    1 
ATOM   4373  N N     . VAL A 1 563 ? -18.436 41.512  43.762  1.00 17.59  ? 563  VAL A N     1 
ATOM   4374  C CA    . VAL A 1 563 ? -17.505 42.320  44.535  1.00 17.82  ? 563  VAL A CA    1 
ATOM   4375  C C     . VAL A 1 563 ? -18.104 42.751  45.866  1.00 18.25  ? 563  VAL A C     1 
ATOM   4376  O O     . VAL A 1 563 ? -19.178 43.375  45.921  1.00 17.76  ? 563  VAL A O     1 
ATOM   4377  C CB    . VAL A 1 563 ? -17.045 43.571  43.726  1.00 18.34  ? 563  VAL A CB    1 
ATOM   4378  C CG1   . VAL A 1 563 ? -16.187 44.498  44.589  1.00 17.79  ? 563  VAL A CG1   1 
ATOM   4379  C CG2   . VAL A 1 563 ? -16.305 43.153  42.439  1.00 17.83  ? 563  VAL A CG2   1 
ATOM   4380  N N     . THR A 1 564 ? -17.395 42.405  46.933  1.00 18.61  ? 564  THR A N     1 
ATOM   4381  C CA    . THR A 1 564 ? -17.750 42.814  48.275  1.00 19.22  ? 564  THR A CA    1 
ATOM   4382  C C     . THR A 1 564 ? -16.813 43.949  48.680  1.00 20.09  ? 564  THR A C     1 
ATOM   4383  O O     . THR A 1 564 ? -15.585 43.798  48.667  1.00 20.81  ? 564  THR A O     1 
ATOM   4384  C CB    . THR A 1 564 ? -17.690 41.617  49.272  1.00 19.11  ? 564  THR A CB    1 
ATOM   4385  O OG1   . THR A 1 564 ? -18.642 40.623  48.872  1.00 18.21  ? 564  THR A OG1   1 
ATOM   4386  C CG2   . THR A 1 564 ? -18.013 42.060  50.696  1.00 18.29  ? 564  THR A CG2   1 
ATOM   4387  N N     . LEU A 1 565 ? -17.399 45.096  48.991  1.00 20.29  ? 565  LEU A N     1 
ATOM   4388  C CA    . LEU A 1 565 ? -16.635 46.252  49.441  1.00 20.82  ? 565  LEU A CA    1 
ATOM   4389  C C     . LEU A 1 565 ? -16.297 46.104  50.915  1.00 20.95  ? 565  LEU A C     1 
ATOM   4390  O O     . LEU A 1 565 ? -16.994 45.398  51.650  1.00 20.79  ? 565  LEU A O     1 
ATOM   4391  C CB    . LEU A 1 565 ? -17.424 47.554  49.203  1.00 20.81  ? 565  LEU A CB    1 
ATOM   4392  C CG    . LEU A 1 565 ? -17.723 47.945  47.751  1.00 20.90  ? 565  LEU A CG    1 
ATOM   4393  C CD1   . LEU A 1 565 ? -18.525 49.230  47.698  1.00 19.58  ? 565  LEU A CD1   1 
ATOM   4394  C CD2   . LEU A 1 565 ? -16.434 48.073  46.939  1.00 21.42  ? 565  LEU A CD2   1 
ATOM   4395  N N     . ASN A 1 566 ? -15.222 46.768  51.337  1.00 21.32  ? 566  ASN A N     1 
ATOM   4396  C CA    . ASN A 1 566 ? -14.870 46.868  52.749  1.00 21.38  ? 566  ASN A CA    1 
ATOM   4397  C C     . ASN A 1 566 ? -16.028 47.464  53.531  1.00 22.10  ? 566  ASN A C     1 
ATOM   4398  O O     . ASN A 1 566 ? -16.820 48.236  52.974  1.00 21.59  ? 566  ASN A O     1 
ATOM   4399  C CB    . ASN A 1 566 ? -13.615 47.729  52.934  1.00 21.13  ? 566  ASN A CB    1 
ATOM   4400  C CG    . ASN A 1 566 ? -12.353 47.028  52.468  1.00 21.04  ? 566  ASN A CG    1 
ATOM   4401  O OD1   . ASN A 1 566 ? -12.160 45.844  52.730  1.00 21.86  ? 566  ASN A OD1   1 
ATOM   4402  N ND2   . ASN A 1 566 ? -11.481 47.762  51.787  1.00 19.60  ? 566  ASN A ND2   1 
ATOM   4403  N N     . HIS A 1 567 ? -16.130 47.089  54.812  1.00 23.13  ? 567  HIS A N     1 
ATOM   4404  C CA    . HIS A 1 567 ? -17.150 47.621  55.710  1.00 24.04  ? 567  HIS A CA    1 
ATOM   4405  C C     . HIS A 1 567 ? -17.064 49.136  55.716  1.00 24.42  ? 567  HIS A C     1 
ATOM   4406  O O     . HIS A 1 567 ? -15.996 49.710  55.966  1.00 24.49  ? 567  HIS A O     1 
ATOM   4407  C CB    . HIS A 1 567 ? -16.983 47.069  57.130  1.00 24.23  ? 567  HIS A CB    1 
ATOM   4408  C CG    . HIS A 1 567 ? -18.094 47.452  58.066  1.00 25.94  ? 567  HIS A CG    1 
ATOM   4409  N ND1   . HIS A 1 567 ? -19.388 46.992  57.918  1.00 26.61  ? 567  HIS A ND1   1 
ATOM   4410  C CD2   . HIS A 1 567 ? -18.103 48.249  59.165  1.00 26.81  ? 567  HIS A CD2   1 
ATOM   4411  C CE1   . HIS A 1 567 ? -20.144 47.493  58.881  1.00 26.85  ? 567  HIS A CE1   1 
ATOM   4412  N NE2   . HIS A 1 567 ? -19.389 48.260  59.649  1.00 26.41  ? 567  HIS A NE2   1 
ATOM   4413  N N     . GLY A 1 568 ? -18.185 49.774  55.391  1.00 24.87  ? 568  GLY A N     1 
ATOM   4414  C CA    . GLY A 1 568 ? -18.275 51.228  55.411  1.00 25.50  ? 568  GLY A CA    1 
ATOM   4415  C C     . GLY A 1 568 ? -18.259 51.870  54.039  1.00 25.94  ? 568  GLY A C     1 
ATOM   4416  O O     . GLY A 1 568 ? -18.438 53.087  53.920  1.00 26.36  ? 568  GLY A O     1 
ATOM   4417  N N     . GLU A 1 569 ? -18.052 51.058  53.003  1.00 25.90  ? 569  GLU A N     1 
ATOM   4418  C CA    . GLU A 1 569 ? -18.000 51.552  51.634  1.00 25.72  ? 569  GLU A CA    1 
ATOM   4419  C C     . GLU A 1 569 ? -19.326 51.336  50.932  1.00 25.77  ? 569  GLU A C     1 
ATOM   4420  O O     . GLU A 1 569 ? -19.977 50.311  51.127  1.00 25.60  ? 569  GLU A O     1 
ATOM   4421  C CB    . GLU A 1 569 ? -16.874 50.873  50.843  1.00 25.61  ? 569  GLU A CB    1 
ATOM   4422  C CG    . GLU A 1 569 ? -15.478 51.048  51.432  1.00 25.96  ? 569  GLU A CG    1 
ATOM   4423  C CD    . GLU A 1 569 ? -14.977 52.498  51.439  1.00 26.27  ? 569  GLU A CD    1 
ATOM   4424  O OE1   . GLU A 1 569 ? -15.562 53.362  50.745  1.00 26.29  ? 569  GLU A OE1   1 
ATOM   4425  O OE2   . GLU A 1 569 ? -13.974 52.764  52.139  1.00 25.92  ? 569  GLU A OE2   1 
ATOM   4426  N N     . GLU A 1 570 ? -19.710 52.311  50.112  1.00 25.95  ? 570  GLU A N     1 
ATOM   4427  C CA    . GLU A 1 570 ? -20.928 52.239  49.311  1.00 26.27  ? 570  GLU A CA    1 
ATOM   4428  C C     . GLU A 1 570 ? -20.568 52.335  47.843  1.00 26.05  ? 570  GLU A C     1 
ATOM   4429  O O     . GLU A 1 570 ? -19.646 53.070  47.474  1.00 26.07  ? 570  GLU A O     1 
ATOM   4430  C CB    . GLU A 1 570 ? -21.898 53.365  49.667  1.00 26.71  ? 570  GLU A CB    1 
ATOM   4431  C CG    . GLU A 1 570 ? -22.456 53.305  51.084  1.00 27.89  ? 570  GLU A CG    1 
ATOM   4432  C CD    . GLU A 1 570 ? -22.984 54.650  51.551  1.00 30.73  ? 570  GLU A CD    1 
ATOM   4433  O OE1   . GLU A 1 570 ? -23.265 55.516  50.686  1.00 31.96  ? 570  GLU A OE1   1 
ATOM   4434  O OE2   . GLU A 1 570 ? -23.116 54.848  52.781  1.00 30.62  ? 570  GLU A OE2   1 
ATOM   4435  N N     . PRO A 1 571 ? -21.294 51.589  46.994  1.00 25.77  ? 571  PRO A N     1 
ATOM   4436  C CA    . PRO A 1 571 ? -20.979 51.632  45.574  1.00 25.69  ? 571  PRO A CA    1 
ATOM   4437  C C     . PRO A 1 571 ? -21.457 52.949  44.951  1.00 25.72  ? 571  PRO A C     1 
ATOM   4438  O O     . PRO A 1 571 ? -22.234 53.679  45.570  1.00 25.18  ? 571  PRO A O     1 
ATOM   4439  C CB    . PRO A 1 571 ? -21.746 50.432  44.999  1.00 25.85  ? 571  PRO A CB    1 
ATOM   4440  C CG    . PRO A 1 571 ? -22.418 49.748  46.166  1.00 25.37  ? 571  PRO A CG    1 
ATOM   4441  C CD    . PRO A 1 571 ? -22.430 50.698  47.291  1.00 25.48  ? 571  PRO A CD    1 
ATOM   4442  N N     . SER A 1 572 ? -20.964 53.248  43.748  1.00 25.74  ? 572  SER A N     1 
ATOM   4443  C CA    . SER A 1 572 ? -21.345 54.453  43.007  1.00 25.43  ? 572  SER A CA    1 
ATOM   4444  C C     . SER A 1 572 ? -21.177 54.104  41.539  1.00 25.37  ? 572  SER A C     1 
ATOM   4445  O O     . SER A 1 572 ? -20.551 53.088  41.223  1.00 25.50  ? 572  SER A O     1 
ATOM   4446  C CB    . SER A 1 572 ? -20.424 55.633  43.349  1.00 25.28  ? 572  SER A CB    1 
ATOM   4447  O OG    . SER A 1 572 ? -19.555 55.351  44.433  1.00 25.41  ? 572  SER A OG    1 
ATOM   4448  N N     . PRO A 1 573 ? -21.732 54.925  40.625  1.00 25.11  ? 573  PRO A N     1 
ATOM   4449  C CA    . PRO A 1 573 ? -21.281 54.734  39.243  1.00 24.71  ? 573  PRO A CA    1 
ATOM   4450  C C     . PRO A 1 573 ? -19.828 55.188  39.060  1.00 24.33  ? 573  PRO A C     1 
ATOM   4451  O O     . PRO A 1 573 ? -19.113 54.663  38.192  1.00 23.98  ? 573  PRO A O     1 
ATOM   4452  C CB    . PRO A 1 573 ? -22.237 55.608  38.421  1.00 24.79  ? 573  PRO A CB    1 
ATOM   4453  C CG    . PRO A 1 573 ? -23.362 55.977  39.360  1.00 25.40  ? 573  PRO A CG    1 
ATOM   4454  C CD    . PRO A 1 573 ? -22.755 55.979  40.731  1.00 25.25  ? 573  PRO A CD    1 
ATOM   4455  N N     . GLU A 1 574 ? -19.391 56.142  39.882  1.00 23.67  ? 574  GLU A N     1 
ATOM   4456  C CA    . GLU A 1 574 ? -17.998 56.574  39.860  1.00 23.63  ? 574  GLU A CA    1 
ATOM   4457  C C     . GLU A 1 574 ? -17.088 55.386  40.158  1.00 22.62  ? 574  GLU A C     1 
ATOM   4458  O O     . GLU A 1 574 ? -16.078 55.183  39.490  1.00 22.62  ? 574  GLU A O     1 
ATOM   4459  C CB    . GLU A 1 574 ? -17.758 57.723  40.848  1.00 23.58  ? 574  GLU A CB    1 
ATOM   4460  C CG    . GLU A 1 574 ? -16.502 58.534  40.550  1.00 25.08  ? 574  GLU A CG    1 
ATOM   4461  C CD    . GLU A 1 574 ? -16.311 59.778  41.434  1.00 25.61  ? 574  GLU A CD    1 
ATOM   4462  O OE1   . GLU A 1 574 ? -17.291 60.530  41.681  1.00 27.00  ? 574  GLU A OE1   1 
ATOM   4463  O OE2   . GLU A 1 574 ? -15.145 60.019  41.851  1.00 28.75  ? 574  GLU A OE2   1 
ATOM   4464  N N     . LEU A 1 575 ? -17.478 54.582  41.139  1.00 21.83  ? 575  LEU A N     1 
ATOM   4465  C CA    . LEU A 1 575 ? -16.671 53.455  41.589  1.00 21.44  ? 575  LEU A CA    1 
ATOM   4466  C C     . LEU A 1 575 ? -16.692 52.319  40.558  1.00 20.99  ? 575  LEU A C     1 
ATOM   4467  O O     . LEU A 1 575 ? -15.703 51.599  40.376  1.00 20.79  ? 575  LEU A O     1 
ATOM   4468  C CB    . LEU A 1 575 ? -17.160 52.978  42.962  1.00 21.33  ? 575  LEU A CB    1 
ATOM   4469  C CG    . LEU A 1 575 ? -16.454 51.791  43.618  1.00 21.98  ? 575  LEU A CG    1 
ATOM   4470  C CD1   . LEU A 1 575 ? -14.984 52.114  43.848  1.00 21.53  ? 575  LEU A CD1   1 
ATOM   4471  C CD2   . LEU A 1 575 ? -17.145 51.441  44.918  1.00 21.67  ? 575  LEU A CD2   1 
ATOM   4472  N N     . TYR A 1 576 ? -17.823 52.188  39.873  1.00 20.32  ? 576  TYR A N     1 
ATOM   4473  C CA    . TYR A 1 576 ? -17.978 51.222  38.796  1.00 19.75  ? 576  TYR A CA    1 
ATOM   4474  C C     . TYR A 1 576 ? -16.867 51.347  37.747  1.00 19.11  ? 576  TYR A C     1 
ATOM   4475  O O     . TYR A 1 576 ? -16.120 50.401  37.523  1.00 19.02  ? 576  TYR A O     1 
ATOM   4476  C CB    . TYR A 1 576 ? -19.355 51.386  38.145  1.00 20.30  ? 576  TYR A CB    1 
ATOM   4477  C CG    . TYR A 1 576 ? -19.842 50.156  37.411  1.00 21.65  ? 576  TYR A CG    1 
ATOM   4478  C CD1   . TYR A 1 576 ? -20.668 49.221  38.051  1.00 21.72  ? 576  TYR A CD1   1 
ATOM   4479  C CD2   . TYR A 1 576 ? -19.485 49.925  36.079  1.00 21.08  ? 576  TYR A CD2   1 
ATOM   4480  C CE1   . TYR A 1 576 ? -21.139 48.095  37.377  1.00 21.74  ? 576  TYR A CE1   1 
ATOM   4481  C CE2   . TYR A 1 576 ? -19.938 48.797  35.400  1.00 21.63  ? 576  TYR A CE2   1 
ATOM   4482  C CZ    . TYR A 1 576 ? -20.762 47.883  36.060  1.00 21.54  ? 576  TYR A CZ    1 
ATOM   4483  O OH    . TYR A 1 576 ? -21.217 46.766  35.390  1.00 22.67  ? 576  TYR A OH    1 
ATOM   4484  N N     . ALA A 1 577 ? -16.773 52.517  37.111  1.00 18.20  ? 577  ALA A N     1 
ATOM   4485  C CA    . ALA A 1 577 ? -15.734 52.805  36.128  1.00 17.39  ? 577  ALA A CA    1 
ATOM   4486  C C     . ALA A 1 577 ? -14.331 52.763  36.749  1.00 17.30  ? 577  ALA A C     1 
ATOM   4487  O O     . ALA A 1 577 ? -13.374 52.304  36.111  1.00 16.94  ? 577  ALA A O     1 
ATOM   4488  C CB    . ALA A 1 577 ? -15.979 54.143  35.501  1.00 16.83  ? 577  ALA A CB    1 
ATOM   4489  N N     . GLU A 1 578 ? -14.215 53.243  37.990  1.00 16.81  ? 578  GLU A N     1 
ATOM   4490  C CA    . GLU A 1 578 ? -12.934 53.259  38.695  1.00 16.93  ? 578  GLU A CA    1 
ATOM   4491  C C     . GLU A 1 578 ? -12.352 51.864  38.835  1.00 16.10  ? 578  GLU A C     1 
ATOM   4492  O O     . GLU A 1 578 ? -11.170 51.643  38.564  1.00 16.06  ? 578  GLU A O     1 
ATOM   4493  C CB    . GLU A 1 578 ? -13.068 53.883  40.091  1.00 16.78  ? 578  GLU A CB    1 
ATOM   4494  C CG    . GLU A 1 578 ? -11.704 54.091  40.749  1.00 19.00  ? 578  GLU A CG    1 
ATOM   4495  C CD    . GLU A 1 578 ? -11.753 54.263  42.267  1.00 21.63  ? 578  GLU A CD    1 
ATOM   4496  O OE1   . GLU A 1 578 ? -12.632 54.973  42.797  1.00 22.12  ? 578  GLU A OE1   1 
ATOM   4497  O OE2   . GLU A 1 578 ? -10.870 53.697  42.934  1.00 23.95  ? 578  GLU A OE2   1 
ATOM   4498  N N     . VAL A 1 579 ? -13.194 50.943  39.291  1.00 15.82  ? 579  VAL A N     1 
ATOM   4499  C CA    . VAL A 1 579 ? -12.809 49.551  39.523  1.00 15.84  ? 579  VAL A CA    1 
ATOM   4500  C C     . VAL A 1 579 ? -12.484 48.851  38.192  1.00 16.36  ? 579  VAL A C     1 
ATOM   4501  O O     . VAL A 1 579 ? -11.474 48.151  38.089  1.00 16.58  ? 579  VAL A O     1 
ATOM   4502  C CB    . VAL A 1 579 ? -13.901 48.818  40.387  1.00 15.84  ? 579  VAL A CB    1 
ATOM   4503  C CG1   . VAL A 1 579 ? -13.770 47.319  40.325  1.00 15.58  ? 579  VAL A CG1   1 
ATOM   4504  C CG2   . VAL A 1 579 ? -13.842 49.315  41.865  1.00 14.71  ? 579  VAL A CG2   1 
ATOM   4505  N N     . ARG A 1 580 ? -13.315 49.068  37.172  1.00 16.44  ? 580  ARG A N     1 
ATOM   4506  C CA    . ARG A 1 580 ? -12.996 48.618  35.809  1.00 16.98  ? 580  ARG A CA    1 
ATOM   4507  C C     . ARG A 1 580 ? -11.615 49.132  35.337  1.00 16.64  ? 580  ARG A C     1 
ATOM   4508  O O     . ARG A 1 580 ? -10.783 48.349  34.857  1.00 16.29  ? 580  ARG A O     1 
ATOM   4509  C CB    . ARG A 1 580 ? -14.095 49.020  34.797  1.00 16.83  ? 580  ARG A CB    1 
ATOM   4510  C CG    . ARG A 1 580 ? -15.504 48.457  35.093  1.00 18.71  ? 580  ARG A CG    1 
ATOM   4511  C CD    . ARG A 1 580 ? -16.258 47.958  33.838  1.00 21.31  ? 580  ARG A CD    1 
ATOM   4512  N NE    . ARG A 1 580 ? -16.311 48.922  32.743  1.00 25.24  ? 580  ARG A NE    1 
ATOM   4513  C CZ    . ARG A 1 580 ? -16.240 48.594  31.454  1.00 28.02  ? 580  ARG A CZ    1 
ATOM   4514  N NH1   . ARG A 1 580 ? -16.106 47.326  31.088  1.00 28.81  ? 580  ARG A NH1   1 
ATOM   4515  N NH2   . ARG A 1 580 ? -16.303 49.535  30.522  1.00 30.13  ? 580  ARG A NH2   1 
ATOM   4516  N N     . ASN A 1 581 ? -11.387 50.441  35.476  1.00 16.33  ? 581  ASN A N     1 
ATOM   4517  C CA    . ASN A 1 581 ? -10.099 51.056  35.140  1.00 16.18  ? 581  ASN A CA    1 
ATOM   4518  C C     . ASN A 1 581 ? -8.940  50.491  35.973  1.00 16.26  ? 581  ASN A C     1 
ATOM   4519  O O     . ASN A 1 581 ? -7.813  50.395  35.488  1.00 15.84  ? 581  ASN A O     1 
ATOM   4520  C CB    . ASN A 1 581 ? -10.155 52.582  35.293  1.00 15.85  ? 581  ASN A CB    1 
ATOM   4521  C CG    . ASN A 1 581 ? -10.868 53.269  34.128  1.00 15.87  ? 581  ASN A CG    1 
ATOM   4522  O OD1   . ASN A 1 581 ? -10.882 52.754  33.009  1.00 18.30  ? 581  ASN A OD1   1 
ATOM   4523  N ND2   . ASN A 1 581 ? -11.460 54.438  34.386  1.00 11.12  ? 581  ASN A ND2   1 
ATOM   4524  N N     . TRP A 1 582 ? -9.235  50.116  37.219  1.00 16.22  ? 582  TRP A N     1 
ATOM   4525  C CA    . TRP A 1 582 ? -8.242  49.525  38.123  1.00 16.07  ? 582  TRP A CA    1 
ATOM   4526  C C     . TRP A 1 582 ? -7.755  48.180  37.605  1.00 15.95  ? 582  TRP A C     1 
ATOM   4527  O O     . TRP A 1 582 ? -6.566  47.903  37.637  1.00 15.91  ? 582  TRP A O     1 
ATOM   4528  C CB    . TRP A 1 582 ? -8.827  49.371  39.536  1.00 15.95  ? 582  TRP A CB    1 
ATOM   4529  C CG    . TRP A 1 582 ? -7.932  48.657  40.494  1.00 16.26  ? 582  TRP A CG    1 
ATOM   4530  C CD1   . TRP A 1 582 ? -7.934  47.323  40.776  1.00 15.38  ? 582  TRP A CD1   1 
ATOM   4531  C CD2   . TRP A 1 582 ? -6.892  49.239  41.293  1.00 15.20  ? 582  TRP A CD2   1 
ATOM   4532  N NE1   . TRP A 1 582 ? -6.973  47.041  41.716  1.00 15.22  ? 582  TRP A NE1   1 
ATOM   4533  C CE2   . TRP A 1 582 ? -6.314  48.194  42.048  1.00 14.91  ? 582  TRP A CE2   1 
ATOM   4534  C CE3   . TRP A 1 582 ? -6.408  50.549  41.461  1.00 16.82  ? 582  TRP A CE3   1 
ATOM   4535  C CZ2   . TRP A 1 582 ? -5.270  48.408  42.964  1.00 14.95  ? 582  TRP A CZ2   1 
ATOM   4536  C CZ3   . TRP A 1 582 ? -5.353  50.767  42.364  1.00 16.08  ? 582  TRP A CZ3   1 
ATOM   4537  C CH2   . TRP A 1 582 ? -4.802  49.693  43.105  1.00 16.38  ? 582  TRP A CH2   1 
ATOM   4538  N N     . VAL A 1 583 ? -8.674  47.345  37.130  1.00 16.10  ? 583  VAL A N     1 
ATOM   4539  C CA    . VAL A 1 583 ? -8.287  46.049  36.565  1.00 16.29  ? 583  VAL A CA    1 
ATOM   4540  C C     . VAL A 1 583 ? -7.484  46.196  35.257  1.00 16.70  ? 583  VAL A C     1 
ATOM   4541  O O     . VAL A 1 583 ? -6.523  45.459  35.023  1.00 16.83  ? 583  VAL A O     1 
ATOM   4542  C CB    . VAL A 1 583 ? -9.501  45.119  36.379  1.00 16.43  ? 583  VAL A CB    1 
ATOM   4543  C CG1   . VAL A 1 583 ? -9.059  43.755  35.785  1.00 16.56  ? 583  VAL A CG1   1 
ATOM   4544  C CG2   . VAL A 1 583 ? -10.224 44.915  37.722  1.00 15.38  ? 583  VAL A CG2   1 
ATOM   4545  N N     . ALA A 1 584 ? -7.894  47.154  34.427  1.00 16.93  ? 584  ALA A N     1 
ATOM   4546  C CA    . ALA A 1 584 ? -7.214  47.496  33.185  1.00 17.62  ? 584  ALA A CA    1 
ATOM   4547  C C     . ALA A 1 584 ? -5.796  47.994  33.460  1.00 17.68  ? 584  ALA A C     1 
ATOM   4548  O O     . ALA A 1 584 ? -4.906  47.851  32.633  1.00 17.74  ? 584  ALA A O     1 
ATOM   4549  C CB    . ALA A 1 584 ? -8.012  48.565  32.437  1.00 17.58  ? 584  ALA A CB    1 
ATOM   4550  N N     . LYS A 1 585 ? -5.600  48.573  34.640  1.00 18.02  ? 585  LYS A N     1 
ATOM   4551  C CA    . LYS A 1 585 ? -4.280  49.013  35.069  1.00 18.10  ? 585  LYS A CA    1 
ATOM   4552  C C     . LYS A 1 585 ? -3.464  47.843  35.603  1.00 17.47  ? 585  LYS A C     1 
ATOM   4553  O O     . LYS A 1 585 ? -2.276  47.752  35.348  1.00 17.47  ? 585  LYS A O     1 
ATOM   4554  C CB    . LYS A 1 585 ? -4.384  50.124  36.117  1.00 18.17  ? 585  LYS A CB    1 
ATOM   4555  C CG    . LYS A 1 585 ? -3.076  50.854  36.301  1.00 21.13  ? 585  LYS A CG    1 
ATOM   4556  C CD    . LYS A 1 585 ? -3.102  51.878  37.424  1.00 24.90  ? 585  LYS A CD    1 
ATOM   4557  C CE    . LYS A 1 585 ? -2.298  53.123  37.017  1.00 26.55  ? 585  LYS A CE    1 
ATOM   4558  N NZ    . LYS A 1 585 ? -1.629  53.725  38.191  1.00 28.15  ? 585  LYS A NZ    1 
ATOM   4559  N N     . GLU A 1 586 ? -4.116  46.945  36.333  1.00 17.42  ? 586  GLU A N     1 
ATOM   4560  C CA    . GLU A 1 586 ? -3.434  45.826  36.974  1.00 17.39  ? 586  GLU A CA    1 
ATOM   4561  C C     . GLU A 1 586 ? -2.933  44.798  35.976  1.00 17.07  ? 586  GLU A C     1 
ATOM   4562  O O     . GLU A 1 586 ? -1.802  44.293  36.107  1.00 16.38  ? 586  GLU A O     1 
ATOM   4563  C CB    . GLU A 1 586 ? -4.354  45.167  37.994  1.00 17.78  ? 586  GLU A CB    1 
ATOM   4564  C CG    . GLU A 1 586 ? -4.515  45.989  39.255  1.00 19.75  ? 586  GLU A CG    1 
ATOM   4565  C CD    . GLU A 1 586 ? -3.289  45.903  40.136  1.00 23.66  ? 586  GLU A CD    1 
ATOM   4566  O OE1   . GLU A 1 586 ? -3.052  44.803  40.701  1.00 25.27  ? 586  GLU A OE1   1 
ATOM   4567  O OE2   . GLU A 1 586 ? -2.567  46.924  40.245  1.00 23.96  ? 586  GLU A OE2   1 
ATOM   4568  N N     . ILE A 1 587 ? -3.772  44.510  34.976  1.00 16.47  ? 587  ILE A N     1 
ATOM   4569  C CA    . ILE A 1 587 ? -3.476  43.500  33.966  1.00 16.42  ? 587  ILE A CA    1 
ATOM   4570  C C     . ILE A 1 587 ? -3.415  44.115  32.564  1.00 16.61  ? 587  ILE A C     1 
ATOM   4571  O O     . ILE A 1 587 ? -2.383  44.083  31.903  1.00 16.36  ? 587  ILE A O     1 
ATOM   4572  C CB    . ILE A 1 587 ? -4.518  42.352  34.002  1.00 16.49  ? 587  ILE A CB    1 
ATOM   4573  C CG1   . ILE A 1 587 ? -4.562  41.696  35.400  1.00 16.18  ? 587  ILE A CG1   1 
ATOM   4574  C CG2   . ILE A 1 587 ? -4.208  41.311  32.936  1.00 15.87  ? 587  ILE A CG2   1 
ATOM   4575  C CD1   . ILE A 1 587 ? -5.781  40.763  35.626  1.00 16.22  ? 587  ILE A CD1   1 
ATOM   4576  N N     . GLY A 1 588 ? -4.538  44.672  32.123  1.00 16.70  ? 588  GLY A N     1 
ATOM   4577  C CA    . GLY A 1 588 ? -4.654  45.266  30.798  1.00 16.38  ? 588  GLY A CA    1 
ATOM   4578  C C     . GLY A 1 588 ? -6.121  45.362  30.436  1.00 16.29  ? 588  GLY A C     1 
ATOM   4579  O O     . GLY A 1 588 ? -6.943  44.678  31.038  1.00 15.84  ? 588  GLY A O     1 
ATOM   4580  N N     . PRO A 1 589 ? -6.464  46.233  29.470  1.00 16.38  ? 589  PRO A N     1 
ATOM   4581  C CA    . PRO A 1 589 ? -7.842  46.359  28.996  1.00 16.86  ? 589  PRO A CA    1 
ATOM   4582  C C     . PRO A 1 589 ? -8.520  45.022  28.693  1.00 17.61  ? 589  PRO A C     1 
ATOM   4583  O O     . PRO A 1 589 ? -9.740  44.906  28.888  1.00 17.79  ? 589  PRO A O     1 
ATOM   4584  C CB    . PRO A 1 589 ? -7.700  47.183  27.713  1.00 16.53  ? 589  PRO A CB    1 
ATOM   4585  C CG    . PRO A 1 589 ? -6.492  48.016  27.948  1.00 16.83  ? 589  PRO A CG    1 
ATOM   4586  C CD    . PRO A 1 589 ? -5.566  47.199  28.812  1.00 16.60  ? 589  PRO A CD    1 
ATOM   4587  N N     . LEU A 1 590 ? -7.742  44.029  28.249  1.00 17.58  ? 590  LEU A N     1 
ATOM   4588  C CA    . LEU A 1 590 ? -8.266  42.702  27.911  1.00 18.25  ? 590  LEU A CA    1 
ATOM   4589  C C     . LEU A 1 590 ? -8.932  41.977  29.099  1.00 18.54  ? 590  LEU A C     1 
ATOM   4590  O O     . LEU A 1 590 ? -9.773  41.085  28.891  1.00 18.65  ? 590  LEU A O     1 
ATOM   4591  C CB    . LEU A 1 590 ? -7.168  41.821  27.274  1.00 18.79  ? 590  LEU A CB    1 
ATOM   4592  C CG    . LEU A 1 590 ? -6.183  40.982  28.126  1.00 20.42  ? 590  LEU A CG    1 
ATOM   4593  C CD1   . LEU A 1 590 ? -5.391  39.991  27.238  1.00 21.64  ? 590  LEU A CD1   1 
ATOM   4594  C CD2   . LEU A 1 590 ? -5.197  41.820  28.946  1.00 21.72  ? 590  LEU A CD2   1 
ATOM   4595  N N     . ALA A 1 591 ? -8.563  42.359  30.325  1.00 17.83  ? 591  ALA A N     1 
ATOM   4596  C CA    . ALA A 1 591 ? -9.129  41.748  31.531  1.00 17.86  ? 591  ALA A CA    1 
ATOM   4597  C C     . ALA A 1 591 ? -10.187 42.598  32.272  1.00 17.47  ? 591  ALA A C     1 
ATOM   4598  O O     . ALA A 1 591 ? -10.608 42.246  33.377  1.00 17.02  ? 591  ALA A O     1 
ATOM   4599  C CB    . ALA A 1 591 ? -8.000  41.305  32.504  1.00 17.51  ? 591  ALA A CB    1 
ATOM   4600  N N     . THR A 1 592 ? -10.612 43.702  31.664  1.00 17.73  ? 592  THR A N     1 
ATOM   4601  C CA    . THR A 1 592 ? -11.623 44.572  32.267  1.00 18.00  ? 592  THR A CA    1 
ATOM   4602  C C     . THR A 1 592 ? -12.964 43.828  32.432  1.00 18.28  ? 592  THR A C     1 
ATOM   4603  O O     . THR A 1 592 ? -13.557 43.392  31.435  1.00 18.34  ? 592  THR A O     1 
ATOM   4604  C CB    . THR A 1 592 ? -11.859 45.842  31.402  1.00 18.09  ? 592  THR A CB    1 
ATOM   4605  O OG1   . THR A 1 592 ? -10.647 46.591  31.259  1.00 18.80  ? 592  THR A OG1   1 
ATOM   4606  C CG2   . THR A 1 592 ? -12.919 46.745  32.035  1.00 18.97  ? 592  THR A CG2   1 
ATOM   4607  N N     . PRO A 1 593 ? -13.474 43.724  33.679  1.00 18.70  ? 593  PRO A N     1 
ATOM   4608  C CA    . PRO A 1 593 ? -14.789 43.093  33.908  1.00 18.99  ? 593  PRO A CA    1 
ATOM   4609  C C     . PRO A 1 593 ? -15.903 43.746  33.105  1.00 19.91  ? 593  PRO A C     1 
ATOM   4610  O O     . PRO A 1 593 ? -15.974 44.975  33.034  1.00 19.88  ? 593  PRO A O     1 
ATOM   4611  C CB    . PRO A 1 593 ? -15.032 43.309  35.396  1.00 18.69  ? 593  PRO A CB    1 
ATOM   4612  C CG    . PRO A 1 593 ? -13.673 43.480  35.981  1.00 18.92  ? 593  PRO A CG    1 
ATOM   4613  C CD    . PRO A 1 593 ? -12.877 44.209  34.938  1.00 18.32  ? 593  PRO A CD    1 
ATOM   4614  N N     . ASP A 1 594 ? -16.750 42.934  32.475  1.00 20.52  ? 594  ASP A N     1 
ATOM   4615  C CA    . ASP A 1 594 ? -17.909 43.484  31.762  1.00 20.97  ? 594  ASP A CA    1 
ATOM   4616  C C     . ASP A 1 594 ? -19.029 43.868  32.741  1.00 20.59  ? 594  ASP A C     1 
ATOM   4617  O O     . ASP A 1 594 ? -19.792 44.789  32.475  1.00 20.33  ? 594  ASP A O     1 
ATOM   4618  C CB    . ASP A 1 594 ? -18.432 42.517  30.687  1.00 20.99  ? 594  ASP A CB    1 
ATOM   4619  C CG    . ASP A 1 594 ? -17.424 42.285  29.572  1.00 22.58  ? 594  ASP A CG    1 
ATOM   4620  O OD1   . ASP A 1 594 ? -17.571 42.939  28.520  1.00 26.45  ? 594  ASP A OD1   1 
ATOM   4621  O OD2   . ASP A 1 594 ? -16.477 41.470  29.748  1.00 23.71  ? 594  ASP A OD2   1 
ATOM   4622  N N     . VAL A 1 595 ? -19.127 43.138  33.852  1.00 20.40  ? 595  VAL A N     1 
ATOM   4623  C CA    . VAL A 1 595 ? -20.152 43.392  34.870  1.00 19.97  ? 595  VAL A CA    1 
ATOM   4624  C C     . VAL A 1 595 ? -19.504 43.416  36.249  1.00 19.72  ? 595  VAL A C     1 
ATOM   4625  O O     . VAL A 1 595 ? -18.698 42.535  36.591  1.00 19.70  ? 595  VAL A O     1 
ATOM   4626  C CB    . VAL A 1 595 ? -21.286 42.306  34.856  1.00 20.18  ? 595  VAL A CB    1 
ATOM   4627  C CG1   . VAL A 1 595 ? -22.333 42.584  35.932  1.00 19.63  ? 595  VAL A CG1   1 
ATOM   4628  C CG2   . VAL A 1 595 ? -21.938 42.183  33.468  1.00 19.90  ? 595  VAL A CG2   1 
ATOM   4629  N N     . LEU A 1 596 ? -19.858 44.431  37.033  1.00 19.28  ? 596  LEU A N     1 
ATOM   4630  C CA    . LEU A 1 596 ? -19.507 44.476  38.454  1.00 18.94  ? 596  LEU A CA    1 
ATOM   4631  C C     . LEU A 1 596 ? -20.791 44.315  39.228  1.00 19.03  ? 596  LEU A C     1 
ATOM   4632  O O     . LEU A 1 596 ? -21.697 45.139  39.102  1.00 19.32  ? 596  LEU A O     1 
ATOM   4633  C CB    . LEU A 1 596 ? -18.822 45.798  38.814  1.00 18.45  ? 596  LEU A CB    1 
ATOM   4634  C CG    . LEU A 1 596 ? -17.485 46.056  38.101  1.00 17.78  ? 596  LEU A CG    1 
ATOM   4635  C CD1   . LEU A 1 596 ? -17.014 47.452  38.355  1.00 17.07  ? 596  LEU A CD1   1 
ATOM   4636  C CD2   . LEU A 1 596 ? -16.413 45.058  38.540  1.00 17.08  ? 596  LEU A CD2   1 
ATOM   4637  N N     . HIS A 1 597 ? -20.877 43.235  40.000  1.00 18.64  ? 597  HIS A N     1 
ATOM   4638  C CA    . HIS A 1 597 ? -22.075 42.924  40.785  1.00 18.27  ? 597  HIS A CA    1 
ATOM   4639  C C     . HIS A 1 597 ? -21.728 43.159  42.258  1.00 17.74  ? 597  HIS A C     1 
ATOM   4640  O O     . HIS A 1 597 ? -21.056 42.337  42.882  1.00 17.08  ? 597  HIS A O     1 
ATOM   4641  C CB    . HIS A 1 597 ? -22.494 41.467  40.499  1.00 17.99  ? 597  HIS A CB    1 
ATOM   4642  C CG    . HIS A 1 597 ? -23.646 40.963  41.321  1.00 18.32  ? 597  HIS A CG    1 
ATOM   4643  N ND1   . HIS A 1 597 ? -24.619 40.141  40.797  1.00 17.56  ? 597  HIS A ND1   1 
ATOM   4644  C CD2   . HIS A 1 597 ? -23.974 41.146  42.625  1.00 17.82  ? 597  HIS A CD2   1 
ATOM   4645  C CE1   . HIS A 1 597 ? -25.492 39.835  41.740  1.00 18.21  ? 597  HIS A CE1   1 
ATOM   4646  N NE2   . HIS A 1 597 ? -25.118 40.425  42.860  1.00 18.04  ? 597  HIS A NE2   1 
ATOM   4647  N N     . TRP A 1 598 ? -22.144 44.308  42.787  1.00 17.76  ? 598  TRP A N     1 
ATOM   4648  C CA    . TRP A 1 598 ? -21.893 44.650  44.181  1.00 17.70  ? 598  TRP A CA    1 
ATOM   4649  C C     . TRP A 1 598 ? -22.748 43.754  45.055  1.00 17.67  ? 598  TRP A C     1 
ATOM   4650  O O     . TRP A 1 598 ? -23.972 43.693  44.885  1.00 16.86  ? 598  TRP A O     1 
ATOM   4651  C CB    . TRP A 1 598 ? -22.233 46.115  44.492  1.00 18.22  ? 598  TRP A CB    1 
ATOM   4652  C CG    . TRP A 1 598 ? -21.750 47.127  43.485  1.00 18.73  ? 598  TRP A CG    1 
ATOM   4653  C CD1   . TRP A 1 598 ? -22.531 47.919  42.691  1.00 18.46  ? 598  TRP A CD1   1 
ATOM   4654  C CD2   . TRP A 1 598 ? -20.389 47.470  43.182  1.00 17.65  ? 598  TRP A CD2   1 
ATOM   4655  N NE1   . TRP A 1 598 ? -21.742 48.727  41.904  1.00 19.49  ? 598  TRP A NE1   1 
ATOM   4656  C CE2   . TRP A 1 598 ? -20.424 48.471  42.182  1.00 19.42  ? 598  TRP A CE2   1 
ATOM   4657  C CE3   . TRP A 1 598 ? -19.148 47.024  43.646  1.00 16.69  ? 598  TRP A CE3   1 
ATOM   4658  C CZ2   . TRP A 1 598 ? -19.261 49.032  41.636  1.00 18.61  ? 598  TRP A CZ2   1 
ATOM   4659  C CZ3   . TRP A 1 598 ? -17.994 47.578  43.102  1.00 18.36  ? 598  TRP A CZ3   1 
ATOM   4660  C CH2   . TRP A 1 598 ? -18.059 48.572  42.108  1.00 18.46  ? 598  TRP A CH2   1 
ATOM   4661  N N     . THR A 1 599 ? -22.104 43.063  45.991  1.00 17.97  ? 599  THR A N     1 
ATOM   4662  C CA    . THR A 1 599 ? -22.833 42.216  46.946  1.00 18.50  ? 599  THR A CA    1 
ATOM   4663  C C     . THR A 1 599 ? -22.130 42.058  48.293  1.00 18.84  ? 599  THR A C     1 
ATOM   4664  O O     . THR A 1 599 ? -20.932 42.277  48.392  1.00 18.40  ? 599  THR A O     1 
ATOM   4665  C CB    . THR A 1 599 ? -23.127 40.807  46.364  1.00 18.09  ? 599  THR A CB    1 
ATOM   4666  O OG1   . THR A 1 599 ? -24.059 40.144  47.215  1.00 18.96  ? 599  THR A OG1   1 
ATOM   4667  C CG2   . THR A 1 599 ? -21.867 39.962  46.268  1.00 17.48  ? 599  THR A CG2   1 
ATOM   4668  N N     . ASP A 1 600 ? -22.908 41.684  49.314  1.00 20.04  ? 600  ASP A N     1 
ATOM   4669  C CA    . ASP A 1 600 ? -22.411 41.249  50.622  1.00 20.89  ? 600  ASP A CA    1 
ATOM   4670  C C     . ASP A 1 600 ? -22.887 39.815  50.864  1.00 20.99  ? 600  ASP A C     1 
ATOM   4671  O O     . ASP A 1 600 ? -22.760 39.272  51.971  1.00 20.47  ? 600  ASP A O     1 
ATOM   4672  C CB    . ASP A 1 600 ? -22.945 42.158  51.742  1.00 21.88  ? 600  ASP A CB    1 
ATOM   4673  C CG    . ASP A 1 600 ? -22.306 43.551  51.744  1.00 23.68  ? 600  ASP A CG    1 
ATOM   4674  O OD1   . ASP A 1 600 ? -21.075 43.662  51.502  1.00 24.85  ? 600  ASP A OD1   1 
ATOM   4675  O OD2   . ASP A 1 600 ? -23.042 44.536  52.015  1.00 24.94  ? 600  ASP A OD2   1 
ATOM   4676  N N     . SER A 1 601 ? -23.414 39.213  49.797  1.00 21.33  ? 601  SER A N     1 
ATOM   4677  C CA    . SER A 1 601 ? -24.047 37.902  49.832  1.00 21.60  ? 601  SER A CA    1 
ATOM   4678  C C     . SER A 1 601 ? -23.276 36.786  49.098  1.00 22.21  ? 601  SER A C     1 
ATOM   4679  O O     . SER A 1 601 ? -23.903 35.855  48.568  1.00 22.76  ? 601  SER A O     1 
ATOM   4680  C CB    . SER A 1 601 ? -25.472 38.003  49.258  1.00 21.53  ? 601  SER A CB    1 
ATOM   4681  O OG    . SER A 1 601 ? -26.249 38.966  49.953  1.00 21.34  ? 601  SER A OG    1 
ATOM   4682  N N     . LEU A 1 602 ? -21.941 36.849  49.069  1.00 22.18  ? 602  LEU A N     1 
ATOM   4683  C CA    . LEU A 1 602 ? -21.154 35.744  48.495  1.00 22.24  ? 602  LEU A CA    1 
ATOM   4684  C C     . LEU A 1 602 ? -21.461 34.431  49.201  1.00 23.14  ? 602  LEU A C     1 
ATOM   4685  O O     . LEU A 1 602 ? -21.453 34.372  50.445  1.00 23.21  ? 602  LEU A O     1 
ATOM   4686  C CB    . LEU A 1 602 ? -19.647 36.020  48.549  1.00 22.05  ? 602  LEU A CB    1 
ATOM   4687  C CG    . LEU A 1 602 ? -19.030 37.011  47.550  1.00 19.95  ? 602  LEU A CG    1 
ATOM   4688  C CD1   . LEU A 1 602 ? -17.562 37.204  47.871  1.00 18.41  ? 602  LEU A CD1   1 
ATOM   4689  C CD2   . LEU A 1 602 ? -19.202 36.543  46.118  1.00 18.08  ? 602  LEU A CD2   1 
ATOM   4690  N N     . PRO A 1 603 ? -21.734 33.369  48.422  1.00 23.79  ? 603  PRO A N     1 
ATOM   4691  C CA    . PRO A 1 603 ? -22.177 32.128  49.060  1.00 24.69  ? 603  PRO A CA    1 
ATOM   4692  C C     . PRO A 1 603 ? -20.987 31.338  49.594  1.00 25.36  ? 603  PRO A C     1 
ATOM   4693  O O     . PRO A 1 603 ? -20.283 30.668  48.838  1.00 25.91  ? 603  PRO A O     1 
ATOM   4694  C CB    . PRO A 1 603 ? -22.901 31.378  47.932  1.00 24.65  ? 603  PRO A CB    1 
ATOM   4695  C CG    . PRO A 1 603 ? -22.398 32.000  46.641  1.00 23.73  ? 603  PRO A CG    1 
ATOM   4696  C CD    . PRO A 1 603 ? -21.617 33.235  46.960  1.00 23.94  ? 603  PRO A CD    1 
ATOM   4697  N N     . LYS A 1 604 ? -20.744 31.467  50.890  1.00 26.30  ? 604  LYS A N     1 
ATOM   4698  C CA    . LYS A 1 604 ? -19.657 30.750  51.533  1.00 27.30  ? 604  LYS A CA    1 
ATOM   4699  C C     . LYS A 1 604 ? -20.194 29.540  52.263  1.00 27.61  ? 604  LYS A C     1 
ATOM   4700  O O     . LYS A 1 604 ? -21.259 29.590  52.876  1.00 27.65  ? 604  LYS A O     1 
ATOM   4701  C CB    . LYS A 1 604 ? -18.881 31.651  52.497  1.00 27.38  ? 604  LYS A CB    1 
ATOM   4702  C CG    . LYS A 1 604 ? -17.889 32.569  51.805  1.00 29.09  ? 604  LYS A CG    1 
ATOM   4703  C CD    . LYS A 1 604 ? -17.490 33.714  52.716  1.00 31.38  ? 604  LYS A CD    1 
ATOM   4704  C CE    . LYS A 1 604 ? -17.145 34.942  51.916  1.00 31.69  ? 604  LYS A CE    1 
ATOM   4705  N NZ    . LYS A 1 604 ? -17.441 36.180  52.692  1.00 33.44  ? 604  LYS A NZ    1 
ATOM   4706  N N     . THR A 1 605 ? -19.433 28.456  52.186  1.00 28.22  ? 605  THR A N     1 
ATOM   4707  C CA    . THR A 1 605 ? -19.781 27.208  52.819  1.00 28.64  ? 605  THR A CA    1 
ATOM   4708  C C     . THR A 1 605 ? -19.386 27.302  54.301  1.00 29.05  ? 605  THR A C     1 
ATOM   4709  O O     . THR A 1 605 ? -18.749 28.279  54.713  1.00 29.07  ? 605  THR A O     1 
ATOM   4710  C CB    . THR A 1 605 ? -19.109 26.030  52.050  1.00 28.79  ? 605  THR A CB    1 
ATOM   4711  O OG1   . THR A 1 605 ? -20.003 24.911  51.967  1.00 29.27  ? 605  THR A OG1   1 
ATOM   4712  C CG2   . THR A 1 605 ? -17.777 25.614  52.671  1.00 28.67  ? 605  THR A CG2   1 
ATOM   4713  N N     . ARG A 1 606 ? -19.794 26.317  55.102  1.00 29.56  ? 606  ARG A N     1 
ATOM   4714  C CA    . ARG A 1 606 ? -19.432 26.266  56.524  1.00 29.96  ? 606  ARG A CA    1 
ATOM   4715  C C     . ARG A 1 606 ? -17.913 26.428  56.731  1.00 30.26  ? 606  ARG A C     1 
ATOM   4716  O O     . ARG A 1 606 ? -17.474 27.228  57.568  1.00 30.13  ? 606  ARG A O     1 
ATOM   4717  C CB    . ARG A 1 606 ? -19.947 24.973  57.161  1.00 29.89  ? 606  ARG A CB    1 
ATOM   4718  N N     . SER A 1 607 ? -17.132 25.684  55.940  1.00 30.51  ? 607  SER A N     1 
ATOM   4719  C CA    . SER A 1 607 ? -15.667 25.806  55.881  1.00 30.68  ? 607  SER A CA    1 
ATOM   4720  C C     . SER A 1 607 ? -15.154 27.189  55.450  1.00 30.71  ? 607  SER A C     1 
ATOM   4721  O O     . SER A 1 607 ? -14.080 27.628  55.887  1.00 30.82  ? 607  SER A O     1 
ATOM   4722  C CB    . SER A 1 607 ? -15.090 24.733  54.946  1.00 30.78  ? 607  SER A CB    1 
ATOM   4723  O OG    . SER A 1 607 ? -14.087 25.276  54.093  1.00 30.82  ? 607  SER A OG    1 
ATOM   4724  N N     . GLY A 1 608 ? -15.902 27.857  54.575  1.00 30.56  ? 608  GLY A N     1 
ATOM   4725  C CA    . GLY A 1 608 ? -15.488 29.154  54.044  1.00 30.19  ? 608  GLY A CA    1 
ATOM   4726  C C     . GLY A 1 608 ? -15.271 29.144  52.541  1.00 30.04  ? 608  GLY A C     1 
ATOM   4727  O O     . GLY A 1 608 ? -14.929 30.179  51.954  1.00 30.13  ? 608  GLY A O     1 
ATOM   4728  N N     . LYS A 1 609 ? -15.470 27.981  51.917  1.00 29.61  ? 609  LYS A N     1 
ATOM   4729  C CA    . LYS A 1 609 ? -15.346 27.849  50.465  1.00 29.51  ? 609  LYS A CA    1 
ATOM   4730  C C     . LYS A 1 609 ? -16.401 28.679  49.725  1.00 29.38  ? 609  LYS A C     1 
ATOM   4731  O O     . LYS A 1 609 ? -17.553 28.775  50.158  1.00 29.32  ? 609  LYS A O     1 
ATOM   4732  C CB    . LYS A 1 609 ? -15.425 26.379  50.039  1.00 29.37  ? 609  LYS A CB    1 
ATOM   4733  N N     . ILE A 1 610 ? -15.996 29.292  48.620  1.00 29.04  ? 610  ILE A N     1 
ATOM   4734  C CA    . ILE A 1 610 ? -16.938 30.024  47.777  1.00 28.99  ? 610  ILE A CA    1 
ATOM   4735  C C     . ILE A 1 610 ? -17.699 29.017  46.920  1.00 28.78  ? 610  ILE A C     1 
ATOM   4736  O O     . ILE A 1 610 ? -17.087 28.195  46.237  1.00 28.77  ? 610  ILE A O     1 
ATOM   4737  C CB    . ILE A 1 610 ? -16.228 31.065  46.857  1.00 28.86  ? 610  ILE A CB    1 
ATOM   4738  C CG1   . ILE A 1 610 ? -15.384 32.062  47.670  1.00 29.35  ? 610  ILE A CG1   1 
ATOM   4739  C CG2   . ILE A 1 610 ? -17.237 31.788  45.964  1.00 28.74  ? 610  ILE A CG2   1 
ATOM   4740  C CD1   . ILE A 1 610 ? -16.175 33.030  48.556  1.00 30.00  ? 610  ILE A CD1   1 
ATOM   4741  N N     . MET A 1 611 ? -19.028 29.081  46.968  1.00 28.52  ? 611  MET A N     1 
ATOM   4742  C CA    . MET A 1 611 ? -19.875 28.203  46.164  1.00 28.60  ? 611  MET A CA    1 
ATOM   4743  C C     . MET A 1 611 ? -19.917 28.739  44.745  1.00 27.94  ? 611  MET A C     1 
ATOM   4744  O O     . MET A 1 611 ? -20.863 29.442  44.366  1.00 28.12  ? 611  MET A O     1 
ATOM   4745  C CB    . MET A 1 611 ? -21.293 28.138  46.734  1.00 28.90  ? 611  MET A CB    1 
ATOM   4746  C CG    . MET A 1 611 ? -21.385 27.655  48.160  1.00 31.12  ? 611  MET A CG    1 
ATOM   4747  S SD    . MET A 1 611 ? -21.898 25.939  48.278  1.00 36.42  ? 611  MET A SD    1 
ATOM   4748  C CE    . MET A 1 611 ? -20.371 25.094  47.787  1.00 34.66  ? 611  MET A CE    1 
ATOM   4749  N N     . ARG A 1 612 ? -18.892 28.404  43.963  1.00 27.04  ? 612  ARG A N     1 
ATOM   4750  C CA    . ARG A 1 612 ? -18.694 29.027  42.650  1.00 26.26  ? 612  ARG A CA    1 
ATOM   4751  C C     . ARG A 1 612 ? -19.673 28.600  41.549  1.00 25.54  ? 612  ARG A C     1 
ATOM   4752  O O     . ARG A 1 612 ? -19.933 29.371  40.624  1.00 25.66  ? 612  ARG A O     1 
ATOM   4753  C CB    . ARG A 1 612 ? -17.243 28.866  42.189  1.00 26.41  ? 612  ARG A CB    1 
ATOM   4754  C CG    . ARG A 1 612 ? -16.206 29.527  43.130  1.00 26.72  ? 612  ARG A CG    1 
ATOM   4755  C CD    . ARG A 1 612 ? -14.797 29.432  42.552  1.00 26.39  ? 612  ARG A CD    1 
ATOM   4756  N NE    . ARG A 1 612 ? -14.806 29.792  41.138  1.00 26.59  ? 612  ARG A NE    1 
ATOM   4757  C CZ    . ARG A 1 612 ? -14.662 31.031  40.678  1.00 26.43  ? 612  ARG A CZ    1 
ATOM   4758  N NH1   . ARG A 1 612 ? -14.466 32.035  41.523  1.00 25.43  ? 612  ARG A NH1   1 
ATOM   4759  N NH2   . ARG A 1 612 ? -14.701 31.256  39.371  1.00 25.53  ? 612  ARG A NH2   1 
ATOM   4760  N N     . ARG A 1 613 ? -20.210 27.385  41.643  1.00 24.81  ? 613  ARG A N     1 
ATOM   4761  C CA    . ARG A 1 613 ? -21.206 26.901  40.665  1.00 24.33  ? 613  ARG A CA    1 
ATOM   4762  C C     . ARG A 1 613 ? -22.518 27.716  40.675  1.00 23.74  ? 613  ARG A C     1 
ATOM   4763  O O     . ARG A 1 613 ? -23.099 27.996  39.624  1.00 23.14  ? 613  ARG A O     1 
ATOM   4764  C CB    . ARG A 1 613 ? -21.492 25.407  40.855  1.00 24.01  ? 613  ARG A CB    1 
ATOM   4765  N N     . ILE A 1 614 ? -22.967 28.096  41.868  1.00 23.43  ? 614  ILE A N     1 
ATOM   4766  C CA    . ILE A 1 614 ? -24.151 28.943  42.004  1.00 23.09  ? 614  ILE A CA    1 
ATOM   4767  C C     . ILE A 1 614 ? -23.904 30.332  41.409  1.00 22.72  ? 614  ILE A C     1 
ATOM   4768  O O     . ILE A 1 614 ? -24.760 30.864  40.702  1.00 22.42  ? 614  ILE A O     1 
ATOM   4769  C CB    . ILE A 1 614 ? -24.623 29.034  43.470  1.00 23.16  ? 614  ILE A CB    1 
ATOM   4770  C CG1   . ILE A 1 614 ? -25.001 27.637  43.989  1.00 23.71  ? 614  ILE A CG1   1 
ATOM   4771  C CG2   . ILE A 1 614 ? -25.809 29.985  43.599  1.00 23.33  ? 614  ILE A CG2   1 
ATOM   4772  C CD1   . ILE A 1 614 ? -24.949 27.478  45.502  1.00 24.25  ? 614  ILE A CD1   1 
ATOM   4773  N N     . LEU A 1 615 ? -22.732 30.904  41.686  1.00 22.22  ? 615  LEU A N     1 
ATOM   4774  C CA    . LEU A 1 615 ? -22.363 32.210  41.135  1.00 22.04  ? 615  LEU A CA    1 
ATOM   4775  C C     . LEU A 1 615 ? -22.347 32.209  39.602  1.00 21.98  ? 615  LEU A C     1 
ATOM   4776  O O     . LEU A 1 615 ? -22.812 33.152  38.955  1.00 21.73  ? 615  LEU A O     1 
ATOM   4777  C CB    . LEU A 1 615 ? -21.016 32.669  41.702  1.00 21.91  ? 615  LEU A CB    1 
ATOM   4778  C CG    . LEU A 1 615 ? -21.020 33.019  43.199  1.00 22.15  ? 615  LEU A CG    1 
ATOM   4779  C CD1   . LEU A 1 615 ? -19.624 33.350  43.679  1.00 21.61  ? 615  LEU A CD1   1 
ATOM   4780  C CD2   . LEU A 1 615 ? -21.994 34.155  43.533  1.00 20.97  ? 615  LEU A CD2   1 
ATOM   4781  N N     . ARG A 1 616 ? -21.821 31.129  39.040  1.00 22.10  ? 616  ARG A N     1 
ATOM   4782  C CA    . ARG A 1 616 ? -21.821 30.907  37.605  1.00 22.78  ? 616  ARG A CA    1 
ATOM   4783  C C     . ARG A 1 616 ? -23.240 30.878  37.053  1.00 21.93  ? 616  ARG A C     1 
ATOM   4784  O O     . ARG A 1 616 ? -23.546 31.604  36.113  1.00 21.74  ? 616  ARG A O     1 
ATOM   4785  C CB    . ARG A 1 616 ? -21.098 29.599  37.274  1.00 22.73  ? 616  ARG A CB    1 
ATOM   4786  C CG    . ARG A 1 616 ? -20.474 29.585  35.876  1.00 24.86  ? 616  ARG A CG    1 
ATOM   4787  C CD    . ARG A 1 616 ? -19.508 28.408  35.666  1.00 25.18  ? 616  ARG A CD    1 
ATOM   4788  N NE    . ARG A 1 616 ? -18.635 28.154  36.824  1.00 30.50  ? 616  ARG A NE    1 
ATOM   4789  C CZ    . ARG A 1 616 ? -18.609 27.004  37.506  1.00 32.46  ? 616  ARG A CZ    1 
ATOM   4790  N NH1   . ARG A 1 616 ? -19.404 25.994  37.154  1.00 32.91  ? 616  ARG A NH1   1 
ATOM   4791  N NH2   . ARG A 1 616 ? -17.780 26.852  38.538  1.00 33.64  ? 616  ARG A NH2   1 
ATOM   4792  N N     . LYS A 1 617 ? -24.105 30.050  37.649  1.00 21.45  ? 617  LYS A N     1 
ATOM   4793  C CA    . LYS A 1 617 ? -25.482 29.912  37.175  1.00 21.14  ? 617  LYS A CA    1 
ATOM   4794  C C     . LYS A 1 617 ? -26.253 31.231  37.206  1.00 20.50  ? 617  LYS A C     1 
ATOM   4795  O O     . LYS A 1 617 ? -26.852 31.620  36.208  1.00 20.46  ? 617  LYS A O     1 
ATOM   4796  C CB    . LYS A 1 617 ? -26.225 28.791  37.922  1.00 21.62  ? 617  LYS A CB    1 
ATOM   4797  C CG    . LYS A 1 617 ? -25.652 27.407  37.618  1.00 22.81  ? 617  LYS A CG    1 
ATOM   4798  C CD    . LYS A 1 617 ? -26.617 26.277  37.904  1.00 25.77  ? 617  LYS A CD    1 
ATOM   4799  C CE    . LYS A 1 617 ? -25.841 24.979  38.074  1.00 27.58  ? 617  LYS A CE    1 
ATOM   4800  N NZ    . LYS A 1 617 ? -26.707 23.774  38.261  1.00 29.73  ? 617  LYS A NZ    1 
ATOM   4801  N N     . ILE A 1 618 ? -26.202 31.918  38.342  1.00 20.29  ? 618  ILE A N     1 
ATOM   4802  C CA    . ILE A 1 618 ? -26.871 33.204  38.539  1.00 19.88  ? 618  ILE A CA    1 
ATOM   4803  C C     . ILE A 1 618 ? -26.413 34.247  37.523  1.00 20.30  ? 618  ILE A C     1 
ATOM   4804  O O     . ILE A 1 618 ? -27.244 34.878  36.866  1.00 20.05  ? 618  ILE A O     1 
ATOM   4805  C CB    . ILE A 1 618 ? -26.694 33.711  39.997  1.00 20.00  ? 618  ILE A CB    1 
ATOM   4806  C CG1   . ILE A 1 618 ? -27.527 32.837  40.960  1.00 19.36  ? 618  ILE A CG1   1 
ATOM   4807  C CG2   . ILE A 1 618 ? -27.059 35.200  40.121  1.00 19.71  ? 618  ILE A CG2   1 
ATOM   4808  C CD1   . ILE A 1 618 ? -27.382 33.187  42.440  1.00 19.37  ? 618  ILE A CD1   1 
ATOM   4809  N N     . ALA A 1 619 ? -25.094 34.409  37.387  1.00 20.62  ? 619  ALA A N     1 
ATOM   4810  C CA    . ALA A 1 619 ? -24.519 35.300  36.385  1.00 21.05  ? 619  ALA A CA    1 
ATOM   4811  C C     . ALA A 1 619 ? -25.008 34.980  34.960  1.00 21.17  ? 619  ALA A C     1 
ATOM   4812  O O     . ALA A 1 619 ? -25.160 35.874  34.149  1.00 21.00  ? 619  ALA A O     1 
ATOM   4813  C CB    . ALA A 1 619 ? -23.008 35.260  36.452  1.00 21.05  ? 619  ALA A CB    1 
ATOM   4814  N N     . ALA A 1 620 ? -25.281 33.708  34.684  1.00 21.58  ? 620  ALA A N     1 
ATOM   4815  C CA    . ALA A 1 620 ? -25.681 33.269  33.354  1.00 22.20  ? 620  ALA A CA    1 
ATOM   4816  C C     . ALA A 1 620 ? -27.176 33.445  33.051  1.00 22.85  ? 620  ALA A C     1 
ATOM   4817  O O     . ALA A 1 620 ? -27.635 33.050  31.982  1.00 23.16  ? 620  ALA A O     1 
ATOM   4818  C CB    . ALA A 1 620 ? -25.265 31.831  33.142  1.00 22.00  ? 620  ALA A CB    1 
ATOM   4819  N N     . GLY A 1 621 ? -27.928 34.031  33.980  1.00 23.57  ? 621  GLY A N     1 
ATOM   4820  C CA    . GLY A 1 621 ? -29.379 34.168  33.829  1.00 24.07  ? 621  GLY A CA    1 
ATOM   4821  C C     . GLY A 1 621 ? -30.245 32.997  34.307  1.00 24.57  ? 621  GLY A C     1 
ATOM   4822  O O     . GLY A 1 621 ? -31.452 32.992  34.061  1.00 24.79  ? 621  GLY A O     1 
ATOM   4823  N N     . ASP A 1 622 ? -29.657 32.007  34.979  1.00 24.78  ? 622  ASP A N     1 
ATOM   4824  C CA    . ASP A 1 622 ? -30.457 30.954  35.624  1.00 25.71  ? 622  ASP A CA    1 
ATOM   4825  C C     . ASP A 1 622 ? -31.192 31.501  36.870  1.00 25.72  ? 622  ASP A C     1 
ATOM   4826  O O     . ASP A 1 622 ? -30.622 32.259  37.658  1.00 25.40  ? 622  ASP A O     1 
ATOM   4827  C CB    . ASP A 1 622 ? -29.589 29.743  36.008  1.00 26.06  ? 622  ASP A CB    1 
ATOM   4828  C CG    . ASP A 1 622 ? -28.859 29.108  34.807  1.00 27.65  ? 622  ASP A CG    1 
ATOM   4829  O OD1   . ASP A 1 622 ? -29.252 29.342  33.638  1.00 29.00  ? 622  ASP A OD1   1 
ATOM   4830  O OD2   . ASP A 1 622 ? -27.888 28.345  35.041  1.00 28.57  ? 622  ASP A OD2   1 
ATOM   4831  N N     . THR A 1 623 ? -32.457 31.117  37.034  1.00 26.05  ? 623  THR A N     1 
ATOM   4832  C CA    . THR A 1 623 ? -33.266 31.543  38.183  1.00 26.36  ? 623  THR A CA    1 
ATOM   4833  C C     . THR A 1 623 ? -33.747 30.358  39.032  1.00 26.61  ? 623  THR A C     1 
ATOM   4834  O O     . THR A 1 623 ? -34.350 30.544  40.101  1.00 26.68  ? 623  THR A O     1 
ATOM   4835  C CB    . THR A 1 623 ? -34.509 32.360  37.741  1.00 26.38  ? 623  THR A CB    1 
ATOM   4836  O OG1   . THR A 1 623 ? -35.295 31.578  36.839  1.00 26.86  ? 623  THR A OG1   1 
ATOM   4837  C CG2   . THR A 1 623 ? -34.105 33.658  37.054  1.00 26.70  ? 623  THR A CG2   1 
ATOM   4838  N N     . SER A 1 624 ? -33.501 29.145  38.544  1.00 26.54  ? 624  SER A N     1 
ATOM   4839  C CA    . SER A 1 624 ? -33.914 27.939  39.242  1.00 26.52  ? 624  SER A CA    1 
ATOM   4840  C C     . SER A 1 624 ? -32.848 26.839  39.148  1.00 26.73  ? 624  SER A C     1 
ATOM   4841  O O     . SER A 1 624 ? -31.967 26.891  38.285  1.00 26.21  ? 624  SER A O     1 
ATOM   4842  C CB    . SER A 1 624 ? -35.268 27.453  38.708  1.00 26.66  ? 624  SER A CB    1 
ATOM   4843  O OG    . SER A 1 624 ? -35.170 27.035  37.360  1.00 26.27  ? 624  SER A OG    1 
ATOM   4844  N N     . ASN A 1 625 ? -32.937 25.860  40.056  1.00 27.05  ? 625  ASN A N     1 
ATOM   4845  C CA    . ASN A 1 625 ? -32.027 24.706  40.102  1.00 27.38  ? 625  ASN A CA    1 
ATOM   4846  C C     . ASN A 1 625 ? -30.542 25.070  39.948  1.00 27.25  ? 625  ASN A C     1 
ATOM   4847  O O     . ASN A 1 625 ? -30.000 25.846  40.745  1.00 27.55  ? 625  ASN A O     1 
ATOM   4848  C CB    . ASN A 1 625 ? -32.446 23.636  39.078  1.00 27.27  ? 625  ASN A CB    1 
ATOM   4849  N N     . ASP A 1 628 ? -27.510 22.864  45.390  1.00 34.85  ? 628  ASP A N     1 
ATOM   4850  C CA    . ASP A 1 628 ? -27.701 22.500  46.792  1.00 34.97  ? 628  ASP A CA    1 
ATOM   4851  C C     . ASP A 1 628 ? -27.258 23.622  47.720  1.00 34.78  ? 628  ASP A C     1 
ATOM   4852  O O     . ASP A 1 628 ? -26.170 24.176  47.582  1.00 35.02  ? 628  ASP A O     1 
ATOM   4853  C CB    . ASP A 1 628 ? -26.956 21.204  47.142  1.00 34.95  ? 628  ASP A CB    1 
ATOM   4854  C CG    . ASP A 1 628 ? -27.477 20.553  48.425  1.00 35.43  ? 628  ASP A CG    1 
ATOM   4855  O OD1   . ASP A 1 628 ? -27.672 19.319  48.417  1.00 36.68  ? 628  ASP A OD1   1 
ATOM   4856  O OD2   . ASP A 1 628 ? -27.702 21.254  49.441  1.00 35.03  ? 628  ASP A OD2   1 
ATOM   4857  N N     . THR A 1 629 ? -28.104 23.925  48.690  1.00 34.65  ? 629  THR A N     1 
ATOM   4858  C CA    . THR A 1 629 ? -27.914 25.077  49.548  1.00 34.34  ? 629  THR A CA    1 
ATOM   4859  C C     . THR A 1 629 ? -27.665 24.684  51.013  1.00 34.32  ? 629  THR A C     1 
ATOM   4860  O O     . THR A 1 629 ? -27.377 25.548  51.840  1.00 34.32  ? 629  THR A O     1 
ATOM   4861  C CB    . THR A 1 629 ? -29.135 26.031  49.425  1.00 34.49  ? 629  THR A CB    1 
ATOM   4862  O OG1   . THR A 1 629 ? -28.801 27.331  49.923  1.00 34.39  ? 629  THR A OG1   1 
ATOM   4863  C CG2   . THR A 1 629 ? -30.380 25.470  50.166  1.00 34.11  ? 629  THR A CG2   1 
ATOM   4864  N N     . SER A 1 630 ? -27.771 23.387  51.322  1.00 34.03  ? 630  SER A N     1 
ATOM   4865  C CA    . SER A 1 630 ? -27.673 22.892  52.707  1.00 33.86  ? 630  SER A CA    1 
ATOM   4866  C C     . SER A 1 630 ? -26.308 23.129  53.360  1.00 33.65  ? 630  SER A C     1 
ATOM   4867  O O     . SER A 1 630 ? -26.240 23.512  54.531  1.00 33.62  ? 630  SER A O     1 
ATOM   4868  C CB    . SER A 1 630 ? -28.057 21.407  52.796  1.00 33.82  ? 630  SER A CB    1 
ATOM   4869  O OG    . SER A 1 630 ? -27.092 20.584  52.165  1.00 33.63  ? 630  SER A OG    1 
ATOM   4870  N N     . THR A 1 631 ? -25.233 22.892  52.606  1.00 33.41  ? 631  THR A N     1 
ATOM   4871  C CA    . THR A 1 631 ? -23.879 23.244  53.043  1.00 33.10  ? 631  THR A CA    1 
ATOM   4872  C C     . THR A 1 631 ? -23.649 24.708  52.705  1.00 32.66  ? 631  THR A C     1 
ATOM   4873  O O     . THR A 1 631 ? -23.141 25.032  51.626  1.00 32.90  ? 631  THR A O     1 
ATOM   4874  C CB    . THR A 1 631 ? -22.779 22.377  52.366  1.00 33.22  ? 631  THR A CB    1 
ATOM   4875  O OG1   . THR A 1 631 ? -22.754 22.638  50.955  1.00 33.55  ? 631  THR A OG1   1 
ATOM   4876  C CG2   . THR A 1 631 ? -23.011 20.886  52.613  1.00 33.18  ? 631  THR A CG2   1 
ATOM   4877  N N     . LEU A 1 632 ? -24.046 25.586  53.624  1.00 32.06  ? 632  LEU A N     1 
ATOM   4878  C CA    . LEU A 1 632 ? -24.034 27.025  53.394  1.00 31.54  ? 632  LEU A CA    1 
ATOM   4879  C C     . LEU A 1 632 ? -24.429 27.764  54.662  1.00 31.07  ? 632  LEU A C     1 
ATOM   4880  O O     . LEU A 1 632 ? -25.515 27.537  55.212  1.00 31.00  ? 632  LEU A O     1 
ATOM   4881  C CB    . LEU A 1 632 ? -25.002 27.384  52.263  1.00 31.70  ? 632  LEU A CB    1 
ATOM   4882  C CG    . LEU A 1 632 ? -24.605 28.503  51.308  1.00 32.17  ? 632  LEU A CG    1 
ATOM   4883  C CD1   . LEU A 1 632 ? -25.297 28.326  49.968  1.00 32.28  ? 632  LEU A CD1   1 
ATOM   4884  C CD2   . LEU A 1 632 ? -24.917 29.867  51.917  1.00 33.52  ? 632  LEU A CD2   1 
ATOM   4885  N N     . ALA A 1 633 ? -23.549 28.659  55.111  1.00 30.49  ? 633  ALA A N     1 
ATOM   4886  C CA    . ALA A 1 633 ? -23.733 29.404  56.369  1.00 29.88  ? 633  ALA A CA    1 
ATOM   4887  C C     . ALA A 1 633 ? -25.095 30.120  56.495  1.00 29.31  ? 633  ALA A C     1 
ATOM   4888  O O     . ALA A 1 633 ? -25.763 30.036  57.534  1.00 28.91  ? 633  ALA A O     1 
ATOM   4889  C CB    . ALA A 1 633 ? -22.577 30.393  56.565  1.00 29.98  ? 633  ALA A CB    1 
ATOM   4890  N N     . ASP A 1 634 ? -25.488 30.809  55.423  1.00 28.58  ? 634  ASP A N     1 
ATOM   4891  C CA    . ASP A 1 634 ? -26.734 31.568  55.355  1.00 27.70  ? 634  ASP A CA    1 
ATOM   4892  C C     . ASP A 1 634 ? -27.382 31.368  53.971  1.00 27.03  ? 634  ASP A C     1 
ATOM   4893  O O     . ASP A 1 634 ? -27.087 32.111  53.027  1.00 27.01  ? 634  ASP A O     1 
ATOM   4894  C CB    . ASP A 1 634 ? -26.442 33.051  55.640  1.00 27.78  ? 634  ASP A CB    1 
ATOM   4895  C CG    . ASP A 1 634 ? -27.667 33.944  55.494  1.00 27.76  ? 634  ASP A CG    1 
ATOM   4896  O OD1   . ASP A 1 634 ? -28.806 33.470  55.723  1.00 28.37  ? 634  ASP A OD1   1 
ATOM   4897  O OD2   . ASP A 1 634 ? -27.478 35.133  55.156  1.00 26.62  ? 634  ASP A OD2   1 
ATOM   4898  N N     . PRO A 1 635 ? -28.271 30.361  53.848  1.00 26.34  ? 635  PRO A N     1 
ATOM   4899  C CA    . PRO A 1 635 ? -28.875 29.984  52.560  1.00 25.67  ? 635  PRO A CA    1 
ATOM   4900  C C     . PRO A 1 635 ? -29.648 31.128  51.902  1.00 25.13  ? 635  PRO A C     1 
ATOM   4901  O O     . PRO A 1 635 ? -29.904 31.093  50.693  1.00 25.08  ? 635  PRO A O     1 
ATOM   4902  C CB    . PRO A 1 635 ? -29.832 28.850  52.937  1.00 25.65  ? 635  PRO A CB    1 
ATOM   4903  C CG    . PRO A 1 635 ? -29.305 28.325  54.230  1.00 25.94  ? 635  PRO A CG    1 
ATOM   4904  C CD    . PRO A 1 635 ? -28.771 29.517  54.948  1.00 26.19  ? 635  PRO A CD    1 
ATOM   4905  N N     . GLY A 1 636 ? -29.997 32.132  52.702  1.00 24.33  ? 636  GLY A N     1 
ATOM   4906  C CA    . GLY A 1 636 ? -30.692 33.318  52.229  1.00 23.41  ? 636  GLY A CA    1 
ATOM   4907  C C     . GLY A 1 636 ? -29.896 34.184  51.268  1.00 23.00  ? 636  GLY A C     1 
ATOM   4908  O O     . GLY A 1 636 ? -30.477 35.049  50.618  1.00 22.78  ? 636  GLY A O     1 
ATOM   4909  N N     . VAL A 1 637 ? -28.580 33.958  51.169  1.00 22.55  ? 637  VAL A N     1 
ATOM   4910  C CA    . VAL A 1 637 ? -27.729 34.735  50.238  1.00 22.25  ? 637  VAL A CA    1 
ATOM   4911  C C     . VAL A 1 637 ? -28.123 34.527  48.782  1.00 22.08  ? 637  VAL A C     1 
ATOM   4912  O O     . VAL A 1 637 ? -27.995 35.438  47.972  1.00 21.72  ? 637  VAL A O     1 
ATOM   4913  C CB    . VAL A 1 637 ? -26.189 34.452  50.376  1.00 22.18  ? 637  VAL A CB    1 
ATOM   4914  C CG1   . VAL A 1 637 ? -25.660 34.877  51.742  1.00 22.45  ? 637  VAL A CG1   1 
ATOM   4915  C CG2   . VAL A 1 637 ? -25.839 32.988  50.056  1.00 21.28  ? 637  VAL A CG2   1 
ATOM   4916  N N     . VAL A 1 638 ? -28.607 33.322  48.466  1.00 22.22  ? 638  VAL A N     1 
ATOM   4917  C CA    . VAL A 1 638 ? -28.941 32.942  47.088  1.00 22.18  ? 638  VAL A CA    1 
ATOM   4918  C C     . VAL A 1 638 ? -30.075 33.807  46.550  1.00 21.98  ? 638  VAL A C     1 
ATOM   4919  O O     . VAL A 1 638 ? -30.020 34.278  45.413  1.00 22.15  ? 638  VAL A O     1 
ATOM   4920  C CB    . VAL A 1 638 ? -29.293 31.442  46.978  1.00 22.17  ? 638  VAL A CB    1 
ATOM   4921  C CG1   . VAL A 1 638 ? -29.779 31.091  45.565  1.00 22.43  ? 638  VAL A CG1   1 
ATOM   4922  C CG2   . VAL A 1 638 ? -28.088 30.594  47.352  1.00 21.61  ? 638  VAL A CG2   1 
ATOM   4923  N N     . GLU A 1 639 ? -31.078 34.034  47.393  1.00 21.79  ? 639  GLU A N     1 
ATOM   4924  C CA    . GLU A 1 639 ? -32.208 34.898  47.061  1.00 21.74  ? 639  GLU A CA    1 
ATOM   4925  C C     . GLU A 1 639 ? -31.749 36.328  46.786  1.00 21.48  ? 639  GLU A C     1 
ATOM   4926  O O     . GLU A 1 639 ? -32.114 36.899  45.764  1.00 21.04  ? 639  GLU A O     1 
ATOM   4927  C CB    . GLU A 1 639 ? -33.267 34.865  48.175  1.00 21.60  ? 639  GLU A CB    1 
ATOM   4928  N N     . LYS A 1 640 ? -30.942 36.881  47.698  1.00 21.66  ? 640  LYS A N     1 
ATOM   4929  C CA    . LYS A 1 640 ? -30.384 38.232  47.560  1.00 21.63  ? 640  LYS A CA    1 
ATOM   4930  C C     . LYS A 1 640 ? -29.541 38.355  46.295  1.00 21.87  ? 640  LYS A C     1 
ATOM   4931  O O     . LYS A 1 640 ? -29.651 39.356  45.572  1.00 22.34  ? 640  LYS A O     1 
ATOM   4932  C CB    . LYS A 1 640 ? -29.560 38.632  48.793  1.00 21.51  ? 640  LYS A CB    1 
ATOM   4933  N N     . LEU A 1 641 ? -28.721 37.339  46.015  1.00 21.38  ? 641  LEU A N     1 
ATOM   4934  C CA    . LEU A 1 641 ? -27.907 37.327  44.792  1.00 21.35  ? 641  LEU A CA    1 
ATOM   4935  C C     . LEU A 1 641 ? -28.749 37.412  43.519  1.00 21.73  ? 641  LEU A C     1 
ATOM   4936  O O     . LEU A 1 641 ? -28.415 38.163  42.610  1.00 21.68  ? 641  LEU A O     1 
ATOM   4937  C CB    . LEU A 1 641 ? -26.962 36.122  44.754  1.00 21.14  ? 641  LEU A CB    1 
ATOM   4938  C CG    . LEU A 1 641 ? -25.745 36.162  45.690  1.00 20.25  ? 641  LEU A CG    1 
ATOM   4939  C CD1   . LEU A 1 641 ? -25.071 34.805  45.711  1.00 19.33  ? 641  LEU A CD1   1 
ATOM   4940  C CD2   . LEU A 1 641 ? -24.758 37.270  45.290  1.00 20.12  ? 641  LEU A CD2   1 
ATOM   4941  N N     . LEU A 1 642 ? -29.846 36.658  43.478  1.00 22.51  ? 642  LEU A N     1 
ATOM   4942  C CA    . LEU A 1 642 ? -30.814 36.702  42.369  1.00 23.37  ? 642  LEU A CA    1 
ATOM   4943  C C     . LEU A 1 642 ? -31.458 38.069  42.184  1.00 23.84  ? 642  LEU A C     1 
ATOM   4944  O O     . LEU A 1 642 ? -31.520 38.586  41.071  1.00 23.88  ? 642  LEU A O     1 
ATOM   4945  C CB    . LEU A 1 642 ? -31.938 35.685  42.586  1.00 23.34  ? 642  LEU A CB    1 
ATOM   4946  C CG    . LEU A 1 642 ? -31.709 34.198  42.342  1.00 23.58  ? 642  LEU A CG    1 
ATOM   4947  C CD1   . LEU A 1 642 ? -32.910 33.433  42.890  1.00 23.00  ? 642  LEU A CD1   1 
ATOM   4948  C CD2   . LEU A 1 642 ? -31.500 33.906  40.854  1.00 23.54  ? 642  LEU A CD2   1 
ATOM   4949  N N     . GLU A 1 643 ? -31.962 38.635  43.273  1.00 24.52  ? 643  GLU A N     1 
ATOM   4950  C CA    . GLU A 1 643 ? -32.552 39.960  43.229  1.00 25.74  ? 643  GLU A CA    1 
ATOM   4951  C C     . GLU A 1 643 ? -31.590 40.944  42.591  1.00 26.10  ? 643  GLU A C     1 
ATOM   4952  O O     . GLU A 1 643 ? -31.942 41.607  41.615  1.00 26.35  ? 643  GLU A O     1 
ATOM   4953  C CB    . GLU A 1 643 ? -32.905 40.444  44.631  1.00 25.88  ? 643  GLU A CB    1 
ATOM   4954  C CG    . GLU A 1 643 ? -34.312 40.133  45.079  1.00 27.09  ? 643  GLU A CG    1 
ATOM   4955  C CD    . GLU A 1 643 ? -34.471 40.302  46.580  1.00 29.04  ? 643  GLU A CD    1 
ATOM   4956  O OE1   . GLU A 1 643 ? -33.625 41.005  47.195  1.00 28.68  ? 643  GLU A OE1   1 
ATOM   4957  O OE2   . GLU A 1 643 ? -35.435 39.727  47.143  1.00 29.10  ? 643  GLU A OE2   1 
ATOM   4958  N N     . GLU A 1 644 ? -30.379 41.012  43.145  1.00 26.65  ? 644  GLU A N     1 
ATOM   4959  C CA    . GLU A 1 644 ? -29.332 41.933  42.690  1.00 27.50  ? 644  GLU A CA    1 
ATOM   4960  C C     . GLU A 1 644 ? -28.971 41.722  41.221  1.00 28.22  ? 644  GLU A C     1 
ATOM   4961  O O     . GLU A 1 644 ? -28.724 42.689  40.497  1.00 28.38  ? 644  GLU A O     1 
ATOM   4962  C CB    . GLU A 1 644 ? -28.072 41.791  43.545  1.00 27.34  ? 644  GLU A CB    1 
ATOM   4963  C CG    . GLU A 1 644 ? -28.277 41.962  45.048  1.00 27.36  ? 644  GLU A CG    1 
ATOM   4964  C CD    . GLU A 1 644 ? -27.086 41.465  45.867  1.00 26.95  ? 644  GLU A CD    1 
ATOM   4965  O OE1   . GLU A 1 644 ? -26.256 40.696  45.331  1.00 26.40  ? 644  GLU A OE1   1 
ATOM   4966  O OE2   . GLU A 1 644 ? -26.983 41.840  47.048  1.00 24.68  ? 644  GLU A OE2   1 
ATOM   4967  N N     . LYS A 1 645 ? -28.936 40.460  40.790  1.00 29.06  ? 645  LYS A N     1 
ATOM   4968  C CA    . LYS A 1 645 ? -28.727 40.133  39.379  1.00 30.09  ? 645  LYS A CA    1 
ATOM   4969  C C     . LYS A 1 645 ? -29.841 40.714  38.510  1.00 30.93  ? 645  LYS A C     1 
ATOM   4970  O O     . LYS A 1 645 ? -29.566 41.244  37.433  1.00 31.38  ? 645  LYS A O     1 
ATOM   4971  C CB    . LYS A 1 645 ? -28.619 38.624  39.157  1.00 29.57  ? 645  LYS A CB    1 
ATOM   4972  C CG    . LYS A 1 645 ? -27.679 38.237  38.026  1.00 30.00  ? 645  LYS A CG    1 
ATOM   4973  C CD    . LYS A 1 645 ? -28.312 38.360  36.657  1.00 30.25  ? 645  LYS A CD    1 
ATOM   4974  C CE    . LYS A 1 645 ? -27.275 38.221  35.582  1.00 30.86  ? 645  LYS A CE    1 
ATOM   4975  N NZ    . LYS A 1 645 ? -27.910 37.997  34.261  1.00 32.28  ? 645  LYS A NZ    1 
ATOM   4976  N N     . GLN A 1 646 ? -31.086 40.629  38.983  1.00 31.77  ? 646  GLN A N     1 
ATOM   4977  C CA    . GLN A 1 646 ? -32.232 41.148  38.232  1.00 32.92  ? 646  GLN A CA    1 
ATOM   4978  C C     . GLN A 1 646 ? -32.197 42.672  38.010  1.00 33.32  ? 646  GLN A C     1 
ATOM   4979  O O     . GLN A 1 646 ? -32.930 43.200  37.169  1.00 33.43  ? 646  GLN A O     1 
ATOM   4980  C CB    . GLN A 1 646 ? -33.555 40.716  38.871  1.00 33.16  ? 646  GLN A CB    1 
ATOM   4981  C CG    . GLN A 1 646 ? -34.264 39.561  38.144  1.00 35.12  ? 646  GLN A CG    1 
ATOM   4982  C CD    . GLN A 1 646 ? -33.893 38.172  38.686  1.00 37.84  ? 646  GLN A CD    1 
ATOM   4983  O OE1   . GLN A 1 646 ? -34.691 37.531  39.390  1.00 37.68  ? 646  GLN A OE1   1 
ATOM   4984  N NE2   . GLN A 1 646 ? -32.685 37.701  38.352  1.00 37.89  ? 646  GLN A NE2   1 
ATOM   4985  N N     . ALA A 1 647 ? -31.327 43.366  38.741  1.00 33.73  ? 647  ALA A N     1 
ATOM   4986  C CA    . ALA A 1 647 ? -31.151 44.809  38.574  1.00 34.02  ? 647  ALA A CA    1 
ATOM   4987  C C     . ALA A 1 647 ? -29.906 45.201  37.740  1.00 34.07  ? 647  ALA A C     1 
ATOM   4988  O O     . ALA A 1 647 ? -29.240 44.363  37.104  1.00 34.10  ? 647  ALA A O     1 
ATOM   4989  C CB    . ALA A 1 647 ? -31.136 45.501  39.950  1.00 33.87  ? 647  ALA A CB    1 
ATOM   4990  N N     . LYS B 1 6   ? -30.594 70.595  46.830  1.00 33.03  ? 6    LYS B N     1 
ATOM   4991  C CA    . LYS B 1 6   ? -30.413 71.729  45.874  1.00 32.97  ? 6    LYS B CA    1 
ATOM   4992  C C     . LYS B 1 6   ? -28.946 72.129  45.694  1.00 32.44  ? 6    LYS B C     1 
ATOM   4993  O O     . LYS B 1 6   ? -28.076 71.741  46.497  1.00 32.54  ? 6    LYS B O     1 
ATOM   4994  C CB    . LYS B 1 6   ? -31.249 72.949  46.291  1.00 33.02  ? 6    LYS B CB    1 
ATOM   4995  C CG    . LYS B 1 6   ? -32.639 72.985  45.655  1.00 33.69  ? 6    LYS B CG    1 
ATOM   4996  C CD    . LYS B 1 6   ? -33.337 74.322  45.881  1.00 33.88  ? 6    LYS B CD    1 
ATOM   4997  C CE    . LYS B 1 6   ? -34.746 74.330  45.273  1.00 35.33  ? 6    LYS B CE    1 
ATOM   4998  N NZ    . LYS B 1 6   ? -35.594 75.490  45.728  1.00 35.01  ? 6    LYS B NZ    1 
ATOM   4999  N N     . HIS B 1 7   ? -28.696 72.875  44.611  1.00 31.05  ? 7    HIS B N     1 
ATOM   5000  C CA    . HIS B 1 7   ? -27.418 73.516  44.337  1.00 29.44  ? 7    HIS B CA    1 
ATOM   5001  C C     . HIS B 1 7   ? -27.645 75.018  44.282  1.00 28.45  ? 7    HIS B C     1 
ATOM   5002  O O     . HIS B 1 7   ? -28.341 75.513  43.391  1.00 28.02  ? 7    HIS B O     1 
ATOM   5003  C CB    . HIS B 1 7   ? -26.823 73.030  43.012  1.00 29.55  ? 7    HIS B CB    1 
ATOM   5004  C CG    . HIS B 1 7   ? -26.239 71.657  43.087  1.00 29.52  ? 7    HIS B CG    1 
ATOM   5005  N ND1   . HIS B 1 7   ? -24.967 71.417  43.561  1.00 28.99  ? 7    HIS B ND1   1 
ATOM   5006  C CD2   . HIS B 1 7   ? -26.760 70.448  42.776  1.00 29.21  ? 7    HIS B CD2   1 
ATOM   5007  C CE1   . HIS B 1 7   ? -24.728 70.118  43.530  1.00 29.47  ? 7    HIS B CE1   1 
ATOM   5008  N NE2   . HIS B 1 7   ? -25.799 69.508  43.054  1.00 28.67  ? 7    HIS B NE2   1 
ATOM   5009  N N     . ALA B 1 8   ? -27.060 75.734  45.241  1.00 27.04  ? 8    ALA B N     1 
ATOM   5010  C CA    . ALA B 1 8   ? -27.187 77.184  45.323  1.00 25.79  ? 8    ALA B CA    1 
ATOM   5011  C C     . ALA B 1 8   ? -26.442 77.869  44.185  1.00 25.04  ? 8    ALA B C     1 
ATOM   5012  O O     . ALA B 1 8   ? -25.489 77.313  43.623  1.00 24.85  ? 8    ALA B O     1 
ATOM   5013  C CB    . ALA B 1 8   ? -26.675 77.683  46.667  1.00 25.99  ? 8    ALA B CB    1 
ATOM   5014  N N     . ILE B 1 9   ? -26.892 79.072  43.837  1.00 24.02  ? 9    ILE B N     1 
ATOM   5015  C CA    . ILE B 1 9   ? -26.188 79.896  42.865  1.00 23.17  ? 9    ILE B CA    1 
ATOM   5016  C C     . ILE B 1 9   ? -24.832 80.321  43.454  1.00 23.19  ? 9    ILE B C     1 
ATOM   5017  O O     . ILE B 1 9   ? -24.785 80.926  44.540  1.00 23.20  ? 9    ILE B O     1 
ATOM   5018  C CB    . ILE B 1 9   ? -27.028 81.128  42.442  1.00 22.95  ? 9    ILE B CB    1 
ATOM   5019  C CG1   . ILE B 1 9   ? -28.300 80.685  41.695  1.00 22.71  ? 9    ILE B CG1   1 
ATOM   5020  C CG2   . ILE B 1 9   ? -26.188 82.113  41.611  1.00 21.99  ? 9    ILE B CG2   1 
ATOM   5021  C CD1   . ILE B 1 9   ? -29.497 81.669  41.823  1.00 20.73  ? 9    ILE B CD1   1 
ATOM   5022  N N     . PRO B 1 10  ? -23.724 79.995  42.752  1.00 22.85  ? 10   PRO B N     1 
ATOM   5023  C CA    . PRO B 1 10  ? -22.405 80.393  43.255  1.00 22.72  ? 10   PRO B CA    1 
ATOM   5024  C C     . PRO B 1 10  ? -22.125 81.896  43.129  1.00 22.57  ? 10   PRO B C     1 
ATOM   5025  O O     . PRO B 1 10  ? -22.579 82.533  42.178  1.00 22.38  ? 10   PRO B O     1 
ATOM   5026  C CB    . PRO B 1 10  ? -21.437 79.575  42.404  1.00 22.69  ? 10   PRO B CB    1 
ATOM   5027  C CG    . PRO B 1 10  ? -22.181 79.229  41.176  1.00 22.41  ? 10   PRO B CG    1 
ATOM   5028  C CD    . PRO B 1 10  ? -23.638 79.248  41.482  1.00 22.60  ? 10   PRO B CD    1 
ATOM   5029  N N     . ALA B 1 11  ? -21.379 82.431  44.099  1.00 22.55  ? 11   ALA B N     1 
ATOM   5030  C CA    . ALA B 1 11  ? -21.052 83.867  44.214  1.00 22.31  ? 11   ALA B CA    1 
ATOM   5031  C C     . ALA B 1 11  ? -20.525 84.547  42.948  1.00 22.39  ? 11   ALA B C     1 
ATOM   5032  O O     . ALA B 1 11  ? -20.944 85.664  42.630  1.00 22.59  ? 11   ALA B O     1 
ATOM   5033  C CB    . ALA B 1 11  ? -20.076 84.093  45.372  1.00 22.41  ? 11   ALA B CB    1 
ATOM   5034  N N     . ASN B 1 12  ? -19.608 83.881  42.238  1.00 22.28  ? 12   ASN B N     1 
ATOM   5035  C CA    . ASN B 1 12  ? -19.086 84.378  40.964  1.00 22.01  ? 12   ASN B CA    1 
ATOM   5036  C C     . ASN B 1 12  ? -20.180 84.596  39.916  1.00 22.38  ? 12   ASN B C     1 
ATOM   5037  O O     . ASN B 1 12  ? -20.151 85.593  39.172  1.00 22.40  ? 12   ASN B O     1 
ATOM   5038  C CB    . ASN B 1 12  ? -17.981 83.456  40.417  1.00 22.12  ? 12   ASN B CB    1 
ATOM   5039  C CG    . ASN B 1 12  ? -18.509 82.084  39.956  1.00 21.89  ? 12   ASN B CG    1 
ATOM   5040  O OD1   . ASN B 1 12  ? -19.155 81.375  40.718  1.00 22.56  ? 12   ASN B OD1   1 
ATOM   5041  N ND2   . ASN B 1 12  ? -18.217 81.714  38.707  1.00 19.00  ? 12   ASN B ND2   1 
ATOM   5042  N N     . ILE B 1 13  ? -21.140 83.665  39.865  1.00 22.08  ? 13   ILE B N     1 
ATOM   5043  C CA    . ILE B 1 13  ? -22.263 83.752  38.937  1.00 21.84  ? 13   ILE B CA    1 
ATOM   5044  C C     . ILE B 1 13  ? -23.246 84.812  39.415  1.00 22.28  ? 13   ILE B C     1 
ATOM   5045  O O     . ILE B 1 13  ? -23.759 85.596  38.622  1.00 22.46  ? 13   ILE B O     1 
ATOM   5046  C CB    . ILE B 1 13  ? -22.952 82.356  38.713  1.00 21.88  ? 13   ILE B CB    1 
ATOM   5047  C CG1   . ILE B 1 13  ? -21.962 81.340  38.116  1.00 20.96  ? 13   ILE B CG1   1 
ATOM   5048  C CG2   . ILE B 1 13  ? -24.210 82.474  37.834  1.00 21.00  ? 13   ILE B CG2   1 
ATOM   5049  C CD1   . ILE B 1 13  ? -21.328 81.749  36.796  1.00 19.38  ? 13   ILE B CD1   1 
ATOM   5050  N N     . ALA B 1 14  ? -23.499 84.832  40.718  1.00 23.10  ? 14   ALA B N     1 
ATOM   5051  C CA    . ALA B 1 14  ? -24.285 85.897  41.346  1.00 23.76  ? 14   ALA B CA    1 
ATOM   5052  C C     . ALA B 1 14  ? -23.748 87.295  41.003  1.00 24.20  ? 14   ALA B C     1 
ATOM   5053  O O     . ALA B 1 14  ? -24.514 88.174  40.622  1.00 24.62  ? 14   ALA B O     1 
ATOM   5054  C CB    . ALA B 1 14  ? -24.328 85.695  42.857  1.00 23.45  ? 14   ALA B CB    1 
ATOM   5055  N N     . ASP B 1 15  ? -22.434 87.483  41.130  1.00 24.82  ? 15   ASP B N     1 
ATOM   5056  C CA    . ASP B 1 15  ? -21.784 88.774  40.903  1.00 25.35  ? 15   ASP B CA    1 
ATOM   5057  C C     . ASP B 1 15  ? -21.817 89.228  39.437  1.00 25.62  ? 15   ASP B C     1 
ATOM   5058  O O     . ASP B 1 15  ? -21.650 90.410  39.159  1.00 26.22  ? 15   ASP B O     1 
ATOM   5059  C CB    . ASP B 1 15  ? -20.317 88.738  41.359  1.00 25.44  ? 15   ASP B CB    1 
ATOM   5060  C CG    . ASP B 1 15  ? -20.137 88.593  42.891  1.00 27.57  ? 15   ASP B CG    1 
ATOM   5061  O OD1   . ASP B 1 15  ? -21.098 88.779  43.697  1.00 27.79  ? 15   ASP B OD1   1 
ATOM   5062  O OD2   . ASP B 1 15  ? -18.975 88.309  43.289  1.00 29.67  ? 15   ASP B OD2   1 
ATOM   5063  N N     . ARG B 1 16  ? -22.007 88.301  38.499  1.00 25.75  ? 16   ARG B N     1 
ATOM   5064  C CA    . ARG B 1 16  ? -21.909 88.644  37.076  1.00 25.77  ? 16   ARG B CA    1 
ATOM   5065  C C     . ARG B 1 16  ? -23.172 88.383  36.234  1.00 25.04  ? 16   ARG B C     1 
ATOM   5066  O O     . ARG B 1 16  ? -23.239 88.808  35.085  1.00 25.05  ? 16   ARG B O     1 
ATOM   5067  C CB    . ARG B 1 16  ? -20.647 88.016  36.435  1.00 25.74  ? 16   ARG B CB    1 
ATOM   5068  C CG    . ARG B 1 16  ? -20.752 86.517  36.087  1.00 27.65  ? 16   ARG B CG    1 
ATOM   5069  C CD    . ARG B 1 16  ? -19.384 85.887  35.759  1.00 26.97  ? 16   ARG B CD    1 
ATOM   5070  N NE    . ARG B 1 16  ? -19.181 85.650  34.325  1.00 30.43  ? 16   ARG B NE    1 
ATOM   5071  C CZ    . ARG B 1 16  ? -18.395 86.373  33.523  1.00 31.81  ? 16   ARG B CZ    1 
ATOM   5072  N NH1   . ARG B 1 16  ? -17.716 87.425  33.994  1.00 31.81  ? 16   ARG B NH1   1 
ATOM   5073  N NH2   . ARG B 1 16  ? -18.292 86.043  32.234  1.00 30.50  ? 16   ARG B NH2   1 
ATOM   5074  N N     . CYS B 1 17  ? -24.169 87.697  36.797  1.00 24.63  ? 17   CYS B N     1 
ATOM   5075  C CA    . CYS B 1 17  ? -25.322 87.251  35.994  1.00 23.90  ? 17   CYS B CA    1 
ATOM   5076  C C     . CYS B 1 17  ? -26.115 88.375  35.335  1.00 23.95  ? 17   CYS B C     1 
ATOM   5077  O O     . CYS B 1 17  ? -26.334 89.443  35.930  1.00 23.98  ? 17   CYS B O     1 
ATOM   5078  C CB    . CYS B 1 17  ? -26.260 86.344  36.794  1.00 23.94  ? 17   CYS B CB    1 
ATOM   5079  S SG    . CYS B 1 17  ? -27.098 87.116  38.198  1.00 22.67  ? 17   CYS B SG    1 
ATOM   5080  N N     . LEU B 1 18  ? -26.541 88.106  34.103  1.00 23.62  ? 18   LEU B N     1 
ATOM   5081  C CA    . LEU B 1 18  ? -27.407 88.996  33.325  1.00 23.48  ? 18   LEU B CA    1 
ATOM   5082  C C     . LEU B 1 18  ? -28.815 89.076  33.912  1.00 23.74  ? 18   LEU B C     1 
ATOM   5083  O O     . LEU B 1 18  ? -29.461 90.140  33.878  1.00 24.08  ? 18   LEU B O     1 
ATOM   5084  C CB    . LEU B 1 18  ? -27.455 88.553  31.858  1.00 22.96  ? 18   LEU B CB    1 
ATOM   5085  C CG    . LEU B 1 18  ? -26.115 88.520  31.113  1.00 22.92  ? 18   LEU B CG    1 
ATOM   5086  C CD1   . LEU B 1 18  ? -26.319 88.098  29.659  1.00 22.84  ? 18   LEU B CD1   1 
ATOM   5087  C CD2   . LEU B 1 18  ? -25.353 89.872  31.198  1.00 22.66  ? 18   LEU B CD2   1 
ATOM   5088  N N     . ILE B 1 19  ? -29.272 87.959  34.478  1.00 23.53  ? 19   ILE B N     1 
ATOM   5089  C CA    . ILE B 1 19  ? -30.580 87.890  35.125  1.00 23.22  ? 19   ILE B CA    1 
ATOM   5090  C C     . ILE B 1 19  ? -30.514 87.210  36.496  1.00 23.10  ? 19   ILE B C     1 
ATOM   5091  O O     . ILE B 1 19  ? -30.205 86.021  36.594  1.00 22.74  ? 19   ILE B O     1 
ATOM   5092  C CB    . ILE B 1 19  ? -31.614 87.196  34.197  1.00 23.30  ? 19   ILE B CB    1 
ATOM   5093  C CG1   . ILE B 1 19  ? -31.793 88.029  32.923  1.00 23.56  ? 19   ILE B CG1   1 
ATOM   5094  C CG2   . ILE B 1 19  ? -32.942 86.981  34.922  1.00 22.63  ? 19   ILE B CG2   1 
ATOM   5095  C CD1   . ILE B 1 19  ? -32.744 87.451  31.925  1.00 25.29  ? 19   ILE B CD1   1 
ATOM   5096  N N     . ASN B 1 20  ? -30.801 87.981  37.550  1.00 23.27  ? 20   ASN B N     1 
ATOM   5097  C CA    . ASN B 1 20  ? -30.877 87.449  38.909  1.00 23.30  ? 20   ASN B CA    1 
ATOM   5098  C C     . ASN B 1 20  ? -32.275 86.890  39.236  1.00 23.54  ? 20   ASN B C     1 
ATOM   5099  O O     . ASN B 1 20  ? -33.190 86.994  38.410  1.00 23.57  ? 20   ASN B O     1 
ATOM   5100  C CB    . ASN B 1 20  ? -30.401 88.493  39.942  1.00 23.51  ? 20   ASN B CB    1 
ATOM   5101  C CG    . ASN B 1 20  ? -31.299 89.730  40.015  1.00 23.21  ? 20   ASN B CG    1 
ATOM   5102  O OD1   . ASN B 1 20  ? -32.530 89.638  40.011  1.00 23.85  ? 20   ASN B OD1   1 
ATOM   5103  N ND2   . ASN B 1 20  ? -30.675 90.891  40.112  1.00 22.60  ? 20   ASN B ND2   1 
ATOM   5104  N N     . PRO B 1 21  ? -32.441 86.265  40.420  1.00 23.94  ? 21   PRO B N     1 
ATOM   5105  C CA    . PRO B 1 21  ? -33.751 85.699  40.777  1.00 24.56  ? 21   PRO B CA    1 
ATOM   5106  C C     . PRO B 1 21  ? -34.942 86.668  40.633  1.00 25.68  ? 21   PRO B C     1 
ATOM   5107  O O     . PRO B 1 21  ? -35.952 86.305  40.022  1.00 25.92  ? 21   PRO B O     1 
ATOM   5108  C CB    . PRO B 1 21  ? -33.555 85.279  42.236  1.00 24.34  ? 21   PRO B CB    1 
ATOM   5109  C CG    . PRO B 1 21  ? -32.098 84.984  42.332  1.00 23.58  ? 21   PRO B CG    1 
ATOM   5110  C CD    . PRO B 1 21  ? -31.437 86.010  41.473  1.00 23.61  ? 21   PRO B CD    1 
ATOM   5111  N N     . GLU B 1 22  ? -34.804 87.879  41.176  1.00 26.65  ? 22   GLU B N     1 
ATOM   5112  C CA    . GLU B 1 22  ? -35.851 88.909  41.172  1.00 27.87  ? 22   GLU B CA    1 
ATOM   5113  C C     . GLU B 1 22  ? -36.196 89.350  39.760  1.00 27.47  ? 22   GLU B C     1 
ATOM   5114  O O     . GLU B 1 22  ? -37.367 89.574  39.445  1.00 27.89  ? 22   GLU B O     1 
ATOM   5115  C CB    . GLU B 1 22  ? -35.401 90.121  42.004  1.00 28.11  ? 22   GLU B CB    1 
ATOM   5116  C CG    . GLU B 1 22  ? -36.500 91.153  42.334  1.00 29.45  ? 22   GLU B CG    1 
ATOM   5117  C CD    . GLU B 1 22  ? -35.965 92.366  43.114  1.00 30.41  ? 22   GLU B CD    1 
ATOM   5118  O OE1   . GLU B 1 22  ? -35.043 93.052  42.600  1.00 32.82  ? 22   GLU B OE1   1 
ATOM   5119  O OE2   . GLU B 1 22  ? -36.474 92.644  44.236  1.00 32.81  ? 22   GLU B OE2   1 
ATOM   5120  N N     . GLN B 1 23  ? -35.170 89.472  38.918  1.00 27.14  ? 23   GLN B N     1 
ATOM   5121  C CA    . GLN B 1 23  ? -35.344 89.810  37.512  1.00 26.76  ? 23   GLN B CA    1 
ATOM   5122  C C     . GLN B 1 23  ? -36.020 88.687  36.719  1.00 26.36  ? 23   GLN B C     1 
ATOM   5123  O O     . GLN B 1 23  ? -36.863 88.958  35.857  1.00 26.57  ? 23   GLN B O     1 
ATOM   5124  C CB    . GLN B 1 23  ? -34.001 90.172  36.872  1.00 27.26  ? 23   GLN B CB    1 
ATOM   5125  C CG    . GLN B 1 23  ? -33.350 91.404  37.467  1.00 27.83  ? 23   GLN B CG    1 
ATOM   5126  C CD    . GLN B 1 23  ? -31.941 91.608  36.972  1.00 29.78  ? 23   GLN B CD    1 
ATOM   5127  O OE1   . GLN B 1 23  ? -31.127 90.678  36.947  1.00 28.93  ? 23   GLN B OE1   1 
ATOM   5128  N NE2   . GLN B 1 23  ? -31.634 92.839  36.581  1.00 30.51  ? 23   GLN B NE2   1 
ATOM   5129  N N     . TYR B 1 24  ? -35.659 87.435  36.990  1.00 25.43  ? 24   TYR B N     1 
ATOM   5130  C CA    . TYR B 1 24  ? -36.396 86.326  36.385  1.00 24.99  ? 24   TYR B CA    1 
ATOM   5131  C C     . TYR B 1 24  ? -37.891 86.451  36.702  1.00 24.66  ? 24   TYR B C     1 
ATOM   5132  O O     . TYR B 1 24  ? -38.728 86.394  35.795  1.00 24.61  ? 24   TYR B O     1 
ATOM   5133  C CB    . TYR B 1 24  ? -35.894 84.953  36.848  1.00 24.70  ? 24   TYR B CB    1 
ATOM   5134  C CG    . TYR B 1 24  ? -36.814 83.844  36.367  1.00 25.67  ? 24   TYR B CG    1 
ATOM   5135  C CD1   . TYR B 1 24  ? -36.669 83.295  35.088  1.00 24.33  ? 24   TYR B CD1   1 
ATOM   5136  C CD2   . TYR B 1 24  ? -37.859 83.375  37.168  1.00 26.02  ? 24   TYR B CD2   1 
ATOM   5137  C CE1   . TYR B 1 24  ? -37.522 82.305  34.637  1.00 24.90  ? 24   TYR B CE1   1 
ATOM   5138  C CE2   . TYR B 1 24  ? -38.727 82.378  36.715  1.00 24.80  ? 24   TYR B CE2   1 
ATOM   5139  C CZ    . TYR B 1 24  ? -38.552 81.853  35.450  1.00 25.27  ? 24   TYR B CZ    1 
ATOM   5140  O OH    . TYR B 1 24  ? -39.406 80.865  34.994  1.00 24.44  ? 24   TYR B OH    1 
ATOM   5141  N N     . GLU B 1 25  ? -38.211 86.612  37.989  1.00 24.26  ? 25   GLU B N     1 
ATOM   5142  C CA    . GLU B 1 25  ? -39.597 86.678  38.454  1.00 24.39  ? 25   GLU B CA    1 
ATOM   5143  C C     . GLU B 1 25  ? -40.352 87.806  37.774  1.00 23.72  ? 25   GLU B C     1 
ATOM   5144  O O     . GLU B 1 25  ? -41.477 87.607  37.321  1.00 23.48  ? 25   GLU B O     1 
ATOM   5145  C CB    . GLU B 1 25  ? -39.681 86.812  39.986  1.00 24.59  ? 25   GLU B CB    1 
ATOM   5146  C CG    . GLU B 1 25  ? -39.288 85.539  40.767  1.00 26.79  ? 25   GLU B CG    1 
ATOM   5147  C CD    . GLU B 1 25  ? -40.139 84.311  40.420  1.00 30.35  ? 25   GLU B CD    1 
ATOM   5148  O OE1   . GLU B 1 25  ? -41.326 84.471  40.033  1.00 30.30  ? 25   GLU B OE1   1 
ATOM   5149  O OE2   . GLU B 1 25  ? -39.618 83.174  40.544  1.00 32.35  ? 25   GLU B OE2   1 
ATOM   5150  N N     . THR B 1 26  ? -39.706 88.969  37.682  1.00 23.65  ? 26   THR B N     1 
ATOM   5151  C CA    . THR B 1 26  ? -40.305 90.154  37.076  1.00 23.66  ? 26   THR B CA    1 
ATOM   5152  C C     . THR B 1 26  ? -40.513 90.000  35.565  1.00 23.06  ? 26   THR B C     1 
ATOM   5153  O O     . THR B 1 26  ? -41.614 90.241  35.074  1.00 22.98  ? 26   THR B O     1 
ATOM   5154  C CB    . THR B 1 26  ? -39.493 91.437  37.389  1.00 23.80  ? 26   THR B CB    1 
ATOM   5155  O OG1   . THR B 1 26  ? -39.355 91.580  38.806  1.00 24.94  ? 26   THR B OG1   1 
ATOM   5156  C CG2   . THR B 1 26  ? -40.208 92.686  36.847  1.00 25.11  ? 26   THR B CG2   1 
ATOM   5157  N N     . LYS B 1 27  ? -39.463 89.610  34.838  1.00 22.32  ? 27   LYS B N     1 
ATOM   5158  C CA    . LYS B 1 27  ? -39.567 89.443  33.387  1.00 21.85  ? 27   LYS B CA    1 
ATOM   5159  C C     . LYS B 1 27  ? -40.569 88.358  33.024  1.00 21.43  ? 27   LYS B C     1 
ATOM   5160  O O     . LYS B 1 27  ? -41.358 88.524  32.090  1.00 21.22  ? 27   LYS B O     1 
ATOM   5161  C CB    . LYS B 1 27  ? -38.212 89.118  32.755  1.00 22.07  ? 27   LYS B CB    1 
ATOM   5162  C CG    . LYS B 1 27  ? -37.194 90.247  32.825  1.00 22.78  ? 27   LYS B CG    1 
ATOM   5163  C CD    . LYS B 1 27  ? -35.923 89.864  32.096  1.00 23.25  ? 27   LYS B CD    1 
ATOM   5164  C CE    . LYS B 1 27  ? -34.900 90.990  32.151  1.00 23.77  ? 27   LYS B CE    1 
ATOM   5165  N NZ    . LYS B 1 27  ? -35.321 92.153  31.318  1.00 23.07  ? 27   LYS B NZ    1 
ATOM   5166  N N     . TYR B 1 28  ? -40.543 87.256  33.770  1.00 20.57  ? 28   TYR B N     1 
ATOM   5167  C CA    . TYR B 1 28  ? -41.444 86.156  33.482  1.00 20.48  ? 28   TYR B CA    1 
ATOM   5168  C C     . TYR B 1 28  ? -42.910 86.594  33.561  1.00 20.48  ? 28   TYR B C     1 
ATOM   5169  O O     . TYR B 1 28  ? -43.693 86.333  32.633  1.00 20.43  ? 28   TYR B O     1 
ATOM   5170  C CB    . TYR B 1 28  ? -41.204 84.937  34.380  1.00 19.96  ? 28   TYR B CB    1 
ATOM   5171  C CG    . TYR B 1 28  ? -42.127 83.808  33.982  1.00 19.96  ? 28   TYR B CG    1 
ATOM   5172  C CD1   . TYR B 1 28  ? -41.851 83.025  32.851  1.00 18.75  ? 28   TYR B CD1   1 
ATOM   5173  C CD2   . TYR B 1 28  ? -43.295 83.550  34.699  1.00 19.44  ? 28   TYR B CD2   1 
ATOM   5174  C CE1   . TYR B 1 28  ? -42.698 82.024  32.457  1.00 18.89  ? 28   TYR B CE1   1 
ATOM   5175  C CE2   . TYR B 1 28  ? -44.144 82.538  34.320  1.00 19.96  ? 28   TYR B CE2   1 
ATOM   5176  C CZ    . TYR B 1 28  ? -43.842 81.781  33.188  1.00 19.65  ? 28   TYR B CZ    1 
ATOM   5177  O OH    . TYR B 1 28  ? -44.689 80.774  32.793  1.00 20.39  ? 28   TYR B OH    1 
ATOM   5178  N N     . LYS B 1 29  ? -43.270 87.248  34.666  1.00 20.28  ? 29   LYS B N     1 
ATOM   5179  C CA    . LYS B 1 29  ? -44.634 87.727  34.882  1.00 20.10  ? 29   LYS B CA    1 
ATOM   5180  C C     . LYS B 1 29  ? -45.067 88.648  33.749  1.00 19.99  ? 29   LYS B C     1 
ATOM   5181  O O     . LYS B 1 29  ? -46.159 88.486  33.197  1.00 19.88  ? 29   LYS B O     1 
ATOM   5182  C CB    . LYS B 1 29  ? -44.764 88.421  36.251  1.00 20.48  ? 29   LYS B CB    1 
ATOM   5183  N N     . GLN B 1 30  ? -44.197 89.585  33.371  1.00 19.64  ? 30   GLN B N     1 
ATOM   5184  C CA    . GLN B 1 30  ? -44.522 90.489  32.274  1.00 19.78  ? 30   GLN B CA    1 
ATOM   5185  C C     . GLN B 1 30  ? -44.725 89.739  30.945  1.00 19.75  ? 30   GLN B C     1 
ATOM   5186  O O     . GLN B 1 30  ? -45.575 90.119  30.141  1.00 19.47  ? 30   GLN B O     1 
ATOM   5187  C CB    . GLN B 1 30  ? -43.488 91.616  32.119  1.00 19.21  ? 30   GLN B CB    1 
ATOM   5188  C CG    . GLN B 1 30  ? -44.043 92.794  31.305  1.00 19.26  ? 30   GLN B CG    1 
ATOM   5189  C CD    . GLN B 1 30  ? -42.991 93.716  30.714  1.00 18.38  ? 30   GLN B CD    1 
ATOM   5190  O OE1   . GLN B 1 30  ? -41.812 93.382  30.630  1.00 18.19  ? 30   GLN B OE1   1 
ATOM   5191  N NE2   . GLN B 1 30  ? -43.429 94.892  30.291  1.00 20.56  ? 30   GLN B NE2   1 
ATOM   5192  N N     . SER B 1 31  ? -43.959 88.674  30.734  1.00 20.28  ? 31   SER B N     1 
ATOM   5193  C CA    . SER B 1 31  ? -44.000 87.926  29.468  1.00 21.05  ? 31   SER B CA    1 
ATOM   5194  C C     . SER B 1 31  ? -45.273 87.087  29.341  1.00 21.64  ? 31   SER B C     1 
ATOM   5195  O O     . SER B 1 31  ? -45.670 86.708  28.246  1.00 21.89  ? 31   SER B O     1 
ATOM   5196  C CB    . SER B 1 31  ? -42.748 87.050  29.303  1.00 20.85  ? 31   SER B CB    1 
ATOM   5197  O OG    . SER B 1 31  ? -42.760 85.940  30.176  1.00 20.68  ? 31   SER B OG    1 
ATOM   5198  N N     . ILE B 1 32  ? -45.896 86.807  30.478  1.00 22.67  ? 32   ILE B N     1 
ATOM   5199  C CA    . ILE B 1 32  ? -47.143 86.064  30.529  1.00 23.56  ? 32   ILE B CA    1 
ATOM   5200  C C     . ILE B 1 32  ? -48.332 87.028  30.473  1.00 24.02  ? 32   ILE B C     1 
ATOM   5201  O O     . ILE B 1 32  ? -49.224 86.862  29.640  1.00 24.33  ? 32   ILE B O     1 
ATOM   5202  C CB    . ILE B 1 32  ? -47.204 85.150  31.794  1.00 23.75  ? 32   ILE B CB    1 
ATOM   5203  C CG1   . ILE B 1 32  ? -46.070 84.111  31.791  1.00 23.70  ? 32   ILE B CG1   1 
ATOM   5204  C CG2   . ILE B 1 32  ? -48.554 84.442  31.926  1.00 24.35  ? 32   ILE B CG2   1 
ATOM   5205  C CD1   . ILE B 1 32  ? -45.710 83.519  30.431  1.00 24.18  ? 32   ILE B CD1   1 
ATOM   5206  N N     . ASN B 1 33  ? -48.322 88.040  31.340  1.00 24.35  ? 33   ASN B N     1 
ATOM   5207  C CA    . ASN B 1 33  ? -49.407 89.016  31.434  1.00 25.23  ? 33   ASN B CA    1 
ATOM   5208  C C     . ASN B 1 33  ? -49.418 90.079  30.324  1.00 25.52  ? 33   ASN B C     1 
ATOM   5209  O O     . ASN B 1 33  ? -50.459 90.691  30.053  1.00 25.65  ? 33   ASN B O     1 
ATOM   5210  C CB    . ASN B 1 33  ? -49.387 89.703  32.811  1.00 25.22  ? 33   ASN B CB    1 
ATOM   5211  C CG    . ASN B 1 33  ? -49.486 88.702  33.981  1.00 27.34  ? 33   ASN B CG    1 
ATOM   5212  O OD1   . ASN B 1 33  ? -50.022 87.584  33.848  1.00 26.00  ? 33   ASN B OD1   1 
ATOM   5213  N ND2   . ASN B 1 33  ? -48.970 89.114  35.139  1.00 29.49  ? 33   ASN B ND2   1 
ATOM   5214  N N     . ASP B 1 34  ? -48.270 90.302  29.686  1.00 25.72  ? 34   ASP B N     1 
ATOM   5215  C CA    . ASP B 1 34  ? -48.152 91.371  28.688  1.00 25.77  ? 34   ASP B CA    1 
ATOM   5216  C C     . ASP B 1 34  ? -47.124 91.041  27.585  1.00 25.54  ? 34   ASP B C     1 
ATOM   5217  O O     . ASP B 1 34  ? -46.131 91.759  27.424  1.00 25.52  ? 34   ASP B O     1 
ATOM   5218  C CB    . ASP B 1 34  ? -47.782 92.674  29.407  1.00 26.07  ? 34   ASP B CB    1 
ATOM   5219  C CG    . ASP B 1 34  ? -47.999 93.920  28.551  1.00 27.36  ? 34   ASP B CG    1 
ATOM   5220  O OD1   . ASP B 1 34  ? -48.407 93.802  27.366  1.00 27.19  ? 34   ASP B OD1   1 
ATOM   5221  O OD2   . ASP B 1 34  ? -47.743 95.028  29.088  1.00 27.55  ? 34   ASP B OD2   1 
ATOM   5222  N N     . PRO B 1 35  ? -47.357 89.950  26.820  1.00 25.40  ? 35   PRO B N     1 
ATOM   5223  C CA    . PRO B 1 35  ? -46.385 89.549  25.788  1.00 25.00  ? 35   PRO B CA    1 
ATOM   5224  C C     . PRO B 1 35  ? -46.097 90.598  24.693  1.00 24.71  ? 35   PRO B C     1 
ATOM   5225  O O     . PRO B 1 35  ? -44.971 90.653  24.192  1.00 24.43  ? 35   PRO B O     1 
ATOM   5226  C CB    . PRO B 1 35  ? -46.993 88.268  25.186  1.00 25.29  ? 35   PRO B CB    1 
ATOM   5227  C CG    . PRO B 1 35  ? -48.418 88.237  25.630  1.00 25.37  ? 35   PRO B CG    1 
ATOM   5228  C CD    . PRO B 1 35  ? -48.503 89.019  26.901  1.00 25.27  ? 35   PRO B CD    1 
ATOM   5229  N N     . ASP B 1 36  ? -47.090 91.406  24.325  1.00 24.16  ? 36   ASP B N     1 
ATOM   5230  C CA    . ASP B 1 36  ? -46.887 92.475  23.341  1.00 24.12  ? 36   ASP B CA    1 
ATOM   5231  C C     . ASP B 1 36  ? -45.841 93.484  23.784  1.00 23.69  ? 36   ASP B C     1 
ATOM   5232  O O     . ASP B 1 36  ? -44.984 93.872  22.990  1.00 24.10  ? 36   ASP B O     1 
ATOM   5233  C CB    . ASP B 1 36  ? -48.195 93.208  23.017  1.00 24.44  ? 36   ASP B CB    1 
ATOM   5234  C CG    . ASP B 1 36  ? -49.053 92.453  22.035  1.00 25.58  ? 36   ASP B CG    1 
ATOM   5235  O OD1   . ASP B 1 36  ? -50.279 92.649  22.047  1.00 26.98  ? 36   ASP B OD1   1 
ATOM   5236  O OD2   . ASP B 1 36  ? -48.509 91.650  21.246  1.00 28.98  ? 36   ASP B OD2   1 
ATOM   5237  N N     . THR B 1 37  ? -45.924 93.918  25.043  1.00 22.92  ? 37   THR B N     1 
ATOM   5238  C CA    . THR B 1 37  ? -44.937 94.836  25.613  1.00 21.75  ? 37   THR B CA    1 
ATOM   5239  C C     . THR B 1 37  ? -43.601 94.140  25.853  1.00 21.10  ? 37   THR B C     1 
ATOM   5240  O O     . THR B 1 37  ? -42.550 94.671  25.484  1.00 20.79  ? 37   THR B O     1 
ATOM   5241  C CB    . THR B 1 37  ? -45.427 95.463  26.923  1.00 21.65  ? 37   THR B CB    1 
ATOM   5242  O OG1   . THR B 1 37  ? -46.660 96.158  26.689  1.00 21.76  ? 37   THR B OG1   1 
ATOM   5243  C CG2   . THR B 1 37  ? -44.396 96.441  27.476  1.00 21.59  ? 37   THR B CG2   1 
ATOM   5244  N N     . PHE B 1 38  ? -43.642 92.956  26.465  1.00 20.44  ? 38   PHE B N     1 
ATOM   5245  C CA    . PHE B 1 38  ? -42.413 92.222  26.755  1.00 19.97  ? 38   PHE B CA    1 
ATOM   5246  C C     . PHE B 1 38  ? -41.626 91.899  25.475  1.00 19.30  ? 38   PHE B C     1 
ATOM   5247  O O     . PHE B 1 38  ? -40.481 92.315  25.305  1.00 19.23  ? 38   PHE B O     1 
ATOM   5248  C CB    . PHE B 1 38  ? -42.682 90.933  27.542  1.00 20.19  ? 38   PHE B CB    1 
ATOM   5249  C CG    . PHE B 1 38  ? -41.428 90.145  27.822  1.00 21.17  ? 38   PHE B CG    1 
ATOM   5250  C CD1   . PHE B 1 38  ? -40.652 90.429  28.942  1.00 22.57  ? 38   PHE B CD1   1 
ATOM   5251  C CD2   . PHE B 1 38  ? -40.992 89.163  26.936  1.00 21.36  ? 38   PHE B CD2   1 
ATOM   5252  C CE1   . PHE B 1 38  ? -39.478 89.719  29.188  1.00 22.71  ? 38   PHE B CE1   1 
ATOM   5253  C CE2   . PHE B 1 38  ? -39.814 88.457  27.165  1.00 21.24  ? 38   PHE B CE2   1 
ATOM   5254  C CZ    . PHE B 1 38  ? -39.059 88.733  28.287  1.00 21.38  ? 38   PHE B CZ    1 
ATOM   5255  N N     . TRP B 1 39  ? -42.257 91.157  24.577  1.00 18.63  ? 39   TRP B N     1 
ATOM   5256  C CA    . TRP B 1 39  ? -41.611 90.770  23.334  1.00 18.26  ? 39   TRP B CA    1 
ATOM   5257  C C     . TRP B 1 39  ? -41.397 91.952  22.374  1.00 18.61  ? 39   TRP B C     1 
ATOM   5258  O O     . TRP B 1 39  ? -40.537 91.890  21.495  1.00 18.80  ? 39   TRP B O     1 
ATOM   5259  C CB    . TRP B 1 39  ? -42.369 89.605  22.701  1.00 17.22  ? 39   TRP B CB    1 
ATOM   5260  C CG    . TRP B 1 39  ? -42.191 88.319  23.481  1.00 16.01  ? 39   TRP B CG    1 
ATOM   5261  C CD1   . TRP B 1 39  ? -43.157 87.625  24.162  1.00 14.67  ? 39   TRP B CD1   1 
ATOM   5262  C CD2   . TRP B 1 39  ? -40.965 87.595  23.679  1.00 14.58  ? 39   TRP B CD2   1 
ATOM   5263  N NE1   . TRP B 1 39  ? -42.614 86.509  24.753  1.00 14.05  ? 39   TRP B NE1   1 
ATOM   5264  C CE2   . TRP B 1 39  ? -41.272 86.463  24.473  1.00 15.49  ? 39   TRP B CE2   1 
ATOM   5265  C CE3   . TRP B 1 39  ? -39.642 87.782  23.247  1.00 15.04  ? 39   TRP B CE3   1 
ATOM   5266  C CZ2   . TRP B 1 39  ? -40.301 85.513  24.837  1.00 15.32  ? 39   TRP B CZ2   1 
ATOM   5267  C CZ3   . TRP B 1 39  ? -38.675 86.847  23.616  1.00 15.56  ? 39   TRP B CZ3   1 
ATOM   5268  C CH2   . TRP B 1 39  ? -39.017 85.721  24.407  1.00 15.54  ? 39   TRP B CH2   1 
ATOM   5269  N N     . GLY B 1 40  ? -42.154 93.035  22.581  1.00 19.28  ? 40   GLY B N     1 
ATOM   5270  C CA    . GLY B 1 40  ? -41.957 94.294  21.853  1.00 19.56  ? 40   GLY B CA    1 
ATOM   5271  C C     . GLY B 1 40  ? -40.605 94.917  22.165  1.00 20.17  ? 40   GLY B C     1 
ATOM   5272  O O     . GLY B 1 40  ? -39.856 95.304  21.259  1.00 20.07  ? 40   GLY B O     1 
ATOM   5273  N N     . GLU B 1 41  ? -40.280 95.000  23.450  1.00 20.46  ? 41   GLU B N     1 
ATOM   5274  C CA    . GLU B 1 41  ? -38.973 95.501  23.878  1.00 21.12  ? 41   GLU B CA    1 
ATOM   5275  C C     . GLU B 1 41  ? -37.847 94.498  23.570  1.00 21.09  ? 41   GLU B C     1 
ATOM   5276  O O     . GLU B 1 41  ? -36.802 94.861  23.024  1.00 21.07  ? 41   GLU B O     1 
ATOM   5277  C CB    . GLU B 1 41  ? -39.010 95.848  25.365  1.00 21.07  ? 41   GLU B CB    1 
ATOM   5278  C CG    . GLU B 1 41  ? -39.732 97.170  25.640  1.00 23.64  ? 41   GLU B CG    1 
ATOM   5279  C CD    . GLU B 1 41  ? -40.214 97.302  27.080  1.00 26.31  ? 41   GLU B CD    1 
ATOM   5280  O OE1   . GLU B 1 41  ? -40.647 98.415  27.471  1.00 26.66  ? 41   GLU B OE1   1 
ATOM   5281  O OE2   . GLU B 1 41  ? -40.163 96.293  27.814  1.00 27.41  ? 41   GLU B OE2   1 
ATOM   5282  N N     . GLN B 1 42  ? -38.082 93.236  23.905  1.00 20.95  ? 42   GLN B N     1 
ATOM   5283  C CA    . GLN B 1 42  ? -37.069 92.193  23.753  1.00 21.24  ? 42   GLN B CA    1 
ATOM   5284  C C     . GLN B 1 42  ? -36.696 91.930  22.287  1.00 21.07  ? 42   GLN B C     1 
ATOM   5285  O O     . GLN B 1 42  ? -35.549 91.607  21.987  1.00 20.88  ? 42   GLN B O     1 
ATOM   5286  C CB    . GLN B 1 42  ? -37.525 90.904  24.465  1.00 21.26  ? 42   GLN B CB    1 
ATOM   5287  C CG    . GLN B 1 42  ? -36.487 89.779  24.506  1.00 21.08  ? 42   GLN B CG    1 
ATOM   5288  C CD    . GLN B 1 42  ? -35.093 90.257  24.890  1.00 20.48  ? 42   GLN B CD    1 
ATOM   5289  O OE1   . GLN B 1 42  ? -34.094 89.839  24.291  1.00 19.72  ? 42   GLN B OE1   1 
ATOM   5290  N NE2   . GLN B 1 42  ? -35.020 91.141  25.875  1.00 17.45  ? 42   GLN B NE2   1 
ATOM   5291  N N     . GLY B 1 43  ? -37.661 92.097  21.381  1.00 21.44  ? 43   GLY B N     1 
ATOM   5292  C CA    . GLY B 1 43  ? -37.420 91.974  19.934  1.00 21.70  ? 43   GLY B CA    1 
ATOM   5293  C C     . GLY B 1 43  ? -36.372 92.935  19.378  1.00 22.02  ? 43   GLY B C     1 
ATOM   5294  O O     . GLY B 1 43  ? -35.858 92.722  18.276  1.00 21.84  ? 43   GLY B O     1 
ATOM   5295  N N     . LYS B 1 44  ? -36.052 93.996  20.131  1.00 22.31  ? 44   LYS B N     1 
ATOM   5296  C CA    . LYS B 1 44  ? -34.998 94.955  19.722  1.00 22.72  ? 44   LYS B CA    1 
ATOM   5297  C C     . LYS B 1 44  ? -33.566 94.384  19.858  1.00 22.43  ? 44   LYS B C     1 
ATOM   5298  O O     . LYS B 1 44  ? -32.593 95.060  19.512  1.00 22.37  ? 44   LYS B O     1 
ATOM   5299  C CB    . LYS B 1 44  ? -35.125 96.305  20.454  1.00 23.21  ? 44   LYS B CB    1 
ATOM   5300  C CG    . LYS B 1 44  ? -36.522 96.964  20.408  1.00 24.31  ? 44   LYS B CG    1 
ATOM   5301  C CD    . LYS B 1 44  ? -36.683 97.939  19.242  1.00 26.96  ? 44   LYS B CD    1 
ATOM   5302  C CE    . LYS B 1 44  ? -38.074 98.598  19.212  1.00 26.66  ? 44   LYS B CE    1 
ATOM   5303  N NZ    . LYS B 1 44  ? -38.487 99.186  20.530  1.00 28.65  ? 44   LYS B NZ    1 
ATOM   5304  N N     . ILE B 1 45  ? -33.447 93.146  20.353  1.00 22.11  ? 45   ILE B N     1 
ATOM   5305  C CA    . ILE B 1 45  ? -32.171 92.398  20.339  1.00 21.90  ? 45   ILE B CA    1 
ATOM   5306  C C     . ILE B 1 45  ? -31.638 92.199  18.895  1.00 22.39  ? 45   ILE B C     1 
ATOM   5307  O O     . ILE B 1 45  ? -30.437 91.960  18.681  1.00 22.29  ? 45   ILE B O     1 
ATOM   5308  C CB    . ILE B 1 45  ? -32.307 91.026  21.092  1.00 22.22  ? 45   ILE B CB    1 
ATOM   5309  C CG1   . ILE B 1 45  ? -30.927 90.422  21.427  1.00 21.94  ? 45   ILE B CG1   1 
ATOM   5310  C CG2   . ILE B 1 45  ? -33.208 90.060  20.314  1.00 21.28  ? 45   ILE B CG2   1 
ATOM   5311  C CD1   . ILE B 1 45  ? -30.961 89.130  22.245  1.00 20.99  ? 45   ILE B CD1   1 
ATOM   5312  N N     . LEU B 1 46  ? -32.546 92.305  17.918  1.00 22.27  ? 46   LEU B N     1 
ATOM   5313  C CA    . LEU B 1 46  ? -32.208 92.233  16.499  1.00 21.93  ? 46   LEU B CA    1 
ATOM   5314  C C     . LEU B 1 46  ? -32.391 93.589  15.840  1.00 21.94  ? 46   LEU B C     1 
ATOM   5315  O O     . LEU B 1 46  ? -33.218 94.394  16.276  1.00 21.52  ? 46   LEU B O     1 
ATOM   5316  C CB    . LEU B 1 46  ? -33.098 91.217  15.761  1.00 21.76  ? 46   LEU B CB    1 
ATOM   5317  C CG    . LEU B 1 46  ? -33.313 89.794  16.307  1.00 21.66  ? 46   LEU B CG    1 
ATOM   5318  C CD1   . LEU B 1 46  ? -34.200 88.989  15.346  1.00 19.53  ? 46   LEU B CD1   1 
ATOM   5319  C CD2   . LEU B 1 46  ? -31.987 89.068  16.612  1.00 19.77  ? 46   LEU B CD2   1 
ATOM   5320  N N     . ASP B 1 47  ? -31.629 93.824  14.777  1.00 21.73  ? 47   ASP B N     1 
ATOM   5321  C CA    . ASP B 1 47  ? -31.853 94.971  13.903  1.00 21.81  ? 47   ASP B CA    1 
ATOM   5322  C C     . ASP B 1 47  ? -33.036 94.710  12.976  1.00 21.59  ? 47   ASP B C     1 
ATOM   5323  O O     . ASP B 1 47  ? -33.176 93.615  12.418  1.00 21.45  ? 47   ASP B O     1 
ATOM   5324  C CB    . ASP B 1 47  ? -30.602 95.268  13.065  1.00 22.00  ? 47   ASP B CB    1 
ATOM   5325  C CG    . ASP B 1 47  ? -29.432 95.763  13.903  1.00 22.48  ? 47   ASP B CG    1 
ATOM   5326  O OD1   . ASP B 1 47  ? -28.372 96.066  13.313  1.00 22.94  ? 47   ASP B OD1   1 
ATOM   5327  O OD2   . ASP B 1 47  ? -29.567 95.854  15.143  1.00 23.57  ? 47   ASP B OD2   1 
ATOM   5328  N N     . TRP B 1 48  ? -33.885 95.718  12.818  1.00 21.40  ? 48   TRP B N     1 
ATOM   5329  C CA    . TRP B 1 48  ? -35.024 95.625  11.908  1.00 21.40  ? 48   TRP B CA    1 
ATOM   5330  C C     . TRP B 1 48  ? -34.912 96.658  10.782  1.00 21.81  ? 48   TRP B C     1 
ATOM   5331  O O     . TRP B 1 48  ? -34.624 97.835  11.028  1.00 21.56  ? 48   TRP B O     1 
ATOM   5332  C CB    . TRP B 1 48  ? -36.346 95.775  12.681  1.00 20.56  ? 48   TRP B CB    1 
ATOM   5333  C CG    . TRP B 1 48  ? -36.581 94.630  13.642  1.00 20.34  ? 48   TRP B CG    1 
ATOM   5334  C CD1   . TRP B 1 48  ? -36.023 94.461  14.888  1.00 19.39  ? 48   TRP B CD1   1 
ATOM   5335  C CD2   . TRP B 1 48  ? -37.414 93.489  13.419  1.00 19.86  ? 48   TRP B CD2   1 
ATOM   5336  N NE1   . TRP B 1 48  ? -36.462 93.281  15.451  1.00 19.91  ? 48   TRP B NE1   1 
ATOM   5337  C CE2   . TRP B 1 48  ? -37.313 92.662  14.571  1.00 19.89  ? 48   TRP B CE2   1 
ATOM   5338  C CE3   . TRP B 1 48  ? -38.234 93.077  12.353  1.00 19.35  ? 48   TRP B CE3   1 
ATOM   5339  C CZ2   . TRP B 1 48  ? -38.008 91.455  14.691  1.00 19.51  ? 48   TRP B CZ2   1 
ATOM   5340  C CZ3   . TRP B 1 48  ? -38.927 91.869  12.472  1.00 20.03  ? 48   TRP B CZ3   1 
ATOM   5341  C CH2   . TRP B 1 48  ? -38.807 91.072  13.641  1.00 19.91  ? 48   TRP B CH2   1 
ATOM   5342  N N     . ILE B 1 49  ? -35.123 96.197  9.553   1.00 22.30  ? 49   ILE B N     1 
ATOM   5343  C CA    . ILE B 1 49  ? -35.205 97.079  8.384   1.00 22.85  ? 49   ILE B CA    1 
ATOM   5344  C C     . ILE B 1 49  ? -36.435 98.009  8.475   1.00 23.44  ? 49   ILE B C     1 
ATOM   5345  O O     . ILE B 1 49  ? -36.283 99.205  8.701   1.00 23.46  ? 49   ILE B O     1 
ATOM   5346  C CB    . ILE B 1 49  ? -35.109 96.280  7.066   1.00 22.62  ? 49   ILE B CB    1 
ATOM   5347  C CG1   . ILE B 1 49  ? -33.742 95.567  7.017   1.00 22.91  ? 49   ILE B CG1   1 
ATOM   5348  C CG2   . ILE B 1 49  ? -35.283 97.217  5.859   1.00 23.03  ? 49   ILE B CG2   1 
ATOM   5349  C CD1   . ILE B 1 49  ? -33.639 94.343  6.086   1.00 22.02  ? 49   ILE B CD1   1 
ATOM   5350  N N     . THR B 1 50  ? -37.639 97.465  8.325   1.00 24.29  ? 50   THR B N     1 
ATOM   5351  C CA    . THR B 1 50  ? -38.849 98.195  8.708   1.00 24.84  ? 50   THR B CA    1 
ATOM   5352  C C     . THR B 1 50  ? -39.313 97.645  10.063  1.00 25.13  ? 50   THR B C     1 
ATOM   5353  O O     . THR B 1 50  ? -39.526 96.436  10.202  1.00 25.19  ? 50   THR B O     1 
ATOM   5354  C CB    . THR B 1 50  ? -39.989 98.098  7.641   1.00 25.26  ? 50   THR B CB    1 
ATOM   5355  O OG1   . THR B 1 50  ? -40.487 96.760  7.565   1.00 25.99  ? 50   THR B OG1   1 
ATOM   5356  C CG2   . THR B 1 50  ? -39.500 98.531  6.247   1.00 25.17  ? 50   THR B CG2   1 
ATOM   5357  N N     . PRO B 1 51  ? -39.432 98.524  11.081  1.00 25.43  ? 51   PRO B N     1 
ATOM   5358  C CA    . PRO B 1 51  ? -39.801 98.077  12.438  1.00 25.13  ? 51   PRO B CA    1 
ATOM   5359  C C     . PRO B 1 51  ? -41.220 97.504  12.542  1.00 24.74  ? 51   PRO B C     1 
ATOM   5360  O O     . PRO B 1 51  ? -42.126 97.928  11.821  1.00 24.60  ? 51   PRO B O     1 
ATOM   5361  C CB    . PRO B 1 51  ? -39.679 99.354  13.284  1.00 24.97  ? 51   PRO B CB    1 
ATOM   5362  C CG    . PRO B 1 51  ? -38.842 100.300 12.456  1.00 25.75  ? 51   PRO B CG    1 
ATOM   5363  C CD    . PRO B 1 51  ? -39.203 99.981  11.030  1.00 25.24  ? 51   PRO B CD    1 
ATOM   5364  N N     . TYR B 1 52  ? -41.403 96.543  13.441  1.00 24.24  ? 52   TYR B N     1 
ATOM   5365  C CA    . TYR B 1 52  ? -42.726 95.976  13.670  1.00 23.68  ? 52   TYR B CA    1 
ATOM   5366  C C     . TYR B 1 52  ? -43.622 96.914  14.490  1.00 23.95  ? 52   TYR B C     1 
ATOM   5367  O O     . TYR B 1 52  ? -43.133 97.797  15.206  1.00 23.32  ? 52   TYR B O     1 
ATOM   5368  C CB    . TYR B 1 52  ? -42.618 94.614  14.359  1.00 23.18  ? 52   TYR B CB    1 
ATOM   5369  C CG    . TYR B 1 52  ? -41.757 94.587  15.602  1.00 21.38  ? 52   TYR B CG    1 
ATOM   5370  C CD1   . TYR B 1 52  ? -42.236 95.064  16.819  1.00 21.08  ? 52   TYR B CD1   1 
ATOM   5371  C CD2   . TYR B 1 52  ? -40.467 94.065  15.561  1.00 21.29  ? 52   TYR B CD2   1 
ATOM   5372  C CE1   . TYR B 1 52  ? -41.450 95.029  17.967  1.00 21.28  ? 52   TYR B CE1   1 
ATOM   5373  C CE2   . TYR B 1 52  ? -39.667 94.018  16.701  1.00 21.11  ? 52   TYR B CE2   1 
ATOM   5374  C CZ    . TYR B 1 52  ? -40.164 94.499  17.900  1.00 22.04  ? 52   TYR B CZ    1 
ATOM   5375  O OH    . TYR B 1 52  ? -39.372 94.461  19.025  1.00 21.51  ? 52   TYR B OH    1 
ATOM   5376  N N     . GLN B 1 53  ? -44.930 96.716  14.365  1.00 24.42  ? 53   GLN B N     1 
ATOM   5377  C CA    . GLN B 1 53  ? -45.900 97.337  15.259  1.00 25.29  ? 53   GLN B CA    1 
ATOM   5378  C C     . GLN B 1 53  ? -46.714 96.240  15.950  1.00 25.10  ? 53   GLN B C     1 
ATOM   5379  O O     . GLN B 1 53  ? -46.795 96.206  17.181  1.00 24.90  ? 53   GLN B O     1 
ATOM   5380  C CB    . GLN B 1 53  ? -46.794 98.328  14.512  1.00 25.73  ? 53   GLN B CB    1 
ATOM   5381  C CG    . GLN B 1 53  ? -46.128 99.682  14.220  1.00 28.99  ? 53   GLN B CG    1 
ATOM   5382  C CD    . GLN B 1 53  ? -45.758 100.466 15.492  1.00 33.02  ? 53   GLN B CD    1 
ATOM   5383  O OE1   . GLN B 1 53  ? -44.617 100.923 15.647  1.00 34.07  ? 53   GLN B OE1   1 
ATOM   5384  N NE2   . GLN B 1 53  ? -46.722 100.613 16.408  1.00 33.63  ? 53   GLN B NE2   1 
ATOM   5385  N N     . LYS B 1 54  ? -47.296 95.333  15.164  1.00 24.99  ? 54   LYS B N     1 
ATOM   5386  C CA    . LYS B 1 54  ? -47.948 94.148  15.729  1.00 25.26  ? 54   LYS B CA    1 
ATOM   5387  C C     . LYS B 1 54  ? -46.889 93.229  16.328  1.00 24.86  ? 54   LYS B C     1 
ATOM   5388  O O     . LYS B 1 54  ? -45.857 92.981  15.694  1.00 25.05  ? 54   LYS B O     1 
ATOM   5389  C CB    . LYS B 1 54  ? -48.764 93.406  14.666  1.00 25.51  ? 54   LYS B CB    1 
ATOM   5390  C CG    . LYS B 1 54  ? -50.248 93.786  14.666  1.00 27.13  ? 54   LYS B CG    1 
ATOM   5391  C CD    . LYS B 1 54  ? -50.928 93.545  13.321  1.00 28.62  ? 54   LYS B CD    1 
ATOM   5392  C CE    . LYS B 1 54  ? -50.886 94.808  12.457  1.00 30.42  ? 54   LYS B CE    1 
ATOM   5393  N NZ    . LYS B 1 54  ? -51.918 94.797  11.383  1.00 31.08  ? 54   LYS B NZ    1 
ATOM   5394  N N     . VAL B 1 55  ? -47.109 92.769  17.558  1.00 24.08  ? 55   VAL B N     1 
ATOM   5395  C CA    . VAL B 1 55  ? -46.169 91.827  18.168  1.00 23.56  ? 55   VAL B CA    1 
ATOM   5396  C C     . VAL B 1 55  ? -46.760 90.410  18.158  1.00 23.13  ? 55   VAL B C     1 
ATOM   5397  O O     . VAL B 1 55  ? -46.399 89.609  17.315  1.00 22.89  ? 55   VAL B O     1 
ATOM   5398  C CB    . VAL B 1 55  ? -45.694 92.262  19.578  1.00 23.73  ? 55   VAL B CB    1 
ATOM   5399  C CG1   . VAL B 1 55  ? -44.709 91.240  20.164  1.00 23.87  ? 55   VAL B CG1   1 
ATOM   5400  C CG2   . VAL B 1 55  ? -45.049 93.647  19.534  1.00 23.36  ? 55   VAL B CG2   1 
ATOM   5401  N N     . LYS B 1 56  ? -47.686 90.119  19.068  1.00 22.58  ? 56   LYS B N     1 
ATOM   5402  C CA    . LYS B 1 56  ? -48.249 88.780  19.166  1.00 21.91  ? 56   LYS B CA    1 
ATOM   5403  C C     . LYS B 1 56  ? -49.575 88.665  18.416  1.00 21.54  ? 56   LYS B C     1 
ATOM   5404  O O     . LYS B 1 56  ? -50.527 89.372  18.728  1.00 21.30  ? 56   LYS B O     1 
ATOM   5405  C CB    . LYS B 1 56  ? -48.411 88.367  20.632  1.00 21.59  ? 56   LYS B CB    1 
ATOM   5406  C CG    . LYS B 1 56  ? -48.966 86.966  20.819  1.00 20.96  ? 56   LYS B CG    1 
ATOM   5407  C CD    . LYS B 1 56  ? -48.906 86.544  22.272  1.00 21.16  ? 56   LYS B CD    1 
ATOM   5408  C CE    . LYS B 1 56  ? -49.434 85.136  22.466  1.00 22.32  ? 56   LYS B CE    1 
ATOM   5409  N NZ    . LYS B 1 56  ? -50.906 85.096  22.391  1.00 21.35  ? 56   LYS B NZ    1 
ATOM   5410  N N     . ASN B 1 57  ? -49.625 87.749  17.446  1.00 20.92  ? 57   ASN B N     1 
ATOM   5411  C CA    . ASN B 1 57  ? -50.845 87.494  16.674  1.00 20.80  ? 57   ASN B CA    1 
ATOM   5412  C C     . ASN B 1 57  ? -51.032 85.989  16.432  1.00 19.94  ? 57   ASN B C     1 
ATOM   5413  O O     . ASN B 1 57  ? -50.695 85.480  15.360  1.00 19.42  ? 57   ASN B O     1 
ATOM   5414  C CB    . ASN B 1 57  ? -50.814 88.274  15.345  1.00 21.00  ? 57   ASN B CB    1 
ATOM   5415  C CG    . ASN B 1 57  ? -52.143 88.249  14.614  1.00 22.31  ? 57   ASN B CG    1 
ATOM   5416  O OD1   . ASN B 1 57  ? -53.165 87.815  15.153  1.00 26.12  ? 57   ASN B OD1   1 
ATOM   5417  N ND2   . ASN B 1 57  ? -52.139 88.722  13.385  1.00 22.11  ? 57   ASN B ND2   1 
ATOM   5418  N N     . THR B 1 58  ? -51.572 85.288  17.436  1.00 19.13  ? 58   THR B N     1 
ATOM   5419  C CA    . THR B 1 58  ? -51.569 83.817  17.431  1.00 18.35  ? 58   THR B CA    1 
ATOM   5420  C C     . THR B 1 58  ? -52.877 83.178  17.888  1.00 18.66  ? 58   THR B C     1 
ATOM   5421  O O     . THR B 1 58  ? -53.617 83.746  18.698  1.00 18.50  ? 58   THR B O     1 
ATOM   5422  C CB    . THR B 1 58  ? -50.461 83.244  18.350  1.00 17.90  ? 58   THR B CB    1 
ATOM   5423  O OG1   . THR B 1 58  ? -50.785 83.547  19.704  1.00 16.79  ? 58   THR B OG1   1 
ATOM   5424  C CG2   . THR B 1 58  ? -49.089 83.830  18.017  1.00 16.54  ? 58   THR B CG2   1 
ATOM   5425  N N     . SER B 1 59  ? -53.128 81.969  17.390  1.00 18.37  ? 59   SER B N     1 
ATOM   5426  C CA    . SER B 1 59  ? -54.260 81.171  17.831  1.00 18.40  ? 59   SER B CA    1 
ATOM   5427  C C     . SER B 1 59  ? -54.018 79.669  17.678  1.00 18.27  ? 59   SER B C     1 
ATOM   5428  O O     . SER B 1 59  ? -53.503 79.213  16.645  1.00 18.24  ? 59   SER B O     1 
ATOM   5429  C CB    . SER B 1 59  ? -55.537 81.567  17.090  1.00 18.53  ? 59   SER B CB    1 
ATOM   5430  O OG    . SER B 1 59  ? -56.581 80.651  17.381  1.00 19.16  ? 59   SER B OG    1 
ATOM   5431  N N     . PHE B 1 60  ? -54.411 78.922  18.715  1.00 17.70  ? 60   PHE B N     1 
ATOM   5432  C CA    . PHE B 1 60  ? -54.370 77.456  18.726  1.00 17.45  ? 60   PHE B CA    1 
ATOM   5433  C C     . PHE B 1 60  ? -55.757 76.846  18.467  1.00 17.78  ? 60   PHE B C     1 
ATOM   5434  O O     . PHE B 1 60  ? -55.957 75.639  18.664  1.00 18.10  ? 60   PHE B O     1 
ATOM   5435  C CB    . PHE B 1 60  ? -53.847 76.937  20.073  1.00 16.72  ? 60   PHE B CB    1 
ATOM   5436  C CG    . PHE B 1 60  ? -52.379 77.206  20.335  1.00 16.10  ? 60   PHE B CG    1 
ATOM   5437  C CD1   . PHE B 1 60  ? -51.830 76.895  21.581  1.00 13.23  ? 60   PHE B CD1   1 
ATOM   5438  C CD2   . PHE B 1 60  ? -51.544 77.763  19.358  1.00 13.97  ? 60   PHE B CD2   1 
ATOM   5439  C CE1   . PHE B 1 60  ? -50.464 77.131  21.852  1.00 13.83  ? 60   PHE B CE1   1 
ATOM   5440  C CE2   . PHE B 1 60  ? -50.181 78.001  19.621  1.00 13.08  ? 60   PHE B CE2   1 
ATOM   5441  C CZ    . PHE B 1 60  ? -49.643 77.692  20.860  1.00 13.80  ? 60   PHE B CZ    1 
ATOM   5442  N N     . ALA B 1 61  ? -56.715 77.681  18.055  1.00 17.84  ? 61   ALA B N     1 
ATOM   5443  C CA    . ALA B 1 61  ? -58.111 77.256  17.894  1.00 18.21  ? 61   ALA B CA    1 
ATOM   5444  C C     . ALA B 1 61  ? -58.254 76.042  16.996  1.00 18.26  ? 61   ALA B C     1 
ATOM   5445  O O     . ALA B 1 61  ? -57.651 75.990  15.922  1.00 18.28  ? 61   ALA B O     1 
ATOM   5446  C CB    . ALA B 1 61  ? -58.984 78.405  17.381  1.00 17.90  ? 61   ALA B CB    1 
ATOM   5447  N N     . PRO B 1 62  ? -59.041 75.047  17.446  1.00 18.93  ? 62   PRO B N     1 
ATOM   5448  C CA    . PRO B 1 62  ? -59.309 73.840  16.668  1.00 19.43  ? 62   PRO B CA    1 
ATOM   5449  C C     . PRO B 1 62  ? -59.633 74.149  15.215  1.00 20.41  ? 62   PRO B C     1 
ATOM   5450  O O     . PRO B 1 62  ? -60.570 74.919  14.930  1.00 20.65  ? 62   PRO B O     1 
ATOM   5451  C CB    . PRO B 1 62  ? -60.527 73.248  17.371  1.00 19.39  ? 62   PRO B CB    1 
ATOM   5452  C CG    . PRO B 1 62  ? -60.339 73.636  18.779  1.00 19.05  ? 62   PRO B CG    1 
ATOM   5453  C CD    . PRO B 1 62  ? -59.718 75.003  18.758  1.00 18.48  ? 62   PRO B CD    1 
ATOM   5454  N N     . GLY B 1 63  ? -58.833 73.580  14.314  1.00 21.06  ? 63   GLY B N     1 
ATOM   5455  C CA    . GLY B 1 63  ? -59.053 73.704  12.867  1.00 22.05  ? 63   GLY B CA    1 
ATOM   5456  C C     . GLY B 1 63  ? -58.730 75.058  12.254  1.00 22.17  ? 63   GLY B C     1 
ATOM   5457  O O     . GLY B 1 63  ? -59.013 75.299  11.079  1.00 22.79  ? 63   GLY B O     1 
ATOM   5458  N N     . ASN B 1 64  ? -58.146 75.945  13.052  1.00 22.14  ? 64   ASN B N     1 
ATOM   5459  C CA    . ASN B 1 64  ? -57.802 77.284  12.599  1.00 21.85  ? 64   ASN B CA    1 
ATOM   5460  C C     . ASN B 1 64  ? -56.555 77.822  13.282  1.00 21.39  ? 64   ASN B C     1 
ATOM   5461  O O     . ASN B 1 64  ? -56.531 78.967  13.747  1.00 21.15  ? 64   ASN B O     1 
ATOM   5462  C CB    . ASN B 1 64  ? -58.975 78.238  12.805  1.00 22.29  ? 64   ASN B CB    1 
ATOM   5463  C CG    . ASN B 1 64  ? -59.003 79.363  11.773  1.00 23.51  ? 64   ASN B CG    1 
ATOM   5464  O OD1   . ASN B 1 64  ? -59.634 80.402  11.990  1.00 25.71  ? 64   ASN B OD1   1 
ATOM   5465  N ND2   . ASN B 1 64  ? -58.339 79.150  10.639  1.00 23.82  ? 64   ASN B ND2   1 
ATOM   5466  N N     . VAL B 1 65  ? -55.520 76.981  13.326  1.00 20.80  ? 65   VAL B N     1 
ATOM   5467  C CA    . VAL B 1 65  ? -54.255 77.328  13.947  1.00 20.23  ? 65   VAL B CA    1 
ATOM   5468  C C     . VAL B 1 65  ? -53.478 78.293  13.046  1.00 20.21  ? 65   VAL B C     1 
ATOM   5469  O O     . VAL B 1 65  ? -53.361 78.080  11.826  1.00 19.95  ? 65   VAL B O     1 
ATOM   5470  C CB    . VAL B 1 65  ? -53.417 76.067  14.271  1.00 20.35  ? 65   VAL B CB    1 
ATOM   5471  C CG1   . VAL B 1 65  ? -52.110 76.451  14.944  1.00 19.57  ? 65   VAL B CG1   1 
ATOM   5472  C CG2   . VAL B 1 65  ? -54.221 75.105  15.175  1.00 20.70  ? 65   VAL B CG2   1 
ATOM   5473  N N     . SER B 1 66  ? -52.968 79.363  13.657  1.00 19.88  ? 66   SER B N     1 
ATOM   5474  C CA    . SER B 1 66  ? -52.212 80.393  12.952  1.00 19.49  ? 66   SER B CA    1 
ATOM   5475  C C     . SER B 1 66  ? -51.296 81.104  13.932  1.00 19.35  ? 66   SER B C     1 
ATOM   5476  O O     . SER B 1 66  ? -51.756 81.664  14.939  1.00 19.77  ? 66   SER B O     1 
ATOM   5477  C CB    . SER B 1 66  ? -53.165 81.403  12.288  1.00 19.66  ? 66   SER B CB    1 
ATOM   5478  O OG    . SER B 1 66  ? -52.455 82.470  11.676  1.00 19.65  ? 66   SER B OG    1 
ATOM   5479  N N     . ILE B 1 67  ? -50.002 81.093  13.635  1.00 18.81  ? 67   ILE B N     1 
ATOM   5480  C CA    . ILE B 1 67  ? -49.010 81.703  14.517  1.00 18.76  ? 67   ILE B CA    1 
ATOM   5481  C C     . ILE B 1 67  ? -48.250 82.798  13.798  1.00 18.66  ? 67   ILE B C     1 
ATOM   5482  O O     . ILE B 1 67  ? -47.473 82.535  12.875  1.00 18.47  ? 67   ILE B O     1 
ATOM   5483  C CB    . ILE B 1 67  ? -48.015 80.646  15.104  1.00 18.93  ? 67   ILE B CB    1 
ATOM   5484  C CG1   . ILE B 1 67  ? -48.777 79.586  15.903  1.00 18.45  ? 67   ILE B CG1   1 
ATOM   5485  C CG2   . ILE B 1 67  ? -46.965 81.311  15.990  1.00 18.31  ? 67   ILE B CG2   1 
ATOM   5486  C CD1   . ILE B 1 67  ? -48.246 78.190  15.720  1.00 20.61  ? 67   ILE B CD1   1 
ATOM   5487  N N     . LYS B 1 68  ? -48.480 84.033  14.220  1.00 18.67  ? 68   LYS B N     1 
ATOM   5488  C CA    . LYS B 1 68  ? -47.688 85.145  13.713  1.00 18.82  ? 68   LYS B CA    1 
ATOM   5489  C C     . LYS B 1 68  ? -47.079 85.926  14.862  1.00 18.66  ? 68   LYS B C     1 
ATOM   5490  O O     . LYS B 1 68  ? -47.706 86.116  15.902  1.00 18.81  ? 68   LYS B O     1 
ATOM   5491  C CB    . LYS B 1 68  ? -48.516 86.049  12.792  1.00 18.85  ? 68   LYS B CB    1 
ATOM   5492  C CG    . LYS B 1 68  ? -48.975 85.346  11.530  1.00 20.04  ? 68   LYS B CG    1 
ATOM   5493  C CD    . LYS B 1 68  ? -50.082 86.100  10.813  1.00 23.15  ? 68   LYS B CD    1 
ATOM   5494  C CE    . LYS B 1 68  ? -50.686 85.225  9.727   1.00 24.99  ? 68   LYS B CE    1 
ATOM   5495  N NZ    . LYS B 1 68  ? -51.036 86.013  8.512   1.00 27.00  ? 68   LYS B NZ    1 
ATOM   5496  N N     . TRP B 1 69  ? -45.836 86.344  14.659  1.00 18.52  ? 69   TRP B N     1 
ATOM   5497  C CA    . TRP B 1 69  ? -45.107 87.178  15.594  1.00 18.41  ? 69   TRP B CA    1 
ATOM   5498  C C     . TRP B 1 69  ? -44.416 88.246  14.749  1.00 18.65  ? 69   TRP B C     1 
ATOM   5499  O O     . TRP B 1 69  ? -43.817 87.919  13.717  1.00 18.44  ? 69   TRP B O     1 
ATOM   5500  C CB    . TRP B 1 69  ? -44.054 86.346  16.358  1.00 18.00  ? 69   TRP B CB    1 
ATOM   5501  C CG    . TRP B 1 69  ? -44.625 85.497  17.468  1.00 17.75  ? 69   TRP B CG    1 
ATOM   5502  C CD1   . TRP B 1 69  ? -45.081 84.210  17.370  1.00 16.42  ? 69   TRP B CD1   1 
ATOM   5503  C CD2   . TRP B 1 69  ? -44.826 85.891  18.834  1.00 16.78  ? 69   TRP B CD2   1 
ATOM   5504  N NE1   . TRP B 1 69  ? -45.561 83.781  18.586  1.00 15.74  ? 69   TRP B NE1   1 
ATOM   5505  C CE2   . TRP B 1 69  ? -45.409 84.788  19.506  1.00 17.33  ? 69   TRP B CE2   1 
ATOM   5506  C CE3   . TRP B 1 69  ? -44.567 87.067  19.559  1.00 17.27  ? 69   TRP B CE3   1 
ATOM   5507  C CZ2   . TRP B 1 69  ? -45.732 84.824  20.872  1.00 16.28  ? 69   TRP B CZ2   1 
ATOM   5508  C CZ3   . TRP B 1 69  ? -44.892 87.102  20.920  1.00 16.54  ? 69   TRP B CZ3   1 
ATOM   5509  C CH2   . TRP B 1 69  ? -45.465 85.980  21.561  1.00 16.32  ? 69   TRP B CH2   1 
ATOM   5510  N N     . TYR B 1 70  ? -44.508 89.508  15.173  1.00 18.85  ? 70   TYR B N     1 
ATOM   5511  C CA    . TYR B 1 70  ? -43.776 90.622  14.544  1.00 19.37  ? 70   TYR B CA    1 
ATOM   5512  C C     . TYR B 1 70  ? -44.109 90.821  13.057  1.00 19.39  ? 70   TYR B C     1 
ATOM   5513  O O     . TYR B 1 70  ? -43.293 91.343  12.293  1.00 19.01  ? 70   TYR B O     1 
ATOM   5514  C CB    . TYR B 1 70  ? -42.261 90.417  14.700  1.00 19.44  ? 70   TYR B CB    1 
ATOM   5515  C CG    . TYR B 1 70  ? -41.747 90.245  16.115  1.00 20.32  ? 70   TYR B CG    1 
ATOM   5516  C CD1   . TYR B 1 70  ? -41.150 89.043  16.519  1.00 20.60  ? 70   TYR B CD1   1 
ATOM   5517  C CD2   . TYR B 1 70  ? -41.824 91.287  17.045  1.00 21.03  ? 70   TYR B CD2   1 
ATOM   5518  C CE1   . TYR B 1 70  ? -40.643 88.881  17.820  1.00 19.77  ? 70   TYR B CE1   1 
ATOM   5519  C CE2   . TYR B 1 70  ? -41.324 91.135  18.353  1.00 21.51  ? 70   TYR B CE2   1 
ATOM   5520  C CZ    . TYR B 1 70  ? -40.735 89.928  18.728  1.00 20.78  ? 70   TYR B CZ    1 
ATOM   5521  O OH    . TYR B 1 70  ? -40.246 89.774  20.016  1.00 21.57  ? 70   TYR B OH    1 
ATOM   5522  N N     . GLU B 1 71  ? -45.315 90.425  12.663  1.00 20.05  ? 71   GLU B N     1 
ATOM   5523  C CA    . GLU B 1 71  ? -45.637 90.127  11.255  1.00 20.65  ? 71   GLU B CA    1 
ATOM   5524  C C     . GLU B 1 71  ? -45.472 91.286  10.262  1.00 21.07  ? 71   GLU B C     1 
ATOM   5525  O O     . GLU B 1 71  ? -45.239 91.056  9.073   1.00 20.77  ? 71   GLU B O     1 
ATOM   5526  C CB    . GLU B 1 71  ? -47.058 89.574  11.148  1.00 20.78  ? 71   GLU B CB    1 
ATOM   5527  C CG    . GLU B 1 71  ? -48.154 90.627  11.319  1.00 21.53  ? 71   GLU B CG    1 
ATOM   5528  C CD    . GLU B 1 71  ? -49.515 90.003  11.350  1.00 22.79  ? 71   GLU B CD    1 
ATOM   5529  O OE1   . GLU B 1 71  ? -49.826 89.350  12.362  1.00 25.54  ? 71   GLU B OE1   1 
ATOM   5530  O OE2   . GLU B 1 71  ? -50.270 90.145  10.369  1.00 22.19  ? 71   GLU B OE2   1 
ATOM   5531  N N     . ASP B 1 72  ? -45.623 92.517  10.748  1.00 21.25  ? 72   ASP B N     1 
ATOM   5532  C CA    . ASP B 1 72  ? -45.482 93.686  9.894   1.00 21.99  ? 72   ASP B CA    1 
ATOM   5533  C C     . ASP B 1 72  ? -44.046 94.229  9.860   1.00 22.00  ? 72   ASP B C     1 
ATOM   5534  O O     . ASP B 1 72  ? -43.787 95.259  9.229   1.00 22.76  ? 72   ASP B O     1 
ATOM   5535  C CB    . ASP B 1 72  ? -46.497 94.776  10.267  1.00 22.17  ? 72   ASP B CB    1 
ATOM   5536  C CG    . ASP B 1 72  ? -46.403 95.213  11.734  1.00 23.50  ? 72   ASP B CG    1 
ATOM   5537  O OD1   . ASP B 1 72  ? -45.484 94.770  12.471  1.00 23.62  ? 72   ASP B OD1   1 
ATOM   5538  O OD2   . ASP B 1 72  ? -47.270 96.025  12.137  1.00 26.43  ? 72   ASP B OD2   1 
ATOM   5539  N N     . GLY B 1 73  ? -43.120 93.534  10.520  1.00 21.26  ? 73   GLY B N     1 
ATOM   5540  C CA    . GLY B 1 73  ? -41.711 93.907  10.474  1.00 20.72  ? 73   GLY B CA    1 
ATOM   5541  C C     . GLY B 1 73  ? -40.935 93.206  9.364   1.00 20.39  ? 73   GLY B C     1 
ATOM   5542  O O     . GLY B 1 73  ? -41.347 92.145  8.885   1.00 20.02  ? 73   GLY B O     1 
ATOM   5543  N N     . THR B 1 74  ? -39.822 93.812  8.948   1.00 19.82  ? 74   THR B N     1 
ATOM   5544  C CA    . THR B 1 74  ? -38.869 93.163  8.034   1.00 19.77  ? 74   THR B CA    1 
ATOM   5545  C C     . THR B 1 74  ? -37.447 93.204  8.590   1.00 19.68  ? 74   THR B C     1 
ATOM   5546  O O     . THR B 1 74  ? -37.094 94.078  9.394   1.00 20.25  ? 74   THR B O     1 
ATOM   5547  C CB    . THR B 1 74  ? -38.835 93.765  6.581   1.00 19.63  ? 74   THR B CB    1 
ATOM   5548  O OG1   . THR B 1 74  ? -38.148 95.018  6.587   1.00 19.78  ? 74   THR B OG1   1 
ATOM   5549  C CG2   . THR B 1 74  ? -40.233 93.935  5.975   1.00 19.71  ? 74   THR B CG2   1 
ATOM   5550  N N     . LEU B 1 75  ? -36.630 92.271  8.122   1.00 19.41  ? 75   LEU B N     1 
ATOM   5551  C CA    . LEU B 1 75  ? -35.290 92.074  8.641   1.00 19.41  ? 75   LEU B CA    1 
ATOM   5552  C C     . LEU B 1 75  ? -34.518 91.104  7.743   1.00 19.34  ? 75   LEU B C     1 
ATOM   5553  O O     . LEU B 1 75  ? -35.054 90.571  6.768   1.00 19.37  ? 75   LEU B O     1 
ATOM   5554  C CB    . LEU B 1 75  ? -35.354 91.528  10.083  1.00 18.87  ? 75   LEU B CB    1 
ATOM   5555  C CG    . LEU B 1 75  ? -35.624 90.030  10.319  1.00 18.81  ? 75   LEU B CG    1 
ATOM   5556  C CD1   . LEU B 1 75  ? -35.266 89.662  11.761  1.00 16.31  ? 75   LEU B CD1   1 
ATOM   5557  C CD2   . LEU B 1 75  ? -37.061 89.592  9.980   1.00 16.69  ? 75   LEU B CD2   1 
ATOM   5558  N N     . ASN B 1 76  ? -33.259 90.876  8.097   1.00 19.44  ? 76   ASN B N     1 
ATOM   5559  C CA    . ASN B 1 76  ? -32.440 89.852  7.468   1.00 19.94  ? 76   ASN B CA    1 
ATOM   5560  C C     . ASN B 1 76  ? -31.617 89.139  8.541   1.00 19.95  ? 76   ASN B C     1 
ATOM   5561  O O     . ASN B 1 76  ? -30.951 89.794  9.353   1.00 20.33  ? 76   ASN B O     1 
ATOM   5562  C CB    . ASN B 1 76  ? -31.538 90.467  6.393   1.00 19.65  ? 76   ASN B CB    1 
ATOM   5563  C CG    . ASN B 1 76  ? -30.976 89.431  5.453   1.00 20.59  ? 76   ASN B CG    1 
ATOM   5564  O OD1   . ASN B 1 76  ? -31.475 89.262  4.340   1.00 20.58  ? 76   ASN B OD1   1 
ATOM   5565  N ND2   . ASN B 1 76  ? -29.943 88.716  5.898   1.00 20.40  ? 76   ASN B ND2   1 
ATOM   5566  N N     . LEU B 1 77  ? -31.686 87.813  8.572   1.00 19.98  ? 77   LEU B N     1 
ATOM   5567  C CA    . LEU B 1 77  ? -30.973 87.053  9.604   1.00 20.37  ? 77   LEU B CA    1 
ATOM   5568  C C     . LEU B 1 77  ? -29.457 87.121  9.432   1.00 20.28  ? 77   LEU B C     1 
ATOM   5569  O O     . LEU B 1 77  ? -28.729 87.287  10.421  1.00 20.66  ? 77   LEU B O     1 
ATOM   5570  C CB    . LEU B 1 77  ? -31.452 85.591  9.669   1.00 20.37  ? 77   LEU B CB    1 
ATOM   5571  C CG    . LEU B 1 77  ? -30.619 84.576  10.456  1.00 20.19  ? 77   LEU B CG    1 
ATOM   5572  C CD1   . LEU B 1 77  ? -31.525 83.534  11.107  1.00 19.19  ? 77   LEU B CD1   1 
ATOM   5573  C CD2   . LEU B 1 77  ? -29.548 83.912  9.571   1.00 17.53  ? 77   LEU B CD2   1 
ATOM   5574  N N     . ALA B 1 78  ? -28.987 86.988  8.192   1.00 19.52  ? 78   ALA B N     1 
ATOM   5575  C CA    . ALA B 1 78  ? -27.553 87.081  7.923   1.00 19.59  ? 78   ALA B CA    1 
ATOM   5576  C C     . ALA B 1 78  ? -26.997 88.455  8.309   1.00 19.69  ? 78   ALA B C     1 
ATOM   5577  O O     . ALA B 1 78  ? -25.886 88.549  8.836   1.00 19.67  ? 78   ALA B O     1 
ATOM   5578  C CB    . ALA B 1 78  ? -27.245 86.758  6.477   1.00 19.36  ? 78   ALA B CB    1 
ATOM   5579  N N     . ALA B 1 79  ? -27.783 89.508  8.069   1.00 19.66  ? 79   ALA B N     1 
ATOM   5580  C CA    . ALA B 1 79  ? -27.414 90.854  8.505   1.00 20.14  ? 79   ALA B CA    1 
ATOM   5581  C C     . ALA B 1 79  ? -27.253 90.935  10.031  1.00 20.20  ? 79   ALA B C     1 
ATOM   5582  O O     . ALA B 1 79  ? -26.365 91.626  10.534  1.00 20.09  ? 79   ALA B O     1 
ATOM   5583  C CB    . ALA B 1 79  ? -28.443 91.882  8.009   1.00 20.48  ? 79   ALA B CB    1 
ATOM   5584  N N     . ASN B 1 80  ? -28.106 90.212  10.757  1.00 20.46  ? 80   ASN B N     1 
ATOM   5585  C CA    . ASN B 1 80  ? -28.063 90.203  12.226  1.00 20.69  ? 80   ASN B CA    1 
ATOM   5586  C C     . ASN B 1 80  ? -26.940 89.344  12.796  1.00 20.49  ? 80   ASN B C     1 
ATOM   5587  O O     . ASN B 1 80  ? -26.454 89.588  13.896  1.00 20.21  ? 80   ASN B O     1 
ATOM   5588  C CB    . ASN B 1 80  ? -29.408 89.756  12.796  1.00 20.60  ? 80   ASN B CB    1 
ATOM   5589  C CG    . ASN B 1 80  ? -30.398 90.883  12.873  1.00 20.86  ? 80   ASN B CG    1 
ATOM   5590  O OD1   . ASN B 1 80  ? -30.369 91.692  13.811  1.00 19.89  ? 80   ASN B OD1   1 
ATOM   5591  N ND2   . ASN B 1 80  ? -31.290 90.950  11.887  1.00 20.19  ? 80   ASN B ND2   1 
ATOM   5592  N N     . CYS B 1 81  ? -26.549 88.338  12.024  1.00 20.40  ? 81   CYS B N     1 
ATOM   5593  C CA    . CYS B 1 81  ? -25.526 87.387  12.419  1.00 20.45  ? 81   CYS B CA    1 
ATOM   5594  C C     . CYS B 1 81  ? -24.127 87.789  11.926  1.00 20.48  ? 81   CYS B C     1 
ATOM   5595  O O     . CYS B 1 81  ? -23.124 87.196  12.348  1.00 20.38  ? 81   CYS B O     1 
ATOM   5596  C CB    . CYS B 1 81  ? -25.895 85.991  11.885  1.00 20.19  ? 81   CYS B CB    1 
ATOM   5597  S SG    . CYS B 1 81  ? -27.405 85.304  12.644  1.00 20.59  ? 81   CYS B SG    1 
ATOM   5598  N N     . LEU B 1 82  ? -24.061 88.780  11.030  1.00 19.80  ? 82   LEU B N     1 
ATOM   5599  C CA    . LEU B 1 82  ? -22.798 89.112  10.374  1.00 19.60  ? 82   LEU B CA    1 
ATOM   5600  C C     . LEU B 1 82  ? -22.569 90.615  10.198  1.00 19.62  ? 82   LEU B C     1 
ATOM   5601  O O     . LEU B 1 82  ? -21.778 91.222  10.939  1.00 19.09  ? 82   LEU B O     1 
ATOM   5602  C CB    . LEU B 1 82  ? -22.690 88.392  9.019   1.00 19.14  ? 82   LEU B CB    1 
ATOM   5603  C CG    . LEU B 1 82  ? -22.862 86.870  8.975   1.00 19.05  ? 82   LEU B CG    1 
ATOM   5604  C CD1   . LEU B 1 82  ? -23.124 86.377  7.572   1.00 17.35  ? 82   LEU B CD1   1 
ATOM   5605  C CD2   . LEU B 1 82  ? -21.672 86.139  9.587   1.00 19.17  ? 82   LEU B CD2   1 
ATOM   5606  N N     . ASP B 1 83  ? -23.275 91.193  9.222   1.00 20.01  ? 83   ASP B N     1 
ATOM   5607  C CA    . ASP B 1 83  ? -23.093 92.588  8.802   1.00 20.42  ? 83   ASP B CA    1 
ATOM   5608  C C     . ASP B 1 83  ? -23.119 93.550  9.990   1.00 20.29  ? 83   ASP B C     1 
ATOM   5609  O O     . ASP B 1 83  ? -22.258 94.423  10.085  1.00 20.41  ? 83   ASP B O     1 
ATOM   5610  C CB    . ASP B 1 83  ? -24.147 93.011  7.760   1.00 20.42  ? 83   ASP B CB    1 
ATOM   5611  C CG    . ASP B 1 83  ? -24.188 92.096  6.539   1.00 21.37  ? 83   ASP B CG    1 
ATOM   5612  O OD1   . ASP B 1 83  ? -24.248 92.620  5.397   1.00 23.50  ? 83   ASP B OD1   1 
ATOM   5613  O OD2   . ASP B 1 83  ? -24.172 90.863  6.707   1.00 19.52  ? 83   ASP B OD2   1 
ATOM   5614  N N     . ARG B 1 84  ? -24.077 93.374  10.906  1.00 20.14  ? 84   ARG B N     1 
ATOM   5615  C CA    . ARG B 1 84  ? -24.245 94.339  12.017  1.00 19.69  ? 84   ARG B CA    1 
ATOM   5616  C C     . ARG B 1 84  ? -23.092 94.344  13.011  1.00 19.90  ? 84   ARG B C     1 
ATOM   5617  O O     . ARG B 1 84  ? -22.980 95.264  13.823  1.00 20.09  ? 84   ARG B O     1 
ATOM   5618  C CB    . ARG B 1 84  ? -25.607 94.204  12.732  1.00 19.48  ? 84   ARG B CB    1 
ATOM   5619  C CG    . ARG B 1 84  ? -25.822 92.953  13.616  1.00 19.29  ? 84   ARG B CG    1 
ATOM   5620  C CD    . ARG B 1 84  ? -27.046 93.155  14.496  1.00 18.53  ? 84   ARG B CD    1 
ATOM   5621  N NE    . ARG B 1 84  ? -27.417 91.983  15.292  1.00 18.15  ? 84   ARG B NE    1 
ATOM   5622  C CZ    . ARG B 1 84  ? -28.294 92.009  16.298  1.00 17.04  ? 84   ARG B CZ    1 
ATOM   5623  N NH1   . ARG B 1 84  ? -28.899 93.139  16.639  1.00 14.27  ? 84   ARG B NH1   1 
ATOM   5624  N NH2   . ARG B 1 84  ? -28.572 90.899  16.968  1.00 18.52  ? 84   ARG B NH2   1 
ATOM   5625  N N     . HIS B 1 85  ? -22.225 93.337  12.915  1.00 20.19  ? 85   HIS B N     1 
ATOM   5626  C CA    . HIS B 1 85  ? -21.117 93.153  13.857  1.00 20.63  ? 85   HIS B CA    1 
ATOM   5627  C C     . HIS B 1 85  ? -19.788 93.652  13.297  1.00 21.04  ? 85   HIS B C     1 
ATOM   5628  O O     . HIS B 1 85  ? -18.783 93.715  14.013  1.00 21.12  ? 85   HIS B O     1 
ATOM   5629  C CB    . HIS B 1 85  ? -20.975 91.677  14.244  1.00 20.27  ? 85   HIS B CB    1 
ATOM   5630  C CG    . HIS B 1 85  ? -22.216 91.081  14.837  1.00 20.12  ? 85   HIS B CG    1 
ATOM   5631  N ND1   . HIS B 1 85  ? -22.779 91.538  16.010  1.00 18.81  ? 85   HIS B ND1   1 
ATOM   5632  C CD2   . HIS B 1 85  ? -22.995 90.053  14.424  1.00 18.86  ? 85   HIS B CD2   1 
ATOM   5633  C CE1   . HIS B 1 85  ? -23.855 90.826  16.292  1.00 18.17  ? 85   HIS B CE1   1 
ATOM   5634  N NE2   . HIS B 1 85  ? -24.009 89.917  15.344  1.00 19.29  ? 85   HIS B NE2   1 
ATOM   5635  N N     . LEU B 1 86  ? -19.779 94.006  12.018  1.00 21.56  ? 86   LEU B N     1 
ATOM   5636  C CA    . LEU B 1 86  ? -18.528 94.370  11.350  1.00 22.04  ? 86   LEU B CA    1 
ATOM   5637  C C     . LEU B 1 86  ? -17.960 95.690  11.849  1.00 22.10  ? 86   LEU B C     1 
ATOM   5638  O O     . LEU B 1 86  ? -16.746 95.808  12.054  1.00 22.11  ? 86   LEU B O     1 
ATOM   5639  C CB    . LEU B 1 86  ? -18.698 94.388  9.828   1.00 22.04  ? 86   LEU B CB    1 
ATOM   5640  C CG    . LEU B 1 86  ? -19.159 93.078  9.201   1.00 22.72  ? 86   LEU B CG    1 
ATOM   5641  C CD1   . LEU B 1 86  ? -19.102 93.218  7.692   1.00 23.51  ? 86   LEU B CD1   1 
ATOM   5642  C CD2   . LEU B 1 86  ? -18.284 91.927  9.667   1.00 23.36  ? 86   LEU B CD2   1 
ATOM   5643  N N     . GLN B 1 87  ? -18.840 96.665  12.071  1.00 22.29  ? 87   GLN B N     1 
ATOM   5644  C CA    . GLN B 1 87  ? -18.406 98.018  12.434  1.00 22.70  ? 87   GLN B CA    1 
ATOM   5645  C C     . GLN B 1 87  ? -17.458 98.041  13.643  1.00 22.69  ? 87   GLN B C     1 
ATOM   5646  O O     . GLN B 1 87  ? -16.397 98.659  13.581  1.00 22.57  ? 87   GLN B O     1 
ATOM   5647  C CB    . GLN B 1 87  ? -19.620 98.926  12.676  1.00 22.76  ? 87   GLN B CB    1 
ATOM   5648  C CG    . GLN B 1 87  ? -19.288 100.387 12.900  1.00 22.89  ? 87   GLN B CG    1 
ATOM   5649  C CD    . GLN B 1 87  ? -20.525 101.244 13.086  1.00 22.83  ? 87   GLN B CD    1 
ATOM   5650  O OE1   . GLN B 1 87  ? -20.536 102.422 12.728  1.00 22.99  ? 87   GLN B OE1   1 
ATOM   5651  N NE2   . GLN B 1 87  ? -21.574 100.656 13.639  1.00 22.41  ? 87   GLN B NE2   1 
ATOM   5652  N N     . GLU B 1 88  ? -17.846 97.354  14.722  1.00 23.06  ? 88   GLU B N     1 
ATOM   5653  C CA    . GLU B 1 88  ? -17.097 97.370  15.988  1.00 23.14  ? 88   GLU B CA    1 
ATOM   5654  C C     . GLU B 1 88  ? -16.426 96.048  16.366  1.00 22.82  ? 88   GLU B C     1 
ATOM   5655  O O     . GLU B 1 88  ? -15.591 96.020  17.267  1.00 22.69  ? 88   GLU B O     1 
ATOM   5656  C CB    . GLU B 1 88  ? -17.991 97.853  17.139  1.00 23.20  ? 88   GLU B CB    1 
ATOM   5657  C CG    . GLU B 1 88  ? -18.524 99.286  16.965  1.00 23.75  ? 88   GLU B CG    1 
ATOM   5658  C CD    . GLU B 1 88  ? -19.272 99.799  18.190  1.00 24.16  ? 88   GLU B CD    1 
ATOM   5659  O OE1   . GLU B 1 88  ? -18.626 100.369 19.099  1.00 25.45  ? 88   GLU B OE1   1 
ATOM   5660  O OE2   . GLU B 1 88  ? -20.507 99.650  18.235  1.00 25.43  ? 88   GLU B OE2   1 
ATOM   5661  N N     . ASN B 1 89  ? -16.781 94.960  15.677  1.00 22.72  ? 89   ASN B N     1 
ATOM   5662  C CA    . ASN B 1 89  ? -16.320 93.611  16.052  1.00 22.40  ? 89   ASN B CA    1 
ATOM   5663  C C     . ASN B 1 89  ? -15.890 92.708  14.891  1.00 22.43  ? 89   ASN B C     1 
ATOM   5664  O O     . ASN B 1 89  ? -15.777 91.498  15.066  1.00 22.76  ? 89   ASN B O     1 
ATOM   5665  C CB    . ASN B 1 89  ? -17.386 92.891  16.892  1.00 22.03  ? 89   ASN B CB    1 
ATOM   5666  C CG    . ASN B 1 89  ? -17.416 93.365  18.339  1.00 21.96  ? 89   ASN B CG    1 
ATOM   5667  O OD1   . ASN B 1 89  ? -18.368 94.018  18.770  1.00 20.55  ? 89   ASN B OD1   1 
ATOM   5668  N ND2   . ASN B 1 89  ? -16.362 93.061  19.085  1.00 20.86  ? 89   ASN B ND2   1 
ATOM   5669  N N     . GLY B 1 90  ? -15.641 93.291  13.721  1.00 22.37  ? 90   GLY B N     1 
ATOM   5670  C CA    . GLY B 1 90  ? -15.260 92.522  12.524  1.00 22.34  ? 90   GLY B CA    1 
ATOM   5671  C C     . GLY B 1 90  ? -14.084 91.556  12.665  1.00 22.40  ? 90   GLY B C     1 
ATOM   5672  O O     . GLY B 1 90  ? -14.041 90.521  11.983  1.00 22.07  ? 90   GLY B O     1 
ATOM   5673  N N     . ASP B 1 91  ? -13.140 91.888  13.550  1.00 22.45  ? 91   ASP B N     1 
ATOM   5674  C CA    . ASP B 1 91  ? -11.926 91.088  13.744  1.00 22.84  ? 91   ASP B CA    1 
ATOM   5675  C C     . ASP B 1 91  ? -12.048 90.054  14.851  1.00 22.89  ? 91   ASP B C     1 
ATOM   5676  O O     . ASP B 1 91  ? -11.152 89.221  15.038  1.00 23.27  ? 91   ASP B O     1 
ATOM   5677  C CB    . ASP B 1 91  ? -10.723 91.984  14.018  1.00 23.10  ? 91   ASP B CB    1 
ATOM   5678  C CG    . ASP B 1 91  ? -10.430 92.927  12.873  1.00 24.03  ? 91   ASP B CG    1 
ATOM   5679  O OD1   . ASP B 1 91  ? -10.430 92.477  11.702  1.00 24.02  ? 91   ASP B OD1   1 
ATOM   5680  O OD2   . ASP B 1 91  ? -10.209 94.123  13.154  1.00 25.60  ? 91   ASP B OD2   1 
ATOM   5681  N N     . ARG B 1 92  ? -13.141 90.121  15.599  1.00 22.75  ? 92   ARG B N     1 
ATOM   5682  C CA    . ARG B 1 92  ? -13.466 89.076  16.570  1.00 22.86  ? 92   ARG B CA    1 
ATOM   5683  C C     . ARG B 1 92  ? -13.748 87.740  15.859  1.00 22.21  ? 92   ARG B C     1 
ATOM   5684  O O     . ARG B 1 92  ? -14.352 87.716  14.786  1.00 22.13  ? 92   ARG B O     1 
ATOM   5685  C CB    . ARG B 1 92  ? -14.656 89.530  17.412  1.00 22.85  ? 92   ARG B CB    1 
ATOM   5686  C CG    . ARG B 1 92  ? -15.583 88.447  17.896  1.00 25.13  ? 92   ARG B CG    1 
ATOM   5687  C CD    . ARG B 1 92  ? -16.457 88.964  19.012  1.00 28.53  ? 92   ARG B CD    1 
ATOM   5688  N NE    . ARG B 1 92  ? -15.789 88.802  20.301  1.00 32.88  ? 92   ARG B NE    1 
ATOM   5689  C CZ    . ARG B 1 92  ? -15.390 89.790  21.099  1.00 33.76  ? 92   ARG B CZ    1 
ATOM   5690  N NH1   . ARG B 1 92  ? -15.588 91.061  20.765  1.00 33.90  ? 92   ARG B NH1   1 
ATOM   5691  N NH2   . ARG B 1 92  ? -14.797 89.495  22.249  1.00 34.25  ? 92   ARG B NH2   1 
ATOM   5692  N N     . THR B 1 93  ? -13.289 86.640  16.450  1.00 21.73  ? 93   THR B N     1 
ATOM   5693  C CA    . THR B 1 93  ? -13.581 85.312  15.929  1.00 20.83  ? 93   THR B CA    1 
ATOM   5694  C C     . THR B 1 93  ? -15.068 85.013  16.044  1.00 20.71  ? 93   THR B C     1 
ATOM   5695  O O     . THR B 1 93  ? -15.644 85.062  17.145  1.00 20.71  ? 93   THR B O     1 
ATOM   5696  C CB    . THR B 1 93  ? -12.795 84.219  16.669  1.00 20.71  ? 93   THR B CB    1 
ATOM   5697  O OG1   . THR B 1 93  ? -11.413 84.583  16.733  1.00 20.57  ? 93   THR B OG1   1 
ATOM   5698  C CG2   . THR B 1 93  ? -12.922 82.892  15.938  1.00 20.22  ? 93   THR B CG2   1 
ATOM   5699  N N     . ALA B 1 94  ? -15.686 84.720  14.900  1.00 19.81  ? 94   ALA B N     1 
ATOM   5700  C CA    . ALA B 1 94  ? -17.068 84.241  14.881  1.00 19.38  ? 94   ALA B CA    1 
ATOM   5701  C C     . ALA B 1 94  ? -17.104 82.741  15.127  1.00 18.97  ? 94   ALA B C     1 
ATOM   5702  O O     . ALA B 1 94  ? -17.881 82.251  15.943  1.00 19.37  ? 94   ALA B O     1 
ATOM   5703  C CB    . ALA B 1 94  ? -17.739 84.585  13.559  1.00 19.04  ? 94   ALA B CB    1 
ATOM   5704  N N     . ILE B 1 95  ? -16.258 82.014  14.408  1.00 18.57  ? 95   ILE B N     1 
ATOM   5705  C CA    . ILE B 1 95  ? -16.232 80.556  14.475  1.00 17.97  ? 95   ILE B CA    1 
ATOM   5706  C C     . ILE B 1 95  ? -14.811 80.056  14.706  1.00 17.89  ? 95   ILE B C     1 
ATOM   5707  O O     . ILE B 1 95  ? -13.887 80.416  13.975  1.00 17.93  ? 95   ILE B O     1 
ATOM   5708  C CB    . ILE B 1 95  ? -16.802 79.903  13.173  1.00 17.77  ? 95   ILE B CB    1 
ATOM   5709  C CG1   . ILE B 1 95  ? -18.226 80.404  12.878  1.00 17.15  ? 95   ILE B CG1   1 
ATOM   5710  C CG2   . ILE B 1 95  ? -16.761 78.363  13.269  1.00 18.63  ? 95   ILE B CG2   1 
ATOM   5711  C CD1   . ILE B 1 95  ? -18.921 79.707  11.704  1.00 17.22  ? 95   ILE B CD1   1 
ATOM   5712  N N     . ILE B 1 96  ? -14.645 79.252  15.748  1.00 17.78  ? 96   ILE B N     1 
ATOM   5713  C CA    . ILE B 1 96  ? -13.437 78.466  15.943  1.00 17.84  ? 96   ILE B CA    1 
ATOM   5714  C C     . ILE B 1 96  ? -13.768 77.091  15.413  1.00 17.87  ? 96   ILE B C     1 
ATOM   5715  O O     . ILE B 1 96  ? -14.706 76.468  15.879  1.00 17.99  ? 96   ILE B O     1 
ATOM   5716  C CB    . ILE B 1 96  ? -13.058 78.331  17.444  1.00 17.79  ? 96   ILE B CB    1 
ATOM   5717  C CG1   . ILE B 1 96  ? -12.745 79.698  18.052  1.00 17.90  ? 96   ILE B CG1   1 
ATOM   5718  C CG2   . ILE B 1 96  ? -11.884 77.362  17.626  1.00 16.48  ? 96   ILE B CG2   1 
ATOM   5719  C CD1   . ILE B 1 96  ? -12.592 79.673  19.582  1.00 18.12  ? 96   ILE B CD1   1 
ATOM   5720  N N     . TRP B 1 97  ? -13.016 76.624  14.427  1.00 17.83  ? 97   TRP B N     1 
ATOM   5721  C CA    . TRP B 1 97  ? -13.205 75.279  13.928  1.00 17.43  ? 97   TRP B CA    1 
ATOM   5722  C C     . TRP B 1 97  ? -12.060 74.397  14.391  1.00 17.17  ? 97   TRP B C     1 
ATOM   5723  O O     . TRP B 1 97  ? -10.900 74.760  14.249  1.00 17.03  ? 97   TRP B O     1 
ATOM   5724  C CB    . TRP B 1 97  ? -13.341 75.265  12.404  1.00 17.55  ? 97   TRP B CB    1 
ATOM   5725  C CG    . TRP B 1 97  ? -13.487 73.869  11.831  1.00 17.30  ? 97   TRP B CG    1 
ATOM   5726  C CD1   . TRP B 1 97  ? -14.599 73.073  11.859  1.00 16.32  ? 97   TRP B CD1   1 
ATOM   5727  C CD2   . TRP B 1 97  ? -12.471 73.117  11.159  1.00 18.01  ? 97   TRP B CD2   1 
ATOM   5728  N NE1   . TRP B 1 97  ? -14.340 71.874  11.225  1.00 16.66  ? 97   TRP B NE1   1 
ATOM   5729  C CE2   . TRP B 1 97  ? -13.037 71.872  10.801  1.00 17.53  ? 97   TRP B CE2   1 
ATOM   5730  C CE3   . TRP B 1 97  ? -11.134 73.378  10.814  1.00 18.52  ? 97   TRP B CE3   1 
ATOM   5731  C CZ2   . TRP B 1 97  ? -12.310 70.889  10.117  1.00 18.13  ? 97   TRP B CZ2   1 
ATOM   5732  C CZ3   . TRP B 1 97  ? -10.416 72.395  10.138  1.00 16.87  ? 97   TRP B CZ3   1 
ATOM   5733  C CH2   . TRP B 1 97  ? -11.009 71.168  9.799   1.00 17.09  ? 97   TRP B CH2   1 
ATOM   5734  N N     . GLU B 1 98  ? -12.407 73.255  14.977  1.00 17.01  ? 98   GLU B N     1 
ATOM   5735  C CA    . GLU B 1 98  ? -11.440 72.299  15.505  1.00 16.88  ? 98   GLU B CA    1 
ATOM   5736  C C     . GLU B 1 98  ? -11.607 70.971  14.767  1.00 17.30  ? 98   GLU B C     1 
ATOM   5737  O O     . GLU B 1 98  ? -12.653 70.324  14.857  1.00 17.30  ? 98   GLU B O     1 
ATOM   5738  C CB    . GLU B 1 98  ? -11.630 72.125  17.022  1.00 16.93  ? 98   GLU B CB    1 
ATOM   5739  C CG    . GLU B 1 98  ? -10.948 70.901  17.645  1.00 16.33  ? 98   GLU B CG    1 
ATOM   5740  C CD    . GLU B 1 98  ? -9.446  71.082  17.889  1.00 17.15  ? 98   GLU B CD    1 
ATOM   5741  O OE1   . GLU B 1 98  ? -8.880  72.129  17.498  1.00 17.44  ? 98   GLU B OE1   1 
ATOM   5742  O OE2   . GLU B 1 98  ? -8.828  70.170  18.481  1.00 16.12  ? 98   GLU B OE2   1 
ATOM   5743  N N     . GLY B 1 99  ? -10.573 70.590  14.023  1.00 17.70  ? 99   GLY B N     1 
ATOM   5744  C CA    . GLY B 1 99  ? -10.592 69.378  13.218  1.00 18.16  ? 99   GLY B CA    1 
ATOM   5745  C C     . GLY B 1 99  ? -10.622 68.108  14.040  1.00 18.36  ? 99   GLY B C     1 
ATOM   5746  O O     . GLY B 1 99  ? -10.226 68.100  15.202  1.00 17.65  ? 99   GLY B O     1 
ATOM   5747  N N     . ASP B 1 100 ? -11.113 67.036  13.416  1.00 19.02  ? 100  ASP B N     1 
ATOM   5748  C CA    . ASP B 1 100 ? -11.115 65.683  13.987  1.00 19.54  ? 100  ASP B CA    1 
ATOM   5749  C C     . ASP B 1 100 ? -9.677  65.319  14.376  1.00 20.06  ? 100  ASP B C     1 
ATOM   5750  O O     . ASP B 1 100 ? -9.415  64.738  15.437  1.00 20.00  ? 100  ASP B O     1 
ATOM   5751  C CB    . ASP B 1 100 ? -11.675 64.709  12.935  1.00 19.76  ? 100  ASP B CB    1 
ATOM   5752  C CG    . ASP B 1 100 ? -11.720 63.270  13.414  1.00 19.40  ? 100  ASP B CG    1 
ATOM   5753  O OD1   . ASP B 1 100 ? -12.522 62.958  14.310  1.00 19.10  ? 100  ASP B OD1   1 
ATOM   5754  O OD2   . ASP B 1 100 ? -10.967 62.442  12.858  1.00 20.04  ? 100  ASP B OD2   1 
ATOM   5755  N N     . ASP B 1 101 ? -8.763  65.680  13.489  1.00 20.23  ? 101  ASP B N     1 
ATOM   5756  C CA    . ASP B 1 101 ? -7.334  65.638  13.726  1.00 21.16  ? 101  ASP B CA    1 
ATOM   5757  C C     . ASP B 1 101 ? -6.953  67.003  14.309  1.00 21.23  ? 101  ASP B C     1 
ATOM   5758  O O     . ASP B 1 101 ? -7.079  68.025  13.628  1.00 21.43  ? 101  ASP B O     1 
ATOM   5759  C CB    . ASP B 1 101 ? -6.637  65.360  12.385  1.00 21.15  ? 101  ASP B CB    1 
ATOM   5760  C CG    . ASP B 1 101 ? -5.144  65.669  12.393  1.00 22.40  ? 101  ASP B CG    1 
ATOM   5761  O OD1   . ASP B 1 101 ? -4.603  66.168  13.409  1.00 22.89  ? 101  ASP B OD1   1 
ATOM   5762  O OD2   . ASP B 1 101 ? -4.506  65.403  11.346  1.00 22.86  ? 101  ASP B OD2   1 
ATOM   5763  N N     . THR B 1 102 ? -6.493  67.016  15.562  1.00 21.25  ? 102  THR B N     1 
ATOM   5764  C CA    . THR B 1 102 ? -6.259  68.270  16.299  1.00 21.81  ? 102  THR B CA    1 
ATOM   5765  C C     . THR B 1 102 ? -5.226  69.249  15.686  1.00 22.57  ? 102  THR B C     1 
ATOM   5766  O O     . THR B 1 102 ? -5.187  70.419  16.066  1.00 22.63  ? 102  THR B O     1 
ATOM   5767  C CB    . THR B 1 102 ? -5.903  68.025  17.793  1.00 21.66  ? 102  THR B CB    1 
ATOM   5768  O OG1   . THR B 1 102 ? -5.988  69.265  18.494  1.00 21.13  ? 102  THR B OG1   1 
ATOM   5769  C CG2   . THR B 1 102 ? -4.492  67.449  17.958  1.00 21.01  ? 102  THR B CG2   1 
ATOM   5770  N N     . SER B 1 103 ? -4.412  68.773  14.745  1.00 22.84  ? 103  SER B N     1 
ATOM   5771  C CA    . SER B 1 103 ? -3.432  69.619  14.078  1.00 23.37  ? 103  SER B CA    1 
ATOM   5772  C C     . SER B 1 103 ? -4.104  70.513  13.042  1.00 23.71  ? 103  SER B C     1 
ATOM   5773  O O     . SER B 1 103 ? -3.451  71.371  12.443  1.00 23.74  ? 103  SER B O     1 
ATOM   5774  C CB    . SER B 1 103 ? -2.361  68.757  13.404  1.00 23.50  ? 103  SER B CB    1 
ATOM   5775  O OG    . SER B 1 103 ? -2.890  68.108  12.255  1.00 24.20  ? 103  SER B OG    1 
ATOM   5776  N N     . GLN B 1 104 ? -5.400  70.302  12.816  1.00 24.25  ? 104  GLN B N     1 
ATOM   5777  C CA    . GLN B 1 104 ? -6.158  71.097  11.834  1.00 25.25  ? 104  GLN B CA    1 
ATOM   5778  C C     . GLN B 1 104 ? -7.164  71.986  12.564  1.00 25.17  ? 104  GLN B C     1 
ATOM   5779  O O     . GLN B 1 104 ? -7.935  71.495  13.388  1.00 25.48  ? 104  GLN B O     1 
ATOM   5780  C CB    . GLN B 1 104 ? -6.871  70.188  10.813  1.00 25.10  ? 104  GLN B CB    1 
ATOM   5781  C CG    . GLN B 1 104 ? -5.940  69.345  9.922   1.00 26.33  ? 104  GLN B CG    1 
ATOM   5782  C CD    . GLN B 1 104 ? -6.677  68.514  8.858   1.00 26.92  ? 104  GLN B CD    1 
ATOM   5783  O OE1   . GLN B 1 104 ? -7.861  68.184  8.992   1.00 29.09  ? 104  GLN B OE1   1 
ATOM   5784  N NE2   . GLN B 1 104 ? -5.958  68.160  7.796   1.00 29.99  ? 104  GLN B NE2   1 
ATOM   5785  N N     . SER B 1 105 ? -7.145  73.288  12.281  1.00 25.40  ? 105  SER B N     1 
ATOM   5786  C CA    . SER B 1 105 ? -8.048  74.244  12.945  1.00 25.96  ? 105  SER B CA    1 
ATOM   5787  C C     . SER B 1 105 ? -7.942  75.674  12.402  1.00 25.76  ? 105  SER B C     1 
ATOM   5788  O O     . SER B 1 105 ? -6.894  76.083  11.903  1.00 26.02  ? 105  SER B O     1 
ATOM   5789  C CB    . SER B 1 105 ? -7.829  74.260  14.465  1.00 26.02  ? 105  SER B CB    1 
ATOM   5790  O OG    . SER B 1 105 ? -6.653  74.977  14.783  1.00 28.45  ? 105  SER B OG    1 
ATOM   5791  N N     . LYS B 1 106 ? -9.039  76.422  12.526  1.00 25.24  ? 106  LYS B N     1 
ATOM   5792  C CA    . LYS B 1 106 ? -9.157  77.780  12.012  1.00 24.83  ? 106  LYS B CA    1 
ATOM   5793  C C     . LYS B 1 106 ? -9.878  78.681  13.017  1.00 24.10  ? 106  LYS B C     1 
ATOM   5794  O O     . LYS B 1 106 ? -10.808 78.247  13.709  1.00 23.67  ? 106  LYS B O     1 
ATOM   5795  C CB    . LYS B 1 106 ? -9.962  77.789  10.700  1.00 24.82  ? 106  LYS B CB    1 
ATOM   5796  C CG    . LYS B 1 106 ? -9.342  77.029  9.548   1.00 26.19  ? 106  LYS B CG    1 
ATOM   5797  C CD    . LYS B 1 106 ? -10.179 77.076  8.277   1.00 26.11  ? 106  LYS B CD    1 
ATOM   5798  C CE    . LYS B 1 106 ? -9.544  76.162  7.214   1.00 29.63  ? 106  LYS B CE    1 
ATOM   5799  N NZ    . LYS B 1 106 ? -9.832  76.581  5.803   1.00 29.67  ? 106  LYS B NZ    1 
ATOM   5800  N N     . HIS B 1 107 ? -9.441  79.935  13.092  1.00 23.34  ? 107  HIS B N     1 
ATOM   5801  C CA    . HIS B 1 107 ? -10.242 81.005  13.686  1.00 22.75  ? 107  HIS B CA    1 
ATOM   5802  C C     . HIS B 1 107 ? -10.827 81.827  12.547  1.00 22.31  ? 107  HIS B C     1 
ATOM   5803  O O     . HIS B 1 107 ? -10.089 82.345  11.715  1.00 22.43  ? 107  HIS B O     1 
ATOM   5804  C CB    . HIS B 1 107 ? -9.395  81.872  14.624  1.00 22.48  ? 107  HIS B CB    1 
ATOM   5805  C CG    . HIS B 1 107 ? -9.011  81.179  15.894  1.00 22.71  ? 107  HIS B CG    1 
ATOM   5806  N ND1   . HIS B 1 107 ? -8.327  79.980  15.909  1.00 23.87  ? 107  HIS B ND1   1 
ATOM   5807  C CD2   . HIS B 1 107 ? -9.219  81.510  17.191  1.00 21.96  ? 107  HIS B CD2   1 
ATOM   5808  C CE1   . HIS B 1 107 ? -8.135  79.600  17.160  1.00 23.42  ? 107  HIS B CE1   1 
ATOM   5809  N NE2   . HIS B 1 107 ? -8.659  80.515  17.958  1.00 22.09  ? 107  HIS B NE2   1 
ATOM   5810  N N     . ILE B 1 108 ? -12.150 81.918  12.485  1.00 21.76  ? 108  ILE B N     1 
ATOM   5811  C CA    . ILE B 1 108 ? -12.800 82.654  11.394  1.00 21.58  ? 108  ILE B CA    1 
ATOM   5812  C C     . ILE B 1 108 ? -13.468 83.906  11.942  1.00 21.54  ? 108  ILE B C     1 
ATOM   5813  O O     . ILE B 1 108 ? -14.425 83.817  12.709  1.00 21.45  ? 108  ILE B O     1 
ATOM   5814  C CB    . ILE B 1 108 ? -13.823 81.779  10.607  1.00 21.33  ? 108  ILE B CB    1 
ATOM   5815  C CG1   . ILE B 1 108 ? -13.120 80.544  10.044  1.00 21.18  ? 108  ILE B CG1   1 
ATOM   5816  C CG2   . ILE B 1 108 ? -14.474 82.596  9.475   1.00 20.68  ? 108  ILE B CG2   1 
ATOM   5817  C CD1   . ILE B 1 108 ? -14.024 79.381  9.796   1.00 20.24  ? 108  ILE B CD1   1 
ATOM   5818  N N     . SER B 1 109 ? -12.945 85.065  11.550  1.00 21.38  ? 109  SER B N     1 
ATOM   5819  C CA    . SER B 1 109 ? -13.430 86.348  12.047  1.00 21.61  ? 109  SER B CA    1 
ATOM   5820  C C     . SER B 1 109 ? -14.794 86.663  11.448  1.00 21.47  ? 109  SER B C     1 
ATOM   5821  O O     . SER B 1 109 ? -15.171 86.104  10.418  1.00 21.42  ? 109  SER B O     1 
ATOM   5822  C CB    . SER B 1 109 ? -12.444 87.466  11.685  1.00 21.69  ? 109  SER B CB    1 
ATOM   5823  O OG    . SER B 1 109 ? -12.606 87.824  10.324  1.00 21.78  ? 109  SER B OG    1 
ATOM   5824  N N     . TYR B 1 110 ? -15.528 87.566  12.093  1.00 21.49  ? 110  TYR B N     1 
ATOM   5825  C CA    . TYR B 1 110 ? -16.788 88.056  11.543  1.00 21.53  ? 110  TYR B CA    1 
ATOM   5826  C C     . TYR B 1 110 ? -16.600 88.563  10.107  1.00 21.98  ? 110  TYR B C     1 
ATOM   5827  O O     . TYR B 1 110 ? -17.372 88.193  9.203   1.00 21.47  ? 110  TYR B O     1 
ATOM   5828  C CB    . TYR B 1 110 ? -17.446 89.095  12.480  1.00 21.52  ? 110  TYR B CB    1 
ATOM   5829  C CG    . TYR B 1 110 ? -18.306 88.414  13.515  1.00 21.27  ? 110  TYR B CG    1 
ATOM   5830  C CD1   . TYR B 1 110 ? -17.804 88.095  14.782  1.00 20.58  ? 110  TYR B CD1   1 
ATOM   5831  C CD2   . TYR B 1 110 ? -19.604 88.009  13.198  1.00 21.46  ? 110  TYR B CD2   1 
ATOM   5832  C CE1   . TYR B 1 110 ? -18.591 87.417  15.717  1.00 20.54  ? 110  TYR B CE1   1 
ATOM   5833  C CE2   . TYR B 1 110 ? -20.395 87.320  14.122  1.00 21.55  ? 110  TYR B CE2   1 
ATOM   5834  C CZ    . TYR B 1 110 ? -19.889 87.031  15.376  1.00 21.30  ? 110  TYR B CZ    1 
ATOM   5835  O OH    . TYR B 1 110 ? -20.697 86.364  16.280  1.00 21.04  ? 110  TYR B OH    1 
ATOM   5836  N N     . ARG B 1 111 ? -15.541 89.348  9.896   1.00 21.97  ? 111  ARG B N     1 
ATOM   5837  C CA    . ARG B 1 111 ? -15.223 89.880  8.572   1.00 22.81  ? 111  ARG B CA    1 
ATOM   5838  C C     . ARG B 1 111 ? -14.984 88.779  7.529   1.00 22.54  ? 111  ARG B C     1 
ATOM   5839  O O     . ARG B 1 111 ? -15.554 88.828  6.435   1.00 22.79  ? 111  ARG B O     1 
ATOM   5840  C CB    . ARG B 1 111 ? -14.039 90.856  8.640   1.00 22.74  ? 111  ARG B CB    1 
ATOM   5841  C CG    . ARG B 1 111 ? -13.801 91.645  7.352   1.00 24.42  ? 111  ARG B CG    1 
ATOM   5842  C CD    . ARG B 1 111 ? -13.012 92.935  7.580   1.00 24.83  ? 111  ARG B CD    1 
ATOM   5843  N NE    . ARG B 1 111 ? -13.836 93.975  8.207   1.00 27.95  ? 111  ARG B NE    1 
ATOM   5844  C CZ    . ARG B 1 111 ? -13.585 94.533  9.391   1.00 28.76  ? 111  ARG B CZ    1 
ATOM   5845  N NH1   . ARG B 1 111 ? -12.513 94.175  10.094  1.00 29.84  ? 111  ARG B NH1   1 
ATOM   5846  N NH2   . ARG B 1 111 ? -14.402 95.463  9.868   1.00 28.92  ? 111  ARG B NH2   1 
ATOM   5847  N N     . GLU B 1 112 ? -14.152 87.794  7.873   1.00 22.34  ? 112  GLU B N     1 
ATOM   5848  C CA    . GLU B 1 112 ? -13.890 86.642  6.999   1.00 22.24  ? 112  GLU B CA    1 
ATOM   5849  C C     . GLU B 1 112 ? -15.162 85.834  6.707   1.00 21.80  ? 112  GLU B C     1 
ATOM   5850  O O     . GLU B 1 112 ? -15.416 85.471  5.555   1.00 21.36  ? 112  GLU B O     1 
ATOM   5851  C CB    . GLU B 1 112 ? -12.801 85.740  7.580   1.00 22.13  ? 112  GLU B CB    1 
ATOM   5852  C CG    . GLU B 1 112 ? -11.441 86.418  7.699   1.00 22.99  ? 112  GLU B CG    1 
ATOM   5853  C CD    . GLU B 1 112 ? -10.466 85.663  8.599   1.00 23.64  ? 112  GLU B CD    1 
ATOM   5854  O OE1   . GLU B 1 112 ? -10.898 85.012  9.580   1.00 22.64  ? 112  GLU B OE1   1 
ATOM   5855  O OE2   . GLU B 1 112 ? -9.246  85.730  8.321   1.00 26.73  ? 112  GLU B OE2   1 
ATOM   5856  N N     . LEU B 1 113 ? -15.958 85.575  7.741   1.00 21.03  ? 113  LEU B N     1 
ATOM   5857  C CA    . LEU B 1 113 ? -17.209 84.855  7.567   1.00 21.19  ? 113  LEU B CA    1 
ATOM   5858  C C     . LEU B 1 113 ? -18.222 85.637  6.716   1.00 21.42  ? 113  LEU B C     1 
ATOM   5859  O O     . LEU B 1 113 ? -18.861 85.070  5.823   1.00 21.47  ? 113  LEU B O     1 
ATOM   5860  C CB    . LEU B 1 113 ? -17.805 84.469  8.928   1.00 21.01  ? 113  LEU B CB    1 
ATOM   5861  C CG    . LEU B 1 113 ? -19.037 83.557  8.950   1.00 21.35  ? 113  LEU B CG    1 
ATOM   5862  C CD1   . LEU B 1 113 ? -18.826 82.267  8.148   1.00 17.96  ? 113  LEU B CD1   1 
ATOM   5863  C CD2   . LEU B 1 113 ? -19.450 83.266  10.403  1.00 20.60  ? 113  LEU B CD2   1 
ATOM   5864  N N     . HIS B 1 114 ? -18.358 86.929  7.001   1.00 21.65  ? 114  HIS B N     1 
ATOM   5865  C CA    . HIS B 1 114 ? -19.186 87.838  6.205   1.00 22.22  ? 114  HIS B CA    1 
ATOM   5866  C C     . HIS B 1 114 ? -18.804 87.801  4.725   1.00 22.11  ? 114  HIS B C     1 
ATOM   5867  O O     . HIS B 1 114 ? -19.671 87.659  3.847   1.00 22.16  ? 114  HIS B O     1 
ATOM   5868  C CB    . HIS B 1 114 ? -19.062 89.285  6.738   1.00 22.32  ? 114  HIS B CB    1 
ATOM   5869  C CG    . HIS B 1 114 ? -19.738 90.312  5.879   1.00 22.16  ? 114  HIS B CG    1 
ATOM   5870  N ND1   . HIS B 1 114 ? -19.062 91.053  4.932   1.00 22.58  ? 114  HIS B ND1   1 
ATOM   5871  C CD2   . HIS B 1 114 ? -21.030 90.719  5.824   1.00 21.93  ? 114  HIS B CD2   1 
ATOM   5872  C CE1   . HIS B 1 114 ? -19.908 91.873  4.332   1.00 22.32  ? 114  HIS B CE1   1 
ATOM   5873  N NE2   . HIS B 1 114 ? -21.107 91.691  4.855   1.00 22.34  ? 114  HIS B NE2   1 
ATOM   5874  N N     . ARG B 1 115 ? -17.506 87.940  4.465   1.00 22.12  ? 115  ARG B N     1 
ATOM   5875  C CA    . ARG B 1 115 ? -16.960 87.909  3.107   1.00 22.20  ? 115  ARG B CA    1 
ATOM   5876  C C     . ARG B 1 115 ? -17.436 86.666  2.349   1.00 22.56  ? 115  ARG B C     1 
ATOM   5877  O O     . ARG B 1 115 ? -17.998 86.768  1.251   1.00 22.57  ? 115  ARG B O     1 
ATOM   5878  C CB    . ARG B 1 115 ? -15.430 87.967  3.159   1.00 21.89  ? 115  ARG B CB    1 
ATOM   5879  C CG    . ARG B 1 115 ? -14.735 87.694  1.828   1.00 22.61  ? 115  ARG B CG    1 
ATOM   5880  N N     . ASP B 1 116 ? -17.227 85.501  2.957   1.00 22.88  ? 116  ASP B N     1 
ATOM   5881  C CA    . ASP B 1 116 ? -17.589 84.225  2.354   1.00 23.13  ? 116  ASP B CA    1 
ATOM   5882  C C     . ASP B 1 116 ? -19.088 84.068  2.093   1.00 22.68  ? 116  ASP B C     1 
ATOM   5883  O O     . ASP B 1 116 ? -19.469 83.497  1.075   1.00 22.96  ? 116  ASP B O     1 
ATOM   5884  C CB    . ASP B 1 116 ? -17.058 83.058  3.196   1.00 23.60  ? 116  ASP B CB    1 
ATOM   5885  C CG    . ASP B 1 116 ? -15.537 82.948  3.161   1.00 25.78  ? 116  ASP B CG    1 
ATOM   5886  O OD1   . ASP B 1 116 ? -14.957 82.995  2.053   1.00 26.71  ? 116  ASP B OD1   1 
ATOM   5887  O OD2   . ASP B 1 116 ? -14.921 82.820  4.250   1.00 28.70  ? 116  ASP B OD2   1 
ATOM   5888  N N     . VAL B 1 117 ? -19.927 84.571  2.998   1.00 22.13  ? 117  VAL B N     1 
ATOM   5889  C CA    . VAL B 1 117 ? -21.390 84.498  2.845   1.00 21.47  ? 117  VAL B CA    1 
ATOM   5890  C C     . VAL B 1 117 ? -21.898 85.357  1.674   1.00 21.35  ? 117  VAL B C     1 
ATOM   5891  O O     . VAL B 1 117 ? -22.752 84.919  0.884   1.00 21.58  ? 117  VAL B O     1 
ATOM   5892  C CB    . VAL B 1 117 ? -22.131 84.856  4.181   1.00 21.89  ? 117  VAL B CB    1 
ATOM   5893  C CG1   . VAL B 1 117 ? -23.624 85.110  3.943   1.00 21.42  ? 117  VAL B CG1   1 
ATOM   5894  C CG2   . VAL B 1 117 ? -21.941 83.737  5.222   1.00 20.77  ? 117  VAL B CG2   1 
ATOM   5895  N N     . CYS B 1 118 ? -21.354 86.566  1.556   1.00 20.66  ? 118  CYS B N     1 
ATOM   5896  C CA    . CYS B 1 118 ? -21.627 87.434  0.415   1.00 20.29  ? 118  CYS B CA    1 
ATOM   5897  C C     . CYS B 1 118 ? -21.274 86.771  -0.916  1.00 20.22  ? 118  CYS B C     1 
ATOM   5898  O O     . CYS B 1 118 ? -22.080 86.786  -1.849  1.00 19.98  ? 118  CYS B O     1 
ATOM   5899  C CB    . CYS B 1 118 ? -20.887 88.763  0.561   1.00 19.91  ? 118  CYS B CB    1 
ATOM   5900  S SG    . CYS B 1 118 ? -21.536 89.762  1.892   1.00 19.40  ? 118  CYS B SG    1 
ATOM   5901  N N     . ARG B 1 119 ? -20.067 86.206  -0.990  1.00 20.28  ? 119  ARG B N     1 
ATOM   5902  C CA    . ARG B 1 119 ? -19.606 85.450  -2.157  1.00 20.30  ? 119  ARG B CA    1 
ATOM   5903  C C     . ARG B 1 119 ? -20.532 84.289  -2.523  1.00 19.57  ? 119  ARG B C     1 
ATOM   5904  O O     . ARG B 1 119 ? -20.934 84.126  -3.677  1.00 18.83  ? 119  ARG B O     1 
ATOM   5905  C CB    . ARG B 1 119 ? -18.197 84.934  -1.893  1.00 21.10  ? 119  ARG B CB    1 
ATOM   5906  C CG    . ARG B 1 119 ? -17.109 85.925  -2.286  1.00 24.44  ? 119  ARG B CG    1 
ATOM   5907  C CD    . ARG B 1 119 ? -15.766 85.244  -2.459  1.00 30.44  ? 119  ARG B CD    1 
ATOM   5908  N NE    . ARG B 1 119 ? -14.950 85.344  -1.256  1.00 35.27  ? 119  ARG B NE    1 
ATOM   5909  C CZ    . ARG B 1 119 ? -13.787 84.718  -1.075  1.00 38.52  ? 119  ARG B CZ    1 
ATOM   5910  N NH1   . ARG B 1 119 ? -13.289 83.919  -2.019  1.00 38.20  ? 119  ARG B NH1   1 
ATOM   5911  N NH2   . ARG B 1 119 ? -13.121 84.889  0.068   1.00 40.12  ? 119  ARG B NH2   1 
ATOM   5912  N N     . PHE B 1 120 ? -20.885 83.498  -1.515  1.00 19.41  ? 120  PHE B N     1 
ATOM   5913  C CA    . PHE B 1 120 ? -21.758 82.348  -1.698  1.00 19.13  ? 120  PHE B CA    1 
ATOM   5914  C C     . PHE B 1 120 ? -23.224 82.703  -2.008  1.00 19.03  ? 120  PHE B C     1 
ATOM   5915  O O     . PHE B 1 120 ? -23.903 81.980  -2.756  1.00 19.05  ? 120  PHE B O     1 
ATOM   5916  C CB    . PHE B 1 120 ? -21.643 81.377  -0.519  1.00 19.13  ? 120  PHE B CB    1 
ATOM   5917  C CG    . PHE B 1 120 ? -22.020 79.971  -0.877  1.00 18.50  ? 120  PHE B CG    1 
ATOM   5918  C CD1   . PHE B 1 120 ? -21.126 79.156  -1.562  1.00 18.41  ? 120  PHE B CD1   1 
ATOM   5919  C CD2   . PHE B 1 120 ? -23.283 79.482  -0.568  1.00 18.69  ? 120  PHE B CD2   1 
ATOM   5920  C CE1   . PHE B 1 120 ? -21.480 77.854  -1.930  1.00 20.60  ? 120  PHE B CE1   1 
ATOM   5921  C CE2   . PHE B 1 120 ? -23.660 78.177  -0.912  1.00 20.42  ? 120  PHE B CE2   1 
ATOM   5922  C CZ    . PHE B 1 120 ? -22.755 77.355  -1.596  1.00 20.17  ? 120  PHE B CZ    1 
ATOM   5923  N N     . ALA B 1 121 ? -23.700 83.815  -1.447  1.00 19.25  ? 121  ALA B N     1 
ATOM   5924  C CA    . ALA B 1 121 ? -25.005 84.368  -1.810  1.00 18.69  ? 121  ALA B CA    1 
ATOM   5925  C C     . ALA B 1 121 ? -25.072 84.703  -3.312  1.00 19.10  ? 121  ALA B C     1 
ATOM   5926  O O     . ALA B 1 121 ? -26.032 84.308  -3.999  1.00 18.79  ? 121  ALA B O     1 
ATOM   5927  C CB    . ALA B 1 121 ? -25.324 85.582  -0.972  1.00 18.62  ? 121  ALA B CB    1 
ATOM   5928  N N     . ASN B 1 122 ? -24.063 85.421  -3.812  1.00 18.72  ? 122  ASN B N     1 
ATOM   5929  C CA    . ASN B 1 122 ? -23.944 85.680  -5.237  1.00 19.40  ? 122  ASN B CA    1 
ATOM   5930  C C     . ASN B 1 122 ? -23.853 84.393  -6.078  1.00 19.50  ? 122  ASN B C     1 
ATOM   5931  O O     . ASN B 1 122 ? -24.468 84.300  -7.155  1.00 19.65  ? 122  ASN B O     1 
ATOM   5932  C CB    . ASN B 1 122 ? -22.754 86.612  -5.532  1.00 19.43  ? 122  ASN B CB    1 
ATOM   5933  C CG    . ASN B 1 122 ? -23.052 88.066  -5.180  1.00 20.72  ? 122  ASN B CG    1 
ATOM   5934  O OD1   . ASN B 1 122 ? -24.117 88.589  -5.519  1.00 21.19  ? 122  ASN B OD1   1 
ATOM   5935  N ND2   . ASN B 1 122 ? -22.118 88.720  -4.490  1.00 21.03  ? 122  ASN B ND2   1 
ATOM   5936  N N     . THR B 1 123 ? -23.090 83.416  -5.580  1.00 19.35  ? 123  THR B N     1 
ATOM   5937  C CA    . THR B 1 123 ? -22.972 82.110  -6.219  1.00 19.38  ? 123  THR B CA    1 
ATOM   5938  C C     . THR B 1 123 ? -24.356 81.504  -6.418  1.00 19.81  ? 123  THR B C     1 
ATOM   5939  O O     . THR B 1 123 ? -24.694 81.092  -7.527  1.00 20.03  ? 123  THR B O     1 
ATOM   5940  C CB    . THR B 1 123 ? -22.070 81.146  -5.385  1.00 19.19  ? 123  THR B CB    1 
ATOM   5941  O OG1   . THR B 1 123 ? -20.757 81.703  -5.250  1.00 19.77  ? 123  THR B OG1   1 
ATOM   5942  C CG2   . THR B 1 123 ? -21.959 79.784  -6.035  1.00 18.13  ? 123  THR B CG2   1 
ATOM   5943  N N     . LEU B 1 124 ? -25.150 81.457  -5.346  1.00 20.35  ? 124  LEU B N     1 
ATOM   5944  C CA    . LEU B 1 124 ? -26.504 80.890  -5.388  1.00 20.87  ? 124  LEU B CA    1 
ATOM   5945  C C     . LEU B 1 124 ? -27.414 81.662  -6.358  1.00 21.51  ? 124  LEU B C     1 
ATOM   5946  O O     . LEU B 1 124 ? -28.178 81.065  -7.119  1.00 21.14  ? 124  LEU B O     1 
ATOM   5947  C CB    . LEU B 1 124 ? -27.124 80.837  -3.973  1.00 20.64  ? 124  LEU B CB    1 
ATOM   5948  C CG    . LEU B 1 124 ? -26.466 79.957  -2.884  1.00 20.91  ? 124  LEU B CG    1 
ATOM   5949  C CD1   . LEU B 1 124 ? -27.187 80.100  -1.538  1.00 20.43  ? 124  LEU B CD1   1 
ATOM   5950  C CD2   . LEU B 1 124 ? -26.407 78.493  -3.261  1.00 18.20  ? 124  LEU B CD2   1 
ATOM   5951  N N     . LEU B 1 125 ? -27.315 82.993  -6.324  1.00 22.27  ? 125  LEU B N     1 
ATOM   5952  C CA    . LEU B 1 125 ? -28.092 83.861  -7.216  1.00 22.90  ? 125  LEU B CA    1 
ATOM   5953  C C     . LEU B 1 125 ? -27.690 83.687  -8.683  1.00 23.44  ? 125  LEU B C     1 
ATOM   5954  O O     . LEU B 1 125 ? -28.552 83.622  -9.564  1.00 23.36  ? 125  LEU B O     1 
ATOM   5955  C CB    . LEU B 1 125 ? -27.959 85.328  -6.798  1.00 22.56  ? 125  LEU B CB    1 
ATOM   5956  C CG    . LEU B 1 125 ? -28.691 85.801  -5.540  1.00 22.21  ? 125  LEU B CG    1 
ATOM   5957  C CD1   . LEU B 1 125 ? -28.154 87.148  -5.107  1.00 21.70  ? 125  LEU B CD1   1 
ATOM   5958  C CD2   . LEU B 1 125 ? -30.205 85.869  -5.758  1.00 21.64  ? 125  LEU B CD2   1 
ATOM   5959  N N     . ASP B 1 126 ? -26.379 83.621  -8.930  1.00 24.20  ? 126  ASP B N     1 
ATOM   5960  C CA    . ASP B 1 126 ? -25.840 83.363  -10.264 1.00 24.91  ? 126  ASP B CA    1 
ATOM   5961  C C     . ASP B 1 126 ? -26.356 82.025  -10.798 1.00 25.18  ? 126  ASP B C     1 
ATOM   5962  O O     . ASP B 1 126 ? -26.556 81.864  -11.999 1.00 25.44  ? 126  ASP B O     1 
ATOM   5963  C CB    . ASP B 1 126 ? -24.303 83.392  -10.252 1.00 25.11  ? 126  ASP B CB    1 
ATOM   5964  C CG    . ASP B 1 126 ? -23.721 84.820  -10.142 1.00 26.21  ? 126  ASP B CG    1 
ATOM   5965  O OD1   . ASP B 1 126 ? -24.488 85.817  -10.075 1.00 25.71  ? 126  ASP B OD1   1 
ATOM   5966  O OD2   . ASP B 1 126 ? -22.474 84.941  -10.126 1.00 27.24  ? 126  ASP B OD2   1 
ATOM   5967  N N     . LEU B 1 127 ? -26.595 81.087  -9.886  1.00 25.39  ? 127  LEU B N     1 
ATOM   5968  C CA    . LEU B 1 127 ? -27.113 79.764  -10.221 1.00 25.76  ? 127  LEU B CA    1 
ATOM   5969  C C     . LEU B 1 127 ? -28.632 79.721  -10.439 1.00 25.61  ? 127  LEU B C     1 
ATOM   5970  O O     . LEU B 1 127 ? -29.187 78.669  -10.773 1.00 25.62  ? 127  LEU B O     1 
ATOM   5971  C CB    . LEU B 1 127 ? -26.714 78.758  -9.134  1.00 25.71  ? 127  LEU B CB    1 
ATOM   5972  C CG    . LEU B 1 127 ? -25.487 77.871  -9.370  1.00 26.12  ? 127  LEU B CG    1 
ATOM   5973  C CD1   . LEU B 1 127 ? -24.208 78.677  -9.577  1.00 26.70  ? 127  LEU B CD1   1 
ATOM   5974  C CD2   . LEU B 1 127 ? -25.325 76.914  -8.197  1.00 25.97  ? 127  LEU B CD2   1 
ATOM   5975  N N     . GLY B 1 128 ? -29.296 80.856  -10.247 1.00 25.33  ? 128  GLY B N     1 
ATOM   5976  C CA    . GLY B 1 128 ? -30.733 80.941  -10.458 1.00 25.13  ? 128  GLY B CA    1 
ATOM   5977  C C     . GLY B 1 128 ? -31.560 80.539  -9.248  1.00 25.22  ? 128  GLY B C     1 
ATOM   5978  O O     . GLY B 1 128 ? -32.783 80.424  -9.349  1.00 24.73  ? 128  GLY B O     1 
ATOM   5979  N N     . ILE B 1 129 ? -30.905 80.322  -8.106  1.00 25.04  ? 129  ILE B N     1 
ATOM   5980  C CA    . ILE B 1 129 ? -31.637 80.158  -6.856  1.00 25.14  ? 129  ILE B CA    1 
ATOM   5981  C C     . ILE B 1 129 ? -32.245 81.514  -6.488  1.00 25.18  ? 129  ILE B C     1 
ATOM   5982  O O     . ILE B 1 129 ? -31.553 82.539  -6.495  1.00 24.91  ? 129  ILE B O     1 
ATOM   5983  C CB    . ILE B 1 129 ? -30.761 79.621  -5.666  1.00 25.00  ? 129  ILE B CB    1 
ATOM   5984  C CG1   . ILE B 1 129 ? -29.935 78.400  -6.069  1.00 24.77  ? 129  ILE B CG1   1 
ATOM   5985  C CG2   . ILE B 1 129 ? -31.648 79.236  -4.472  1.00 25.39  ? 129  ILE B CG2   1 
ATOM   5986  C CD1   . ILE B 1 129 ? -30.758 77.164  -6.411  1.00 24.94  ? 129  ILE B CD1   1 
ATOM   5987  N N     . LYS B 1 130 ? -33.541 81.499  -6.183  1.00 25.19  ? 130  LYS B N     1 
ATOM   5988  C CA    . LYS B 1 130 ? -34.262 82.696  -5.767  1.00 25.41  ? 130  LYS B CA    1 
ATOM   5989  C C     . LYS B 1 130 ? -34.868 82.526  -4.360  1.00 25.48  ? 130  LYS B C     1 
ATOM   5990  O O     . LYS B 1 130 ? -34.925 81.418  -3.821  1.00 25.97  ? 130  LYS B O     1 
ATOM   5991  C CB    . LYS B 1 130 ? -35.354 83.032  -6.787  1.00 25.30  ? 130  LYS B CB    1 
ATOM   5992  N N     . LYS B 1 131 ? -35.312 83.636  -3.782  1.00 25.49  ? 131  LYS B N     1 
ATOM   5993  C CA    . LYS B 1 131 ? -36.079 83.644  -2.539  1.00 25.61  ? 131  LYS B CA    1 
ATOM   5994  C C     . LYS B 1 131 ? -37.161 82.585  -2.624  1.00 25.32  ? 131  LYS B C     1 
ATOM   5995  O O     . LYS B 1 131 ? -37.834 82.464  -3.654  1.00 25.16  ? 131  LYS B O     1 
ATOM   5996  C CB    . LYS B 1 131 ? -36.716 85.023  -2.315  1.00 25.40  ? 131  LYS B CB    1 
ATOM   5997  C CG    . LYS B 1 131 ? -37.420 85.201  -0.970  1.00 26.12  ? 131  LYS B CG    1 
ATOM   5998  C CD    . LYS B 1 131 ? -37.798 86.665  -0.766  1.00 26.53  ? 131  LYS B CD    1 
ATOM   5999  C CE    . LYS B 1 131 ? -38.821 86.866  0.341   1.00 26.41  ? 131  LYS B CE    1 
ATOM   6000  N NZ    . LYS B 1 131 ? -39.376 88.255  0.256   1.00 27.00  ? 131  LYS B NZ    1 
ATOM   6001  N N     . GLY B 1 132 ? -37.303 81.807  -1.553  1.00 24.73  ? 132  GLY B N     1 
ATOM   6002  C CA    . GLY B 1 132 ? -38.356 80.797  -1.461  1.00 24.12  ? 132  GLY B CA    1 
ATOM   6003  C C     . GLY B 1 132 ? -37.994 79.429  -2.013  1.00 23.37  ? 132  GLY B C     1 
ATOM   6004  O O     . GLY B 1 132 ? -38.684 78.456  -1.730  1.00 23.26  ? 132  GLY B O     1 
ATOM   6005  N N     . ASP B 1 133 ? -36.937 79.356  -2.821  1.00 22.80  ? 133  ASP B N     1 
ATOM   6006  C CA    . ASP B 1 133 ? -36.411 78.065  -3.290  1.00 22.23  ? 133  ASP B CA    1 
ATOM   6007  C C     . ASP B 1 133 ? -35.846 77.309  -2.097  1.00 21.89  ? 133  ASP B C     1 
ATOM   6008  O O     . ASP B 1 133 ? -35.199 77.908  -1.226  1.00 21.35  ? 133  ASP B O     1 
ATOM   6009  C CB    . ASP B 1 133 ? -35.279 78.260  -4.297  1.00 22.22  ? 133  ASP B CB    1 
ATOM   6010  C CG    . ASP B 1 133 ? -35.770 78.647  -5.687  1.00 23.15  ? 133  ASP B CG    1 
ATOM   6011  O OD1   . ASP B 1 133 ? -36.989 78.612  -5.968  1.00 22.61  ? 133  ASP B OD1   1 
ATOM   6012  O OD2   . ASP B 1 133 ? -34.904 78.975  -6.516  1.00 24.75  ? 133  ASP B OD2   1 
ATOM   6013  N N     . VAL B 1 134 ? -36.080 76.003  -2.061  1.00 21.21  ? 134  VAL B N     1 
ATOM   6014  C CA    . VAL B 1 134 ? -35.486 75.170  -1.022  1.00 21.60  ? 134  VAL B CA    1 
ATOM   6015  C C     . VAL B 1 134 ? -34.120 74.636  -1.478  1.00 21.24  ? 134  VAL B C     1 
ATOM   6016  O O     . VAL B 1 134 ? -33.951 74.159  -2.623  1.00 21.00  ? 134  VAL B O     1 
ATOM   6017  C CB    . VAL B 1 134 ? -36.428 74.018  -0.591  1.00 21.52  ? 134  VAL B CB    1 
ATOM   6018  C CG1   . VAL B 1 134 ? -35.789 73.168  0.500   1.00 23.07  ? 134  VAL B CG1   1 
ATOM   6019  C CG2   . VAL B 1 134 ? -37.763 74.578  -0.109  1.00 22.00  ? 134  VAL B CG2   1 
ATOM   6020  N N     . VAL B 1 135 ? -33.147 74.739  -0.577  1.00 20.41  ? 135  VAL B N     1 
ATOM   6021  C CA    . VAL B 1 135 ? -31.779 74.303  -0.845  1.00 19.62  ? 135  VAL B CA    1 
ATOM   6022  C C     . VAL B 1 135 ? -31.394 73.237  0.164   1.00 19.01  ? 135  VAL B C     1 
ATOM   6023  O O     . VAL B 1 135 ? -31.451 73.473  1.366   1.00 19.32  ? 135  VAL B O     1 
ATOM   6024  C CB    . VAL B 1 135 ? -30.784 75.490  -0.797  1.00 19.83  ? 135  VAL B CB    1 
ATOM   6025  C CG1   . VAL B 1 135 ? -29.342 74.999  -0.852  1.00 19.69  ? 135  VAL B CG1   1 
ATOM   6026  C CG2   . VAL B 1 135 ? -31.078 76.465  -1.947  1.00 19.58  ? 135  VAL B CG2   1 
ATOM   6027  N N     . ALA B 1 136 ? -31.020 72.064  -0.341  1.00 18.35  ? 136  ALA B N     1 
ATOM   6028  C CA    . ALA B 1 136 ? -30.651 70.922  0.491   1.00 17.71  ? 136  ALA B CA    1 
ATOM   6029  C C     . ALA B 1 136 ? -29.171 70.956  0.856   1.00 17.53  ? 136  ALA B C     1 
ATOM   6030  O O     . ALA B 1 136 ? -28.302 71.109  -0.012  1.00 16.83  ? 136  ALA B O     1 
ATOM   6031  C CB    . ALA B 1 136 ? -31.005 69.612  -0.214  1.00 17.25  ? 136  ALA B CB    1 
ATOM   6032  N N     . ILE B 1 137 ? -28.898 70.835  2.154   1.00 17.53  ? 137  ILE B N     1 
ATOM   6033  C CA    . ILE B 1 137 ? -27.535 70.918  2.672   1.00 17.53  ? 137  ILE B CA    1 
ATOM   6034  C C     . ILE B 1 137 ? -27.191 69.596  3.385   1.00 17.88  ? 137  ILE B C     1 
ATOM   6035  O O     . ILE B 1 137 ? -27.821 69.219  4.374   1.00 18.06  ? 137  ILE B O     1 
ATOM   6036  C CB    . ILE B 1 137 ? -27.313 72.202  3.559   1.00 17.71  ? 137  ILE B CB    1 
ATOM   6037  C CG1   . ILE B 1 137 ? -27.651 73.470  2.765   1.00 17.10  ? 137  ILE B CG1   1 
ATOM   6038  C CG2   . ILE B 1 137 ? -25.877 72.300  4.051   1.00 16.82  ? 137  ILE B CG2   1 
ATOM   6039  C CD1   . ILE B 1 137 ? -27.647 74.749  3.569   1.00 17.59  ? 137  ILE B CD1   1 
ATOM   6040  N N     . TYR B 1 138 ? -26.204 68.897  2.833   1.00 17.71  ? 138  TYR B N     1 
ATOM   6041  C CA    . TYR B 1 138 ? -25.801 67.578  3.270   1.00 17.70  ? 138  TYR B CA    1 
ATOM   6042  C C     . TYR B 1 138 ? -24.310 67.637  3.538   1.00 18.14  ? 138  TYR B C     1 
ATOM   6043  O O     . TYR B 1 138 ? -23.504 67.196  2.722   1.00 17.77  ? 138  TYR B O     1 
ATOM   6044  C CB    . TYR B 1 138 ? -26.124 66.563  2.167   1.00 17.37  ? 138  TYR B CB    1 
ATOM   6045  C CG    . TYR B 1 138 ? -25.944 65.106  2.528   1.00 17.13  ? 138  TYR B CG    1 
ATOM   6046  C CD1   . TYR B 1 138 ? -26.675 64.522  3.567   1.00 15.35  ? 138  TYR B CD1   1 
ATOM   6047  C CD2   . TYR B 1 138 ? -25.068 64.291  1.790   1.00 17.55  ? 138  TYR B CD2   1 
ATOM   6048  C CE1   . TYR B 1 138 ? -26.519 63.172  3.884   1.00 16.35  ? 138  TYR B CE1   1 
ATOM   6049  C CE2   . TYR B 1 138 ? -24.909 62.946  2.089   1.00 16.63  ? 138  TYR B CE2   1 
ATOM   6050  C CZ    . TYR B 1 138 ? -25.635 62.389  3.132   1.00 17.59  ? 138  TYR B CZ    1 
ATOM   6051  O OH    . TYR B 1 138 ? -25.478 61.055  3.419   1.00 17.32  ? 138  TYR B OH    1 
ATOM   6052  N N     . MET B 1 139 ? -23.956 68.189  4.696   1.00 18.92  ? 139  MET B N     1 
ATOM   6053  C CA    . MET B 1 139 ? -22.576 68.561  4.992   1.00 19.99  ? 139  MET B CA    1 
ATOM   6054  C C     . MET B 1 139 ? -22.020 67.966  6.294   1.00 20.02  ? 139  MET B C     1 
ATOM   6055  O O     . MET B 1 139 ? -22.777 67.617  7.210   1.00 19.66  ? 139  MET B O     1 
ATOM   6056  C CB    . MET B 1 139 ? -22.437 70.089  5.036   1.00 20.41  ? 139  MET B CB    1 
ATOM   6057  C CG    . MET B 1 139 ? -22.677 70.797  3.715   1.00 22.82  ? 139  MET B CG    1 
ATOM   6058  S SD    . MET B 1 139 ? -21.222 70.889  2.665   1.00 32.02  ? 139  MET B SD    1 
ATOM   6059  C CE    . MET B 1 139 ? -20.441 72.371  3.283   1.00 27.15  ? 139  MET B CE    1 
ATOM   6060  N N     . PRO B 1 140 ? -20.678 67.848  6.371   1.00 20.01  ? 140  PRO B N     1 
ATOM   6061  C CA    . PRO B 1 140 ? -20.045 67.478  7.625   1.00 19.62  ? 140  PRO B CA    1 
ATOM   6062  C C     . PRO B 1 140 ? -19.862 68.727  8.484   1.00 19.28  ? 140  PRO B C     1 
ATOM   6063  O O     . PRO B 1 140 ? -20.247 69.826  8.062   1.00 19.86  ? 140  PRO B O     1 
ATOM   6064  C CB    . PRO B 1 140 ? -18.700 66.899  7.173   1.00 19.54  ? 140  PRO B CB    1 
ATOM   6065  C CG    . PRO B 1 140 ? -18.369 67.600  5.923   1.00 19.89  ? 140  PRO B CG    1 
ATOM   6066  C CD    . PRO B 1 140 ? -19.685 68.053  5.291   1.00 19.94  ? 140  PRO B CD    1 
ATOM   6067  N N     . MET B 1 141 ? -19.290 68.554  9.673   1.00 19.00  ? 141  MET B N     1 
ATOM   6068  C CA    . MET B 1 141 ? -19.054 69.654  10.603  1.00 18.23  ? 141  MET B CA    1 
ATOM   6069  C C     . MET B 1 141 ? -17.814 70.464  10.238  1.00 18.18  ? 141  MET B C     1 
ATOM   6070  O O     . MET B 1 141 ? -16.767 70.378  10.899  1.00 17.61  ? 141  MET B O     1 
ATOM   6071  C CB    . MET B 1 141 ? -18.978 69.132  12.045  1.00 18.70  ? 141  MET B CB    1 
ATOM   6072  C CG    . MET B 1 141 ? -20.357 68.815  12.651  1.00 17.66  ? 141  MET B CG    1 
ATOM   6073  S SD    . MET B 1 141 ? -21.274 70.303  13.099  1.00 19.27  ? 141  MET B SD    1 
ATOM   6074  C CE    . MET B 1 141 ? -20.603 70.659  14.710  1.00 14.70  ? 141  MET B CE    1 
ATOM   6075  N N     . VAL B 1 142 ? -17.971 71.253  9.170   1.00 18.20  ? 142  VAL B N     1 
ATOM   6076  C CA    . VAL B 1 142 ? -16.959 72.167  8.646   1.00 17.53  ? 142  VAL B CA    1 
ATOM   6077  C C     . VAL B 1 142 ? -17.586 73.560  8.472   1.00 18.25  ? 142  VAL B C     1 
ATOM   6078  O O     . VAL B 1 142 ? -18.795 73.673  8.226   1.00 18.64  ? 142  VAL B O     1 
ATOM   6079  C CB    . VAL B 1 142 ? -16.344 71.654  7.321   1.00 17.46  ? 142  VAL B CB    1 
ATOM   6080  C CG1   . VAL B 1 142 ? -15.526 70.393  7.578   1.00 16.37  ? 142  VAL B CG1   1 
ATOM   6081  C CG2   . VAL B 1 142 ? -17.419 71.421  6.226   1.00 16.72  ? 142  VAL B CG2   1 
ATOM   6082  N N     . PRO B 1 143 ? -16.778 74.631  8.619   1.00 18.40  ? 143  PRO B N     1 
ATOM   6083  C CA    . PRO B 1 143 ? -17.309 75.996  8.607   1.00 18.50  ? 143  PRO B CA    1 
ATOM   6084  C C     . PRO B 1 143 ? -18.169 76.290  7.381   1.00 18.34  ? 143  PRO B C     1 
ATOM   6085  O O     . PRO B 1 143 ? -19.120 77.071  7.476   1.00 18.14  ? 143  PRO B O     1 
ATOM   6086  C CB    . PRO B 1 143 ? -16.047 76.860  8.569   1.00 18.84  ? 143  PRO B CB    1 
ATOM   6087  C CG    . PRO B 1 143 ? -14.991 76.006  9.186   1.00 18.76  ? 143  PRO B CG    1 
ATOM   6088  C CD    . PRO B 1 143 ? -15.312 74.611  8.786   1.00 18.29  ? 143  PRO B CD    1 
ATOM   6089  N N     . GLU B 1 144 ? -17.850 75.643  6.259   1.00 17.93  ? 144  GLU B N     1 
ATOM   6090  C CA    . GLU B 1 144 ? -18.571 75.848  5.004   1.00 17.87  ? 144  GLU B CA    1 
ATOM   6091  C C     . GLU B 1 144 ? -20.049 75.522  5.087   1.00 17.97  ? 144  GLU B C     1 
ATOM   6092  O O     . GLU B 1 144 ? -20.860 76.100  4.342   1.00 18.54  ? 144  GLU B O     1 
ATOM   6093  C CB    . GLU B 1 144 ? -17.921 75.069  3.858   1.00 18.18  ? 144  GLU B CB    1 
ATOM   6094  C CG    . GLU B 1 144 ? -16.548 75.601  3.445   1.00 17.83  ? 144  GLU B CG    1 
ATOM   6095  C CD    . GLU B 1 144 ? -15.419 75.020  4.287   1.00 18.63  ? 144  GLU B CD    1 
ATOM   6096  O OE1   . GLU B 1 144 ? -15.679 74.207  5.206   1.00 19.01  ? 144  GLU B OE1   1 
ATOM   6097  O OE2   . GLU B 1 144 ? -14.259 75.370  4.017   1.00 19.43  ? 144  GLU B OE2   1 
ATOM   6098  N N     . ALA B 1 145 ? -20.409 74.604  5.985   1.00 17.33  ? 145  ALA B N     1 
ATOM   6099  C CA    . ALA B 1 145 ? -21.820 74.327  6.246   1.00 17.35  ? 145  ALA B CA    1 
ATOM   6100  C C     . ALA B 1 145 ? -22.520 75.588  6.779   1.00 17.19  ? 145  ALA B C     1 
ATOM   6101  O O     . ALA B 1 145 ? -23.629 75.926  6.349   1.00 17.53  ? 145  ALA B O     1 
ATOM   6102  C CB    . ALA B 1 145 ? -21.975 73.158  7.204   1.00 17.19  ? 145  ALA B CB    1 
ATOM   6103  N N     . ALA B 1 146 ? -21.849 76.300  7.682   1.00 16.72  ? 146  ALA B N     1 
ATOM   6104  C CA    . ALA B 1 146 ? -22.361 77.567  8.189   1.00 16.46  ? 146  ALA B CA    1 
ATOM   6105  C C     . ALA B 1 146 ? -22.497 78.605  7.053   1.00 16.56  ? 146  ALA B C     1 
ATOM   6106  O O     . ALA B 1 146 ? -23.514 79.309  6.965   1.00 16.65  ? 146  ALA B O     1 
ATOM   6107  C CB    . ALA B 1 146 ? -21.473 78.082  9.305   1.00 16.01  ? 146  ALA B CB    1 
ATOM   6108  N N     . VAL B 1 147 ? -21.484 78.688  6.187   1.00 16.20  ? 147  VAL B N     1 
ATOM   6109  C CA    . VAL B 1 147 ? -21.505 79.623  5.048   1.00 16.30  ? 147  VAL B CA    1 
ATOM   6110  C C     . VAL B 1 147 ? -22.717 79.345  4.150   1.00 16.76  ? 147  VAL B C     1 
ATOM   6111  O O     . VAL B 1 147 ? -23.422 80.288  3.747   1.00 17.22  ? 147  VAL B O     1 
ATOM   6112  C CB    . VAL B 1 147 ? -20.212 79.533  4.193   1.00 16.10  ? 147  VAL B CB    1 
ATOM   6113  C CG1   . VAL B 1 147 ? -20.320 80.395  2.915   1.00 16.15  ? 147  VAL B CG1   1 
ATOM   6114  C CG2   . VAL B 1 147 ? -18.978 79.913  5.019   1.00 16.60  ? 147  VAL B CG2   1 
ATOM   6115  N N     . ALA B 1 148 ? -22.961 78.068  3.836   1.00 16.46  ? 148  ALA B N     1 
ATOM   6116  C CA    . ALA B 1 148 ? -24.080 77.706  2.960   1.00 16.83  ? 148  ALA B CA    1 
ATOM   6117  C C     . ALA B 1 148 ? -25.426 78.068  3.591   1.00 16.91  ? 148  ALA B C     1 
ATOM   6118  O O     . ALA B 1 148 ? -26.315 78.606  2.915   1.00 17.01  ? 148  ALA B O     1 
ATOM   6119  C CB    . ALA B 1 148 ? -24.027 76.216  2.552   1.00 16.08  ? 148  ALA B CB    1 
ATOM   6120  N N     . MET B 1 149 ? -25.549 77.811  4.891   1.00 17.27  ? 149  MET B N     1 
ATOM   6121  C CA    . MET B 1 149 ? -26.761 78.149  5.657   1.00 17.33  ? 149  MET B CA    1 
ATOM   6122  C C     . MET B 1 149 ? -27.023 79.656  5.722   1.00 17.19  ? 149  MET B C     1 
ATOM   6123  O O     . MET B 1 149 ? -28.128 80.126  5.414   1.00 17.23  ? 149  MET B O     1 
ATOM   6124  C CB    . MET B 1 149 ? -26.675 77.562  7.069   1.00 17.31  ? 149  MET B CB    1 
ATOM   6125  C CG    . MET B 1 149 ? -26.972 76.075  7.136   1.00 16.85  ? 149  MET B CG    1 
ATOM   6126  S SD    . MET B 1 149 ? -26.514 75.249  8.678   1.00 18.10  ? 149  MET B SD    1 
ATOM   6127  C CE    . MET B 1 149 ? -27.801 75.795  9.824   1.00 15.37  ? 149  MET B CE    1 
ATOM   6128  N N     . LEU B 1 150 ? -26.010 80.410  6.129   1.00 16.69  ? 150  LEU B N     1 
ATOM   6129  C CA    . LEU B 1 150 ? -26.137 81.860  6.205   1.00 17.12  ? 150  LEU B CA    1 
ATOM   6130  C C     . LEU B 1 150 ? -26.471 82.534  4.856   1.00 17.04  ? 150  LEU B C     1 
ATOM   6131  O O     . LEU B 1 150 ? -27.262 83.490  4.813   1.00 16.62  ? 150  LEU B O     1 
ATOM   6132  C CB    . LEU B 1 150 ? -24.880 82.466  6.819   1.00 17.10  ? 150  LEU B CB    1 
ATOM   6133  C CG    . LEU B 1 150 ? -24.640 82.139  8.296   1.00 17.84  ? 150  LEU B CG    1 
ATOM   6134  C CD1   . LEU B 1 150 ? -23.165 82.329  8.642   1.00 18.18  ? 150  LEU B CD1   1 
ATOM   6135  C CD2   . LEU B 1 150 ? -25.563 82.961  9.225   1.00 18.15  ? 150  LEU B CD2   1 
ATOM   6136  N N     . ALA B 1 151 ? -25.884 82.018  3.772   1.00 17.07  ? 151  ALA B N     1 
ATOM   6137  C CA    . ALA B 1 151 ? -26.101 82.545  2.408   1.00 17.23  ? 151  ALA B CA    1 
ATOM   6138  C C     . ALA B 1 151 ? -27.527 82.270  1.914   1.00 17.71  ? 151  ALA B C     1 
ATOM   6139  O O     . ALA B 1 151 ? -28.142 83.114  1.237   1.00 17.61  ? 151  ALA B O     1 
ATOM   6140  C CB    . ALA B 1 151 ? -25.091 81.953  1.443   1.00 16.68  ? 151  ALA B CB    1 
ATOM   6141  N N     . CYS B 1 152 ? -28.044 81.088  2.257   1.00 18.02  ? 152  CYS B N     1 
ATOM   6142  C CA    . CYS B 1 152 ? -29.436 80.754  1.985   1.00 18.77  ? 152  CYS B CA    1 
ATOM   6143  C C     . CYS B 1 152 ? -30.361 81.767  2.648   1.00 18.47  ? 152  CYS B C     1 
ATOM   6144  O O     . CYS B 1 152 ? -31.248 82.337  2.004   1.00 18.27  ? 152  CYS B O     1 
ATOM   6145  C CB    . CYS B 1 152 ? -29.748 79.349  2.483   1.00 19.11  ? 152  CYS B CB    1 
ATOM   6146  S SG    . CYS B 1 152 ? -29.047 78.072  1.452   1.00 20.39  ? 152  CYS B SG    1 
ATOM   6147  N N     . ALA B 1 153 ? -30.121 81.997  3.937   1.00 18.57  ? 153  ALA B N     1 
ATOM   6148  C CA    . ALA B 1 153 ? -30.896 82.940  4.722   1.00 18.61  ? 153  ALA B CA    1 
ATOM   6149  C C     . ALA B 1 153 ? -30.762 84.365  4.165   1.00 18.68  ? 153  ALA B C     1 
ATOM   6150  O O     . ALA B 1 153 ? -31.727 85.139  4.174   1.00 18.49  ? 153  ALA B O     1 
ATOM   6151  C CB    . ALA B 1 153 ? -30.462 82.879  6.189   1.00 18.52  ? 153  ALA B CB    1 
ATOM   6152  N N     . ARG B 1 154 ? -29.570 84.687  3.657   1.00 18.57  ? 154  ARG B N     1 
ATOM   6153  C CA    . ARG B 1 154 ? -29.266 86.041  3.211   1.00 18.52  ? 154  ARG B CA    1 
ATOM   6154  C C     . ARG B 1 154 ? -30.156 86.480  2.049   1.00 18.37  ? 154  ARG B C     1 
ATOM   6155  O O     . ARG B 1 154 ? -30.693 87.590  2.065   1.00 18.56  ? 154  ARG B O     1 
ATOM   6156  C CB    . ARG B 1 154 ? -27.798 86.177  2.841   1.00 18.14  ? 154  ARG B CB    1 
ATOM   6157  C CG    . ARG B 1 154 ? -27.350 87.622  2.787   1.00 18.64  ? 154  ARG B CG    1 
ATOM   6158  C CD    . ARG B 1 154 ? -25.857 87.741  2.536   1.00 17.52  ? 154  ARG B CD    1 
ATOM   6159  N NE    . ARG B 1 154 ? -25.478 89.135  2.412   1.00 17.59  ? 154  ARG B NE    1 
ATOM   6160  C CZ    . ARG B 1 154 ? -25.052 89.893  3.422   1.00 17.11  ? 154  ARG B CZ    1 
ATOM   6161  N NH1   . ARG B 1 154 ? -24.920 89.391  4.640   1.00 14.33  ? 154  ARG B NH1   1 
ATOM   6162  N NH2   . ARG B 1 154 ? -24.745 91.157  3.199   1.00 16.66  ? 154  ARG B NH2   1 
ATOM   6163  N N     . ILE B 1 155 ? -30.315 85.595  1.064   1.00 17.76  ? 155  ILE B N     1 
ATOM   6164  C CA    . ILE B 1 155 ? -31.166 85.846  -0.097  1.00 17.23  ? 155  ILE B CA    1 
ATOM   6165  C C     . ILE B 1 155 ? -32.620 85.396  0.108   1.00 17.29  ? 155  ILE B C     1 
ATOM   6166  O O     . ILE B 1 155 ? -33.480 85.664  -0.733  1.00 17.53  ? 155  ILE B O     1 
ATOM   6167  C CB    . ILE B 1 155 ? -30.597 85.172  -1.385  1.00 17.52  ? 155  ILE B CB    1 
ATOM   6168  C CG1   . ILE B 1 155 ? -30.655 83.640  -1.271  1.00 16.26  ? 155  ILE B CG1   1 
ATOM   6169  C CG2   . ILE B 1 155 ? -29.170 85.689  -1.693  1.00 16.31  ? 155  ILE B CG2   1 
ATOM   6170  C CD1   . ILE B 1 155 ? -30.367 82.909  -2.588  1.00 16.29  ? 155  ILE B CD1   1 
ATOM   6171  N N     . GLY B 1 156 ? -32.894 84.712  1.216   1.00 16.89  ? 156  GLY B N     1 
ATOM   6172  C CA    . GLY B 1 156 ? -34.248 84.273  1.503   1.00 16.35  ? 156  GLY B CA    1 
ATOM   6173  C C     . GLY B 1 156 ? -34.583 82.948  0.854   1.00 16.34  ? 156  GLY B C     1 
ATOM   6174  O O     . GLY B 1 156 ? -35.751 82.642  0.641   1.00 16.69  ? 156  GLY B O     1 
ATOM   6175  N N     . ALA B 1 157 ? -33.558 82.169  0.514   1.00 16.24  ? 157  ALA B N     1 
ATOM   6176  C CA    . ALA B 1 157 ? -33.743 80.761  0.148   1.00 16.27  ? 157  ALA B CA    1 
ATOM   6177  C C     . ALA B 1 157 ? -34.034 80.006  1.442   1.00 16.39  ? 157  ALA B C     1 
ATOM   6178  O O     . ALA B 1 157 ? -33.718 80.490  2.535   1.00 16.41  ? 157  ALA B O     1 
ATOM   6179  C CB    . ALA B 1 157 ? -32.499 80.199  -0.515  1.00 16.01  ? 157  ALA B CB    1 
ATOM   6180  N N     . VAL B 1 158 ? -34.646 78.833  1.330   1.00 16.35  ? 158  VAL B N     1 
ATOM   6181  C CA    . VAL B 1 158 ? -35.036 78.087  2.511   1.00 16.30  ? 158  VAL B CA    1 
ATOM   6182  C C     . VAL B 1 158 ? -34.179 76.826  2.584   1.00 16.42  ? 158  VAL B C     1 
ATOM   6183  O O     . VAL B 1 158 ? -34.415 75.856  1.853   1.00 17.07  ? 158  VAL B O     1 
ATOM   6184  C CB    . VAL B 1 158 ? -36.558 77.793  2.502   1.00 16.53  ? 158  VAL B CB    1 
ATOM   6185  C CG1   . VAL B 1 158 ? -36.978 76.999  3.745   1.00 15.02  ? 158  VAL B CG1   1 
ATOM   6186  C CG2   . VAL B 1 158 ? -37.333 79.088  2.423   1.00 16.12  ? 158  VAL B CG2   1 
ATOM   6187  N N     . HIS B 1 159 ? -33.156 76.858  3.434   1.00 16.57  ? 159  HIS B N     1 
ATOM   6188  C CA    . HIS B 1 159 ? -32.280 75.701  3.572   1.00 16.58  ? 159  HIS B CA    1 
ATOM   6189  C C     . HIS B 1 159 ? -32.968 74.556  4.279   1.00 16.89  ? 159  HIS B C     1 
ATOM   6190  O O     . HIS B 1 159 ? -33.816 74.767  5.145   1.00 16.94  ? 159  HIS B O     1 
ATOM   6191  C CB    . HIS B 1 159 ? -30.906 76.017  4.182   1.00 16.79  ? 159  HIS B CB    1 
ATOM   6192  C CG    . HIS B 1 159 ? -30.920 76.444  5.628   1.00 17.06  ? 159  HIS B CG    1 
ATOM   6193  N ND1   . HIS B 1 159 ? -31.270 75.599  6.661   1.00 17.38  ? 159  HIS B ND1   1 
ATOM   6194  C CD2   . HIS B 1 159 ? -30.535 77.606  6.213   1.00 16.57  ? 159  HIS B CD2   1 
ATOM   6195  C CE1   . HIS B 1 159 ? -31.129 76.231  7.815   1.00 18.23  ? 159  HIS B CE1   1 
ATOM   6196  N NE2   . HIS B 1 159 ? -30.701 77.457  7.571   1.00 16.28  ? 159  HIS B NE2   1 
ATOM   6197  N N     . SER B 1 160 ? -32.632 73.349  3.836   1.00 16.57  ? 160  SER B N     1 
ATOM   6198  C CA    . SER B 1 160 ? -33.097 72.133  4.441   1.00 16.88  ? 160  SER B CA    1 
ATOM   6199  C C     . SER B 1 160 ? -31.848 71.277  4.720   1.00 16.75  ? 160  SER B C     1 
ATOM   6200  O O     . SER B 1 160 ? -31.328 70.583  3.834   1.00 16.70  ? 160  SER B O     1 
ATOM   6201  C CB    . SER B 1 160 ? -34.097 71.443  3.514   1.00 16.75  ? 160  SER B CB    1 
ATOM   6202  O OG    . SER B 1 160 ? -34.685 70.325  4.143   1.00 18.92  ? 160  SER B OG    1 
ATOM   6203  N N     . VAL B 1 161 ? -31.337 71.389  5.943   1.00 16.54  ? 161  VAL B N     1 
ATOM   6204  C CA    . VAL B 1 161 ? -30.118 70.693  6.329   1.00 16.89  ? 161  VAL B CA    1 
ATOM   6205  C C     . VAL B 1 161 ? -30.423 69.225  6.621   1.00 17.00  ? 161  VAL B C     1 
ATOM   6206  O O     . VAL B 1 161 ? -31.286 68.905  7.443   1.00 16.68  ? 161  VAL B O     1 
ATOM   6207  C CB    . VAL B 1 161 ? -29.383 71.391  7.519   1.00 16.88  ? 161  VAL B CB    1 
ATOM   6208  C CG1   . VAL B 1 161 ? -28.117 70.629  7.916   1.00 15.89  ? 161  VAL B CG1   1 
ATOM   6209  C CG2   . VAL B 1 161 ? -29.010 72.824  7.130   1.00 16.75  ? 161  VAL B CG2   1 
ATOM   6210  N N     . ILE B 1 162 ? -29.730 68.346  5.903   1.00 17.08  ? 162  ILE B N     1 
ATOM   6211  C CA    . ILE B 1 162 ? -29.831 66.904  6.116   1.00 17.10  ? 162  ILE B CA    1 
ATOM   6212  C C     . ILE B 1 162 ? -28.590 66.390  6.856   1.00 17.41  ? 162  ILE B C     1 
ATOM   6213  O O     . ILE B 1 162 ? -27.475 66.407  6.302   1.00 17.50  ? 162  ILE B O     1 
ATOM   6214  C CB    . ILE B 1 162 ? -29.980 66.144  4.767   1.00 17.23  ? 162  ILE B CB    1 
ATOM   6215  C CG1   . ILE B 1 162 ? -31.143 66.725  3.951   1.00 17.62  ? 162  ILE B CG1   1 
ATOM   6216  C CG2   . ILE B 1 162 ? -30.153 64.644  5.009   1.00 15.03  ? 162  ILE B CG2   1 
ATOM   6217  C CD1   . ILE B 1 162 ? -31.063 66.455  2.465   1.00 19.08  ? 162  ILE B CD1   1 
ATOM   6218  N N     . PHE B 1 163 ? -28.788 65.928  8.092   1.00 17.02  ? 163  PHE B N     1 
ATOM   6219  C CA    . PHE B 1 163 ? -27.749 65.233  8.858   1.00 17.04  ? 163  PHE B CA    1 
ATOM   6220  C C     . PHE B 1 163 ? -26.955 64.311  7.933   1.00 17.21  ? 163  PHE B C     1 
ATOM   6221  O O     . PHE B 1 163 ? -27.530 63.486  7.210   1.00 17.20  ? 163  PHE B O     1 
ATOM   6222  C CB    . PHE B 1 163 ? -28.398 64.433  10.008  1.00 17.15  ? 163  PHE B CB    1 
ATOM   6223  C CG    . PHE B 1 163 ? -27.429 63.623  10.850  1.00 16.98  ? 163  PHE B CG    1 
ATOM   6224  C CD1   . PHE B 1 163 ? -26.385 64.232  11.538  1.00 18.13  ? 163  PHE B CD1   1 
ATOM   6225  C CD2   . PHE B 1 163 ? -27.611 62.240  11.005  1.00 18.12  ? 163  PHE B CD2   1 
ATOM   6226  C CE1   . PHE B 1 163 ? -25.506 63.469  12.341  1.00 18.26  ? 163  PHE B CE1   1 
ATOM   6227  C CE2   . PHE B 1 163 ? -26.751 61.468  11.820  1.00 17.00  ? 163  PHE B CE2   1 
ATOM   6228  C CZ    . PHE B 1 163 ? -25.699 62.084  12.479  1.00 18.15  ? 163  PHE B CZ    1 
ATOM   6229  N N     . GLY B 1 164 ? -25.637 64.462  7.962   1.00 17.37  ? 164  GLY B N     1 
ATOM   6230  C CA    . GLY B 1 164 ? -24.738 63.674  7.122   1.00 17.75  ? 164  GLY B CA    1 
ATOM   6231  C C     . GLY B 1 164 ? -24.680 62.188  7.429   1.00 17.89  ? 164  GLY B C     1 
ATOM   6232  O O     . GLY B 1 164 ? -24.015 61.451  6.726   1.00 18.25  ? 164  GLY B O     1 
ATOM   6233  N N     . GLY B 1 165 ? -25.367 61.742  8.476   1.00 18.14  ? 165  GLY B N     1 
ATOM   6234  C CA    . GLY B 1 165 ? -25.440 60.315  8.793   1.00 18.05  ? 165  GLY B CA    1 
ATOM   6235  C C     . GLY B 1 165 ? -26.616 59.601  8.142   1.00 18.16  ? 165  GLY B C     1 
ATOM   6236  O O     . GLY B 1 165 ? -26.789 58.388  8.302   1.00 18.13  ? 165  GLY B O     1 
ATOM   6237  N N     . PHE B 1 166 ? -27.428 60.360  7.412   1.00 17.64  ? 166  PHE B N     1 
ATOM   6238  C CA    . PHE B 1 166 ? -28.543 59.805  6.672   1.00 17.33  ? 166  PHE B CA    1 
ATOM   6239  C C     . PHE B 1 166 ? -28.083 59.131  5.390   1.00 17.27  ? 166  PHE B C     1 
ATOM   6240  O O     . PHE B 1 166 ? -27.122 59.551  4.750   1.00 16.78  ? 166  PHE B O     1 
ATOM   6241  C CB    . PHE B 1 166 ? -29.595 60.885  6.384   1.00 17.05  ? 166  PHE B CB    1 
ATOM   6242  C CG    . PHE B 1 166 ? -30.529 61.125  7.536   1.00 17.44  ? 166  PHE B CG    1 
ATOM   6243  C CD1   . PHE B 1 166 ? -31.278 60.070  8.070   1.00 17.06  ? 166  PHE B CD1   1 
ATOM   6244  C CD2   . PHE B 1 166 ? -30.655 62.387  8.096   1.00 15.39  ? 166  PHE B CD2   1 
ATOM   6245  C CE1   . PHE B 1 166 ? -32.147 60.268  9.135   1.00 16.57  ? 166  PHE B CE1   1 
ATOM   6246  C CE2   . PHE B 1 166 ? -31.521 62.601  9.164   1.00 17.05  ? 166  PHE B CE2   1 
ATOM   6247  C CZ    . PHE B 1 166 ? -32.268 61.545  9.688   1.00 18.12  ? 166  PHE B CZ    1 
ATOM   6248  N N     . SER B 1 167 ? -28.795 58.075  5.043   1.00 17.40  ? 167  SER B N     1 
ATOM   6249  C CA    . SER B 1 167 ? -28.513 57.264  3.884   1.00 17.43  ? 167  SER B CA    1 
ATOM   6250  C C     . SER B 1 167 ? -29.029 57.919  2.586   1.00 17.12  ? 167  SER B C     1 
ATOM   6251  O O     . SER B 1 167 ? -29.902 58.786  2.633   1.00 17.06  ? 167  SER B O     1 
ATOM   6252  C CB    . SER B 1 167 ? -29.203 55.909  4.080   1.00 17.99  ? 167  SER B CB    1 
ATOM   6253  O OG    . SER B 1 167 ? -30.604 56.011  3.801   1.00 19.32  ? 167  SER B OG    1 
ATOM   6254  N N     . PRO B 1 168 ? -28.491 57.496  1.425   1.00 16.97  ? 168  PRO B N     1 
ATOM   6255  C CA    . PRO B 1 168 ? -28.974 57.993  0.134   1.00 17.01  ? 168  PRO B CA    1 
ATOM   6256  C C     . PRO B 1 168 ? -30.495 57.960  0.004   1.00 17.42  ? 168  PRO B C     1 
ATOM   6257  O O     . PRO B 1 168 ? -31.082 58.894  -0.538  1.00 17.47  ? 168  PRO B O     1 
ATOM   6258  C CB    . PRO B 1 168 ? -28.342 57.024  -0.871  1.00 16.80  ? 168  PRO B CB    1 
ATOM   6259  C CG    . PRO B 1 168 ? -27.044 56.597  -0.191  1.00 16.51  ? 168  PRO B CG    1 
ATOM   6260  C CD    . PRO B 1 168 ? -27.362 56.546  1.275   1.00 16.47  ? 168  PRO B CD    1 
ATOM   6261  N N     . GLU B 1 169 ? -31.122 56.883  0.480   1.00 17.56  ? 169  GLU B N     1 
ATOM   6262  C CA    . GLU B 1 169 ? -32.566 56.745  0.401   1.00 18.20  ? 169  GLU B CA    1 
ATOM   6263  C C     . GLU B 1 169 ? -33.263 57.859  1.183   1.00 18.05  ? 169  GLU B C     1 
ATOM   6264  O O     . GLU B 1 169 ? -34.272 58.400  0.718   1.00 18.10  ? 169  GLU B O     1 
ATOM   6265  C CB    . GLU B 1 169 ? -33.013 55.367  0.909   1.00 18.37  ? 169  GLU B CB    1 
ATOM   6266  C CG    . GLU B 1 169 ? -34.528 55.182  0.984   1.00 20.66  ? 169  GLU B CG    1 
ATOM   6267  C CD    . GLU B 1 169 ? -35.210 55.141  -0.395  1.00 25.12  ? 169  GLU B CD    1 
ATOM   6268  O OE1   . GLU B 1 169 ? -34.559 54.779  -1.415  1.00 25.43  ? 169  GLU B OE1   1 
ATOM   6269  O OE2   . GLU B 1 169 ? -36.414 55.477  -0.448  1.00 27.17  ? 169  GLU B OE2   1 
ATOM   6270  N N     . ALA B 1 170 ? -32.717 58.187  2.358   1.00 17.48  ? 170  ALA B N     1 
ATOM   6271  C CA    . ALA B 1 170 ? -33.266 59.219  3.240   1.00 17.80  ? 170  ALA B CA    1 
ATOM   6272  C C     . ALA B 1 170 ? -33.038 60.651  2.704   1.00 18.01  ? 170  ALA B C     1 
ATOM   6273  O O     . ALA B 1 170 ? -33.912 61.519  2.809   1.00 17.14  ? 170  ALA B O     1 
ATOM   6274  C CB    . ALA B 1 170 ? -32.695 59.064  4.662   1.00 17.56  ? 170  ALA B CB    1 
ATOM   6275  N N     . VAL B 1 171 ? -31.857 60.868  2.129   1.00 18.14  ? 171  VAL B N     1 
ATOM   6276  C CA    . VAL B 1 171 ? -31.491 62.123  1.460   1.00 17.69  ? 171  VAL B CA    1 
ATOM   6277  C C     . VAL B 1 171 ? -32.461 62.412  0.294   1.00 18.12  ? 171  VAL B C     1 
ATOM   6278  O O     . VAL B 1 171 ? -33.018 63.519  0.191   1.00 18.12  ? 171  VAL B O     1 
ATOM   6279  C CB    . VAL B 1 171 ? -30.028 62.032  0.972   1.00 17.45  ? 171  VAL B CB    1 
ATOM   6280  C CG1   . VAL B 1 171 ? -29.671 63.172  0.031   1.00 18.03  ? 171  VAL B CG1   1 
ATOM   6281  C CG2   . VAL B 1 171 ? -29.099 62.020  2.170   1.00 17.47  ? 171  VAL B CG2   1 
ATOM   6282  N N     . ALA B 1 172 ? -32.668 61.392  -0.541  1.00 17.53  ? 172  ALA B N     1 
ATOM   6283  C CA    . ALA B 1 172 ? -33.622 61.391  -1.641  1.00 18.24  ? 172  ALA B CA    1 
ATOM   6284  C C     . ALA B 1 172 ? -35.066 61.730  -1.216  1.00 18.55  ? 172  ALA B C     1 
ATOM   6285  O O     . ALA B 1 172 ? -35.726 62.584  -1.825  1.00 18.53  ? 172  ALA B O     1 
ATOM   6286  C CB    . ALA B 1 172 ? -33.583 60.017  -2.341  1.00 17.58  ? 172  ALA B CB    1 
ATOM   6287  N N     . GLY B 1 173 ? -35.542 61.054  -0.170  1.00 19.15  ? 173  GLY B N     1 
ATOM   6288  C CA    . GLY B 1 173 ? -36.880 61.276  0.367   1.00 19.26  ? 173  GLY B CA    1 
ATOM   6289  C C     . GLY B 1 173 ? -37.092 62.713  0.782   1.00 19.45  ? 173  GLY B C     1 
ATOM   6290  O O     . GLY B 1 173 ? -38.156 63.292  0.527   1.00 19.35  ? 173  GLY B O     1 
ATOM   6291  N N     . ARG B 1 174 ? -36.069 63.290  1.413   1.00 19.76  ? 174  ARG B N     1 
ATOM   6292  C CA    . ARG B 1 174 ? -36.094 64.688  1.838   1.00 19.77  ? 174  ARG B CA    1 
ATOM   6293  C C     . ARG B 1 174 ? -36.000 65.661  0.674   1.00 20.06  ? 174  ARG B C     1 
ATOM   6294  O O     . ARG B 1 174 ? -36.635 66.712  0.701   1.00 20.58  ? 174  ARG B O     1 
ATOM   6295  C CB    . ARG B 1 174 ? -34.993 64.977  2.862   1.00 19.30  ? 174  ARG B CB    1 
ATOM   6296  C CG    . ARG B 1 174 ? -35.335 64.510  4.261   1.00 19.39  ? 174  ARG B CG    1 
ATOM   6297  C CD    . ARG B 1 174 ? -34.083 64.272  5.091   1.00 19.76  ? 174  ARG B CD    1 
ATOM   6298  N NE    . ARG B 1 174 ? -34.398 63.829  6.448   1.00 18.81  ? 174  ARG B NE    1 
ATOM   6299  C CZ    . ARG B 1 174 ? -34.727 62.583  6.780   1.00 21.49  ? 174  ARG B CZ    1 
ATOM   6300  N NH1   . ARG B 1 174 ? -34.792 61.627  5.859   1.00 19.22  ? 174  ARG B NH1   1 
ATOM   6301  N NH2   . ARG B 1 174 ? -34.995 62.288  8.049   1.00 23.21  ? 174  ARG B NH2   1 
ATOM   6302  N N     . ILE B 1 175 ? -35.198 65.338  -0.336  1.00 20.48  ? 175  ILE B N     1 
ATOM   6303  C CA    . ILE B 1 175 ? -35.157 66.175  -1.544  1.00 20.88  ? 175  ILE B CA    1 
ATOM   6304  C C     . ILE B 1 175 ? -36.496 66.133  -2.306  1.00 21.56  ? 175  ILE B C     1 
ATOM   6305  O O     . ILE B 1 175 ? -36.977 67.165  -2.791  1.00 22.09  ? 175  ILE B O     1 
ATOM   6306  C CB    . ILE B 1 175 ? -33.970 65.793  -2.489  1.00 21.14  ? 175  ILE B CB    1 
ATOM   6307  C CG1   . ILE B 1 175 ? -32.623 66.222  -1.860  1.00 20.75  ? 175  ILE B CG1   1 
ATOM   6308  C CG2   . ILE B 1 175 ? -34.178 66.413  -3.901  1.00 19.57  ? 175  ILE B CG2   1 
ATOM   6309  C CD1   . ILE B 1 175 ? -31.396 65.445  -2.376  1.00 20.39  ? 175  ILE B CD1   1 
ATOM   6310  N N     . ILE B 1 176 ? -37.100 64.949  -2.405  1.00 21.84  ? 176  ILE B N     1 
ATOM   6311  C CA    . ILE B 1 176 ? -38.374 64.813  -3.117  1.00 22.49  ? 176  ILE B CA    1 
ATOM   6312  C C     . ILE B 1 176 ? -39.520 65.565  -2.419  1.00 22.80  ? 176  ILE B C     1 
ATOM   6313  O O     . ILE B 1 176 ? -40.381 66.138  -3.085  1.00 22.87  ? 176  ILE B O     1 
ATOM   6314  C CB    . ILE B 1 176 ? -38.756 63.318  -3.348  1.00 22.67  ? 176  ILE B CB    1 
ATOM   6315  C CG1   . ILE B 1 176 ? -37.818 62.679  -4.381  1.00 21.73  ? 176  ILE B CG1   1 
ATOM   6316  C CG2   . ILE B 1 176 ? -40.226 63.179  -3.808  1.00 22.73  ? 176  ILE B CG2   1 
ATOM   6317  C CD1   . ILE B 1 176 ? -37.637 61.171  -4.209  1.00 21.59  ? 176  ILE B CD1   1 
ATOM   6318  N N     . ASP B 1 177 ? -39.530 65.565  -1.087  1.00 23.31  ? 177  ASP B N     1 
ATOM   6319  C CA    . ASP B 1 177 ? -40.621 66.199  -0.355  1.00 23.70  ? 177  ASP B CA    1 
ATOM   6320  C C     . ASP B 1 177 ? -40.518 67.720  -0.425  1.00 23.85  ? 177  ASP B C     1 
ATOM   6321  O O     . ASP B 1 177 ? -41.528 68.419  -0.545  1.00 23.29  ? 177  ASP B O     1 
ATOM   6322  C CB    . ASP B 1 177 ? -40.687 65.723  1.098   1.00 23.47  ? 177  ASP B CB    1 
ATOM   6323  C CG    . ASP B 1 177 ? -41.831 66.384  1.877   1.00 24.91  ? 177  ASP B CG    1 
ATOM   6324  O OD1   . ASP B 1 177 ? -41.570 67.348  2.636   1.00 21.72  ? 177  ASP B OD1   1 
ATOM   6325  O OD2   . ASP B 1 177 ? -43.002 65.952  1.699   1.00 26.25  ? 177  ASP B OD2   1 
ATOM   6326  N N     . SER B 1 178 ? -39.288 68.216  -0.360  1.00 24.19  ? 178  SER B N     1 
ATOM   6327  C CA    . SER B 1 178 ? -39.031 69.651  -0.327  1.00 24.73  ? 178  SER B CA    1 
ATOM   6328  C C     . SER B 1 178 ? -38.794 70.260  -1.722  1.00 24.74  ? 178  SER B C     1 
ATOM   6329  O O     . SER B 1 178 ? -38.553 71.471  -1.841  1.00 25.23  ? 178  SER B O     1 
ATOM   6330  C CB    . SER B 1 178 ? -37.811 69.911  0.546   1.00 24.63  ? 178  SER B CB    1 
ATOM   6331  O OG    . SER B 1 178 ? -36.658 69.357  -0.083  1.00 25.93  ? 178  SER B OG    1 
ATOM   6332  N N     . SER B 1 179 ? -38.842 69.431  -2.771  1.00 24.72  ? 179  SER B N     1 
ATOM   6333  C CA    . SER B 1 179 ? -38.532 69.886  -4.137  1.00 24.68  ? 179  SER B CA    1 
ATOM   6334  C C     . SER B 1 179 ? -37.239 70.718  -4.212  1.00 24.60  ? 179  SER B C     1 
ATOM   6335  O O     . SER B 1 179 ? -37.182 71.726  -4.928  1.00 24.80  ? 179  SER B O     1 
ATOM   6336  C CB    . SER B 1 179 ? -39.714 70.672  -4.746  1.00 24.77  ? 179  SER B CB    1 
ATOM   6337  O OG    . SER B 1 179 ? -40.687 69.813  -5.317  1.00 25.33  ? 179  SER B OG    1 
ATOM   6338  N N     . SER B 1 180 ? -36.207 70.298  -3.480  1.00 24.36  ? 180  SER B N     1 
ATOM   6339  C CA    . SER B 1 180 ? -34.930 71.023  -3.457  1.00 24.43  ? 180  SER B CA    1 
ATOM   6340  C C     . SER B 1 180 ? -34.351 71.196  -4.863  1.00 24.53  ? 180  SER B C     1 
ATOM   6341  O O     . SER B 1 180 ? -34.248 70.231  -5.620  1.00 23.90  ? 180  SER B O     1 
ATOM   6342  C CB    . SER B 1 180 ? -33.917 70.325  -2.543  1.00 24.20  ? 180  SER B CB    1 
ATOM   6343  O OG    . SER B 1 180 ? -34.289 70.457  -1.180  1.00 24.40  ? 180  SER B OG    1 
ATOM   6344  N N     . ARG B 1 181 ? -34.003 72.435  -5.204  1.00 24.96  ? 181  ARG B N     1 
ATOM   6345  C CA    . ARG B 1 181 ? -33.456 72.769  -6.527  1.00 25.34  ? 181  ARG B CA    1 
ATOM   6346  C C     . ARG B 1 181 ? -31.950 72.527  -6.587  1.00 24.79  ? 181  ARG B C     1 
ATOM   6347  O O     . ARG B 1 181 ? -31.357 72.404  -7.666  1.00 24.70  ? 181  ARG B O     1 
ATOM   6348  C CB    . ARG B 1 181 ? -33.708 74.245  -6.852  1.00 25.86  ? 181  ARG B CB    1 
ATOM   6349  C CG    . ARG B 1 181 ? -35.161 74.639  -7.010  1.00 27.82  ? 181  ARG B CG    1 
ATOM   6350  C CD    . ARG B 1 181 ? -35.249 76.028  -7.620  1.00 31.36  ? 181  ARG B CD    1 
ATOM   6351  N NE    . ARG B 1 181 ? -34.621 76.105  -8.943  1.00 34.07  ? 181  ARG B NE    1 
ATOM   6352  C CZ    . ARG B 1 181 ? -34.243 77.231  -9.545  1.00 34.31  ? 181  ARG B CZ    1 
ATOM   6353  N NH1   . ARG B 1 181 ? -34.421 78.406  -8.954  1.00 34.25  ? 181  ARG B NH1   1 
ATOM   6354  N NH2   . ARG B 1 181 ? -33.682 77.178  -10.750 1.00 35.82  ? 181  ARG B NH2   1 
ATOM   6355  N N     . LEU B 1 182 ? -31.342 72.485  -5.406  1.00 23.76  ? 182  LEU B N     1 
ATOM   6356  C CA    . LEU B 1 182 ? -29.902 72.428  -5.276  1.00 22.45  ? 182  LEU B CA    1 
ATOM   6357  C C     . LEU B 1 182 ? -29.525 71.585  -4.058  1.00 21.80  ? 182  LEU B C     1 
ATOM   6358  O O     . LEU B 1 182 ? -30.188 71.651  -3.019  1.00 21.33  ? 182  LEU B O     1 
ATOM   6359  C CB    . LEU B 1 182 ? -29.340 73.854  -5.127  1.00 22.12  ? 182  LEU B CB    1 
ATOM   6360  C CG    . LEU B 1 182 ? -27.878 74.025  -4.704  1.00 21.61  ? 182  LEU B CG    1 
ATOM   6361  C CD1   . LEU B 1 182 ? -26.923 73.480  -5.764  1.00 21.33  ? 182  LEU B CD1   1 
ATOM   6362  C CD2   . LEU B 1 182 ? -27.572 75.481  -4.416  1.00 21.59  ? 182  LEU B CD2   1 
ATOM   6363  N N     . VAL B 1 183 ? -28.454 70.807  -4.210  1.00 20.87  ? 183  VAL B N     1 
ATOM   6364  C CA    . VAL B 1 183 ? -27.829 70.086  -3.099  1.00 20.35  ? 183  VAL B CA    1 
ATOM   6365  C C     . VAL B 1 183 ? -26.411 70.631  -2.865  1.00 20.14  ? 183  VAL B C     1 
ATOM   6366  O O     . VAL B 1 183 ? -25.642 70.801  -3.815  1.00 19.91  ? 183  VAL B O     1 
ATOM   6367  C CB    . VAL B 1 183 ? -27.822 68.552  -3.370  1.00 20.06  ? 183  VAL B CB    1 
ATOM   6368  C CG1   . VAL B 1 183 ? -27.067 67.797  -2.287  1.00 19.75  ? 183  VAL B CG1   1 
ATOM   6369  C CG2   . VAL B 1 183 ? -29.259 68.030  -3.488  1.00 18.00  ? 183  VAL B CG2   1 
ATOM   6370  N N     . ILE B 1 184 ? -26.079 70.926  -1.610  1.00 20.07  ? 184  ILE B N     1 
ATOM   6371  C CA    . ILE B 1 184 ? -24.708 71.338  -1.247  1.00 19.84  ? 184  ILE B CA    1 
ATOM   6372  C C     . ILE B 1 184 ? -24.067 70.292  -0.331  1.00 19.85  ? 184  ILE B C     1 
ATOM   6373  O O     . ILE B 1 184 ? -24.617 69.978  0.731   1.00 19.59  ? 184  ILE B O     1 
ATOM   6374  C CB    . ILE B 1 184 ? -24.670 72.716  -0.555  1.00 20.06  ? 184  ILE B CB    1 
ATOM   6375  C CG1   . ILE B 1 184 ? -25.305 73.797  -1.458  1.00 20.11  ? 184  ILE B CG1   1 
ATOM   6376  C CG2   . ILE B 1 184 ? -23.226 73.067  -0.140  1.00 18.93  ? 184  ILE B CG2   1 
ATOM   6377  C CD1   . ILE B 1 184 ? -25.747 75.056  -0.710  1.00 20.07  ? 184  ILE B CD1   1 
ATOM   6378  N N     . THR B 1 185 ? -22.923 69.748  -0.754  1.00 19.44  ? 185  THR B N     1 
ATOM   6379  C CA    . THR B 1 185 ? -22.273 68.673  -0.023  1.00 19.84  ? 185  THR B CA    1 
ATOM   6380  C C     . THR B 1 185 ? -20.738 68.791  -0.045  1.00 19.94  ? 185  THR B C     1 
ATOM   6381  O O     . THR B 1 185 ? -20.186 69.795  -0.512  1.00 19.88  ? 185  THR B O     1 
ATOM   6382  C CB    . THR B 1 185 ? -22.783 67.269  -0.506  1.00 20.25  ? 185  THR B CB    1 
ATOM   6383  O OG1   . THR B 1 185 ? -22.456 66.265  0.460   1.00 20.43  ? 185  THR B OG1   1 
ATOM   6384  C CG2   . THR B 1 185 ? -22.204 66.878  -1.881  1.00 20.56  ? 185  THR B CG2   1 
ATOM   6385  N N     . ALA B 1 186 ? -20.060 67.798  0.527   1.00 19.73  ? 186  ALA B N     1 
ATOM   6386  C CA    . ALA B 1 186 ? -18.605 67.689  0.424   1.00 19.75  ? 186  ALA B CA    1 
ATOM   6387  C C     . ALA B 1 186 ? -18.275 66.348  -0.202  1.00 19.64  ? 186  ALA B C     1 
ATOM   6388  O O     . ALA B 1 186 ? -19.113 65.434  -0.186  1.00 20.11  ? 186  ALA B O     1 
ATOM   6389  C CB    . ALA B 1 186 ? -17.941 67.825  1.802   1.00 19.26  ? 186  ALA B CB    1 
ATOM   6390  N N     . ASP B 1 187 ? -17.073 66.228  -0.773  1.00 19.62  ? 187  ASP B N     1 
ATOM   6391  C CA    . ASP B 1 187 ? -16.602 64.935  -1.266  1.00 19.20  ? 187  ASP B CA    1 
ATOM   6392  C C     . ASP B 1 187 ? -16.698 63.855  -0.168  1.00 19.28  ? 187  ASP B C     1 
ATOM   6393  O O     . ASP B 1 187 ? -17.295 62.799  -0.380  1.00 19.67  ? 187  ASP B O     1 
ATOM   6394  C CB    . ASP B 1 187 ? -15.193 65.019  -1.892  1.00 18.72  ? 187  ASP B CB    1 
ATOM   6395  C CG    . ASP B 1 187 ? -14.123 65.578  -0.938  1.00 18.31  ? 187  ASP B CG    1 
ATOM   6396  O OD1   . ASP B 1 187 ? -14.395 65.880  0.237   1.00 16.67  ? 187  ASP B OD1   1 
ATOM   6397  O OD2   . ASP B 1 187 ? -12.967 65.715  -1.386  1.00 19.19  ? 187  ASP B OD2   1 
ATOM   6398  N N     . GLU B 1 188 ? -16.137 64.142  1.001   1.00 19.31  ? 188  GLU B N     1 
ATOM   6399  C CA    . GLU B 1 188 ? -16.184 63.233  2.153   1.00 19.44  ? 188  GLU B CA    1 
ATOM   6400  C C     . GLU B 1 188 ? -16.248 64.010  3.455   1.00 19.66  ? 188  GLU B C     1 
ATOM   6401  O O     . GLU B 1 188 ? -15.797 65.157  3.518   1.00 18.77  ? 188  GLU B O     1 
ATOM   6402  C CB    . GLU B 1 188 ? -14.953 62.328  2.190   1.00 19.67  ? 188  GLU B CB    1 
ATOM   6403  C CG    . GLU B 1 188 ? -15.047 61.086  1.339   1.00 19.46  ? 188  GLU B CG    1 
ATOM   6404  C CD    . GLU B 1 188 ? -13.744 60.325  1.298   1.00 21.74  ? 188  GLU B CD    1 
ATOM   6405  O OE1   . GLU B 1 188 ? -12.723 60.865  1.776   1.00 24.71  ? 188  GLU B OE1   1 
ATOM   6406  O OE2   . GLU B 1 188 ? -13.718 59.190  0.768   1.00 23.88  ? 188  GLU B OE2   1 
ATOM   6407  N N     . GLY B 1 189 ? -16.830 63.376  4.479   1.00 20.38  ? 189  GLY B N     1 
ATOM   6408  C CA    . GLY B 1 189 ? -16.759 63.857  5.863   1.00 21.44  ? 189  GLY B CA    1 
ATOM   6409  C C     . GLY B 1 189 ? -15.628 63.135  6.578   1.00 22.18  ? 189  GLY B C     1 
ATOM   6410  O O     . GLY B 1 189 ? -15.196 62.085  6.136   1.00 22.24  ? 189  GLY B O     1 
ATOM   6411  N N     . VAL B 1 190 ? -15.135 63.709  7.672   1.00 23.48  ? 190  VAL B N     1 
ATOM   6412  C CA    . VAL B 1 190 ? -14.045 63.109  8.462   1.00 24.31  ? 190  VAL B CA    1 
ATOM   6413  C C     . VAL B 1 190 ? -14.486 63.005  9.924   1.00 25.09  ? 190  VAL B C     1 
ATOM   6414  O O     . VAL B 1 190 ? -14.786 64.015  10.552  1.00 25.30  ? 190  VAL B O     1 
ATOM   6415  C CB    . VAL B 1 190 ? -12.724 63.939  8.369   1.00 24.41  ? 190  VAL B CB    1 
ATOM   6416  C CG1   . VAL B 1 190 ? -11.622 63.301  9.207   1.00 23.44  ? 190  VAL B CG1   1 
ATOM   6417  C CG2   . VAL B 1 190 ? -12.263 64.088  6.918   1.00 23.91  ? 190  VAL B CG2   1 
ATOM   6418  N N     . ARG B 1 191 ? -14.538 61.781  10.450  1.00 26.00  ? 191  ARG B N     1 
ATOM   6419  C CA    . ARG B 1 191 ? -15.036 61.532  11.801  1.00 27.29  ? 191  ARG B CA    1 
ATOM   6420  C C     . ARG B 1 191 ? -14.299 60.350  12.411  1.00 27.09  ? 191  ARG B C     1 
ATOM   6421  O O     . ARG B 1 191 ? -14.214 59.289  11.801  1.00 26.60  ? 191  ARG B O     1 
ATOM   6422  C CB    . ARG B 1 191 ? -16.544 61.266  11.768  1.00 27.19  ? 191  ARG B CB    1 
ATOM   6423  C CG    . ARG B 1 191 ? -17.227 61.102  13.112  1.00 28.60  ? 191  ARG B CG    1 
ATOM   6424  C CD    . ARG B 1 191 ? -18.732 60.867  12.920  1.00 29.64  ? 191  ARG B CD    1 
ATOM   6425  N NE    . ARG B 1 191 ? -19.534 61.380  14.039  1.00 35.24  ? 191  ARG B NE    1 
ATOM   6426  C CZ    . ARG B 1 191 ? -19.960 60.649  15.067  1.00 36.49  ? 191  ARG B CZ    1 
ATOM   6427  N NH1   . ARG B 1 191 ? -19.653 59.356  15.139  1.00 38.14  ? 191  ARG B NH1   1 
ATOM   6428  N NH2   . ARG B 1 191 ? -20.681 61.212  16.034  1.00 36.81  ? 191  ARG B NH2   1 
ATOM   6429  N N     . ALA B 1 192 ? -13.756 60.558  13.614  1.00 27.66  ? 192  ALA B N     1 
ATOM   6430  C CA    . ALA B 1 192 ? -13.022 59.526  14.356  1.00 27.79  ? 192  ALA B CA    1 
ATOM   6431  C C     . ALA B 1 192 ? -12.014 58.752  13.498  1.00 28.00  ? 192  ALA B C     1 
ATOM   6432  O O     . ALA B 1 192 ? -11.916 57.524  13.570  1.00 28.08  ? 192  ALA B O     1 
ATOM   6433  C CB    . ALA B 1 192 ? -13.984 58.578  15.081  1.00 27.71  ? 192  ALA B CB    1 
ATOM   6434  N N     . GLY B 1 193 ? -11.264 59.497  12.688  1.00 28.27  ? 193  GLY B N     1 
ATOM   6435  C CA    . GLY B 1 193 ? -10.177 58.939  11.888  1.00 28.51  ? 193  GLY B CA    1 
ATOM   6436  C C     . GLY B 1 193 ? -10.618 58.219  10.628  1.00 28.97  ? 193  GLY B C     1 
ATOM   6437  O O     . GLY B 1 193 ? -9.807  57.537  9.997   1.00 28.48  ? 193  GLY B O     1 
ATOM   6438  N N     . ARG B 1 194 ? -11.889 58.396  10.253  1.00 29.46  ? 194  ARG B N     1 
ATOM   6439  C CA    . ARG B 1 194 ? -12.495 57.696  9.118   1.00 30.40  ? 194  ARG B CA    1 
ATOM   6440  C C     . ARG B 1 194 ? -13.337 58.641  8.266   1.00 30.73  ? 194  ARG B C     1 
ATOM   6441  O O     . ARG B 1 194 ? -13.785 59.693  8.749   1.00 30.98  ? 194  ARG B O     1 
ATOM   6442  C CB    . ARG B 1 194 ? -13.410 56.565  9.605   1.00 30.45  ? 194  ARG B CB    1 
ATOM   6443  C CG    . ARG B 1 194 ? -12.772 55.553  10.519  1.00 31.85  ? 194  ARG B CG    1 
ATOM   6444  C CD    . ARG B 1 194 ? -13.817 55.012  11.472  1.00 34.89  ? 194  ARG B CD    1 
ATOM   6445  N NE    . ARG B 1 194 ? -14.244 53.661  11.133  1.00 38.16  ? 194  ARG B NE    1 
ATOM   6446  C CZ    . ARG B 1 194 ? -14.964 52.884  11.947  1.00 41.55  ? 194  ARG B CZ    1 
ATOM   6447  N NH1   . ARG B 1 194 ? -15.353 53.337  13.145  1.00 41.00  ? 194  ARG B NH1   1 
ATOM   6448  N NH2   . ARG B 1 194 ? -15.305 51.654  11.566  1.00 41.82  ? 194  ARG B NH2   1 
ATOM   6449  N N     . SER B 1 195 ? -13.596 58.223  7.023   1.00 30.75  ? 195  SER B N     1 
ATOM   6450  C CA    . SER B 1 195 ? -14.326 59.016  6.026   1.00 30.66  ? 195  SER B CA    1 
ATOM   6451  C C     . SER B 1 195 ? -15.796 58.636  5.894   1.00 29.93  ? 195  SER B C     1 
ATOM   6452  O O     . SER B 1 195 ? -16.156 57.476  6.063   1.00 30.13  ? 195  SER B O     1 
ATOM   6453  C CB    . SER B 1 195 ? -13.662 58.851  4.662   1.00 30.99  ? 195  SER B CB    1 
ATOM   6454  O OG    . SER B 1 195 ? -12.366 59.427  4.672   1.00 33.24  ? 195  SER B OG    1 
ATOM   6455  N N     . ILE B 1 196 ? -16.632 59.623  5.579   1.00 29.08  ? 196  ILE B N     1 
ATOM   6456  C CA    . ILE B 1 196 ? -18.048 59.414  5.288   1.00 28.23  ? 196  ILE B CA    1 
ATOM   6457  C C     . ILE B 1 196 ? -18.223 59.765  3.823   1.00 27.24  ? 196  ILE B C     1 
ATOM   6458  O O     . ILE B 1 196 ? -17.872 60.858  3.424   1.00 27.27  ? 196  ILE B O     1 
ATOM   6459  C CB    . ILE B 1 196 ? -18.972 60.365  6.114   1.00 28.58  ? 196  ILE B CB    1 
ATOM   6460  C CG1   . ILE B 1 196 ? -18.525 60.471  7.583   1.00 30.01  ? 196  ILE B CG1   1 
ATOM   6461  C CG2   . ILE B 1 196 ? -20.466 59.969  5.979   1.00 28.37  ? 196  ILE B CG2   1 
ATOM   6462  C CD1   . ILE B 1 196 ? -18.413 59.129  8.328   1.00 32.10  ? 196  ILE B CD1   1 
ATOM   6463  N N     . PRO B 1 197 ? -18.792 58.853  3.020   1.00 26.52  ? 197  PRO B N     1 
ATOM   6464  C CA    . PRO B 1 197 ? -18.843 59.100  1.586   1.00 25.74  ? 197  PRO B CA    1 
ATOM   6465  C C     . PRO B 1 197 ? -20.054 59.961  1.216   1.00 25.34  ? 197  PRO B C     1 
ATOM   6466  O O     . PRO B 1 197 ? -20.975 59.488  0.518   1.00 25.69  ? 197  PRO B O     1 
ATOM   6467  C CB    . PRO B 1 197 ? -18.962 57.689  1.006   1.00 25.69  ? 197  PRO B CB    1 
ATOM   6468  C CG    . PRO B 1 197 ? -19.760 56.925  2.048   1.00 25.58  ? 197  PRO B CG    1 
ATOM   6469  C CD    . PRO B 1 197 ? -19.433 57.570  3.388   1.00 26.46  ? 197  PRO B CD    1 
ATOM   6470  N N     . LEU B 1 198 ? -20.036 61.214  1.666   1.00 24.02  ? 198  LEU B N     1 
ATOM   6471  C CA    . LEU B 1 198 ? -21.137 62.152  1.451   1.00 23.41  ? 198  LEU B CA    1 
ATOM   6472  C C     . LEU B 1 198 ? -21.518 62.337  -0.017  1.00 23.18  ? 198  LEU B C     1 
ATOM   6473  O O     . LEU B 1 198 ? -22.667 62.107  -0.379  1.00 23.14  ? 198  LEU B O     1 
ATOM   6474  C CB    . LEU B 1 198 ? -20.843 63.515  2.112   1.00 23.63  ? 198  LEU B CB    1 
ATOM   6475  C CG    . LEU B 1 198 ? -20.689 63.604  3.639   1.00 22.13  ? 198  LEU B CG    1 
ATOM   6476  C CD1   . LEU B 1 198 ? -20.293 65.012  4.065   1.00 20.97  ? 198  LEU B CD1   1 
ATOM   6477  C CD2   . LEU B 1 198 ? -21.963 63.169  4.364   1.00 20.55  ? 198  LEU B CD2   1 
ATOM   6478  N N     . LYS B 1 199 ? -20.563 62.739  -0.855  1.00 22.88  ? 199  LYS B N     1 
ATOM   6479  C CA    . LYS B 1 199 ? -20.841 62.977  -2.281  1.00 22.85  ? 199  LYS B CA    1 
ATOM   6480  C C     . LYS B 1 199 ? -21.375 61.739  -3.010  1.00 22.41  ? 199  LYS B C     1 
ATOM   6481  O O     . LYS B 1 199 ? -22.328 61.845  -3.787  1.00 22.51  ? 199  LYS B O     1 
ATOM   6482  C CB    . LYS B 1 199 ? -19.628 63.594  -2.998  1.00 22.67  ? 199  LYS B CB    1 
ATOM   6483  C CG    . LYS B 1 199 ? -19.602 63.455  -4.529  1.00 24.77  ? 199  LYS B CG    1 
ATOM   6484  C CD    . LYS B 1 199 ? -20.405 64.515  -5.255  1.00 25.60  ? 199  LYS B CD    1 
ATOM   6485  C CE    . LYS B 1 199 ? -19.977 64.647  -6.730  1.00 24.12  ? 199  LYS B CE    1 
ATOM   6486  N NZ    . LYS B 1 199 ? -20.762 63.813  -7.683  1.00 23.53  ? 199  LYS B NZ    1 
ATOM   6487  N N     . LYS B 1 200 ? -20.774 60.582  -2.748  1.00 21.87  ? 200  LYS B N     1 
ATOM   6488  C CA    . LYS B 1 200 ? -21.251 59.316  -3.296  1.00 21.86  ? 200  LYS B CA    1 
ATOM   6489  C C     . LYS B 1 200 ? -22.697 58.999  -2.868  1.00 20.85  ? 200  LYS B C     1 
ATOM   6490  O O     . LYS B 1 200 ? -23.481 58.478  -3.670  1.00 20.94  ? 200  LYS B O     1 
ATOM   6491  C CB    . LYS B 1 200 ? -20.315 58.165  -2.916  1.00 21.89  ? 200  LYS B CB    1 
ATOM   6492  C CG    . LYS B 1 200 ? -20.632 56.862  -3.653  1.00 23.44  ? 200  LYS B CG    1 
ATOM   6493  C CD    . LYS B 1 200 ? -19.724 55.705  -3.203  1.00 23.58  ? 200  LYS B CD    1 
ATOM   6494  C CE    . LYS B 1 200 ? -20.102 54.390  -3.896  1.00 25.33  ? 200  LYS B CE    1 
ATOM   6495  N NZ    . LYS B 1 200 ? -19.798 54.409  -5.356  1.00 27.75  ? 200  LYS B NZ    1 
ATOM   6496  N N     . ASN B 1 201 ? -23.051 59.316  -1.620  1.00 19.47  ? 201  ASN B N     1 
ATOM   6497  C CA    . ASN B 1 201 ? -24.439 59.178  -1.166  1.00 18.08  ? 201  ASN B CA    1 
ATOM   6498  C C     . ASN B 1 201 ? -25.396 60.065  -1.982  1.00 17.90  ? 201  ASN B C     1 
ATOM   6499  O O     . ASN B 1 201 ? -26.519 59.655  -2.319  1.00 17.48  ? 201  ASN B O     1 
ATOM   6500  C CB    . ASN B 1 201 ? -24.562 59.492  0.329   1.00 18.34  ? 201  ASN B CB    1 
ATOM   6501  C CG    . ASN B 1 201 ? -23.894 58.437  1.234   1.00 16.83  ? 201  ASN B CG    1 
ATOM   6502  O OD1   . ASN B 1 201 ? -23.453 57.383  0.781   1.00 15.50  ? 201  ASN B OD1   1 
ATOM   6503  N ND2   . ASN B 1 201 ? -23.828 58.736  2.520   1.00 14.87  ? 201  ASN B ND2   1 
ATOM   6504  N N     . VAL B 1 202 ? -24.944 61.272  -2.301  1.00 17.16  ? 202  VAL B N     1 
ATOM   6505  C CA    . VAL B 1 202 ? -25.712 62.183  -3.161  1.00 17.58  ? 202  VAL B CA    1 
ATOM   6506  C C     . VAL B 1 202 ? -25.906 61.623  -4.586  1.00 17.65  ? 202  VAL B C     1 
ATOM   6507  O O     . VAL B 1 202 ? -27.033 61.618  -5.080  1.00 17.72  ? 202  VAL B O     1 
ATOM   6508  C CB    . VAL B 1 202 ? -25.121 63.623  -3.164  1.00 17.41  ? 202  VAL B CB    1 
ATOM   6509  C CG1   . VAL B 1 202 ? -25.846 64.529  -4.168  1.00 17.78  ? 202  VAL B CG1   1 
ATOM   6510  C CG2   . VAL B 1 202 ? -25.193 64.230  -1.757  1.00 16.78  ? 202  VAL B CG2   1 
ATOM   6511  N N     . ASP B 1 203 ? -24.828 61.138  -5.220  1.00 17.66  ? 203  ASP B N     1 
ATOM   6512  C CA    . ASP B 1 203 ? -24.917 60.480  -6.525  1.00 18.34  ? 203  ASP B CA    1 
ATOM   6513  C C     . ASP B 1 203 ? -26.014 59.413  -6.510  1.00 18.58  ? 203  ASP B C     1 
ATOM   6514  O O     . ASP B 1 203 ? -26.855 59.377  -7.399  1.00 18.39  ? 203  ASP B O     1 
ATOM   6515  C CB    . ASP B 1 203 ? -23.583 59.819  -6.919  1.00 18.34  ? 203  ASP B CB    1 
ATOM   6516  C CG    . ASP B 1 203 ? -22.444 60.824  -7.139  1.00 19.16  ? 203  ASP B CG    1 
ATOM   6517  O OD1   . ASP B 1 203 ? -22.700 62.028  -7.349  1.00 17.87  ? 203  ASP B OD1   1 
ATOM   6518  O OD2   . ASP B 1 203 ? -21.268 60.393  -7.121  1.00 20.70  ? 203  ASP B OD2   1 
ATOM   6519  N N     . ASP B 1 204 ? -25.975 58.554  -5.486  1.00 19.38  ? 204  ASP B N     1 
ATOM   6520  C CA    . ASP B 1 204 ? -26.943 57.471  -5.259  1.00 19.87  ? 204  ASP B CA    1 
ATOM   6521  C C     . ASP B 1 204 ? -28.356 58.000  -4.997  1.00 19.88  ? 204  ASP B C     1 
ATOM   6522  O O     . ASP B 1 204 ? -29.326 57.466  -5.525  1.00 19.95  ? 204  ASP B O     1 
ATOM   6523  C CB    . ASP B 1 204 ? -26.495 56.585  -4.081  1.00 19.71  ? 204  ASP B CB    1 
ATOM   6524  C CG    . ASP B 1 204 ? -25.227 55.749  -4.393  1.00 21.69  ? 204  ASP B CG    1 
ATOM   6525  O OD1   . ASP B 1 204 ? -24.809 54.935  -3.527  1.00 21.17  ? 204  ASP B OD1   1 
ATOM   6526  O OD2   . ASP B 1 204 ? -24.644 55.898  -5.489  1.00 22.17  ? 204  ASP B OD2   1 
ATOM   6527  N N     . ALA B 1 205 ? -28.472 59.039  -4.175  1.00 20.42  ? 205  ALA B N     1 
ATOM   6528  C CA    . ALA B 1 205 ? -29.760 59.714  -3.969  1.00 21.14  ? 205  ALA B CA    1 
ATOM   6529  C C     . ALA B 1 205 ? -30.393 60.172  -5.288  1.00 21.52  ? 205  ALA B C     1 
ATOM   6530  O O     . ALA B 1 205 ? -31.575 59.930  -5.540  1.00 21.84  ? 205  ALA B O     1 
ATOM   6531  C CB    . ALA B 1 205 ? -29.602 60.911  -3.016  1.00 20.66  ? 205  ALA B CB    1 
ATOM   6532  N N     . LEU B 1 206 ? -29.591 60.832  -6.119  1.00 22.22  ? 206  LEU B N     1 
ATOM   6533  C CA    . LEU B 1 206 ? -30.065 61.444  -7.360  1.00 22.65  ? 206  LEU B CA    1 
ATOM   6534  C C     . LEU B 1 206 ? -30.383 60.432  -8.464  1.00 23.11  ? 206  LEU B C     1 
ATOM   6535  O O     . LEU B 1 206 ? -31.009 60.785  -9.469  1.00 23.42  ? 206  LEU B O     1 
ATOM   6536  C CB    . LEU B 1 206 ? -29.083 62.522  -7.840  1.00 22.21  ? 206  LEU B CB    1 
ATOM   6537  C CG    . LEU B 1 206 ? -28.914 63.737  -6.910  1.00 23.17  ? 206  LEU B CG    1 
ATOM   6538  C CD1   . LEU B 1 206 ? -28.174 64.898  -7.590  1.00 21.41  ? 206  LEU B CD1   1 
ATOM   6539  C CD2   . LEU B 1 206 ? -30.253 64.249  -6.337  1.00 23.24  ? 206  LEU B CD2   1 
ATOM   6540  N N     . LYS B 1 207 ? -29.971 59.178  -8.271  1.00 23.46  ? 207  LYS B N     1 
ATOM   6541  C CA    . LYS B 1 207 ? -30.371 58.095  -9.179  1.00 23.92  ? 207  LYS B CA    1 
ATOM   6542  C C     . LYS B 1 207 ? -31.827 57.635  -8.963  1.00 24.20  ? 207  LYS B C     1 
ATOM   6543  O O     . LYS B 1 207 ? -32.368 56.880  -9.770  1.00 24.12  ? 207  LYS B O     1 
ATOM   6544  C CB    . LYS B 1 207 ? -29.400 56.922  -9.082  1.00 23.65  ? 207  LYS B CB    1 
ATOM   6545  C CG    . LYS B 1 207 ? -28.022 57.219  -9.663  1.00 24.70  ? 207  LYS B CG    1 
ATOM   6546  C CD    . LYS B 1 207 ? -27.063 56.104  -9.297  1.00 27.63  ? 207  LYS B CD    1 
ATOM   6547  C CE    . LYS B 1 207 ? -25.691 56.288  -9.909  1.00 29.02  ? 207  LYS B CE    1 
ATOM   6548  N NZ    . LYS B 1 207 ? -24.846 55.079  -9.610  1.00 30.97  ? 207  LYS B NZ    1 
ATOM   6549  N N     . ASN B 1 208 ? -32.453 58.084  -7.871  1.00 24.55  ? 208  ASN B N     1 
ATOM   6550  C CA    . ASN B 1 208 ? -33.888 57.896  -7.684  1.00 25.15  ? 208  ASN B CA    1 
ATOM   6551  C C     . ASN B 1 208 ? -34.659 58.688  -8.758  1.00 25.73  ? 208  ASN B C     1 
ATOM   6552  O O     . ASN B 1 208 ? -34.486 59.901  -8.873  1.00 25.16  ? 208  ASN B O     1 
ATOM   6553  C CB    . ASN B 1 208 ? -34.292 58.332  -6.276  1.00 25.33  ? 208  ASN B CB    1 
ATOM   6554  C CG    . ASN B 1 208 ? -35.713 57.932  -5.908  1.00 25.45  ? 208  ASN B CG    1 
ATOM   6555  O OD1   . ASN B 1 208 ? -36.662 58.148  -6.672  1.00 26.55  ? 208  ASN B OD1   1 
ATOM   6556  N ND2   . ASN B 1 208 ? -35.870 57.365  -4.714  1.00 23.87  ? 208  ASN B ND2   1 
ATOM   6557  N N     . PRO B 1 209 ? -35.508 57.997  -9.547  1.00 26.43  ? 209  PRO B N     1 
ATOM   6558  C CA    . PRO B 1 209 ? -36.207 58.622  -10.682 1.00 26.95  ? 209  PRO B CA    1 
ATOM   6559  C C     . PRO B 1 209 ? -37.245 59.656  -10.236 1.00 27.07  ? 209  PRO B C     1 
ATOM   6560  O O     . PRO B 1 209 ? -37.671 60.503  -11.033 1.00 26.95  ? 209  PRO B O     1 
ATOM   6561  C CB    . PRO B 1 209 ? -36.897 57.437  -11.373 1.00 27.00  ? 209  PRO B CB    1 
ATOM   6562  C CG    . PRO B 1 209 ? -37.083 56.420  -10.285 1.00 27.62  ? 209  PRO B CG    1 
ATOM   6563  C CD    . PRO B 1 209 ? -35.869 56.575  -9.392  1.00 26.82  ? 209  PRO B CD    1 
ATOM   6564  N N     . ASN B 1 210 ? -37.632 59.583  -8.965  1.00 26.85  ? 210  ASN B N     1 
ATOM   6565  C CA    . ASN B 1 210 ? -38.613 60.504  -8.403  1.00 26.79  ? 210  ASN B CA    1 
ATOM   6566  C C     . ASN B 1 210 ? -38.024 61.865  -8.031  1.00 26.11  ? 210  ASN B C     1 
ATOM   6567  O O     . ASN B 1 210 ? -38.756 62.846  -7.881  1.00 26.07  ? 210  ASN B O     1 
ATOM   6568  C CB    . ASN B 1 210 ? -39.350 59.827  -7.247  1.00 27.03  ? 210  ASN B CB    1 
ATOM   6569  C CG    . ASN B 1 210 ? -40.100 58.574  -7.709  1.00 28.82  ? 210  ASN B CG    1 
ATOM   6570  O OD1   . ASN B 1 210 ? -41.031 58.661  -8.514  1.00 29.11  ? 210  ASN B OD1   1 
ATOM   6571  N ND2   . ASN B 1 210 ? -39.675 57.406  -7.228  1.00 29.28  ? 210  ASN B ND2   1 
ATOM   6572  N N     . VAL B 1 211 ? -36.698 61.929  -7.937  1.00 25.63  ? 211  VAL B N     1 
ATOM   6573  C CA    . VAL B 1 211 ? -35.994 63.203  -7.793  1.00 24.89  ? 211  VAL B CA    1 
ATOM   6574  C C     . VAL B 1 211 ? -35.964 63.906  -9.156  1.00 25.11  ? 211  VAL B C     1 
ATOM   6575  O O     . VAL B 1 211 ? -35.205 63.508  -10.045 1.00 24.62  ? 211  VAL B O     1 
ATOM   6576  C CB    . VAL B 1 211 ? -34.554 62.996  -7.284  1.00 24.66  ? 211  VAL B CB    1 
ATOM   6577  C CG1   . VAL B 1 211 ? -33.841 64.337  -7.075  1.00 24.31  ? 211  VAL B CG1   1 
ATOM   6578  C CG2   . VAL B 1 211 ? -34.543 62.180  -6.017  1.00 23.76  ? 211  VAL B CG2   1 
ATOM   6579  N N     . THR B 1 212 ? -36.795 64.942  -9.304  1.00 25.36  ? 212  THR B N     1 
ATOM   6580  C CA    . THR B 1 212 ? -36.910 65.715  -10.550 1.00 25.95  ? 212  THR B CA    1 
ATOM   6581  C C     . THR B 1 212 ? -36.499 67.194  -10.417 1.00 25.80  ? 212  THR B C     1 
ATOM   6582  O O     . THR B 1 212 ? -36.504 67.932  -11.403 1.00 25.92  ? 212  THR B O     1 
ATOM   6583  C CB    . THR B 1 212 ? -38.363 65.668  -11.122 1.00 26.16  ? 212  THR B CB    1 
ATOM   6584  O OG1   . THR B 1 212 ? -39.285 66.201  -10.158 1.00 25.95  ? 212  THR B OG1   1 
ATOM   6585  C CG2   . THR B 1 212 ? -38.770 64.244  -11.476 1.00 26.80  ? 212  THR B CG2   1 
ATOM   6586  N N     . SER B 1 213 ? -36.135 67.613  -9.208  1.00 25.76  ? 213  SER B N     1 
ATOM   6587  C CA    . SER B 1 213 ? -35.994 69.038  -8.872  1.00 25.56  ? 213  SER B CA    1 
ATOM   6588  C C     . SER B 1 213 ? -34.547 69.569  -8.828  1.00 25.43  ? 213  SER B C     1 
ATOM   6589  O O     . SER B 1 213 ? -34.316 70.770  -8.986  1.00 25.00  ? 213  SER B O     1 
ATOM   6590  C CB    . SER B 1 213 ? -36.668 69.299  -7.524  1.00 25.77  ? 213  SER B CB    1 
ATOM   6591  O OG    . SER B 1 213 ? -36.109 68.440  -6.541  1.00 25.71  ? 213  SER B OG    1 
ATOM   6592  N N     . VAL B 1 214 ? -33.585 68.678  -8.595  1.00 25.63  ? 214  VAL B N     1 
ATOM   6593  C CA    . VAL B 1 214 ? -32.171 69.064  -8.461  1.00 25.41  ? 214  VAL B CA    1 
ATOM   6594  C C     . VAL B 1 214 ? -31.571 69.391  -9.821  1.00 25.49  ? 214  VAL B C     1 
ATOM   6595  O O     . VAL B 1 214 ? -31.640 68.582  -10.756 1.00 25.11  ? 214  VAL B O     1 
ATOM   6596  C CB    . VAL B 1 214 ? -31.328 67.952  -7.755  1.00 25.89  ? 214  VAL B CB    1 
ATOM   6597  C CG1   . VAL B 1 214 ? -29.877 68.396  -7.575  1.00 25.73  ? 214  VAL B CG1   1 
ATOM   6598  C CG2   . VAL B 1 214 ? -31.934 67.590  -6.392  1.00 25.24  ? 214  VAL B CG2   1 
ATOM   6599  N N     . GLU B 1 215 ? -30.992 70.583  -9.923  1.00 25.49  ? 215  GLU B N     1 
ATOM   6600  C CA    . GLU B 1 215 ? -30.348 71.033  -11.151 1.00 25.85  ? 215  GLU B CA    1 
ATOM   6601  C C     . GLU B 1 215 ? -28.837 70.980  -11.019 1.00 25.25  ? 215  GLU B C     1 
ATOM   6602  O O     . GLU B 1 215 ? -28.137 70.655  -11.987 1.00 25.60  ? 215  GLU B O     1 
ATOM   6603  C CB    . GLU B 1 215 ? -30.818 72.444  -11.521 1.00 26.45  ? 215  GLU B CB    1 
ATOM   6604  C CG    . GLU B 1 215 ? -32.275 72.499  -11.984 1.00 29.32  ? 215  GLU B CG    1 
ATOM   6605  C CD    . GLU B 1 215 ? -32.936 73.840  -11.706 1.00 33.63  ? 215  GLU B CD    1 
ATOM   6606  O OE1   . GLU B 1 215 ? -34.087 73.838  -11.211 1.00 35.34  ? 215  GLU B OE1   1 
ATOM   6607  O OE2   . GLU B 1 215 ? -32.310 74.895  -11.976 1.00 34.98  ? 215  GLU B OE2   1 
ATOM   6608  N N     . HIS B 1 216 ? -28.335 71.296  -9.824  1.00 24.31  ? 216  HIS B N     1 
ATOM   6609  C CA    . HIS B 1 216 ? -26.903 71.213  -9.539  1.00 23.45  ? 216  HIS B CA    1 
ATOM   6610  C C     . HIS B 1 216 ? -26.596 70.633  -8.161  1.00 22.61  ? 216  HIS B C     1 
ATOM   6611  O O     . HIS B 1 216 ? -27.441 70.641  -7.267  1.00 22.52  ? 216  HIS B O     1 
ATOM   6612  C CB    . HIS B 1 216 ? -26.245 72.590  -9.648  1.00 23.61  ? 216  HIS B CB    1 
ATOM   6613  C CG    . HIS B 1 216 ? -26.427 73.245  -10.980 1.00 24.38  ? 216  HIS B CG    1 
ATOM   6614  N ND1   . HIS B 1 216 ? -25.669 72.912  -12.085 1.00 24.28  ? 216  HIS B ND1   1 
ATOM   6615  C CD2   . HIS B 1 216 ? -27.281 74.216  -11.383 1.00 24.06  ? 216  HIS B CD2   1 
ATOM   6616  C CE1   . HIS B 1 216 ? -26.054 73.646  -13.112 1.00 24.44  ? 216  HIS B CE1   1 
ATOM   6617  N NE2   . HIS B 1 216 ? -27.029 74.447  -12.713 1.00 25.06  ? 216  HIS B NE2   1 
ATOM   6618  N N     . VAL B 1 217 ? -25.373 70.123  -8.023  1.00 21.63  ? 217  VAL B N     1 
ATOM   6619  C CA    . VAL B 1 217 ? -24.781 69.745  -6.742  1.00 20.63  ? 217  VAL B CA    1 
ATOM   6620  C C     . VAL B 1 217 ? -23.450 70.513  -6.586  1.00 20.49  ? 217  VAL B C     1 
ATOM   6621  O O     . VAL B 1 217 ? -22.553 70.398  -7.418  1.00 20.32  ? 217  VAL B O     1 
ATOM   6622  C CB    . VAL B 1 217 ? -24.568 68.206  -6.628  1.00 20.83  ? 217  VAL B CB    1 
ATOM   6623  C CG1   . VAL B 1 217 ? -23.712 67.838  -5.421  1.00 19.38  ? 217  VAL B CG1   1 
ATOM   6624  C CG2   . VAL B 1 217 ? -25.910 67.483  -6.572  1.00 20.40  ? 217  VAL B CG2   1 
ATOM   6625  N N     . ILE B 1 218 ? -23.353 71.317  -5.532  1.00 20.05  ? 218  ILE B N     1 
ATOM   6626  C CA    . ILE B 1 218 ? -22.114 71.994  -5.176  1.00 19.95  ? 218  ILE B CA    1 
ATOM   6627  C C     . ILE B 1 218 ? -21.339 71.117  -4.187  1.00 20.41  ? 218  ILE B C     1 
ATOM   6628  O O     . ILE B 1 218 ? -21.891 70.654  -3.183  1.00 20.16  ? 218  ILE B O     1 
ATOM   6629  C CB    . ILE B 1 218 ? -22.387 73.411  -4.595  1.00 20.20  ? 218  ILE B CB    1 
ATOM   6630  C CG1   . ILE B 1 218 ? -23.122 74.278  -5.637  1.00 19.48  ? 218  ILE B CG1   1 
ATOM   6631  C CG2   . ILE B 1 218 ? -21.085 74.083  -4.120  1.00 20.01  ? 218  ILE B CG2   1 
ATOM   6632  C CD1   . ILE B 1 218 ? -23.556 75.662  -5.128  1.00 19.41  ? 218  ILE B CD1   1 
ATOM   6633  N N     . VAL B 1 219 ? -20.065 70.881  -4.495  1.00 20.57  ? 219  VAL B N     1 
ATOM   6634  C CA    . VAL B 1 219 ? -19.234 69.961  -3.727  1.00 20.50  ? 219  VAL B CA    1 
ATOM   6635  C C     . VAL B 1 219 ? -18.019 70.681  -3.159  1.00 21.05  ? 219  VAL B C     1 
ATOM   6636  O O     . VAL B 1 219 ? -17.233 71.270  -3.903  1.00 21.56  ? 219  VAL B O     1 
ATOM   6637  C CB    . VAL B 1 219 ? -18.739 68.773  -4.582  1.00 20.12  ? 219  VAL B CB    1 
ATOM   6638  C CG1   . VAL B 1 219 ? -18.047 67.734  -3.705  1.00 19.58  ? 219  VAL B CG1   1 
ATOM   6639  C CG2   . VAL B 1 219 ? -19.886 68.149  -5.370  1.00 19.77  ? 219  VAL B CG2   1 
ATOM   6640  N N     . LEU B 1 220 ? -17.881 70.639  -1.838  1.00 21.37  ? 220  LEU B N     1 
ATOM   6641  C CA    . LEU B 1 220 ? -16.667 71.093  -1.183  1.00 21.67  ? 220  LEU B CA    1 
ATOM   6642  C C     . LEU B 1 220 ? -15.613 69.989  -1.193  1.00 21.74  ? 220  LEU B C     1 
ATOM   6643  O O     . LEU B 1 220 ? -15.867 68.863  -0.754  1.00 21.46  ? 220  LEU B O     1 
ATOM   6644  C CB    . LEU B 1 220 ? -16.953 71.533  0.261   1.00 21.55  ? 220  LEU B CB    1 
ATOM   6645  C CG    . LEU B 1 220 ? -15.718 71.876  1.104   1.00 21.35  ? 220  LEU B CG    1 
ATOM   6646  C CD1   . LEU B 1 220 ? -15.139 73.243  0.717   1.00 21.67  ? 220  LEU B CD1   1 
ATOM   6647  C CD2   . LEU B 1 220 ? -16.045 71.817  2.591   1.00 21.02  ? 220  LEU B CD2   1 
ATOM   6648  N N     . LYS B 1 221 ? -14.431 70.320  -1.701  1.00 22.30  ? 221  LYS B N     1 
ATOM   6649  C CA    . LYS B 1 221 ? -13.301 69.406  -1.624  1.00 22.75  ? 221  LYS B CA    1 
ATOM   6650  C C     . LYS B 1 221 ? -12.727 69.420  -0.203  1.00 22.71  ? 221  LYS B C     1 
ATOM   6651  O O     . LYS B 1 221 ? -11.879 70.250  0.128   1.00 22.95  ? 221  LYS B O     1 
ATOM   6652  C CB    . LYS B 1 221 ? -12.230 69.763  -2.661  1.00 22.76  ? 221  LYS B CB    1 
ATOM   6653  C CG    . LYS B 1 221 ? -11.320 68.601  -3.025  1.00 22.82  ? 221  LYS B CG    1 
ATOM   6654  C CD    . LYS B 1 221 ? -10.188 69.028  -3.962  1.00 23.34  ? 221  LYS B CD    1 
ATOM   6655  N N     . ARG B 1 222 ? -13.216 68.510  0.640   1.00 22.44  ? 222  ARG B N     1 
ATOM   6656  C CA    . ARG B 1 222 ? -12.734 68.400  2.012   1.00 21.76  ? 222  ARG B CA    1 
ATOM   6657  C C     . ARG B 1 222 ? -11.512 67.488  2.088   1.00 21.74  ? 222  ARG B C     1 
ATOM   6658  O O     . ARG B 1 222 ? -10.517 67.839  2.724   1.00 21.49  ? 222  ARG B O     1 
ATOM   6659  C CB    . ARG B 1 222 ? -13.856 67.903  2.942   1.00 22.00  ? 222  ARG B CB    1 
ATOM   6660  C CG    . ARG B 1 222 ? -13.440 67.522  4.374   1.00 20.98  ? 222  ARG B CG    1 
ATOM   6661  C CD    . ARG B 1 222 ? -12.819 68.677  5.136   1.00 20.87  ? 222  ARG B CD    1 
ATOM   6662  N NE    . ARG B 1 222 ? -12.391 68.252  6.467   1.00 22.80  ? 222  ARG B NE    1 
ATOM   6663  C CZ    . ARG B 1 222 ? -11.162 67.832  6.762   1.00 23.56  ? 222  ARG B CZ    1 
ATOM   6664  N NH1   . ARG B 1 222 ? -10.213 67.797  5.828   1.00 22.92  ? 222  ARG B NH1   1 
ATOM   6665  N NH2   . ARG B 1 222 ? -10.878 67.454  7.996   1.00 24.43  ? 222  ARG B NH2   1 
ATOM   6666  N N     . THR B 1 223 ? -11.587 66.321  1.443   1.00 21.54  ? 223  THR B N     1 
ATOM   6667  C CA    . THR B 1 223 ? -10.509 65.335  1.544   1.00 20.88  ? 223  THR B CA    1 
ATOM   6668  C C     . THR B 1 223 ? -9.695  65.159  0.265   1.00 20.95  ? 223  THR B C     1 
ATOM   6669  O O     . THR B 1 223 ? -8.567  64.653  0.312   1.00 20.70  ? 223  THR B O     1 
ATOM   6670  C CB    . THR B 1 223 ? -11.026 63.945  1.966   1.00 20.84  ? 223  THR B CB    1 
ATOM   6671  O OG1   . THR B 1 223 ? -11.910 63.431  0.957   1.00 20.49  ? 223  THR B OG1   1 
ATOM   6672  C CG2   . THR B 1 223 ? -11.723 64.012  3.339   1.00 20.57  ? 223  THR B CG2   1 
ATOM   6673  N N     . GLY B 1 224 ? -10.278 65.542  -0.868  1.00 20.82  ? 224  GLY B N     1 
ATOM   6674  C CA    . GLY B 1 224 ? -9.637  65.348  -2.166  1.00 21.34  ? 224  GLY B CA    1 
ATOM   6675  C C     . GLY B 1 224 ? -9.674  63.912  -2.656  1.00 21.58  ? 224  GLY B C     1 
ATOM   6676  O O     . GLY B 1 224 ? -8.920  63.539  -3.551  1.00 21.06  ? 224  GLY B O     1 
ATOM   6677  N N     . SER B 1 225 ? -10.565 63.106  -2.078  1.00 22.08  ? 225  SER B N     1 
ATOM   6678  C CA    . SER B 1 225 ? -10.680 61.683  -2.428  1.00 22.66  ? 225  SER B CA    1 
ATOM   6679  C C     . SER B 1 225 ? -11.264 61.514  -3.824  1.00 22.85  ? 225  SER B C     1 
ATOM   6680  O O     . SER B 1 225 ? -11.896 62.434  -4.346  1.00 22.77  ? 225  SER B O     1 
ATOM   6681  C CB    . SER B 1 225 ? -11.566 60.945  -1.414  1.00 22.95  ? 225  SER B CB    1 
ATOM   6682  O OG    . SER B 1 225 ? -12.945 61.198  -1.677  1.00 22.93  ? 225  SER B OG    1 
ATOM   6683  N N     . ASP B 1 226 ? -11.050 60.343  -4.417  1.00 23.33  ? 226  ASP B N     1 
ATOM   6684  C CA    . ASP B 1 226 ? -11.596 60.031  -5.736  1.00 24.30  ? 226  ASP B CA    1 
ATOM   6685  C C     . ASP B 1 226 ? -13.114 59.990  -5.682  1.00 24.79  ? 226  ASP B C     1 
ATOM   6686  O O     . ASP B 1 226 ? -13.696 59.235  -4.893  1.00 25.45  ? 226  ASP B O     1 
ATOM   6687  C CB    . ASP B 1 226 ? -11.111 58.662  -6.211  1.00 24.80  ? 226  ASP B CB    1 
ATOM   6688  C CG    . ASP B 1 226 ? -9.633  58.632  -6.519  1.00 25.56  ? 226  ASP B CG    1 
ATOM   6689  O OD1   . ASP B 1 226 ? -9.028  59.708  -6.648  1.00 27.02  ? 226  ASP B OD1   1 
ATOM   6690  O OD2   . ASP B 1 226 ? -9.078  57.521  -6.647  1.00 27.71  ? 226  ASP B OD2   1 
ATOM   6691  N N     . ILE B 1 227 ? -13.754 60.809  -6.510  1.00 25.27  ? 227  ILE B N     1 
ATOM   6692  C CA    . ILE B 1 227 ? -15.206 60.781  -6.641  1.00 25.36  ? 227  ILE B CA    1 
ATOM   6693  C C     . ILE B 1 227 ? -15.617 60.733  -8.114  1.00 25.15  ? 227  ILE B C     1 
ATOM   6694  O O     . ILE B 1 227 ? -14.799 60.959  -9.007  1.00 25.13  ? 227  ILE B O     1 
ATOM   6695  C CB    . ILE B 1 227 ? -15.910 61.956  -5.875  1.00 25.82  ? 227  ILE B CB    1 
ATOM   6696  C CG1   . ILE B 1 227 ? -15.532 63.317  -6.448  1.00 26.09  ? 227  ILE B CG1   1 
ATOM   6697  C CG2   . ILE B 1 227 ? -15.622 61.896  -4.350  1.00 26.50  ? 227  ILE B CG2   1 
ATOM   6698  C CD1   . ILE B 1 227 ? -16.318 64.449  -5.826  1.00 25.49  ? 227  ILE B CD1   1 
ATOM   6699  N N     . ASP B 1 228 ? -16.876 60.386  -8.358  1.00 24.52  ? 228  ASP B N     1 
ATOM   6700  C CA    . ASP B 1 228 ? -17.442 60.431  -9.690  1.00 23.83  ? 228  ASP B CA    1 
ATOM   6701  C C     . ASP B 1 228 ? -17.986 61.836  -9.893  1.00 23.68  ? 228  ASP B C     1 
ATOM   6702  O O     . ASP B 1 228 ? -18.303 62.536  -8.914  1.00 23.11  ? 228  ASP B O     1 
ATOM   6703  C CB    . ASP B 1 228 ? -18.546 59.380  -9.829  1.00 23.76  ? 228  ASP B CB    1 
ATOM   6704  C CG    . ASP B 1 228 ? -18.063 57.968  -9.483  1.00 24.44  ? 228  ASP B CG    1 
ATOM   6705  O OD1   . ASP B 1 228 ? -18.776 57.255  -8.737  1.00 24.12  ? 228  ASP B OD1   1 
ATOM   6706  O OD2   . ASP B 1 228 ? -16.968 57.566  -9.943  1.00 23.99  ? 228  ASP B OD2   1 
ATOM   6707  N N     . TRP B 1 229 ? -18.113 62.249  -11.151 1.00 23.18  ? 229  TRP B N     1 
ATOM   6708  C CA    . TRP B 1 229 ? -18.355 63.650  -11.455 1.00 23.20  ? 229  TRP B CA    1 
ATOM   6709  C C     . TRP B 1 229 ? -19.258 63.815  -12.670 1.00 23.28  ? 229  TRP B C     1 
ATOM   6710  O O     . TRP B 1 229 ? -18.900 63.424  -13.781 1.00 23.63  ? 229  TRP B O     1 
ATOM   6711  C CB    . TRP B 1 229 ? -17.012 64.367  -11.664 1.00 23.18  ? 229  TRP B CB    1 
ATOM   6712  C CG    . TRP B 1 229 ? -17.125 65.851  -11.597 1.00 23.35  ? 229  TRP B CG    1 
ATOM   6713  C CD1   . TRP B 1 229 ? -17.134 66.728  -12.651 1.00 23.18  ? 229  TRP B CD1   1 
ATOM   6714  C CD2   . TRP B 1 229 ? -17.257 66.640  -10.414 1.00 22.96  ? 229  TRP B CD2   1 
ATOM   6715  N NE1   . TRP B 1 229 ? -17.270 68.015  -12.191 1.00 23.06  ? 229  TRP B NE1   1 
ATOM   6716  C CE2   . TRP B 1 229 ? -17.347 67.991  -10.821 1.00 22.61  ? 229  TRP B CE2   1 
ATOM   6717  C CE3   . TRP B 1 229 ? -17.316 66.338  -9.043  1.00 22.91  ? 229  TRP B CE3   1 
ATOM   6718  C CZ2   . TRP B 1 229 ? -17.492 69.040  -9.906  1.00 22.40  ? 229  TRP B CZ2   1 
ATOM   6719  C CZ3   . TRP B 1 229 ? -17.463 67.382  -8.134  1.00 22.40  ? 229  TRP B CZ3   1 
ATOM   6720  C CH2   . TRP B 1 229 ? -17.549 68.715  -8.570  1.00 23.16  ? 229  TRP B CH2   1 
ATOM   6721  N N     . GLN B 1 230 ? -20.443 64.370  -12.460 1.00 23.32  ? 230  GLN B N     1 
ATOM   6722  C CA    . GLN B 1 230 ? -21.377 64.537  -13.555 1.00 23.44  ? 230  GLN B CA    1 
ATOM   6723  C C     . GLN B 1 230 ? -21.275 65.932  -14.119 1.00 23.80  ? 230  GLN B C     1 
ATOM   6724  O O     . GLN B 1 230 ? -21.693 66.896  -13.482 1.00 23.86  ? 230  GLN B O     1 
ATOM   6725  C CB    . GLN B 1 230 ? -22.816 64.239  -13.139 1.00 23.44  ? 230  GLN B CB    1 
ATOM   6726  C CG    . GLN B 1 230 ? -23.748 64.108  -14.341 1.00 22.55  ? 230  GLN B CG    1 
ATOM   6727  C CD    . GLN B 1 230 ? -25.158 63.703  -13.963 1.00 21.89  ? 230  GLN B CD    1 
ATOM   6728  O OE1   . GLN B 1 230 ? -25.377 62.666  -13.337 1.00 21.54  ? 230  GLN B OE1   1 
ATOM   6729  N NE2   . GLN B 1 230 ? -26.125 64.510  -14.368 1.00 21.47  ? 230  GLN B NE2   1 
ATOM   6730  N N     . GLU B 1 231 ? -20.711 66.019  -15.320 1.00 24.24  ? 231  GLU B N     1 
ATOM   6731  C CA    . GLU B 1 231 ? -20.533 67.277  -16.025 1.00 24.80  ? 231  GLU B CA    1 
ATOM   6732  C C     . GLU B 1 231 ? -21.861 67.996  -16.188 1.00 24.56  ? 231  GLU B C     1 
ATOM   6733  O O     . GLU B 1 231 ? -22.865 67.389  -16.569 1.00 24.55  ? 231  GLU B O     1 
ATOM   6734  C CB    . GLU B 1 231 ? -19.929 67.026  -17.404 1.00 25.20  ? 231  GLU B CB    1 
ATOM   6735  C CG    . GLU B 1 231 ? -18.882 68.047  -17.801 1.00 28.03  ? 231  GLU B CG    1 
ATOM   6736  C CD    . GLU B 1 231 ? -17.727 68.039  -16.814 1.00 31.73  ? 231  GLU B CD    1 
ATOM   6737  O OE1   . GLU B 1 231 ? -16.936 67.053  -16.814 1.00 31.72  ? 231  GLU B OE1   1 
ATOM   6738  O OE2   . GLU B 1 231 ? -17.634 69.009  -16.022 1.00 32.10  ? 231  GLU B OE2   1 
ATOM   6739  N N     . GLY B 1 232 ? -21.868 69.291  -15.891 1.00 24.64  ? 232  GLY B N     1 
ATOM   6740  C CA    . GLY B 1 232 ? -23.049 70.103  -16.137 1.00 24.33  ? 232  GLY B CA    1 
ATOM   6741  C C     . GLY B 1 232 ? -24.006 70.119  -14.965 1.00 24.19  ? 232  GLY B C     1 
ATOM   6742  O O     . GLY B 1 232 ? -24.890 70.978  -14.910 1.00 24.35  ? 232  GLY B O     1 
ATOM   6743  N N     . ARG B 1 233 ? -23.838 69.160  -14.047 1.00 23.36  ? 233  ARG B N     1 
ATOM   6744  C CA    . ARG B 1 233 ? -24.580 69.120  -12.795 1.00 22.62  ? 233  ARG B CA    1 
ATOM   6745  C C     . ARG B 1 233 ? -23.674 69.505  -11.626 1.00 22.17  ? 233  ARG B C     1 
ATOM   6746  O O     . ARG B 1 233 ? -24.004 70.407  -10.857 1.00 21.53  ? 233  ARG B O     1 
ATOM   6747  C CB    . ARG B 1 233 ? -25.192 67.727  -12.529 1.00 22.63  ? 233  ARG B CB    1 
ATOM   6748  C CG    . ARG B 1 233 ? -26.038 67.663  -11.237 1.00 22.07  ? 233  ARG B CG    1 
ATOM   6749  C CD    . ARG B 1 233 ? -26.419 66.238  -10.840 1.00 22.79  ? 233  ARG B CD    1 
ATOM   6750  N NE    . ARG B 1 233 ? -25.265 65.474  -10.366 1.00 23.37  ? 233  ARG B NE    1 
ATOM   6751  C CZ    . ARG B 1 233 ? -25.283 64.184  -10.030 1.00 24.55  ? 233  ARG B CZ    1 
ATOM   6752  N NH1   . ARG B 1 233 ? -26.403 63.472  -10.107 1.00 24.71  ? 233  ARG B NH1   1 
ATOM   6753  N NH2   . ARG B 1 233 ? -24.166 63.597  -9.617  1.00 24.13  ? 233  ARG B NH2   1 
ATOM   6754  N N     . ASP B 1 234 ? -22.545 68.805  -11.502 1.00 21.55  ? 234  ASP B N     1 
ATOM   6755  C CA    . ASP B 1 234 ? -21.667 68.934  -10.341 1.00 21.15  ? 234  ASP B CA    1 
ATOM   6756  C C     . ASP B 1 234 ? -20.718 70.124  -10.485 1.00 21.12  ? 234  ASP B C     1 
ATOM   6757  O O     . ASP B 1 234 ? -20.125 70.335  -11.542 1.00 21.00  ? 234  ASP B O     1 
ATOM   6758  C CB    . ASP B 1 234 ? -20.854 67.650  -10.136 1.00 20.97  ? 234  ASP B CB    1 
ATOM   6759  C CG    . ASP B 1 234 ? -21.718 66.433  -9.836  1.00 20.34  ? 234  ASP B CG    1 
ATOM   6760  O OD1   . ASP B 1 234 ? -22.898 66.600  -9.452  1.00 20.17  ? 234  ASP B OD1   1 
ATOM   6761  O OD2   . ASP B 1 234 ? -21.202 65.297  -9.978  1.00 18.63  ? 234  ASP B OD2   1 
ATOM   6762  N N     . LEU B 1 235 ? -20.582 70.892  -9.408  1.00 20.88  ? 235  LEU B N     1 
ATOM   6763  C CA    . LEU B 1 235 ? -19.713 72.061  -9.372  1.00 21.02  ? 235  LEU B CA    1 
ATOM   6764  C C     . LEU B 1 235 ? -18.871 72.075  -8.090  1.00 20.94  ? 235  LEU B C     1 
ATOM   6765  O O     . LEU B 1 235 ? -19.358 71.759  -7.007  1.00 20.79  ? 235  LEU B O     1 
ATOM   6766  C CB    . LEU B 1 235 ? -20.534 73.365  -9.509  1.00 21.03  ? 235  LEU B CB    1 
ATOM   6767  C CG    . LEU B 1 235 ? -21.587 73.466  -10.637 1.00 21.60  ? 235  LEU B CG    1 
ATOM   6768  C CD1   . LEU B 1 235 ? -22.556 74.635  -10.421 1.00 20.89  ? 235  LEU B CD1   1 
ATOM   6769  C CD2   . LEU B 1 235 ? -20.950 73.506  -12.057 1.00 20.32  ? 235  LEU B CD2   1 
ATOM   6770  N N     . TRP B 1 236 ? -17.599 72.431  -8.223  1.00 21.35  ? 236  TRP B N     1 
ATOM   6771  C CA    . TRP B 1 236 ? -16.715 72.521  -7.073  1.00 21.40  ? 236  TRP B CA    1 
ATOM   6772  C C     . TRP B 1 236 ? -16.929 73.844  -6.359  1.00 21.68  ? 236  TRP B C     1 
ATOM   6773  O O     . TRP B 1 236 ? -16.968 74.908  -6.992  1.00 21.93  ? 236  TRP B O     1 
ATOM   6774  C CB    . TRP B 1 236 ? -15.265 72.374  -7.497  1.00 21.12  ? 236  TRP B CB    1 
ATOM   6775  C CG    . TRP B 1 236 ? -14.879 70.960  -7.876  1.00 21.81  ? 236  TRP B CG    1 
ATOM   6776  C CD1   . TRP B 1 236 ? -14.569 70.495  -9.128  1.00 21.35  ? 236  TRP B CD1   1 
ATOM   6777  C CD2   . TRP B 1 236 ? -14.743 69.840  -6.990  1.00 21.61  ? 236  TRP B CD2   1 
ATOM   6778  N NE1   . TRP B 1 236 ? -14.253 69.155  -9.073  1.00 21.34  ? 236  TRP B NE1   1 
ATOM   6779  C CE2   . TRP B 1 236 ? -14.348 68.731  -7.773  1.00 21.44  ? 236  TRP B CE2   1 
ATOM   6780  C CE3   . TRP B 1 236 ? -14.927 69.665  -5.612  1.00 20.34  ? 236  TRP B CE3   1 
ATOM   6781  C CZ2   . TRP B 1 236 ? -14.131 67.467  -7.221  1.00 21.17  ? 236  TRP B CZ2   1 
ATOM   6782  C CZ3   . TRP B 1 236 ? -14.706 68.415  -5.069  1.00 20.86  ? 236  TRP B CZ3   1 
ATOM   6783  C CH2   . TRP B 1 236 ? -14.311 67.333  -5.869  1.00 21.15  ? 236  TRP B CH2   1 
ATOM   6784  N N     . TRP B 1 237 ? -17.087 73.757  -5.041  1.00 21.97  ? 237  TRP B N     1 
ATOM   6785  C CA    . TRP B 1 237 ? -17.271 74.920  -4.166  1.00 21.98  ? 237  TRP B CA    1 
ATOM   6786  C C     . TRP B 1 237 ? -16.212 76.001  -4.447  1.00 22.32  ? 237  TRP B C     1 
ATOM   6787  O O     . TRP B 1 237 ? -16.554 77.151  -4.681  1.00 21.55  ? 237  TRP B O     1 
ATOM   6788  C CB    . TRP B 1 237 ? -17.237 74.468  -2.705  1.00 21.63  ? 237  TRP B CB    1 
ATOM   6789  C CG    . TRP B 1 237 ? -17.299 75.571  -1.654  1.00 21.97  ? 237  TRP B CG    1 
ATOM   6790  C CD1   . TRP B 1 237 ? -16.327 76.498  -1.361  1.00 21.72  ? 237  TRP B CD1   1 
ATOM   6791  C CD2   . TRP B 1 237 ? -18.369 75.819  -0.741  1.00 21.30  ? 237  TRP B CD2   1 
ATOM   6792  N NE1   . TRP B 1 237 ? -16.743 77.318  -0.340  1.00 21.48  ? 237  TRP B NE1   1 
ATOM   6793  C CE2   . TRP B 1 237 ? -17.988 76.918  0.066   1.00 21.93  ? 237  TRP B CE2   1 
ATOM   6794  C CE3   . TRP B 1 237 ? -19.615 75.223  -0.525  1.00 21.81  ? 237  TRP B CE3   1 
ATOM   6795  C CZ2   . TRP B 1 237 ? -18.811 77.430  1.068   1.00 21.55  ? 237  TRP B CZ2   1 
ATOM   6796  C CZ3   . TRP B 1 237 ? -20.430 75.732  0.467   1.00 21.96  ? 237  TRP B CZ3   1 
ATOM   6797  C CH2   . TRP B 1 237 ? -20.027 76.834  1.247   1.00 21.66  ? 237  TRP B CH2   1 
ATOM   6798  N N     . ARG B 1 238 ? -14.941 75.612  -4.438  1.00 23.34  ? 238  ARG B N     1 
ATOM   6799  C CA    . ARG B 1 238 ? -13.843 76.565  -4.606  1.00 25.06  ? 238  ARG B CA    1 
ATOM   6800  C C     . ARG B 1 238 ? -13.889 77.347  -5.935  1.00 25.35  ? 238  ARG B C     1 
ATOM   6801  O O     . ARG B 1 238 ? -13.654 78.545  -5.941  1.00 25.67  ? 238  ARG B O     1 
ATOM   6802  C CB    . ARG B 1 238 ? -12.490 75.880  -4.414  1.00 25.02  ? 238  ARG B CB    1 
ATOM   6803  C CG    . ARG B 1 238 ? -11.332 76.853  -4.197  1.00 27.31  ? 238  ARG B CG    1 
ATOM   6804  C CD    . ARG B 1 238 ? -10.046 76.102  -3.905  1.00 29.66  ? 238  ARG B CD    1 
ATOM   6805  N NE    . ARG B 1 238 ? -8.859  76.790  -4.413  1.00 29.15  ? 238  ARG B NE    1 
ATOM   6806  C CZ    . ARG B 1 238 ? -7.645  76.242  -4.480  1.00 29.32  ? 238  ARG B CZ    1 
ATOM   6807  N NH1   . ARG B 1 238 ? -7.447  74.991  -4.069  1.00 27.48  ? 238  ARG B NH1   1 
ATOM   6808  N NH2   . ARG B 1 238 ? -6.620  76.949  -4.960  1.00 30.01  ? 238  ARG B NH2   1 
ATOM   6809  N N     . ASP B 1 239 ? -14.207 76.672  -7.043  1.00 26.46  ? 239  ASP B N     1 
ATOM   6810  C CA    . ASP B 1 239 ? -14.371 77.336  -8.346  1.00 27.13  ? 239  ASP B CA    1 
ATOM   6811  C C     . ASP B 1 239 ? -15.493 78.360  -8.369  1.00 27.45  ? 239  ASP B C     1 
ATOM   6812  O O     . ASP B 1 239 ? -15.347 79.433  -8.956  1.00 27.56  ? 239  ASP B O     1 
ATOM   6813  C CB    . ASP B 1 239 ? -14.665 76.315  -9.436  1.00 27.89  ? 239  ASP B CB    1 
ATOM   6814  C CG    . ASP B 1 239 ? -13.431 75.862  -10.137 1.00 29.24  ? 239  ASP B CG    1 
ATOM   6815  O OD1   . ASP B 1 239 ? -12.889 76.656  -10.947 1.00 31.26  ? 239  ASP B OD1   1 
ATOM   6816  O OD2   . ASP B 1 239 ? -13.013 74.714  -9.872  1.00 30.71  ? 239  ASP B OD2   1 
ATOM   6817  N N     . LEU B 1 240 ? -16.622 78.008  -7.757  1.00 27.69  ? 240  LEU B N     1 
ATOM   6818  C CA    . LEU B 1 240 ? -17.793 78.874  -7.753  1.00 27.97  ? 240  LEU B CA    1 
ATOM   6819  C C     . LEU B 1 240 ? -17.591 80.095  -6.885  1.00 28.35  ? 240  LEU B C     1 
ATOM   6820  O O     . LEU B 1 240 ? -17.877 81.214  -7.316  1.00 28.40  ? 240  LEU B O     1 
ATOM   6821  C CB    . LEU B 1 240 ? -19.046 78.117  -7.301  1.00 27.79  ? 240  LEU B CB    1 
ATOM   6822  C CG    . LEU B 1 240 ? -19.771 77.232  -8.316  1.00 27.19  ? 240  LEU B CG    1 
ATOM   6823  C CD1   . LEU B 1 240 ? -20.933 76.538  -7.638  1.00 25.70  ? 240  LEU B CD1   1 
ATOM   6824  C CD2   . LEU B 1 240 ? -20.247 78.030  -9.520  1.00 26.29  ? 240  LEU B CD2   1 
ATOM   6825  N N     . ILE B 1 241 ? -17.098 79.880  -5.669  1.00 28.87  ? 241  ILE B N     1 
ATOM   6826  C CA    . ILE B 1 241 ? -16.969 80.964  -4.695  1.00 29.66  ? 241  ILE B CA    1 
ATOM   6827  C C     . ILE B 1 241 ? -15.902 81.987  -5.113  1.00 30.35  ? 241  ILE B C     1 
ATOM   6828  O O     . ILE B 1 241 ? -16.124 83.200  -5.014  1.00 30.25  ? 241  ILE B O     1 
ATOM   6829  C CB    . ILE B 1 241 ? -16.757 80.429  -3.237  1.00 29.66  ? 241  ILE B CB    1 
ATOM   6830  C CG1   . ILE B 1 241 ? -17.145 81.500  -2.209  1.00 29.76  ? 241  ILE B CG1   1 
ATOM   6831  C CG2   . ILE B 1 241 ? -15.331 79.876  -3.019  1.00 29.79  ? 241  ILE B CG2   1 
ATOM   6832  C CD1   . ILE B 1 241 ? -17.350 80.986  -0.779  1.00 29.57  ? 241  ILE B CD1   1 
ATOM   6833  N N     . GLU B 1 242 ? -14.773 81.496  -5.620  1.00 31.09  ? 242  GLU B N     1 
ATOM   6834  C CA    . GLU B 1 242 ? -13.667 82.367  -6.031  1.00 32.16  ? 242  GLU B CA    1 
ATOM   6835  C C     . GLU B 1 242 ? -13.939 83.204  -7.297  1.00 32.35  ? 242  GLU B C     1 
ATOM   6836  O O     . GLU B 1 242 ? -13.244 84.195  -7.548  1.00 32.60  ? 242  GLU B O     1 
ATOM   6837  C CB    . GLU B 1 242 ? -12.368 81.566  -6.162  1.00 32.03  ? 242  GLU B CB    1 
ATOM   6838  C CG    . GLU B 1 242 ? -11.682 81.277  -4.824  1.00 32.37  ? 242  GLU B CG    1 
ATOM   6839  C CD    . GLU B 1 242 ? -10.461 80.357  -4.954  1.00 33.10  ? 242  GLU B CD    1 
ATOM   6840  O OE1   . GLU B 1 242 ? -9.920  80.194  -6.078  1.00 33.08  ? 242  GLU B OE1   1 
ATOM   6841  O OE2   . GLU B 1 242 ? -10.037 79.800  -3.916  1.00 35.01  ? 242  GLU B OE2   1 
ATOM   6842  N N     . LYS B 1 243 ? -14.944 82.816  -8.082  1.00 32.58  ? 243  LYS B N     1 
ATOM   6843  C CA    . LYS B 1 243 ? -15.332 83.603  -9.254  1.00 32.97  ? 243  LYS B CA    1 
ATOM   6844  C C     . LYS B 1 243 ? -16.483 84.589  -8.963  1.00 33.10  ? 243  LYS B C     1 
ATOM   6845  O O     . LYS B 1 243 ? -16.895 85.360  -9.839  1.00 33.08  ? 243  LYS B O     1 
ATOM   6846  C CB    . LYS B 1 243 ? -15.657 82.695  -10.452 1.00 33.01  ? 243  LYS B CB    1 
ATOM   6847  C CG    . LYS B 1 243 ? -17.090 82.187  -10.495 1.00 33.72  ? 243  LYS B CG    1 
ATOM   6848  C CD    . LYS B 1 243 ? -17.472 81.680  -11.879 1.00 35.11  ? 243  LYS B CD    1 
ATOM   6849  C CE    . LYS B 1 243 ? -17.028 80.234  -12.092 1.00 35.85  ? 243  LYS B CE    1 
ATOM   6850  N NZ    . LYS B 1 243 ? -17.750 79.579  -13.225 1.00 35.99  ? 243  LYS B NZ    1 
ATOM   6851  N N     . ALA B 1 244 ? -16.987 84.572  -7.729  1.00 33.03  ? 244  ALA B N     1 
ATOM   6852  C CA    . ALA B 1 244 ? -18.115 85.421  -7.350  1.00 32.94  ? 244  ALA B CA    1 
ATOM   6853  C C     . ALA B 1 244 ? -17.695 86.639  -6.513  1.00 32.75  ? 244  ALA B C     1 
ATOM   6854  O O     . ALA B 1 244 ? -16.742 86.566  -5.718  1.00 32.67  ? 244  ALA B O     1 
ATOM   6855  C CB    . ALA B 1 244 ? -19.182 84.596  -6.621  1.00 32.92  ? 244  ALA B CB    1 
ATOM   6856  N N     . SER B 1 245 ? -18.423 87.743  -6.698  1.00 32.28  ? 245  SER B N     1 
ATOM   6857  C CA    . SER B 1 245 ? -18.188 88.985  -5.953  1.00 32.15  ? 245  SER B CA    1 
ATOM   6858  C C     . SER B 1 245 ? -18.477 88.824  -4.461  1.00 31.88  ? 245  SER B C     1 
ATOM   6859  O O     . SER B 1 245 ? -19.470 88.174  -4.087  1.00 31.47  ? 245  SER B O     1 
ATOM   6860  C CB    . SER B 1 245 ? -19.029 90.131  -6.535  1.00 32.47  ? 245  SER B CB    1 
ATOM   6861  O OG    . SER B 1 245 ? -19.001 91.290  -5.705  1.00 32.84  ? 245  SER B OG    1 
ATOM   6862  N N     . PRO B 1 246 ? -17.611 89.414  -3.602  1.00 31.62  ? 246  PRO B N     1 
ATOM   6863  C CA    . PRO B 1 246 ? -17.832 89.388  -2.151  1.00 31.19  ? 246  PRO B CA    1 
ATOM   6864  C C     . PRO B 1 246 ? -18.685 90.571  -1.692  1.00 30.95  ? 246  PRO B C     1 
ATOM   6865  O O     . PRO B 1 246 ? -18.739 90.873  -0.489  1.00 30.93  ? 246  PRO B O     1 
ATOM   6866  C CB    . PRO B 1 246 ? -16.417 89.493  -1.578  1.00 31.26  ? 246  PRO B CB    1 
ATOM   6867  C CG    . PRO B 1 246 ? -15.600 90.190  -2.657  1.00 31.46  ? 246  PRO B CG    1 
ATOM   6868  C CD    . PRO B 1 246 ? -16.376 90.145  -3.954  1.00 31.66  ? 246  PRO B CD    1 
ATOM   6869  N N     . GLU B 1 247 ? -19.331 91.229  -2.658  1.00 30.27  ? 247  GLU B N     1 
ATOM   6870  C CA    . GLU B 1 247 ? -20.209 92.362  -2.401  1.00 29.80  ? 247  GLU B CA    1 
ATOM   6871  C C     . GLU B 1 247 ? -21.652 91.924  -2.565  1.00 29.28  ? 247  GLU B C     1 
ATOM   6872  O O     . GLU B 1 247 ? -22.094 91.598  -3.672  1.00 28.96  ? 247  GLU B O     1 
ATOM   6873  C CB    . GLU B 1 247 ? -19.913 93.506  -3.374  1.00 29.98  ? 247  GLU B CB    1 
ATOM   6874  C CG    . GLU B 1 247 ? -18.453 93.919  -3.440  1.00 30.64  ? 247  GLU B CG    1 
ATOM   6875  C CD    . GLU B 1 247 ? -18.139 95.081  -2.529  1.00 32.11  ? 247  GLU B CD    1 
ATOM   6876  O OE1   . GLU B 1 247 ? -18.568 95.055  -1.355  1.00 32.11  ? 247  GLU B OE1   1 
ATOM   6877  O OE2   . GLU B 1 247 ? -17.465 96.028  -2.998  1.00 33.35  ? 247  GLU B OE2   1 
ATOM   6878  N N     . HIS B 1 248 ? -22.382 91.915  -1.459  1.00 28.96  ? 248  HIS B N     1 
ATOM   6879  C CA    . HIS B 1 248 ? -23.789 91.553  -1.479  1.00 28.72  ? 248  HIS B CA    1 
ATOM   6880  C C     . HIS B 1 248 ? -24.594 92.342  -0.450  1.00 29.21  ? 248  HIS B C     1 
ATOM   6881  O O     . HIS B 1 248 ? -24.293 92.326  0.754   1.00 28.81  ? 248  HIS B O     1 
ATOM   6882  C CB    . HIS B 1 248 ? -23.989 90.043  -1.282  1.00 28.09  ? 248  HIS B CB    1 
ATOM   6883  C CG    . HIS B 1 248 ? -25.401 89.608  -1.503  1.00 27.26  ? 248  HIS B CG    1 
ATOM   6884  N ND1   . HIS B 1 248 ? -26.358 89.663  -0.513  1.00 26.35  ? 248  HIS B ND1   1 
ATOM   6885  C CD2   . HIS B 1 248 ? -26.034 89.169  -2.617  1.00 26.99  ? 248  HIS B CD2   1 
ATOM   6886  C CE1   . HIS B 1 248 ? -27.517 89.256  -1.002  1.00 27.06  ? 248  HIS B CE1   1 
ATOM   6887  N NE2   . HIS B 1 248 ? -27.347 88.948  -2.276  1.00 27.48  ? 248  HIS B NE2   1 
ATOM   6888  N N     . GLN B 1 249 ? -25.622 93.028  -0.941  1.00 29.93  ? 249  GLN B N     1 
ATOM   6889  C CA    . GLN B 1 249 ? -26.496 93.824  -0.089  1.00 30.77  ? 249  GLN B CA    1 
ATOM   6890  C C     . GLN B 1 249 ? -27.621 92.935  0.402   1.00 30.92  ? 249  GLN B C     1 
ATOM   6891  O O     . GLN B 1 249 ? -28.355 92.374  -0.410  1.00 31.09  ? 249  GLN B O     1 
ATOM   6892  C CB    . GLN B 1 249 ? -27.078 95.013  -0.860  1.00 31.10  ? 249  GLN B CB    1 
ATOM   6893  C CG    . GLN B 1 249 ? -26.086 95.754  -1.788  1.00 33.21  ? 249  GLN B CG    1 
ATOM   6894  C CD    . GLN B 1 249 ? -24.966 96.491  -1.045  1.00 34.92  ? 249  GLN B CD    1 
ATOM   6895  O OE1   . GLN B 1 249 ? -24.972 96.609  0.192   1.00 35.88  ? 249  GLN B OE1   1 
ATOM   6896  N NE2   . GLN B 1 249 ? -23.995 96.986  -1.806  1.00 34.84  ? 249  GLN B NE2   1 
ATOM   6897  N N     . PRO B 1 250 ? -27.771 92.808  1.732   1.00 31.10  ? 250  PRO B N     1 
ATOM   6898  C CA    . PRO B 1 250 ? -28.850 91.970  2.249   1.00 31.23  ? 250  PRO B CA    1 
ATOM   6899  C C     . PRO B 1 250 ? -30.205 92.668  2.068   1.00 31.54  ? 250  PRO B C     1 
ATOM   6900  O O     . PRO B 1 250 ? -30.371 93.824  2.471   1.00 31.56  ? 250  PRO B O     1 
ATOM   6901  C CB    . PRO B 1 250 ? -28.496 91.811  3.733   1.00 31.34  ? 250  PRO B CB    1 
ATOM   6902  C CG    . PRO B 1 250 ? -27.634 92.989  4.065   1.00 30.86  ? 250  PRO B CG    1 
ATOM   6903  C CD    . PRO B 1 250 ? -26.988 93.460  2.802   1.00 31.15  ? 250  PRO B CD    1 
ATOM   6904  N N     . GLU B 1 251 ? -31.156 91.982  1.440   1.00 31.60  ? 251  GLU B N     1 
ATOM   6905  C CA    . GLU B 1 251 ? -32.469 92.578  1.201   1.00 31.56  ? 251  GLU B CA    1 
ATOM   6906  C C     . GLU B 1 251 ? -33.497 92.154  2.247   1.00 30.53  ? 251  GLU B C     1 
ATOM   6907  O O     . GLU B 1 251 ? -33.368 91.100  2.879   1.00 30.87  ? 251  GLU B O     1 
ATOM   6908  C CB    . GLU B 1 251 ? -32.976 92.273  -0.215  1.00 31.79  ? 251  GLU B CB    1 
ATOM   6909  C CG    . GLU B 1 251 ? -32.355 93.116  -1.318  1.00 32.15  ? 251  GLU B CG    1 
ATOM   6910  C CD    . GLU B 1 251 ? -32.771 92.642  -2.703  1.00 33.15  ? 251  GLU B CD    1 
ATOM   6911  O OE1   . GLU B 1 251 ? -31.873 92.345  -3.524  1.00 35.47  ? 251  GLU B OE1   1 
ATOM   6912  O OE2   . GLU B 1 251 ? -33.994 92.554  -2.975  1.00 35.16  ? 251  GLU B OE2   1 
ATOM   6913  N N     . ALA B 1 252 ? -34.517 92.992  2.401   1.00 29.55  ? 252  ALA B N     1 
ATOM   6914  C CA    . ALA B 1 252 ? -35.529 92.857  3.437   1.00 28.59  ? 252  ALA B CA    1 
ATOM   6915  C C     . ALA B 1 252 ? -36.434 91.633  3.268   1.00 28.02  ? 252  ALA B C     1 
ATOM   6916  O O     . ALA B 1 252 ? -37.035 91.412  2.210   1.00 27.66  ? 252  ALA B O     1 
ATOM   6917  C CB    . ALA B 1 252 ? -36.356 94.131  3.519   1.00 28.34  ? 252  ALA B CB    1 
ATOM   6918  N N     . MET B 1 253 ? -36.504 90.838  4.328   1.00 27.26  ? 253  MET B N     1 
ATOM   6919  C CA    . MET B 1 253 ? -37.393 89.691  4.387   1.00 26.88  ? 253  MET B CA    1 
ATOM   6920  C C     . MET B 1 253 ? -38.478 90.017  5.401   1.00 26.50  ? 253  MET B C     1 
ATOM   6921  O O     . MET B 1 253 ? -38.196 90.618  6.436   1.00 26.45  ? 253  MET B O     1 
ATOM   6922  C CB    . MET B 1 253 ? -36.620 88.431  4.815   1.00 27.17  ? 253  MET B CB    1 
ATOM   6923  C CG    . MET B 1 253 ? -35.376 88.136  3.971   1.00 27.63  ? 253  MET B CG    1 
ATOM   6924  S SD    . MET B 1 253 ? -35.806 87.539  2.322   1.00 30.09  ? 253  MET B SD    1 
ATOM   6925  C CE    . MET B 1 253 ? -34.565 88.324  1.269   1.00 28.30  ? 253  MET B CE    1 
ATOM   6926  N N     . ASN B 1 254 ? -39.717 89.630  5.105   1.00 26.06  ? 254  ASN B N     1 
ATOM   6927  C CA    . ASN B 1 254 ? -40.800 89.719  6.086   1.00 25.23  ? 254  ASN B CA    1 
ATOM   6928  C C     . ASN B 1 254 ? -40.521 88.764  7.247   1.00 24.30  ? 254  ASN B C     1 
ATOM   6929  O O     . ASN B 1 254 ? -39.969 87.671  7.042   1.00 23.93  ? 254  ASN B O     1 
ATOM   6930  C CB    . ASN B 1 254 ? -42.159 89.420  5.436   1.00 25.50  ? 254  ASN B CB    1 
ATOM   6931  C CG    . ASN B 1 254 ? -43.339 89.718  6.366   1.00 27.46  ? 254  ASN B CG    1 
ATOM   6932  O OD1   . ASN B 1 254 ? -43.933 88.801  6.965   1.00 29.02  ? 254  ASN B OD1   1 
ATOM   6933  N ND2   . ASN B 1 254 ? -43.674 91.007  6.505   1.00 27.90  ? 254  ASN B ND2   1 
ATOM   6934  N N     . ALA B 1 255 ? -40.884 89.185  8.460   1.00 23.10  ? 255  ALA B N     1 
ATOM   6935  C CA    . ALA B 1 255 ? -40.683 88.376  9.669   1.00 22.35  ? 255  ALA B CA    1 
ATOM   6936  C C     . ALA B 1 255 ? -41.198 86.953  9.493   1.00 21.67  ? 255  ALA B C     1 
ATOM   6937  O O     . ALA B 1 255 ? -40.577 86.006  9.960   1.00 21.41  ? 255  ALA B O     1 
ATOM   6938  C CB    . ALA B 1 255 ? -41.329 89.038  10.881  1.00 22.05  ? 255  ALA B CB    1 
ATOM   6939  N N     . GLU B 1 256 ? -42.310 86.820  8.772   1.00 21.18  ? 256  GLU B N     1 
ATOM   6940  C CA    . GLU B 1 256 ? -42.969 85.539  8.565   1.00 20.63  ? 256  GLU B CA    1 
ATOM   6941  C C     . GLU B 1 256 ? -42.580 84.819  7.274   1.00 20.32  ? 256  GLU B C     1 
ATOM   6942  O O     . GLU B 1 256 ? -43.191 83.799  6.938   1.00 19.73  ? 256  GLU B O     1 
ATOM   6943  C CB    . GLU B 1 256 ? -44.497 85.700  8.660   1.00 20.75  ? 256  GLU B CB    1 
ATOM   6944  C CG    . GLU B 1 256 ? -44.999 86.019  10.069  1.00 21.01  ? 256  GLU B CG    1 
ATOM   6945  C CD    . GLU B 1 256 ? -44.591 84.970  11.106  1.00 22.47  ? 256  GLU B CD    1 
ATOM   6946  O OE1   . GLU B 1 256 ? -44.383 83.790  10.737  1.00 22.73  ? 256  GLU B OE1   1 
ATOM   6947  O OE2   . GLU B 1 256 ? -44.485 85.328  12.295  1.00 21.41  ? 256  GLU B OE2   1 
ATOM   6948  N N     . ASP B 1 257 ? -41.584 85.354  6.557   1.00 20.15  ? 257  ASP B N     1 
ATOM   6949  C CA    . ASP B 1 257 ? -40.936 84.642  5.443   1.00 20.37  ? 257  ASP B CA    1 
ATOM   6950  C C     . ASP B 1 257 ? -40.219 83.388  5.983   1.00 20.52  ? 257  ASP B C     1 
ATOM   6951  O O     . ASP B 1 257 ? -39.496 83.478  6.978   1.00 20.59  ? 257  ASP B O     1 
ATOM   6952  C CB    . ASP B 1 257 ? -39.932 85.550  4.704   1.00 20.44  ? 257  ASP B CB    1 
ATOM   6953  C CG    . ASP B 1 257 ? -40.600 86.482  3.688   1.00 21.17  ? 257  ASP B CG    1 
ATOM   6954  O OD1   . ASP B 1 257 ? -41.724 86.154  3.223   1.00 21.65  ? 257  ASP B OD1   1 
ATOM   6955  O OD2   . ASP B 1 257 ? -39.994 87.537  3.348   1.00 20.97  ? 257  ASP B OD2   1 
ATOM   6956  N N     . PRO B 1 258 ? -40.431 82.215  5.342   1.00 20.65  ? 258  PRO B N     1 
ATOM   6957  C CA    . PRO B 1 258 ? -39.836 80.971  5.852   1.00 20.66  ? 258  PRO B CA    1 
ATOM   6958  C C     . PRO B 1 258 ? -38.306 80.953  5.800   1.00 20.85  ? 258  PRO B C     1 
ATOM   6959  O O     . PRO B 1 258 ? -37.712 81.367  4.791   1.00 21.17  ? 258  PRO B O     1 
ATOM   6960  C CB    . PRO B 1 258 ? -40.428 79.893  4.940   1.00 20.75  ? 258  PRO B CB    1 
ATOM   6961  C CG    . PRO B 1 258 ? -40.839 80.615  3.706   1.00 21.09  ? 258  PRO B CG    1 
ATOM   6962  C CD    . PRO B 1 258 ? -41.241 81.988  4.128   1.00 20.30  ? 258  PRO B CD    1 
ATOM   6963  N N     . LEU B 1 259 ? -37.684 80.469  6.881   1.00 20.56  ? 259  LEU B N     1 
ATOM   6964  C CA    . LEU B 1 259 ? -36.228 80.488  7.026   1.00 20.02  ? 259  LEU B CA    1 
ATOM   6965  C C     . LEU B 1 259 ? -35.613 79.118  6.758   1.00 20.18  ? 259  LEU B C     1 
ATOM   6966  O O     . LEU B 1 259 ? -34.636 78.990  6.018   1.00 21.08  ? 259  LEU B O     1 
ATOM   6967  C CB    . LEU B 1 259 ? -35.847 80.980  8.421   1.00 19.88  ? 259  LEU B CB    1 
ATOM   6968  C CG    . LEU B 1 259 ? -34.382 80.930  8.862   1.00 19.14  ? 259  LEU B CG    1 
ATOM   6969  C CD1   . LEU B 1 259 ? -33.501 81.923  8.101   1.00 17.64  ? 259  LEU B CD1   1 
ATOM   6970  C CD2   . LEU B 1 259 ? -34.326 81.205  10.331  1.00 18.28  ? 259  LEU B CD2   1 
ATOM   6971  N N     . PHE B 1 260 ? -36.181 78.090  7.369   1.00 19.63  ? 260  PHE B N     1 
ATOM   6972  C CA    . PHE B 1 260 ? -35.754 76.741  7.094   1.00 19.15  ? 260  PHE B CA    1 
ATOM   6973  C C     . PHE B 1 260 ? -36.801 75.667  7.406   1.00 19.44  ? 260  PHE B C     1 
ATOM   6974  O O     . PHE B 1 260 ? -37.813 75.913  8.101   1.00 18.56  ? 260  PHE B O     1 
ATOM   6975  C CB    . PHE B 1 260 ? -34.435 76.434  7.810   1.00 18.99  ? 260  PHE B CB    1 
ATOM   6976  C CG    . PHE B 1 260 ? -34.549 76.337  9.299   1.00 18.38  ? 260  PHE B CG    1 
ATOM   6977  C CD1   . PHE B 1 260 ? -34.989 75.158  9.908   1.00 18.25  ? 260  PHE B CD1   1 
ATOM   6978  C CD2   . PHE B 1 260 ? -34.173 77.405  10.100  1.00 16.61  ? 260  PHE B CD2   1 
ATOM   6979  C CE1   . PHE B 1 260 ? -35.065 75.058  11.300  1.00 17.70  ? 260  PHE B CE1   1 
ATOM   6980  C CE2   . PHE B 1 260 ? -34.253 77.319  11.464  1.00 17.34  ? 260  PHE B CE2   1 
ATOM   6981  C CZ    . PHE B 1 260 ? -34.703 76.139  12.076  1.00 18.12  ? 260  PHE B CZ    1 
ATOM   6982  N N     . ILE B 1 261 ? -36.513 74.480  6.867   1.00 19.27  ? 261  ILE B N     1 
ATOM   6983  C CA    . ILE B 1 261 ? -37.265 73.266  7.099   1.00 20.06  ? 261  ILE B CA    1 
ATOM   6984  C C     . ILE B 1 261 ? -36.306 72.220  7.684   1.00 19.51  ? 261  ILE B C     1 
ATOM   6985  O O     . ILE B 1 261 ? -35.201 72.017  7.159   1.00 19.81  ? 261  ILE B O     1 
ATOM   6986  C CB    . ILE B 1 261 ? -37.910 72.752  5.787   1.00 20.11  ? 261  ILE B CB    1 
ATOM   6987  C CG1   . ILE B 1 261 ? -39.074 73.644  5.382   1.00 20.61  ? 261  ILE B CG1   1 
ATOM   6988  C CG2   . ILE B 1 261 ? -38.443 71.331  5.951   1.00 21.44  ? 261  ILE B CG2   1 
ATOM   6989  C CD1   . ILE B 1 261 ? -39.244 73.731  3.878   1.00 25.77  ? 261  ILE B CD1   1 
ATOM   6990  N N     . LEU B 1 262 ? -36.722 71.608  8.790   1.00 18.96  ? 262  LEU B N     1 
ATOM   6991  C CA    . LEU B 1 262 ? -36.012 70.488  9.411   1.00 18.57  ? 262  LEU B CA    1 
ATOM   6992  C C     . LEU B 1 262 ? -36.891 69.251  9.434   1.00 18.40  ? 262  LEU B C     1 
ATOM   6993  O O     . LEU B 1 262 ? -37.937 69.227  10.091  1.00 18.00  ? 262  LEU B O     1 
ATOM   6994  C CB    . LEU B 1 262 ? -35.566 70.812  10.833  1.00 18.71  ? 262  LEU B CB    1 
ATOM   6995  C CG    . LEU B 1 262 ? -34.072 71.058  11.038  1.00 20.19  ? 262  LEU B CG    1 
ATOM   6996  C CD1   . LEU B 1 262 ? -33.785 71.047  12.513  1.00 19.25  ? 262  LEU B CD1   1 
ATOM   6997  C CD2   . LEU B 1 262 ? -33.192 70.012  10.322  1.00 20.17  ? 262  LEU B CD2   1 
ATOM   6998  N N     . TYR B 1 263 ? -36.483 68.222  8.697   1.00 18.12  ? 263  TYR B N     1 
ATOM   6999  C CA    . TYR B 1 263 ? -37.260 66.998  8.699   1.00 18.02  ? 263  TYR B CA    1 
ATOM   7000  C C     . TYR B 1 263 ? -37.136 66.362  10.067  1.00 18.43  ? 263  TYR B C     1 
ATOM   7001  O O     . TYR B 1 263 ? -36.035 66.275  10.632  1.00 18.61  ? 263  TYR B O     1 
ATOM   7002  C CB    . TYR B 1 263 ? -36.882 66.089  7.526   1.00 18.15  ? 263  TYR B CB    1 
ATOM   7003  C CG    . TYR B 1 263 ? -37.497 66.631  6.263   1.00 18.10  ? 263  TYR B CG    1 
ATOM   7004  C CD1   . TYR B 1 263 ? -36.852 67.610  5.508   1.00 18.26  ? 263  TYR B CD1   1 
ATOM   7005  C CD2   . TYR B 1 263 ? -38.776 66.235  5.876   1.00 18.41  ? 263  TYR B CD2   1 
ATOM   7006  C CE1   . TYR B 1 263 ? -37.441 68.145  4.364   1.00 18.70  ? 263  TYR B CE1   1 
ATOM   7007  C CE2   . TYR B 1 263 ? -39.374 66.752  4.749   1.00 18.49  ? 263  TYR B CE2   1 
ATOM   7008  C CZ    . TYR B 1 263 ? -38.703 67.704  3.993   1.00 19.76  ? 263  TYR B CZ    1 
ATOM   7009  O OH    . TYR B 1 263 ? -39.323 68.211  2.878   1.00 20.53  ? 263  TYR B OH    1 
ATOM   7010  N N     . THR B 1 264 ? -38.292 66.012  10.627  1.00 17.90  ? 264  THR B N     1 
ATOM   7011  C CA    . THR B 1 264 ? -38.377 65.579  11.995  1.00 17.60  ? 264  THR B CA    1 
ATOM   7012  C C     . THR B 1 264 ? -39.306 64.388  12.073  1.00 18.34  ? 264  THR B C     1 
ATOM   7013  O O     . THR B 1 264 ? -40.427 64.424  11.546  1.00 18.54  ? 264  THR B O     1 
ATOM   7014  C CB    . THR B 1 264 ? -38.922 66.707  12.907  1.00 17.26  ? 264  THR B CB    1 
ATOM   7015  O OG1   . THR B 1 264 ? -38.128 67.893  12.730  1.00 15.76  ? 264  THR B OG1   1 
ATOM   7016  C CG2   . THR B 1 264 ? -38.882 66.262  14.355  1.00 14.05  ? 264  THR B CG2   1 
ATOM   7017  N N     . SER B 1 265 ? -38.824 63.343  12.732  1.00 18.97  ? 265  SER B N     1 
ATOM   7018  C CA    . SER B 1 265 ? -39.604 62.130  12.972  1.00 20.37  ? 265  SER B CA    1 
ATOM   7019  C C     . SER B 1 265 ? -40.789 62.395  13.902  1.00 20.94  ? 265  SER B C     1 
ATOM   7020  O O     . SER B 1 265 ? -40.652 63.095  14.912  1.00 21.30  ? 265  SER B O     1 
ATOM   7021  C CB    . SER B 1 265 ? -38.715 61.058  13.606  1.00 19.56  ? 265  SER B CB    1 
ATOM   7022  O OG    . SER B 1 265 ? -37.640 60.707  12.760  1.00 19.02  ? 265  SER B OG    1 
ATOM   7023  N N     . GLY B 1 266 ? -41.936 61.814  13.577  1.00 21.78  ? 266  GLY B N     1 
ATOM   7024  C CA    . GLY B 1 266 ? -43.090 61.868  14.476  1.00 22.80  ? 266  GLY B CA    1 
ATOM   7025  C C     . GLY B 1 266 ? -43.621 60.502  14.893  1.00 23.95  ? 266  GLY B C     1 
ATOM   7026  O O     . GLY B 1 266 ? -43.041 59.457  14.565  1.00 22.62  ? 266  GLY B O     1 
ATOM   7027  N N     . SER B 1 267 ? -44.744 60.525  15.613  1.00 25.53  ? 267  SER B N     1 
ATOM   7028  C CA    . SER B 1 267 ? -45.398 59.309  16.114  1.00 27.50  ? 267  SER B CA    1 
ATOM   7029  C C     . SER B 1 267 ? -45.910 58.442  14.970  1.00 28.36  ? 267  SER B C     1 
ATOM   7030  O O     . SER B 1 267 ? -45.899 57.210  15.067  1.00 29.26  ? 267  SER B O     1 
ATOM   7031  C CB    . SER B 1 267 ? -46.559 59.670  17.053  1.00 27.76  ? 267  SER B CB    1 
ATOM   7032  O OG    . SER B 1 267 ? -46.851 58.613  17.966  1.00 29.09  ? 267  SER B OG    1 
ATOM   7033  N N     . THR B 1 268 ? -46.343 59.093  13.889  1.00 28.97  ? 268  THR B N     1 
ATOM   7034  C CA    . THR B 1 268 ? -46.938 58.412  12.741  1.00 29.59  ? 268  THR B CA    1 
ATOM   7035  C C     . THR B 1 268 ? -46.267 58.881  11.463  1.00 29.48  ? 268  THR B C     1 
ATOM   7036  O O     . THR B 1 268 ? -45.827 60.022  11.373  1.00 29.78  ? 268  THR B O     1 
ATOM   7037  C CB    . THR B 1 268 ? -48.466 58.707  12.622  1.00 29.88  ? 268  THR B CB    1 
ATOM   7038  O OG1   . THR B 1 268 ? -48.674 60.081  12.263  1.00 31.08  ? 268  THR B OG1   1 
ATOM   7039  C CG2   . THR B 1 268 ? -49.200 58.409  13.937  1.00 30.58  ? 268  THR B CG2   1 
ATOM   7040  N N     . GLY B 1 269 ? -46.190 57.991  10.479  1.00 29.37  ? 269  GLY B N     1 
ATOM   7041  C CA    . GLY B 1 269 ? -45.667 58.326  9.162   1.00 28.98  ? 269  GLY B CA    1 
ATOM   7042  C C     . GLY B 1 269 ? -44.186 58.634  9.102   1.00 29.07  ? 269  GLY B C     1 
ATOM   7043  O O     . GLY B 1 269 ? -43.438 58.397  10.058  1.00 29.66  ? 269  GLY B O     1 
ATOM   7044  N N     . LYS B 1 270 ? -43.762 59.159  7.960   1.00 28.51  ? 270  LYS B N     1 
ATOM   7045  C CA    . LYS B 1 270 ? -42.367 59.493  7.737   1.00 28.54  ? 270  LYS B CA    1 
ATOM   7046  C C     . LYS B 1 270 ? -42.083 60.902  8.271   1.00 26.98  ? 270  LYS B C     1 
ATOM   7047  O O     . LYS B 1 270 ? -43.025 61.675  8.490   1.00 27.03  ? 270  LYS B O     1 
ATOM   7048  C CB    . LYS B 1 270 ? -42.036 59.360  6.244   1.00 28.60  ? 270  LYS B CB    1 
ATOM   7049  C CG    . LYS B 1 270 ? -42.445 57.991  5.669   1.00 30.97  ? 270  LYS B CG    1 
ATOM   7050  C CD    . LYS B 1 270 ? -41.785 57.645  4.316   1.00 30.85  ? 270  LYS B CD    1 
ATOM   7051  C CE    . LYS B 1 270 ? -40.648 56.643  4.488   1.00 33.67  ? 270  LYS B CE    1 
ATOM   7052  N NZ    . LYS B 1 270 ? -40.282 56.041  3.161   1.00 35.92  ? 270  LYS B NZ    1 
ATOM   7053  N N     . PRO B 1 271 ? -40.794 61.241  8.492   1.00 25.55  ? 271  PRO B N     1 
ATOM   7054  C CA    . PRO B 1 271 ? -40.430 62.578  8.942   1.00 24.64  ? 271  PRO B CA    1 
ATOM   7055  C C     . PRO B 1 271 ? -41.042 63.680  8.068   1.00 23.84  ? 271  PRO B C     1 
ATOM   7056  O O     . PRO B 1 271 ? -41.047 63.557  6.847   1.00 23.46  ? 271  PRO B O     1 
ATOM   7057  C CB    . PRO B 1 271 ? -38.908 62.582  8.804   1.00 24.59  ? 271  PRO B CB    1 
ATOM   7058  C CG    . PRO B 1 271 ? -38.520 61.170  9.029   1.00 24.66  ? 271  PRO B CG    1 
ATOM   7059  C CD    . PRO B 1 271 ? -39.601 60.386  8.329   1.00 25.88  ? 271  PRO B CD    1 
ATOM   7060  N N     . LYS B 1 272 ? -41.576 64.723  8.700   1.00 22.98  ? 272  LYS B N     1 
ATOM   7061  C CA    . LYS B 1 272 ? -42.124 65.873  7.975   1.00 22.65  ? 272  LYS B CA    1 
ATOM   7062  C C     . LYS B 1 272 ? -41.228 67.074  8.217   1.00 21.68  ? 272  LYS B C     1 
ATOM   7063  O O     . LYS B 1 272 ? -40.518 67.126  9.216   1.00 21.40  ? 272  LYS B O     1 
ATOM   7064  C CB    . LYS B 1 272 ? -43.555 66.208  8.416   1.00 22.73  ? 272  LYS B CB    1 
ATOM   7065  C CG    . LYS B 1 272 ? -44.495 65.044  8.509   1.00 23.99  ? 272  LYS B CG    1 
ATOM   7066  C CD    . LYS B 1 272 ? -44.943 64.554  7.148   1.00 26.57  ? 272  LYS B CD    1 
ATOM   7067  C CE    . LYS B 1 272 ? -45.911 63.368  7.326   1.00 28.47  ? 272  LYS B CE    1 
ATOM   7068  N NZ    . LYS B 1 272 ? -46.439 62.889  6.035   1.00 29.86  ? 272  LYS B NZ    1 
ATOM   7069  N N     . GLY B 1 273 ? -41.264 68.028  7.292   1.00 21.04  ? 273  GLY B N     1 
ATOM   7070  C CA    . GLY B 1 273 ? -40.437 69.212  7.384   1.00 20.39  ? 273  GLY B CA    1 
ATOM   7071  C C     . GLY B 1 273 ? -41.011 70.237  8.350   1.00 19.82  ? 273  GLY B C     1 
ATOM   7072  O O     . GLY B 1 273 ? -42.004 70.881  8.064   1.00 19.60  ? 273  GLY B O     1 
ATOM   7073  N N     . VAL B 1 274 ? -40.375 70.383  9.501   1.00 19.61  ? 274  VAL B N     1 
ATOM   7074  C CA    . VAL B 1 274 ? -40.783 71.394  10.467  1.00 18.66  ? 274  VAL B CA    1 
ATOM   7075  C C     . VAL B 1 274 ? -40.287 72.727  9.947   1.00 18.87  ? 274  VAL B C     1 
ATOM   7076  O O     . VAL B 1 274 ? -39.075 72.908  9.734   1.00 18.78  ? 274  VAL B O     1 
ATOM   7077  C CB    . VAL B 1 274 ? -40.244 71.094  11.877  1.00 18.69  ? 274  VAL B CB    1 
ATOM   7078  C CG1   . VAL B 1 274 ? -40.557 72.260  12.852  1.00 18.14  ? 274  VAL B CG1   1 
ATOM   7079  C CG2   . VAL B 1 274 ? -40.833 69.794  12.386  1.00 17.73  ? 274  VAL B CG2   1 
ATOM   7080  N N     . LEU B 1 275 ? -41.234 73.644  9.711   1.00 18.28  ? 275  LEU B N     1 
ATOM   7081  C CA    . LEU B 1 275 ? -40.935 74.940  9.095   1.00 17.71  ? 275  LEU B CA    1 
ATOM   7082  C C     . LEU B 1 275 ? -40.872 76.069  10.133  1.00 17.71  ? 275  LEU B C     1 
ATOM   7083  O O     . LEU B 1 275 ? -41.826 76.299  10.890  1.00 17.62  ? 275  LEU B O     1 
ATOM   7084  C CB    . LEU B 1 275 ? -41.954 75.266  7.987   1.00 17.39  ? 275  LEU B CB    1 
ATOM   7085  C CG    . LEU B 1 275 ? -41.714 76.517  7.106   1.00 17.68  ? 275  LEU B CG    1 
ATOM   7086  C CD1   . LEU B 1 275 ? -42.249 76.309  5.679   1.00 16.83  ? 275  LEU B CD1   1 
ATOM   7087  C CD2   . LEU B 1 275 ? -42.296 77.800  7.736   1.00 13.96  ? 275  LEU B CD2   1 
ATOM   7088  N N     . HIS B 1 276 ? -39.729 76.755  10.152  1.00 17.67  ? 276  HIS B N     1 
ATOM   7089  C CA    . HIS B 1 276 ? -39.531 77.965  10.934  1.00 17.05  ? 276  HIS B CA    1 
ATOM   7090  C C     . HIS B 1 276 ? -39.442 79.196  10.044  1.00 17.10  ? 276  HIS B C     1 
ATOM   7091  O O     . HIS B 1 276 ? -38.793 79.176  8.993   1.00 16.25  ? 276  HIS B O     1 
ATOM   7092  C CB    . HIS B 1 276 ? -38.273 77.854  11.795  1.00 16.99  ? 276  HIS B CB    1 
ATOM   7093  C CG    . HIS B 1 276 ? -38.463 76.990  12.997  1.00 16.93  ? 276  HIS B CG    1 
ATOM   7094  N ND1   . HIS B 1 276 ? -39.127 77.424  14.127  1.00 16.08  ? 276  HIS B ND1   1 
ATOM   7095  C CD2   . HIS B 1 276 ? -38.124 75.701  13.229  1.00 15.48  ? 276  HIS B CD2   1 
ATOM   7096  C CE1   . HIS B 1 276 ? -39.172 76.443  15.008  1.00 14.39  ? 276  HIS B CE1   1 
ATOM   7097  N NE2   . HIS B 1 276 ? -38.563 75.390  14.491  1.00 15.63  ? 276  HIS B NE2   1 
ATOM   7098  N N     . THR B 1 277 ? -40.104 80.274  10.473  1.00 17.52  ? 277  THR B N     1 
ATOM   7099  C CA    . THR B 1 277 ? -39.954 81.568  9.785   1.00 17.62  ? 277  THR B CA    1 
ATOM   7100  C C     . THR B 1 277 ? -38.775 82.344  10.387  1.00 17.68  ? 277  THR B C     1 
ATOM   7101  O O     . THR B 1 277 ? -37.862 81.734  10.944  1.00 17.88  ? 277  THR B O     1 
ATOM   7102  C CB    . THR B 1 277 ? -41.280 82.380  9.690   1.00 17.50  ? 277  THR B CB    1 
ATOM   7103  O OG1   . THR B 1 277 ? -41.715 82.799  10.987  1.00 17.44  ? 277  THR B OG1   1 
ATOM   7104  C CG2   . THR B 1 277 ? -42.378 81.548  9.001   1.00 17.84  ? 277  THR B CG2   1 
ATOM   7105  N N     . THR B 1 278 ? -38.787 83.669  10.293  1.00 17.80  ? 278  THR B N     1 
ATOM   7106  C CA    . THR B 1 278 ? -37.548 84.436  10.460  1.00 17.39  ? 278  THR B CA    1 
ATOM   7107  C C     . THR B 1 278 ? -37.469 85.317  11.713  1.00 17.46  ? 278  THR B C     1 
ATOM   7108  O O     . THR B 1 278 ? -36.498 85.235  12.480  1.00 17.06  ? 278  THR B O     1 
ATOM   7109  C CB    . THR B 1 278 ? -37.277 85.289  9.202   1.00 17.46  ? 278  THR B CB    1 
ATOM   7110  O OG1   . THR B 1 278 ? -37.328 84.445  8.046   1.00 17.65  ? 278  THR B OG1   1 
ATOM   7111  C CG2   . THR B 1 278 ? -35.914 85.988  9.282   1.00 16.39  ? 278  THR B CG2   1 
ATOM   7112  N N     . GLY B 1 279 ? -38.477 86.168  11.894  1.00 17.07  ? 279  GLY B N     1 
ATOM   7113  C CA    . GLY B 1 279 ? -38.464 87.171  12.946  1.00 17.63  ? 279  GLY B CA    1 
ATOM   7114  C C     . GLY B 1 279 ? -38.472 86.599  14.348  1.00 17.63  ? 279  GLY B C     1 
ATOM   7115  O O     . GLY B 1 279 ? -37.507 86.766  15.107  1.00 17.82  ? 279  GLY B O     1 
ATOM   7116  N N     . GLY B 1 280 ? -39.575 85.939  14.687  1.00 17.27  ? 280  GLY B N     1 
ATOM   7117  C CA    . GLY B 1 280 ? -39.743 85.314  15.984  1.00 17.03  ? 280  GLY B CA    1 
ATOM   7118  C C     . GLY B 1 280 ? -38.689 84.263  16.255  1.00 17.12  ? 280  GLY B C     1 
ATOM   7119  O O     . GLY B 1 280 ? -38.159 84.190  17.366  1.00 17.61  ? 280  GLY B O     1 
ATOM   7120  N N     . TYR B 1 281 ? -38.377 83.447  15.246  1.00 16.64  ? 281  TYR B N     1 
ATOM   7121  C CA    . TYR B 1 281 ? -37.361 82.409  15.420  1.00 16.36  ? 281  TYR B CA    1 
ATOM   7122  C C     . TYR B 1 281 ? -36.041 82.976  15.919  1.00 16.41  ? 281  TYR B C     1 
ATOM   7123  O O     . TYR B 1 281 ? -35.481 82.482  16.908  1.00 16.87  ? 281  TYR B O     1 
ATOM   7124  C CB    . TYR B 1 281 ? -37.100 81.599  14.140  1.00 16.27  ? 281  TYR B CB    1 
ATOM   7125  C CG    . TYR B 1 281 ? -35.882 80.715  14.301  1.00 16.06  ? 281  TYR B CG    1 
ATOM   7126  C CD1   . TYR B 1 281 ? -35.956 79.488  14.978  1.00 15.16  ? 281  TYR B CD1   1 
ATOM   7127  C CD2   . TYR B 1 281 ? -34.635 81.139  13.849  1.00 17.12  ? 281  TYR B CD2   1 
ATOM   7128  C CE1   . TYR B 1 281 ? -34.813 78.688  15.143  1.00 16.46  ? 281  TYR B CE1   1 
ATOM   7129  C CE2   . TYR B 1 281 ? -33.492 80.352  14.016  1.00 17.15  ? 281  TYR B CE2   1 
ATOM   7130  C CZ    . TYR B 1 281 ? -33.587 79.140  14.657  1.00 16.27  ? 281  TYR B CZ    1 
ATOM   7131  O OH    . TYR B 1 281 ? -32.455 78.399  14.798  1.00 16.11  ? 281  TYR B OH    1 
ATOM   7132  N N     . LEU B 1 282 ? -35.540 83.997  15.222  1.00 16.13  ? 282  LEU B N     1 
ATOM   7133  C CA    . LEU B 1 282 ? -34.257 84.583  15.563  1.00 16.02  ? 282  LEU B CA    1 
ATOM   7134  C C     . LEU B 1 282 ? -34.281 85.383  16.875  1.00 15.89  ? 282  LEU B C     1 
ATOM   7135  O O     . LEU B 1 282 ? -33.327 85.326  17.628  1.00 15.76  ? 282  LEU B O     1 
ATOM   7136  C CB    . LEU B 1 282 ? -33.687 85.421  14.400  1.00 15.77  ? 282  LEU B CB    1 
ATOM   7137  C CG    . LEU B 1 282 ? -32.198 85.800  14.509  1.00 16.10  ? 282  LEU B CG    1 
ATOM   7138  C CD1   . LEU B 1 282 ? -31.317 84.550  14.616  1.00 16.04  ? 282  LEU B CD1   1 
ATOM   7139  C CD2   . LEU B 1 282 ? -31.724 86.710  13.357  1.00 15.40  ? 282  LEU B CD2   1 
ATOM   7140  N N     . VAL B 1 283 ? -35.344 86.135  17.143  1.00 16.24  ? 283  VAL B N     1 
ATOM   7141  C CA    . VAL B 1 283 ? -35.437 86.857  18.425  1.00 16.90  ? 283  VAL B CA    1 
ATOM   7142  C C     . VAL B 1 283 ? -35.322 85.837  19.559  1.00 16.77  ? 283  VAL B C     1 
ATOM   7143  O O     . VAL B 1 283 ? -34.547 86.028  20.499  1.00 16.37  ? 283  VAL B O     1 
ATOM   7144  C CB    . VAL B 1 283 ? -36.776 87.650  18.582  1.00 17.22  ? 283  VAL B CB    1 
ATOM   7145  C CG1   . VAL B 1 283 ? -37.026 88.027  20.045  1.00 17.11  ? 283  VAL B CG1   1 
ATOM   7146  C CG2   . VAL B 1 283 ? -36.799 88.888  17.709  1.00 17.52  ? 283  VAL B CG2   1 
ATOM   7147  N N     . TYR B 1 284 ? -36.098 84.753  19.438  1.00 16.61  ? 284  TYR B N     1 
ATOM   7148  C CA    . TYR B 1 284 ? -36.145 83.701  20.447  1.00 16.36  ? 284  TYR B CA    1 
ATOM   7149  C C     . TYR B 1 284 ? -34.804 82.975  20.578  1.00 16.55  ? 284  TYR B C     1 
ATOM   7150  O O     . TYR B 1 284 ? -34.315 82.780  21.695  1.00 16.32  ? 284  TYR B O     1 
ATOM   7151  C CB    . TYR B 1 284 ? -37.294 82.722  20.168  1.00 15.92  ? 284  TYR B CB    1 
ATOM   7152  C CG    . TYR B 1 284 ? -37.760 82.013  21.408  1.00 16.12  ? 284  TYR B CG    1 
ATOM   7153  C CD1   . TYR B 1 284 ? -37.517 80.641  21.592  1.00 16.89  ? 284  TYR B CD1   1 
ATOM   7154  C CD2   . TYR B 1 284 ? -38.418 82.710  22.418  1.00 14.36  ? 284  TYR B CD2   1 
ATOM   7155  C CE1   . TYR B 1 284 ? -37.944 79.976  22.746  1.00 17.56  ? 284  TYR B CE1   1 
ATOM   7156  C CE2   . TYR B 1 284 ? -38.834 82.062  23.580  1.00 16.35  ? 284  TYR B CE2   1 
ATOM   7157  C CZ    . TYR B 1 284 ? -38.595 80.696  23.746  1.00 16.45  ? 284  TYR B CZ    1 
ATOM   7158  O OH    . TYR B 1 284 ? -39.010 80.065  24.908  1.00 15.46  ? 284  TYR B OH    1 
ATOM   7159  N N     . ALA B 1 285 ? -34.202 82.594  19.446  1.00 16.83  ? 285  ALA B N     1 
ATOM   7160  C CA    . ALA B 1 285 ? -32.884 81.939  19.475  1.00 17.38  ? 285  ALA B CA    1 
ATOM   7161  C C     . ALA B 1 285 ? -31.845 82.820  20.186  1.00 17.50  ? 285  ALA B C     1 
ATOM   7162  O O     . ALA B 1 285 ? -31.143 82.367  21.073  1.00 17.55  ? 285  ALA B O     1 
ATOM   7163  C CB    . ALA B 1 285 ? -32.418 81.581  18.062  1.00 17.10  ? 285  ALA B CB    1 
ATOM   7164  N N     . ALA B 1 286 ? -31.778 84.091  19.802  1.00 18.01  ? 286  ALA B N     1 
ATOM   7165  C CA    . ALA B 1 286 ? -30.819 85.024  20.391  1.00 17.97  ? 286  ALA B CA    1 
ATOM   7166  C C     . ALA B 1 286 ? -31.089 85.307  21.891  1.00 18.03  ? 286  ALA B C     1 
ATOM   7167  O O     . ALA B 1 286 ? -30.160 85.318  22.716  1.00 17.87  ? 286  ALA B O     1 
ATOM   7168  C CB    . ALA B 1 286 ? -30.797 86.315  19.584  1.00 17.44  ? 286  ALA B CB    1 
ATOM   7169  N N     . THR B 1 287 ? -32.355 85.540  22.234  1.00 18.27  ? 287  THR B N     1 
ATOM   7170  C CA    . THR B 1 287 ? -32.753 85.825  23.620  1.00 18.44  ? 287  THR B CA    1 
ATOM   7171  C C     . THR B 1 287 ? -32.424 84.653  24.543  1.00 18.59  ? 287  THR B C     1 
ATOM   7172  O O     . THR B 1 287 ? -31.802 84.845  25.585  1.00 18.34  ? 287  THR B O     1 
ATOM   7173  C CB    . THR B 1 287 ? -34.261 86.176  23.719  1.00 18.33  ? 287  THR B CB    1 
ATOM   7174  O OG1   . THR B 1 287 ? -34.527 87.337  22.924  1.00 17.91  ? 287  THR B OG1   1 
ATOM   7175  C CG2   . THR B 1 287 ? -34.695 86.442  25.182  1.00 17.79  ? 287  THR B CG2   1 
ATOM   7176  N N     . THR B 1 288 ? -32.839 83.447  24.140  1.00 19.04  ? 288  THR B N     1 
ATOM   7177  C CA    . THR B 1 288 ? -32.583 82.232  24.919  1.00 18.99  ? 288  THR B CA    1 
ATOM   7178  C C     . THR B 1 288 ? -31.086 82.014  25.090  1.00 19.26  ? 288  THR B C     1 
ATOM   7179  O O     . THR B 1 288 ? -30.618 81.827  26.196  1.00 19.45  ? 288  THR B O     1 
ATOM   7180  C CB    . THR B 1 288 ? -33.248 80.967  24.313  1.00 18.95  ? 288  THR B CB    1 
ATOM   7181  O OG1   . THR B 1 288 ? -32.929 80.867  22.919  1.00 17.09  ? 288  THR B OG1   1 
ATOM   7182  C CG2   . THR B 1 288 ? -34.754 81.014  24.479  1.00 18.64  ? 288  THR B CG2   1 
ATOM   7183  N N     . PHE B 1 289 ? -30.332 82.078  24.000  1.00 19.78  ? 289  PHE B N     1 
ATOM   7184  C CA    . PHE B 1 289 ? -28.874 81.916  24.085  1.00 20.30  ? 289  PHE B CA    1 
ATOM   7185  C C     . PHE B 1 289 ? -28.236 82.853  25.120  1.00 20.36  ? 289  PHE B C     1 
ATOM   7186  O O     . PHE B 1 289 ? -27.550 82.405  26.048  1.00 20.50  ? 289  PHE B O     1 
ATOM   7187  C CB    . PHE B 1 289 ? -28.221 82.135  22.713  1.00 19.99  ? 289  PHE B CB    1 
ATOM   7188  C CG    . PHE B 1 289 ? -26.723 82.235  22.770  1.00 20.47  ? 289  PHE B CG    1 
ATOM   7189  C CD1   . PHE B 1 289 ? -25.934 81.083  22.786  1.00 19.61  ? 289  PHE B CD1   1 
ATOM   7190  C CD2   . PHE B 1 289 ? -26.097 83.481  22.830  1.00 20.16  ? 289  PHE B CD2   1 
ATOM   7191  C CE1   . PHE B 1 289 ? -24.545 81.171  22.847  1.00 17.44  ? 289  PHE B CE1   1 
ATOM   7192  C CE2   . PHE B 1 289 ? -24.718 83.573  22.888  1.00 19.86  ? 289  PHE B CE2   1 
ATOM   7193  C CZ    . PHE B 1 289 ? -23.942 82.406  22.889  1.00 19.34  ? 289  PHE B CZ    1 
ATOM   7194  N N     . LYS B 1 290 ? -28.455 84.152  24.929  1.00 20.41  ? 290  LYS B N     1 
ATOM   7195  C CA    . LYS B 1 290 ? -27.893 85.192  25.794  1.00 21.02  ? 290  LYS B CA    1 
ATOM   7196  C C     . LYS B 1 290 ? -28.149 84.906  27.277  1.00 20.85  ? 290  LYS B C     1 
ATOM   7197  O O     . LYS B 1 290 ? -27.219 84.847  28.068  1.00 20.73  ? 290  LYS B O     1 
ATOM   7198  C CB    . LYS B 1 290 ? -28.468 86.560  25.401  1.00 20.53  ? 290  LYS B CB    1 
ATOM   7199  C CG    . LYS B 1 290 ? -27.724 87.776  25.951  1.00 21.63  ? 290  LYS B CG    1 
ATOM   7200  C CD    . LYS B 1 290 ? -28.343 89.045  25.385  1.00 21.78  ? 290  LYS B CD    1 
ATOM   7201  C CE    . LYS B 1 290 ? -27.723 90.291  25.958  1.00 25.02  ? 290  LYS B CE    1 
ATOM   7202  N NZ    . LYS B 1 290 ? -28.412 91.539  25.468  1.00 26.69  ? 290  LYS B NZ    1 
ATOM   7203  N N     . TYR B 1 291 ? -29.408 84.691  27.638  1.00 21.45  ? 291  TYR B N     1 
ATOM   7204  C CA    . TYR B 1 291 ? -29.792 84.675  29.049  1.00 21.80  ? 291  TYR B CA    1 
ATOM   7205  C C     . TYR B 1 291 ? -29.514 83.351  29.750  1.00 21.75  ? 291  TYR B C     1 
ATOM   7206  O O     . TYR B 1 291 ? -29.052 83.339  30.898  1.00 21.25  ? 291  TYR B O     1 
ATOM   7207  C CB    . TYR B 1 291 ? -31.259 85.079  29.210  1.00 22.11  ? 291  TYR B CB    1 
ATOM   7208  C CG    . TYR B 1 291 ? -31.545 86.553  28.944  1.00 22.62  ? 291  TYR B CG    1 
ATOM   7209  C CD1   . TYR B 1 291 ? -32.700 86.943  28.261  1.00 23.17  ? 291  TYR B CD1   1 
ATOM   7210  C CD2   . TYR B 1 291 ? -30.675 87.548  29.385  1.00 23.09  ? 291  TYR B CD2   1 
ATOM   7211  C CE1   . TYR B 1 291 ? -32.987 88.276  28.026  1.00 23.99  ? 291  TYR B CE1   1 
ATOM   7212  C CE2   . TYR B 1 291 ? -30.950 88.897  29.151  1.00 24.10  ? 291  TYR B CE2   1 
ATOM   7213  C CZ    . TYR B 1 291 ? -32.111 89.254  28.471  1.00 24.01  ? 291  TYR B CZ    1 
ATOM   7214  O OH    . TYR B 1 291 ? -32.397 90.586  28.234  1.00 22.96  ? 291  TYR B OH    1 
ATOM   7215  N N     . VAL B 1 292 ? -29.795 82.240  29.060  1.00 21.23  ? 292  VAL B N     1 
ATOM   7216  C CA    . VAL B 1 292 ? -29.627 80.915  29.656  1.00 20.79  ? 292  VAL B CA    1 
ATOM   7217  C C     . VAL B 1 292 ? -28.144 80.533  29.796  1.00 20.75  ? 292  VAL B C     1 
ATOM   7218  O O     . VAL B 1 292 ? -27.778 79.881  30.766  1.00 20.84  ? 292  VAL B O     1 
ATOM   7219  C CB    . VAL B 1 292 ? -30.447 79.826  28.916  1.00 20.96  ? 292  VAL B CB    1 
ATOM   7220  C CG1   . VAL B 1 292 ? -30.080 78.424  29.394  1.00 19.62  ? 292  VAL B CG1   1 
ATOM   7221  C CG2   . VAL B 1 292 ? -31.927 80.062  29.115  1.00 20.94  ? 292  VAL B CG2   1 
ATOM   7222  N N     . PHE B 1 293 ? -27.302 80.948  28.849  1.00 20.14  ? 293  PHE B N     1 
ATOM   7223  C CA    . PHE B 1 293 ? -25.858 80.705  28.953  1.00 20.02  ? 293  PHE B CA    1 
ATOM   7224  C C     . PHE B 1 293 ? -25.097 81.878  29.573  1.00 19.87  ? 293  PHE B C     1 
ATOM   7225  O O     . PHE B 1 293 ? -23.865 81.844  29.666  1.00 19.29  ? 293  PHE B O     1 
ATOM   7226  C CB    . PHE B 1 293 ? -25.238 80.369  27.587  1.00 19.90  ? 293  PHE B CB    1 
ATOM   7227  C CG    . PHE B 1 293 ? -25.728 79.093  26.999  1.00 19.57  ? 293  PHE B CG    1 
ATOM   7228  C CD1   . PHE B 1 293 ? -26.408 79.096  25.787  1.00 20.12  ? 293  PHE B CD1   1 
ATOM   7229  C CD2   . PHE B 1 293 ? -25.505 77.884  27.647  1.00 18.71  ? 293  PHE B CD2   1 
ATOM   7230  C CE1   . PHE B 1 293 ? -26.869 77.910  25.236  1.00 20.51  ? 293  PHE B CE1   1 
ATOM   7231  C CE2   . PHE B 1 293 ? -25.956 76.704  27.111  1.00 18.63  ? 293  PHE B CE2   1 
ATOM   7232  C CZ    . PHE B 1 293 ? -26.640 76.706  25.907  1.00 19.97  ? 293  PHE B CZ    1 
ATOM   7233  N N     . ASP B 1 294 ? -25.833 82.910  29.977  1.00 20.15  ? 294  ASP B N     1 
ATOM   7234  C CA    . ASP B 1 294 ? -25.254 84.082  30.629  1.00 20.98  ? 294  ASP B CA    1 
ATOM   7235  C C     . ASP B 1 294 ? -24.088 84.658  29.793  1.00 21.47  ? 294  ASP B C     1 
ATOM   7236  O O     . ASP B 1 294 ? -23.060 85.067  30.346  1.00 21.29  ? 294  ASP B O     1 
ATOM   7237  C CB    . ASP B 1 294 ? -24.802 83.709  32.056  1.00 20.62  ? 294  ASP B CB    1 
ATOM   7238  C CG    . ASP B 1 294 ? -24.728 84.908  32.985  1.00 21.81  ? 294  ASP B CG    1 
ATOM   7239  O OD1   . ASP B 1 294 ? -23.680 85.084  33.648  1.00 22.03  ? 294  ASP B OD1   1 
ATOM   7240  O OD2   . ASP B 1 294 ? -25.715 85.679  33.052  1.00 21.83  ? 294  ASP B OD2   1 
ATOM   7241  N N     . TYR B 1 295 ? -24.250 84.670  28.465  1.00 21.66  ? 295  TYR B N     1 
ATOM   7242  C CA    . TYR B 1 295 ? -23.158 85.064  27.570  1.00 22.63  ? 295  TYR B CA    1 
ATOM   7243  C C     . TYR B 1 295 ? -22.711 86.482  27.804  1.00 22.87  ? 295  TYR B C     1 
ATOM   7244  O O     . TYR B 1 295 ? -23.504 87.419  27.661  1.00 22.67  ? 295  TYR B O     1 
ATOM   7245  C CB    . TYR B 1 295 ? -23.501 84.914  26.076  1.00 22.33  ? 295  TYR B CB    1 
ATOM   7246  C CG    . TYR B 1 295 ? -22.279 85.092  25.184  1.00 23.08  ? 295  TYR B CG    1 
ATOM   7247  C CD1   . TYR B 1 295 ? -21.404 84.033  24.961  1.00 23.18  ? 295  TYR B CD1   1 
ATOM   7248  C CD2   . TYR B 1 295 ? -21.986 86.329  24.575  1.00 23.42  ? 295  TYR B CD2   1 
ATOM   7249  C CE1   . TYR B 1 295 ? -20.267 84.185  24.158  1.00 23.15  ? 295  TYR B CE1   1 
ATOM   7250  C CE2   . TYR B 1 295 ? -20.851 86.493  23.762  1.00 22.68  ? 295  TYR B CE2   1 
ATOM   7251  C CZ    . TYR B 1 295 ? -19.988 85.412  23.565  1.00 23.96  ? 295  TYR B CZ    1 
ATOM   7252  O OH    . TYR B 1 295 ? -18.854 85.536  22.756  1.00 23.30  ? 295  TYR B OH    1 
ATOM   7253  N N     . HIS B 1 296 ? -21.428 86.618  28.135  1.00 23.68  ? 296  HIS B N     1 
ATOM   7254  C CA    . HIS B 1 296 ? -20.752 87.915  28.210  1.00 24.02  ? 296  HIS B CA    1 
ATOM   7255  C C     . HIS B 1 296 ? -19.846 88.052  27.000  1.00 24.08  ? 296  HIS B C     1 
ATOM   7256  O O     . HIS B 1 296 ? -19.234 87.073  26.590  1.00 24.39  ? 296  HIS B O     1 
ATOM   7257  C CB    . HIS B 1 296 ? -19.951 88.022  29.509  1.00 24.25  ? 296  HIS B CB    1 
ATOM   7258  C CG    . HIS B 1 296 ? -20.810 88.168  30.726  1.00 24.76  ? 296  HIS B CG    1 
ATOM   7259  N ND1   . HIS B 1 296 ? -21.696 87.194  31.130  1.00 24.91  ? 296  HIS B ND1   1 
ATOM   7260  C CD2   . HIS B 1 296 ? -20.945 89.186  31.607  1.00 25.41  ? 296  HIS B CD2   1 
ATOM   7261  C CE1   . HIS B 1 296 ? -22.333 87.598  32.214  1.00 25.25  ? 296  HIS B CE1   1 
ATOM   7262  N NE2   . HIS B 1 296 ? -21.893 88.804  32.526  1.00 26.48  ? 296  HIS B NE2   1 
ATOM   7263  N N     . PRO B 1 297 ? -19.771 89.258  26.404  1.00 24.09  ? 297  PRO B N     1 
ATOM   7264  C CA    . PRO B 1 297 ? -18.890 89.441  25.245  1.00 23.84  ? 297  PRO B CA    1 
ATOM   7265  C C     . PRO B 1 297 ? -17.482 88.886  25.515  1.00 23.53  ? 297  PRO B C     1 
ATOM   7266  O O     . PRO B 1 297 ? -16.904 89.162  26.567  1.00 23.63  ? 297  PRO B O     1 
ATOM   7267  C CB    . PRO B 1 297 ? -18.852 90.965  25.069  1.00 23.97  ? 297  PRO B CB    1 
ATOM   7268  C CG    . PRO B 1 297 ? -20.128 91.446  25.628  1.00 24.31  ? 297  PRO B CG    1 
ATOM   7269  C CD    . PRO B 1 297 ? -20.491 90.498  26.755  1.00 24.16  ? 297  PRO B CD    1 
ATOM   7270  N N     . GLY B 1 298 ? -16.958 88.072  24.602  1.00 23.14  ? 298  GLY B N     1 
ATOM   7271  C CA    . GLY B 1 298 ? -15.644 87.459  24.815  1.00 22.74  ? 298  GLY B CA    1 
ATOM   7272  C C     . GLY B 1 298 ? -15.613 86.034  25.355  1.00 22.35  ? 298  GLY B C     1 
ATOM   7273  O O     . GLY B 1 298 ? -14.566 85.393  25.310  1.00 22.45  ? 298  GLY B O     1 
ATOM   7274  N N     . ASP B 1 299 ? -16.743 85.551  25.881  1.00 21.84  ? 299  ASP B N     1 
ATOM   7275  C CA    . ASP B 1 299 ? -16.897 84.139  26.280  1.00 21.37  ? 299  ASP B CA    1 
ATOM   7276  C C     . ASP B 1 299 ? -16.705 83.186  25.096  1.00 20.90  ? 299  ASP B C     1 
ATOM   7277  O O     . ASP B 1 299 ? -17.263 83.401  24.016  1.00 21.04  ? 299  ASP B O     1 
ATOM   7278  C CB    . ASP B 1 299 ? -18.287 83.881  26.874  1.00 21.46  ? 299  ASP B CB    1 
ATOM   7279  C CG    . ASP B 1 299 ? -18.506 84.557  28.219  1.00 21.94  ? 299  ASP B CG    1 
ATOM   7280  O OD1   . ASP B 1 299 ? -17.529 85.064  28.819  1.00 21.99  ? 299  ASP B OD1   1 
ATOM   7281  O OD2   . ASP B 1 299 ? -19.677 84.570  28.674  1.00 22.23  ? 299  ASP B OD2   1 
ATOM   7282  N N     . ILE B 1 300 ? -15.913 82.139  25.295  1.00 20.37  ? 300  ILE B N     1 
ATOM   7283  C CA    . ILE B 1 300 ? -15.799 81.093  24.286  1.00 19.86  ? 300  ILE B CA    1 
ATOM   7284  C C     . ILE B 1 300 ? -16.875 80.025  24.547  1.00 19.50  ? 300  ILE B C     1 
ATOM   7285  O O     . ILE B 1 300 ? -16.936 79.426  25.622  1.00 19.10  ? 300  ILE B O     1 
ATOM   7286  C CB    . ILE B 1 300 ? -14.378 80.482  24.228  1.00 19.71  ? 300  ILE B CB    1 
ATOM   7287  C CG1   . ILE B 1 300 ? -13.298 81.571  24.067  1.00 19.79  ? 300  ILE B CG1   1 
ATOM   7288  C CG2   . ILE B 1 300 ? -14.296 79.415  23.125  1.00 20.72  ? 300  ILE B CG2   1 
ATOM   7289  C CD1   . ILE B 1 300 ? -13.438 82.463  22.825  1.00 19.07  ? 300  ILE B CD1   1 
ATOM   7290  N N     . TYR B 1 301 ? -17.726 79.813  23.543  1.00 19.37  ? 301  TYR B N     1 
ATOM   7291  C CA    . TYR B 1 301 ? -18.930 78.996  23.668  1.00 18.67  ? 301  TYR B CA    1 
ATOM   7292  C C     . TYR B 1 301 ? -18.878 77.804  22.713  1.00 18.43  ? 301  TYR B C     1 
ATOM   7293  O O     . TYR B 1 301 ? -18.635 77.961  21.505  1.00 17.86  ? 301  TYR B O     1 
ATOM   7294  C CB    . TYR B 1 301 ? -20.183 79.845  23.400  1.00 18.63  ? 301  TYR B CB    1 
ATOM   7295  C CG    . TYR B 1 301 ? -21.432 79.022  23.189  1.00 18.95  ? 301  TYR B CG    1 
ATOM   7296  C CD1   . TYR B 1 301 ? -21.815 78.627  21.908  1.00 20.35  ? 301  TYR B CD1   1 
ATOM   7297  C CD2   . TYR B 1 301 ? -22.219 78.616  24.270  1.00 19.16  ? 301  TYR B CD2   1 
ATOM   7298  C CE1   . TYR B 1 301 ? -22.949 77.851  21.704  1.00 19.45  ? 301  TYR B CE1   1 
ATOM   7299  C CE2   . TYR B 1 301 ? -23.363 77.849  24.080  1.00 19.87  ? 301  TYR B CE2   1 
ATOM   7300  C CZ    . TYR B 1 301 ? -23.720 77.468  22.782  1.00 19.81  ? 301  TYR B CZ    1 
ATOM   7301  O OH    . TYR B 1 301 ? -24.848 76.710  22.561  1.00 19.70  ? 301  TYR B OH    1 
ATOM   7302  N N     . TRP B 1 302 ? -19.113 76.615  23.266  1.00 17.88  ? 302  TRP B N     1 
ATOM   7303  C CA    . TRP B 1 302 ? -19.067 75.385  22.489  1.00 17.53  ? 302  TRP B CA    1 
ATOM   7304  C C     . TRP B 1 302 ? -20.299 74.527  22.706  1.00 17.85  ? 302  TRP B C     1 
ATOM   7305  O O     . TRP B 1 302 ? -20.505 73.977  23.791  1.00 17.75  ? 302  TRP B O     1 
ATOM   7306  C CB    . TRP B 1 302 ? -17.791 74.587  22.781  1.00 17.31  ? 302  TRP B CB    1 
ATOM   7307  C CG    . TRP B 1 302 ? -17.633 73.284  22.002  1.00 16.00  ? 302  TRP B CG    1 
ATOM   7308  C CD1   . TRP B 1 302 ? -18.187 72.961  20.786  1.00 16.63  ? 302  TRP B CD1   1 
ATOM   7309  C CD2   . TRP B 1 302 ? -16.848 72.154  22.390  1.00 15.62  ? 302  TRP B CD2   1 
ATOM   7310  N NE1   . TRP B 1 302 ? -17.802 71.694  20.409  1.00 14.64  ? 302  TRP B NE1   1 
ATOM   7311  C CE2   . TRP B 1 302 ? -16.979 71.179  21.374  1.00 15.88  ? 302  TRP B CE2   1 
ATOM   7312  C CE3   . TRP B 1 302 ? -16.064 71.856  23.516  1.00 16.69  ? 302  TRP B CE3   1 
ATOM   7313  C CZ2   . TRP B 1 302 ? -16.340 69.932  21.446  1.00 17.00  ? 302  TRP B CZ2   1 
ATOM   7314  C CZ3   . TRP B 1 302 ? -15.439 70.621  23.590  1.00 16.36  ? 302  TRP B CZ3   1 
ATOM   7315  C CH2   . TRP B 1 302 ? -15.579 69.673  22.558  1.00 16.68  ? 302  TRP B CH2   1 
ATOM   7316  N N     . CYS B 1 303 ? -21.097 74.437  21.640  1.00 17.64  ? 303  CYS B N     1 
ATOM   7317  C CA    . CYS B 1 303 ? -22.204 73.514  21.515  1.00 17.75  ? 303  CYS B CA    1 
ATOM   7318  C C     . CYS B 1 303 ? -21.737 72.315  20.681  1.00 17.69  ? 303  CYS B C     1 
ATOM   7319  O O     . CYS B 1 303 ? -21.229 72.493  19.569  1.00 18.00  ? 303  CYS B O     1 
ATOM   7320  C CB    . CYS B 1 303 ? -23.377 74.213  20.827  1.00 17.45  ? 303  CYS B CB    1 
ATOM   7321  S SG    . CYS B 1 303 ? -24.733 73.096  20.410  1.00 17.74  ? 303  CYS B SG    1 
ATOM   7322  N N     . THR B 1 304 ? -21.883 71.105  21.216  1.00 17.52  ? 304  THR B N     1 
ATOM   7323  C CA    . THR B 1 304 ? -21.318 69.913  20.553  1.00 17.40  ? 304  THR B CA    1 
ATOM   7324  C C     . THR B 1 304 ? -22.251 69.318  19.475  1.00 17.74  ? 304  THR B C     1 
ATOM   7325  O O     . THR B 1 304 ? -21.841 68.444  18.711  1.00 16.61  ? 304  THR B O     1 
ATOM   7326  C CB    . THR B 1 304 ? -20.956 68.799  21.563  1.00 17.72  ? 304  THR B CB    1 
ATOM   7327  O OG1   . THR B 1 304 ? -22.152 68.354  22.223  1.00 17.60  ? 304  THR B OG1   1 
ATOM   7328  C CG2   . THR B 1 304 ? -19.919 69.296  22.602  1.00 16.22  ? 304  THR B CG2   1 
ATOM   7329  N N     . ALA B 1 305 ? -23.495 69.801  19.428  1.00 17.77  ? 305  ALA B N     1 
ATOM   7330  C CA    . ALA B 1 305 ? -24.504 69.269  18.505  1.00 17.99  ? 305  ALA B CA    1 
ATOM   7331  C C     . ALA B 1 305 ? -24.142 69.484  17.039  1.00 18.33  ? 305  ALA B C     1 
ATOM   7332  O O     . ALA B 1 305 ? -23.578 70.531  16.661  1.00 18.00  ? 305  ALA B O     1 
ATOM   7333  C CB    . ALA B 1 305 ? -25.859 69.871  18.786  1.00 17.87  ? 305  ALA B CB    1 
ATOM   7334  N N     . ASP B 1 306 ? -24.478 68.471  16.232  1.00 18.56  ? 306  ASP B N     1 
ATOM   7335  C CA    . ASP B 1 306 ? -24.308 68.517  14.806  1.00 18.22  ? 306  ASP B CA    1 
ATOM   7336  C C     . ASP B 1 306 ? -25.192 69.594  14.183  1.00 17.99  ? 306  ASP B C     1 
ATOM   7337  O O     . ASP B 1 306 ? -26.316 69.831  14.622  1.00 17.53  ? 306  ASP B O     1 
ATOM   7338  C CB    . ASP B 1 306 ? -24.589 67.158  14.187  1.00 18.47  ? 306  ASP B CB    1 
ATOM   7339  C CG    . ASP B 1 306 ? -24.056 67.057  12.755  1.00 20.57  ? 306  ASP B CG    1 
ATOM   7340  O OD1   . ASP B 1 306 ? -24.762 67.518  11.827  1.00 23.60  ? 306  ASP B OD1   1 
ATOM   7341  O OD2   . ASP B 1 306 ? -22.923 66.547  12.558  1.00 20.79  ? 306  ASP B OD2   1 
ATOM   7342  N N     . VAL B 1 307 ? -24.648 70.253  13.164  1.00 17.79  ? 307  VAL B N     1 
ATOM   7343  C CA    . VAL B 1 307 ? -25.362 71.264  12.408  1.00 17.59  ? 307  VAL B CA    1 
ATOM   7344  C C     . VAL B 1 307 ? -26.656 70.713  11.792  1.00 17.88  ? 307  VAL B C     1 
ATOM   7345  O O     . VAL B 1 307 ? -27.606 71.460  11.589  1.00 18.68  ? 307  VAL B O     1 
ATOM   7346  C CB    . VAL B 1 307 ? -24.445 71.900  11.326  1.00 18.02  ? 307  VAL B CB    1 
ATOM   7347  C CG1   . VAL B 1 307 ? -24.052 70.870  10.213  1.00 16.51  ? 307  VAL B CG1   1 
ATOM   7348  C CG2   . VAL B 1 307 ? -25.101 73.140  10.734  1.00 17.92  ? 307  VAL B CG2   1 
ATOM   7349  N N     . GLY B 1 308 ? -26.686 69.408  11.509  1.00 17.62  ? 308  GLY B N     1 
ATOM   7350  C CA    . GLY B 1 308 ? -27.864 68.738  10.945  1.00 17.55  ? 308  GLY B CA    1 
ATOM   7351  C C     . GLY B 1 308 ? -29.105 68.629  11.829  1.00 17.59  ? 308  GLY B C     1 
ATOM   7352  O O     . GLY B 1 308 ? -30.170 68.216  11.356  1.00 17.18  ? 308  GLY B O     1 
ATOM   7353  N N     . TRP B 1 309 ? -28.973 69.019  13.099  1.00 17.28  ? 309  TRP B N     1 
ATOM   7354  C CA    . TRP B 1 309 ? -30.090 69.012  14.047  1.00 17.62  ? 309  TRP B CA    1 
ATOM   7355  C C     . TRP B 1 309 ? -30.412 70.415  14.538  1.00 17.27  ? 309  TRP B C     1 
ATOM   7356  O O     . TRP B 1 309 ? -29.590 71.318  14.463  1.00 17.64  ? 309  TRP B O     1 
ATOM   7357  C CB    . TRP B 1 309 ? -29.795 68.102  15.264  1.00 17.59  ? 309  TRP B CB    1 
ATOM   7358  C CG    . TRP B 1 309 ? -29.326 66.686  14.914  1.00 17.66  ? 309  TRP B CG    1 
ATOM   7359  C CD1   . TRP B 1 309 ? -28.154 66.085  15.318  1.00 17.74  ? 309  TRP B CD1   1 
ATOM   7360  C CD2   . TRP B 1 309 ? -30.003 65.722  14.085  1.00 17.46  ? 309  TRP B CD2   1 
ATOM   7361  N NE1   . TRP B 1 309 ? -28.086 64.798  14.814  1.00 19.67  ? 309  TRP B NE1   1 
ATOM   7362  C CE2   . TRP B 1 309 ? -29.200 64.558  14.048  1.00 17.96  ? 309  TRP B CE2   1 
ATOM   7363  C CE3   . TRP B 1 309 ? -31.220 65.724  13.381  1.00 18.85  ? 309  TRP B CE3   1 
ATOM   7364  C CZ2   . TRP B 1 309 ? -29.577 63.408  13.340  1.00 18.73  ? 309  TRP B CZ2   1 
ATOM   7365  C CZ3   . TRP B 1 309 ? -31.586 64.579  12.660  1.00 17.76  ? 309  TRP B CZ3   1 
ATOM   7366  C CH2   . TRP B 1 309 ? -30.764 63.444  12.643  1.00 17.78  ? 309  TRP B CH2   1 
ATOM   7367  N N     . VAL B 1 310 ? -31.610 70.565  15.085  1.00 17.21  ? 310  VAL B N     1 
ATOM   7368  C CA    . VAL B 1 310 ? -32.142 71.855  15.525  1.00 16.21  ? 310  VAL B CA    1 
ATOM   7369  C C     . VAL B 1 310 ? -31.253 72.580  16.533  1.00 16.56  ? 310  VAL B C     1 
ATOM   7370  O O     . VAL B 1 310 ? -31.153 73.797  16.492  1.00 15.77  ? 310  VAL B O     1 
ATOM   7371  C CB    . VAL B 1 310 ? -33.608 71.698  16.066  1.00 16.12  ? 310  VAL B CB    1 
ATOM   7372  C CG1   . VAL B 1 310 ? -33.651 70.871  17.390  1.00 14.77  ? 310  VAL B CG1   1 
ATOM   7373  C CG2   . VAL B 1 310 ? -34.291 73.049  16.198  1.00 14.85  ? 310  VAL B CG2   1 
ATOM   7374  N N     . THR B 1 311 ? -30.622 71.825  17.432  1.00 16.87  ? 311  THR B N     1 
ATOM   7375  C CA    . THR B 1 311 ? -29.733 72.403  18.433  1.00 17.74  ? 311  THR B CA    1 
ATOM   7376  C C     . THR B 1 311 ? -28.545 73.054  17.732  1.00 18.26  ? 311  THR B C     1 
ATOM   7377  O O     . THR B 1 311 ? -28.074 74.118  18.154  1.00 18.01  ? 311  THR B O     1 
ATOM   7378  C CB    . THR B 1 311 ? -29.221 71.344  19.438  1.00 17.99  ? 311  THR B CB    1 
ATOM   7379  O OG1   . THR B 1 311 ? -30.333 70.619  19.993  1.00 16.77  ? 311  THR B OG1   1 
ATOM   7380  C CG2   . THR B 1 311 ? -28.415 72.006  20.554  1.00 18.25  ? 311  THR B CG2   1 
ATOM   7381  N N     . GLY B 1 312 ? -28.063 72.395  16.673  1.00 18.45  ? 312  GLY B N     1 
ATOM   7382  C CA    . GLY B 1 312 ? -27.051 72.974  15.778  1.00 18.80  ? 312  GLY B CA    1 
ATOM   7383  C C     . GLY B 1 312 ? -27.512 74.238  15.047  1.00 19.03  ? 312  GLY B C     1 
ATOM   7384  O O     . GLY B 1 312 ? -26.731 75.184  14.892  1.00 19.74  ? 312  GLY B O     1 
ATOM   7385  N N     . HIS B 1 313 ? -28.769 74.269  14.598  1.00 18.39  ? 313  HIS B N     1 
ATOM   7386  C CA    . HIS B 1 313 ? -29.324 75.481  13.975  1.00 18.41  ? 313  HIS B CA    1 
ATOM   7387  C C     . HIS B 1 313 ? -29.395 76.631  14.962  1.00 18.82  ? 313  HIS B C     1 
ATOM   7388  O O     . HIS B 1 313 ? -28.807 77.685  14.716  1.00 18.06  ? 313  HIS B O     1 
ATOM   7389  C CB    . HIS B 1 313 ? -30.703 75.232  13.334  1.00 18.33  ? 313  HIS B CB    1 
ATOM   7390  C CG    . HIS B 1 313 ? -30.660 74.289  12.169  1.00 17.43  ? 313  HIS B CG    1 
ATOM   7391  N ND1   . HIS B 1 313 ? -31.559 74.344  11.128  1.00 17.87  ? 313  HIS B ND1   1 
ATOM   7392  C CD2   . HIS B 1 313 ? -29.814 73.271  11.882  1.00 15.05  ? 313  HIS B CD2   1 
ATOM   7393  C CE1   . HIS B 1 313 ? -31.277 73.396  10.252  1.00 16.15  ? 313  HIS B CE1   1 
ATOM   7394  N NE2   . HIS B 1 313 ? -30.221 72.732  10.688  1.00 17.71  ? 313  HIS B NE2   1 
ATOM   7395  N N     . SER B 1 314 ? -30.080 76.410  16.087  1.00 19.06  ? 314  SER B N     1 
ATOM   7396  C CA    . SER B 1 314 ? -30.352 77.492  17.033  1.00 19.77  ? 314  SER B CA    1 
ATOM   7397  C C     . SER B 1 314 ? -29.171 77.877  17.940  1.00 20.10  ? 314  SER B C     1 
ATOM   7398  O O     . SER B 1 314 ? -29.008 79.059  18.250  1.00 20.32  ? 314  SER B O     1 
ATOM   7399  C CB    . SER B 1 314 ? -31.601 77.192  17.860  1.00 19.26  ? 314  SER B CB    1 
ATOM   7400  O OG    . SER B 1 314 ? -32.687 76.878  17.013  1.00 20.18  ? 314  SER B OG    1 
ATOM   7401  N N     . TYR B 1 315 ? -28.346 76.897  18.325  1.00 20.30  ? 315  TYR B N     1 
ATOM   7402  C CA    . TYR B 1 315 ? -27.354 77.093  19.388  1.00 20.77  ? 315  TYR B CA    1 
ATOM   7403  C C     . TYR B 1 315 ? -25.894 76.808  19.039  1.00 21.72  ? 315  TYR B C     1 
ATOM   7404  O O     . TYR B 1 315 ? -24.992 77.110  19.837  1.00 21.75  ? 315  TYR B O     1 
ATOM   7405  C CB    . TYR B 1 315 ? -27.797 76.380  20.672  1.00 20.57  ? 315  TYR B CB    1 
ATOM   7406  C CG    . TYR B 1 315 ? -29.136 76.910  21.134  1.00 20.20  ? 315  TYR B CG    1 
ATOM   7407  C CD1   . TYR B 1 315 ? -30.300 76.175  20.939  1.00 19.20  ? 315  TYR B CD1   1 
ATOM   7408  C CD2   . TYR B 1 315 ? -29.242 78.186  21.692  1.00 18.84  ? 315  TYR B CD2   1 
ATOM   7409  C CE1   . TYR B 1 315 ? -31.542 76.682  21.334  1.00 19.51  ? 315  TYR B CE1   1 
ATOM   7410  C CE2   . TYR B 1 315 ? -30.478 78.710  22.079  1.00 19.20  ? 315  TYR B CE2   1 
ATOM   7411  C CZ    . TYR B 1 315 ? -31.620 77.952  21.898  1.00 20.55  ? 315  TYR B CZ    1 
ATOM   7412  O OH    . TYR B 1 315 ? -32.845 78.450  22.294  1.00 21.08  ? 315  TYR B OH    1 
ATOM   7413  N N     . LEU B 1 316 ? -25.654 76.247  17.851  1.00 21.98  ? 316  LEU B N     1 
ATOM   7414  C CA    . LEU B 1 316 ? -24.303 76.240  17.286  1.00 21.81  ? 316  LEU B CA    1 
ATOM   7415  C C     . LEU B 1 316 ? -24.095 77.563  16.532  1.00 21.47  ? 316  LEU B C     1 
ATOM   7416  O O     . LEU B 1 316 ? -23.045 78.205  16.651  1.00 20.27  ? 316  LEU B O     1 
ATOM   7417  C CB    . LEU B 1 316 ? -24.086 74.995  16.380  1.00 22.16  ? 316  LEU B CB    1 
ATOM   7418  C CG    . LEU B 1 316 ? -22.758 74.451  15.787  1.00 22.64  ? 316  LEU B CG    1 
ATOM   7419  C CD1   . LEU B 1 316 ? -22.775 74.329  14.252  1.00 23.48  ? 316  LEU B CD1   1 
ATOM   7420  C CD2   . LEU B 1 316 ? -21.491 75.179  16.251  1.00 24.03  ? 316  LEU B CD2   1 
ATOM   7421  N N     . LEU B 1 317 ? -25.122 77.989  15.796  1.00 21.28  ? 317  LEU B N     1 
ATOM   7422  C CA    . LEU B 1 317 ? -24.963 79.090  14.833  1.00 21.72  ? 317  LEU B CA    1 
ATOM   7423  C C     . LEU B 1 317 ? -25.819 80.335  15.066  1.00 21.26  ? 317  LEU B C     1 
ATOM   7424  O O     . LEU B 1 317 ? -25.307 81.377  15.444  1.00 20.88  ? 317  LEU B O     1 
ATOM   7425  C CB    . LEU B 1 317 ? -25.189 78.581  13.398  1.00 21.92  ? 317  LEU B CB    1 
ATOM   7426  C CG    . LEU B 1 317 ? -24.135 77.656  12.800  1.00 22.78  ? 317  LEU B CG    1 
ATOM   7427  C CD1   . LEU B 1 317 ? -24.573 77.249  11.404  1.00 24.92  ? 317  LEU B CD1   1 
ATOM   7428  C CD2   . LEU B 1 317 ? -22.750 78.329  12.775  1.00 24.53  ? 317  LEU B CD2   1 
ATOM   7429  N N     . TYR B 1 318 ? -27.117 80.224  14.817  1.00 20.97  ? 318  TYR B N     1 
ATOM   7430  C CA    . TYR B 1 318 ? -27.973 81.406  14.766  1.00 21.22  ? 318  TYR B CA    1 
ATOM   7431  C C     . TYR B 1 318 ? -28.056 82.253  16.051  1.00 21.06  ? 318  TYR B C     1 
ATOM   7432  O O     . TYR B 1 318 ? -27.813 83.458  16.001  1.00 21.27  ? 318  TYR B O     1 
ATOM   7433  C CB    . TYR B 1 318 ? -29.348 81.038  14.218  1.00 20.81  ? 318  TYR B CB    1 
ATOM   7434  C CG    . TYR B 1 318 ? -29.291 80.607  12.767  1.00 21.02  ? 318  TYR B CG    1 
ATOM   7435  C CD1   . TYR B 1 318 ? -28.335 81.134  11.900  1.00 21.45  ? 318  TYR B CD1   1 
ATOM   7436  C CD2   . TYR B 1 318 ? -30.202 79.696  12.255  1.00 21.49  ? 318  TYR B CD2   1 
ATOM   7437  C CE1   . TYR B 1 318 ? -28.277 80.746  10.569  1.00 21.22  ? 318  TYR B CE1   1 
ATOM   7438  C CE2   . TYR B 1 318 ? -30.160 79.309  10.916  1.00 21.53  ? 318  TYR B CE2   1 
ATOM   7439  C CZ    . TYR B 1 318 ? -29.202 79.844  10.082  1.00 20.78  ? 318  TYR B CZ    1 
ATOM   7440  O OH    . TYR B 1 318 ? -29.162 79.477  8.757   1.00 20.61  ? 318  TYR B OH    1 
ATOM   7441  N N     . GLY B 1 319 ? -28.391 81.622  17.177  1.00 21.08  ? 319  GLY B N     1 
ATOM   7442  C CA    . GLY B 1 319 ? -28.352 82.263  18.497  1.00 20.35  ? 319  GLY B CA    1 
ATOM   7443  C C     . GLY B 1 319 ? -27.059 83.022  18.800  1.00 20.10  ? 319  GLY B C     1 
ATOM   7444  O O     . GLY B 1 319 ? -27.100 84.237  19.043  1.00 19.04  ? 319  GLY B O     1 
ATOM   7445  N N     . PRO B 1 320 ? -25.910 82.304  18.809  1.00 19.68  ? 320  PRO B N     1 
ATOM   7446  C CA    . PRO B 1 320 ? -24.609 82.903  19.097  1.00 19.17  ? 320  PRO B CA    1 
ATOM   7447  C C     . PRO B 1 320 ? -24.107 83.899  18.051  1.00 19.01  ? 320  PRO B C     1 
ATOM   7448  O O     . PRO B 1 320 ? -23.527 84.911  18.419  1.00 18.87  ? 320  PRO B O     1 
ATOM   7449  C CB    . PRO B 1 320 ? -23.661 81.690  19.208  1.00 18.82  ? 320  PRO B CB    1 
ATOM   7450  C CG    . PRO B 1 320 ? -24.543 80.493  19.320  1.00 19.20  ? 320  PRO B CG    1 
ATOM   7451  C CD    . PRO B 1 320 ? -25.796 80.846  18.595  1.00 19.86  ? 320  PRO B CD    1 
ATOM   7452  N N     . LEU B 1 321 ? -24.316 83.645  16.766  1.00 19.03  ? 321  LEU B N     1 
ATOM   7453  C CA    . LEU B 1 321 ? -23.844 84.629  15.788  1.00 19.03  ? 321  LEU B CA    1 
ATOM   7454  C C     . LEU B 1 321 ? -24.702 85.894  15.876  1.00 19.47  ? 321  LEU B C     1 
ATOM   7455  O O     . LEU B 1 321 ? -24.174 87.012  15.847  1.00 19.55  ? 321  LEU B O     1 
ATOM   7456  C CB    . LEU B 1 321 ? -23.776 84.061  14.372  1.00 18.99  ? 321  LEU B CB    1 
ATOM   7457  C CG    . LEU B 1 321 ? -22.825 82.873  14.144  1.00 18.46  ? 321  LEU B CG    1 
ATOM   7458  C CD1   . LEU B 1 321 ? -22.962 82.387  12.712  1.00 19.50  ? 321  LEU B CD1   1 
ATOM   7459  C CD2   . LEU B 1 321 ? -21.338 83.183  14.496  1.00 16.59  ? 321  LEU B CD2   1 
ATOM   7460  N N     . ALA B 1 322 ? -26.013 85.713  16.054  1.00 19.47  ? 322  ALA B N     1 
ATOM   7461  C CA    . ALA B 1 322 ? -26.911 86.847  16.311  1.00 19.60  ? 322  ALA B CA    1 
ATOM   7462  C C     . ALA B 1 322 ? -26.417 87.719  17.473  1.00 19.49  ? 322  ALA B C     1 
ATOM   7463  O O     . ALA B 1 322 ? -26.541 88.940  17.430  1.00 19.39  ? 322  ALA B O     1 
ATOM   7464  C CB    . ALA B 1 322 ? -28.329 86.362  16.578  1.00 19.33  ? 322  ALA B CB    1 
ATOM   7465  N N     . CYS B 1 323 ? -25.860 87.078  18.503  1.00 19.42  ? 323  CYS B N     1 
ATOM   7466  C CA    . CYS B 1 323 ? -25.349 87.764  19.686  1.00 19.13  ? 323  CYS B CA    1 
ATOM   7467  C C     . CYS B 1 323 ? -23.906 88.255  19.585  1.00 19.29  ? 323  CYS B C     1 
ATOM   7468  O O     . CYS B 1 323 ? -23.361 88.778  20.562  1.00 19.24  ? 323  CYS B O     1 
ATOM   7469  C CB    . CYS B 1 323 ? -25.471 86.847  20.897  1.00 19.32  ? 323  CYS B CB    1 
ATOM   7470  S SG    . CYS B 1 323 ? -27.140 86.691  21.521  1.00 19.61  ? 323  CYS B SG    1 
ATOM   7471  N N     . GLY B 1 324 ? -23.279 88.079  18.425  1.00 19.63  ? 324  GLY B N     1 
ATOM   7472  C CA    . GLY B 1 324 ? -21.890 88.506  18.234  1.00 20.09  ? 324  GLY B CA    1 
ATOM   7473  C C     . GLY B 1 324 ? -20.879 87.691  19.040  1.00 20.28  ? 324  GLY B C     1 
ATOM   7474  O O     . GLY B 1 324 ? -19.772 88.162  19.333  1.00 19.81  ? 324  GLY B O     1 
ATOM   7475  N N     . ALA B 1 325 ? -21.275 86.466  19.382  1.00 19.84  ? 325  ALA B N     1 
ATOM   7476  C CA    . ALA B 1 325 ? -20.456 85.514  20.122  1.00 20.16  ? 325  ALA B CA    1 
ATOM   7477  C C     . ALA B 1 325 ? -19.348 84.827  19.294  1.00 20.48  ? 325  ALA B C     1 
ATOM   7478  O O     . ALA B 1 325 ? -19.350 84.874  18.061  1.00 20.72  ? 325  ALA B O     1 
ATOM   7479  C CB    . ALA B 1 325 ? -21.380 84.436  20.742  1.00 20.08  ? 325  ALA B CB    1 
ATOM   7480  N N     . THR B 1 326 ? -18.406 84.197  19.998  1.00 20.53  ? 326  THR B N     1 
ATOM   7481  C CA    . THR B 1 326 ? -17.513 83.211  19.420  1.00 20.36  ? 326  THR B CA    1 
ATOM   7482  C C     . THR B 1 326 ? -18.098 81.836  19.737  1.00 20.44  ? 326  THR B C     1 
ATOM   7483  O O     . THR B 1 326 ? -18.194 81.444  20.911  1.00 20.36  ? 326  THR B O     1 
ATOM   7484  C CB    . THR B 1 326 ? -16.075 83.316  19.995  1.00 20.70  ? 326  THR B CB    1 
ATOM   7485  O OG1   . THR B 1 326 ? -15.523 84.599  19.681  1.00 20.63  ? 326  THR B OG1   1 
ATOM   7486  C CG2   . THR B 1 326 ? -15.172 82.248  19.380  1.00 19.97  ? 326  THR B CG2   1 
ATOM   7487  N N     . THR B 1 327 ? -18.507 81.128  18.683  1.00 20.18  ? 327  THR B N     1 
ATOM   7488  C CA    . THR B 1 327 ? -19.060 79.781  18.789  1.00 20.08  ? 327  THR B CA    1 
ATOM   7489  C C     . THR B 1 327 ? -18.061 78.772  18.202  1.00 19.95  ? 327  THR B C     1 
ATOM   7490  O O     . THR B 1 327 ? -17.427 79.043  17.186  1.00 20.51  ? 327  THR B O     1 
ATOM   7491  C CB    . THR B 1 327 ? -20.459 79.669  18.108  1.00 20.16  ? 327  THR B CB    1 
ATOM   7492  O OG1   . THR B 1 327 ? -21.014 78.360  18.334  1.00 20.98  ? 327  THR B OG1   1 
ATOM   7493  C CG2   . THR B 1 327 ? -20.381 79.944  16.599  1.00 19.31  ? 327  THR B CG2   1 
ATOM   7494  N N     . LEU B 1 328 ? -17.898 77.625  18.857  1.00 19.05  ? 328  LEU B N     1 
ATOM   7495  C CA    . LEU B 1 328 ? -16.940 76.629  18.394  1.00 18.35  ? 328  LEU B CA    1 
ATOM   7496  C C     . LEU B 1 328 ? -17.648 75.520  17.614  1.00 18.36  ? 328  LEU B C     1 
ATOM   7497  O O     . LEU B 1 328 ? -18.703 75.014  18.039  1.00 17.64  ? 328  LEU B O     1 
ATOM   7498  C CB    . LEU B 1 328 ? -16.138 76.063  19.570  1.00 18.14  ? 328  LEU B CB    1 
ATOM   7499  C CG    . LEU B 1 328 ? -14.863 75.212  19.376  1.00 18.27  ? 328  LEU B CG    1 
ATOM   7500  C CD1   . LEU B 1 328 ? -14.119 75.159  20.708  1.00 16.29  ? 328  LEU B CD1   1 
ATOM   7501  C CD2   . LEU B 1 328 ? -15.128 73.778  18.866  1.00 15.90  ? 328  LEU B CD2   1 
ATOM   7502  N N     . MET B 1 329 ? -17.063 75.171  16.466  1.00 18.28  ? 329  MET B N     1 
ATOM   7503  C CA    . MET B 1 329 ? -17.509 74.058  15.644  1.00 19.31  ? 329  MET B CA    1 
ATOM   7504  C C     . MET B 1 329 ? -16.436 72.980  15.602  1.00 18.47  ? 329  MET B C     1 
ATOM   7505  O O     . MET B 1 329 ? -15.334 73.207  15.101  1.00 18.50  ? 329  MET B O     1 
ATOM   7506  C CB    . MET B 1 329 ? -17.837 74.496  14.207  1.00 19.18  ? 329  MET B CB    1 
ATOM   7507  C CG    . MET B 1 329 ? -18.215 73.298  13.317  1.00 19.37  ? 329  MET B CG    1 
ATOM   7508  S SD    . MET B 1 329 ? -18.561 73.651  11.580  1.00 22.80  ? 329  MET B SD    1 
ATOM   7509  C CE    . MET B 1 329 ? -20.011 74.697  11.695  1.00 22.42  ? 329  MET B CE    1 
ATOM   7510  N N     . PHE B 1 330 ? -16.794 71.807  16.113  1.00 18.27  ? 330  PHE B N     1 
ATOM   7511  C CA    . PHE B 1 330 ? -15.901 70.659  16.230  1.00 18.09  ? 330  PHE B CA    1 
ATOM   7512  C C     . PHE B 1 330 ? -16.280 69.607  15.198  1.00 18.82  ? 330  PHE B C     1 
ATOM   7513  O O     . PHE B 1 330 ? -17.443 69.202  15.112  1.00 19.28  ? 330  PHE B O     1 
ATOM   7514  C CB    . PHE B 1 330 ? -16.004 70.084  17.641  1.00 16.64  ? 330  PHE B CB    1 
ATOM   7515  C CG    . PHE B 1 330 ? -15.188 68.853  17.873  1.00 15.41  ? 330  PHE B CG    1 
ATOM   7516  C CD1   . PHE B 1 330 ? -13.888 68.746  17.388  1.00 13.15  ? 330  PHE B CD1   1 
ATOM   7517  C CD2   . PHE B 1 330 ? -15.705 67.806  18.645  1.00 13.76  ? 330  PHE B CD2   1 
ATOM   7518  C CE1   . PHE B 1 330 ? -13.130 67.626  17.632  1.00 13.10  ? 330  PHE B CE1   1 
ATOM   7519  C CE2   . PHE B 1 330 ? -14.939 66.674  18.903  1.00 13.17  ? 330  PHE B CE2   1 
ATOM   7520  C CZ    . PHE B 1 330 ? -13.647 66.585  18.395  1.00 13.95  ? 330  PHE B CZ    1 
ATOM   7521  N N     . GLU B 1 331 ? -15.284 69.175  14.427  1.00 19.45  ? 331  GLU B N     1 
ATOM   7522  C CA    . GLU B 1 331 ? -15.460 68.195  13.355  1.00 19.67  ? 331  GLU B CA    1 
ATOM   7523  C C     . GLU B 1 331 ? -15.726 66.774  13.834  1.00 20.04  ? 331  GLU B C     1 
ATOM   7524  O O     . GLU B 1 331 ? -16.535 66.069  13.237  1.00 20.13  ? 331  GLU B O     1 
ATOM   7525  C CB    . GLU B 1 331 ? -14.243 68.196  12.454  1.00 19.44  ? 331  GLU B CB    1 
ATOM   7526  C CG    . GLU B 1 331 ? -14.404 67.376  11.179  1.00 19.97  ? 331  GLU B CG    1 
ATOM   7527  C CD    . GLU B 1 331 ? -13.219 67.500  10.236  1.00 19.49  ? 331  GLU B CD    1 
ATOM   7528  O OE1   . GLU B 1 331 ? -12.063 67.506  10.697  1.00 17.58  ? 331  GLU B OE1   1 
ATOM   7529  O OE2   . GLU B 1 331 ? -13.447 67.566  9.013   1.00 22.53  ? 331  GLU B OE2   1 
ATOM   7530  N N     . GLY B 1 332 ? -15.050 66.357  14.904  1.00 20.71  ? 332  GLY B N     1 
ATOM   7531  C CA    . GLY B 1 332 ? -15.054 64.948  15.320  1.00 21.23  ? 332  GLY B CA    1 
ATOM   7532  C C     . GLY B 1 332 ? -16.069 64.523  16.371  1.00 21.59  ? 332  GLY B C     1 
ATOM   7533  O O     . GLY B 1 332 ? -17.228 64.960  16.356  1.00 21.55  ? 332  GLY B O     1 
ATOM   7534  N N     . VAL B 1 333 ? -15.620 63.650  17.269  1.00 21.86  ? 333  VAL B N     1 
ATOM   7535  C CA    . VAL B 1 333 ? -16.426 63.146  18.388  1.00 22.62  ? 333  VAL B CA    1 
ATOM   7536  C C     . VAL B 1 333 ? -15.703 63.392  19.721  1.00 22.37  ? 333  VAL B C     1 
ATOM   7537  O O     . VAL B 1 333 ? -14.474 63.410  19.761  1.00 22.93  ? 333  VAL B O     1 
ATOM   7538  C CB    . VAL B 1 333 ? -16.782 61.625  18.231  1.00 22.63  ? 333  VAL B CB    1 
ATOM   7539  C CG1   . VAL B 1 333 ? -17.588 61.387  16.972  1.00 23.30  ? 333  VAL B CG1   1 
ATOM   7540  C CG2   . VAL B 1 333 ? -15.546 60.758  18.192  1.00 23.02  ? 333  VAL B CG2   1 
ATOM   7541  N N     . PRO B 1 334 ? -16.462 63.591  20.816  1.00 22.51  ? 334  PRO B N     1 
ATOM   7542  C CA    . PRO B 1 334 ? -15.866 63.895  22.140  1.00 21.93  ? 334  PRO B CA    1 
ATOM   7543  C C     . PRO B 1 334 ? -14.906 62.849  22.707  1.00 21.48  ? 334  PRO B C     1 
ATOM   7544  O O     . PRO B 1 334 ? -14.204 63.137  23.679  1.00 21.81  ? 334  PRO B O     1 
ATOM   7545  C CB    . PRO B 1 334 ? -17.093 64.029  23.063  1.00 22.03  ? 334  PRO B CB    1 
ATOM   7546  C CG    . PRO B 1 334 ? -18.192 63.298  22.338  1.00 22.14  ? 334  PRO B CG    1 
ATOM   7547  C CD    . PRO B 1 334 ? -17.938 63.575  20.881  1.00 22.19  ? 334  PRO B CD    1 
ATOM   7548  N N     . ASN B 1 335 ? -14.849 61.658  22.122  1.00 20.81  ? 335  ASN B N     1 
ATOM   7549  C CA    . ASN B 1 335 ? -14.031 60.590  22.715  1.00 20.31  ? 335  ASN B CA    1 
ATOM   7550  C C     . ASN B 1 335 ? -13.011 59.964  21.768  1.00 20.34  ? 335  ASN B C     1 
ATOM   7551  O O     . ASN B 1 335 ? -12.506 58.857  22.000  1.00 20.03  ? 335  ASN B O     1 
ATOM   7552  C CB    . ASN B 1 335 ? -14.916 59.521  23.400  1.00 20.33  ? 335  ASN B CB    1 
ATOM   7553  C CG    . ASN B 1 335 ? -15.871 58.814  22.437  1.00 20.57  ? 335  ASN B CG    1 
ATOM   7554  O OD1   . ASN B 1 335 ? -16.528 57.853  22.823  1.00 23.85  ? 335  ASN B OD1   1 
ATOM   7555  N ND2   . ASN B 1 335 ? -15.946 59.271  21.199  1.00 17.83  ? 335  ASN B ND2   1 
ATOM   7556  N N     . TRP B 1 336 ? -12.704 60.687  20.696  1.00 19.97  ? 336  TRP B N     1 
ATOM   7557  C CA    . TRP B 1 336 ? -11.694 60.233  19.759  1.00 19.36  ? 336  TRP B CA    1 
ATOM   7558  C C     . TRP B 1 336 ? -10.608 61.292  19.566  1.00 18.99  ? 336  TRP B C     1 
ATOM   7559  O O     . TRP B 1 336 ? -10.928 62.463  19.349  1.00 19.66  ? 336  TRP B O     1 
ATOM   7560  C CB    . TRP B 1 336 ? -12.322 59.831  18.424  1.00 18.78  ? 336  TRP B CB    1 
ATOM   7561  C CG    . TRP B 1 336 ? -11.424 58.960  17.648  1.00 18.45  ? 336  TRP B CG    1 
ATOM   7562  C CD1   . TRP B 1 336 ? -11.329 57.597  17.728  1.00 19.04  ? 336  TRP B CD1   1 
ATOM   7563  C CD2   . TRP B 1 336 ? -10.441 59.375  16.698  1.00 18.82  ? 336  TRP B CD2   1 
ATOM   7564  N NE1   . TRP B 1 336 ? -10.357 57.142  16.879  1.00 18.45  ? 336  TRP B NE1   1 
ATOM   7565  C CE2   . TRP B 1 336 ? -9.800  58.209  16.227  1.00 18.45  ? 336  TRP B CE2   1 
ATOM   7566  C CE3   . TRP B 1 336 ? -10.042 60.620  16.191  1.00 17.87  ? 336  TRP B CE3   1 
ATOM   7567  C CZ2   . TRP B 1 336 ? -8.782  58.249  15.281  1.00 17.84  ? 336  TRP B CZ2   1 
ATOM   7568  C CZ3   . TRP B 1 336 ? -9.044  60.656  15.244  1.00 18.71  ? 336  TRP B CZ3   1 
ATOM   7569  C CH2   . TRP B 1 336 ? -8.416  59.478  14.803  1.00 18.30  ? 336  TRP B CH2   1 
ATOM   7570  N N     . PRO B 1 337 ? -9.323  60.880  19.600  1.00 18.82  ? 337  PRO B N     1 
ATOM   7571  C CA    . PRO B 1 337 ? -8.837  59.487  19.713  1.00 18.80  ? 337  PRO B CA    1 
ATOM   7572  C C     . PRO B 1 337 ? -8.910  58.850  21.100  1.00 18.47  ? 337  PRO B C     1 
ATOM   7573  O O     . PRO B 1 337 ? -8.691  57.640  21.202  1.00 18.14  ? 337  PRO B O     1 
ATOM   7574  C CB    . PRO B 1 337 ? -7.367  59.569  19.242  1.00 18.47  ? 337  PRO B CB    1 
ATOM   7575  C CG    . PRO B 1 337 ? -7.173  60.981  18.732  1.00 19.12  ? 337  PRO B CG    1 
ATOM   7576  C CD    . PRO B 1 337 ? -8.198  61.816  19.452  1.00 18.76  ? 337  PRO B CD    1 
ATOM   7577  N N     . THR B 1 338 ? -9.193  59.652  22.136  1.00 18.25  ? 338  THR B N     1 
ATOM   7578  C CA    . THR B 1 338 ? -9.287  59.186  23.550  1.00 17.50  ? 338  THR B CA    1 
ATOM   7579  C C     . THR B 1 338 ? -10.481 59.842  24.276  1.00 17.28  ? 338  THR B C     1 
ATOM   7580  O O     . THR B 1 338 ? -10.942 60.902  23.844  1.00 17.56  ? 338  THR B O     1 
ATOM   7581  C CB    . THR B 1 338 ? -8.023  59.549  24.368  1.00 17.67  ? 338  THR B CB    1 
ATOM   7582  O OG1   . THR B 1 338 ? -8.009  60.960  24.635  1.00 18.15  ? 338  THR B OG1   1 
ATOM   7583  C CG2   . THR B 1 338 ? -6.713  59.111  23.666  1.00 17.01  ? 338  THR B CG2   1 
ATOM   7584  N N     . PRO B 1 339 ? -10.983 59.228  25.381  1.00 16.93  ? 339  PRO B N     1 
ATOM   7585  C CA    . PRO B 1 339 ? -12.107 59.801  26.153  1.00 16.51  ? 339  PRO B CA    1 
ATOM   7586  C C     . PRO B 1 339 ? -11.913 61.245  26.620  1.00 16.46  ? 339  PRO B C     1 
ATOM   7587  O O     . PRO B 1 339 ? -12.906 61.975  26.838  1.00 16.47  ? 339  PRO B O     1 
ATOM   7588  C CB    . PRO B 1 339 ? -12.206 58.878  27.372  1.00 16.89  ? 339  PRO B CB    1 
ATOM   7589  C CG    . PRO B 1 339 ? -11.656 57.571  26.896  1.00 16.83  ? 339  PRO B CG    1 
ATOM   7590  C CD    . PRO B 1 339 ? -10.540 57.937  25.956  1.00 16.92  ? 339  PRO B CD    1 
ATOM   7591  N N     . ALA B 1 340 ? -10.661 61.665  26.751  1.00 16.44  ? 340  ALA B N     1 
ATOM   7592  C CA    . ALA B 1 340 ? -10.340 63.020  27.208  1.00 16.39  ? 340  ALA B CA    1 
ATOM   7593  C C     . ALA B 1 340 ? -10.400 64.057  26.096  1.00 16.34  ? 340  ALA B C     1 
ATOM   7594  O O     . ALA B 1 340 ? -10.140 65.219  26.353  1.00 16.64  ? 340  ALA B O     1 
ATOM   7595  C CB    . ALA B 1 340 ? -8.972  63.052  27.895  1.00 16.42  ? 340  ALA B CB    1 
ATOM   7596  N N     . ARG B 1 341 ? -10.763 63.653  24.874  1.00 16.34  ? 341  ARG B N     1 
ATOM   7597  C CA    . ARG B 1 341 ? -10.812 64.594  23.749  1.00 15.84  ? 341  ARG B CA    1 
ATOM   7598  C C     . ARG B 1 341 ? -11.680 65.824  23.995  1.00 15.59  ? 341  ARG B C     1 
ATOM   7599  O O     . ARG B 1 341 ? -11.243 66.942  23.725  1.00 15.64  ? 341  ARG B O     1 
ATOM   7600  C CB    . ARG B 1 341 ? -11.266 63.947  22.438  1.00 15.59  ? 341  ARG B CB    1 
ATOM   7601  C CG    . ARG B 1 341 ? -11.187 64.941  21.243  1.00 15.05  ? 341  ARG B CG    1 
ATOM   7602  C CD    . ARG B 1 341 ? -9.733  65.408  21.019  1.00 14.51  ? 341  ARG B CD    1 
ATOM   7603  N NE    . ARG B 1 341 ? -9.559  66.414  19.967  1.00 14.89  ? 341  ARG B NE    1 
ATOM   7604  C CZ    . ARG B 1 341 ? -9.659  66.182  18.653  1.00 16.41  ? 341  ARG B CZ    1 
ATOM   7605  N NH1   . ARG B 1 341 ? -9.974  64.965  18.195  1.00 13.87  ? 341  ARG B NH1   1 
ATOM   7606  N NH2   . ARG B 1 341 ? -9.454  67.180  17.786  1.00 16.18  ? 341  ARG B NH2   1 
ATOM   7607  N N     . MET B 1 342 ? -12.907 65.624  24.470  1.00 15.29  ? 342  MET B N     1 
ATOM   7608  C CA    . MET B 1 342 ? -13.793 66.770  24.723  1.00 15.44  ? 342  MET B CA    1 
ATOM   7609  C C     . MET B 1 342 ? -13.128 67.830  25.593  1.00 15.56  ? 342  MET B C     1 
ATOM   7610  O O     . MET B 1 342 ? -13.187 69.021  25.275  1.00 15.94  ? 342  MET B O     1 
ATOM   7611  C CB    . MET B 1 342 ? -15.118 66.352  25.356  1.00 14.86  ? 342  MET B CB    1 
ATOM   7612  C CG    . MET B 1 342 ? -16.061 67.527  25.523  1.00 15.54  ? 342  MET B CG    1 
ATOM   7613  S SD    . MET B 1 342 ? -17.653 67.126  26.269  1.00 15.17  ? 342  MET B SD    1 
ATOM   7614  C CE    . MET B 1 342 ? -17.149 66.872  27.973  1.00 15.81  ? 342  MET B CE    1 
ATOM   7615  N N     . CYS B 1 343 ? -12.511 67.392  26.691  1.00 15.20  ? 343  CYS B N     1 
ATOM   7616  C CA    . CYS B 1 343 ? -11.869 68.312  27.623  1.00 15.49  ? 343  CYS B CA    1 
ATOM   7617  C C     . CYS B 1 343 ? -10.567 68.886  27.070  1.00 15.47  ? 343  CYS B C     1 
ATOM   7618  O O     . CYS B 1 343 ? -10.190 70.006  27.422  1.00 15.61  ? 343  CYS B O     1 
ATOM   7619  C CB    . CYS B 1 343 ? -11.653 67.645  28.989  1.00 15.18  ? 343  CYS B CB    1 
ATOM   7620  S SG    . CYS B 1 343 ? -13.229 67.339  29.857  1.00 17.06  ? 343  CYS B SG    1 
ATOM   7621  N N     . GLN B 1 344 ? -9.900  68.130  26.196  1.00 15.18  ? 344  GLN B N     1 
ATOM   7622  C CA    . GLN B 1 344 ? -8.723  68.628  25.491  1.00 15.76  ? 344  GLN B CA    1 
ATOM   7623  C C     . GLN B 1 344 ? -9.104  69.818  24.592  1.00 16.12  ? 344  GLN B C     1 
ATOM   7624  O O     . GLN B 1 344 ? -8.357  70.817  24.524  1.00 16.73  ? 344  GLN B O     1 
ATOM   7625  C CB    . GLN B 1 344 ? -8.039  67.513  24.678  1.00 15.66  ? 344  GLN B CB    1 
ATOM   7626  C CG    . GLN B 1 344 ? -7.338  66.478  25.535  1.00 15.48  ? 344  GLN B CG    1 
ATOM   7627  C CD    . GLN B 1 344 ? -6.806  65.258  24.777  1.00 16.00  ? 344  GLN B CD    1 
ATOM   7628  O OE1   . GLN B 1 344 ? -6.077  64.457  25.347  1.00 18.13  ? 344  GLN B OE1   1 
ATOM   7629  N NE2   . GLN B 1 344 ? -7.169  65.108  23.517  1.00 14.69  ? 344  GLN B NE2   1 
ATOM   7630  N N     . VAL B 1 345 ? -10.271 69.726  23.936  1.00 15.56  ? 345  VAL B N     1 
ATOM   7631  C CA    . VAL B 1 345 ? -10.802 70.852  23.150  1.00 15.30  ? 345  VAL B CA    1 
ATOM   7632  C C     . VAL B 1 345 ? -11.076 72.040  24.086  1.00 15.55  ? 345  VAL B C     1 
ATOM   7633  O O     . VAL B 1 345 ? -10.728 73.196  23.768  1.00 14.94  ? 345  VAL B O     1 
ATOM   7634  C CB    . VAL B 1 345 ? -12.077 70.476  22.310  1.00 15.50  ? 345  VAL B CB    1 
ATOM   7635  C CG1   . VAL B 1 345 ? -12.473 71.618  21.354  1.00 14.62  ? 345  VAL B CG1   1 
ATOM   7636  C CG2   . VAL B 1 345 ? -11.848 69.194  21.501  1.00 14.83  ? 345  VAL B CG2   1 
ATOM   7637  N N     . VAL B 1 346 ? -11.655 71.740  25.250  1.00 14.94  ? 346  VAL B N     1 
ATOM   7638  C CA    . VAL B 1 346 ? -11.955 72.767  26.250  1.00 14.67  ? 346  VAL B CA    1 
ATOM   7639  C C     . VAL B 1 346 ? -10.676 73.546  26.619  1.00 15.13  ? 346  VAL B C     1 
ATOM   7640  O O     . VAL B 1 346 ? -10.680 74.767  26.635  1.00 14.49  ? 346  VAL B O     1 
ATOM   7641  C CB    . VAL B 1 346 ? -12.664 72.173  27.526  1.00 14.24  ? 346  VAL B CB    1 
ATOM   7642  C CG1   . VAL B 1 346 ? -12.644 73.154  28.704  1.00 12.50  ? 346  VAL B CG1   1 
ATOM   7643  C CG2   . VAL B 1 346 ? -14.093 71.751  27.204  1.00 13.02  ? 346  VAL B CG2   1 
ATOM   7644  N N     . ASP B 1 347 ? -9.588  72.831  26.879  1.00 16.06  ? 347  ASP B N     1 
ATOM   7645  C CA    . ASP B 1 347 ? -8.327  73.469  27.258  1.00 17.22  ? 347  ASP B CA    1 
ATOM   7646  C C     . ASP B 1 347 ? -7.667  74.231  26.108  1.00 17.64  ? 347  ASP B C     1 
ATOM   7647  O O     . ASP B 1 347 ? -7.232  75.385  26.279  1.00 18.18  ? 347  ASP B O     1 
ATOM   7648  C CB    . ASP B 1 347 ? -7.343  72.427  27.801  1.00 17.38  ? 347  ASP B CB    1 
ATOM   7649  C CG    . ASP B 1 347 ? -7.725  71.923  29.174  1.00 17.95  ? 347  ASP B CG    1 
ATOM   7650  O OD1   . ASP B 1 347 ? -8.609  72.523  29.819  1.00 18.52  ? 347  ASP B OD1   1 
ATOM   7651  O OD2   . ASP B 1 347 ? -7.123  70.925  29.612  1.00 19.85  ? 347  ASP B OD2   1 
ATOM   7652  N N     . LYS B 1 348 ? -7.566  73.568  24.957  1.00 17.41  ? 348  LYS B N     1 
ATOM   7653  C CA    . LYS B 1 348 ? -6.919  74.135  23.786  1.00 17.66  ? 348  LYS B CA    1 
ATOM   7654  C C     . LYS B 1 348 ? -7.558  75.463  23.441  1.00 17.70  ? 348  LYS B C     1 
ATOM   7655  O O     . LYS B 1 348 ? -6.873  76.453  23.221  1.00 17.67  ? 348  LYS B O     1 
ATOM   7656  C CB    . LYS B 1 348 ? -7.061  73.184  22.595  1.00 17.40  ? 348  LYS B CB    1 
ATOM   7657  C CG    . LYS B 1 348 ? -6.374  73.667  21.343  1.00 18.32  ? 348  LYS B CG    1 
ATOM   7658  C CD    . LYS B 1 348 ? -6.408  72.577  20.275  1.00 17.54  ? 348  LYS B CD    1 
ATOM   7659  C CE    . LYS B 1 348 ? -6.052  73.127  18.913  1.00 16.86  ? 348  LYS B CE    1 
ATOM   7660  N NZ    . LYS B 1 348 ? -6.098  72.053  17.859  1.00 17.08  ? 348  LYS B NZ    1 
ATOM   7661  N N     . HIS B 1 349 ? -8.885  75.476  23.400  1.00 17.80  ? 349  HIS B N     1 
ATOM   7662  C CA    . HIS B 1 349 ? -9.612  76.662  22.972  1.00 17.70  ? 349  HIS B CA    1 
ATOM   7663  C C     . HIS B 1 349 ? -10.164 77.504  24.125  1.00 18.11  ? 349  HIS B C     1 
ATOM   7664  O O     . HIS B 1 349 ? -10.870 78.495  23.892  1.00 18.79  ? 349  HIS B O     1 
ATOM   7665  C CB    . HIS B 1 349 ? -10.686 76.262  21.967  1.00 17.18  ? 349  HIS B CB    1 
ATOM   7666  C CG    . HIS B 1 349 ? -10.117 75.670  20.711  1.00 16.95  ? 349  HIS B CG    1 
ATOM   7667  N ND1   . HIS B 1 349 ? -9.217  76.348  19.911  1.00 16.43  ? 349  HIS B ND1   1 
ATOM   7668  C CD2   . HIS B 1 349 ? -10.302 74.460  20.126  1.00 14.76  ? 349  HIS B CD2   1 
ATOM   7669  C CE1   . HIS B 1 349 ? -8.868  75.583  18.893  1.00 13.94  ? 349  HIS B CE1   1 
ATOM   7670  N NE2   . HIS B 1 349 ? -9.510  74.432  19.002  1.00 15.54  ? 349  HIS B NE2   1 
ATOM   7671  N N     . GLN B 1 350 ? -9.821  77.122  25.361  1.00 17.64  ? 350  GLN B N     1 
ATOM   7672  C CA    . GLN B 1 350 ? -10.243 77.863  26.549  1.00 17.49  ? 350  GLN B CA    1 
ATOM   7673  C C     . GLN B 1 350 ? -11.754 78.156  26.532  1.00 17.28  ? 350  GLN B C     1 
ATOM   7674  O O     . GLN B 1 350 ? -12.182 79.298  26.696  1.00 17.24  ? 350  GLN B O     1 
ATOM   7675  C CB    . GLN B 1 350 ? -9.405  79.150  26.728  1.00 17.81  ? 350  GLN B CB    1 
ATOM   7676  C CG    . GLN B 1 350 ? -7.910  78.919  27.011  1.00 17.87  ? 350  GLN B CG    1 
ATOM   7677  C CD    . GLN B 1 350 ? -7.634  78.381  28.416  1.00 19.56  ? 350  GLN B CD    1 
ATOM   7678  O OE1   . GLN B 1 350 ? -7.337  77.197  28.592  1.00 20.28  ? 350  GLN B OE1   1 
ATOM   7679  N NE2   . GLN B 1 350 ? -7.727  79.253  29.419  1.00 18.03  ? 350  GLN B NE2   1 
ATOM   7680  N N     . VAL B 1 351 ? -12.551 77.104  26.323  1.00 16.88  ? 351  VAL B N     1 
ATOM   7681  C CA    . VAL B 1 351 ? -14.013 77.187  26.383  1.00 16.11  ? 351  VAL B CA    1 
ATOM   7682  C C     . VAL B 1 351 ? -14.509 77.637  27.772  1.00 16.23  ? 351  VAL B C     1 
ATOM   7683  O O     . VAL B 1 351 ? -14.043 77.135  28.800  1.00 15.57  ? 351  VAL B O     1 
ATOM   7684  C CB    . VAL B 1 351 ? -14.675 75.824  26.019  1.00 16.11  ? 351  VAL B CB    1 
ATOM   7685  C CG1   . VAL B 1 351 ? -16.180 75.951  25.946  1.00 15.78  ? 351  VAL B CG1   1 
ATOM   7686  C CG2   . VAL B 1 351 ? -14.140 75.279  24.696  1.00 15.69  ? 351  VAL B CG2   1 
ATOM   7687  N N     . ASN B 1 352 ? -15.460 78.576  27.776  1.00 16.16  ? 352  ASN B N     1 
ATOM   7688  C CA    . ASN B 1 352 ? -16.099 79.075  28.995  1.00 16.47  ? 352  ASN B CA    1 
ATOM   7689  C C     . ASN B 1 352 ? -17.481 78.473  29.224  1.00 16.75  ? 352  ASN B C     1 
ATOM   7690  O O     . ASN B 1 352 ? -17.915 78.309  30.366  1.00 17.06  ? 352  ASN B O     1 
ATOM   7691  C CB    . ASN B 1 352 ? -16.201 80.597  28.944  1.00 16.35  ? 352  ASN B CB    1 
ATOM   7692  C CG    . ASN B 1 352 ? -14.854 81.260  28.695  1.00 17.05  ? 352  ASN B CG    1 
ATOM   7693  O OD1   . ASN B 1 352 ? -14.682 81.984  27.714  1.00 18.78  ? 352  ASN B OD1   1 
ATOM   7694  N ND2   . ASN B 1 352 ? -13.887 81.005  29.579  1.00 15.58  ? 352  ASN B ND2   1 
ATOM   7695  N N     . ILE B 1 353 ? -18.158 78.140  28.128  1.00 16.69  ? 353  ILE B N     1 
ATOM   7696  C CA    . ILE B 1 353 ? -19.489 77.557  28.167  1.00 16.35  ? 353  ILE B CA    1 
ATOM   7697  C C     . ILE B 1 353 ? -19.513 76.283  27.308  1.00 16.98  ? 353  ILE B C     1 
ATOM   7698  O O     . ILE B 1 353 ? -19.141 76.305  26.132  1.00 17.05  ? 353  ILE B O     1 
ATOM   7699  C CB    . ILE B 1 353 ? -20.574 78.535  27.643  1.00 16.04  ? 353  ILE B CB    1 
ATOM   7700  C CG1   . ILE B 1 353 ? -20.464 79.907  28.321  1.00 16.44  ? 353  ILE B CG1   1 
ATOM   7701  C CG2   . ILE B 1 353 ? -21.969 77.942  27.828  1.00 14.95  ? 353  ILE B CG2   1 
ATOM   7702  C CD1   . ILE B 1 353 ? -21.050 81.079  27.492  1.00 15.87  ? 353  ILE B CD1   1 
ATOM   7703  N N     . LEU B 1 354 ? -19.962 75.181  27.903  1.00 16.89  ? 354  LEU B N     1 
ATOM   7704  C CA    . LEU B 1 354 ? -20.034 73.936  27.193  1.00 16.88  ? 354  LEU B CA    1 
ATOM   7705  C C     . LEU B 1 354 ? -21.455 73.401  27.226  1.00 16.97  ? 354  LEU B C     1 
ATOM   7706  O O     . LEU B 1 354 ? -22.058 73.253  28.289  1.00 16.79  ? 354  LEU B O     1 
ATOM   7707  C CB    . LEU B 1 354 ? -19.047 72.928  27.783  1.00 17.16  ? 354  LEU B CB    1 
ATOM   7708  C CG    . LEU B 1 354 ? -19.123 71.487  27.268  1.00 16.64  ? 354  LEU B CG    1 
ATOM   7709  C CD1   . LEU B 1 354 ? -18.712 71.408  25.784  1.00 15.83  ? 354  LEU B CD1   1 
ATOM   7710  C CD2   . LEU B 1 354 ? -18.266 70.557  28.140  1.00 15.55  ? 354  LEU B CD2   1 
ATOM   7711  N N     . TYR B 1 355 ? -21.972 73.111  26.043  1.00 16.55  ? 355  TYR B N     1 
ATOM   7712  C CA    . TYR B 1 355 ? -23.344 72.692  25.880  1.00 16.77  ? 355  TYR B CA    1 
ATOM   7713  C C     . TYR B 1 355 ? -23.338 71.391  25.099  1.00 16.52  ? 355  TYR B C     1 
ATOM   7714  O O     . TYR B 1 355 ? -23.027 71.385  23.902  1.00 17.39  ? 355  TYR B O     1 
ATOM   7715  C CB    . TYR B 1 355 ? -24.091 73.767  25.102  1.00 16.65  ? 355  TYR B CB    1 
ATOM   7716  C CG    . TYR B 1 355 ? -25.579 73.566  24.964  1.00 16.64  ? 355  TYR B CG    1 
ATOM   7717  C CD1   . TYR B 1 355 ? -26.346 73.014  26.007  1.00 16.02  ? 355  TYR B CD1   1 
ATOM   7718  C CD2   . TYR B 1 355 ? -26.236 73.976  23.803  1.00 17.01  ? 355  TYR B CD2   1 
ATOM   7719  C CE1   . TYR B 1 355 ? -27.733 72.877  25.876  1.00 16.42  ? 355  TYR B CE1   1 
ATOM   7720  C CE2   . TYR B 1 355 ? -27.622 73.848  23.668  1.00 16.36  ? 355  TYR B CE2   1 
ATOM   7721  C CZ    . TYR B 1 355 ? -28.355 73.302  24.705  1.00 16.66  ? 355  TYR B CZ    1 
ATOM   7722  O OH    . TYR B 1 355 ? -29.708 73.173  24.545  1.00 17.59  ? 355  TYR B OH    1 
ATOM   7723  N N     . THR B 1 356 ? -23.666 70.300  25.779  1.00 15.94  ? 356  THR B N     1 
ATOM   7724  C CA    . THR B 1 356 ? -23.612 68.971  25.189  1.00 15.72  ? 356  THR B CA    1 
ATOM   7725  C C     . THR B 1 356 ? -24.827 68.097  25.564  1.00 15.90  ? 356  THR B C     1 
ATOM   7726  O O     . THR B 1 356 ? -25.855 68.613  26.043  1.00 15.73  ? 356  THR B O     1 
ATOM   7727  C CB    . THR B 1 356 ? -22.203 68.278  25.408  1.00 15.71  ? 356  THR B CB    1 
ATOM   7728  O OG1   . THR B 1 356 ? -22.071 67.137  24.532  1.00 15.56  ? 356  THR B OG1   1 
ATOM   7729  C CG2   . THR B 1 356 ? -21.964 67.883  26.851  1.00 15.51  ? 356  THR B CG2   1 
ATOM   7730  N N     . ALA B 1 357 ? -24.709 66.785  25.316  1.00 15.87  ? 357  ALA B N     1 
ATOM   7731  C CA    . ALA B 1 357 ? -25.820 65.835  25.414  1.00 15.16  ? 357  ALA B CA    1 
ATOM   7732  C C     . ALA B 1 357 ? -25.568 64.724  26.432  1.00 14.75  ? 357  ALA B C     1 
ATOM   7733  O O     . ALA B 1 357 ? -24.439 64.232  26.535  1.00 14.19  ? 357  ALA B O     1 
ATOM   7734  C CB    . ALA B 1 357 ? -26.106 65.201  24.012  1.00 15.60  ? 357  ALA B CB    1 
ATOM   7735  N N     . PRO B 1 358 ? -26.627 64.289  27.164  1.00 14.06  ? 358  PRO B N     1 
ATOM   7736  C CA    . PRO B 1 358 ? -26.477 63.168  28.103  1.00 14.06  ? 358  PRO B CA    1 
ATOM   7737  C C     . PRO B 1 358 ? -25.824 61.893  27.520  1.00 14.45  ? 358  PRO B C     1 
ATOM   7738  O O     . PRO B 1 358 ? -25.077 61.222  28.234  1.00 14.99  ? 358  PRO B O     1 
ATOM   7739  C CB    . PRO B 1 358 ? -27.910 62.920  28.579  1.00 13.25  ? 358  PRO B CB    1 
ATOM   7740  C CG    . PRO B 1 358 ? -28.549 64.281  28.470  1.00 14.06  ? 358  PRO B CG    1 
ATOM   7741  C CD    . PRO B 1 358 ? -27.996 64.835  27.195  1.00 13.59  ? 358  PRO B CD    1 
ATOM   7742  N N     . THR B 1 359 ? -26.082 61.556  26.256  1.00 14.75  ? 359  THR B N     1 
ATOM   7743  C CA    . THR B 1 359 ? -25.412 60.390  25.641  1.00 15.09  ? 359  THR B CA    1 
ATOM   7744  C C     . THR B 1 359 ? -23.876 60.509  25.697  1.00 14.93  ? 359  THR B C     1 
ATOM   7745  O O     . THR B 1 359 ? -23.181 59.572  26.120  1.00 14.89  ? 359  THR B O     1 
ATOM   7746  C CB    . THR B 1 359 ? -25.919 60.100  24.196  1.00 15.42  ? 359  THR B CB    1 
ATOM   7747  O OG1   . THR B 1 359 ? -27.285 59.676  24.257  1.00 15.97  ? 359  THR B OG1   1 
ATOM   7748  C CG2   . THR B 1 359 ? -25.097 58.977  23.528  1.00 15.25  ? 359  THR B CG2   1 
ATOM   7749  N N     . ALA B 1 360 ? -23.357 61.665  25.292  1.00 14.71  ? 360  ALA B N     1 
ATOM   7750  C CA    . ALA B 1 360 ? -21.922 61.979  25.428  1.00 14.48  ? 360  ALA B CA    1 
ATOM   7751  C C     . ALA B 1 360 ? -21.461 61.891  26.896  1.00 14.59  ? 360  ALA B C     1 
ATOM   7752  O O     . ALA B 1 360 ? -20.514 61.167  27.205  1.00 14.50  ? 360  ALA B O     1 
ATOM   7753  C CB    . ALA B 1 360 ? -21.616 63.370  24.824  1.00 14.21  ? 360  ALA B CB    1 
ATOM   7754  N N     . ILE B 1 361 ? -22.160 62.582  27.802  1.00 14.46  ? 361  ILE B N     1 
ATOM   7755  C CA    . ILE B 1 361 ? -21.837 62.542  29.229  1.00 14.62  ? 361  ILE B CA    1 
ATOM   7756  C C     . ILE B 1 361 ? -21.766 61.118  29.803  1.00 14.79  ? 361  ILE B C     1 
ATOM   7757  O O     . ILE B 1 361 ? -20.798 60.799  30.501  1.00 14.31  ? 361  ILE B O     1 
ATOM   7758  C CB    . ILE B 1 361 ? -22.809 63.435  30.097  1.00 15.35  ? 361  ILE B CB    1 
ATOM   7759  C CG1   . ILE B 1 361 ? -22.719 64.918  29.684  1.00 15.45  ? 361  ILE B CG1   1 
ATOM   7760  C CG2   . ILE B 1 361 ? -22.551 63.245  31.631  1.00 14.35  ? 361  ILE B CG2   1 
ATOM   7761  C CD1   . ILE B 1 361 ? -23.917 65.759  30.152  1.00 14.48  ? 361  ILE B CD1   1 
ATOM   7762  N N     . ARG B 1 362 ? -22.783 60.285  29.522  1.00 14.48  ? 362  ARG B N     1 
ATOM   7763  C CA    . ARG B 1 362 ? -22.786 58.860  29.918  1.00 15.03  ? 362  ARG B CA    1 
ATOM   7764  C C     . ARG B 1 362 ? -21.617 58.063  29.319  1.00 15.17  ? 362  ARG B C     1 
ATOM   7765  O O     . ARG B 1 362 ? -21.063 57.181  29.978  1.00 14.74  ? 362  ARG B O     1 
ATOM   7766  C CB    . ARG B 1 362 ? -24.113 58.174  29.531  1.00 14.94  ? 362  ARG B CB    1 
ATOM   7767  C CG    . ARG B 1 362 ? -25.342 58.642  30.307  1.00 15.79  ? 362  ARG B CG    1 
ATOM   7768  C CD    . ARG B 1 362 ? -26.572 57.763  30.033  1.00 15.98  ? 362  ARG B CD    1 
ATOM   7769  N NE    . ARG B 1 362 ? -26.840 57.620  28.591  1.00 20.10  ? 362  ARG B NE    1 
ATOM   7770  C CZ    . ARG B 1 362 ? -27.721 58.355  27.916  1.00 19.30  ? 362  ARG B CZ    1 
ATOM   7771  N NH1   . ARG B 1 362 ? -28.419 59.282  28.546  1.00 18.68  ? 362  ARG B NH1   1 
ATOM   7772  N NH2   . ARG B 1 362 ? -27.906 58.157  26.614  1.00 19.86  ? 362  ARG B NH2   1 
ATOM   7773  N N     . ALA B 1 363 ? -21.257 58.372  28.067  1.00 15.47  ? 363  ALA B N     1 
ATOM   7774  C CA    . ALA B 1 363 ? -20.116 57.735  27.401  1.00 16.43  ? 363  ALA B CA    1 
ATOM   7775  C C     . ALA B 1 363 ? -18.781 58.074  28.060  1.00 17.21  ? 363  ALA B C     1 
ATOM   7776  O O     . ALA B 1 363 ? -17.907 57.193  28.200  1.00 17.73  ? 363  ALA B O     1 
ATOM   7777  C CB    . ALA B 1 363 ? -20.072 58.103  25.915  1.00 16.65  ? 363  ALA B CB    1 
ATOM   7778  N N     . LEU B 1 364 ? -18.610 59.342  28.440  1.00 17.48  ? 364  LEU B N     1 
ATOM   7779  C CA    . LEU B 1 364 ? -17.388 59.779  29.128  1.00 18.18  ? 364  LEU B CA    1 
ATOM   7780  C C     . LEU B 1 364 ? -17.367 59.247  30.547  1.00 18.23  ? 364  LEU B C     1 
ATOM   7781  O O     . LEU B 1 364 ? -16.339 58.818  31.047  1.00 18.42  ? 364  LEU B O     1 
ATOM   7782  C CB    . LEU B 1 364 ? -17.266 61.306  29.137  1.00 17.90  ? 364  LEU B CB    1 
ATOM   7783  C CG    . LEU B 1 364 ? -17.200 61.937  27.741  1.00 18.94  ? 364  LEU B CG    1 
ATOM   7784  C CD1   . LEU B 1 364 ? -17.123 63.438  27.830  1.00 19.99  ? 364  LEU B CD1   1 
ATOM   7785  C CD2   . LEU B 1 364 ? -16.045 61.368  26.894  1.00 19.88  ? 364  LEU B CD2   1 
ATOM   7786  N N     . MET B 1 365 ? -18.529 59.266  31.180  1.00 18.54  ? 365  MET B N     1 
ATOM   7787  C CA    . MET B 1 365 ? -18.675 58.814  32.546  1.00 19.10  ? 365  MET B CA    1 
ATOM   7788  C C     . MET B 1 365 ? -18.311 57.334  32.698  1.00 18.58  ? 365  MET B C     1 
ATOM   7789  O O     . MET B 1 365 ? -17.729 56.937  33.699  1.00 18.79  ? 365  MET B O     1 
ATOM   7790  C CB    . MET B 1 365 ? -20.108 59.074  33.003  1.00 18.98  ? 365  MET B CB    1 
ATOM   7791  C CG    . MET B 1 365 ? -20.358 58.704  34.416  1.00 19.65  ? 365  MET B CG    1 
ATOM   7792  S SD    . MET B 1 365 ? -21.995 59.229  34.868  1.00 20.79  ? 365  MET B SD    1 
ATOM   7793  C CE    . MET B 1 365 ? -22.027 58.646  36.551  1.00 20.20  ? 365  MET B CE    1 
ATOM   7794  N N     . ALA B 1 366 ? -18.645 56.540  31.685  1.00 18.75  ? 366  ALA B N     1 
ATOM   7795  C CA    . ALA B 1 366 ? -18.344 55.121  31.653  1.00 18.59  ? 366  ALA B CA    1 
ATOM   7796  C C     . ALA B 1 366 ? -16.838 54.857  31.680  1.00 18.90  ? 366  ALA B C     1 
ATOM   7797  O O     . ALA B 1 366 ? -16.407 53.768  32.071  1.00 17.86  ? 366  ALA B O     1 
ATOM   7798  C CB    . ALA B 1 366 ? -18.981 54.468  30.422  1.00 18.44  ? 366  ALA B CB    1 
ATOM   7799  N N     . GLU B 1 367 ? -16.062 55.863  31.256  1.00 19.42  ? 367  GLU B N     1 
ATOM   7800  C CA    . GLU B 1 367 ? -14.596 55.816  31.215  1.00 19.78  ? 367  GLU B CA    1 
ATOM   7801  C C     . GLU B 1 367 ? -13.961 56.342  32.508  1.00 19.65  ? 367  GLU B C     1 
ATOM   7802  O O     . GLU B 1 367 ? -12.744 56.198  32.717  1.00 19.03  ? 367  GLU B O     1 
ATOM   7803  C CB    . GLU B 1 367 ? -14.077 56.629  30.021  1.00 20.42  ? 367  GLU B CB    1 
ATOM   7804  C CG    . GLU B 1 367 ? -14.551 56.115  28.653  1.00 23.74  ? 367  GLU B CG    1 
ATOM   7805  C CD    . GLU B 1 367 ? -14.363 54.605  28.467  1.00 29.72  ? 367  GLU B CD    1 
ATOM   7806  O OE1   . GLU B 1 367 ? -13.229 54.115  28.628  1.00 31.67  ? 367  GLU B OE1   1 
ATOM   7807  O OE2   . GLU B 1 367 ? -15.355 53.902  28.152  1.00 32.99  ? 367  GLU B OE2   1 
ATOM   7808  N N     . GLY B 1 368 ? -14.783 56.964  33.359  1.00 19.24  ? 368  GLY B N     1 
ATOM   7809  C CA    . GLY B 1 368 ? -14.315 57.525  34.624  1.00 18.58  ? 368  GLY B CA    1 
ATOM   7810  C C     . GLY B 1 368 ? -13.352 58.688  34.454  1.00 18.45  ? 368  GLY B C     1 
ATOM   7811  O O     . GLY B 1 368 ? -13.602 59.617  33.681  1.00 18.11  ? 368  GLY B O     1 
ATOM   7812  N N     . ASP B 1 369 ? -12.245 58.640  35.188  1.00 18.50  ? 369  ASP B N     1 
ATOM   7813  C CA    . ASP B 1 369 ? -11.289 59.746  35.201  1.00 18.39  ? 369  ASP B CA    1 
ATOM   7814  C C     . ASP B 1 369 ? -10.453 59.833  33.908  1.00 18.49  ? 369  ASP B C     1 
ATOM   7815  O O     . ASP B 1 369 ? -9.767  60.826  33.674  1.00 17.98  ? 369  ASP B O     1 
ATOM   7816  C CB    . ASP B 1 369 ? -10.414 59.683  36.458  1.00 18.66  ? 369  ASP B CB    1 
ATOM   7817  C CG    . ASP B 1 369 ? -11.205 59.989  37.739  1.00 18.58  ? 369  ASP B CG    1 
ATOM   7818  O OD1   . ASP B 1 369 ? -12.302 60.576  37.658  1.00 17.11  ? 369  ASP B OD1   1 
ATOM   7819  O OD2   . ASP B 1 369 ? -10.727 59.637  38.835  1.00 20.02  ? 369  ASP B OD2   1 
ATOM   7820  N N     . LYS B 1 370 ? -10.551 58.804  33.064  1.00 18.24  ? 370  LYS B N     1 
ATOM   7821  C CA    . LYS B 1 370 ? -9.978  58.840  31.734  1.00 18.69  ? 370  LYS B CA    1 
ATOM   7822  C C     . LYS B 1 370 ? -10.602 59.956  30.891  1.00 18.40  ? 370  LYS B C     1 
ATOM   7823  O O     . LYS B 1 370 ? -9.992  60.438  29.946  1.00 18.21  ? 370  LYS B O     1 
ATOM   7824  C CB    . LYS B 1 370 ? -10.164 57.491  31.034  1.00 19.01  ? 370  LYS B CB    1 
ATOM   7825  C CG    . LYS B 1 370 ? -9.377  56.353  31.650  1.00 20.96  ? 370  LYS B CG    1 
ATOM   7826  C CD    . LYS B 1 370 ? -9.027  55.273  30.628  1.00 26.50  ? 370  LYS B CD    1 
ATOM   7827  C CE    . LYS B 1 370 ? -10.253 54.691  29.908  1.00 29.32  ? 370  LYS B CE    1 
ATOM   7828  N NZ    . LYS B 1 370 ? -9.870  53.786  28.775  1.00 31.60  ? 370  LYS B NZ    1 
ATOM   7829  N N     . ALA B 1 371 ? -11.821 60.367  31.242  1.00 18.24  ? 371  ALA B N     1 
ATOM   7830  C CA    . ALA B 1 371 ? -12.497 61.446  30.521  1.00 18.03  ? 371  ALA B CA    1 
ATOM   7831  C C     . ALA B 1 371 ? -11.874 62.825  30.797  1.00 18.05  ? 371  ALA B C     1 
ATOM   7832  O O     . ALA B 1 371 ? -12.030 63.749  29.984  1.00 17.83  ? 371  ALA B O     1 
ATOM   7833  C CB    . ALA B 1 371 ? -13.975 61.442  30.833  1.00 17.46  ? 371  ALA B CB    1 
ATOM   7834  N N     . ILE B 1 372 ? -11.155 62.941  31.916  1.00 18.03  ? 372  ILE B N     1 
ATOM   7835  C CA    . ILE B 1 372 ? -10.545 64.215  32.361  1.00 18.78  ? 372  ILE B CA    1 
ATOM   7836  C C     . ILE B 1 372 ? -9.019  64.173  32.576  1.00 19.33  ? 372  ILE B C     1 
ATOM   7837  O O     . ILE B 1 372 ? -8.402  65.204  32.869  1.00 19.41  ? 372  ILE B O     1 
ATOM   7838  C CB    . ILE B 1 372 ? -11.208 64.762  33.672  1.00 18.85  ? 372  ILE B CB    1 
ATOM   7839  C CG1   . ILE B 1 372 ? -10.998 63.791  34.852  1.00 18.98  ? 372  ILE B CG1   1 
ATOM   7840  C CG2   . ILE B 1 372 ? -12.695 65.097  33.458  1.00 18.51  ? 372  ILE B CG2   1 
ATOM   7841  C CD1   . ILE B 1 372 ? -11.199 64.422  36.231  1.00 18.81  ? 372  ILE B CD1   1 
ATOM   7842  N N     . GLU B 1 373 ? -8.432  62.985  32.433  1.00 19.64  ? 373  GLU B N     1 
ATOM   7843  C CA    . GLU B 1 373 ? -7.006  62.732  32.679  1.00 20.76  ? 373  GLU B CA    1 
ATOM   7844  C C     . GLU B 1 373 ? -6.078  63.600  31.822  1.00 20.33  ? 373  GLU B C     1 
ATOM   7845  O O     . GLU B 1 373 ? -6.142  63.581  30.576  1.00 20.01  ? 373  GLU B O     1 
ATOM   7846  C CB    . GLU B 1 373 ? -6.687  61.248  32.447  1.00 20.59  ? 373  GLU B CB    1 
ATOM   7847  C CG    . GLU B 1 373 ? -5.390  60.730  33.080  1.00 22.50  ? 373  GLU B CG    1 
ATOM   7848  C CD    . GLU B 1 373 ? -5.137  59.251  32.746  1.00 23.30  ? 373  GLU B CD    1 
ATOM   7849  O OE1   . GLU B 1 373 ? -5.865  58.372  33.273  1.00 25.85  ? 373  GLU B OE1   1 
ATOM   7850  O OE2   . GLU B 1 373 ? -4.214  58.967  31.947  1.00 27.41  ? 373  GLU B OE2   1 
ATOM   7851  N N     . GLY B 1 374 ? -5.222  64.358  32.503  1.00 19.78  ? 374  GLY B N     1 
ATOM   7852  C CA    . GLY B 1 374 ? -4.255  65.208  31.832  1.00 19.90  ? 374  GLY B CA    1 
ATOM   7853  C C     . GLY B 1 374 ? -4.852  66.497  31.308  1.00 20.17  ? 374  GLY B C     1 
ATOM   7854  O O     . GLY B 1 374 ? -4.186  67.229  30.579  1.00 20.65  ? 374  GLY B O     1 
ATOM   7855  N N     . THR B 1 375 ? -6.106  66.781  31.667  1.00 20.02  ? 375  THR B N     1 
ATOM   7856  C CA    . THR B 1 375 ? -6.746  68.033  31.272  1.00 19.77  ? 375  THR B CA    1 
ATOM   7857  C C     . THR B 1 375 ? -7.011  68.890  32.485  1.00 19.89  ? 375  THR B C     1 
ATOM   7858  O O     . THR B 1 375 ? -6.935  68.428  33.627  1.00 19.52  ? 375  THR B O     1 
ATOM   7859  C CB    . THR B 1 375 ? -8.057  67.843  30.464  1.00 19.50  ? 375  THR B CB    1 
ATOM   7860  O OG1   . THR B 1 375 ? -9.133  67.470  31.344  1.00 19.89  ? 375  THR B OG1   1 
ATOM   7861  C CG2   . THR B 1 375 ? -7.871  66.803  29.386  1.00 19.18  ? 375  THR B CG2   1 
ATOM   7862  N N     . ASP B 1 376 ? -7.338  70.146  32.226  1.00 20.45  ? 376  ASP B N     1 
ATOM   7863  C CA    . ASP B 1 376 ? -7.428  71.132  33.287  1.00 20.99  ? 376  ASP B CA    1 
ATOM   7864  C C     . ASP B 1 376 ? -8.848  71.674  33.525  1.00 20.64  ? 376  ASP B C     1 
ATOM   7865  O O     . ASP B 1 376 ? -9.285  71.769  34.680  1.00 20.44  ? 376  ASP B O     1 
ATOM   7866  C CB    . ASP B 1 376 ? -6.428  72.248  33.010  1.00 21.71  ? 376  ASP B CB    1 
ATOM   7867  C CG    . ASP B 1 376 ? -6.377  73.238  34.108  1.00 23.95  ? 376  ASP B CG    1 
ATOM   7868  O OD1   . ASP B 1 376 ? -6.998  74.310  33.949  1.00 27.02  ? 376  ASP B OD1   1 
ATOM   7869  O OD2   . ASP B 1 376 ? -5.743  72.932  35.142  1.00 27.69  ? 376  ASP B OD2   1 
ATOM   7870  N N     . ARG B 1 377 ? -9.545  72.038  32.444  1.00 20.28  ? 377  ARG B N     1 
ATOM   7871  C CA    . ARG B 1 377 ? -10.973 72.443  32.490  1.00 20.15  ? 377  ARG B CA    1 
ATOM   7872  C C     . ARG B 1 377 ? -11.302 73.739  33.238  1.00 19.99  ? 377  ARG B C     1 
ATOM   7873  O O     . ARG B 1 377 ? -12.475 74.079  33.378  1.00 20.42  ? 377  ARG B O     1 
ATOM   7874  C CB    . ARG B 1 377 ? -11.859 71.314  33.064  1.00 20.10  ? 377  ARG B CB    1 
ATOM   7875  C CG    . ARG B 1 377 ? -11.994 70.050  32.209  1.00 18.55  ? 377  ARG B CG    1 
ATOM   7876  C CD    . ARG B 1 377 ? -12.117 68.820  33.120  1.00 18.33  ? 377  ARG B CD    1 
ATOM   7877  N NE    . ARG B 1 377 ? -10.804 68.444  33.644  1.00 18.00  ? 377  ARG B NE    1 
ATOM   7878  C CZ    . ARG B 1 377 ? -10.492 68.233  34.923  1.00 17.71  ? 377  ARG B CZ    1 
ATOM   7879  N NH1   . ARG B 1 377 ? -11.407 68.302  35.897  1.00 16.62  ? 377  ARG B NH1   1 
ATOM   7880  N NH2   . ARG B 1 377 ? -9.239  67.910  35.221  1.00 17.17  ? 377  ARG B NH2   1 
ATOM   7881  N N     . SER B 1 378 ? -10.288 74.449  33.732  1.00 20.05  ? 378  SER B N     1 
ATOM   7882  C CA    . SER B 1 378 ? -10.499 75.665  34.538  1.00 19.47  ? 378  SER B CA    1 
ATOM   7883  C C     . SER B 1 378 ? -11.183 76.810  33.786  1.00 18.71  ? 378  SER B C     1 
ATOM   7884  O O     . SER B 1 378 ? -11.770 77.685  34.403  1.00 18.59  ? 378  SER B O     1 
ATOM   7885  C CB    . SER B 1 378 ? -9.167  76.165  35.118  1.00 20.22  ? 378  SER B CB    1 
ATOM   7886  O OG    . SER B 1 378 ? -8.573  75.179  35.947  1.00 21.65  ? 378  SER B OG    1 
ATOM   7887  N N     . SER B 1 379 ? -11.093 76.818  32.459  1.00 18.30  ? 379  SER B N     1 
ATOM   7888  C CA    . SER B 1 379 ? -11.719 77.882  31.671  1.00 17.71  ? 379  SER B CA    1 
ATOM   7889  C C     . SER B 1 379 ? -13.262 77.919  31.781  1.00 17.20  ? 379  SER B C     1 
ATOM   7890  O O     . SER B 1 379 ? -13.870 78.968  31.567  1.00 17.02  ? 379  SER B O     1 
ATOM   7891  C CB    . SER B 1 379 ? -11.238 77.855  30.210  1.00 17.69  ? 379  SER B CB    1 
ATOM   7892  O OG    . SER B 1 379 ? -11.625 76.671  29.508  1.00 18.43  ? 379  SER B OG    1 
ATOM   7893  N N     . LEU B 1 380 ? -13.870 76.791  32.159  1.00 16.62  ? 380  LEU B N     1 
ATOM   7894  C CA    . LEU B 1 380 ? -15.329 76.615  32.158  1.00 15.98  ? 380  LEU B CA    1 
ATOM   7895  C C     . LEU B 1 380 ? -16.036 77.379  33.269  1.00 16.72  ? 380  LEU B C     1 
ATOM   7896  O O     . LEU B 1 380 ? -15.593 77.362  34.428  1.00 15.75  ? 380  LEU B O     1 
ATOM   7897  C CB    . LEU B 1 380 ? -15.680 75.126  32.255  1.00 16.10  ? 380  LEU B CB    1 
ATOM   7898  C CG    . LEU B 1 380 ? -15.398 74.263  31.011  1.00 15.65  ? 380  LEU B CG    1 
ATOM   7899  C CD1   . LEU B 1 380 ? -15.653 72.774  31.276  1.00 15.17  ? 380  LEU B CD1   1 
ATOM   7900  C CD2   . LEU B 1 380 ? -16.222 74.736  29.813  1.00 13.79  ? 380  LEU B CD2   1 
ATOM   7901  N N     . ARG B 1 381 ? -17.143 78.032  32.901  1.00 17.06  ? 381  ARG B N     1 
ATOM   7902  C CA    . ARG B 1 381 ? -17.984 78.793  33.834  1.00 17.95  ? 381  ARG B CA    1 
ATOM   7903  C C     . ARG B 1 381 ? -19.418 78.283  33.840  1.00 17.53  ? 381  ARG B C     1 
ATOM   7904  O O     . ARG B 1 381 ? -20.111 78.381  34.856  1.00 17.58  ? 381  ARG B O     1 
ATOM   7905  C CB    . ARG B 1 381 ? -17.991 80.279  33.482  1.00 18.16  ? 381  ARG B CB    1 
ATOM   7906  C CG    . ARG B 1 381 ? -16.681 80.982  33.794  1.00 22.61  ? 381  ARG B CG    1 
ATOM   7907  C CD    . ARG B 1 381 ? -16.806 82.495  33.660  1.00 28.16  ? 381  ARG B CD    1 
ATOM   7908  N NE    . ARG B 1 381 ? -16.624 82.963  32.281  1.00 32.17  ? 381  ARG B NE    1 
ATOM   7909  C CZ    . ARG B 1 381 ? -15.458 83.338  31.750  1.00 33.81  ? 381  ARG B CZ    1 
ATOM   7910  N NH1   . ARG B 1 381 ? -14.339 83.289  32.473  1.00 33.08  ? 381  ARG B NH1   1 
ATOM   7911  N NH2   . ARG B 1 381 ? -15.415 83.761  30.485  1.00 34.52  ? 381  ARG B NH2   1 
ATOM   7912  N N     . ILE B 1 382 ? -19.852 77.756  32.695  1.00 16.65  ? 382  ILE B N     1 
ATOM   7913  C CA    . ILE B 1 382 ? -21.229 77.316  32.499  1.00 16.42  ? 382  ILE B CA    1 
ATOM   7914  C C     . ILE B 1 382 ? -21.252 75.984  31.759  1.00 16.53  ? 382  ILE B C     1 
ATOM   7915  O O     . ILE B 1 382 ? -20.473 75.781  30.818  1.00 16.01  ? 382  ILE B O     1 
ATOM   7916  C CB    . ILE B 1 382 ? -22.067 78.367  31.685  1.00 16.38  ? 382  ILE B CB    1 
ATOM   7917  C CG1   . ILE B 1 382 ? -22.071 79.740  32.371  1.00 16.08  ? 382  ILE B CG1   1 
ATOM   7918  C CG2   . ILE B 1 382 ? -23.490 77.866  31.387  1.00 15.33  ? 382  ILE B CG2   1 
ATOM   7919  C CD1   . ILE B 1 382 ? -22.860 79.847  33.680  1.00 16.27  ? 382  ILE B CD1   1 
ATOM   7920  N N     . LEU B 1 383 ? -22.139 75.091  32.207  1.00 16.27  ? 383  LEU B N     1 
ATOM   7921  C CA    . LEU B 1 383 ? -22.397 73.820  31.548  1.00 16.33  ? 383  LEU B CA    1 
ATOM   7922  C C     . LEU B 1 383 ? -23.857 73.734  31.145  1.00 16.53  ? 383  LEU B C     1 
ATOM   7923  O O     . LEU B 1 383 ? -24.733 74.358  31.766  1.00 17.29  ? 383  LEU B O     1 
ATOM   7924  C CB    . LEU B 1 383 ? -22.080 72.631  32.474  1.00 16.10  ? 383  LEU B CB    1 
ATOM   7925  C CG    . LEU B 1 383 ? -20.674 72.443  33.051  1.00 15.08  ? 383  LEU B CG    1 
ATOM   7926  C CD1   . LEU B 1 383 ? -20.584 71.212  34.000  1.00 10.32  ? 383  LEU B CD1   1 
ATOM   7927  C CD2   . LEU B 1 383 ? -19.658 72.373  31.937  1.00 13.28  ? 383  LEU B CD2   1 
ATOM   7928  N N     . GLY B 1 384 ? -24.118 72.931  30.118  1.00 16.37  ? 384  GLY B N     1 
ATOM   7929  C CA    . GLY B 1 384 ? -25.454 72.716  29.626  1.00 15.71  ? 384  GLY B CA    1 
ATOM   7930  C C     . GLY B 1 384 ? -25.643 71.295  29.176  1.00 15.87  ? 384  GLY B C     1 
ATOM   7931  O O     . GLY B 1 384 ? -24.697 70.645  28.720  1.00 15.93  ? 384  GLY B O     1 
ATOM   7932  N N     . SER B 1 385 ? -26.870 70.810  29.319  1.00 15.73  ? 385  SER B N     1 
ATOM   7933  C CA    . SER B 1 385 ? -27.244 69.480  28.876  1.00 15.85  ? 385  SER B CA    1 
ATOM   7934  C C     . SER B 1 385 ? -28.475 69.637  27.967  1.00 16.11  ? 385  SER B C     1 
ATOM   7935  O O     . SER B 1 385 ? -29.331 70.470  28.254  1.00 16.18  ? 385  SER B O     1 
ATOM   7936  C CB    . SER B 1 385 ? -27.571 68.614  30.093  1.00 15.63  ? 385  SER B CB    1 
ATOM   7937  O OG    . SER B 1 385 ? -27.692 67.254  29.741  1.00 16.54  ? 385  SER B OG    1 
ATOM   7938  N N     . VAL B 1 386 ? -28.560 68.865  26.876  1.00 15.95  ? 386  VAL B N     1 
ATOM   7939  C CA    . VAL B 1 386 ? -29.746 68.902  25.998  1.00 16.24  ? 386  VAL B CA    1 
ATOM   7940  C C     . VAL B 1 386 ? -30.112 67.560  25.337  1.00 16.97  ? 386  VAL B C     1 
ATOM   7941  O O     . VAL B 1 386 ? -29.237 66.754  24.994  1.00 16.19  ? 386  VAL B O     1 
ATOM   7942  C CB    . VAL B 1 386 ? -29.607 70.008  24.889  1.00 16.81  ? 386  VAL B CB    1 
ATOM   7943  C CG1   . VAL B 1 386 ? -28.327 69.796  24.035  1.00 16.05  ? 386  VAL B CG1   1 
ATOM   7944  C CG2   . VAL B 1 386 ? -30.863 70.096  24.009  1.00 15.20  ? 386  VAL B CG2   1 
ATOM   7945  N N     . GLY B 1 387 ? -31.418 67.327  25.176  1.00 17.58  ? 387  GLY B N     1 
ATOM   7946  C CA    . GLY B 1 387 ? -31.907 66.332  24.222  1.00 17.42  ? 387  GLY B CA    1 
ATOM   7947  C C     . GLY B 1 387 ? -32.496 65.073  24.817  1.00 18.18  ? 387  GLY B C     1 
ATOM   7948  O O     . GLY B 1 387 ? -33.139 64.287  24.110  1.00 18.05  ? 387  GLY B O     1 
ATOM   7949  N N     . GLU B 1 388 ? -32.262 64.860  26.102  1.00 18.61  ? 388  GLU B N     1 
ATOM   7950  C CA    . GLU B 1 388 ? -32.635 63.613  26.758  1.00 19.91  ? 388  GLU B CA    1 
ATOM   7951  C C     . GLU B 1 388 ? -32.807 63.898  28.221  1.00 20.70  ? 388  GLU B C     1 
ATOM   7952  O O     . GLU B 1 388 ? -32.168 64.831  28.723  1.00 20.51  ? 388  GLU B O     1 
ATOM   7953  C CB    . GLU B 1 388 ? -31.490 62.608  26.695  1.00 20.21  ? 388  GLU B CB    1 
ATOM   7954  C CG    . GLU B 1 388 ? -31.026 62.172  25.348  1.00 22.03  ? 388  GLU B CG    1 
ATOM   7955  C CD    . GLU B 1 388 ? -29.671 61.495  25.443  1.00 25.27  ? 388  GLU B CD    1 
ATOM   7956  O OE1   . GLU B 1 388 ? -29.587 60.441  26.131  1.00 25.44  ? 388  GLU B OE1   1 
ATOM   7957  O OE2   . GLU B 1 388 ? -28.700 62.032  24.850  1.00 23.63  ? 388  GLU B OE2   1 
ATOM   7958  N N     . PRO B 1 389 ? -33.635 63.080  28.923  1.00 21.23  ? 389  PRO B N     1 
ATOM   7959  C CA    . PRO B 1 389 ? -33.577 63.065  30.369  1.00 21.85  ? 389  PRO B CA    1 
ATOM   7960  C C     . PRO B 1 389 ? -32.157 62.780  30.802  1.00 22.48  ? 389  PRO B C     1 
ATOM   7961  O O     . PRO B 1 389 ? -31.461 61.986  30.167  1.00 22.78  ? 389  PRO B O     1 
ATOM   7962  C CB    . PRO B 1 389 ? -34.481 61.886  30.741  1.00 22.13  ? 389  PRO B CB    1 
ATOM   7963  C CG    . PRO B 1 389 ? -35.480 61.848  29.657  1.00 21.57  ? 389  PRO B CG    1 
ATOM   7964  C CD    . PRO B 1 389 ? -34.657 62.135  28.425  1.00 21.65  ? 389  PRO B CD    1 
ATOM   7965  N N     . ILE B 1 390 ? -31.710 63.483  31.835  1.00 22.87  ? 390  ILE B N     1 
ATOM   7966  C CA    . ILE B 1 390 ? -30.424 63.199  32.452  1.00 22.50  ? 390  ILE B CA    1 
ATOM   7967  C C     . ILE B 1 390 ? -30.729 62.715  33.857  1.00 22.76  ? 390  ILE B C     1 
ATOM   7968  O O     . ILE B 1 390 ? -31.383 63.424  34.628  1.00 22.95  ? 390  ILE B O     1 
ATOM   7969  C CB    . ILE B 1 390 ? -29.489 64.455  32.456  1.00 22.47  ? 390  ILE B CB    1 
ATOM   7970  C CG1   . ILE B 1 390 ? -28.118 64.124  33.047  1.00 21.53  ? 390  ILE B CG1   1 
ATOM   7971  C CG2   . ILE B 1 390 ? -30.149 65.663  33.159  1.00 22.15  ? 390  ILE B CG2   1 
ATOM   7972  C CD1   . ILE B 1 390 ? -27.010 64.972  32.471  1.00 20.13  ? 390  ILE B CD1   1 
ATOM   7973  N N     . ASN B 1 391 ? -30.284 61.515  34.205  1.00 22.57  ? 391  ASN B N     1 
ATOM   7974  C CA    . ASN B 1 391 ? -30.461 61.108  35.584  1.00 23.13  ? 391  ASN B CA    1 
ATOM   7975  C C     . ASN B 1 391 ? -29.475 61.822  36.488  1.00 22.22  ? 391  ASN B C     1 
ATOM   7976  O O     . ASN B 1 391 ? -28.423 62.248  36.021  1.00 22.14  ? 391  ASN B O     1 
ATOM   7977  C CB    . ASN B 1 391 ? -30.387 59.596  35.759  1.00 24.21  ? 391  ASN B CB    1 
ATOM   7978  C CG    . ASN B 1 391 ? -29.015 59.072  35.554  1.00 27.59  ? 391  ASN B CG    1 
ATOM   7979  O OD1   . ASN B 1 391 ? -28.407 59.280  34.483  1.00 33.37  ? 391  ASN B OD1   1 
ATOM   7980  N ND2   . ASN B 1 391 ? -28.500 58.375  36.559  1.00 28.20  ? 391  ASN B ND2   1 
ATOM   7981  N N     . PRO B 1 392 ? -29.842 61.984  37.775  1.00 21.45  ? 392  PRO B N     1 
ATOM   7982  C CA    . PRO B 1 392 ? -29.070 62.701  38.779  1.00 21.26  ? 392  PRO B CA    1 
ATOM   7983  C C     . PRO B 1 392 ? -27.594 62.318  38.858  1.00 20.74  ? 392  PRO B C     1 
ATOM   7984  O O     . PRO B 1 392 ? -26.751 63.195  39.026  1.00 20.04  ? 392  PRO B O     1 
ATOM   7985  C CB    . PRO B 1 392 ? -29.802 62.362  40.092  1.00 21.24  ? 392  PRO B CB    1 
ATOM   7986  C CG    . PRO B 1 392 ? -31.214 62.180  39.669  1.00 21.30  ? 392  PRO B CG    1 
ATOM   7987  C CD    . PRO B 1 392 ? -31.111 61.474  38.339  1.00 21.42  ? 392  PRO B CD    1 
ATOM   7988  N N     . GLU B 1 393 ? -27.290 61.029  38.735  1.00 20.78  ? 393  GLU B N     1 
ATOM   7989  C CA    . GLU B 1 393 ? -25.907 60.543  38.848  1.00 21.28  ? 393  GLU B CA    1 
ATOM   7990  C C     . GLU B 1 393 ? -25.013 61.023  37.701  1.00 19.75  ? 393  GLU B C     1 
ATOM   7991  O O     . GLU B 1 393 ? -23.853 61.374  37.918  1.00 20.37  ? 393  GLU B O     1 
ATOM   7992  C CB    . GLU B 1 393 ? -25.885 59.028  38.978  1.00 20.83  ? 393  GLU B CB    1 
ATOM   7993  C CG    . GLU B 1 393 ? -26.367 58.567  40.368  1.00 23.85  ? 393  GLU B CG    1 
ATOM   7994  C CD    . GLU B 1 393 ? -26.533 57.059  40.496  1.00 24.98  ? 393  GLU B CD    1 
ATOM   7995  O OE1   . GLU B 1 393 ? -26.546 56.582  41.656  1.00 30.54  ? 393  GLU B OE1   1 
ATOM   7996  O OE2   . GLU B 1 393 ? -26.655 56.350  39.460  1.00 29.42  ? 393  GLU B OE2   1 
ATOM   7997  N N     . ALA B 1 394 ? -25.575 61.050  36.499  1.00 18.21  ? 394  ALA B N     1 
ATOM   7998  C CA    . ALA B 1 394 ? -24.909 61.592  35.318  1.00 17.24  ? 394  ALA B CA    1 
ATOM   7999  C C     . ALA B 1 394 ? -24.737 63.100  35.474  1.00 16.75  ? 394  ALA B C     1 
ATOM   8000  O O     . ALA B 1 394 ? -23.667 63.626  35.226  1.00 15.94  ? 394  ALA B O     1 
ATOM   8001  C CB    . ALA B 1 394 ? -25.705 61.256  34.064  1.00 16.43  ? 394  ALA B CB    1 
ATOM   8002  N N     . TRP B 1 395 ? -25.803 63.777  35.907  1.00 16.76  ? 395  TRP B N     1 
ATOM   8003  C CA    . TRP B 1 395 ? -25.776 65.203  36.204  1.00 16.99  ? 395  TRP B CA    1 
ATOM   8004  C C     . TRP B 1 395 ? -24.683 65.564  37.208  1.00 16.96  ? 395  TRP B C     1 
ATOM   8005  O O     . TRP B 1 395 ? -23.892 66.460  36.941  1.00 17.76  ? 395  TRP B O     1 
ATOM   8006  C CB    . TRP B 1 395 ? -27.139 65.648  36.728  1.00 17.34  ? 395  TRP B CB    1 
ATOM   8007  C CG    . TRP B 1 395 ? -27.406 67.133  36.731  1.00 17.25  ? 395  TRP B CG    1 
ATOM   8008  C CD1   . TRP B 1 395 ? -28.192 67.814  35.846  1.00 18.35  ? 395  TRP B CD1   1 
ATOM   8009  C CD2   . TRP B 1 395 ? -26.932 68.111  37.678  1.00 17.11  ? 395  TRP B CD2   1 
ATOM   8010  N NE1   . TRP B 1 395 ? -28.241 69.145  36.176  1.00 17.46  ? 395  TRP B NE1   1 
ATOM   8011  C CE2   . TRP B 1 395 ? -27.480 69.353  37.300  1.00 17.60  ? 395  TRP B CE2   1 
ATOM   8012  C CE3   . TRP B 1 395 ? -26.104 68.054  38.807  1.00 17.04  ? 395  TRP B CE3   1 
ATOM   8013  C CZ2   . TRP B 1 395 ? -27.223 70.531  38.004  1.00 17.54  ? 395  TRP B CZ2   1 
ATOM   8014  C CZ3   . TRP B 1 395 ? -25.848 69.228  39.509  1.00 18.35  ? 395  TRP B CZ3   1 
ATOM   8015  C CH2   . TRP B 1 395 ? -26.413 70.450  39.106  1.00 17.72  ? 395  TRP B CH2   1 
ATOM   8016  N N     . GLU B 1 396 ? -24.640 64.878  38.349  1.00 16.92  ? 396  GLU B N     1 
ATOM   8017  C CA    . GLU B 1 396 ? -23.640 65.140  39.397  1.00 17.12  ? 396  GLU B CA    1 
ATOM   8018  C C     . GLU B 1 396 ? -22.198 64.904  38.917  1.00 16.82  ? 396  GLU B C     1 
ATOM   8019  O O     . GLU B 1 396 ? -21.282 65.643  39.304  1.00 17.14  ? 396  GLU B O     1 
ATOM   8020  C CB    . GLU B 1 396 ? -23.903 64.282  40.651  1.00 16.98  ? 396  GLU B CB    1 
ATOM   8021  C CG    . GLU B 1 396 ? -25.146 64.656  41.470  1.00 19.49  ? 396  GLU B CG    1 
ATOM   8022  C CD    . GLU B 1 396 ? -25.063 66.031  42.138  1.00 21.66  ? 396  GLU B CD    1 
ATOM   8023  O OE1   . GLU B 1 396 ? -23.938 66.560  42.331  1.00 22.77  ? 396  GLU B OE1   1 
ATOM   8024  O OE2   . GLU B 1 396 ? -26.135 66.586  42.474  1.00 22.71  ? 396  GLU B OE2   1 
ATOM   8025  N N     . TRP B 1 397 ? -22.011 63.869  38.098  1.00 16.39  ? 397  TRP B N     1 
ATOM   8026  C CA    . TRP B 1 397 ? -20.716 63.533  37.506  1.00 15.98  ? 397  TRP B CA    1 
ATOM   8027  C C     . TRP B 1 397 ? -20.250 64.653  36.593  1.00 16.02  ? 397  TRP B C     1 
ATOM   8028  O O     . TRP B 1 397 ? -19.103 65.123  36.682  1.00 15.74  ? 397  TRP B O     1 
ATOM   8029  C CB    . TRP B 1 397 ? -20.805 62.219  36.716  1.00 15.59  ? 397  TRP B CB    1 
ATOM   8030  C CG    . TRP B 1 397 ? -19.439 61.717  36.266  1.00 15.93  ? 397  TRP B CG    1 
ATOM   8031  C CD1   . TRP B 1 397 ? -18.582 60.899  36.969  1.00 14.67  ? 397  TRP B CD1   1 
ATOM   8032  C CD2   . TRP B 1 397 ? -18.769 62.031  35.036  1.00 14.84  ? 397  TRP B CD2   1 
ATOM   8033  N NE1   . TRP B 1 397 ? -17.439 60.674  36.239  1.00 13.68  ? 397  TRP B NE1   1 
ATOM   8034  C CE2   . TRP B 1 397 ? -17.522 61.361  35.056  1.00 13.84  ? 397  TRP B CE2   1 
ATOM   8035  C CE3   . TRP B 1 397 ? -19.107 62.808  33.914  1.00 15.18  ? 397  TRP B CE3   1 
ATOM   8036  C CZ2   . TRP B 1 397 ? -16.606 61.461  34.011  1.00 13.52  ? 397  TRP B CZ2   1 
ATOM   8037  C CZ3   . TRP B 1 397 ? -18.201 62.911  32.884  1.00 14.79  ? 397  TRP B CZ3   1 
ATOM   8038  C CH2   . TRP B 1 397 ? -16.960 62.233  32.935  1.00 15.19  ? 397  TRP B CH2   1 
ATOM   8039  N N     . TYR B 1 398 ? -21.159 65.074  35.715  1.00 15.82  ? 398  TYR B N     1 
ATOM   8040  C CA    . TYR B 1 398 ? -20.938 66.187  34.807  1.00 16.14  ? 398  TYR B CA    1 
ATOM   8041  C C     . TYR B 1 398 ? -20.542 67.433  35.605  1.00 16.69  ? 398  TYR B C     1 
ATOM   8042  O O     . TYR B 1 398 ? -19.555 68.115  35.314  1.00 16.46  ? 398  TYR B O     1 
ATOM   8043  C CB    . TYR B 1 398 ? -22.236 66.425  34.029  1.00 15.73  ? 398  TYR B CB    1 
ATOM   8044  C CG    . TYR B 1 398 ? -22.157 67.383  32.864  1.00 15.79  ? 398  TYR B CG    1 
ATOM   8045  C CD1   . TYR B 1 398 ? -21.024 67.436  32.027  1.00 14.21  ? 398  TYR B CD1   1 
ATOM   8046  C CD2   . TYR B 1 398 ? -23.236 68.225  32.573  1.00 14.61  ? 398  TYR B CD2   1 
ATOM   8047  C CE1   . TYR B 1 398 ? -20.976 68.320  30.949  1.00 12.94  ? 398  TYR B CE1   1 
ATOM   8048  C CE2   . TYR B 1 398 ? -23.199 69.101  31.488  1.00 13.38  ? 398  TYR B CE2   1 
ATOM   8049  C CZ    . TYR B 1 398 ? -22.073 69.148  30.690  1.00 14.14  ? 398  TYR B CZ    1 
ATOM   8050  O OH    . TYR B 1 398 ? -22.061 70.030  29.632  1.00 15.42  ? 398  TYR B OH    1 
ATOM   8051  N N     . TRP B 1 399 ? -21.329 67.699  36.638  1.00 17.42  ? 399  TRP B N     1 
ATOM   8052  C CA    . TRP B 1 399 ? -21.137 68.839  37.494  1.00 18.02  ? 399  TRP B CA    1 
ATOM   8053  C C     . TRP B 1 399 ? -19.801 68.798  38.222  1.00 18.34  ? 399  TRP B C     1 
ATOM   8054  O O     . TRP B 1 399 ? -19.110 69.828  38.326  1.00 18.43  ? 399  TRP B O     1 
ATOM   8055  C CB    . TRP B 1 399 ? -22.286 68.886  38.495  1.00 18.09  ? 399  TRP B CB    1 
ATOM   8056  C CG    . TRP B 1 399 ? -22.346 70.127  39.280  1.00 18.10  ? 399  TRP B CG    1 
ATOM   8057  C CD1   . TRP B 1 399 ? -22.836 71.336  38.872  1.00 18.23  ? 399  TRP B CD1   1 
ATOM   8058  C CD2   . TRP B 1 399 ? -21.916 70.297  40.632  1.00 17.04  ? 399  TRP B CD2   1 
ATOM   8059  N NE1   . TRP B 1 399 ? -22.725 72.253  39.889  1.00 17.25  ? 399  TRP B NE1   1 
ATOM   8060  C CE2   . TRP B 1 399 ? -22.171 71.638  40.983  1.00 17.67  ? 399  TRP B CE2   1 
ATOM   8061  C CE3   . TRP B 1 399 ? -21.326 69.449  41.575  1.00 16.91  ? 399  TRP B CE3   1 
ATOM   8062  C CZ2   . TRP B 1 399 ? -21.855 72.158  42.255  1.00 18.28  ? 399  TRP B CZ2   1 
ATOM   8063  C CZ3   . TRP B 1 399 ? -21.017 69.961  42.841  1.00 18.59  ? 399  TRP B CZ3   1 
ATOM   8064  C CH2   . TRP B 1 399 ? -21.285 71.304  43.166  1.00 17.69  ? 399  TRP B CH2   1 
ATOM   8065  N N     . LYS B 1 400 ? -19.440 67.619  38.730  1.00 18.59  ? 400  LYS B N     1 
ATOM   8066  C CA    . LYS B 1 400 ? -18.217 67.466  39.513  1.00 19.06  ? 400  LYS B CA    1 
ATOM   8067  C C     . LYS B 1 400 ? -16.976 67.359  38.620  1.00 18.98  ? 400  LYS B C     1 
ATOM   8068  O O     . LYS B 1 400 ? -16.022 68.127  38.772  1.00 19.55  ? 400  LYS B O     1 
ATOM   8069  C CB    . LYS B 1 400 ? -18.321 66.249  40.429  1.00 19.11  ? 400  LYS B CB    1 
ATOM   8070  C CG    . LYS B 1 400 ? -17.066 65.995  41.262  1.00 20.74  ? 400  LYS B CG    1 
ATOM   8071  C CD    . LYS B 1 400 ? -17.179 64.728  42.130  1.00 20.49  ? 400  LYS B CD    1 
ATOM   8072  C CE    . LYS B 1 400 ? -16.070 64.713  43.203  1.00 22.44  ? 400  LYS B CE    1 
ATOM   8073  N NZ    . LYS B 1 400 ? -16.180 63.562  44.137  1.00 24.01  ? 400  LYS B NZ    1 
ATOM   8074  N N     . LYS B 1 401 ? -16.993 66.416  37.681  1.00 18.73  ? 401  LYS B N     1 
ATOM   8075  C CA    . LYS B 1 401 ? -15.810 66.119  36.868  1.00 17.96  ? 401  LYS B CA    1 
ATOM   8076  C C     . LYS B 1 401 ? -15.524 67.128  35.750  1.00 17.84  ? 401  LYS B C     1 
ATOM   8077  O O     . LYS B 1 401 ? -14.367 67.466  35.502  1.00 18.04  ? 401  LYS B O     1 
ATOM   8078  C CB    . LYS B 1 401 ? -15.909 64.707  36.286  1.00 18.02  ? 401  LYS B CB    1 
ATOM   8079  C CG    . LYS B 1 401 ? -16.045 63.601  37.322  1.00 17.45  ? 401  LYS B CG    1 
ATOM   8080  C CD    . LYS B 1 401 ? -14.727 63.313  38.000  1.00 18.10  ? 401  LYS B CD    1 
ATOM   8081  C CE    . LYS B 1 401 ? -14.873 62.185  39.031  1.00 19.17  ? 401  LYS B CE    1 
ATOM   8082  N NZ    . LYS B 1 401 ? -13.617 61.996  39.812  1.00 20.06  ? 401  LYS B NZ    1 
ATOM   8083  N N     . ILE B 1 402 ? -16.557 67.604  35.067  1.00 17.20  ? 402  ILE B N     1 
ATOM   8084  C CA    . ILE B 1 402 ? -16.325 68.507  33.951  1.00 16.97  ? 402  ILE B CA    1 
ATOM   8085  C C     . ILE B 1 402 ? -16.318 69.957  34.418  1.00 17.58  ? 402  ILE B C     1 
ATOM   8086  O O     . ILE B 1 402 ? -15.497 70.760  33.961  1.00 17.17  ? 402  ILE B O     1 
ATOM   8087  C CB    . ILE B 1 402 ? -17.353 68.300  32.808  1.00 16.65  ? 402  ILE B CB    1 
ATOM   8088  C CG1   . ILE B 1 402 ? -17.375 66.834  32.354  1.00 17.03  ? 402  ILE B CG1   1 
ATOM   8089  C CG2   . ILE B 1 402 ? -17.085 69.245  31.646  1.00 15.17  ? 402  ILE B CG2   1 
ATOM   8090  C CD1   . ILE B 1 402 ? -16.057 66.263  31.837  1.00 15.10  ? 402  ILE B CD1   1 
ATOM   8091  N N     . GLY B 1 403 ? -17.233 70.272  35.337  1.00 17.54  ? 403  GLY B N     1 
ATOM   8092  C CA    . GLY B 1 403 ? -17.397 71.621  35.848  1.00 17.60  ? 403  GLY B CA    1 
ATOM   8093  C C     . GLY B 1 403 ? -16.674 71.895  37.149  1.00 18.35  ? 403  GLY B C     1 
ATOM   8094  O O     . GLY B 1 403 ? -16.745 73.016  37.656  1.00 18.04  ? 403  GLY B O     1 
ATOM   8095  N N     . LYS B 1 404 ? -15.993 70.875  37.688  1.00 18.57  ? 404  LYS B N     1 
ATOM   8096  C CA    . LYS B 1 404 ? -15.156 71.001  38.884  1.00 18.72  ? 404  LYS B CA    1 
ATOM   8097  C C     . LYS B 1 404 ? -15.926 71.685  40.007  1.00 19.32  ? 404  LYS B C     1 
ATOM   8098  O O     . LYS B 1 404 ? -15.376 72.517  40.735  1.00 19.20  ? 404  LYS B O     1 
ATOM   8099  C CB    . LYS B 1 404 ? -13.857 71.766  38.586  1.00 18.69  ? 404  LYS B CB    1 
ATOM   8100  C CG    . LYS B 1 404 ? -12.977 71.147  37.491  1.00 19.18  ? 404  LYS B CG    1 
ATOM   8101  C CD    . LYS B 1 404 ? -11.795 72.054  37.124  1.00 18.51  ? 404  LYS B CD    1 
ATOM   8102  C CE    . LYS B 1 404 ? -10.631 71.915  38.106  1.00 17.44  ? 404  LYS B CE    1 
ATOM   8103  N NZ    . LYS B 1 404 ? -9.397  72.594  37.586  1.00 15.46  ? 404  LYS B NZ    1 
ATOM   8104  N N     . GLU B 1 405 ? -17.210 71.341  40.110  1.00 19.72  ? 405  GLU B N     1 
ATOM   8105  C CA    . GLU B 1 405 ? -18.108 71.820  41.160  1.00 20.62  ? 405  GLU B CA    1 
ATOM   8106  C C     . GLU B 1 405 ? -18.335 73.332  41.164  1.00 20.48  ? 405  GLU B C     1 
ATOM   8107  O O     . GLU B 1 405 ? -18.856 73.878  42.128  1.00 21.60  ? 405  GLU B O     1 
ATOM   8108  C CB    . GLU B 1 405 ? -17.642 71.317  42.539  1.00 20.83  ? 405  GLU B CB    1 
ATOM   8109  C CG    . GLU B 1 405 ? -17.436 69.801  42.603  1.00 21.10  ? 405  GLU B CG    1 
ATOM   8110  C CD    . GLU B 1 405 ? -17.101 69.274  43.988  1.00 22.13  ? 405  GLU B CD    1 
ATOM   8111  O OE1   . GLU B 1 405 ? -16.660 68.113  44.081  1.00 25.17  ? 405  GLU B OE1   1 
ATOM   8112  O OE2   . GLU B 1 405 ? -17.278 69.995  44.994  1.00 25.70  ? 405  GLU B OE2   1 
ATOM   8113  N N     . LYS B 1 406 ? -17.975 74.008  40.080  1.00 20.26  ? 406  LYS B N     1 
ATOM   8114  C CA    . LYS B 1 406 ? -18.021 75.466  40.040  1.00 20.02  ? 406  LYS B CA    1 
ATOM   8115  C C     . LYS B 1 406 ? -19.038 76.004  39.042  1.00 19.91  ? 406  LYS B C     1 
ATOM   8116  O O     . LYS B 1 406 ? -19.344 77.200  39.060  1.00 19.98  ? 406  LYS B O     1 
ATOM   8117  C CB    . LYS B 1 406 ? -16.642 76.039  39.677  1.00 20.15  ? 406  LYS B CB    1 
ATOM   8118  C CG    . LYS B 1 406 ? -15.554 75.941  40.747  1.00 20.12  ? 406  LYS B CG    1 
ATOM   8119  C CD    . LYS B 1 406 ? -14.183 76.379  40.181  1.00 20.43  ? 406  LYS B CD    1 
ATOM   8120  C CE    . LYS B 1 406 ? -14.184 77.879  39.836  1.00 22.65  ? 406  LYS B CE    1 
ATOM   8121  N NZ    . LYS B 1 406 ? -12.837 78.473  39.523  1.00 22.36  ? 406  LYS B NZ    1 
ATOM   8122  N N     . CYS B 1 407 ? -19.569 75.130  38.181  1.00 19.67  ? 407  CYS B N     1 
ATOM   8123  C CA    . CYS B 1 407 ? -20.363 75.577  37.041  1.00 19.18  ? 407  CYS B CA    1 
ATOM   8124  C C     . CYS B 1 407 ? -21.813 75.172  37.154  1.00 19.31  ? 407  CYS B C     1 
ATOM   8125  O O     . CYS B 1 407 ? -22.109 73.973  37.224  1.00 20.54  ? 407  CYS B O     1 
ATOM   8126  C CB    . CYS B 1 407 ? -19.795 75.013  35.733  1.00 19.02  ? 407  CYS B CB    1 
ATOM   8127  S SG    . CYS B 1 407 ? -18.118 75.546  35.354  1.00 17.15  ? 407  CYS B SG    1 
ATOM   8128  N N     . PRO B 1 408 ? -22.733 76.159  37.152  1.00 18.60  ? 408  PRO B N     1 
ATOM   8129  C CA    . PRO B 1 408 ? -24.147 75.822  36.979  1.00 17.78  ? 408  PRO B CA    1 
ATOM   8130  C C     . PRO B 1 408 ? -24.357 75.009  35.699  1.00 17.18  ? 408  PRO B C     1 
ATOM   8131  O O     . PRO B 1 408 ? -23.731 75.288  34.678  1.00 16.75  ? 408  PRO B O     1 
ATOM   8132  C CB    . PRO B 1 408 ? -24.820 77.192  36.862  1.00 17.11  ? 408  PRO B CB    1 
ATOM   8133  C CG    . PRO B 1 408 ? -23.906 78.111  37.632  1.00 17.79  ? 408  PRO B CG    1 
ATOM   8134  C CD    . PRO B 1 408 ? -22.532 77.613  37.314  1.00 18.66  ? 408  PRO B CD    1 
ATOM   8135  N N     . VAL B 1 409 ? -25.213 73.993  35.792  1.00 16.69  ? 409  VAL B N     1 
ATOM   8136  C CA    . VAL B 1 409 ? -25.609 73.159  34.667  1.00 15.93  ? 409  VAL B CA    1 
ATOM   8137  C C     . VAL B 1 409 ? -27.004 73.573  34.215  1.00 16.20  ? 409  VAL B C     1 
ATOM   8138  O O     . VAL B 1 409 ? -27.966 73.474  34.981  1.00 17.33  ? 409  VAL B O     1 
ATOM   8139  C CB    . VAL B 1 409 ? -25.636 71.633  35.035  1.00 15.71  ? 409  VAL B CB    1 
ATOM   8140  C CG1   . VAL B 1 409 ? -26.237 70.816  33.888  1.00 13.08  ? 409  VAL B CG1   1 
ATOM   8141  C CG2   . VAL B 1 409 ? -24.234 71.117  35.381  1.00 14.55  ? 409  VAL B CG2   1 
ATOM   8142  N N     . VAL B 1 410 ? -27.119 74.013  32.970  1.00 15.95  ? 410  VAL B N     1 
ATOM   8143  C CA    . VAL B 1 410 ? -28.417 74.382  32.419  1.00 15.53  ? 410  VAL B CA    1 
ATOM   8144  C C     . VAL B 1 410 ? -28.958 73.216  31.564  1.00 15.67  ? 410  VAL B C     1 
ATOM   8145  O O     . VAL B 1 410 ? -28.520 72.990  30.432  1.00 15.66  ? 410  VAL B O     1 
ATOM   8146  C CB    . VAL B 1 410 ? -28.386 75.767  31.665  1.00 15.52  ? 410  VAL B CB    1 
ATOM   8147  C CG1   . VAL B 1 410 ? -28.059 76.907  32.641  1.00 15.64  ? 410  VAL B CG1   1 
ATOM   8148  C CG2   . VAL B 1 410 ? -27.398 75.774  30.479  1.00 14.58  ? 410  VAL B CG2   1 
ATOM   8149  N N     . ASP B 1 411 ? -29.871 72.457  32.163  1.00 15.38  ? 411  ASP B N     1 
ATOM   8150  C CA    . ASP B 1 411 ? -30.555 71.347  31.526  1.00 15.43  ? 411  ASP B CA    1 
ATOM   8151  C C     . ASP B 1 411 ? -31.725 71.935  30.745  1.00 15.08  ? 411  ASP B C     1 
ATOM   8152  O O     . ASP B 1 411 ? -32.723 72.332  31.335  1.00 14.70  ? 411  ASP B O     1 
ATOM   8153  C CB    . ASP B 1 411 ? -31.047 70.378  32.607  1.00 15.81  ? 411  ASP B CB    1 
ATOM   8154  C CG    . ASP B 1 411 ? -31.820 69.187  32.039  1.00 17.36  ? 411  ASP B CG    1 
ATOM   8155  O OD1   . ASP B 1 411 ? -31.882 69.047  30.800  1.00 18.78  ? 411  ASP B OD1   1 
ATOM   8156  O OD2   . ASP B 1 411 ? -32.372 68.391  32.840  1.00 17.65  ? 411  ASP B OD2   1 
ATOM   8157  N N     . THR B 1 412 ? -31.596 71.998  29.422  1.00 14.11  ? 412  THR B N     1 
ATOM   8158  C CA    . THR B 1 412 ? -32.571 72.712  28.598  1.00 14.33  ? 412  THR B CA    1 
ATOM   8159  C C     . THR B 1 412 ? -33.542 71.768  27.906  1.00 14.11  ? 412  THR B C     1 
ATOM   8160  O O     . THR B 1 412 ? -33.145 70.960  27.033  1.00 13.82  ? 412  THR B O     1 
ATOM   8161  C CB    . THR B 1 412 ? -31.882 73.556  27.505  1.00 13.99  ? 412  THR B CB    1 
ATOM   8162  O OG1   . THR B 1 412 ? -31.156 72.673  26.637  1.00 14.70  ? 412  THR B OG1   1 
ATOM   8163  C CG2   . THR B 1 412 ? -30.919 74.584  28.131  1.00 13.80  ? 412  THR B CG2   1 
ATOM   8164  N N     . TRP B 1 413 ? -34.812 71.880  28.273  1.00 14.11  ? 413  TRP B N     1 
ATOM   8165  C CA    . TRP B 1 413 ? -35.853 71.113  27.592  1.00 14.34  ? 413  TRP B CA    1 
ATOM   8166  C C     . TRP B 1 413 ? -36.489 71.959  26.492  1.00 14.78  ? 413  TRP B C     1 
ATOM   8167  O O     . TRP B 1 413 ? -36.856 73.120  26.721  1.00 14.85  ? 413  TRP B O     1 
ATOM   8168  C CB    . TRP B 1 413 ? -36.934 70.547  28.550  1.00 14.05  ? 413  TRP B CB    1 
ATOM   8169  C CG    . TRP B 1 413 ? -38.007 69.855  27.743  1.00 13.83  ? 413  TRP B CG    1 
ATOM   8170  C CD1   . TRP B 1 413 ? -37.987 68.577  27.279  1.00 13.45  ? 413  TRP B CD1   1 
ATOM   8171  C CD2   . TRP B 1 413 ? -39.195 70.453  27.221  1.00 12.48  ? 413  TRP B CD2   1 
ATOM   8172  N NE1   . TRP B 1 413 ? -39.113 68.326  26.529  1.00 14.89  ? 413  TRP B NE1   1 
ATOM   8173  C CE2   . TRP B 1 413 ? -39.870 69.467  26.479  1.00 13.75  ? 413  TRP B CE2   1 
ATOM   8174  C CE3   . TRP B 1 413 ? -39.762 71.726  27.326  1.00 12.10  ? 413  TRP B CE3   1 
ATOM   8175  C CZ2   . TRP B 1 413 ? -41.087 69.720  25.819  1.00 15.91  ? 413  TRP B CZ2   1 
ATOM   8176  C CZ3   . TRP B 1 413 ? -40.960 71.984  26.679  1.00 13.82  ? 413  TRP B CZ3   1 
ATOM   8177  C CH2   . TRP B 1 413 ? -41.616 70.984  25.932  1.00 14.72  ? 413  TRP B CH2   1 
ATOM   8178  N N     . TRP B 1 414 ? -36.612 71.358  25.306  1.00 15.18  ? 414  TRP B N     1 
ATOM   8179  C CA    . TRP B 1 414 ? -37.255 71.968  24.134  1.00 15.94  ? 414  TRP B CA    1 
ATOM   8180  C C     . TRP B 1 414 ? -37.231 70.943  22.991  1.00 16.51  ? 414  TRP B C     1 
ATOM   8181  O O     . TRP B 1 414 ? -36.821 69.807  23.205  1.00 15.98  ? 414  TRP B O     1 
ATOM   8182  C CB    . TRP B 1 414 ? -36.595 73.296  23.722  1.00 16.09  ? 414  TRP B CB    1 
ATOM   8183  C CG    . TRP B 1 414 ? -35.165 73.179  23.280  1.00 16.97  ? 414  TRP B CG    1 
ATOM   8184  C CD1   . TRP B 1 414 ? -34.107 72.780  24.042  1.00 17.25  ? 414  TRP B CD1   1 
ATOM   8185  C CD2   . TRP B 1 414 ? -34.632 73.494  21.984  1.00 16.77  ? 414  TRP B CD2   1 
ATOM   8186  N NE1   . TRP B 1 414 ? -32.948 72.812  23.300  1.00 17.92  ? 414  TRP B NE1   1 
ATOM   8187  C CE2   . TRP B 1 414 ? -33.242 73.244  22.032  1.00 17.81  ? 414  TRP B CE2   1 
ATOM   8188  C CE3   . TRP B 1 414 ? -35.196 73.943  20.782  1.00 17.42  ? 414  TRP B CE3   1 
ATOM   8189  C CZ2   . TRP B 1 414 ? -32.403 73.422  20.916  1.00 15.92  ? 414  TRP B CZ2   1 
ATOM   8190  C CZ3   . TRP B 1 414 ? -34.359 74.122  19.673  1.00 17.23  ? 414  TRP B CZ3   1 
ATOM   8191  C CH2   . TRP B 1 414 ? -32.983 73.861  19.753  1.00 16.91  ? 414  TRP B CH2   1 
ATOM   8192  N N     . GLN B 1 415 ? -37.701 71.343  21.805  1.00 16.70  ? 415  GLN B N     1 
ATOM   8193  C CA    . GLN B 1 415 ? -37.839 70.440  20.663  1.00 17.32  ? 415  GLN B CA    1 
ATOM   8194  C C     . GLN B 1 415 ? -37.711 71.217  19.377  1.00 16.98  ? 415  GLN B C     1 
ATOM   8195  O O     . GLN B 1 415 ? -37.740 72.451  19.368  1.00 17.28  ? 415  GLN B O     1 
ATOM   8196  C CB    . GLN B 1 415 ? -39.225 69.758  20.644  1.00 17.71  ? 415  GLN B CB    1 
ATOM   8197  C CG    . GLN B 1 415 ? -39.941 69.660  21.965  1.00 17.86  ? 415  GLN B CG    1 
ATOM   8198  C CD    . GLN B 1 415 ? -41.368 69.203  21.804  1.00 18.10  ? 415  GLN B CD    1 
ATOM   8199  O OE1   . GLN B 1 415 ? -42.259 70.006  21.500  1.00 17.69  ? 415  GLN B OE1   1 
ATOM   8200  N NE2   . GLN B 1 415 ? -41.607 67.897  22.021  1.00 18.06  ? 415  GLN B NE2   1 
ATOM   8201  N N     . THR B 1 416 ? -37.617 70.486  18.274  1.00 17.13  ? 416  THR B N     1 
ATOM   8202  C CA    . THR B 1 416 ? -37.567 71.099  16.939  1.00 16.71  ? 416  THR B CA    1 
ATOM   8203  C C     . THR B 1 416 ? -38.707 72.107  16.704  1.00 16.77  ? 416  THR B C     1 
ATOM   8204  O O     . THR B 1 416 ? -38.487 73.213  16.184  1.00 16.69  ? 416  THR B O     1 
ATOM   8205  C CB    . THR B 1 416 ? -37.561 70.013  15.859  1.00 16.25  ? 416  THR B CB    1 
ATOM   8206  O OG1   . THR B 1 416 ? -36.496 69.097  16.160  1.00 17.23  ? 416  THR B OG1   1 
ATOM   8207  C CG2   . THR B 1 416 ? -37.326 70.618  14.476  1.00 16.04  ? 416  THR B CG2   1 
ATOM   8208  N N     . GLU B 1 417 ? -39.916 71.711  17.095  1.00 16.38  ? 417  GLU B N     1 
ATOM   8209  C CA    . GLU B 1 417 ? -41.121 72.508  16.887  1.00 15.85  ? 417  GLU B CA    1 
ATOM   8210  C C     . GLU B 1 417 ? -41.186 73.775  17.745  1.00 15.75  ? 417  GLU B C     1 
ATOM   8211  O O     . GLU B 1 417 ? -42.029 74.634  17.489  1.00 16.32  ? 417  GLU B O     1 
ATOM   8212  C CB    . GLU B 1 417 ? -42.368 71.644  17.137  1.00 16.10  ? 417  GLU B CB    1 
ATOM   8213  C CG    . GLU B 1 417 ? -42.566 70.439  16.168  1.00 15.59  ? 417  GLU B CG    1 
ATOM   8214  C CD    . GLU B 1 417 ? -41.841 69.165  16.588  1.00 15.66  ? 417  GLU B CD    1 
ATOM   8215  O OE1   . GLU B 1 417 ? -40.937 69.229  17.453  1.00 14.56  ? 417  GLU B OE1   1 
ATOM   8216  O OE2   . GLU B 1 417 ? -42.174 68.083  16.034  1.00 16.12  ? 417  GLU B OE2   1 
ATOM   8217  N N     . THR B 1 418 ? -40.322 73.897  18.753  1.00 15.03  ? 418  THR B N     1 
ATOM   8218  C CA    . THR B 1 418 ? -40.360 75.068  19.651  1.00 15.04  ? 418  THR B CA    1 
ATOM   8219  C C     . THR B 1 418 ? -39.289 76.130  19.347  1.00 14.86  ? 418  THR B C     1 
ATOM   8220  O O     . THR B 1 418 ? -39.350 77.239  19.900  1.00 15.17  ? 418  THR B O     1 
ATOM   8221  C CB    . THR B 1 418 ? -40.296 74.706  21.187  1.00 14.47  ? 418  THR B CB    1 
ATOM   8222  O OG1   . THR B 1 418 ? -38.941 74.483  21.593  1.00 15.35  ? 418  THR B OG1   1 
ATOM   8223  C CG2   . THR B 1 418 ? -41.147 73.515  21.558  1.00 13.89  ? 418  THR B CG2   1 
ATOM   8224  N N     . GLY B 1 419 ? -38.309 75.780  18.510  1.00 14.86  ? 419  GLY B N     1 
ATOM   8225  C CA    . GLY B 1 419 ? -37.284 76.725  18.015  1.00 14.95  ? 419  GLY B CA    1 
ATOM   8226  C C     . GLY B 1 419 ? -36.152 77.108  18.956  1.00 15.11  ? 419  GLY B C     1 
ATOM   8227  O O     . GLY B 1 419 ? -35.020 77.291  18.525  1.00 15.05  ? 419  GLY B O     1 
ATOM   8228  N N     . GLY B 1 420 ? -36.462 77.245  20.244  1.00 15.36  ? 420  GLY B N     1 
ATOM   8229  C CA    . GLY B 1 420 ? -35.471 77.534  21.276  1.00 15.24  ? 420  GLY B CA    1 
ATOM   8230  C C     . GLY B 1 420 ? -35.918 76.981  22.618  1.00 15.44  ? 420  GLY B C     1 
ATOM   8231  O O     . GLY B 1 420 ? -36.987 76.351  22.710  1.00 15.92  ? 420  GLY B O     1 
ATOM   8232  N N     . PHE B 1 421 ? -35.101 77.216  23.649  1.00 15.13  ? 421  PHE B N     1 
ATOM   8233  C CA    . PHE B 1 421 ? -35.319 76.686  25.002  1.00 14.79  ? 421  PHE B CA    1 
ATOM   8234  C C     . PHE B 1 421 ? -36.711 76.998  25.526  1.00 15.02  ? 421  PHE B C     1 
ATOM   8235  O O     . PHE B 1 421 ? -37.232 78.069  25.289  1.00 15.94  ? 421  PHE B O     1 
ATOM   8236  C CB    . PHE B 1 421 ? -34.266 77.201  26.004  1.00 14.29  ? 421  PHE B CB    1 
ATOM   8237  C CG    . PHE B 1 421 ? -32.824 76.998  25.567  1.00 14.50  ? 421  PHE B CG    1 
ATOM   8238  C CD1   . PHE B 1 421 ? -31.833 77.890  25.984  1.00 12.73  ? 421  PHE B CD1   1 
ATOM   8239  C CD2   . PHE B 1 421 ? -32.458 75.929  24.738  1.00 13.58  ? 421  PHE B CD2   1 
ATOM   8240  C CE1   . PHE B 1 421 ? -30.495 77.725  25.576  1.00 13.42  ? 421  PHE B CE1   1 
ATOM   8241  C CE2   . PHE B 1 421 ? -31.126 75.762  24.335  1.00 14.77  ? 421  PHE B CE2   1 
ATOM   8242  C CZ    . PHE B 1 421 ? -30.142 76.666  24.749  1.00 12.55  ? 421  PHE B CZ    1 
ATOM   8243  N N     . MET B 1 422 ? -37.301 76.059  26.251  1.00 15.53  ? 422  MET B N     1 
ATOM   8244  C CA    . MET B 1 422 ? -38.673 76.194  26.708  1.00 15.84  ? 422  MET B CA    1 
ATOM   8245  C C     . MET B 1 422 ? -38.768 76.086  28.226  1.00 16.11  ? 422  MET B C     1 
ATOM   8246  O O     . MET B 1 422 ? -39.481 76.875  28.888  1.00 15.56  ? 422  MET B O     1 
ATOM   8247  C CB    . MET B 1 422 ? -39.551 75.126  26.042  1.00 16.16  ? 422  MET B CB    1 
ATOM   8248  C CG    . MET B 1 422 ? -39.679 75.284  24.549  1.00 15.79  ? 422  MET B CG    1 
ATOM   8249  S SD    . MET B 1 422 ? -40.610 76.766  24.082  1.00 18.53  ? 422  MET B SD    1 
ATOM   8250  C CE    . MET B 1 422 ? -42.269 76.234  24.484  1.00 16.07  ? 422  MET B CE    1 
ATOM   8251  N N     . ILE B 1 423 ? -38.082 75.077  28.762  1.00 16.26  ? 423  ILE B N     1 
ATOM   8252  C CA    . ILE B 1 423 ? -37.965 74.878  30.210  1.00 16.61  ? 423  ILE B CA    1 
ATOM   8253  C C     . ILE B 1 423 ? -36.499 74.604  30.523  1.00 16.81  ? 423  ILE B C     1 
ATOM   8254  O O     . ILE B 1 423 ? -35.906 73.673  29.977  1.00 16.22  ? 423  ILE B O     1 
ATOM   8255  C CB    . ILE B 1 423 ? -38.856 73.727  30.731  1.00 16.53  ? 423  ILE B CB    1 
ATOM   8256  C CG1   . ILE B 1 423 ? -40.320 73.973  30.351  1.00 16.20  ? 423  ILE B CG1   1 
ATOM   8257  C CG2   . ILE B 1 423 ? -38.698 73.605  32.224  1.00 16.01  ? 423  ILE B CG2   1 
ATOM   8258  C CD1   . ILE B 1 423 ? -41.285 72.799  30.651  1.00 16.11  ? 423  ILE B CD1   1 
ATOM   8259  N N     . THR B 1 424 ? -35.933 75.442  31.389  1.00 17.21  ? 424  THR B N     1 
ATOM   8260  C CA    . THR B 1 424 ? -34.491 75.567  31.550  1.00 17.71  ? 424  THR B CA    1 
ATOM   8261  C C     . THR B 1 424 ? -34.159 76.407  32.791  1.00 18.53  ? 424  THR B C     1 
ATOM   8262  O O     . THR B 1 424 ? -34.897 77.337  33.139  1.00 18.49  ? 424  THR B O     1 
ATOM   8263  C CB    . THR B 1 424 ? -33.842 76.262  30.302  1.00 18.12  ? 424  THR B CB    1 
ATOM   8264  O OG1   . THR B 1 424 ? -32.423 76.404  30.492  1.00 17.29  ? 424  THR B OG1   1 
ATOM   8265  C CG2   . THR B 1 424 ? -34.471 77.653  30.033  1.00 16.93  ? 424  THR B CG2   1 
ATOM   8266  N N     . PRO B 1 425 ? -33.040 76.092  33.460  1.00 18.82  ? 425  PRO B N     1 
ATOM   8267  C CA    . PRO B 1 425 ? -32.570 77.062  34.438  1.00 18.80  ? 425  PRO B CA    1 
ATOM   8268  C C     . PRO B 1 425 ? -31.954 78.287  33.753  1.00 18.99  ? 425  PRO B C     1 
ATOM   8269  O O     . PRO B 1 425 ? -31.561 78.222  32.569  1.00 18.72  ? 425  PRO B O     1 
ATOM   8270  C CB    . PRO B 1 425 ? -31.473 76.299  35.209  1.00 18.59  ? 425  PRO B CB    1 
ATOM   8271  C CG    . PRO B 1 425 ? -31.521 74.890  34.740  1.00 18.29  ? 425  PRO B CG    1 
ATOM   8272  C CD    . PRO B 1 425 ? -32.168 74.904  33.386  1.00 19.01  ? 425  PRO B CD    1 
ATOM   8273  N N     . LEU B 1 426 ? -31.891 79.384  34.501  1.00 18.91  ? 426  LEU B N     1 
ATOM   8274  C CA    . LEU B 1 426 ? -31.024 80.525  34.198  1.00 18.94  ? 426  LEU B CA    1 
ATOM   8275  C C     . LEU B 1 426 ? -29.968 80.516  35.301  1.00 19.17  ? 426  LEU B C     1 
ATOM   8276  O O     . LEU B 1 426 ? -30.318 80.468  36.480  1.00 19.24  ? 426  LEU B O     1 
ATOM   8277  C CB    . LEU B 1 426 ? -31.827 81.828  34.201  1.00 18.70  ? 426  LEU B CB    1 
ATOM   8278  C CG    . LEU B 1 426 ? -32.422 82.236  32.844  1.00 19.62  ? 426  LEU B CG    1 
ATOM   8279  C CD1   . LEU B 1 426 ? -33.578 81.332  32.391  1.00 20.38  ? 426  LEU B CD1   1 
ATOM   8280  C CD2   . LEU B 1 426 ? -32.845 83.687  32.847  1.00 18.43  ? 426  LEU B CD2   1 
ATOM   8281  N N     . PRO B 1 427 ? -28.669 80.535  34.937  1.00 19.44  ? 427  PRO B N     1 
ATOM   8282  C CA    . PRO B 1 427 ? -27.671 80.076  35.924  1.00 19.41  ? 427  PRO B CA    1 
ATOM   8283  C C     . PRO B 1 427 ? -27.493 80.986  37.159  1.00 19.80  ? 427  PRO B C     1 
ATOM   8284  O O     . PRO B 1 427 ? -27.089 80.503  38.217  1.00 19.89  ? 427  PRO B O     1 
ATOM   8285  C CB    . PRO B 1 427 ? -26.374 79.957  35.119  1.00 19.78  ? 427  PRO B CB    1 
ATOM   8286  C CG    . PRO B 1 427 ? -26.623 80.639  33.788  1.00 19.28  ? 427  PRO B CG    1 
ATOM   8287  C CD    . PRO B 1 427 ? -28.068 81.017  33.678  1.00 19.48  ? 427  PRO B CD    1 
ATOM   8288  N N     . GLY B 1 428 ? -27.804 82.275  37.031  1.00 19.55  ? 428  GLY B N     1 
ATOM   8289  C CA    . GLY B 1 428 ? -27.793 83.176  38.178  1.00 19.62  ? 428  GLY B CA    1 
ATOM   8290  C C     . GLY B 1 428 ? -29.176 83.506  38.723  1.00 19.94  ? 428  GLY B C     1 
ATOM   8291  O O     . GLY B 1 428 ? -29.301 84.363  39.590  1.00 20.16  ? 428  GLY B O     1 
ATOM   8292  N N     . ALA B 1 429 ? -30.216 82.824  38.231  1.00 19.64  ? 429  ALA B N     1 
ATOM   8293  C CA    . ALA B 1 429 ? -31.594 83.115  38.655  1.00 19.37  ? 429  ALA B CA    1 
ATOM   8294  C C     . ALA B 1 429 ? -32.271 81.957  39.387  1.00 19.15  ? 429  ALA B C     1 
ATOM   8295  O O     . ALA B 1 429 ? -33.093 82.175  40.284  1.00 18.92  ? 429  ALA B O     1 
ATOM   8296  C CB    . ALA B 1 429 ? -32.438 83.538  37.453  1.00 19.48  ? 429  ALA B CB    1 
ATOM   8297  N N     . ILE B 1 430 ? -31.915 80.733  38.996  1.00 18.66  ? 430  ILE B N     1 
ATOM   8298  C CA    . ILE B 1 430 ? -32.604 79.518  39.435  1.00 18.37  ? 430  ILE B CA    1 
ATOM   8299  C C     . ILE B 1 430 ? -31.619 78.515  40.073  1.00 18.07  ? 430  ILE B C     1 
ATOM   8300  O O     . ILE B 1 430 ? -30.664 78.069  39.434  1.00 17.76  ? 430  ILE B O     1 
ATOM   8301  C CB    . ILE B 1 430 ? -33.388 78.852  38.230  1.00 18.42  ? 430  ILE B CB    1 
ATOM   8302  C CG1   . ILE B 1 430 ? -34.436 79.828  37.665  1.00 18.97  ? 430  ILE B CG1   1 
ATOM   8303  C CG2   . ILE B 1 430 ? -34.046 77.520  38.645  1.00 17.80  ? 430  ILE B CG2   1 
ATOM   8304  C CD1   . ILE B 1 430 ? -35.125 79.404  36.363  1.00 18.15  ? 430  ILE B CD1   1 
ATOM   8305  N N     . GLU B 1 431 ? -31.865 78.168  41.334  1.00 17.68  ? 431  GLU B N     1 
ATOM   8306  C CA    . GLU B 1 431 ? -31.104 77.120  42.026  1.00 17.87  ? 431  GLU B CA    1 
ATOM   8307  C C     . GLU B 1 431 ? -31.434 75.767  41.427  1.00 17.47  ? 431  GLU B C     1 
ATOM   8308  O O     . GLU B 1 431 ? -32.592 75.529  41.055  1.00 17.92  ? 431  GLU B O     1 
ATOM   8309  C CB    . GLU B 1 431 ? -31.451 77.095  43.499  1.00 17.31  ? 431  GLU B CB    1 
ATOM   8310  C CG    . GLU B 1 431 ? -31.051 78.328  44.249  1.00 19.78  ? 431  GLU B CG    1 
ATOM   8311  C CD    . GLU B 1 431 ? -31.383 78.196  45.707  1.00 23.53  ? 431  GLU B CD    1 
ATOM   8312  O OE1   . GLU B 1 431 ? -32.557 77.879  46.021  1.00 24.78  ? 431  GLU B OE1   1 
ATOM   8313  O OE2   . GLU B 1 431 ? -30.468 78.408  46.537  1.00 25.88  ? 431  GLU B OE2   1 
ATOM   8314  N N     . LEU B 1 432 ? -30.444 74.879  41.375  1.00 16.69  ? 432  LEU B N     1 
ATOM   8315  C CA    . LEU B 1 432 ? -30.543 73.661  40.547  1.00 16.46  ? 432  LEU B CA    1 
ATOM   8316  C C     . LEU B 1 432 ? -30.909 72.378  41.292  1.00 16.47  ? 432  LEU B C     1 
ATOM   8317  O O     . LEU B 1 432 ? -30.517 72.174  42.438  1.00 16.87  ? 432  LEU B O     1 
ATOM   8318  C CB    . LEU B 1 432 ? -29.234 73.437  39.785  1.00 15.92  ? 432  LEU B CB    1 
ATOM   8319  C CG    . LEU B 1 432 ? -28.602 74.628  39.046  1.00 15.82  ? 432  LEU B CG    1 
ATOM   8320  C CD1   . LEU B 1 432 ? -27.334 74.179  38.343  1.00 15.19  ? 432  LEU B CD1   1 
ATOM   8321  C CD2   . LEU B 1 432 ? -29.580 75.250  38.049  1.00 15.39  ? 432  LEU B CD2   1 
ATOM   8322  N N     . LYS B 1 433 ? -31.659 71.506  40.628  1.00 16.65  ? 433  LYS B N     1 
ATOM   8323  C CA    . LYS B 1 433 ? -31.875 70.146  41.143  1.00 16.51  ? 433  LYS B CA    1 
ATOM   8324  C C     . LYS B 1 433 ? -31.377 69.176  40.085  1.00 16.38  ? 433  LYS B C     1 
ATOM   8325  O O     . LYS B 1 433 ? -31.765 69.273  38.911  1.00 16.83  ? 433  LYS B O     1 
ATOM   8326  C CB    . LYS B 1 433 ? -33.352 69.881  41.464  1.00 16.30  ? 433  LYS B CB    1 
ATOM   8327  C CG    . LYS B 1 433 ? -33.983 70.855  42.474  1.00 16.47  ? 433  LYS B CG    1 
ATOM   8328  C CD    . LYS B 1 433 ? -35.432 70.503  42.736  1.00 16.52  ? 433  LYS B CD    1 
ATOM   8329  C CE    . LYS B 1 433 ? -36.043 71.441  43.780  1.00 16.01  ? 433  LYS B CE    1 
ATOM   8330  N NZ    . LYS B 1 433 ? -37.486 71.167  44.000  1.00 16.73  ? 433  LYS B NZ    1 
ATOM   8331  N N     . ALA B 1 434 ? -30.533 68.238  40.491  1.00 15.82  ? 434  ALA B N     1 
ATOM   8332  C CA    . ALA B 1 434 ? -29.915 67.334  39.525  1.00 15.95  ? 434  ALA B CA    1 
ATOM   8333  C C     . ALA B 1 434 ? -31.020 66.570  38.785  1.00 16.15  ? 434  ALA B C     1 
ATOM   8334  O O     . ALA B 1 434 ? -31.840 65.881  39.407  1.00 16.22  ? 434  ALA B O     1 
ATOM   8335  C CB    . ALA B 1 434 ? -28.935 66.385  40.223  1.00 15.27  ? 434  ALA B CB    1 
ATOM   8336  N N     . GLY B 1 435 ? -31.078 66.747  37.466  1.00 16.02  ? 435  GLY B N     1 
ATOM   8337  C CA    . GLY B 1 435 ? -32.039 66.022  36.653  1.00 16.01  ? 435  GLY B CA    1 
ATOM   8338  C C     . GLY B 1 435 ? -33.322 66.770  36.313  1.00 16.29  ? 435  GLY B C     1 
ATOM   8339  O O     . GLY B 1 435 ? -34.153 66.250  35.565  1.00 16.34  ? 435  GLY B O     1 
ATOM   8340  N N     . SER B 1 436 ? -33.494 67.978  36.856  1.00 15.83  ? 436  SER B N     1 
ATOM   8341  C CA    . SER B 1 436 ? -34.678 68.801  36.565  1.00 15.33  ? 436  SER B CA    1 
ATOM   8342  C C     . SER B 1 436 ? -34.357 69.923  35.564  1.00 15.05  ? 436  SER B C     1 
ATOM   8343  O O     . SER B 1 436 ? -33.299 70.551  35.635  1.00 14.49  ? 436  SER B O     1 
ATOM   8344  C CB    . SER B 1 436 ? -35.287 69.356  37.871  1.00 15.56  ? 436  SER B CB    1 
ATOM   8345  O OG    . SER B 1 436 ? -36.331 70.288  37.635  1.00 15.25  ? 436  SER B OG    1 
ATOM   8346  N N     . ALA B 1 437 ? -35.267 70.148  34.615  1.00 15.18  ? 437  ALA B N     1 
ATOM   8347  C CA    . ALA B 1 437 ? -35.150 71.279  33.667  1.00 15.59  ? 437  ALA B CA    1 
ATOM   8348  C C     . ALA B 1 437 ? -35.526 72.594  34.367  1.00 15.95  ? 437  ALA B C     1 
ATOM   8349  O O     . ALA B 1 437 ? -35.151 73.675  33.922  1.00 16.75  ? 437  ALA B O     1 
ATOM   8350  C CB    . ALA B 1 437 ? -36.013 71.038  32.417  1.00 14.81  ? 437  ALA B CB    1 
ATOM   8351  N N     . THR B 1 438 ? -36.213 72.468  35.497  1.00 16.19  ? 438  THR B N     1 
ATOM   8352  C CA    . THR B 1 438 ? -36.632 73.585  36.381  1.00 16.99  ? 438  THR B CA    1 
ATOM   8353  C C     . THR B 1 438 ? -37.857 74.381  35.861  1.00 17.21  ? 438  THR B C     1 
ATOM   8354  O O     . THR B 1 438 ? -38.958 73.828  35.775  1.00 17.81  ? 438  THR B O     1 
ATOM   8355  C CB    . THR B 1 438 ? -35.451 74.496  36.864  1.00 16.72  ? 438  THR B CB    1 
ATOM   8356  O OG1   . THR B 1 438 ? -35.136 75.468  35.862  1.00 18.88  ? 438  THR B OG1   1 
ATOM   8357  C CG2   . THR B 1 438 ? -34.180 73.665  37.211  1.00 16.98  ? 438  THR B CG2   1 
ATOM   8358  N N     . ARG B 1 439 ? -37.674 75.650  35.513  1.00 17.47  ? 439  ARG B N     1 
ATOM   8359  C CA    . ARG B 1 439 ? -38.803 76.560  35.296  1.00 17.97  ? 439  ARG B CA    1 
ATOM   8360  C C     . ARG B 1 439 ? -38.962 76.945  33.821  1.00 17.96  ? 439  ARG B C     1 
ATOM   8361  O O     . ARG B 1 439 ? -38.001 76.865  33.067  1.00 18.30  ? 439  ARG B O     1 
ATOM   8362  C CB    . ARG B 1 439 ? -38.629 77.831  36.146  1.00 18.08  ? 439  ARG B CB    1 
ATOM   8363  C CG    . ARG B 1 439 ? -38.523 77.600  37.643  1.00 19.18  ? 439  ARG B CG    1 
ATOM   8364  C CD    . ARG B 1 439 ? -38.967 78.865  38.367  1.00 22.32  ? 439  ARG B CD    1 
ATOM   8365  N NE    . ARG B 1 439 ? -38.777 78.810  39.808  1.00 24.54  ? 439  ARG B NE    1 
ATOM   8366  C CZ    . ARG B 1 439 ? -39.650 78.296  40.672  1.00 25.08  ? 439  ARG B CZ    1 
ATOM   8367  N NH1   . ARG B 1 439 ? -40.790 77.755  40.249  1.00 23.88  ? 439  ARG B NH1   1 
ATOM   8368  N NH2   . ARG B 1 439 ? -39.364 78.307  41.968  1.00 25.79  ? 439  ARG B NH2   1 
ATOM   8369  N N     . PRO B 1 440 ? -40.184 77.351  33.403  1.00 17.91  ? 440  PRO B N     1 
ATOM   8370  C CA    . PRO B 1 440 ? -40.381 77.795  32.018  1.00 17.53  ? 440  PRO B CA    1 
ATOM   8371  C C     . PRO B 1 440 ? -39.612 79.079  31.692  1.00 17.36  ? 440  PRO B C     1 
ATOM   8372  O O     . PRO B 1 440 ? -39.412 79.915  32.576  1.00 17.78  ? 440  PRO B O     1 
ATOM   8373  C CB    . PRO B 1 440 ? -41.888 78.047  31.943  1.00 17.30  ? 440  PRO B CB    1 
ATOM   8374  C CG    . PRO B 1 440 ? -42.295 78.331  33.359  1.00 18.19  ? 440  PRO B CG    1 
ATOM   8375  C CD    . PRO B 1 440 ? -41.444 77.401  34.174  1.00 17.59  ? 440  PRO B CD    1 
ATOM   8376  N N     . PHE B 1 441 ? -39.179 79.225  30.442  1.00 16.53  ? 441  PHE B N     1 
ATOM   8377  C CA    . PHE B 1 441 ? -38.518 80.438  30.007  1.00 16.46  ? 441  PHE B CA    1 
ATOM   8378  C C     . PHE B 1 441 ? -39.556 81.542  29.827  1.00 16.65  ? 441  PHE B C     1 
ATOM   8379  O O     . PHE B 1 441 ? -40.763 81.261  29.826  1.00 16.34  ? 441  PHE B O     1 
ATOM   8380  C CB    . PHE B 1 441 ? -37.723 80.189  28.707  1.00 16.25  ? 441  PHE B CB    1 
ATOM   8381  C CG    . PHE B 1 441 ? -36.785 81.325  28.337  1.00 16.17  ? 441  PHE B CG    1 
ATOM   8382  C CD1   . PHE B 1 441 ? -35.605 81.542  29.063  1.00 14.64  ? 441  PHE B CD1   1 
ATOM   8383  C CD2   . PHE B 1 441 ? -37.090 82.188  27.288  1.00 15.21  ? 441  PHE B CD2   1 
ATOM   8384  C CE1   . PHE B 1 441 ? -34.742 82.583  28.752  1.00 12.20  ? 441  PHE B CE1   1 
ATOM   8385  C CE2   . PHE B 1 441 ? -36.227 83.251  26.963  1.00 15.15  ? 441  PHE B CE2   1 
ATOM   8386  C CZ    . PHE B 1 441 ? -35.052 83.452  27.708  1.00 14.60  ? 441  PHE B CZ    1 
ATOM   8387  N N     . PHE B 1 442 ? -39.089 82.787  29.688  1.00 16.81  ? 442  PHE B N     1 
ATOM   8388  C CA    . PHE B 1 442 ? -39.960 83.939  29.398  1.00 17.23  ? 442  PHE B CA    1 
ATOM   8389  C C     . PHE B 1 442 ? -40.872 83.658  28.212  1.00 17.45  ? 442  PHE B C     1 
ATOM   8390  O O     . PHE B 1 442 ? -40.411 83.206  27.168  1.00 17.49  ? 442  PHE B O     1 
ATOM   8391  C CB    . PHE B 1 442 ? -39.143 85.204  29.104  1.00 17.23  ? 442  PHE B CB    1 
ATOM   8392  C CG    . PHE B 1 442 ? -38.090 85.514  30.129  1.00 17.30  ? 442  PHE B CG    1 
ATOM   8393  C CD1   . PHE B 1 442 ? -36.849 85.984  29.729  1.00 18.28  ? 442  PHE B CD1   1 
ATOM   8394  C CD2   . PHE B 1 442 ? -38.331 85.339  31.490  1.00 17.27  ? 442  PHE B CD2   1 
ATOM   8395  C CE1   . PHE B 1 442 ? -35.850 86.275  30.671  1.00 18.25  ? 442  PHE B CE1   1 
ATOM   8396  C CE2   . PHE B 1 442 ? -37.349 85.620  32.436  1.00 18.22  ? 442  PHE B CE2   1 
ATOM   8397  C CZ    . PHE B 1 442 ? -36.098 86.095  32.021  1.00 17.80  ? 442  PHE B CZ    1 
ATOM   8398  N N     . GLY B 1 443 ? -42.171 83.902  28.389  1.00 17.61  ? 443  GLY B N     1 
ATOM   8399  C CA    . GLY B 1 443 ? -43.149 83.676  27.317  1.00 17.72  ? 443  GLY B CA    1 
ATOM   8400  C C     . GLY B 1 443 ? -43.699 82.260  27.181  1.00 17.62  ? 443  GLY B C     1 
ATOM   8401  O O     . GLY B 1 443 ? -44.579 82.012  26.347  1.00 17.05  ? 443  GLY B O     1 
ATOM   8402  N N     . VAL B 1 444 ? -43.203 81.342  28.012  1.00 17.90  ? 444  VAL B N     1 
ATOM   8403  C CA    . VAL B 1 444 ? -43.629 79.936  27.980  1.00 18.02  ? 444  VAL B CA    1 
ATOM   8404  C C     . VAL B 1 444 ? -44.609 79.591  29.107  1.00 18.49  ? 444  VAL B C     1 
ATOM   8405  O O     . VAL B 1 444 ? -44.300 79.785  30.292  1.00 18.93  ? 444  VAL B O     1 
ATOM   8406  C CB    . VAL B 1 444 ? -42.420 78.958  28.017  1.00 17.90  ? 444  VAL B CB    1 
ATOM   8407  C CG1   . VAL B 1 444 ? -42.890 77.500  27.863  1.00 17.56  ? 444  VAL B CG1   1 
ATOM   8408  C CG2   . VAL B 1 444 ? -41.406 79.310  26.958  1.00 16.50  ? 444  VAL B CG2   1 
ATOM   8409  N N     . GLN B 1 445 ? -45.788 79.077  28.731  1.00 18.45  ? 445  GLN B N     1 
ATOM   8410  C CA    . GLN B 1 445 ? -46.808 78.682  29.713  1.00 18.92  ? 445  GLN B CA    1 
ATOM   8411  C C     . GLN B 1 445 ? -47.098 77.196  29.641  1.00 17.91  ? 445  GLN B C     1 
ATOM   8412  O O     . GLN B 1 445 ? -47.981 76.773  28.888  1.00 17.14  ? 445  GLN B O     1 
ATOM   8413  C CB    . GLN B 1 445 ? -48.112 79.472  29.533  1.00 19.02  ? 445  GLN B CB    1 
ATOM   8414  C CG    . GLN B 1 445 ? -47.939 80.977  29.570  1.00 20.67  ? 445  GLN B CG    1 
ATOM   8415  C CD    . GLN B 1 445 ? -49.226 81.729  29.252  1.00 20.98  ? 445  GLN B CD    1 
ATOM   8416  O OE1   . GLN B 1 445 ? -50.233 81.598  29.961  1.00 23.97  ? 445  GLN B OE1   1 
ATOM   8417  N NE2   . GLN B 1 445 ? -49.193 82.529  28.191  1.00 21.76  ? 445  GLN B NE2   1 
ATOM   8418  N N     . PRO B 1 446 ? -46.356 76.392  30.426  1.00 17.83  ? 446  PRO B N     1 
ATOM   8419  C CA    . PRO B 1 446 ? -46.591 74.952  30.401  1.00 17.41  ? 446  PRO B CA    1 
ATOM   8420  C C     . PRO B 1 446 ? -47.729 74.546  31.323  1.00 17.52  ? 446  PRO B C     1 
ATOM   8421  O O     . PRO B 1 446 ? -48.063 75.272  32.258  1.00 17.76  ? 446  PRO B O     1 
ATOM   8422  C CB    . PRO B 1 446 ? -45.266 74.363  30.905  1.00 17.11  ? 446  PRO B CB    1 
ATOM   8423  C CG    . PRO B 1 446 ? -44.588 75.458  31.656  1.00 17.47  ? 446  PRO B CG    1 
ATOM   8424  C CD    . PRO B 1 446 ? -45.286 76.764  31.374  1.00 17.77  ? 446  PRO B CD    1 
ATOM   8425  N N     . ALA B 1 447 ? -48.307 73.380  31.049  1.00 17.82  ? 447  ALA B N     1 
ATOM   8426  C CA    . ALA B 1 447 ? -49.282 72.744  31.935  1.00 17.42  ? 447  ALA B CA    1 
ATOM   8427  C C     . ALA B 1 447 ? -49.142 71.220  31.797  1.00 17.67  ? 447  ALA B C     1 
ATOM   8428  O O     . ALA B 1 447 ? -48.592 70.731  30.810  1.00 17.55  ? 447  ALA B O     1 
ATOM   8429  C CB    . ALA B 1 447 ? -50.691 73.210  31.588  1.00 16.85  ? 447  ALA B CB    1 
ATOM   8430  N N     . LEU B 1 448 ? -49.603 70.480  32.800  1.00 18.04  ? 448  LEU B N     1 
ATOM   8431  C CA    . LEU B 1 448 ? -49.665 69.016  32.728  1.00 18.30  ? 448  LEU B CA    1 
ATOM   8432  C C     . LEU B 1 448 ? -51.118 68.597  32.742  1.00 18.62  ? 448  LEU B C     1 
ATOM   8433  O O     . LEU B 1 448 ? -51.874 69.026  33.600  1.00 19.06  ? 448  LEU B O     1 
ATOM   8434  C CB    . LEU B 1 448 ? -48.903 68.355  33.889  1.00 17.98  ? 448  LEU B CB    1 
ATOM   8435  C CG    . LEU B 1 448 ? -47.463 68.808  34.160  1.00 17.64  ? 448  LEU B CG    1 
ATOM   8436  C CD1   . LEU B 1 448 ? -46.884 68.170  35.431  1.00 17.05  ? 448  LEU B CD1   1 
ATOM   8437  C CD2   . LEU B 1 448 ? -46.570 68.530  32.965  1.00 15.26  ? 448  LEU B CD2   1 
ATOM   8438  N N     . VAL B 1 449 ? -51.510 67.773  31.779  1.00 19.33  ? 449  VAL B N     1 
ATOM   8439  C CA    . VAL B 1 449 ? -52.905 67.357  31.623  1.00 19.76  ? 449  VAL B CA    1 
ATOM   8440  C C     . VAL B 1 449 ? -52.978 65.847  31.685  1.00 20.41  ? 449  VAL B C     1 
ATOM   8441  O O     . VAL B 1 449 ? -52.009 65.161  31.322  1.00 20.59  ? 449  VAL B O     1 
ATOM   8442  C CB    . VAL B 1 449 ? -53.539 67.868  30.272  1.00 19.84  ? 449  VAL B CB    1 
ATOM   8443  C CG1   . VAL B 1 449 ? -53.583 69.418  30.221  1.00 19.46  ? 449  VAL B CG1   1 
ATOM   8444  C CG2   . VAL B 1 449 ? -52.826 67.276  29.041  1.00 19.06  ? 449  VAL B CG2   1 
ATOM   8445  N N     . ASP B 1 450 ? -54.103 65.308  32.145  1.00 21.01  ? 450  ASP B N     1 
ATOM   8446  C CA    . ASP B 1 450 ? -54.254 63.853  32.104  1.00 22.06  ? 450  ASP B CA    1 
ATOM   8447  C C     . ASP B 1 450 ? -54.628 63.388  30.690  1.00 22.27  ? 450  ASP B C     1 
ATOM   8448  O O     . ASP B 1 450 ? -54.650 64.193  29.752  1.00 22.10  ? 450  ASP B O     1 
ATOM   8449  C CB    . ASP B 1 450 ? -55.191 63.325  33.206  1.00 22.12  ? 450  ASP B CB    1 
ATOM   8450  C CG    . ASP B 1 450 ? -56.663 63.603  32.939  1.00 23.99  ? 450  ASP B CG    1 
ATOM   8451  O OD1   . ASP B 1 450 ? -57.015 64.341  31.988  1.00 25.05  ? 450  ASP B OD1   1 
ATOM   8452  O OD2   . ASP B 1 450 ? -57.479 63.064  33.716  1.00 26.62  ? 450  ASP B OD2   1 
ATOM   8453  N N     . ASN B 1 451 ? -54.910 62.103  30.528  1.00 23.20  ? 451  ASN B N     1 
ATOM   8454  C CA    . ASN B 1 451 ? -55.147 61.549  29.188  1.00 24.28  ? 451  ASN B CA    1 
ATOM   8455  C C     . ASN B 1 451 ? -56.406 62.080  28.517  1.00 25.05  ? 451  ASN B C     1 
ATOM   8456  O O     . ASN B 1 451 ? -56.543 62.002  27.287  1.00 25.65  ? 451  ASN B O     1 
ATOM   8457  C CB    . ASN B 1 451 ? -55.090 60.020  29.197  1.00 23.87  ? 451  ASN B CB    1 
ATOM   8458  C CG    . ASN B 1 451 ? -53.662 59.498  29.335  1.00 25.58  ? 451  ASN B CG    1 
ATOM   8459  O OD1   . ASN B 1 451 ? -52.691 60.215  29.058  1.00 24.34  ? 451  ASN B OD1   1 
ATOM   8460  N ND2   . ASN B 1 451 ? -53.527 58.248  29.772  1.00 26.76  ? 451  ASN B ND2   1 
ATOM   8461  N N     . GLU B 1 452 ? -57.302 62.647  29.330  1.00 25.68  ? 452  GLU B N     1 
ATOM   8462  C CA    . GLU B 1 452 ? -58.533 63.245  28.844  1.00 26.26  ? 452  GLU B CA    1 
ATOM   8463  C C     . GLU B 1 452 ? -58.440 64.781  28.807  1.00 26.14  ? 452  GLU B C     1 
ATOM   8464  O O     . GLU B 1 452 ? -59.440 65.473  28.606  1.00 26.00  ? 452  GLU B O     1 
ATOM   8465  C CB    . GLU B 1 452 ? -59.717 62.774  29.694  1.00 26.88  ? 452  GLU B CB    1 
ATOM   8466  C CG    . GLU B 1 452 ? -59.919 61.244  29.756  1.00 29.32  ? 452  GLU B CG    1 
ATOM   8467  C CD    . GLU B 1 452 ? -58.957 60.524  30.726  1.00 32.87  ? 452  GLU B CD    1 
ATOM   8468  O OE1   . GLU B 1 452 ? -58.613 61.088  31.801  1.00 34.62  ? 452  GLU B OE1   1 
ATOM   8469  O OE2   . GLU B 1 452 ? -58.548 59.381  30.415  1.00 33.14  ? 452  GLU B OE2   1 
ATOM   8470  N N     . GLY B 1 453 ? -57.235 65.313  28.997  1.00 26.02  ? 453  GLY B N     1 
ATOM   8471  C CA    . GLY B 1 453 ? -57.006 66.756  28.897  1.00 25.95  ? 453  GLY B CA    1 
ATOM   8472  C C     . GLY B 1 453 ? -57.328 67.600  30.121  1.00 26.04  ? 453  GLY B C     1 
ATOM   8473  O O     . GLY B 1 453 ? -57.256 68.824  30.053  1.00 25.92  ? 453  GLY B O     1 
ATOM   8474  N N     . HIS B 1 454 ? -57.691 66.955  31.233  1.00 26.29  ? 454  HIS B N     1 
ATOM   8475  C CA    . HIS B 1 454 ? -57.936 67.658  32.499  1.00 26.30  ? 454  HIS B CA    1 
ATOM   8476  C C     . HIS B 1 454 ? -56.599 68.188  33.054  1.00 26.29  ? 454  HIS B C     1 
ATOM   8477  O O     . HIS B 1 454 ? -55.697 67.397  33.336  1.00 25.80  ? 454  HIS B O     1 
ATOM   8478  C CB    . HIS B 1 454 ? -58.594 66.735  33.536  1.00 26.25  ? 454  HIS B CB    1 
ATOM   8479  C CG    . HIS B 1 454 ? -59.918 66.164  33.112  1.00 27.78  ? 454  HIS B CG    1 
ATOM   8480  N ND1   . HIS B 1 454 ? -60.194 64.812  33.160  1.00 28.54  ? 454  HIS B ND1   1 
ATOM   8481  C CD2   . HIS B 1 454 ? -61.049 66.759  32.655  1.00 28.93  ? 454  HIS B CD2   1 
ATOM   8482  C CE1   . HIS B 1 454 ? -61.431 64.599  32.741  1.00 28.94  ? 454  HIS B CE1   1 
ATOM   8483  N NE2   . HIS B 1 454 ? -61.971 65.763  32.429  1.00 28.36  ? 454  HIS B NE2   1 
ATOM   8484  N N     . PRO B 1 455 ? -56.461 69.528  33.192  1.00 26.37  ? 455  PRO B N     1 
ATOM   8485  C CA    . PRO B 1 455 ? -55.229 70.106  33.739  1.00 26.11  ? 455  PRO B CA    1 
ATOM   8486  C C     . PRO B 1 455 ? -55.012 69.639  35.166  1.00 26.09  ? 455  PRO B C     1 
ATOM   8487  O O     . PRO B 1 455 ? -55.952 69.611  35.960  1.00 26.43  ? 455  PRO B O     1 
ATOM   8488  C CB    . PRO B 1 455 ? -55.505 71.614  33.721  1.00 26.26  ? 455  PRO B CB    1 
ATOM   8489  C CG    . PRO B 1 455 ? -56.602 71.795  32.721  1.00 26.34  ? 455  PRO B CG    1 
ATOM   8490  C CD    . PRO B 1 455 ? -57.448 70.575  32.858  1.00 26.23  ? 455  PRO B CD    1 
ATOM   8491  N N     . GLN B 1 456 ? -53.781 69.263  35.479  1.00 25.88  ? 456  GLN B N     1 
ATOM   8492  C CA    . GLN B 1 456 ? -53.446 68.731  36.792  1.00 25.63  ? 456  GLN B CA    1 
ATOM   8493  C C     . GLN B 1 456 ? -52.745 69.807  37.619  1.00 25.51  ? 456  GLN B C     1 
ATOM   8494  O O     . GLN B 1 456 ? -51.770 70.415  37.181  1.00 25.23  ? 456  GLN B O     1 
ATOM   8495  C CB    . GLN B 1 456 ? -52.572 67.486  36.633  1.00 25.83  ? 456  GLN B CB    1 
ATOM   8496  C CG    . GLN B 1 456 ? -53.221 66.358  35.844  1.00 25.71  ? 456  GLN B CG    1 
ATOM   8497  C CD    . GLN B 1 456 ? -54.502 65.847  36.493  1.00 26.62  ? 456  GLN B CD    1 
ATOM   8498  O OE1   . GLN B 1 456 ? -55.594 65.979  35.932  1.00 26.33  ? 456  GLN B OE1   1 
ATOM   8499  N NE2   . GLN B 1 456 ? -54.377 65.273  37.686  1.00 26.83  ? 456  GLN B NE2   1 
ATOM   8500  N N     . GLU B 1 457 ? -53.265 70.050  38.814  1.00 25.79  ? 457  GLU B N     1 
ATOM   8501  C CA    . GLU B 1 457 ? -52.784 71.139  39.663  1.00 26.31  ? 457  GLU B CA    1 
ATOM   8502  C C     . GLU B 1 457 ? -51.799 70.659  40.730  1.00 25.59  ? 457  GLU B C     1 
ATOM   8503  O O     . GLU B 1 457 ? -51.868 69.512  41.182  1.00 25.40  ? 457  GLU B O     1 
ATOM   8504  C CB    . GLU B 1 457 ? -53.966 71.825  40.336  1.00 26.93  ? 457  GLU B CB    1 
ATOM   8505  C CG    . GLU B 1 457 ? -55.078 72.228  39.381  1.00 29.51  ? 457  GLU B CG    1 
ATOM   8506  C CD    . GLU B 1 457 ? -56.236 72.861  40.115  1.00 33.38  ? 457  GLU B CD    1 
ATOM   8507  O OE1   . GLU B 1 457 ? -57.351 72.304  40.051  1.00 36.32  ? 457  GLU B OE1   1 
ATOM   8508  O OE2   . GLU B 1 457 ? -56.029 73.904  40.776  1.00 35.31  ? 457  GLU B OE2   1 
ATOM   8509  N N     . GLY B 1 458 ? -50.886 71.545  41.115  1.00 25.01  ? 458  GLY B N     1 
ATOM   8510  C CA    . GLY B 1 458 ? -49.929 71.266  42.178  1.00 24.97  ? 458  GLY B CA    1 
ATOM   8511  C C     . GLY B 1 458 ? -48.829 70.301  41.783  1.00 24.64  ? 458  GLY B C     1 
ATOM   8512  O O     . GLY B 1 458 ? -48.464 70.211  40.606  1.00 24.64  ? 458  GLY B O     1 
ATOM   8513  N N     . ALA B 1 459 ? -48.293 69.598  42.781  1.00 24.15  ? 459  ALA B N     1 
ATOM   8514  C CA    . ALA B 1 459 ? -47.283 68.570  42.573  1.00 23.60  ? 459  ALA B CA    1 
ATOM   8515  C C     . ALA B 1 459 ? -47.994 67.362  41.982  1.00 23.37  ? 459  ALA B C     1 
ATOM   8516  O O     . ALA B 1 459 ? -48.810 66.714  42.651  1.00 22.96  ? 459  ALA B O     1 
ATOM   8517  C CB    . ALA B 1 459 ? -46.589 68.217  43.881  1.00 23.41  ? 459  ALA B CB    1 
ATOM   8518  N N     . THR B 1 460 ? -47.699 67.087  40.712  1.00 23.29  ? 460  THR B N     1 
ATOM   8519  C CA    . THR B 1 460 ? -48.464 66.126  39.926  1.00 22.94  ? 460  THR B CA    1 
ATOM   8520  C C     . THR B 1 460 ? -47.631 65.687  38.736  1.00 23.15  ? 460  THR B C     1 
ATOM   8521  O O     . THR B 1 460 ? -46.532 66.206  38.523  1.00 23.09  ? 460  THR B O     1 
ATOM   8522  C CB    . THR B 1 460 ? -49.815 66.770  39.442  1.00 23.19  ? 460  THR B CB    1 
ATOM   8523  O OG1   . THR B 1 460 ? -50.636 65.789  38.804  1.00 23.32  ? 460  THR B OG1   1 
ATOM   8524  C CG2   . THR B 1 460 ? -49.571 67.937  38.475  1.00 21.64  ? 460  THR B CG2   1 
ATOM   8525  N N     . GLU B 1 461 ? -48.154 64.731  37.971  1.00 23.07  ? 461  GLU B N     1 
ATOM   8526  C CA    . GLU B 1 461 ? -47.628 64.442  36.635  1.00 24.22  ? 461  GLU B CA    1 
ATOM   8527  C C     . GLU B 1 461 ? -48.696 64.438  35.528  1.00 22.82  ? 461  GLU B C     1 
ATOM   8528  O O     . GLU B 1 461 ? -49.896 64.437  35.798  1.00 22.89  ? 461  GLU B O     1 
ATOM   8529  C CB    . GLU B 1 461 ? -46.754 63.179  36.597  1.00 23.95  ? 461  GLU B CB    1 
ATOM   8530  C CG    . GLU B 1 461 ? -47.124 62.003  37.492  1.00 27.12  ? 461  GLU B CG    1 
ATOM   8531  C CD    . GLU B 1 461 ? -45.873 61.151  37.810  1.00 28.08  ? 461  GLU B CD    1 
ATOM   8532  O OE1   . GLU B 1 461 ? -44.934 61.134  36.969  1.00 33.16  ? 461  GLU B OE1   1 
ATOM   8533  O OE2   . GLU B 1 461 ? -45.807 60.524  38.896  1.00 32.18  ? 461  GLU B OE2   1 
ATOM   8534  N N     . GLY B 1 462 ? -48.251 64.454  34.279  1.00 21.85  ? 462  GLY B N     1 
ATOM   8535  C CA    . GLY B 1 462 ? -49.180 64.407  33.158  1.00 20.58  ? 462  GLY B CA    1 
ATOM   8536  C C     . GLY B 1 462 ? -48.499 64.668  31.836  1.00 19.80  ? 462  GLY B C     1 
ATOM   8537  O O     . GLY B 1 462 ? -47.274 64.785  31.781  1.00 18.59  ? 462  GLY B O     1 
ATOM   8538  N N     . ASN B 1 463 ? -49.311 64.740  30.777  1.00 19.54  ? 463  ASN B N     1 
ATOM   8539  C CA    . ASN B 1 463 ? -48.843 65.067  29.434  1.00 19.50  ? 463  ASN B CA    1 
ATOM   8540  C C     . ASN B 1 463 ? -48.464 66.537  29.377  1.00 19.30  ? 463  ASN B C     1 
ATOM   8541  O O     . ASN B 1 463 ? -49.211 67.402  29.844  1.00 19.47  ? 463  ASN B O     1 
ATOM   8542  C CB    . ASN B 1 463 ? -49.922 64.769  28.387  1.00 19.63  ? 463  ASN B CB    1 
ATOM   8543  C CG    . ASN B 1 463 ? -50.366 63.316  28.398  1.00 19.93  ? 463  ASN B CG    1 
ATOM   8544  O OD1   . ASN B 1 463 ? -49.646 62.430  27.918  1.00 20.86  ? 463  ASN B OD1   1 
ATOM   8545  N ND2   . ASN B 1 463 ? -51.559 63.062  28.938  1.00 17.81  ? 463  ASN B ND2   1 
ATOM   8546  N N     . LEU B 1 464 ? -47.306 66.824  28.806  1.00 18.89  ? 464  LEU B N     1 
ATOM   8547  C CA    . LEU B 1 464 ? -46.791 68.179  28.819  1.00 19.14  ? 464  LEU B CA    1 
ATOM   8548  C C     . LEU B 1 464 ? -47.333 68.987  27.644  1.00 18.88  ? 464  LEU B C     1 
ATOM   8549  O O     . LEU B 1 464 ? -47.055 68.658  26.497  1.00 18.89  ? 464  LEU B O     1 
ATOM   8550  C CB    . LEU B 1 464 ? -45.258 68.152  28.795  1.00 18.98  ? 464  LEU B CB    1 
ATOM   8551  C CG    . LEU B 1 464 ? -44.498 69.476  28.767  1.00 20.15  ? 464  LEU B CG    1 
ATOM   8552  C CD1   . LEU B 1 464 ? -44.874 70.395  29.964  1.00 17.80  ? 464  LEU B CD1   1 
ATOM   8553  C CD2   . LEU B 1 464 ? -43.004 69.147  28.745  1.00 19.06  ? 464  LEU B CD2   1 
ATOM   8554  N N     . VAL B 1 465 ? -48.091 70.046  27.944  1.00 18.65  ? 465  VAL B N     1 
ATOM   8555  C CA    . VAL B 1 465 ? -48.603 70.960  26.921  1.00 18.51  ? 465  VAL B CA    1 
ATOM   8556  C C     . VAL B 1 465 ? -48.088 72.364  27.164  1.00 18.51  ? 465  VAL B C     1 
ATOM   8557  O O     . VAL B 1 465 ? -47.639 72.673  28.276  1.00 18.79  ? 465  VAL B O     1 
ATOM   8558  C CB    . VAL B 1 465 ? -50.168 71.019  26.886  1.00 18.54  ? 465  VAL B CB    1 
ATOM   8559  C CG1   . VAL B 1 465 ? -50.762 69.729  26.339  1.00 17.52  ? 465  VAL B CG1   1 
ATOM   8560  C CG2   . VAL B 1 465 ? -50.742 71.355  28.270  1.00 19.46  ? 465  VAL B CG2   1 
ATOM   8561  N N     . ILE B 1 466 ? -48.157 73.202  26.124  1.00 18.30  ? 466  ILE B N     1 
ATOM   8562  C CA    . ILE B 1 466 ? -47.908 74.636  26.236  1.00 18.29  ? 466  ILE B CA    1 
ATOM   8563  C C     . ILE B 1 466 ? -49.202 75.344  25.810  1.00 19.10  ? 466  ILE B C     1 
ATOM   8564  O O     . ILE B 1 466 ? -49.697 75.148  24.679  1.00 19.09  ? 466  ILE B O     1 
ATOM   8565  C CB    . ILE B 1 466 ? -46.713 75.123  25.362  1.00 18.07  ? 466  ILE B CB    1 
ATOM   8566  C CG1   . ILE B 1 466 ? -45.491 74.186  25.471  1.00 18.07  ? 466  ILE B CG1   1 
ATOM   8567  C CG2   . ILE B 1 466 ? -46.326 76.554  25.743  1.00 18.23  ? 466  ILE B CG2   1 
ATOM   8568  C CD1   . ILE B 1 466 ? -44.718 74.222  26.820  1.00 17.08  ? 466  ILE B CD1   1 
ATOM   8569  N N     . THR B 1 467 ? -49.745 76.162  26.708  1.00 19.18  ? 467  THR B N     1 
ATOM   8570  C CA    . THR B 1 467 ? -51.110 76.681  26.559  1.00 20.09  ? 467  THR B CA    1 
ATOM   8571  C C     . THR B 1 467 ? -51.226 77.932  25.677  1.00 20.61  ? 467  THR B C     1 
ATOM   8572  O O     . THR B 1 467 ? -52.340 78.391  25.407  1.00 20.92  ? 467  THR B O     1 
ATOM   8573  C CB    . THR B 1 467 ? -51.763 77.002  27.932  1.00 20.24  ? 467  THR B CB    1 
ATOM   8574  O OG1   . THR B 1 467 ? -51.079 78.105  28.537  1.00 20.40  ? 467  THR B OG1   1 
ATOM   8575  C CG2   . THR B 1 467 ? -51.736 75.785  28.881  1.00 19.85  ? 467  THR B CG2   1 
ATOM   8576  N N     . ASP B 1 468 ? -50.086 78.483  25.250  1.00 20.69  ? 468  ASP B N     1 
ATOM   8577  C CA    . ASP B 1 468 ? -50.051 79.705  24.438  1.00 20.54  ? 468  ASP B CA    1 
ATOM   8578  C C     . ASP B 1 468 ? -48.777 79.748  23.602  1.00 20.17  ? 468  ASP B C     1 
ATOM   8579  O O     . ASP B 1 468 ? -47.807 79.045  23.898  1.00 19.71  ? 468  ASP B O     1 
ATOM   8580  C CB    . ASP B 1 468 ? -50.115 80.955  25.335  1.00 21.25  ? 468  ASP B CB    1 
ATOM   8581  C CG    . ASP B 1 468 ? -50.799 82.153  24.654  1.00 22.00  ? 468  ASP B CG    1 
ATOM   8582  O OD1   . ASP B 1 468 ? -50.806 82.249  23.405  1.00 23.26  ? 468  ASP B OD1   1 
ATOM   8583  O OD2   . ASP B 1 468 ? -51.336 83.008  25.388  1.00 23.58  ? 468  ASP B OD2   1 
ATOM   8584  N N     . SER B 1 469 ? -48.783 80.580  22.564  1.00 19.47  ? 469  SER B N     1 
ATOM   8585  C CA    . SER B 1 469 ? -47.609 80.746  21.701  1.00 19.07  ? 469  SER B CA    1 
ATOM   8586  C C     . SER B 1 469 ? -46.419 81.463  22.364  1.00 18.44  ? 469  SER B C     1 
ATOM   8587  O O     . SER B 1 469 ? -46.545 82.081  23.416  1.00 18.52  ? 469  SER B O     1 
ATOM   8588  C CB    . SER B 1 469 ? -48.001 81.465  20.417  1.00 18.97  ? 469  SER B CB    1 
ATOM   8589  O OG    . SER B 1 469 ? -46.995 81.342  19.431  1.00 19.37  ? 469  SER B OG    1 
ATOM   8590  N N     . TRP B 1 470 ? -45.260 81.330  21.729  1.00 17.86  ? 470  TRP B N     1 
ATOM   8591  C CA    . TRP B 1 470 ? -44.021 81.997  22.115  1.00 16.73  ? 470  TRP B CA    1 
ATOM   8592  C C     . TRP B 1 470 ? -43.361 82.294  20.749  1.00 16.45  ? 470  TRP B C     1 
ATOM   8593  O O     . TRP B 1 470 ? -43.758 81.698  19.746  1.00 15.95  ? 470  TRP B O     1 
ATOM   8594  C CB    . TRP B 1 470 ? -43.172 81.087  23.019  1.00 16.24  ? 470  TRP B CB    1 
ATOM   8595  C CG    . TRP B 1 470 ? -42.788 79.831  22.331  1.00 16.15  ? 470  TRP B CG    1 
ATOM   8596  C CD1   . TRP B 1 470 ? -41.602 79.572  21.711  1.00 14.07  ? 470  TRP B CD1   1 
ATOM   8597  C CD2   . TRP B 1 470 ? -43.613 78.663  22.143  1.00 16.11  ? 470  TRP B CD2   1 
ATOM   8598  N NE1   . TRP B 1 470 ? -41.636 78.314  21.142  1.00 15.20  ? 470  TRP B NE1   1 
ATOM   8599  C CE2   . TRP B 1 470 ? -42.854 77.733  21.396  1.00 15.30  ? 470  TRP B CE2   1 
ATOM   8600  C CE3   . TRP B 1 470 ? -44.918 78.313  22.535  1.00 15.50  ? 470  TRP B CE3   1 
ATOM   8601  C CZ2   . TRP B 1 470 ? -43.360 76.468  21.023  1.00 15.51  ? 470  TRP B CZ2   1 
ATOM   8602  C CZ3   . TRP B 1 470 ? -45.419 77.050  22.172  1.00 15.19  ? 470  TRP B CZ3   1 
ATOM   8603  C CH2   . TRP B 1 470 ? -44.635 76.145  21.427  1.00 15.04  ? 470  TRP B CH2   1 
ATOM   8604  N N     . PRO B 1 471 ? -42.414 83.252  20.686  1.00 15.91  ? 471  PRO B N     1 
ATOM   8605  C CA    . PRO B 1 471 ? -41.844 83.715  19.397  1.00 15.40  ? 471  PRO B CA    1 
ATOM   8606  C C     . PRO B 1 471 ? -41.103 82.699  18.484  1.00 15.64  ? 471  PRO B C     1 
ATOM   8607  O O     . PRO B 1 471 ? -41.145 82.846  17.251  1.00 14.77  ? 471  PRO B O     1 
ATOM   8608  C CB    . PRO B 1 471 ? -40.909 84.865  19.818  1.00 14.90  ? 471  PRO B CB    1 
ATOM   8609  C CG    . PRO B 1 471 ? -41.469 85.346  21.142  1.00 16.16  ? 471  PRO B CG    1 
ATOM   8610  C CD    . PRO B 1 471 ? -41.884 84.035  21.821  1.00 16.35  ? 471  PRO B CD    1 
ATOM   8611  N N     . GLY B 1 472 ? -40.438 81.692  19.062  1.00 16.13  ? 472  GLY B N     1 
ATOM   8612  C CA    . GLY B 1 472 ? -39.684 80.700  18.260  1.00 16.78  ? 472  GLY B CA    1 
ATOM   8613  C C     . GLY B 1 472 ? -40.469 79.488  17.755  1.00 17.71  ? 472  GLY B C     1 
ATOM   8614  O O     . GLY B 1 472 ? -39.890 78.554  17.155  1.00 17.22  ? 472  GLY B O     1 
ATOM   8615  N N     . GLN B 1 473 ? -41.782 79.499  17.980  1.00 17.43  ? 473  GLN B N     1 
ATOM   8616  C CA    . GLN B 1 473 ? -42.619 78.358  17.649  1.00 17.63  ? 473  GLN B CA    1 
ATOM   8617  C C     . GLN B 1 473 ? -42.648 78.051  16.147  1.00 18.29  ? 473  GLN B C     1 
ATOM   8618  O O     . GLN B 1 473 ? -42.871 78.955  15.330  1.00 18.52  ? 473  GLN B O     1 
ATOM   8619  C CB    . GLN B 1 473 ? -44.035 78.611  18.144  1.00 17.49  ? 473  GLN B CB    1 
ATOM   8620  C CG    . GLN B 1 473 ? -44.986 77.439  17.908  1.00 16.97  ? 473  GLN B CG    1 
ATOM   8621  C CD    . GLN B 1 473 ? -46.289 77.589  18.655  1.00 16.34  ? 473  GLN B CD    1 
ATOM   8622  O OE1   . GLN B 1 473 ? -46.642 78.680  19.121  1.00 16.89  ? 473  GLN B OE1   1 
ATOM   8623  N NE2   . GLN B 1 473 ? -47.015 76.488  18.783  1.00 16.25  ? 473  GLN B NE2   1 
ATOM   8624  N N     . ALA B 1 474 ? -42.429 76.785  15.777  1.00 17.95  ? 474  ALA B N     1 
ATOM   8625  C CA    . ALA B 1 474 ? -42.607 76.386  14.384  1.00 18.36  ? 474  ALA B CA    1 
ATOM   8626  C C     . ALA B 1 474 ? -43.985 76.835  13.919  1.00 18.52  ? 474  ALA B C     1 
ATOM   8627  O O     . ALA B 1 474 ? -44.957 76.763  14.675  1.00 18.49  ? 474  ALA B O     1 
ATOM   8628  C CB    . ALA B 1 474 ? -42.457 74.890  14.205  1.00 17.40  ? 474  ALA B CB    1 
ATOM   8629  N N     . ARG B 1 475 ? -44.064 77.262  12.666  1.00 18.65  ? 475  ARG B N     1 
ATOM   8630  C CA    . ARG B 1 475 ? -45.277 77.879  12.156  1.00 19.60  ? 475  ARG B CA    1 
ATOM   8631  C C     . ARG B 1 475 ? -46.184 76.870  11.459  1.00 19.94  ? 475  ARG B C     1 
ATOM   8632  O O     . ARG B 1 475 ? -47.410 77.053  11.421  1.00 20.08  ? 475  ARG B O     1 
ATOM   8633  C CB    . ARG B 1 475 ? -44.942 79.046  11.208  1.00 19.59  ? 475  ARG B CB    1 
ATOM   8634  C CG    . ARG B 1 475 ? -44.112 80.179  11.836  1.00 18.69  ? 475  ARG B CG    1 
ATOM   8635  C CD    . ARG B 1 475 ? -44.724 80.745  13.120  1.00 18.38  ? 475  ARG B CD    1 
ATOM   8636  N NE    . ARG B 1 475 ? -44.275 82.121  13.355  1.00 20.12  ? 475  ARG B NE    1 
ATOM   8637  C CZ    . ARG B 1 475 ? -43.452 82.527  14.323  1.00 19.70  ? 475  ARG B CZ    1 
ATOM   8638  N NH1   . ARG B 1 475 ? -42.969 81.679  15.214  1.00 19.19  ? 475  ARG B NH1   1 
ATOM   8639  N NH2   . ARG B 1 475 ? -43.116 83.807  14.401  1.00 19.87  ? 475  ARG B NH2   1 
ATOM   8640  N N     . THR B 1 476 ? -45.576 75.822  10.908  1.00 19.57  ? 476  THR B N     1 
ATOM   8641  C CA    . THR B 1 476 ? -46.297 74.829  10.135  1.00 19.48  ? 476  THR B CA    1 
ATOM   8642  C C     . THR B 1 476 ? -45.417 73.617  9.830   1.00 19.61  ? 476  THR B C     1 
ATOM   8643  O O     . THR B 1 476 ? -44.256 73.556  10.236  1.00 19.60  ? 476  THR B O     1 
ATOM   8644  C CB    . THR B 1 476 ? -46.898 75.430  8.806   1.00 19.42  ? 476  THR B CB    1 
ATOM   8645  O OG1   . THR B 1 476 ? -47.922 74.559  8.317   1.00 19.46  ? 476  THR B OG1   1 
ATOM   8646  C CG2   . THR B 1 476 ? -45.849 75.614  7.728   1.00 17.64  ? 476  THR B CG2   1 
ATOM   8647  N N     . LEU B 1 477 ? -45.995 72.642  9.142   1.00 19.77  ? 477  LEU B N     1 
ATOM   8648  C CA    . LEU B 1 477 ? -45.209 71.595  8.503   1.00 20.16  ? 477  LEU B CA    1 
ATOM   8649  C C     . LEU B 1 477 ? -45.226 71.909  7.018   1.00 21.22  ? 477  LEU B C     1 
ATOM   8650  O O     . LEU B 1 477 ? -46.259 72.377  6.494   1.00 21.18  ? 477  LEU B O     1 
ATOM   8651  C CB    . LEU B 1 477 ? -45.800 70.212  8.774   1.00 19.37  ? 477  LEU B CB    1 
ATOM   8652  C CG    . LEU B 1 477 ? -45.706 69.701  10.209  1.00 17.64  ? 477  LEU B CG    1 
ATOM   8653  C CD1   . LEU B 1 477 ? -46.453 68.364  10.325  1.00 15.03  ? 477  LEU B CD1   1 
ATOM   8654  C CD2   . LEU B 1 477 ? -44.254 69.564  10.647  1.00 13.19  ? 477  LEU B CD2   1 
ATOM   8655  N N     . PHE B 1 478 ? -44.096 71.665  6.345   1.00 22.09  ? 478  PHE B N     1 
ATOM   8656  C CA    . PHE B 1 478 ? -43.924 72.098  4.958   1.00 23.02  ? 478  PHE B CA    1 
ATOM   8657  C C     . PHE B 1 478 ? -44.922 71.419  4.033   1.00 23.43  ? 478  PHE B C     1 
ATOM   8658  O O     . PHE B 1 478 ? -44.924 70.192  3.900   1.00 23.41  ? 478  PHE B O     1 
ATOM   8659  C CB    . PHE B 1 478 ? -42.487 71.883  4.469   1.00 23.26  ? 478  PHE B CB    1 
ATOM   8660  C CG    . PHE B 1 478 ? -42.282 72.249  3.028   1.00 24.29  ? 478  PHE B CG    1 
ATOM   8661  C CD1   . PHE B 1 478 ? -42.232 73.582  2.634   1.00 26.06  ? 478  PHE B CD1   1 
ATOM   8662  C CD2   . PHE B 1 478 ? -42.166 71.257  2.053   1.00 24.94  ? 478  PHE B CD2   1 
ATOM   8663  C CE1   . PHE B 1 478 ? -42.062 73.930  1.290   1.00 26.82  ? 478  PHE B CE1   1 
ATOM   8664  C CE2   . PHE B 1 478 ? -41.995 71.589  0.712   1.00 25.59  ? 478  PHE B CE2   1 
ATOM   8665  C CZ    . PHE B 1 478 ? -41.944 72.928  0.325   1.00 25.69  ? 478  PHE B CZ    1 
ATOM   8666  N N     . GLY B 1 479 ? -45.772 72.237  3.414   1.00 24.16  ? 479  GLY B N     1 
ATOM   8667  C CA    . GLY B 1 479 ? -46.750 71.783  2.430   1.00 24.35  ? 479  GLY B CA    1 
ATOM   8668  C C     . GLY B 1 479 ? -47.976 71.107  3.018   1.00 24.73  ? 479  GLY B C     1 
ATOM   8669  O O     . GLY B 1 479 ? -48.778 70.515  2.276   1.00 24.30  ? 479  GLY B O     1 
ATOM   8670  N N     . ASP B 1 480 ? -48.146 71.201  4.341   1.00 24.78  ? 480  ASP B N     1 
ATOM   8671  C CA    . ASP B 1 480 ? -49.185 70.411  5.012   1.00 25.04  ? 480  ASP B CA    1 
ATOM   8672  C C     . ASP B 1 480 ? -49.599 70.940  6.382   1.00 24.64  ? 480  ASP B C     1 
ATOM   8673  O O     . ASP B 1 480 ? -49.280 70.339  7.424   1.00 24.42  ? 480  ASP B O     1 
ATOM   8674  C CB    . ASP B 1 480 ? -48.736 68.946  5.114   1.00 25.66  ? 480  ASP B CB    1 
ATOM   8675  C CG    . ASP B 1 480 ? -49.900 67.979  5.261   1.00 27.31  ? 480  ASP B CG    1 
ATOM   8676  O OD1   . ASP B 1 480 ? -51.059 68.437  5.335   1.00 29.16  ? 480  ASP B OD1   1 
ATOM   8677  O OD2   . ASP B 1 480 ? -49.652 66.753  5.303   1.00 29.03  ? 480  ASP B OD2   1 
ATOM   8678  N N     . HIS B 1 481 ? -50.330 72.055  6.370   1.00 24.10  ? 481  HIS B N     1 
ATOM   8679  C CA    . HIS B 1 481 ? -50.786 72.710  7.598   1.00 24.02  ? 481  HIS B CA    1 
ATOM   8680  C C     . HIS B 1 481 ? -51.861 71.912  8.351   1.00 24.15  ? 481  HIS B C     1 
ATOM   8681  O O     . HIS B 1 481 ? -51.921 71.959  9.575   1.00 24.39  ? 481  HIS B O     1 
ATOM   8682  C CB    . HIS B 1 481 ? -51.270 74.124  7.296   1.00 23.75  ? 481  HIS B CB    1 
ATOM   8683  C CG    . HIS B 1 481 ? -51.380 74.998  8.504   1.00 24.42  ? 481  HIS B CG    1 
ATOM   8684  N ND1   . HIS B 1 481 ? -50.288 75.357  9.267   1.00 24.06  ? 481  HIS B ND1   1 
ATOM   8685  C CD2   . HIS B 1 481 ? -52.452 75.594  9.077   1.00 24.60  ? 481  HIS B CD2   1 
ATOM   8686  C CE1   . HIS B 1 481 ? -50.685 76.129  10.261  1.00 24.09  ? 481  HIS B CE1   1 
ATOM   8687  N NE2   . HIS B 1 481 ? -51.993 76.287  10.171  1.00 24.87  ? 481  HIS B NE2   1 
ATOM   8688  N N     . GLU B 1 482 ? -52.695 71.178  7.617   1.00 24.61  ? 482  GLU B N     1 
ATOM   8689  C CA    . GLU B 1 482 ? -53.695 70.271  8.208   1.00 24.95  ? 482  GLU B CA    1 
ATOM   8690  C C     . GLU B 1 482 ? -53.042 69.186  9.077   1.00 23.85  ? 482  GLU B C     1 
ATOM   8691  O O     . GLU B 1 482 ? -53.495 68.940  10.197  1.00 24.10  ? 482  GLU B O     1 
ATOM   8692  C CB    . GLU B 1 482 ? -54.639 69.682  7.124   1.00 24.99  ? 482  GLU B CB    1 
ATOM   8693  C CG    . GLU B 1 482 ? -55.778 70.667  6.701   1.00 26.23  ? 482  GLU B CG    1 
ATOM   8694  C CD    . GLU B 1 482 ? -56.415 70.415  5.304   1.00 27.51  ? 482  GLU B CD    1 
ATOM   8695  O OE1   . GLU B 1 482 ? -57.676 70.473  5.209   1.00 27.47  ? 482  GLU B OE1   1 
ATOM   8696  O OE2   . GLU B 1 482 ? -55.665 70.207  4.299   1.00 30.79  ? 482  GLU B OE2   1 
ATOM   8697  N N     . ARG B 1 483 ? -51.970 68.565  8.585   1.00 22.67  ? 483  ARG B N     1 
ATOM   8698  C CA    . ARG B 1 483 ? -51.182 67.634  9.405   1.00 21.65  ? 483  ARG B CA    1 
ATOM   8699  C C     . ARG B 1 483 ? -50.531 68.317  10.627  1.00 20.99  ? 483  ARG B C     1 
ATOM   8700  O O     . ARG B 1 483 ? -50.487 67.738  11.713  1.00 19.94  ? 483  ARG B O     1 
ATOM   8701  C CB    . ARG B 1 483 ? -50.119 66.910  8.568   1.00 21.84  ? 483  ARG B CB    1 
ATOM   8702  C CG    . ARG B 1 483 ? -49.355 65.782  9.311   1.00 21.66  ? 483  ARG B CG    1 
ATOM   8703  C CD    . ARG B 1 483 ? -50.070 64.426  9.183   1.00 24.10  ? 483  ARG B CD    1 
ATOM   8704  N N     . PHE B 1 484 ? -50.039 69.540  10.439  1.00 20.26  ? 484  PHE B N     1 
ATOM   8705  C CA    . PHE B 1 484 ? -49.464 70.342  11.525  1.00 20.45  ? 484  PHE B CA    1 
ATOM   8706  C C     . PHE B 1 484 ? -50.483 70.480  12.655  1.00 20.99  ? 484  PHE B C     1 
ATOM   8707  O O     . PHE B 1 484 ? -50.213 70.075  13.782  1.00 20.91  ? 484  PHE B O     1 
ATOM   8708  C CB    . PHE B 1 484 ? -49.028 71.709  10.983  1.00 20.06  ? 484  PHE B CB    1 
ATOM   8709  C CG    . PHE B 1 484 ? -48.451 72.657  12.020  1.00 20.13  ? 484  PHE B CG    1 
ATOM   8710  C CD1   . PHE B 1 484 ? -47.199 72.425  12.592  1.00 19.20  ? 484  PHE B CD1   1 
ATOM   8711  C CD2   . PHE B 1 484 ? -49.132 73.828  12.357  1.00 19.49  ? 484  PHE B CD2   1 
ATOM   8712  C CE1   . PHE B 1 484 ? -46.653 73.324  13.520  1.00 20.18  ? 484  PHE B CE1   1 
ATOM   8713  C CE2   . PHE B 1 484 ? -48.605 74.740  13.288  1.00 20.22  ? 484  PHE B CE2   1 
ATOM   8714  C CZ    . PHE B 1 484 ? -47.362 74.490  13.875  1.00 19.90  ? 484  PHE B CZ    1 
ATOM   8715  N N     . GLU B 1 485 ? -51.666 71.010  12.336  1.00 21.54  ? 485  GLU B N     1 
ATOM   8716  C CA    . GLU B 1 485 ? -52.739 71.149  13.323  1.00 22.35  ? 485  GLU B CA    1 
ATOM   8717  C C     . GLU B 1 485 ? -53.102 69.788  13.939  1.00 22.22  ? 485  GLU B C     1 
ATOM   8718  O O     . GLU B 1 485 ? -53.228 69.661  15.164  1.00 21.96  ? 485  GLU B O     1 
ATOM   8719  C CB    . GLU B 1 485 ? -53.973 71.832  12.705  1.00 22.36  ? 485  GLU B CB    1 
ATOM   8720  C CG    . GLU B 1 485 ? -53.671 73.182  12.016  1.00 23.08  ? 485  GLU B CG    1 
ATOM   8721  C CD    . GLU B 1 485 ? -54.863 73.758  11.222  1.00 23.83  ? 485  GLU B CD    1 
ATOM   8722  O OE1   . GLU B 1 485 ? -55.483 73.016  10.411  1.00 26.72  ? 485  GLU B OE1   1 
ATOM   8723  O OE2   . GLU B 1 485 ? -55.173 74.965  11.390  1.00 24.31  ? 485  GLU B OE2   1 
ATOM   8724  N N     . GLN B 1 486 ? -53.234 68.768  13.092  1.00 22.25  ? 486  GLN B N     1 
ATOM   8725  C CA    . GLN B 1 486 ? -53.570 67.414  13.549  1.00 22.22  ? 486  GLN B CA    1 
ATOM   8726  C C     . GLN B 1 486 ? -52.555 66.877  14.571  1.00 22.28  ? 486  GLN B C     1 
ATOM   8727  O O     . GLN B 1 486 ? -52.921 66.332  15.627  1.00 22.83  ? 486  GLN B O     1 
ATOM   8728  C CB    . GLN B 1 486 ? -53.691 66.468  12.347  1.00 21.89  ? 486  GLN B CB    1 
ATOM   8729  C CG    . GLN B 1 486 ? -54.403 65.154  12.627  1.00 23.65  ? 486  GLN B CG    1 
ATOM   8730  N N     . THR B 1 487 ? -51.277 67.056  14.270  1.00 21.96  ? 487  THR B N     1 
ATOM   8731  C CA    . THR B 1 487 ? -50.222 66.472  15.073  1.00 21.69  ? 487  THR B CA    1 
ATOM   8732  C C     . THR B 1 487 ? -50.075 67.119  16.451  1.00 21.57  ? 487  THR B C     1 
ATOM   8733  O O     . THR B 1 487 ? -49.904 66.418  17.445  1.00 21.63  ? 487  THR B O     1 
ATOM   8734  C CB    . THR B 1 487 ? -48.909 66.521  14.301  1.00 22.08  ? 487  THR B CB    1 
ATOM   8735  O OG1   . THR B 1 487 ? -49.095 65.819  13.074  1.00 20.96  ? 487  THR B OG1   1 
ATOM   8736  C CG2   . THR B 1 487 ? -47.738 65.876  15.098  1.00 22.21  ? 487  THR B CG2   1 
ATOM   8737  N N     . TYR B 1 488 ? -50.163 68.447  16.509  1.00 20.94  ? 488  TYR B N     1 
ATOM   8738  C CA    . TYR B 1 488 ? -49.835 69.176  17.742  1.00 20.34  ? 488  TYR B CA    1 
ATOM   8739  C C     . TYR B 1 488 ? -51.028 69.788  18.484  1.00 20.55  ? 488  TYR B C     1 
ATOM   8740  O O     . TYR B 1 488 ? -50.941 70.038  19.680  1.00 21.04  ? 488  TYR B O     1 
ATOM   8741  C CB    . TYR B 1 488 ? -48.786 70.249  17.449  1.00 19.82  ? 488  TYR B CB    1 
ATOM   8742  C CG    . TYR B 1 488 ? -47.579 69.709  16.691  1.00 19.07  ? 488  TYR B CG    1 
ATOM   8743  C CD1   . TYR B 1 488 ? -47.440 69.922  15.317  1.00 17.33  ? 488  TYR B CD1   1 
ATOM   8744  C CD2   . TYR B 1 488 ? -46.602 68.950  17.346  1.00 17.46  ? 488  TYR B CD2   1 
ATOM   8745  C CE1   . TYR B 1 488 ? -46.343 69.396  14.613  1.00 17.27  ? 488  TYR B CE1   1 
ATOM   8746  C CE2   . TYR B 1 488 ? -45.515 68.421  16.660  1.00 17.05  ? 488  TYR B CE2   1 
ATOM   8747  C CZ    . TYR B 1 488 ? -45.390 68.657  15.297  1.00 17.56  ? 488  TYR B CZ    1 
ATOM   8748  O OH    . TYR B 1 488 ? -44.298 68.163  14.627  1.00 19.28  ? 488  TYR B OH    1 
ATOM   8749  N N     . PHE B 1 489 ? -52.138 69.995  17.783  1.00 20.13  ? 489  PHE B N     1 
ATOM   8750  C CA    . PHE B 1 489 ? -53.240 70.779  18.314  1.00 20.29  ? 489  PHE B CA    1 
ATOM   8751  C C     . PHE B 1 489 ? -54.604 70.063  18.306  1.00 20.66  ? 489  PHE B C     1 
ATOM   8752  O O     . PHE B 1 489 ? -55.630 70.712  18.503  1.00 20.66  ? 489  PHE B O     1 
ATOM   8753  C CB    . PHE B 1 489 ? -53.349 72.101  17.538  1.00 19.33  ? 489  PHE B CB    1 
ATOM   8754  C CG    . PHE B 1 489 ? -52.099 72.944  17.586  1.00 18.47  ? 489  PHE B CG    1 
ATOM   8755  C CD1   . PHE B 1 489 ? -51.154 72.869  16.571  1.00 16.24  ? 489  PHE B CD1   1 
ATOM   8756  C CD2   . PHE B 1 489 ? -51.865 73.805  18.650  1.00 16.83  ? 489  PHE B CD2   1 
ATOM   8757  C CE1   . PHE B 1 489 ? -49.992 73.640  16.619  1.00 16.13  ? 489  PHE B CE1   1 
ATOM   8758  C CE2   . PHE B 1 489 ? -50.718 74.589  18.691  1.00 15.69  ? 489  PHE B CE2   1 
ATOM   8759  C CZ    . PHE B 1 489 ? -49.783 74.511  17.674  1.00 16.50  ? 489  PHE B CZ    1 
ATOM   8760  N N     . SER B 1 490 ? -54.623 68.746  18.081  1.00 21.46  ? 490  SER B N     1 
ATOM   8761  C CA    . SER B 1 490 ? -55.901 67.997  18.034  1.00 22.01  ? 490  SER B CA    1 
ATOM   8762  C C     . SER B 1 490 ? -56.171 67.090  19.249  1.00 22.34  ? 490  SER B C     1 
ATOM   8763  O O     . SER B 1 490 ? -57.336 66.757  19.524  1.00 22.17  ? 490  SER B O     1 
ATOM   8764  C CB    . SER B 1 490 ? -56.021 67.180  16.740  1.00 22.41  ? 490  SER B CB    1 
ATOM   8765  O OG    . SER B 1 490 ? -55.218 66.000  16.779  1.00 22.66  ? 490  SER B OG    1 
ATOM   8766  N N     . THR B 1 491 ? -55.106 66.678  19.953  1.00 22.02  ? 491  THR B N     1 
ATOM   8767  C CA    . THR B 1 491 ? -55.239 65.800  21.130  1.00 21.55  ? 491  THR B CA    1 
ATOM   8768  C C     . THR B 1 491 ? -55.817 66.577  22.308  1.00 21.24  ? 491  THR B C     1 
ATOM   8769  O O     . THR B 1 491 ? -56.652 66.062  23.049  1.00 21.14  ? 491  THR B O     1 
ATOM   8770  C CB    . THR B 1 491 ? -53.879 65.169  21.571  1.00 21.62  ? 491  THR B CB    1 
ATOM   8771  O OG1   . THR B 1 491 ? -53.218 64.588  20.441  1.00 22.04  ? 491  THR B OG1   1 
ATOM   8772  C CG2   . THR B 1 491 ? -54.083 64.099  22.652  1.00 20.59  ? 491  THR B CG2   1 
ATOM   8773  N N     . PHE B 1 492 ? -55.347 67.810  22.476  1.00 20.50  ? 492  PHE B N     1 
ATOM   8774  C CA    . PHE B 1 492 ? -55.795 68.682  23.549  1.00 19.93  ? 492  PHE B CA    1 
ATOM   8775  C C     . PHE B 1 492 ? -56.115 70.041  22.941  1.00 20.35  ? 492  PHE B C     1 
ATOM   8776  O O     . PHE B 1 492 ? -55.226 70.873  22.708  1.00 19.88  ? 492  PHE B O     1 
ATOM   8777  C CB    . PHE B 1 492 ? -54.725 68.793  24.648  1.00 19.49  ? 492  PHE B CB    1 
ATOM   8778  C CG    . PHE B 1 492 ? -54.308 67.457  25.235  1.00 18.14  ? 492  PHE B CG    1 
ATOM   8779  C CD1   . PHE B 1 492 ? -52.999 66.985  25.078  1.00 15.60  ? 492  PHE B CD1   1 
ATOM   8780  C CD2   . PHE B 1 492 ? -55.232 66.662  25.927  1.00 15.93  ? 492  PHE B CD2   1 
ATOM   8781  C CE1   . PHE B 1 492 ? -52.614 65.746  25.622  1.00 15.06  ? 492  PHE B CE1   1 
ATOM   8782  C CE2   . PHE B 1 492 ? -54.864 65.417  26.466  1.00 13.88  ? 492  PHE B CE2   1 
ATOM   8783  C CZ    . PHE B 1 492 ? -53.550 64.959  26.314  1.00 15.92  ? 492  PHE B CZ    1 
ATOM   8784  N N     . LYS B 1 493 ? -57.400 70.235  22.665  1.00 20.61  ? 493  LYS B N     1 
ATOM   8785  C CA    . LYS B 1 493 ? -57.906 71.436  22.023  1.00 21.26  ? 493  LYS B CA    1 
ATOM   8786  C C     . LYS B 1 493 ? -57.360 72.700  22.673  1.00 21.10  ? 493  LYS B C     1 
ATOM   8787  O O     . LYS B 1 493 ? -57.344 72.813  23.893  1.00 20.71  ? 493  LYS B O     1 
ATOM   8788  C CB    . LYS B 1 493 ? -59.439 71.429  22.026  1.00 21.39  ? 493  LYS B CB    1 
ATOM   8789  C CG    . LYS B 1 493 ? -60.044 70.363  21.093  1.00 22.70  ? 493  LYS B CG    1 
ATOM   8790  N N     . ASN B 1 494 ? -56.902 73.628  21.830  1.00 21.34  ? 494  ASN B N     1 
ATOM   8791  C CA    . ASN B 1 494 ? -56.401 74.945  22.237  1.00 21.86  ? 494  ASN B CA    1 
ATOM   8792  C C     . ASN B 1 494 ? -55.020 74.906  22.887  1.00 22.18  ? 494  ASN B C     1 
ATOM   8793  O O     . ASN B 1 494 ? -54.575 75.884  23.504  1.00 22.16  ? 494  ASN B O     1 
ATOM   8794  C CB    . ASN B 1 494 ? -57.415 75.671  23.129  1.00 21.92  ? 494  ASN B CB    1 
ATOM   8795  C CG    . ASN B 1 494 ? -58.723 75.974  22.397  1.00 23.42  ? 494  ASN B CG    1 
ATOM   8796  O OD1   . ASN B 1 494 ? -58.766 76.834  21.499  1.00 25.03  ? 494  ASN B OD1   1 
ATOM   8797  N ND2   . ASN B 1 494 ? -59.797 75.267  22.774  1.00 22.39  ? 494  ASN B ND2   1 
ATOM   8798  N N     . MET B 1 495 ? -54.330 73.776  22.722  1.00 22.32  ? 495  MET B N     1 
ATOM   8799  C CA    . MET B 1 495 ? -53.033 73.590  23.343  1.00 22.71  ? 495  MET B CA    1 
ATOM   8800  C C     . MET B 1 495 ? -52.039 72.937  22.423  1.00 21.17  ? 495  MET B C     1 
ATOM   8801  O O     . MET B 1 495 ? -52.384 72.050  21.647  1.00 21.07  ? 495  MET B O     1 
ATOM   8802  C CB    . MET B 1 495 ? -53.171 72.780  24.628  1.00 22.22  ? 495  MET B CB    1 
ATOM   8803  C CG    . MET B 1 495 ? -53.724 73.590  25.795  1.00 23.50  ? 495  MET B CG    1 
ATOM   8804  S SD    . MET B 1 495 ? -54.206 72.460  27.088  1.00 28.17  ? 495  MET B SD    1 
ATOM   8805  C CE    . MET B 1 495 ? -55.849 71.933  26.545  1.00 30.65  ? 495  MET B CE    1 
ATOM   8806  N N     . TYR B 1 496 ? -50.798 73.401  22.512  1.00 19.81  ? 496  TYR B N     1 
ATOM   8807  C CA    . TYR B 1 496 ? -49.699 72.716  21.883  1.00 19.25  ? 496  TYR B CA    1 
ATOM   8808  C C     . TYR B 1 496 ? -49.302 71.487  22.699  1.00 18.80  ? 496  TYR B C     1 
ATOM   8809  O O     . TYR B 1 496 ? -48.954 71.605  23.874  1.00 18.06  ? 496  TYR B O     1 
ATOM   8810  C CB    . TYR B 1 496 ? -48.497 73.645  21.699  1.00 18.75  ? 496  TYR B CB    1 
ATOM   8811  C CG    . TYR B 1 496 ? -47.284 72.904  21.207  1.00 19.01  ? 496  TYR B CG    1 
ATOM   8812  C CD1   . TYR B 1 496 ? -47.163 72.547  19.865  1.00 19.42  ? 496  TYR B CD1   1 
ATOM   8813  C CD2   . TYR B 1 496 ? -46.257 72.531  22.090  1.00 20.36  ? 496  TYR B CD2   1 
ATOM   8814  C CE1   . TYR B 1 496 ? -46.036 71.838  19.403  1.00 20.36  ? 496  TYR B CE1   1 
ATOM   8815  C CE2   . TYR B 1 496 ? -45.122 71.821  21.637  1.00 18.71  ? 496  TYR B CE2   1 
ATOM   8816  C CZ    . TYR B 1 496 ? -45.023 71.479  20.294  1.00 19.17  ? 496  TYR B CZ    1 
ATOM   8817  O OH    . TYR B 1 496 ? -43.910 70.792  19.829  1.00 19.00  ? 496  TYR B OH    1 
ATOM   8818  N N     . PHE B 1 497 ? -49.368 70.313  22.071  1.00 18.25  ? 497  PHE B N     1 
ATOM   8819  C CA    . PHE B 1 497 ? -48.976 69.067  22.743  1.00 17.84  ? 497  PHE B CA    1 
ATOM   8820  C C     . PHE B 1 497 ? -47.547 68.674  22.321  1.00 17.37  ? 497  PHE B C     1 
ATOM   8821  O O     . PHE B 1 497 ? -47.273 68.531  21.123  1.00 16.50  ? 497  PHE B O     1 
ATOM   8822  C CB    . PHE B 1 497 ? -49.987 67.938  22.463  1.00 18.16  ? 497  PHE B CB    1 
ATOM   8823  C CG    . PHE B 1 497 ? -49.623 66.608  23.096  1.00 18.94  ? 497  PHE B CG    1 
ATOM   8824  C CD1   . PHE B 1 497 ? -49.053 66.549  24.376  1.00 18.64  ? 497  PHE B CD1   1 
ATOM   8825  C CD2   . PHE B 1 497 ? -49.860 65.416  22.417  1.00 21.50  ? 497  PHE B CD2   1 
ATOM   8826  C CE1   . PHE B 1 497 ? -48.718 65.333  24.958  1.00 19.57  ? 497  PHE B CE1   1 
ATOM   8827  C CE2   . PHE B 1 497 ? -49.524 64.175  22.996  1.00 20.56  ? 497  PHE B CE2   1 
ATOM   8828  C CZ    . PHE B 1 497 ? -48.961 64.144  24.283  1.00 19.68  ? 497  PHE B CZ    1 
ATOM   8829  N N     . SER B 1 498 ? -46.653 68.531  23.307  1.00 16.00  ? 498  SER B N     1 
ATOM   8830  C CA    . SER B 1 498 ? -45.238 68.251  23.039  1.00 15.49  ? 498  SER B CA    1 
ATOM   8831  C C     . SER B 1 498 ? -44.979 66.792  22.687  1.00 15.42  ? 498  SER B C     1 
ATOM   8832  O O     . SER B 1 498 ? -44.056 66.482  21.934  1.00 15.89  ? 498  SER B O     1 
ATOM   8833  C CB    . SER B 1 498 ? -44.366 68.662  24.222  1.00 14.76  ? 498  SER B CB    1 
ATOM   8834  O OG    . SER B 1 498 ? -44.717 67.907  25.369  1.00 13.59  ? 498  SER B OG    1 
ATOM   8835  N N     . GLY B 1 499 ? -45.780 65.889  23.238  1.00 15.89  ? 499  GLY B N     1 
ATOM   8836  C CA    . GLY B 1 499 ? -45.576 64.455  23.016  1.00 16.25  ? 499  GLY B CA    1 
ATOM   8837  C C     . GLY B 1 499 ? -44.720 63.887  24.133  1.00 16.92  ? 499  GLY B C     1 
ATOM   8838  O O     . GLY B 1 499 ? -44.415 62.698  24.139  1.00 16.82  ? 499  GLY B O     1 
ATOM   8839  N N     . ASP B 1 500 ? -44.354 64.764  25.075  1.00 16.95  ? 500  ASP B N     1 
ATOM   8840  C CA    . ASP B 1 500 ? -43.612 64.436  26.284  1.00 16.95  ? 500  ASP B CA    1 
ATOM   8841  C C     . ASP B 1 500 ? -44.512 64.339  27.503  1.00 17.32  ? 500  ASP B C     1 
ATOM   8842  O O     . ASP B 1 500 ? -45.567 64.984  27.565  1.00 16.46  ? 500  ASP B O     1 
ATOM   8843  C CB    . ASP B 1 500 ? -42.564 65.521  26.581  1.00 17.16  ? 500  ASP B CB    1 
ATOM   8844  C CG    . ASP B 1 500 ? -41.352 65.425  25.682  1.00 17.20  ? 500  ASP B CG    1 
ATOM   8845  O OD1   . ASP B 1 500 ? -40.836 64.300  25.498  1.00 18.08  ? 500  ASP B OD1   1 
ATOM   8846  O OD2   . ASP B 1 500 ? -40.927 66.473  25.157  1.00 15.45  ? 500  ASP B OD2   1 
ATOM   8847  N N     . GLY B 1 501 ? -44.067 63.513  28.454  1.00 16.99  ? 501  GLY B N     1 
ATOM   8848  C CA    . GLY B 1 501 ? -44.601 63.446  29.801  1.00 18.03  ? 501  GLY B CA    1 
ATOM   8849  C C     . GLY B 1 501 ? -43.640 64.153  30.751  1.00 18.59  ? 501  GLY B C     1 
ATOM   8850  O O     . GLY B 1 501 ? -42.425 64.228  30.492  1.00 19.06  ? 501  GLY B O     1 
ATOM   8851  N N     . ALA B 1 502 ? -44.183 64.688  31.837  1.00 18.58  ? 502  ALA B N     1 
ATOM   8852  C CA    . ALA B 1 502 ? -43.400 65.436  32.819  1.00 19.33  ? 502  ALA B CA    1 
ATOM   8853  C C     . ALA B 1 502 ? -44.042 65.340  34.187  1.00 19.88  ? 502  ALA B C     1 
ATOM   8854  O O     . ALA B 1 502 ? -45.238 65.078  34.313  1.00 20.53  ? 502  ALA B O     1 
ATOM   8855  C CB    . ALA B 1 502 ? -43.273 66.887  32.417  1.00 18.79  ? 502  ALA B CB    1 
ATOM   8856  N N     . ARG B 1 503 ? -43.239 65.526  35.218  1.00 20.47  ? 503  ARG B N     1 
ATOM   8857  C CA    . ARG B 1 503 ? -43.793 65.736  36.528  1.00 21.18  ? 503  ARG B CA    1 
ATOM   8858  C C     . ARG B 1 503 ? -43.343 67.104  37.006  1.00 20.33  ? 503  ARG B C     1 
ATOM   8859  O O     . ARG B 1 503 ? -42.296 67.602  36.601  1.00 20.07  ? 503  ARG B O     1 
ATOM   8860  C CB    . ARG B 1 503 ? -43.455 64.581  37.496  1.00 21.24  ? 503  ARG B CB    1 
ATOM   8861  C CG    . ARG B 1 503 ? -42.149 64.675  38.247  1.00 24.01  ? 503  ARG B CG    1 
ATOM   8862  C CD    . ARG B 1 503 ? -42.146 63.758  39.491  1.00 23.80  ? 503  ARG B CD    1 
ATOM   8863  N NE    . ARG B 1 503 ? -41.327 64.330  40.571  1.00 28.46  ? 503  ARG B NE    1 
ATOM   8864  C CZ    . ARG B 1 503 ? -40.008 64.164  40.683  1.00 30.72  ? 503  ARG B CZ    1 
ATOM   8865  N NH1   . ARG B 1 503 ? -39.343 63.434  39.784  1.00 33.10  ? 503  ARG B NH1   1 
ATOM   8866  N NH2   . ARG B 1 503 ? -39.346 64.728  41.687  1.00 30.38  ? 503  ARG B NH2   1 
ATOM   8867  N N     . ARG B 1 504 ? -44.190 67.734  37.812  1.00 20.09  ? 504  ARG B N     1 
ATOM   8868  C CA    . ARG B 1 504 ? -43.895 69.025  38.414  1.00 19.52  ? 504  ARG B CA    1 
ATOM   8869  C C     . ARG B 1 504 ? -43.849 68.789  39.926  1.00 19.19  ? 504  ARG B C     1 
ATOM   8870  O O     . ARG B 1 504 ? -44.720 68.118  40.468  1.00 19.20  ? 504  ARG B O     1 
ATOM   8871  C CB    . ARG B 1 504 ? -44.974 70.052  38.026  1.00 19.24  ? 504  ARG B CB    1 
ATOM   8872  C CG    . ARG B 1 504 ? -44.732 71.464  38.528  1.00 19.02  ? 504  ARG B CG    1 
ATOM   8873  C CD    . ARG B 1 504 ? -45.795 72.466  38.051  1.00 19.34  ? 504  ARG B CD    1 
ATOM   8874  N NE    . ARG B 1 504 ? -47.163 72.069  38.392  1.00 18.89  ? 504  ARG B NE    1 
ATOM   8875  C CZ    . ARG B 1 504 ? -48.175 71.969  37.525  1.00 18.54  ? 504  ARG B CZ    1 
ATOM   8876  N NH1   . ARG B 1 504 ? -48.017 72.271  36.234  1.00 17.24  ? 504  ARG B NH1   1 
ATOM   8877  N NH2   . ARG B 1 504 ? -49.368 71.585  37.962  1.00 18.25  ? 504  ARG B NH2   1 
ATOM   8878  N N     . ASP B 1 505 ? -42.828 69.308  40.599  1.00 18.76  ? 505  ASP B N     1 
ATOM   8879  C CA    . ASP B 1 505 ? -42.737 69.120  42.038  1.00 18.88  ? 505  ASP B CA    1 
ATOM   8880  C C     . ASP B 1 505 ? -43.400 70.251  42.824  1.00 19.22  ? 505  ASP B C     1 
ATOM   8881  O O     . ASP B 1 505 ? -44.006 71.163  42.228  1.00 18.88  ? 505  ASP B O     1 
ATOM   8882  C CB    . ASP B 1 505 ? -41.296 68.832  42.505  1.00 18.70  ? 505  ASP B CB    1 
ATOM   8883  C CG    . ASP B 1 505 ? -40.325 69.996  42.259  1.00 19.03  ? 505  ASP B CG    1 
ATOM   8884  O OD1   . ASP B 1 505 ? -40.749 71.158  42.097  1.00 16.91  ? 505  ASP B OD1   1 
ATOM   8885  O OD2   . ASP B 1 505 ? -39.108 69.728  42.266  1.00 19.15  ? 505  ASP B OD2   1 
ATOM   8886  N N     . GLU B 1 506 ? -43.280 70.173  44.150  1.00 19.37  ? 506  GLU B N     1 
ATOM   8887  C CA    . GLU B 1 506 ? -43.848 71.148  45.087  1.00 20.02  ? 506  GLU B CA    1 
ATOM   8888  C C     . GLU B 1 506 ? -43.335 72.573  44.855  1.00 20.28  ? 506  GLU B C     1 
ATOM   8889  O O     . GLU B 1 506 ? -44.084 73.524  45.047  1.00 21.06  ? 506  GLU B O     1 
ATOM   8890  C CB    . GLU B 1 506 ? -43.619 70.707  46.552  1.00 20.10  ? 506  GLU B CB    1 
ATOM   8891  N N     . ASP B 1 507 ? -42.079 72.711  44.410  1.00 20.50  ? 507  ASP B N     1 
ATOM   8892  C CA    . ASP B 1 507 ? -41.481 74.018  44.052  1.00 19.93  ? 507  ASP B CA    1 
ATOM   8893  C C     . ASP B 1 507 ? -41.847 74.523  42.662  1.00 19.32  ? 507  ASP B C     1 
ATOM   8894  O O     . ASP B 1 507 ? -41.439 75.625  42.259  1.00 18.88  ? 507  ASP B O     1 
ATOM   8895  C CB    . ASP B 1 507 ? -39.948 73.948  44.161  1.00 20.59  ? 507  ASP B CB    1 
ATOM   8896  C CG    . ASP B 1 507 ? -39.477 73.666  45.578  1.00 21.33  ? 507  ASP B CG    1 
ATOM   8897  O OD1   . ASP B 1 507 ? -40.107 74.169  46.535  1.00 22.35  ? 507  ASP B OD1   1 
ATOM   8898  O OD2   . ASP B 1 507 ? -38.474 72.943  45.735  1.00 22.11  ? 507  ASP B OD2   1 
ATOM   8899  N N     . GLY B 1 508 ? -42.596 73.716  41.915  1.00 19.01  ? 508  GLY B N     1 
ATOM   8900  C CA    . GLY B 1 508 ? -42.973 74.078  40.548  1.00 17.96  ? 508  GLY B CA    1 
ATOM   8901  C C     . GLY B 1 508 ? -41.940 73.688  39.491  1.00 17.84  ? 508  GLY B C     1 
ATOM   8902  O O     . GLY B 1 508 ? -42.094 74.046  38.314  1.00 17.40  ? 508  GLY B O     1 
ATOM   8903  N N     . TYR B 1 509 ? -40.897 72.965  39.902  1.00 17.20  ? 509  TYR B N     1 
ATOM   8904  C CA    . TYR B 1 509 ? -39.854 72.484  38.977  1.00 17.83  ? 509  TYR B CA    1 
ATOM   8905  C C     . TYR B 1 509 ? -40.384 71.334  38.113  1.00 17.38  ? 509  TYR B C     1 
ATOM   8906  O O     . TYR B 1 509 ? -41.016 70.416  38.631  1.00 17.50  ? 509  TYR B O     1 
ATOM   8907  C CB    . TYR B 1 509 ? -38.605 72.002  39.747  1.00 17.92  ? 509  TYR B CB    1 
ATOM   8908  C CG    . TYR B 1 509 ? -37.645 73.079  40.243  1.00 18.44  ? 509  TYR B CG    1 
ATOM   8909  C CD1   . TYR B 1 509 ? -38.119 74.252  40.842  1.00 18.48  ? 509  TYR B CD1   1 
ATOM   8910  C CD2   . TYR B 1 509 ? -36.253 72.897  40.156  1.00 17.94  ? 509  TYR B CD2   1 
ATOM   8911  C CE1   . TYR B 1 509 ? -37.239 75.236  41.320  1.00 20.00  ? 509  TYR B CE1   1 
ATOM   8912  C CE2   . TYR B 1 509 ? -35.357 73.874  40.634  1.00 19.11  ? 509  TYR B CE2   1 
ATOM   8913  C CZ    . TYR B 1 509 ? -35.860 75.038  41.216  1.00 20.18  ? 509  TYR B CZ    1 
ATOM   8914  O OH    . TYR B 1 509 ? -35.007 76.013  41.688  1.00 20.10  ? 509  TYR B OH    1 
ATOM   8915  N N     . TYR B 1 510 ? -40.117 71.387  36.808  1.00 17.11  ? 510  TYR B N     1 
ATOM   8916  C CA    . TYR B 1 510 ? -40.527 70.309  35.897  1.00 17.48  ? 510  TYR B CA    1 
ATOM   8917  C C     . TYR B 1 510 ? -39.441 69.259  35.753  1.00 17.68  ? 510  TYR B C     1 
ATOM   8918  O O     . TYR B 1 510 ? -38.257 69.584  35.759  1.00 18.00  ? 510  TYR B O     1 
ATOM   8919  C CB    . TYR B 1 510 ? -40.956 70.850  34.528  1.00 17.07  ? 510  TYR B CB    1 
ATOM   8920  C CG    . TYR B 1 510 ? -42.266 71.613  34.582  1.00 17.16  ? 510  TYR B CG    1 
ATOM   8921  C CD1   . TYR B 1 510 ? -42.295 72.976  34.893  1.00 16.84  ? 510  TYR B CD1   1 
ATOM   8922  C CD2   . TYR B 1 510 ? -43.478 70.969  34.335  1.00 17.06  ? 510  TYR B CD2   1 
ATOM   8923  C CE1   . TYR B 1 510 ? -43.518 73.681  34.954  1.00 17.79  ? 510  TYR B CE1   1 
ATOM   8924  C CE2   . TYR B 1 510 ? -44.706 71.664  34.390  1.00 15.74  ? 510  TYR B CE2   1 
ATOM   8925  C CZ    . TYR B 1 510 ? -44.716 73.012  34.697  1.00 17.27  ? 510  TYR B CZ    1 
ATOM   8926  O OH    . TYR B 1 510 ? -45.921 73.682  34.761  1.00 16.97  ? 510  TYR B OH    1 
ATOM   8927  N N     . TRP B 1 511 ? -39.862 67.999  35.675  1.00 17.88  ? 511  TRP B N     1 
ATOM   8928  C CA    . TRP B 1 511 ? -38.963 66.869  35.491  1.00 18.45  ? 511  TRP B CA    1 
ATOM   8929  C C     . TRP B 1 511 ? -39.490 66.172  34.258  1.00 19.26  ? 511  TRP B C     1 
ATOM   8930  O O     . TRP B 1 511 ? -40.576 65.553  34.294  1.00 19.19  ? 511  TRP B O     1 
ATOM   8931  C CB    . TRP B 1 511 ? -38.977 65.916  36.693  1.00 17.38  ? 511  TRP B CB    1 
ATOM   8932  C CG    . TRP B 1 511 ? -38.559 66.567  37.984  1.00 18.30  ? 511  TRP B CG    1 
ATOM   8933  C CD1   . TRP B 1 511 ? -39.285 67.460  38.731  1.00 17.76  ? 511  TRP B CD1   1 
ATOM   8934  C CD2   . TRP B 1 511 ? -37.323 66.383  38.680  1.00 18.01  ? 511  TRP B CD2   1 
ATOM   8935  N NE1   . TRP B 1 511 ? -38.582 67.832  39.845  1.00 17.25  ? 511  TRP B NE1   1 
ATOM   8936  C CE2   . TRP B 1 511 ? -37.371 67.192  39.838  1.00 18.55  ? 511  TRP B CE2   1 
ATOM   8937  C CE3   . TRP B 1 511 ? -36.179 65.607  38.444  1.00 19.12  ? 511  TRP B CE3   1 
ATOM   8938  C CZ2   . TRP B 1 511 ? -36.311 67.252  40.761  1.00 17.18  ? 511  TRP B CZ2   1 
ATOM   8939  C CZ3   . TRP B 1 511 ? -35.129 65.663  39.366  1.00 18.00  ? 511  TRP B CZ3   1 
ATOM   8940  C CH2   . TRP B 1 511 ? -35.204 66.489  40.505  1.00 17.26  ? 511  TRP B CH2   1 
ATOM   8941  N N     . ILE B 1 512 ? -38.758 66.318  33.155  1.00 19.68  ? 512  ILE B N     1 
ATOM   8942  C CA    . ILE B 1 512 ? -39.205 65.753  31.891  1.00 20.83  ? 512  ILE B CA    1 
ATOM   8943  C C     . ILE B 1 512 ? -38.793 64.287  31.849  1.00 21.21  ? 512  ILE B C     1 
ATOM   8944  O O     . ILE B 1 512 ? -37.606 63.968  31.976  1.00 21.75  ? 512  ILE B O     1 
ATOM   8945  C CB    . ILE B 1 512 ? -38.703 66.572  30.644  1.00 20.87  ? 512  ILE B CB    1 
ATOM   8946  C CG1   . ILE B 1 512 ? -39.553 67.839  30.448  1.00 22.57  ? 512  ILE B CG1   1 
ATOM   8947  C CG2   . ILE B 1 512 ? -38.823 65.732  29.353  1.00 20.41  ? 512  ILE B CG2   1 
ATOM   8948  C CD1   . ILE B 1 512 ? -39.360 68.940  31.479  1.00 23.63  ? 512  ILE B CD1   1 
ATOM   8949  N N     . THR B 1 513 ? -39.785 63.409  31.698  1.00 21.61  ? 513  THR B N     1 
ATOM   8950  C CA    . THR B 1 513 ? -39.570 61.961  31.703  1.00 21.69  ? 513  THR B CA    1 
ATOM   8951  C C     . THR B 1 513 ? -39.515 61.353  30.292  1.00 21.75  ? 513  THR B C     1 
ATOM   8952  O O     . THR B 1 513 ? -39.076 60.222  30.111  1.00 21.75  ? 513  THR B O     1 
ATOM   8953  C CB    . THR B 1 513 ? -40.629 61.233  32.555  1.00 21.67  ? 513  THR B CB    1 
ATOM   8954  O OG1   . THR B 1 513 ? -41.935 61.653  32.155  1.00 21.13  ? 513  THR B OG1   1 
ATOM   8955  C CG2   . THR B 1 513 ? -40.442 61.566  34.044  1.00 22.67  ? 513  THR B CG2   1 
ATOM   8956  N N     . GLY B 1 514 ? -39.946 62.106  29.291  1.00 21.67  ? 514  GLY B N     1 
ATOM   8957  C CA    . GLY B 1 514 ? -39.771 61.668  27.910  1.00 21.72  ? 514  GLY B CA    1 
ATOM   8958  C C     . GLY B 1 514 ? -41.068 61.460  27.166  1.00 21.14  ? 514  GLY B C     1 
ATOM   8959  O O     . GLY B 1 514 ? -42.142 61.768  27.671  1.00 21.46  ? 514  GLY B O     1 
ATOM   8960  N N     . ARG B 1 515 ? -40.949 60.939  25.956  1.00 20.56  ? 515  ARG B N     1 
ATOM   8961  C CA    . ARG B 1 515 ? -42.071 60.796  25.034  1.00 20.05  ? 515  ARG B CA    1 
ATOM   8962  C C     . ARG B 1 515 ? -43.150 59.861  25.552  1.00 20.13  ? 515  ARG B C     1 
ATOM   8963  O O     . ARG B 1 515 ? -42.859 58.783  26.083  1.00 19.52  ? 515  ARG B O     1 
ATOM   8964  C CB    . ARG B 1 515 ? -41.579 60.298  23.669  1.00 19.35  ? 515  ARG B CB    1 
ATOM   8965  C CG    . ARG B 1 515 ? -40.456 61.133  23.051  1.00 18.70  ? 515  ARG B CG    1 
ATOM   8966  C CD    . ARG B 1 515 ? -40.899 62.565  22.702  1.00 17.41  ? 515  ARG B CD    1 
ATOM   8967  N NE    . ARG B 1 515 ? -41.947 62.631  21.684  1.00 15.44  ? 515  ARG B NE    1 
ATOM   8968  C CZ    . ARG B 1 515 ? -42.105 63.652  20.837  1.00 15.46  ? 515  ARG B CZ    1 
ATOM   8969  N NH1   . ARG B 1 515 ? -41.289 64.712  20.879  1.00 14.85  ? 515  ARG B NH1   1 
ATOM   8970  N NH2   . ARG B 1 515 ? -43.073 63.612  19.931  1.00 11.73  ? 515  ARG B NH2   1 
ATOM   8971  N N     . VAL B 1 516 ? -44.400 60.288  25.398  1.00 20.40  ? 516  VAL B N     1 
ATOM   8972  C CA    . VAL B 1 516 ? -45.562 59.429  25.705  1.00 20.63  ? 516  VAL B CA    1 
ATOM   8973  C C     . VAL B 1 516 ? -46.227 58.920  24.421  1.00 20.84  ? 516  VAL B C     1 
ATOM   8974  O O     . VAL B 1 516 ? -47.127 58.100  24.483  1.00 21.04  ? 516  VAL B O     1 
ATOM   8975  C CB    . VAL B 1 516 ? -46.625 60.151  26.576  1.00 20.60  ? 516  VAL B CB    1 
ATOM   8976  C CG1   . VAL B 1 516 ? -46.078 60.433  27.992  1.00 20.61  ? 516  VAL B CG1   1 
ATOM   8977  C CG2   . VAL B 1 516 ? -47.097 61.423  25.896  1.00 18.75  ? 516  VAL B CG2   1 
ATOM   8978  N N     . ASP B 1 517 ? -45.797 59.435  23.268  1.00 20.92  ? 517  ASP B N     1 
ATOM   8979  C CA    . ASP B 1 517 ? -46.215 58.882  21.976  1.00 21.33  ? 517  ASP B CA    1 
ATOM   8980  C C     . ASP B 1 517 ? -45.203 57.822  21.506  1.00 21.69  ? 517  ASP B C     1 
ATOM   8981  O O     . ASP B 1 517 ? -44.335 57.400  22.288  1.00 22.43  ? 517  ASP B O     1 
ATOM   8982  C CB    . ASP B 1 517 ? -46.423 60.002  20.939  1.00 21.00  ? 517  ASP B CB    1 
ATOM   8983  C CG    . ASP B 1 517 ? -45.208 60.922  20.789  1.00 21.66  ? 517  ASP B CG    1 
ATOM   8984  O OD1   . ASP B 1 517 ? -45.320 61.916  20.033  1.00 19.66  ? 517  ASP B OD1   1 
ATOM   8985  O OD2   . ASP B 1 517 ? -44.144 60.666  21.413  1.00 21.44  ? 517  ASP B OD2   1 
ATOM   8986  N N     . ASP B 1 518 ? -45.304 57.392  20.249  1.00 21.94  ? 518  ASP B N     1 
ATOM   8987  C CA    . ASP B 1 518 ? -44.433 56.339  19.719  1.00 22.06  ? 518  ASP B CA    1 
ATOM   8988  C C     . ASP B 1 518 ? -43.171 56.901  19.072  1.00 21.73  ? 518  ASP B C     1 
ATOM   8989  O O     . ASP B 1 518 ? -42.797 56.511  17.959  1.00 22.91  ? 518  ASP B O     1 
ATOM   8990  C CB    . ASP B 1 518 ? -45.194 55.460  18.721  1.00 22.31  ? 518  ASP B CB    1 
ATOM   8991  C CG    . ASP B 1 518 ? -46.356 54.699  19.366  1.00 23.87  ? 518  ASP B CG    1 
ATOM   8992  O OD1   . ASP B 1 518 ? -46.157 54.078  20.437  1.00 25.53  ? 518  ASP B OD1   1 
ATOM   8993  O OD2   . ASP B 1 518 ? -47.471 54.722  18.791  1.00 24.18  ? 518  ASP B OD2   1 
ATOM   8994  N N     . VAL B 1 519 ? -42.533 57.838  19.761  1.00 21.01  ? 519  VAL B N     1 
ATOM   8995  C CA    . VAL B 1 519 ? -41.251 58.394  19.328  1.00 19.71  ? 519  VAL B CA    1 
ATOM   8996  C C     . VAL B 1 519 ? -40.135 57.897  20.250  1.00 19.40  ? 519  VAL B C     1 
ATOM   8997  O O     . VAL B 1 519 ? -40.305 57.831  21.488  1.00 19.71  ? 519  VAL B O     1 
ATOM   8998  C CB    . VAL B 1 519 ? -41.299 59.933  19.260  1.00 20.10  ? 519  VAL B CB    1 
ATOM   8999  C CG1   . VAL B 1 519 ? -39.917 60.526  18.908  1.00 17.97  ? 519  VAL B CG1   1 
ATOM   9000  C CG2   . VAL B 1 519 ? -42.348 60.367  18.227  1.00 19.95  ? 519  VAL B CG2   1 
ATOM   9001  N N     . LEU B 1 520 ? -39.013 57.529  19.634  1.00 18.61  ? 520  LEU B N     1 
ATOM   9002  C CA    . LEU B 1 520 ? -37.854 56.990  20.336  1.00 18.00  ? 520  LEU B CA    1 
ATOM   9003  C C     . LEU B 1 520 ? -36.758 58.037  20.494  1.00 17.00  ? 520  LEU B C     1 
ATOM   9004  O O     . LEU B 1 520 ? -36.696 58.994  19.725  1.00 16.28  ? 520  LEU B O     1 
ATOM   9005  C CB    . LEU B 1 520 ? -37.280 55.789  19.580  1.00 18.17  ? 520  LEU B CB    1 
ATOM   9006  C CG    . LEU B 1 520 ? -38.235 54.695  19.106  1.00 19.08  ? 520  LEU B CG    1 
ATOM   9007  C CD1   . LEU B 1 520 ? -37.559 53.845  18.043  1.00 19.96  ? 520  LEU B CD1   1 
ATOM   9008  C CD2   . LEU B 1 520 ? -38.699 53.836  20.268  1.00 21.85  ? 520  LEU B CD2   1 
ATOM   9009  N N     . ASN B 1 521 ? -35.899 57.827  21.492  1.00 16.10  ? 521  ASN B N     1 
ATOM   9010  C CA    . ASN B 1 521 ? -34.717 58.663  21.721  1.00 15.43  ? 521  ASN B CA    1 
ATOM   9011  C C     . ASN B 1 521 ? -33.501 57.765  21.857  1.00 14.89  ? 521  ASN B C     1 
ATOM   9012  O O     . ASN B 1 521 ? -33.236 57.167  22.912  1.00 13.97  ? 521  ASN B O     1 
ATOM   9013  C CB    . ASN B 1 521 ? -34.896 59.546  22.959  1.00 15.67  ? 521  ASN B CB    1 
ATOM   9014  C CG    . ASN B 1 521 ? -33.825 60.649  23.077  1.00 16.93  ? 521  ASN B CG    1 
ATOM   9015  O OD1   . ASN B 1 521 ? -32.624 60.429  22.874  1.00 16.67  ? 521  ASN B OD1   1 
ATOM   9016  N ND2   . ASN B 1 521 ? -34.274 61.845  23.438  1.00 18.80  ? 521  ASN B ND2   1 
ATOM   9017  N N     . VAL B 1 522 ? -32.774 57.657  20.760  1.00 14.76  ? 522  VAL B N     1 
ATOM   9018  C CA    . VAL B 1 522 ? -31.667 56.719  20.654  1.00 15.15  ? 522  VAL B CA    1 
ATOM   9019  C C     . VAL B 1 522 ? -30.382 57.516  20.413  1.00 14.99  ? 522  VAL B C     1 
ATOM   9020  O O     . VAL B 1 522 ? -30.237 58.185  19.394  1.00 14.49  ? 522  VAL B O     1 
ATOM   9021  C CB    . VAL B 1 522 ? -31.957 55.700  19.522  1.00 15.34  ? 522  VAL B CB    1 
ATOM   9022  C CG1   . VAL B 1 522 ? -30.871 54.618  19.457  1.00 15.19  ? 522  VAL B CG1   1 
ATOM   9023  C CG2   . VAL B 1 522 ? -33.361 55.051  19.729  1.00 15.85  ? 522  VAL B CG2   1 
ATOM   9024  N N     . SER B 1 523 ? -29.478 57.471  21.387  1.00 15.42  ? 523  SER B N     1 
ATOM   9025  C CA    . SER B 1 523 ? -28.265 58.302  21.414  1.00 15.77  ? 523  SER B CA    1 
ATOM   9026  C C     . SER B 1 523 ? -28.556 59.775  21.170  1.00 16.38  ? 523  SER B C     1 
ATOM   9027  O O     . SER B 1 523 ? -27.788 60.471  20.498  1.00 17.05  ? 523  SER B O     1 
ATOM   9028  C CB    . SER B 1 523 ? -27.214 57.808  20.419  1.00 15.28  ? 523  SER B CB    1 
ATOM   9029  O OG    . SER B 1 523 ? -26.796 56.501  20.750  1.00 16.20  ? 523  SER B OG    1 
ATOM   9030  N N     . GLY B 1 524 ? -29.671 60.254  21.706  1.00 16.50  ? 524  GLY B N     1 
ATOM   9031  C CA    . GLY B 1 524 ? -30.023 61.650  21.540  1.00 16.93  ? 524  GLY B CA    1 
ATOM   9032  C C     . GLY B 1 524 ? -30.629 61.944  20.179  1.00 17.45  ? 524  GLY B C     1 
ATOM   9033  O O     . GLY B 1 524 ? -30.774 63.111  19.817  1.00 18.24  ? 524  GLY B O     1 
ATOM   9034  N N     . HIS B 1 525 ? -30.960 60.898  19.422  1.00 16.92  ? 525  HIS B N     1 
ATOM   9035  C CA    . HIS B 1 525 ? -31.645 61.049  18.145  1.00 16.90  ? 525  HIS B CA    1 
ATOM   9036  C C     . HIS B 1 525 ? -33.116 60.700  18.265  1.00 16.38  ? 525  HIS B C     1 
ATOM   9037  O O     . HIS B 1 525 ? -33.468 59.629  18.764  1.00 15.25  ? 525  HIS B O     1 
ATOM   9038  C CB    . HIS B 1 525 ? -30.995 60.184  17.051  1.00 17.32  ? 525  HIS B CB    1 
ATOM   9039  C CG    . HIS B 1 525 ? -29.570 60.539  16.785  1.00 18.62  ? 525  HIS B CG    1 
ATOM   9040  N ND1   . HIS B 1 525 ? -28.571 59.592  16.688  1.00 21.22  ? 525  HIS B ND1   1 
ATOM   9041  C CD2   . HIS B 1 525 ? -28.964 61.742  16.646  1.00 19.74  ? 525  HIS B CD2   1 
ATOM   9042  C CE1   . HIS B 1 525 ? -27.416 60.198  16.477  1.00 21.69  ? 525  HIS B CE1   1 
ATOM   9043  N NE2   . HIS B 1 525 ? -27.625 61.503  16.454  1.00 20.09  ? 525  HIS B NE2   1 
ATOM   9044  N N     . ARG B 1 526 ? -33.962 61.613  17.786  1.00 15.75  ? 526  ARG B N     1 
ATOM   9045  C CA    . ARG B 1 526 ? -35.403 61.423  17.783  1.00 15.39  ? 526  ARG B CA    1 
ATOM   9046  C C     . ARG B 1 526 ? -35.804 60.640  16.534  1.00 15.60  ? 526  ARG B C     1 
ATOM   9047  O O     . ARG B 1 526 ? -35.538 61.076  15.417  1.00 15.16  ? 526  ARG B O     1 
ATOM   9048  C CB    . ARG B 1 526 ? -36.100 62.788  17.824  1.00 15.09  ? 526  ARG B CB    1 
ATOM   9049  C CG    . ARG B 1 526 ? -37.599 62.762  17.555  1.00 13.22  ? 526  ARG B CG    1 
ATOM   9050  C CD    . ARG B 1 526 ? -38.131 64.178  17.635  1.00 14.14  ? 526  ARG B CD    1 
ATOM   9051  N NE    . ARG B 1 526 ? -39.489 64.314  17.144  1.00 12.28  ? 526  ARG B NE    1 
ATOM   9052  C CZ    . ARG B 1 526 ? -40.200 65.428  17.246  1.00 11.45  ? 526  ARG B CZ    1 
ATOM   9053  N NH1   . ARG B 1 526 ? -39.668 66.510  17.816  1.00 9.89   ? 526  ARG B NH1   1 
ATOM   9054  N NH2   . ARG B 1 526 ? -41.438 65.461  16.771  1.00 10.57  ? 526  ARG B NH2   1 
ATOM   9055  N N     . LEU B 1 527 ? -36.433 59.483  16.735  1.00 16.15  ? 527  LEU B N     1 
ATOM   9056  C CA    . LEU B 1 527 ? -36.813 58.573  15.642  1.00 16.23  ? 527  LEU B CA    1 
ATOM   9057  C C     . LEU B 1 527 ? -38.205 58.023  15.857  1.00 16.65  ? 527  LEU B C     1 
ATOM   9058  O O     . LEU B 1 527 ? -38.583 57.701  16.991  1.00 17.48  ? 527  LEU B O     1 
ATOM   9059  C CB    . LEU B 1 527 ? -35.856 57.384  15.569  1.00 16.12  ? 527  LEU B CB    1 
ATOM   9060  C CG    . LEU B 1 527 ? -34.396 57.525  15.125  1.00 17.01  ? 527  LEU B CG    1 
ATOM   9061  C CD1   . LEU B 1 527 ? -33.661 56.223  15.408  1.00 16.52  ? 527  LEU B CD1   1 
ATOM   9062  C CD2   . LEU B 1 527 ? -34.239 57.931  13.652  1.00 14.85  ? 527  LEU B CD2   1 
ATOM   9063  N N     . GLY B 1 528 ? -38.968 57.894  14.779  1.00 16.62  ? 528  GLY B N     1 
ATOM   9064  C CA    . GLY B 1 528 ? -40.325 57.358  14.871  1.00 17.23  ? 528  GLY B CA    1 
ATOM   9065  C C     . GLY B 1 528 ? -40.313 55.850  14.701  1.00 17.96  ? 528  GLY B C     1 
ATOM   9066  O O     . GLY B 1 528 ? -39.589 55.325  13.852  1.00 18.07  ? 528  GLY B O     1 
ATOM   9067  N N     . THR B 1 529 ? -41.095 55.140  15.513  1.00 18.37  ? 529  THR B N     1 
ATOM   9068  C CA    . THR B 1 529 ? -41.216 53.688  15.345  1.00 18.91  ? 529  THR B CA    1 
ATOM   9069  C C     . THR B 1 529 ? -41.795 53.338  13.976  1.00 19.09  ? 529  THR B C     1 
ATOM   9070  O O     . THR B 1 529 ? -41.345 52.395  13.323  1.00 19.12  ? 529  THR B O     1 
ATOM   9071  C CB    . THR B 1 529 ? -42.011 52.991  16.485  1.00 18.82  ? 529  THR B CB    1 
ATOM   9072  O OG1   . THR B 1 529 ? -43.387 53.369  16.439  1.00 20.11  ? 529  THR B OG1   1 
ATOM   9073  C CG2   . THR B 1 529 ? -41.448 53.347  17.837  1.00 17.33  ? 529  THR B CG2   1 
ATOM   9074  N N     . ALA B 1 530 ? -42.764 54.123  13.528  1.00 19.10  ? 530  ALA B N     1 
ATOM   9075  C CA    . ALA B 1 530 ? -43.439 53.835  12.264  1.00 19.86  ? 530  ALA B CA    1 
ATOM   9076  C C     . ALA B 1 530 ? -42.494 53.839  11.060  1.00 19.74  ? 530  ALA B C     1 
ATOM   9077  O O     . ALA B 1 530 ? -42.598 52.961  10.198  1.00 20.32  ? 530  ALA B O     1 
ATOM   9078  C CB    . ALA B 1 530 ? -44.651 54.795  12.034  1.00 19.80  ? 530  ALA B CB    1 
ATOM   9079  N N     . GLU B 1 531 ? -41.570 54.806  11.000  1.00 19.12  ? 531  GLU B N     1 
ATOM   9080  C CA    . GLU B 1 531 ? -40.612 54.852  9.896   1.00 18.76  ? 531  GLU B CA    1 
ATOM   9081  C C     . GLU B 1 531 ? -39.641 53.666  9.893   1.00 17.60  ? 531  GLU B C     1 
ATOM   9082  O O     . GLU B 1 531 ? -39.238 53.193  8.814   1.00 17.53  ? 531  GLU B O     1 
ATOM   9083  C CB    . GLU B 1 531 ? -39.847 56.176  9.869   1.00 19.84  ? 531  GLU B CB    1 
ATOM   9084  C CG    . GLU B 1 531 ? -39.058 56.462  11.130  1.00 22.01  ? 531  GLU B CG    1 
ATOM   9085  C CD    . GLU B 1 531 ? -38.363 57.790  11.104  1.00 25.38  ? 531  GLU B CD    1 
ATOM   9086  O OE1   . GLU B 1 531 ? -37.481 58.000  10.235  1.00 26.74  ? 531  GLU B OE1   1 
ATOM   9087  O OE2   . GLU B 1 531 ? -38.687 58.615  11.975  1.00 25.54  ? 531  GLU B OE2   1 
ATOM   9088  N N     . ILE B 1 532 ? -39.273 53.171  11.078  1.00 16.34  ? 532  ILE B N     1 
ATOM   9089  C CA    . ILE B 1 532 ? -38.404 51.976  11.152  1.00 14.97  ? 532  ILE B CA    1 
ATOM   9090  C C     . ILE B 1 532 ? -39.165 50.736  10.670  1.00 14.64  ? 532  ILE B C     1 
ATOM   9091  O O     . ILE B 1 532 ? -38.610 49.885  9.941   1.00 13.66  ? 532  ILE B O     1 
ATOM   9092  C CB    . ILE B 1 532 ? -37.783 51.771  12.553  1.00 15.49  ? 532  ILE B CB    1 
ATOM   9093  C CG1   . ILE B 1 532 ? -36.936 53.009  12.922  1.00 14.27  ? 532  ILE B CG1   1 
ATOM   9094  C CG2   . ILE B 1 532 ? -36.909 50.484  12.568  1.00 13.84  ? 532  ILE B CG2   1 
ATOM   9095  C CD1   . ILE B 1 532 ? -36.565 53.108  14.358  1.00 13.33  ? 532  ILE B CD1   1 
ATOM   9096  N N     . GLU B 1 533 ? -40.445 50.669  11.045  1.00 14.01  ? 533  GLU B N     1 
ATOM   9097  C CA    . GLU B 1 533 ? -41.323 49.591  10.611  1.00 14.30  ? 533  GLU B CA    1 
ATOM   9098  C C     . GLU B 1 533 ? -41.487 49.535  9.087   1.00 14.59  ? 533  GLU B C     1 
ATOM   9099  O O     . GLU B 1 533 ? -41.434 48.449  8.511   1.00 14.32  ? 533  GLU B O     1 
ATOM   9100  C CB    . GLU B 1 533 ? -42.683 49.683  11.316  1.00 14.27  ? 533  GLU B CB    1 
ATOM   9101  C CG    . GLU B 1 533 ? -42.651 49.284  12.804  1.00 12.96  ? 533  GLU B CG    1 
ATOM   9102  C CD    . GLU B 1 533 ? -43.954 49.613  13.554  1.00 14.57  ? 533  GLU B CD    1 
ATOM   9103  O OE1   . GLU B 1 533 ? -44.958 49.980  12.888  1.00 14.68  ? 533  GLU B OE1   1 
ATOM   9104  O OE2   . GLU B 1 533 ? -43.988 49.480  14.810  1.00 13.32  ? 533  GLU B OE2   1 
ATOM   9105  N N     . SER B 1 534 ? -41.695 50.703  8.453   1.00 15.67  ? 534  SER B N     1 
ATOM   9106  C CA    . SER B 1 534 ? -41.751 50.859  6.981   1.00 16.07  ? 534  SER B CA    1 
ATOM   9107  C C     . SER B 1 534 ? -40.485 50.367  6.322   1.00 15.99  ? 534  SER B C     1 
ATOM   9108  O O     . SER B 1 534 ? -40.543 49.584  5.377   1.00 16.08  ? 534  SER B O     1 
ATOM   9109  C CB    . SER B 1 534 ? -41.910 52.337  6.574   1.00 16.42  ? 534  SER B CB    1 
ATOM   9110  O OG    . SER B 1 534 ? -43.223 52.802  6.794   1.00 19.83  ? 534  SER B OG    1 
ATOM   9111  N N     . ALA B 1 535 ? -39.341 50.865  6.805   1.00 16.11  ? 535  ALA B N     1 
ATOM   9112  C CA    . ALA B 1 535 ? -38.016 50.395  6.364   1.00 15.85  ? 535  ALA B CA    1 
ATOM   9113  C C     . ALA B 1 535 ? -37.941 48.866  6.409   1.00 15.74  ? 535  ALA B C     1 
ATOM   9114  O O     . ALA B 1 535 ? -37.557 48.224  5.417   1.00 16.03  ? 535  ALA B O     1 
ATOM   9115  C CB    . ALA B 1 535 ? -36.905 51.013  7.220   1.00 15.30  ? 535  ALA B CB    1 
ATOM   9116  N N     . LEU B 1 536 ? -38.327 48.296  7.553   1.00 15.08  ? 536  LEU B N     1 
ATOM   9117  C CA    . LEU B 1 536 ? -38.266 46.853  7.762   1.00 14.70  ? 536  LEU B CA    1 
ATOM   9118  C C     . LEU B 1 536 ? -39.163 46.101  6.791   1.00 14.96  ? 536  LEU B C     1 
ATOM   9119  O O     . LEU B 1 536 ? -38.711 45.169  6.118   1.00 14.37  ? 536  LEU B O     1 
ATOM   9120  C CB    . LEU B 1 536 ? -38.641 46.496  9.192   1.00 14.02  ? 536  LEU B CB    1 
ATOM   9121  C CG    . LEU B 1 536 ? -37.539 46.715  10.235  1.00 14.48  ? 536  LEU B CG    1 
ATOM   9122  C CD1   . LEU B 1 536 ? -38.113 46.719  11.664  1.00 11.13  ? 536  LEU B CD1   1 
ATOM   9123  C CD2   . LEU B 1 536 ? -36.444 45.661  10.080  1.00 12.55  ? 536  LEU B CD2   1 
ATOM   9124  N N     . VAL B 1 537 ? -40.425 46.530  6.706   1.00 15.02  ? 537  VAL B N     1 
ATOM   9125  C CA    . VAL B 1 537 ? -41.409 45.871  5.844   1.00 15.30  ? 537  VAL B CA    1 
ATOM   9126  C C     . VAL B 1 537 ? -41.061 45.981  4.341   1.00 15.28  ? 537  VAL B C     1 
ATOM   9127  O O     . VAL B 1 537 ? -41.478 45.128  3.534   1.00 15.46  ? 537  VAL B O     1 
ATOM   9128  C CB    . VAL B 1 537 ? -42.839 46.384  6.143   1.00 15.76  ? 537  VAL B CB    1 
ATOM   9129  C CG1   . VAL B 1 537 ? -43.822 45.937  5.070   1.00 16.62  ? 537  VAL B CG1   1 
ATOM   9130  C CG2   . VAL B 1 537 ? -43.286 45.892  7.526   1.00 15.72  ? 537  VAL B CG2   1 
ATOM   9131  N N     . ALA B 1 538 ? -40.275 46.999  3.979   1.00 14.55  ? 538  ALA B N     1 
ATOM   9132  C CA    . ALA B 1 538 ? -39.755 47.136  2.599   1.00 14.22  ? 538  ALA B CA    1 
ATOM   9133  C C     . ALA B 1 538 ? -38.760 46.048  2.180   1.00 13.95  ? 538  ALA B C     1 
ATOM   9134  O O     . ALA B 1 538 ? -38.544 45.839  0.986   1.00 14.13  ? 538  ALA B O     1 
ATOM   9135  C CB    . ALA B 1 538 ? -39.141 48.532  2.374   1.00 13.65  ? 538  ALA B CB    1 
ATOM   9136  N N     . HIS B 1 539 ? -38.136 45.378  3.145   1.00 13.49  ? 539  HIS B N     1 
ATOM   9137  C CA    . HIS B 1 539 ? -37.258 44.243  2.841   1.00 13.71  ? 539  HIS B CA    1 
ATOM   9138  C C     . HIS B 1 539 ? -38.065 43.097  2.218   1.00 13.13  ? 539  HIS B C     1 
ATOM   9139  O O     . HIS B 1 539 ? -39.116 42.752  2.730   1.00 12.95  ? 539  HIS B O     1 
ATOM   9140  C CB    . HIS B 1 539 ? -36.520 43.770  4.111   1.00 14.09  ? 539  HIS B CB    1 
ATOM   9141  C CG    . HIS B 1 539 ? -35.459 42.742  3.844   1.00 14.88  ? 539  HIS B CG    1 
ATOM   9142  N ND1   . HIS B 1 539 ? -35.734 41.394  3.748   1.00 16.79  ? 539  HIS B ND1   1 
ATOM   9143  C CD2   . HIS B 1 539 ? -34.127 42.868  3.640   1.00 14.90  ? 539  HIS B CD2   1 
ATOM   9144  C CE1   . HIS B 1 539 ? -34.619 40.737  3.484   1.00 16.99  ? 539  HIS B CE1   1 
ATOM   9145  N NE2   . HIS B 1 539 ? -33.629 41.608  3.415   1.00 16.38  ? 539  HIS B NE2   1 
ATOM   9146  N N     . PRO B 1 540 ? -37.578 42.513  1.108   1.00 13.29  ? 540  PRO B N     1 
ATOM   9147  C CA    . PRO B 1 540 ? -38.341 41.519  0.322   1.00 13.20  ? 540  PRO B CA    1 
ATOM   9148  C C     . PRO B 1 540 ? -38.784 40.264  1.092   1.00 13.03  ? 540  PRO B C     1 
ATOM   9149  O O     . PRO B 1 540 ? -39.681 39.576  0.627   1.00 13.33  ? 540  PRO B O     1 
ATOM   9150  C CB    . PRO B 1 540 ? -37.362 41.108  -0.798  1.00 13.39  ? 540  PRO B CB    1 
ATOM   9151  C CG    . PRO B 1 540 ? -36.352 42.233  -0.879  1.00 13.76  ? 540  PRO B CG    1 
ATOM   9152  C CD    . PRO B 1 540 ? -36.252 42.796  0.517   1.00 13.77  ? 540  PRO B CD    1 
ATOM   9153  N N     . LYS B 1 541 ? -38.164 39.970  2.236   1.00 12.42  ? 541  LYS B N     1 
ATOM   9154  C CA    . LYS B 1 541 ? -38.498 38.765  3.020   1.00 12.17  ? 541  LYS B CA    1 
ATOM   9155  C C     . LYS B 1 541 ? -39.297 39.051  4.286   1.00 11.86  ? 541  LYS B C     1 
ATOM   9156  O O     . LYS B 1 541 ? -39.640 38.133  5.035   1.00 11.68  ? 541  LYS B O     1 
ATOM   9157  C CB    . LYS B 1 541 ? -37.231 38.001  3.401   1.00 12.38  ? 541  LYS B CB    1 
ATOM   9158  C CG    . LYS B 1 541 ? -36.459 37.482  2.208   1.00 12.40  ? 541  LYS B CG    1 
ATOM   9159  C CD    . LYS B 1 541 ? -35.312 36.602  2.641   1.00 14.39  ? 541  LYS B CD    1 
ATOM   9160  C CE    . LYS B 1 541 ? -34.695 35.944  1.406   1.00 16.23  ? 541  LYS B CE    1 
ATOM   9161  N NZ    . LYS B 1 541 ? -33.285 35.645  1.686   1.00 18.09  ? 541  LYS B NZ    1 
ATOM   9162  N N     . ILE B 1 542 ? -39.581 40.326  4.527   1.00 11.70  ? 542  ILE B N     1 
ATOM   9163  C CA    . ILE B 1 542 ? -40.313 40.728  5.720   1.00 11.64  ? 542  ILE B CA    1 
ATOM   9164  C C     . ILE B 1 542 ? -41.765 40.976  5.366   1.00 11.39  ? 542  ILE B C     1 
ATOM   9165  O O     . ILE B 1 542 ? -42.052 41.670  4.389   1.00 11.25  ? 542  ILE B O     1 
ATOM   9166  C CB    . ILE B 1 542 ? -39.647 41.945  6.428   1.00 11.52  ? 542  ILE B CB    1 
ATOM   9167  C CG1   . ILE B 1 542 ? -38.252 41.529  6.943   1.00 11.94  ? 542  ILE B CG1   1 
ATOM   9168  C CG2   . ILE B 1 542 ? -40.534 42.461  7.576   1.00 12.05  ? 542  ILE B CG2   1 
ATOM   9169  C CD1   . ILE B 1 542 ? -37.431 42.623  7.627   1.00 11.11  ? 542  ILE B CD1   1 
ATOM   9170  N N     . ALA B 1 543 ? -42.671 40.377  6.147   1.00 11.57  ? 543  ALA B N     1 
ATOM   9171  C CA    . ALA B 1 543 ? -44.128 40.559  5.953   1.00 11.62  ? 543  ALA B CA    1 
ATOM   9172  C C     . ALA B 1 543 ? -44.721 41.624  6.875   1.00 11.98  ? 543  ALA B C     1 
ATOM   9173  O O     . ALA B 1 543 ? -45.646 42.339  6.481   1.00 12.11  ? 543  ALA B O     1 
ATOM   9174  C CB    . ALA B 1 543 ? -44.855 39.249  6.179   1.00 11.21  ? 543  ALA B CB    1 
ATOM   9175  N N     . GLU B 1 544 ? -44.239 41.665  8.122   1.00 11.78  ? 544  GLU B N     1 
ATOM   9176  C CA    . GLU B 1 544 ? -44.750 42.574  9.152   1.00 12.31  ? 544  GLU B CA    1 
ATOM   9177  C C     . GLU B 1 544 ? -43.649 42.810  10.175  1.00 11.90  ? 544  GLU B C     1 
ATOM   9178  O O     . GLU B 1 544 ? -42.812 41.944  10.393  1.00 11.33  ? 544  GLU B O     1 
ATOM   9179  C CB    . GLU B 1 544 ? -45.968 41.994  9.878   1.00 12.18  ? 544  GLU B CB    1 
ATOM   9180  C CG    . GLU B 1 544 ? -47.141 41.521  8.980   1.00 14.67  ? 544  GLU B CG    1 
ATOM   9181  C CD    . GLU B 1 544 ? -48.203 40.774  9.764   1.00 15.04  ? 544  GLU B CD    1 
ATOM   9182  O OE1   . GLU B 1 544 ? -48.928 41.431  10.537  1.00 18.52  ? 544  GLU B OE1   1 
ATOM   9183  O OE2   . GLU B 1 544 ? -48.313 39.531  9.611   1.00 18.22  ? 544  GLU B OE2   1 
ATOM   9184  N N     . ALA B 1 545 ? -43.657 43.984  10.799  1.00 11.13  ? 545  ALA B N     1 
ATOM   9185  C CA    . ALA B 1 545 ? -42.690 44.313  11.835  1.00 10.85  ? 545  ALA B CA    1 
ATOM   9186  C C     . ALA B 1 545 ? -43.334 45.263  12.808  1.00 10.71  ? 545  ALA B C     1 
ATOM   9187  O O     . ALA B 1 545 ? -44.210 46.021  12.435  1.00 10.67  ? 545  ALA B O     1 
ATOM   9188  C CB    . ALA B 1 545 ? -41.458 44.964  11.231  1.00 10.57  ? 545  ALA B CB    1 
ATOM   9189  N N     . ALA B 1 546 ? -42.895 45.223  14.058  1.00 10.99  ? 546  ALA B N     1 
ATOM   9190  C CA    . ALA B 1 546 ? -43.343 46.183  15.064  1.00 11.46  ? 546  ALA B CA    1 
ATOM   9191  C C     . ALA B 1 546 ? -42.124 46.590  15.893  1.00 12.00  ? 546  ALA B C     1 
ATOM   9192  O O     . ALA B 1 546 ? -41.333 45.734  16.315  1.00 12.11  ? 546  ALA B O     1 
ATOM   9193  C CB    . ALA B 1 546 ? -44.453 45.574  15.944  1.00 10.77  ? 546  ALA B CB    1 
ATOM   9194  N N     . VAL B 1 547 ? -41.963 47.901  16.100  1.00 12.85  ? 547  VAL B N     1 
ATOM   9195  C CA    . VAL B 1 547 ? -40.746 48.452  16.726  1.00 12.51  ? 547  VAL B CA    1 
ATOM   9196  C C     . VAL B 1 547 ? -41.073 49.150  18.049  1.00 13.10  ? 547  VAL B C     1 
ATOM   9197  O O     . VAL B 1 547 ? -42.022 49.943  18.119  1.00 13.28  ? 547  VAL B O     1 
ATOM   9198  C CB    . VAL B 1 547 ? -39.999 49.397  15.744  1.00 12.30  ? 547  VAL B CB    1 
ATOM   9199  C CG1   . VAL B 1 547 ? -38.950 50.234  16.456  1.00 10.97  ? 547  VAL B CG1   1 
ATOM   9200  C CG2   . VAL B 1 547 ? -39.357 48.559  14.606  1.00 12.36  ? 547  VAL B CG2   1 
ATOM   9201  N N     . VAL B 1 548 ? -40.315 48.817  19.097  1.00 12.78  ? 548  VAL B N     1 
ATOM   9202  C CA    . VAL B 1 548 ? -40.463 49.476  20.387  1.00 12.52  ? 548  VAL B CA    1 
ATOM   9203  C C     . VAL B 1 548 ? -39.095 49.916  20.895  1.00 12.65  ? 548  VAL B C     1 
ATOM   9204  O O     . VAL B 1 548 ? -38.069 49.384  20.452  1.00 12.23  ? 548  VAL B O     1 
ATOM   9205  C CB    . VAL B 1 548 ? -41.194 48.586  21.463  1.00 12.86  ? 548  VAL B CB    1 
ATOM   9206  C CG1   . VAL B 1 548 ? -42.628 48.210  21.005  1.00 11.33  ? 548  VAL B CG1   1 
ATOM   9207  C CG2   . VAL B 1 548 ? -40.359 47.349  21.846  1.00 11.50  ? 548  VAL B CG2   1 
ATOM   9208  N N     . GLY B 1 549 ? -39.089 50.902  21.792  1.00 12.44  ? 549  GLY B N     1 
ATOM   9209  C CA    . GLY B 1 549 ? -37.876 51.288  22.522  1.00 12.89  ? 549  GLY B CA    1 
ATOM   9210  C C     . GLY B 1 549 ? -37.757 50.460  23.795  1.00 13.51  ? 549  GLY B C     1 
ATOM   9211  O O     . GLY B 1 549 ? -38.770 50.101  24.397  1.00 12.95  ? 549  GLY B O     1 
ATOM   9212  N N     . ILE B 1 550 ? -36.525 50.118  24.184  1.00 14.24  ? 550  ILE B N     1 
ATOM   9213  C CA    . ILE B 1 550 ? -36.251 49.576  25.528  1.00 14.85  ? 550  ILE B CA    1 
ATOM   9214  C C     . ILE B 1 550 ? -35.177 50.440  26.242  1.00 14.72  ? 550  ILE B C     1 
ATOM   9215  O O     . ILE B 1 550 ? -34.391 51.113  25.581  1.00 14.22  ? 550  ILE B O     1 
ATOM   9216  C CB    . ILE B 1 550 ? -35.834 48.072  25.502  1.00 14.93  ? 550  ILE B CB    1 
ATOM   9217  C CG1   . ILE B 1 550 ? -34.555 47.861  24.682  1.00 15.96  ? 550  ILE B CG1   1 
ATOM   9218  C CG2   . ILE B 1 550 ? -36.943 47.207  24.918  1.00 14.75  ? 550  ILE B CG2   1 
ATOM   9219  C CD1   . ILE B 1 550 ? -33.853 46.534  24.988  1.00 16.18  ? 550  ILE B CD1   1 
ATOM   9220  N N     . PRO B 1 551 ? -35.171 50.460  27.594  1.00 14.63  ? 551  PRO B N     1 
ATOM   9221  C CA    . PRO B 1 551 ? -34.055 51.125  28.279  1.00 14.74  ? 551  PRO B CA    1 
ATOM   9222  C C     . PRO B 1 551 ? -32.704 50.562  27.864  1.00 15.15  ? 551  PRO B C     1 
ATOM   9223  O O     . PRO B 1 551 ? -32.584 49.370  27.588  1.00 15.40  ? 551  PRO B O     1 
ATOM   9224  C CB    . PRO B 1 551 ? -34.332 50.846  29.760  1.00 14.26  ? 551  PRO B CB    1 
ATOM   9225  C CG    . PRO B 1 551 ? -35.823 50.713  29.825  1.00 14.34  ? 551  PRO B CG    1 
ATOM   9226  C CD    . PRO B 1 551 ? -36.177 49.966  28.555  1.00 14.13  ? 551  PRO B CD    1 
ATOM   9227  N N     . HIS B 1 552 ? -31.712 51.442  27.780  1.00 15.41  ? 552  HIS B N     1 
ATOM   9228  C CA    . HIS B 1 552 ? -30.370 51.066  27.390  1.00 16.41  ? 552  HIS B CA    1 
ATOM   9229  C C     . HIS B 1 552 ? -29.474 52.080  28.078  1.00 17.03  ? 552  HIS B C     1 
ATOM   9230  O O     . HIS B 1 552 ? -29.654 53.277  27.889  1.00 16.79  ? 552  HIS B O     1 
ATOM   9231  C CB    . HIS B 1 552 ? -30.223 51.123  25.865  1.00 16.33  ? 552  HIS B CB    1 
ATOM   9232  C CG    . HIS B 1 552 ? -28.918 50.589  25.354  1.00 16.49  ? 552  HIS B CG    1 
ATOM   9233  N ND1   . HIS B 1 552 ? -28.784 49.316  24.833  1.00 16.92  ? 552  HIS B ND1   1 
ATOM   9234  C CD2   . HIS B 1 552 ? -27.689 51.156  25.281  1.00 16.16  ? 552  HIS B CD2   1 
ATOM   9235  C CE1   . HIS B 1 552 ? -27.528 49.122  24.463  1.00 16.12  ? 552  HIS B CE1   1 
ATOM   9236  N NE2   . HIS B 1 552 ? -26.843 50.224  24.722  1.00 16.06  ? 552  HIS B NE2   1 
ATOM   9237  N N     . ALA B 1 553 ? -28.546 51.599  28.908  1.00 17.62  ? 553  ALA B N     1 
ATOM   9238  C CA    . ALA B 1 553 ? -27.694 52.478  29.723  1.00 18.59  ? 553  ALA B CA    1 
ATOM   9239  C C     . ALA B 1 553 ? -26.809 53.412  28.891  1.00 19.06  ? 553  ALA B C     1 
ATOM   9240  O O     . ALA B 1 553 ? -26.485 54.517  29.331  1.00 19.03  ? 553  ALA B O     1 
ATOM   9241  C CB    . ALA B 1 553 ? -26.839 51.649  30.698  1.00 18.54  ? 553  ALA B CB    1 
ATOM   9242  N N     . ILE B 1 554 ? -26.418 52.967  27.696  1.00 19.84  ? 554  ILE B N     1 
ATOM   9243  C CA    . ILE B 1 554 ? -25.518 53.760  26.838  1.00 20.84  ? 554  ILE B CA    1 
ATOM   9244  C C     . ILE B 1 554 ? -26.321 54.743  25.957  1.00 20.64  ? 554  ILE B C     1 
ATOM   9245  O O     . ILE B 1 554 ? -26.134 55.958  26.045  1.00 20.97  ? 554  ILE B O     1 
ATOM   9246  C CB    . ILE B 1 554 ? -24.528 52.841  26.013  1.00 20.94  ? 554  ILE B CB    1 
ATOM   9247  C CG1   . ILE B 1 554 ? -23.503 52.171  26.946  1.00 22.24  ? 554  ILE B CG1   1 
ATOM   9248  C CG2   . ILE B 1 554 ? -23.780 53.631  24.939  1.00 21.31  ? 554  ILE B CG2   1 
ATOM   9249  C CD1   . ILE B 1 554 ? -22.847 50.850  26.397  1.00 21.49  ? 554  ILE B CD1   1 
ATOM   9250  N N     . LYS B 1 555 ? -27.245 54.224  25.150  1.00 20.19  ? 555  LYS B N     1 
ATOM   9251  C CA    . LYS B 1 555 ? -28.002 55.085  24.238  1.00 19.31  ? 555  LYS B CA    1 
ATOM   9252  C C     . LYS B 1 555 ? -29.328 55.650  24.753  1.00 18.18  ? 555  LYS B C     1 
ATOM   9253  O O     . LYS B 1 555 ? -30.025 56.352  24.014  1.00 18.21  ? 555  LYS B O     1 
ATOM   9254  C CB    . LYS B 1 555 ? -28.163 54.430  22.864  1.00 19.62  ? 555  LYS B CB    1 
ATOM   9255  C CG    . LYS B 1 555 ? -28.072 52.936  22.877  1.00 21.41  ? 555  LYS B CG    1 
ATOM   9256  C CD    . LYS B 1 555 ? -27.084 52.443  21.851  1.00 23.83  ? 555  LYS B CD    1 
ATOM   9257  C CE    . LYS B 1 555 ? -27.782 51.912  20.614  1.00 26.31  ? 555  LYS B CE    1 
ATOM   9258  N NZ    . LYS B 1 555 ? -26.804 51.115  19.797  1.00 26.97  ? 555  LYS B NZ    1 
ATOM   9259  N N     . GLY B 1 556 ? -29.662 55.369  26.011  1.00 16.87  ? 556  GLY B N     1 
ATOM   9260  C CA    . GLY B 1 556 ? -30.928 55.811  26.596  1.00 15.90  ? 556  GLY B CA    1 
ATOM   9261  C C     . GLY B 1 556 ? -32.054 54.869  26.228  1.00 15.62  ? 556  GLY B C     1 
ATOM   9262  O O     . GLY B 1 556 ? -32.710 54.286  27.107  1.00 15.52  ? 556  GLY B O     1 
ATOM   9263  N N     . GLN B 1 557 ? -32.295 54.721  24.927  1.00 14.70  ? 557  GLN B N     1 
ATOM   9264  C CA    . GLN B 1 557 ? -33.167 53.662  24.450  1.00 14.50  ? 557  GLN B CA    1 
ATOM   9265  C C     . GLN B 1 557 ? -32.484 52.912  23.336  1.00 14.50  ? 557  GLN B C     1 
ATOM   9266  O O     . GLN B 1 557 ? -31.737 53.489  22.546  1.00 13.89  ? 557  GLN B O     1 
ATOM   9267  C CB    . GLN B 1 557 ? -34.488 54.188  23.912  1.00 14.52  ? 557  GLN B CB    1 
ATOM   9268  C CG    . GLN B 1 557 ? -35.457 54.726  24.916  1.00 15.44  ? 557  GLN B CG    1 
ATOM   9269  C CD    . GLN B 1 557 ? -36.795 54.969  24.253  1.00 16.55  ? 557  GLN B CD    1 
ATOM   9270  O OE1   . GLN B 1 557 ? -36.903 55.798  23.354  1.00 14.05  ? 557  GLN B OE1   1 
ATOM   9271  N NE2   . GLN B 1 557 ? -37.814 54.213  24.670  1.00 14.60  ? 557  GLN B NE2   1 
ATOM   9272  N N     . ALA B 1 558 ? -32.757 51.619  23.277  1.00 14.44  ? 558  ALA B N     1 
ATOM   9273  C CA    . ALA B 1 558 ? -32.292 50.786  22.186  1.00 14.67  ? 558  ALA B CA    1 
ATOM   9274  C C     . ALA B 1 558 ? -33.536 50.442  21.360  1.00 14.95  ? 558  ALA B C     1 
ATOM   9275  O O     . ALA B 1 558 ? -34.660 50.513  21.880  1.00 15.54  ? 558  ALA B O     1 
ATOM   9276  C CB    . ALA B 1 558 ? -31.605 49.531  22.735  1.00 14.30  ? 558  ALA B CB    1 
ATOM   9277  N N     . ILE B 1 559 ? -33.336 50.132  20.078  1.00 14.71  ? 559  ILE B N     1 
ATOM   9278  C CA    . ILE B 1 559 ? -34.427 49.856  19.145  1.00 14.41  ? 559  ILE B CA    1 
ATOM   9279  C C     . ILE B 1 559 ? -34.675 48.349  19.151  1.00 14.58  ? 559  ILE B C     1 
ATOM   9280  O O     . ILE B 1 559 ? -33.774 47.568  18.839  1.00 14.69  ? 559  ILE B O     1 
ATOM   9281  C CB    . ILE B 1 559 ? -34.070 50.354  17.696  1.00 14.69  ? 559  ILE B CB    1 
ATOM   9282  C CG1   . ILE B 1 559 ? -33.832 51.867  17.684  1.00 13.88  ? 559  ILE B CG1   1 
ATOM   9283  C CG2   . ILE B 1 559 ? -35.124 49.909  16.654  1.00 12.80  ? 559  ILE B CG2   1 
ATOM   9284  C CD1   . ILE B 1 559 ? -33.345 52.439  16.348  1.00 14.93  ? 559  ILE B CD1   1 
ATOM   9285  N N     . TYR B 1 560 ? -35.890 47.943  19.514  1.00 14.37  ? 560  TYR B N     1 
ATOM   9286  C CA    . TYR B 1 560 ? -36.235 46.528  19.603  1.00 14.26  ? 560  TYR B CA    1 
ATOM   9287  C C     . TYR B 1 560 ? -37.310 46.184  18.568  1.00 14.41  ? 560  TYR B C     1 
ATOM   9288  O O     . TYR B 1 560 ? -38.443 46.653  18.663  1.00 14.55  ? 560  TYR B O     1 
ATOM   9289  C CB    . TYR B 1 560 ? -36.677 46.206  21.038  1.00 13.70  ? 560  TYR B CB    1 
ATOM   9290  C CG    . TYR B 1 560 ? -36.894 44.739  21.359  1.00 13.74  ? 560  TYR B CG    1 
ATOM   9291  C CD1   . TYR B 1 560 ? -37.898 44.004  20.724  1.00 12.75  ? 560  TYR B CD1   1 
ATOM   9292  C CD2   . TYR B 1 560 ? -36.136 44.101  22.357  1.00 14.18  ? 560  TYR B CD2   1 
ATOM   9293  C CE1   . TYR B 1 560 ? -38.120 42.648  21.050  1.00 13.08  ? 560  TYR B CE1   1 
ATOM   9294  C CE2   . TYR B 1 560 ? -36.344 42.755  22.683  1.00 13.37  ? 560  TYR B CE2   1 
ATOM   9295  C CZ    . TYR B 1 560 ? -37.340 42.039  22.026  1.00 13.01  ? 560  TYR B CZ    1 
ATOM   9296  O OH    . TYR B 1 560 ? -37.552 40.717  22.333  1.00 12.20  ? 560  TYR B OH    1 
ATOM   9297  N N     . ALA B 1 561 ? -36.948 45.373  17.571  1.00 14.51  ? 561  ALA B N     1 
ATOM   9298  C CA    . ALA B 1 561 ? -37.835 45.111  16.431  1.00 14.48  ? 561  ALA B CA    1 
ATOM   9299  C C     . ALA B 1 561 ? -38.377 43.676  16.411  1.00 14.67  ? 561  ALA B C     1 
ATOM   9300  O O     . ALA B 1 561 ? -37.608 42.711  16.389  1.00 14.55  ? 561  ALA B O     1 
ATOM   9301  C CB    . ALA B 1 561 ? -37.117 45.432  15.103  1.00 14.13  ? 561  ALA B CB    1 
ATOM   9302  N N     . TYR B 1 562 ? -39.705 43.553  16.442  1.00 14.64  ? 562  TYR B N     1 
ATOM   9303  C CA    . TYR B 1 562 ? -40.373 42.272  16.217  1.00 14.96  ? 562  TYR B CA    1 
ATOM   9304  C C     . TYR B 1 562 ? -40.608 42.160  14.717  1.00 15.50  ? 562  TYR B C     1 
ATOM   9305  O O     . TYR B 1 562 ? -41.163 43.082  14.094  1.00 16.14  ? 562  TYR B O     1 
ATOM   9306  C CB    . TYR B 1 562 ? -41.704 42.182  16.953  1.00 14.95  ? 562  TYR B CB    1 
ATOM   9307  C CG    . TYR B 1 562 ? -41.663 42.264  18.480  1.00 13.57  ? 562  TYR B CG    1 
ATOM   9308  C CD1   . TYR B 1 562 ? -41.627 43.497  19.130  1.00 13.11  ? 562  TYR B CD1   1 
ATOM   9309  C CD2   . TYR B 1 562 ? -41.746 41.109  19.269  1.00 13.94  ? 562  TYR B CD2   1 
ATOM   9310  C CE1   . TYR B 1 562 ? -41.637 43.585  20.515  1.00 13.17  ? 562  TYR B CE1   1 
ATOM   9311  C CE2   . TYR B 1 562 ? -41.744 41.182  20.674  1.00 12.89  ? 562  TYR B CE2   1 
ATOM   9312  C CZ    . TYR B 1 562 ? -41.687 42.417  21.282  1.00 13.87  ? 562  TYR B CZ    1 
ATOM   9313  O OH    . TYR B 1 562 ? -41.692 42.504  22.657  1.00 15.93  ? 562  TYR B OH    1 
ATOM   9314  N N     . VAL B 1 563 ? -40.143 41.059  14.132  1.00 15.34  ? 563  VAL B N     1 
ATOM   9315  C CA    . VAL B 1 563 ? -40.173 40.891  12.689  1.00 15.10  ? 563  VAL B CA    1 
ATOM   9316  C C     . VAL B 1 563 ? -40.834 39.569  12.361  1.00 15.14  ? 563  VAL B C     1 
ATOM   9317  O O     . VAL B 1 563 ? -40.442 38.522  12.891  1.00 15.17  ? 563  VAL B O     1 
ATOM   9318  C CB    . VAL B 1 563 ? -38.745 40.935  12.068  1.00 15.39  ? 563  VAL B CB    1 
ATOM   9319  C CG1   . VAL B 1 563 ? -38.806 40.735  10.566  1.00 14.92  ? 563  VAL B CG1   1 
ATOM   9320  C CG2   . VAL B 1 563 ? -38.019 42.262  12.412  1.00 14.75  ? 563  VAL B CG2   1 
ATOM   9321  N N     . THR B 1 564 ? -41.850 39.640  11.503  1.00 14.86  ? 564  THR B N     1 
ATOM   9322  C CA    . THR B 1 564 ? -42.516 38.461  10.929  1.00 14.78  ? 564  THR B CA    1 
ATOM   9323  C C     . THR B 1 564 ? -42.091 38.374  9.469   1.00 14.47  ? 564  THR B C     1 
ATOM   9324  O O     . THR B 1 564 ? -42.283 39.320  8.705   1.00 14.35  ? 564  THR B O     1 
ATOM   9325  C CB    . THR B 1 564 ? -44.060 38.568  11.061  1.00 14.10  ? 564  THR B CB    1 
ATOM   9326  O OG1   . THR B 1 564 ? -44.392 38.587  12.447  1.00 15.59  ? 564  THR B OG1   1 
ATOM   9327  C CG2   . THR B 1 564 ? -44.778 37.396  10.431  1.00 14.83  ? 564  THR B CG2   1 
ATOM   9328  N N     . LEU B 1 565 ? -41.488 37.237  9.115   1.00 14.37  ? 565  LEU B N     1 
ATOM   9329  C CA    . LEU B 1 565 ? -41.034 36.934  7.757   1.00 14.10  ? 565  LEU B CA    1 
ATOM   9330  C C     . LEU B 1 565 ? -42.171 36.422  6.896   1.00 14.00  ? 565  LEU B C     1 
ATOM   9331  O O     . LEU B 1 565 ? -43.168 35.906  7.415   1.00 13.90  ? 565  LEU B O     1 
ATOM   9332  C CB    . LEU B 1 565 ? -39.913 35.878  7.781   1.00 13.40  ? 565  LEU B CB    1 
ATOM   9333  C CG    . LEU B 1 565 ? -38.631 36.287  8.531   1.00 13.26  ? 565  LEU B CG    1 
ATOM   9334  C CD1   . LEU B 1 565 ? -37.629 35.156  8.522   1.00 11.15  ? 565  LEU B CD1   1 
ATOM   9335  C CD2   . LEU B 1 565 ? -38.005 37.571  7.961   1.00 12.54  ? 565  LEU B CD2   1 
ATOM   9336  N N     . ASN B 1 566 ? -42.017 36.580  5.585   1.00 13.68  ? 566  ASN B N     1 
ATOM   9337  C CA    . ASN B 1 566 ? -42.929 35.974  4.618   1.00 14.54  ? 566  ASN B CA    1 
ATOM   9338  C C     . ASN B 1 566 ? -42.907 34.465  4.730   1.00 13.99  ? 566  ASN B C     1 
ATOM   9339  O O     . ASN B 1 566 ? -41.886 33.881  5.111   1.00 13.65  ? 566  ASN B O     1 
ATOM   9340  C CB    . ASN B 1 566 ? -42.563 36.390  3.184   1.00 14.76  ? 566  ASN B CB    1 
ATOM   9341  C CG    . ASN B 1 566 ? -42.879 37.844  2.908   1.00 16.81  ? 566  ASN B CG    1 
ATOM   9342  O OD1   . ASN B 1 566 ? -43.932 38.335  3.302   1.00 19.55  ? 566  ASN B OD1   1 
ATOM   9343  N ND2   . ASN B 1 566 ? -41.963 38.544  2.245   1.00 16.80  ? 566  ASN B ND2   1 
ATOM   9344  N N     . HIS B 1 567 ? -44.037 33.840  4.413   1.00 13.90  ? 567  HIS B N     1 
ATOM   9345  C CA    . HIS B 1 567 ? -44.129 32.378  4.389   1.00 14.05  ? 567  HIS B CA    1 
ATOM   9346  C C     . HIS B 1 567 ? -43.086 31.789  3.442   1.00 14.35  ? 567  HIS B C     1 
ATOM   9347  O O     . HIS B 1 567 ? -42.936 32.250  2.305   1.00 13.87  ? 567  HIS B O     1 
ATOM   9348  C CB    . HIS B 1 567 ? -45.540 31.897  3.968   1.00 13.84  ? 567  HIS B CB    1 
ATOM   9349  C CG    . HIS B 1 567 ? -46.663 32.512  4.753   1.00 13.12  ? 567  HIS B CG    1 
ATOM   9350  N ND1   . HIS B 1 567 ? -47.961 32.527  4.296   1.00 11.90  ? 567  HIS B ND1   1 
ATOM   9351  C CD2   . HIS B 1 567 ? -46.679 33.151  5.948   1.00 11.45  ? 567  HIS B CD2   1 
ATOM   9352  C CE1   . HIS B 1 567 ? -48.734 33.132  5.181   1.00 11.71  ? 567  HIS B CE1   1 
ATOM   9353  N NE2   . HIS B 1 567 ? -47.979 33.522  6.193   1.00 12.42  ? 567  HIS B NE2   1 
ATOM   9354  N N     . GLY B 1 568 ? -42.375 30.771  3.932   1.00 15.05  ? 568  GLY B N     1 
ATOM   9355  C CA    . GLY B 1 568 ? -41.318 30.092  3.183   1.00 15.17  ? 568  GLY B CA    1 
ATOM   9356  C C     . GLY B 1 568 ? -39.957 30.680  3.471   1.00 16.18  ? 568  GLY B C     1 
ATOM   9357  O O     . GLY B 1 568 ? -38.936 30.208  2.934   1.00 15.66  ? 568  GLY B O     1 
ATOM   9358  N N     . GLU B 1 569 ? -39.935 31.730  4.296   1.00 16.37  ? 569  GLU B N     1 
ATOM   9359  C CA    . GLU B 1 569 ? -38.667 32.331  4.733   1.00 17.87  ? 569  GLU B CA    1 
ATOM   9360  C C     . GLU B 1 569 ? -38.335 31.890  6.154   1.00 18.61  ? 569  GLU B C     1 
ATOM   9361  O O     . GLU B 1 569 ? -39.234 31.756  6.994   1.00 19.13  ? 569  GLU B O     1 
ATOM   9362  C CB    . GLU B 1 569 ? -38.688 33.862  4.642   1.00 17.40  ? 569  GLU B CB    1 
ATOM   9363  C CG    . GLU B 1 569 ? -39.100 34.417  3.268   1.00 18.31  ? 569  GLU B CG    1 
ATOM   9364  C CD    . GLU B 1 569 ? -38.154 34.046  2.137   1.00 17.55  ? 569  GLU B CD    1 
ATOM   9365  O OE1   . GLU B 1 569 ? -37.001 33.653  2.401   1.00 19.56  ? 569  GLU B OE1   1 
ATOM   9366  O OE2   . GLU B 1 569 ? -38.566 34.143  0.968   1.00 17.75  ? 569  GLU B OE2   1 
ATOM   9367  N N     . GLU B 1 570 ? -37.051 31.654  6.405   1.00 19.31  ? 570  GLU B N     1 
ATOM   9368  C CA    . GLU B 1 570 ? -36.577 31.204  7.713   1.00 20.28  ? 570  GLU B CA    1 
ATOM   9369  C C     . GLU B 1 570 ? -35.530 32.175  8.255   1.00 19.71  ? 570  GLU B C     1 
ATOM   9370  O O     . GLU B 1 570 ? -34.777 32.763  7.474   1.00 19.83  ? 570  GLU B O     1 
ATOM   9371  C CB    . GLU B 1 570 ? -35.973 29.800  7.604   1.00 20.98  ? 570  GLU B CB    1 
ATOM   9372  C CG    . GLU B 1 570 ? -36.983 28.684  7.253   1.00 25.25  ? 570  GLU B CG    1 
ATOM   9373  C CD    . GLU B 1 570 ? -37.994 28.418  8.373   1.00 30.44  ? 570  GLU B CD    1 
ATOM   9374  O OE1   . GLU B 1 570 ? -39.122 27.963  8.059   1.00 31.60  ? 570  GLU B OE1   1 
ATOM   9375  O OE2   . GLU B 1 570 ? -37.662 28.671  9.563   1.00 32.34  ? 570  GLU B OE2   1 
ATOM   9376  N N     . PRO B 1 571 ? -35.466 32.347  9.590   1.00 19.41  ? 571  PRO B N     1 
ATOM   9377  C CA    . PRO B 1 571 ? -34.401 33.195  10.142  1.00 18.96  ? 571  PRO B CA    1 
ATOM   9378  C C     . PRO B 1 571 ? -33.018 32.524  10.074  1.00 18.80  ? 571  PRO B C     1 
ATOM   9379  O O     . PRO B 1 571 ? -32.930 31.304  9.972   1.00 18.60  ? 571  PRO B O     1 
ATOM   9380  C CB    . PRO B 1 571 ? -34.820 33.389  11.609  1.00 18.98  ? 571  PRO B CB    1 
ATOM   9381  C CG    . PRO B 1 571 ? -36.213 32.846  11.732  1.00 19.64  ? 571  PRO B CG    1 
ATOM   9382  C CD    . PRO B 1 571 ? -36.342 31.809  10.650  1.00 19.35  ? 571  PRO B CD    1 
ATOM   9383  N N     . SER B 1 572 ? -31.953 33.329  10.129  1.00 18.24  ? 572  SER B N     1 
ATOM   9384  C CA    . SER B 1 572 ? -30.580 32.844  10.194  1.00 17.51  ? 572  SER B CA    1 
ATOM   9385  C C     . SER B 1 572 ? -29.726 34.001  10.668  1.00 17.40  ? 572  SER B C     1 
ATOM   9386  O O     . SER B 1 572 ? -30.170 35.152  10.584  1.00 18.08  ? 572  SER B O     1 
ATOM   9387  C CB    . SER B 1 572 ? -30.093 32.389  8.810   1.00 17.69  ? 572  SER B CB    1 
ATOM   9388  O OG    . SER B 1 572 ? -30.058 33.473  7.895   1.00 18.22  ? 572  SER B OG    1 
ATOM   9389  N N     . PRO B 1 573 ? -28.502 33.723  11.168  1.00 16.72  ? 573  PRO B N     1 
ATOM   9390  C CA    . PRO B 1 573 ? -27.555 34.809  11.460  1.00 16.42  ? 573  PRO B CA    1 
ATOM   9391  C C     . PRO B 1 573 ? -27.287 35.725  10.268  1.00 16.03  ? 573  PRO B C     1 
ATOM   9392  O O     . PRO B 1 573 ? -27.166 36.939  10.438  1.00 16.09  ? 573  PRO B O     1 
ATOM   9393  C CB    . PRO B 1 573 ? -26.269 34.064  11.830  1.00 15.98  ? 573  PRO B CB    1 
ATOM   9394  C CG    . PRO B 1 573 ? -26.735 32.748  12.340  1.00 16.92  ? 573  PRO B CG    1 
ATOM   9395  C CD    . PRO B 1 573 ? -27.947 32.404  11.530  1.00 16.63  ? 573  PRO B CD    1 
ATOM   9396  N N     . GLU B 1 574 ? -27.171 35.148  9.075   1.00 15.81  ? 574  GLU B N     1 
ATOM   9397  C CA    . GLU B 1 574 ? -26.942 35.935  7.854   1.00 15.26  ? 574  GLU B CA    1 
ATOM   9398  C C     . GLU B 1 574 ? -28.096 36.902  7.615   1.00 14.75  ? 574  GLU B C     1 
ATOM   9399  O O     . GLU B 1 574 ? -27.866 38.080  7.324   1.00 15.29  ? 574  GLU B O     1 
ATOM   9400  C CB    . GLU B 1 574 ? -26.724 35.032  6.628   1.00 14.43  ? 574  GLU B CB    1 
ATOM   9401  C CG    . GLU B 1 574 ? -26.776 35.782  5.309   1.00 16.26  ? 574  GLU B CG    1 
ATOM   9402  C CD    . GLU B 1 574 ? -26.498 34.931  4.069   1.00 16.28  ? 574  GLU B CD    1 
ATOM   9403  O OE1   . GLU B 1 574 ? -26.410 35.529  2.957   1.00 17.61  ? 574  GLU B OE1   1 
ATOM   9404  O OE2   . GLU B 1 574 ? -26.351 33.700  4.200   1.00 16.23  ? 574  GLU B OE2   1 
ATOM   9405  N N     . LEU B 1 575 ? -29.329 36.404  7.739   1.00 14.25  ? 575  LEU B N     1 
ATOM   9406  C CA    . LEU B 1 575 ? -30.523 37.233  7.547   1.00 13.93  ? 575  LEU B CA    1 
ATOM   9407  C C     . LEU B 1 575 ? -30.626 38.296  8.642   1.00 13.63  ? 575  LEU B C     1 
ATOM   9408  O O     . LEU B 1 575 ? -30.993 39.435  8.377   1.00 14.00  ? 575  LEU B O     1 
ATOM   9409  C CB    . LEU B 1 575 ? -31.810 36.379  7.467   1.00 13.05  ? 575  LEU B CB    1 
ATOM   9410  C CG    . LEU B 1 575 ? -33.099 37.165  7.129   1.00 14.43  ? 575  LEU B CG    1 
ATOM   9411  C CD1   . LEU B 1 575 ? -33.028 37.899  5.774   1.00 10.48  ? 575  LEU B CD1   1 
ATOM   9412  C CD2   . LEU B 1 575 ? -34.350 36.281  7.184   1.00 14.54  ? 575  LEU B CD2   1 
ATOM   9413  N N     . TYR B 1 576 ? -30.280 37.922  9.868   1.00 13.79  ? 576  TYR B N     1 
ATOM   9414  C CA    . TYR B 1 576 ? -30.227 38.865  10.988  1.00 13.65  ? 576  TYR B CA    1 
ATOM   9415  C C     . TYR B 1 576 ? -29.439 40.140  10.639  1.00 13.48  ? 576  TYR B C     1 
ATOM   9416  O O     . TYR B 1 576 ? -29.918 41.260  10.852  1.00 13.82  ? 576  TYR B O     1 
ATOM   9417  C CB    . TYR B 1 576 ? -29.615 38.175  12.223  1.00 14.00  ? 576  TYR B CB    1 
ATOM   9418  C CG    . TYR B 1 576 ? -29.861 38.902  13.530  1.00 14.79  ? 576  TYR B CG    1 
ATOM   9419  C CD1   . TYR B 1 576 ? -30.972 38.590  14.312  1.00 14.91  ? 576  TYR B CD1   1 
ATOM   9420  C CD2   . TYR B 1 576 ? -28.982 39.895  13.988  1.00 15.35  ? 576  TYR B CD2   1 
ATOM   9421  C CE1   . TYR B 1 576 ? -31.216 39.240  15.508  1.00 17.06  ? 576  TYR B CE1   1 
ATOM   9422  C CE2   . TYR B 1 576 ? -29.215 40.571  15.206  1.00 16.67  ? 576  TYR B CE2   1 
ATOM   9423  C CZ    . TYR B 1 576 ? -30.345 40.231  15.956  1.00 17.36  ? 576  TYR B CZ    1 
ATOM   9424  O OH    . TYR B 1 576 ? -30.630 40.857  17.155  1.00 17.71  ? 576  TYR B OH    1 
ATOM   9425  N N     . ALA B 1 577 ? -28.219 39.956  10.135  1.00 12.87  ? 577  ALA B N     1 
ATOM   9426  C CA    . ALA B 1 577 ? -27.312 41.058  9.801   1.00 12.19  ? 577  ALA B CA    1 
ATOM   9427  C C     . ALA B 1 577 ? -27.785 41.813  8.566   1.00 12.26  ? 577  ALA B C     1 
ATOM   9428  O O     . ALA B 1 577 ? -27.604 43.030  8.474   1.00 11.34  ? 577  ALA B O     1 
ATOM   9429  C CB    . ALA B 1 577 ? -25.911 40.534  9.578   1.00 11.71  ? 577  ALA B CB    1 
ATOM   9430  N N     . GLU B 1 578 ? -28.386 41.069  7.627   1.00 12.12  ? 578  GLU B N     1 
ATOM   9431  C CA    . GLU B 1 578 ? -28.936 41.620  6.397   1.00 12.62  ? 578  GLU B CA    1 
ATOM   9432  C C     . GLU B 1 578 ? -30.037 42.632  6.666   1.00 12.51  ? 578  GLU B C     1 
ATOM   9433  O O     . GLU B 1 578 ? -30.102 43.698  6.028   1.00 12.80  ? 578  GLU B O     1 
ATOM   9434  C CB    . GLU B 1 578 ? -29.500 40.502  5.509   1.00 12.52  ? 578  GLU B CB    1 
ATOM   9435  C CG    . GLU B 1 578 ? -29.726 40.961  4.071   1.00 15.15  ? 578  GLU B CG    1 
ATOM   9436  C CD    . GLU B 1 578 ? -30.317 39.890  3.193   1.00 16.41  ? 578  GLU B CD    1 
ATOM   9437  O OE1   . GLU B 1 578 ? -29.712 38.806  3.099   1.00 17.98  ? 578  GLU B OE1   1 
ATOM   9438  O OE2   . GLU B 1 578 ? -31.392 40.130  2.606   1.00 15.75  ? 578  GLU B OE2   1 
ATOM   9439  N N     . VAL B 1 579 ? -30.914 42.267  7.595   1.00 12.26  ? 579  VAL B N     1 
ATOM   9440  C CA    . VAL B 1 579 ? -32.067 43.072  7.946   1.00 11.76  ? 579  VAL B CA    1 
ATOM   9441  C C     . VAL B 1 579 ? -31.639 44.313  8.710   1.00 11.97  ? 579  VAL B C     1 
ATOM   9442  O O     . VAL B 1 579 ? -32.183 45.389  8.482   1.00 12.67  ? 579  VAL B O     1 
ATOM   9443  C CB    . VAL B 1 579 ? -33.105 42.258  8.762   1.00 11.69  ? 579  VAL B CB    1 
ATOM   9444  C CG1   . VAL B 1 579 ? -34.135 43.195  9.423   1.00 10.74  ? 579  VAL B CG1   1 
ATOM   9445  C CG2   . VAL B 1 579 ? -33.793 41.238  7.869   1.00 9.22   ? 579  VAL B CG2   1 
ATOM   9446  N N     . ARG B 1 580 ? -30.659 44.168  9.599   1.00 12.16  ? 580  ARG B N     1 
ATOM   9447  C CA    . ARG B 1 580 ? -30.061 45.325  10.285  1.00 12.49  ? 580  ARG B CA    1 
ATOM   9448  C C     . ARG B 1 580 ? -29.379 46.277  9.303   1.00 12.17  ? 580  ARG B C     1 
ATOM   9449  O O     . ARG B 1 580 ? -29.595 47.483  9.364   1.00 11.90  ? 580  ARG B O     1 
ATOM   9450  C CB    . ARG B 1 580 ? -29.078 44.875  11.346  1.00 12.75  ? 580  ARG B CB    1 
ATOM   9451  C CG    . ARG B 1 580 ? -29.745 44.101  12.491  1.00 15.78  ? 580  ARG B CG    1 
ATOM   9452  C CD    . ARG B 1 580 ? -29.219 44.593  13.823  1.00 20.81  ? 580  ARG B CD    1 
ATOM   9453  N NE    . ARG B 1 580 ? -27.790 44.364  13.916  1.00 24.68  ? 580  ARG B NE    1 
ATOM   9454  C CZ    . ARG B 1 580 ? -26.919 45.136  14.554  1.00 25.25  ? 580  ARG B CZ    1 
ATOM   9455  N NH1   . ARG B 1 580 ? -27.303 46.230  15.193  1.00 24.85  ? 580  ARG B NH1   1 
ATOM   9456  N NH2   . ARG B 1 580 ? -25.640 44.792  14.537  1.00 26.43  ? 580  ARG B NH2   1 
ATOM   9457  N N     . ASN B 1 581 ? -28.580 45.723  8.383   1.00 12.05  ? 581  ASN B N     1 
ATOM   9458  C CA    . ASN B 1 581 ? -27.961 46.503  7.319   1.00 11.53  ? 581  ASN B CA    1 
ATOM   9459  C C     . ASN B 1 581 ? -29.018 47.153  6.420   1.00 11.58  ? 581  ASN B C     1 
ATOM   9460  O O     . ASN B 1 581 ? -28.804 48.231  5.892   1.00 11.62  ? 581  ASN B O     1 
ATOM   9461  C CB    . ASN B 1 581 ? -26.997 45.636  6.484   1.00 10.94  ? 581  ASN B CB    1 
ATOM   9462  C CG    . ASN B 1 581 ? -25.680 45.308  7.222   1.00 10.30  ? 581  ASN B CG    1 
ATOM   9463  O OD1   . ASN B 1 581 ? -25.212 46.076  8.052   1.00 7.82   ? 581  ASN B OD1   1 
ATOM   9464  N ND2   . ASN B 1 581 ? -25.077 44.160  6.891   1.00 6.90   ? 581  ASN B ND2   1 
ATOM   9465  N N     . TRP B 1 582 ? -30.164 46.494  6.252   1.00 12.26  ? 582  TRP B N     1 
ATOM   9466  C CA    . TRP B 1 582 ? -31.228 47.010  5.378   1.00 12.53  ? 582  TRP B CA    1 
ATOM   9467  C C     . TRP B 1 582 ? -31.799 48.318  5.931   1.00 12.40  ? 582  TRP B C     1 
ATOM   9468  O O     . TRP B 1 582 ? -32.070 49.244  5.193   1.00 13.11  ? 582  TRP B O     1 
ATOM   9469  C CB    . TRP B 1 582 ? -32.349 45.970  5.217   1.00 12.97  ? 582  TRP B CB    1 
ATOM   9470  C CG    . TRP B 1 582 ? -33.514 46.469  4.421   1.00 13.72  ? 582  TRP B CG    1 
ATOM   9471  C CD1   . TRP B 1 582 ? -34.656 47.059  4.907   1.00 14.36  ? 582  TRP B CD1   1 
ATOM   9472  C CD2   . TRP B 1 582 ? -33.665 46.414  2.994   1.00 14.33  ? 582  TRP B CD2   1 
ATOM   9473  N NE1   . TRP B 1 582 ? -35.500 47.375  3.866   1.00 14.93  ? 582  TRP B NE1   1 
ATOM   9474  C CE2   . TRP B 1 582 ? -34.919 46.984  2.684   1.00 14.37  ? 582  TRP B CE2   1 
ATOM   9475  C CE3   . TRP B 1 582 ? -32.865 45.920  1.948   1.00 13.72  ? 582  TRP B CE3   1 
ATOM   9476  C CZ2   . TRP B 1 582 ? -35.381 47.100  1.370   1.00 14.50  ? 582  TRP B CZ2   1 
ATOM   9477  C CZ3   . TRP B 1 582 ? -33.322 46.035  0.650   1.00 14.11  ? 582  TRP B CZ3   1 
ATOM   9478  C CH2   . TRP B 1 582 ? -34.575 46.616  0.369   1.00 13.85  ? 582  TRP B CH2   1 
ATOM   9479  N N     . VAL B 1 583 ? -31.992 48.377  7.239   1.00 12.58  ? 583  VAL B N     1 
ATOM   9480  C CA    . VAL B 1 583 ? -32.504 49.584  7.878   1.00 12.14  ? 583  VAL B CA    1 
ATOM   9481  C C     . VAL B 1 583 ? -31.455 50.701  7.837   1.00 12.36  ? 583  VAL B C     1 
ATOM   9482  O O     . VAL B 1 583 ? -31.791 51.846  7.552   1.00 12.56  ? 583  VAL B O     1 
ATOM   9483  C CB    . VAL B 1 583 ? -32.950 49.299  9.315   1.00 12.06  ? 583  VAL B CB    1 
ATOM   9484  C CG1   . VAL B 1 583 ? -33.477 50.587  9.995   1.00 10.81  ? 583  VAL B CG1   1 
ATOM   9485  C CG2   . VAL B 1 583 ? -34.008 48.173  9.308   1.00 11.19  ? 583  VAL B CG2   1 
ATOM   9486  N N     . ALA B 1 584 ? -30.189 50.359  8.075   1.00 11.95  ? 584  ALA B N     1 
ATOM   9487  C CA    . ALA B 1 584 ? -29.100 51.322  7.941   1.00 11.89  ? 584  ALA B CA    1 
ATOM   9488  C C     . ALA B 1 584 ? -29.096 51.933  6.548   1.00 12.50  ? 584  ALA B C     1 
ATOM   9489  O O     . ALA B 1 584 ? -28.748 53.087  6.387   1.00 12.99  ? 584  ALA B O     1 
ATOM   9490  C CB    . ALA B 1 584 ? -27.750 50.667  8.234   1.00 10.92  ? 584  ALA B CB    1 
ATOM   9491  N N     . LYS B 1 585 ? -29.462 51.143  5.542   1.00 13.16  ? 585  LYS B N     1 
ATOM   9492  C CA    . LYS B 1 585 ? -29.502 51.601  4.149   1.00 14.30  ? 585  LYS B CA    1 
ATOM   9493  C C     . LYS B 1 585 ? -30.744 52.444  3.881   1.00 13.97  ? 585  LYS B C     1 
ATOM   9494  O O     . LYS B 1 585 ? -30.689 53.421  3.145   1.00 14.79  ? 585  LYS B O     1 
ATOM   9495  C CB    . LYS B 1 585 ? -29.532 50.374  3.218   1.00 14.66  ? 585  LYS B CB    1 
ATOM   9496  C CG    . LYS B 1 585 ? -29.166 50.603  1.746   1.00 17.30  ? 585  LYS B CG    1 
ATOM   9497  C CD    . LYS B 1 585 ? -30.329 51.003  0.822   1.00 22.10  ? 585  LYS B CD    1 
ATOM   9498  C CE    . LYS B 1 585 ? -31.720 50.458  1.234   1.00 24.86  ? 585  LYS B CE    1 
ATOM   9499  N NZ    . LYS B 1 585 ? -31.971 49.028  0.918   1.00 26.12  ? 585  LYS B NZ    1 
ATOM   9500  N N     . GLU B 1 586 ? -31.874 52.019  4.435   1.00 14.01  ? 586  GLU B N     1 
ATOM   9501  C CA    . GLU B 1 586 ? -33.143 52.693  4.230   1.00 14.08  ? 586  GLU B CA    1 
ATOM   9502  C C     . GLU B 1 586 ? -33.166 54.057  4.911   1.00 13.62  ? 586  GLU B C     1 
ATOM   9503  O O     . GLU B 1 586 ? -33.657 55.025  4.346   1.00 13.40  ? 586  GLU B O     1 
ATOM   9504  C CB    . GLU B 1 586 ? -34.291 51.822  4.755   1.00 14.56  ? 586  GLU B CB    1 
ATOM   9505  C CG    . GLU B 1 586 ? -34.679 50.671  3.841   1.00 15.85  ? 586  GLU B CG    1 
ATOM   9506  C CD    . GLU B 1 586 ? -35.082 51.145  2.448   1.00 19.81  ? 586  GLU B CD    1 
ATOM   9507  O OE1   . GLU B 1 586 ? -36.194 51.713  2.313   1.00 20.94  ? 586  GLU B OE1   1 
ATOM   9508  O OE2   . GLU B 1 586 ? -34.276 50.964  1.503   1.00 19.42  ? 586  GLU B OE2   1 
ATOM   9509  N N     . ILE B 1 587 ? -32.622 54.130  6.124   1.00 13.41  ? 587  ILE B N     1 
ATOM   9510  C CA    . ILE B 1 587 ? -32.670 55.357  6.918   1.00 12.59  ? 587  ILE B CA    1 
ATOM   9511  C C     . ILE B 1 587 ? -31.251 55.867  7.191   1.00 13.09  ? 587  ILE B C     1 
ATOM   9512  O O     . ILE B 1 587 ? -30.891 56.962  6.780   1.00 13.29  ? 587  ILE B O     1 
ATOM   9513  C CB    . ILE B 1 587 ? -33.479 55.180  8.239   1.00 12.11  ? 587  ILE B CB    1 
ATOM   9514  C CG1   . ILE B 1 587 ? -34.921 54.752  7.943   1.00 12.79  ? 587  ILE B CG1   1 
ATOM   9515  C CG2   . ILE B 1 587 ? -33.497 56.507  9.084   1.00 10.94  ? 587  ILE B CG2   1 
ATOM   9516  C CD1   . ILE B 1 587 ? -35.753 54.359  9.170   1.00 11.74  ? 587  ILE B CD1   1 
ATOM   9517  N N     . GLY B 1 588 ? -30.454 55.059  7.882   1.00 13.40  ? 588  GLY B N     1 
ATOM   9518  C CA    . GLY B 1 588 ? -29.107 55.433  8.277   1.00 13.30  ? 588  GLY B CA    1 
ATOM   9519  C C     . GLY B 1 588 ? -28.708 54.550  9.439   1.00 14.05  ? 588  GLY B C     1 
ATOM   9520  O O     . GLY B 1 588 ? -29.581 53.991  10.106  1.00 13.60  ? 588  GLY B O     1 
ATOM   9521  N N     . PRO B 1 589 ? -27.386 54.410  9.691   1.00 14.72  ? 589  PRO B N     1 
ATOM   9522  C CA    . PRO B 1 589 ? -26.889 53.608  10.809  1.00 14.78  ? 589  PRO B CA    1 
ATOM   9523  C C     . PRO B 1 589 ? -27.553 53.972  12.137  1.00 14.96  ? 589  PRO B C     1 
ATOM   9524  O O     . PRO B 1 589 ? -27.775 53.089  12.953  1.00 15.45  ? 589  PRO B O     1 
ATOM   9525  C CB    . PRO B 1 589 ? -25.397 53.953  10.848  1.00 14.83  ? 589  PRO B CB    1 
ATOM   9526  C CG    . PRO B 1 589 ? -25.066 54.279  9.446   1.00 15.44  ? 589  PRO B CG    1 
ATOM   9527  C CD    . PRO B 1 589 ? -26.276 55.012  8.927   1.00 14.64  ? 589  PRO B CD    1 
ATOM   9528  N N     . LEU B 1 590 ? -27.865 55.253  12.343  1.00 16.08  ? 590  LEU B N     1 
ATOM   9529  C CA    . LEU B 1 590 ? -28.558 55.743  13.565  1.00 16.45  ? 590  LEU B CA    1 
ATOM   9530  C C     . LEU B 1 590 ? -29.857 55.011  13.922  1.00 16.58  ? 590  LEU B C     1 
ATOM   9531  O O     . LEU B 1 590 ? -30.236 54.964  15.087  1.00 17.12  ? 590  LEU B O     1 
ATOM   9532  C CB    . LEU B 1 590 ? -28.828 57.253  13.465  1.00 16.79  ? 590  LEU B CB    1 
ATOM   9533  C CG    . LEU B 1 590 ? -30.048 57.854  12.724  1.00 17.88  ? 590  LEU B CG    1 
ATOM   9534  C CD1   . LEU B 1 590 ? -30.224 59.332  13.096  1.00 18.01  ? 590  LEU B CD1   1 
ATOM   9535  C CD2   . LEU B 1 590 ? -30.014 57.690  11.189  1.00 14.79  ? 590  LEU B CD2   1 
ATOM   9536  N N     . ALA B 1 591 ? -30.528 54.445  12.918  1.00 16.66  ? 591  ALA B N     1 
ATOM   9537  C CA    . ALA B 1 591 ? -31.825 53.781  13.089  1.00 16.39  ? 591  ALA B CA    1 
ATOM   9538  C C     . ALA B 1 591 ? -31.733 52.255  13.093  1.00 16.55  ? 591  ALA B C     1 
ATOM   9539  O O     . ALA B 1 591 ? -32.753 51.569  13.145  1.00 16.94  ? 591  ALA B O     1 
ATOM   9540  C CB    . ALA B 1 591 ? -32.762 54.229  11.999  1.00 16.10  ? 591  ALA B CB    1 
ATOM   9541  N N     . THR B 1 592 ? -30.519 51.717  12.999  1.00 16.70  ? 592  THR B N     1 
ATOM   9542  C CA    . THR B 1 592 ? -30.318 50.265  13.013  1.00 16.40  ? 592  THR B CA    1 
ATOM   9543  C C     . THR B 1 592 ? -30.868 49.645  14.303  1.00 16.19  ? 592  THR B C     1 
ATOM   9544  O O     . THR B 1 592 ? -30.508 50.080  15.390  1.00 16.48  ? 592  THR B O     1 
ATOM   9545  C CB    . THR B 1 592 ? -28.812 49.907  12.891  1.00 16.58  ? 592  THR B CB    1 
ATOM   9546  O OG1   . THR B 1 592 ? -28.244 50.586  11.763  1.00 17.43  ? 592  THR B OG1   1 
ATOM   9547  C CG2   . THR B 1 592 ? -28.623 48.413  12.713  1.00 15.37  ? 592  THR B CG2   1 
ATOM   9548  N N     . PRO B 1 593 ? -31.746 48.631  14.183  1.00 16.38  ? 593  PRO B N     1 
ATOM   9549  C CA    . PRO B 1 593 ? -32.275 47.972  15.379  1.00 16.28  ? 593  PRO B CA    1 
ATOM   9550  C C     . PRO B 1 593 ? -31.190 47.268  16.164  1.00 16.66  ? 593  PRO B C     1 
ATOM   9551  O O     . PRO B 1 593 ? -30.286 46.670  15.584  1.00 16.96  ? 593  PRO B O     1 
ATOM   9552  C CB    . PRO B 1 593 ? -33.261 46.948  14.823  1.00 15.93  ? 593  PRO B CB    1 
ATOM   9553  C CG    . PRO B 1 593 ? -33.574 47.413  13.429  1.00 16.71  ? 593  PRO B CG    1 
ATOM   9554  C CD    . PRO B 1 593 ? -32.315 48.060  12.942  1.00 16.36  ? 593  PRO B CD    1 
ATOM   9555  N N     . ASP B 1 594 ? -31.273 47.366  17.481  1.00 16.81  ? 594  ASP B N     1 
ATOM   9556  C CA    . ASP B 1 594 ? -30.308 46.743  18.360  1.00 17.17  ? 594  ASP B CA    1 
ATOM   9557  C C     . ASP B 1 594 ? -30.639 45.280  18.583  1.00 16.89  ? 594  ASP B C     1 
ATOM   9558  O O     . ASP B 1 594 ? -29.747 44.473  18.887  1.00 17.13  ? 594  ASP B O     1 
ATOM   9559  C CB    . ASP B 1 594 ? -30.278 47.499  19.682  1.00 17.46  ? 594  ASP B CB    1 
ATOM   9560  C CG    . ASP B 1 594 ? -29.754 48.904  19.510  1.00 19.61  ? 594  ASP B CG    1 
ATOM   9561  O OD1   . ASP B 1 594 ? -28.510 49.030  19.423  1.00 20.37  ? 594  ASP B OD1   1 
ATOM   9562  O OD2   . ASP B 1 594 ? -30.577 49.865  19.419  1.00 21.10  ? 594  ASP B OD2   1 
ATOM   9563  N N     . VAL B 1 595 ? -31.920 44.949  18.423  1.00 16.11  ? 595  VAL B N     1 
ATOM   9564  C CA    . VAL B 1 595 ? -32.427 43.594  18.643  1.00 15.92  ? 595  VAL B CA    1 
ATOM   9565  C C     . VAL B 1 595 ? -33.403 43.284  17.526  1.00 15.39  ? 595  VAL B C     1 
ATOM   9566  O O     . VAL B 1 595 ? -34.212 44.130  17.153  1.00 15.51  ? 595  VAL B O     1 
ATOM   9567  C CB    . VAL B 1 595 ? -33.161 43.465  20.009  1.00 15.78  ? 595  VAL B CB    1 
ATOM   9568  C CG1   . VAL B 1 595 ? -33.758 42.064  20.214  1.00 17.24  ? 595  VAL B CG1   1 
ATOM   9569  C CG2   . VAL B 1 595 ? -32.223 43.793  21.154  1.00 16.61  ? 595  VAL B CG2   1 
ATOM   9570  N N     . LEU B 1 596 ? -33.301 42.093  16.953  1.00 14.44  ? 596  LEU B N     1 
ATOM   9571  C CA    . LEU B 1 596 ? -34.389 41.612  16.117  1.00 13.75  ? 596  LEU B CA    1 
ATOM   9572  C C     . LEU B 1 596 ? -35.016 40.400  16.786  1.00 13.79  ? 596  LEU B C     1 
ATOM   9573  O O     . LEU B 1 596 ? -34.321 39.461  17.182  1.00 14.71  ? 596  LEU B O     1 
ATOM   9574  C CB    . LEU B 1 596 ? -33.918 41.304  14.701  1.00 13.05  ? 596  LEU B CB    1 
ATOM   9575  C CG    . LEU B 1 596 ? -33.221 42.420  13.895  1.00 11.92  ? 596  LEU B CG    1 
ATOM   9576  C CD1   . LEU B 1 596 ? -32.690 41.795  12.617  1.00 10.74  ? 596  LEU B CD1   1 
ATOM   9577  C CD2   . LEU B 1 596 ? -34.132 43.612  13.558  1.00 6.90   ? 596  LEU B CD2   1 
ATOM   9578  N N     . HIS B 1 597 ? -36.335 40.434  16.932  1.00 13.27  ? 597  HIS B N     1 
ATOM   9579  C CA    . HIS B 1 597 ? -37.084 39.366  17.593  1.00 12.78  ? 597  HIS B CA    1 
ATOM   9580  C C     . HIS B 1 597 ? -37.980 38.736  16.515  1.00 12.62  ? 597  HIS B C     1 
ATOM   9581  O O     . HIS B 1 597 ? -39.028 39.313  16.178  1.00 12.18  ? 597  HIS B O     1 
ATOM   9582  C CB    . HIS B 1 597 ? -37.910 40.003  18.717  1.00 12.60  ? 597  HIS B CB    1 
ATOM   9583  C CG    . HIS B 1 597 ? -38.801 39.061  19.472  1.00 13.24  ? 597  HIS B CG    1 
ATOM   9584  N ND1   . HIS B 1 597 ? -38.846 39.036  20.855  1.00 13.22  ? 597  HIS B ND1   1 
ATOM   9585  C CD2   . HIS B 1 597 ? -39.698 38.140  19.052  1.00 13.52  ? 597  HIS B CD2   1 
ATOM   9586  C CE1   . HIS B 1 597 ? -39.732 38.137  21.246  1.00 13.80  ? 597  HIS B CE1   1 
ATOM   9587  N NE2   . HIS B 1 597 ? -40.259 37.576  20.172  1.00 11.86  ? 597  HIS B NE2   1 
ATOM   9588  N N     . TRP B 1 598 ? -37.542 37.608  15.947  1.00 12.02  ? 598  TRP B N     1 
ATOM   9589  C CA    . TRP B 1 598 ? -38.323 36.875  14.949  1.00 12.66  ? 598  TRP B CA    1 
ATOM   9590  C C     . TRP B 1 598 ? -39.534 36.275  15.621  1.00 13.09  ? 598  TRP B C     1 
ATOM   9591  O O     . TRP B 1 598 ? -39.416 35.612  16.658  1.00 13.80  ? 598  TRP B O     1 
ATOM   9592  C CB    . TRP B 1 598 ? -37.546 35.698  14.345  1.00 12.79  ? 598  TRP B CB    1 
ATOM   9593  C CG    . TRP B 1 598 ? -36.153 35.975  13.936  1.00 13.11  ? 598  TRP B CG    1 
ATOM   9594  C CD1   . TRP B 1 598 ? -35.018 35.442  14.483  1.00 13.48  ? 598  TRP B CD1   1 
ATOM   9595  C CD2   . TRP B 1 598 ? -35.727 36.824  12.864  1.00 12.78  ? 598  TRP B CD2   1 
ATOM   9596  N NE1   . TRP B 1 598 ? -33.907 35.915  13.813  1.00 14.56  ? 598  TRP B NE1   1 
ATOM   9597  C CE2   . TRP B 1 598 ? -34.314 36.762  12.816  1.00 12.39  ? 598  TRP B CE2   1 
ATOM   9598  C CE3   . TRP B 1 598 ? -36.404 37.621  11.926  1.00 14.61  ? 598  TRP B CE3   1 
ATOM   9599  C CZ2   . TRP B 1 598 ? -33.558 37.491  11.882  1.00 12.61  ? 598  TRP B CZ2   1 
ATOM   9600  C CZ3   . TRP B 1 598 ? -35.646 38.348  10.992  1.00 13.71  ? 598  TRP B CZ3   1 
ATOM   9601  C CH2   . TRP B 1 598 ? -34.238 38.269  10.983  1.00 12.35  ? 598  TRP B CH2   1 
ATOM   9602  N N     . THR B 1 599 ? -40.699 36.504  15.040  1.00 13.26  ? 599  THR B N     1 
ATOM   9603  C CA    . THR B 1 599 ? -41.936 35.957  15.598  1.00 13.43  ? 599  THR B CA    1 
ATOM   9604  C C     . THR B 1 599 ? -42.976 35.772  14.501  1.00 13.85  ? 599  THR B C     1 
ATOM   9605  O O     . THR B 1 599 ? -42.908 36.433  13.460  1.00 13.69  ? 599  THR B O     1 
ATOM   9606  C CB    . THR B 1 599 ? -42.495 36.860  16.730  1.00 12.75  ? 599  THR B CB    1 
ATOM   9607  O OG1   . THR B 1 599 ? -43.474 36.125  17.473  1.00 13.69  ? 599  THR B OG1   1 
ATOM   9608  C CG2   . THR B 1 599 ? -43.118 38.147  16.179  1.00 12.55  ? 599  THR B CG2   1 
ATOM   9609  N N     . ASP B 1 600 ? -43.917 34.864  14.728  1.00 14.95  ? 600  ASP B N     1 
ATOM   9610  C CA    . ASP B 1 600 ? -45.099 34.755  13.888  1.00 16.66  ? 600  ASP B CA    1 
ATOM   9611  C C     . ASP B 1 600 ? -46.309 35.106  14.731  1.00 16.92  ? 600  ASP B C     1 
ATOM   9612  O O     . ASP B 1 600 ? -47.433 34.771  14.387  1.00 17.51  ? 600  ASP B O     1 
ATOM   9613  C CB    . ASP B 1 600 ? -45.224 33.341  13.331  1.00 17.25  ? 600  ASP B CB    1 
ATOM   9614  C CG    . ASP B 1 600 ? -44.179 33.042  12.270  1.00 20.80  ? 600  ASP B CG    1 
ATOM   9615  O OD1   . ASP B 1 600 ? -43.978 33.891  11.357  1.00 23.58  ? 600  ASP B OD1   1 
ATOM   9616  O OD2   . ASP B 1 600 ? -43.553 31.956  12.348  1.00 24.35  ? 600  ASP B OD2   1 
ATOM   9617  N N     . SER B 1 601 ? -46.064 35.819  15.826  1.00 17.22  ? 601  SER B N     1 
ATOM   9618  C CA    . SER B 1 601 ? -47.048 35.966  16.887  1.00 17.78  ? 601  SER B CA    1 
ATOM   9619  C C     . SER B 1 601 ? -47.315 37.414  17.299  1.00 17.57  ? 601  SER B C     1 
ATOM   9620  O O     . SER B 1 601 ? -47.503 37.696  18.482  1.00 17.71  ? 601  SER B O     1 
ATOM   9621  C CB    . SER B 1 601 ? -46.611 35.139  18.104  1.00 17.63  ? 601  SER B CB    1 
ATOM   9622  O OG    . SER B 1 601 ? -46.642 33.761  17.789  1.00 17.30  ? 601  SER B OG    1 
ATOM   9623  N N     . LEU B 1 602 ? -47.352 38.319  16.325  1.00 17.64  ? 602  LEU B N     1 
ATOM   9624  C CA    . LEU B 1 602 ? -47.686 39.712  16.604  1.00 18.18  ? 602  LEU B CA    1 
ATOM   9625  C C     . LEU B 1 602 ? -49.086 39.789  17.193  1.00 18.53  ? 602  LEU B C     1 
ATOM   9626  O O     . LEU B 1 602 ? -50.029 39.201  16.627  1.00 18.74  ? 602  LEU B O     1 
ATOM   9627  C CB    . LEU B 1 602 ? -47.594 40.586  15.345  1.00 17.83  ? 602  LEU B CB    1 
ATOM   9628  C CG    . LEU B 1 602 ? -46.207 40.900  14.754  1.00 18.40  ? 602  LEU B CG    1 
ATOM   9629  C CD1   . LEU B 1 602 ? -46.369 41.750  13.495  1.00 19.00  ? 602  LEU B CD1   1 
ATOM   9630  C CD2   . LEU B 1 602 ? -45.301 41.605  15.746  1.00 17.33  ? 602  LEU B CD2   1 
ATOM   9631  N N     . PRO B 1 603 ? -49.231 40.506  18.325  1.00 18.60  ? 603  PRO B N     1 
ATOM   9632  C CA    . PRO B 1 603 ? -50.525 40.684  18.973  1.00 18.57  ? 603  PRO B CA    1 
ATOM   9633  C C     . PRO B 1 603 ? -51.364 41.716  18.212  1.00 18.97  ? 603  PRO B C     1 
ATOM   9634  O O     . PRO B 1 603 ? -50.965 42.865  18.059  1.00 18.79  ? 603  PRO B O     1 
ATOM   9635  C CB    . PRO B 1 603 ? -50.155 41.187  20.367  1.00 18.59  ? 603  PRO B CB    1 
ATOM   9636  C CG    . PRO B 1 603 ? -48.861 41.873  20.207  1.00 18.72  ? 603  PRO B CG    1 
ATOM   9637  C CD    . PRO B 1 603 ? -48.156 41.230  19.028  1.00 18.94  ? 603  PRO B CD    1 
ATOM   9638  N N     . LYS B 1 604 ? -52.510 41.293  17.706  1.00 19.34  ? 604  LYS B N     1 
ATOM   9639  C CA    . LYS B 1 604 ? -53.321 42.168  16.878  1.00 19.98  ? 604  LYS B CA    1 
ATOM   9640  C C     . LYS B 1 604 ? -54.766 42.194  17.360  1.00 19.91  ? 604  LYS B C     1 
ATOM   9641  O O     . LYS B 1 604 ? -55.279 41.204  17.884  1.00 19.80  ? 604  LYS B O     1 
ATOM   9642  C CB    . LYS B 1 604 ? -53.189 41.796  15.384  1.00 20.52  ? 604  LYS B CB    1 
ATOM   9643  C CG    . LYS B 1 604 ? -51.720 41.845  14.890  1.00 23.19  ? 604  LYS B CG    1 
ATOM   9644  C CD    . LYS B 1 604 ? -51.563 42.208  13.416  1.00 26.31  ? 604  LYS B CD    1 
ATOM   9645  C CE    . LYS B 1 604 ? -51.269 40.980  12.580  1.00 29.40  ? 604  LYS B CE    1 
ATOM   9646  N NZ    . LYS B 1 604 ? -51.472 41.231  11.119  1.00 30.48  ? 604  LYS B NZ    1 
ATOM   9647  N N     . THR B 1 605 ? -55.391 43.361  17.230  1.00 19.76  ? 605  THR B N     1 
ATOM   9648  C CA    . THR B 1 605 ? -56.809 43.508  17.464  1.00 19.75  ? 605  THR B CA    1 
ATOM   9649  C C     . THR B 1 605 ? -57.529 42.724  16.376  1.00 20.09  ? 605  THR B C     1 
ATOM   9650  O O     . THR B 1 605 ? -56.896 42.212  15.435  1.00 19.85  ? 605  THR B O     1 
ATOM   9651  C CB    . THR B 1 605 ? -57.260 44.967  17.394  1.00 19.59  ? 605  THR B CB    1 
ATOM   9652  O OG1   . THR B 1 605 ? -57.034 45.468  16.072  1.00 20.32  ? 605  THR B OG1   1 
ATOM   9653  C CG2   . THR B 1 605 ? -56.531 45.838  18.431  1.00 18.88  ? 605  THR B CG2   1 
ATOM   9654  N N     . ARG B 1 606 ? -58.848 42.629  16.510  1.00 20.16  ? 606  ARG B N     1 
ATOM   9655  C CA    . ARG B 1 606 ? -59.652 41.852  15.581  1.00 20.42  ? 606  ARG B CA    1 
ATOM   9656  C C     . ARG B 1 606 ? -59.814 42.546  14.225  1.00 21.13  ? 606  ARG B C     1 
ATOM   9657  O O     . ARG B 1 606 ? -60.161 41.901  13.230  1.00 21.17  ? 606  ARG B O     1 
ATOM   9658  C CB    . ARG B 1 606 ? -60.995 41.495  16.214  1.00 20.18  ? 606  ARG B CB    1 
ATOM   9659  C CG    . ARG B 1 606 ? -60.859 40.432  17.282  1.00 18.57  ? 606  ARG B CG    1 
ATOM   9660  C CD    . ARG B 1 606 ? -62.183 40.084  17.926  1.00 16.17  ? 606  ARG B CD    1 
ATOM   9661  N NE    . ARG B 1 606 ? -61.982 39.005  18.885  1.00 15.71  ? 606  ARG B NE    1 
ATOM   9662  C CZ    . ARG B 1 606 ? -61.745 39.183  20.181  1.00 14.91  ? 606  ARG B CZ    1 
ATOM   9663  N NH1   . ARG B 1 606 ? -61.711 40.410  20.707  1.00 15.18  ? 606  ARG B NH1   1 
ATOM   9664  N NH2   . ARG B 1 606 ? -61.562 38.128  20.956  1.00 12.36  ? 606  ARG B NH2   1 
ATOM   9665  N N     . SER B 1 607 ? -59.542 43.850  14.198  1.00 21.77  ? 607  SER B N     1 
ATOM   9666  C CA    . SER B 1 607 ? -59.447 44.614  12.957  1.00 22.68  ? 607  SER B CA    1 
ATOM   9667  C C     . SER B 1 607 ? -58.015 44.622  12.373  1.00 23.46  ? 607  SER B C     1 
ATOM   9668  O O     . SER B 1 607 ? -57.764 45.282  11.365  1.00 23.60  ? 607  SER B O     1 
ATOM   9669  C CB    . SER B 1 607 ? -59.951 46.049  13.165  1.00 22.68  ? 607  SER B CB    1 
ATOM   9670  N N     . GLY B 1 608 ? -57.086 43.894  12.994  1.00 23.55  ? 608  GLY B N     1 
ATOM   9671  C CA    . GLY B 1 608 ? -55.727 43.788  12.474  1.00 24.32  ? 608  GLY B CA    1 
ATOM   9672  C C     . GLY B 1 608 ? -54.732 44.876  12.882  1.00 25.02  ? 608  GLY B C     1 
ATOM   9673  O O     . GLY B 1 608 ? -53.638 44.962  12.317  1.00 25.27  ? 608  GLY B O     1 
ATOM   9674  N N     . LYS B 1 609 ? -55.090 45.710  13.855  1.00 25.44  ? 609  LYS B N     1 
ATOM   9675  C CA    . LYS B 1 609 ? -54.150 46.695  14.380  1.00 25.87  ? 609  LYS B CA    1 
ATOM   9676  C C     . LYS B 1 609 ? -53.218 46.026  15.385  1.00 26.27  ? 609  LYS B C     1 
ATOM   9677  O O     . LYS B 1 609 ? -53.662 45.256  16.233  1.00 25.56  ? 609  LYS B O     1 
ATOM   9678  C CB    . LYS B 1 609 ? -54.895 47.865  15.034  1.00 26.11  ? 609  LYS B CB    1 
ATOM   9679  N N     . ILE B 1 610 ? -51.921 46.311  15.302  1.00 27.08  ? 610  ILE B N     1 
ATOM   9680  C CA    . ILE B 1 610 ? -51.007 45.691  16.254  1.00 27.72  ? 610  ILE B CA    1 
ATOM   9681  C C     . ILE B 1 610 ? -50.987 46.422  17.609  1.00 28.26  ? 610  ILE B C     1 
ATOM   9682  O O     . ILE B 1 610 ? -51.037 47.660  17.661  1.00 27.77  ? 610  ILE B O     1 
ATOM   9683  C CB    . ILE B 1 610 ? -49.613 45.290  15.615  1.00 28.28  ? 610  ILE B CB    1 
ATOM   9684  C CG1   . ILE B 1 610 ? -48.534 45.032  16.677  1.00 28.75  ? 610  ILE B CG1   1 
ATOM   9685  C CG2   . ILE B 1 610 ? -49.151 46.262  14.541  1.00 28.92  ? 610  ILE B CG2   1 
ATOM   9686  C CD1   . ILE B 1 610 ? -48.061 46.263  17.369  1.00 29.39  ? 610  ILE B CD1   1 
ATOM   9687  N N     . MET B 1 611 ? -50.975 45.646  18.697  1.00 28.61  ? 611  MET B N     1 
ATOM   9688  C CA    . MET B 1 611 ? -51.066 46.189  20.053  1.00 29.51  ? 611  MET B CA    1 
ATOM   9689  C C     . MET B 1 611 ? -49.670 46.401  20.656  1.00 28.81  ? 611  MET B C     1 
ATOM   9690  O O     . MET B 1 611 ? -49.015 45.473  21.129  1.00 28.52  ? 611  MET B O     1 
ATOM   9691  C CB    . MET B 1 611 ? -51.945 45.295  20.947  1.00 29.56  ? 611  MET B CB    1 
ATOM   9692  C CG    . MET B 1 611 ? -53.128 44.647  20.228  1.00 30.66  ? 611  MET B CG    1 
ATOM   9693  S SD    . MET B 1 611 ? -54.554 44.085  21.229  1.00 32.74  ? 611  MET B SD    1 
ATOM   9694  C CE    . MET B 1 611 ? -53.918 44.080  22.921  1.00 33.61  ? 611  MET B CE    1 
ATOM   9695  N N     . ARG B 1 612 ? -49.234 47.651  20.641  1.00 28.69  ? 612  ARG B N     1 
ATOM   9696  C CA    . ARG B 1 612 ? -47.855 47.995  20.928  1.00 28.92  ? 612  ARG B CA    1 
ATOM   9697  C C     . ARG B 1 612 ? -47.511 48.013  22.409  1.00 27.78  ? 612  ARG B C     1 
ATOM   9698  O O     . ARG B 1 612 ? -46.364 47.766  22.770  1.00 27.44  ? 612  ARG B O     1 
ATOM   9699  C CB    . ARG B 1 612 ? -47.512 49.335  20.272  1.00 29.20  ? 612  ARG B CB    1 
ATOM   9700  C CG    . ARG B 1 612 ? -47.341 49.230  18.761  1.00 30.18  ? 612  ARG B CG    1 
ATOM   9701  C CD    . ARG B 1 612 ? -47.325 50.586  18.053  1.00 31.75  ? 612  ARG B CD    1 
ATOM   9702  N NE    . ARG B 1 612 ? -46.960 50.439  16.636  1.00 37.35  ? 612  ARG B NE    1 
ATOM   9703  C CZ    . ARG B 1 612 ? -47.823 50.149  15.659  1.00 39.78  ? 612  ARG B CZ    1 
ATOM   9704  N NH1   . ARG B 1 612 ? -49.121 49.968  15.921  1.00 40.52  ? 612  ARG B NH1   1 
ATOM   9705  N NH2   . ARG B 1 612 ? -47.389 50.036  14.408  1.00 40.81  ? 612  ARG B NH2   1 
ATOM   9706  N N     . ARG B 1 613 ? -48.504 48.293  23.254  1.00 26.95  ? 613  ARG B N     1 
ATOM   9707  C CA    . ARG B 1 613 ? -48.319 48.379  24.709  1.00 26.26  ? 613  ARG B CA    1 
ATOM   9708  C C     . ARG B 1 613 ? -47.751 47.087  25.307  1.00 25.58  ? 613  ARG B C     1 
ATOM   9709  O O     . ARG B 1 613 ? -46.804 47.113  26.094  1.00 25.03  ? 613  ARG B O     1 
ATOM   9710  C CB    . ARG B 1 613 ? -49.643 48.745  25.397  1.00 26.38  ? 613  ARG B CB    1 
ATOM   9711  N N     . ILE B 1 614 ? -48.344 45.961  24.920  1.00 24.90  ? 614  ILE B N     1 
ATOM   9712  C CA    . ILE B 1 614 ? -47.872 44.657  25.355  1.00 24.32  ? 614  ILE B CA    1 
ATOM   9713  C C     . ILE B 1 614 ? -46.474 44.342  24.809  1.00 23.38  ? 614  ILE B C     1 
ATOM   9714  O O     . ILE B 1 614 ? -45.629 43.819  25.537  1.00 22.95  ? 614  ILE B O     1 
ATOM   9715  C CB    . ILE B 1 614 ? -48.913 43.539  25.056  1.00 24.68  ? 614  ILE B CB    1 
ATOM   9716  C CG1   . ILE B 1 614 ? -48.477 42.192  25.643  1.00 25.67  ? 614  ILE B CG1   1 
ATOM   9717  C CG2   . ILE B 1 614 ? -49.181 43.411  23.585  1.00 25.41  ? 614  ILE B CG2   1 
ATOM   9718  C CD1   . ILE B 1 614 ? -48.215 42.227  27.125  1.00 27.98  ? 614  ILE B CD1   1 
ATOM   9719  N N     . LEU B 1 615 ? -46.222 44.700  23.551  1.00 22.51  ? 615  LEU B N     1 
ATOM   9720  C CA    . LEU B 1 615 ? -44.890 44.522  22.945  1.00 21.91  ? 615  LEU B CA    1 
ATOM   9721  C C     . LEU B 1 615 ? -43.829 45.334  23.696  1.00 21.91  ? 615  LEU B C     1 
ATOM   9722  O O     . LEU B 1 615 ? -42.733 44.829  23.964  1.00 21.48  ? 615  LEU B O     1 
ATOM   9723  C CB    . LEU B 1 615 ? -44.905 44.884  21.458  1.00 20.99  ? 615  LEU B CB    1 
ATOM   9724  C CG    . LEU B 1 615 ? -45.757 43.981  20.550  1.00 20.48  ? 615  LEU B CG    1 
ATOM   9725  C CD1   . LEU B 1 615 ? -45.687 44.459  19.125  1.00 18.74  ? 615  LEU B CD1   1 
ATOM   9726  C CD2   . LEU B 1 615 ? -45.330 42.524  20.638  1.00 17.88  ? 615  LEU B CD2   1 
ATOM   9727  N N     . ARG B 1 616 ? -44.182 46.580  24.033  1.00 21.96  ? 616  ARG B N     1 
ATOM   9728  C CA    . ARG B 1 616 ? -43.370 47.450  24.895  1.00 22.39  ? 616  ARG B CA    1 
ATOM   9729  C C     . ARG B 1 616 ? -43.015 46.763  26.206  1.00 21.58  ? 616  ARG B C     1 
ATOM   9730  O O     . ARG B 1 616 ? -41.844 46.698  26.581  1.00 21.37  ? 616  ARG B O     1 
ATOM   9731  C CB    . ARG B 1 616 ? -44.076 48.792  25.160  1.00 21.98  ? 616  ARG B CB    1 
ATOM   9732  C CG    . ARG B 1 616 ? -43.719 49.885  24.152  1.00 23.70  ? 616  ARG B CG    1 
ATOM   9733  C CD    . ARG B 1 616 ? -44.287 51.257  24.496  1.00 24.58  ? 616  ARG B CD    1 
ATOM   9734  N NE    . ARG B 1 616 ? -45.403 51.617  23.612  1.00 29.76  ? 616  ARG B NE    1 
ATOM   9735  C CZ    . ARG B 1 616 ? -46.653 51.862  24.014  1.00 32.43  ? 616  ARG B CZ    1 
ATOM   9736  N NH1   . ARG B 1 616 ? -46.979 51.818  25.311  1.00 32.06  ? 616  ARG B NH1   1 
ATOM   9737  N NH2   . ARG B 1 616 ? -47.586 52.177  23.110  1.00 33.81  ? 616  ARG B NH2   1 
ATOM   9738  N N     . LYS B 1 617 ? -44.033 46.227  26.873  1.00 21.38  ? 617  LYS B N     1 
ATOM   9739  C CA    . LYS B 1 617 ? -43.874 45.572  28.169  1.00 21.17  ? 617  LYS B CA    1 
ATOM   9740  C C     . LYS B 1 617 ? -43.031 44.315  28.097  1.00 20.63  ? 617  LYS B C     1 
ATOM   9741  O O     . LYS B 1 617 ? -42.144 44.117  28.924  1.00 20.05  ? 617  LYS B O     1 
ATOM   9742  C CB    . LYS B 1 617 ? -45.236 45.263  28.780  1.00 21.43  ? 617  LYS B CB    1 
ATOM   9743  C CG    . LYS B 1 617 ? -45.966 46.487  29.308  1.00 23.12  ? 617  LYS B CG    1 
ATOM   9744  C CD    . LYS B 1 617 ? -47.417 46.160  29.635  1.00 25.63  ? 617  LYS B CD    1 
ATOM   9745  C CE    . LYS B 1 617 ? -48.094 47.326  30.343  1.00 27.22  ? 617  LYS B CE    1 
ATOM   9746  N NZ    . LYS B 1 617 ? -49.581 47.180  30.306  1.00 29.12  ? 617  LYS B NZ    1 
ATOM   9747  N N     . ILE B 1 618 ? -43.293 43.473  27.100  1.00 20.47  ? 618  ILE B N     1 
ATOM   9748  C CA    . ILE B 1 618 ? -42.568 42.209  26.973  1.00 20.41  ? 618  ILE B CA    1 
ATOM   9749  C C     . ILE B 1 618 ? -41.100 42.447  26.673  1.00 21.20  ? 618  ILE B C     1 
ATOM   9750  O O     . ILE B 1 618 ? -40.231 41.840  27.310  1.00 21.45  ? 618  ILE B O     1 
ATOM   9751  C CB    . ILE B 1 618 ? -43.197 41.274  25.916  1.00 20.33  ? 618  ILE B CB    1 
ATOM   9752  C CG1   . ILE B 1 618 ? -44.560 40.748  26.423  1.00 20.06  ? 618  ILE B CG1   1 
ATOM   9753  C CG2   . ILE B 1 618 ? -42.240 40.124  25.601  1.00 19.42  ? 618  ILE B CG2   1 
ATOM   9754  C CD1   . ILE B 1 618 ? -45.413 40.081  25.377  1.00 19.12  ? 618  ILE B CD1   1 
ATOM   9755  N N     . ALA B 1 619 ? -40.824 43.335  25.715  1.00 21.43  ? 619  ALA B N     1 
ATOM   9756  C CA    . ALA B 1 619 ? -39.451 43.670  25.347  1.00 22.32  ? 619  ALA B CA    1 
ATOM   9757  C C     . ALA B 1 619 ? -38.668 44.308  26.495  1.00 23.10  ? 619  ALA B C     1 
ATOM   9758  O O     . ALA B 1 619 ? -37.447 44.289  26.477  1.00 23.11  ? 619  ALA B O     1 
ATOM   9759  C CB    . ALA B 1 619 ? -39.435 44.582  24.126  1.00 22.40  ? 619  ALA B CB    1 
ATOM   9760  N N     . ALA B 1 620 ? -39.377 44.864  27.480  1.00 24.02  ? 620  ALA B N     1 
ATOM   9761  C CA    . ALA B 1 620 ? -38.760 45.461  28.675  1.00 25.48  ? 620  ALA B CA    1 
ATOM   9762  C C     . ALA B 1 620 ? -38.311 44.424  29.720  1.00 26.58  ? 620  ALA B C     1 
ATOM   9763  O O     . ALA B 1 620 ? -37.317 44.638  30.429  1.00 26.99  ? 620  ALA B O     1 
ATOM   9764  C CB    . ALA B 1 620 ? -39.689 46.501  29.309  1.00 25.26  ? 620  ALA B CB    1 
ATOM   9765  N N     . GLY B 1 621 ? -39.028 43.308  29.817  1.00 27.39  ? 621  GLY B N     1 
ATOM   9766  C CA    . GLY B 1 621 ? -38.567 42.193  30.642  1.00 28.81  ? 621  GLY B CA    1 
ATOM   9767  C C     . GLY B 1 621 ? -39.573 41.620  31.621  1.00 29.84  ? 621  GLY B C     1 
ATOM   9768  O O     . GLY B 1 621 ? -39.283 40.625  32.306  1.00 30.29  ? 621  GLY B O     1 
ATOM   9769  N N     . ASP B 1 622 ? -40.756 42.228  31.691  1.00 30.52  ? 622  ASP B N     1 
ATOM   9770  C CA    . ASP B 1 622 ? -41.841 41.692  32.530  1.00 31.47  ? 622  ASP B CA    1 
ATOM   9771  C C     . ASP B 1 622 ? -42.769 40.690  31.822  1.00 31.42  ? 622  ASP B C     1 
ATOM   9772  O O     . ASP B 1 622 ? -42.968 40.752  30.609  1.00 31.17  ? 622  ASP B O     1 
ATOM   9773  C CB    . ASP B 1 622 ? -42.650 42.833  33.139  1.00 31.78  ? 622  ASP B CB    1 
ATOM   9774  C CG    . ASP B 1 622 ? -42.932 43.912  32.153  1.00 32.14  ? 622  ASP B CG    1 
ATOM   9775  O OD1   . ASP B 1 622 ? -42.273 44.972  32.205  1.00 31.98  ? 622  ASP B OD1   1 
ATOM   9776  O OD2   . ASP B 1 622 ? -43.804 43.679  31.305  1.00 34.38  ? 622  ASP B OD2   1 
ATOM   9777  N N     . THR B 1 631 ? -59.781 41.934  23.638  1.00 26.30  ? 631  THR B N     1 
ATOM   9778  C CA    . THR B 1 631 ? -59.310 42.802  22.547  1.00 26.01  ? 631  THR B CA    1 
ATOM   9779  C C     . THR B 1 631 ? -58.349 42.059  21.614  1.00 25.92  ? 631  THR B C     1 
ATOM   9780  O O     . THR B 1 631 ? -58.346 42.290  20.399  1.00 25.28  ? 631  THR B O     1 
ATOM   9781  C CB    . THR B 1 631 ? -58.639 44.103  23.069  1.00 26.22  ? 631  THR B CB    1 
ATOM   9782  N N     . LEU B 1 632 ? -57.549 41.162  22.196  1.00 25.87  ? 632  LEU B N     1 
ATOM   9783  C CA    . LEU B 1 632 ? -56.605 40.337  21.449  1.00 25.77  ? 632  LEU B CA    1 
ATOM   9784  C C     . LEU B 1 632 ? -57.304 39.304  20.578  1.00 25.62  ? 632  LEU B C     1 
ATOM   9785  O O     . LEU B 1 632 ? -58.065 38.488  21.072  1.00 25.79  ? 632  LEU B O     1 
ATOM   9786  C CB    . LEU B 1 632 ? -55.620 39.645  22.404  1.00 25.86  ? 632  LEU B CB    1 
ATOM   9787  C CG    . LEU B 1 632 ? -54.210 40.225  22.512  1.00 25.92  ? 632  LEU B CG    1 
ATOM   9788  C CD1   . LEU B 1 632 ? -53.417 39.572  23.632  1.00 25.87  ? 632  LEU B CD1   1 
ATOM   9789  C CD2   . LEU B 1 632 ? -53.471 40.063  21.195  1.00 26.00  ? 632  LEU B CD2   1 
ATOM   9790  N N     . ALA B 1 633 ? -57.043 39.351  19.276  1.00 25.69  ? 633  ALA B N     1 
ATOM   9791  C CA    . ALA B 1 633 ? -57.589 38.370  18.336  1.00 25.93  ? 633  ALA B CA    1 
ATOM   9792  C C     . ALA B 1 633 ? -57.208 36.932  18.714  1.00 26.10  ? 633  ALA B C     1 
ATOM   9793  O O     . ALA B 1 633 ? -58.044 36.023  18.624  1.00 25.89  ? 633  ALA B O     1 
ATOM   9794  C CB    . ALA B 1 633 ? -57.136 38.685  16.905  1.00 25.76  ? 633  ALA B CB    1 
ATOM   9795  N N     . ASP B 1 634 ? -55.944 36.746  19.115  1.00 26.03  ? 634  ASP B N     1 
ATOM   9796  C CA    . ASP B 1 634 ? -55.405 35.448  19.530  1.00 26.18  ? 634  ASP B CA    1 
ATOM   9797  C C     . ASP B 1 634 ? -54.573 35.634  20.801  1.00 26.10  ? 634  ASP B C     1 
ATOM   9798  O O     . ASP B 1 634 ? -53.410 36.029  20.736  1.00 25.74  ? 634  ASP B O     1 
ATOM   9799  C CB    . ASP B 1 634 ? -54.584 34.814  18.392  1.00 26.46  ? 634  ASP B CB    1 
ATOM   9800  C CG    . ASP B 1 634 ? -53.860 33.523  18.806  1.00 27.47  ? 634  ASP B CG    1 
ATOM   9801  O OD1   . ASP B 1 634 ? -54.018 33.052  19.965  1.00 28.41  ? 634  ASP B OD1   1 
ATOM   9802  O OD2   . ASP B 1 634 ? -53.118 32.979  17.953  1.00 28.25  ? 634  ASP B OD2   1 
ATOM   9803  N N     . PRO B 1 635 ? -55.176 35.346  21.972  1.00 26.23  ? 635  PRO B N     1 
ATOM   9804  C CA    . PRO B 1 635 ? -54.545 35.616  23.275  1.00 26.04  ? 635  PRO B CA    1 
ATOM   9805  C C     . PRO B 1 635 ? -53.359 34.690  23.595  1.00 25.84  ? 635  PRO B C     1 
ATOM   9806  O O     . PRO B 1 635 ? -52.570 34.979  24.513  1.00 25.59  ? 635  PRO B O     1 
ATOM   9807  C CB    . PRO B 1 635 ? -55.694 35.406  24.279  1.00 26.21  ? 635  PRO B CB    1 
ATOM   9808  C CG    . PRO B 1 635 ? -56.964 35.301  23.437  1.00 26.22  ? 635  PRO B CG    1 
ATOM   9809  C CD    . PRO B 1 635 ? -56.511 34.738  22.132  1.00 26.22  ? 635  PRO B CD    1 
ATOM   9810  N N     . GLY B 1 636 ? -53.232 33.607  22.827  1.00 25.30  ? 636  GLY B N     1 
ATOM   9811  C CA    . GLY B 1 636 ? -52.108 32.690  22.955  1.00 24.95  ? 636  GLY B CA    1 
ATOM   9812  C C     . GLY B 1 636 ? -50.780 33.232  22.438  1.00 24.66  ? 636  GLY B C     1 
ATOM   9813  O O     . GLY B 1 636 ? -49.744 32.593  22.613  1.00 24.65  ? 636  GLY B O     1 
ATOM   9814  N N     . VAL B 1 637 ? -50.798 34.397  21.793  1.00 24.38  ? 637  VAL B N     1 
ATOM   9815  C CA    . VAL B 1 637 ? -49.553 35.016  21.324  1.00 24.13  ? 637  VAL B CA    1 
ATOM   9816  C C     . VAL B 1 637 ? -48.668 35.434  22.492  1.00 24.41  ? 637  VAL B C     1 
ATOM   9817  O O     . VAL B 1 637 ? -47.445 35.367  22.392  1.00 24.40  ? 637  VAL B O     1 
ATOM   9818  C CB    . VAL B 1 637 ? -49.767 36.217  20.343  1.00 23.85  ? 637  VAL B CB    1 
ATOM   9819  C CG1   . VAL B 1 637 ? -50.395 35.741  19.044  1.00 23.48  ? 637  VAL B CG1   1 
ATOM   9820  C CG2   . VAL B 1 637 ? -50.584 37.356  20.979  1.00 23.45  ? 637  VAL B CG2   1 
ATOM   9821  N N     . VAL B 1 638 ? -49.289 35.829  23.601  1.00 24.73  ? 638  VAL B N     1 
ATOM   9822  C CA    . VAL B 1 638 ? -48.549 36.394  24.728  1.00 25.41  ? 638  VAL B CA    1 
ATOM   9823  C C     . VAL B 1 638 ? -47.520 35.393  25.268  1.00 26.21  ? 638  VAL B C     1 
ATOM   9824  O O     . VAL B 1 638 ? -46.360 35.760  25.503  1.00 26.24  ? 638  VAL B O     1 
ATOM   9825  C CB    . VAL B 1 638 ? -49.482 36.915  25.852  1.00 25.36  ? 638  VAL B CB    1 
ATOM   9826  C CG1   . VAL B 1 638 ? -48.673 37.586  26.965  1.00 25.31  ? 638  VAL B CG1   1 
ATOM   9827  C CG2   . VAL B 1 638 ? -50.510 37.895  25.292  1.00 24.55  ? 638  VAL B CG2   1 
ATOM   9828  N N     . GLU B 1 639 ? -47.939 34.134  25.416  1.00 26.53  ? 639  GLU B N     1 
ATOM   9829  C CA    . GLU B 1 639 ? -47.065 33.076  25.922  1.00 27.50  ? 639  GLU B CA    1 
ATOM   9830  C C     . GLU B 1 639 ? -45.870 32.836  25.002  1.00 26.62  ? 639  GLU B C     1 
ATOM   9831  O O     . GLU B 1 639 ? -44.737 32.752  25.473  1.00 26.74  ? 639  GLU B O     1 
ATOM   9832  C CB    . GLU B 1 639 ? -47.844 31.769  26.173  1.00 27.49  ? 639  GLU B CB    1 
ATOM   9833  C CG    . GLU B 1 639 ? -47.122 30.813  27.127  1.00 29.14  ? 639  GLU B CG    1 
ATOM   9834  C CD    . GLU B 1 639 ? -47.755 29.410  27.212  1.00 29.73  ? 639  GLU B CD    1 
ATOM   9835  O OE1   . GLU B 1 639 ? -48.912 29.272  27.693  1.00 30.49  ? 639  GLU B OE1   1 
ATOM   9836  O OE2   . GLU B 1 639 ? -47.063 28.438  26.823  1.00 32.38  ? 639  GLU B OE2   1 
ATOM   9837  N N     . LYS B 1 640 ? -46.128 32.736  23.699  1.00 26.37  ? 640  LYS B N     1 
ATOM   9838  C CA    . LYS B 1 640 ? -45.067 32.630  22.694  1.00 26.35  ? 640  LYS B CA    1 
ATOM   9839  C C     . LYS B 1 640 ? -44.119 33.827  22.735  1.00 26.10  ? 640  LYS B C     1 
ATOM   9840  O O     . LYS B 1 640 ? -42.903 33.662  22.795  1.00 26.15  ? 640  LYS B O     1 
ATOM   9841  C CB    . LYS B 1 640 ? -45.651 32.478  21.290  1.00 26.59  ? 640  LYS B CB    1 
ATOM   9842  C CG    . LYS B 1 640 ? -46.517 31.240  21.121  1.00 27.88  ? 640  LYS B CG    1 
ATOM   9843  C CD    . LYS B 1 640 ? -46.298 30.570  19.765  1.00 30.39  ? 640  LYS B CD    1 
ATOM   9844  C CE    . LYS B 1 640 ? -46.528 29.057  19.857  1.00 31.84  ? 640  LYS B CE    1 
ATOM   9845  N NZ    . LYS B 1 640 ? -47.836 28.699  20.494  1.00 31.62  ? 640  LYS B NZ    1 
ATOM   9846  N N     . LEU B 1 641 ? -44.677 35.033  22.722  1.00 25.57  ? 641  LEU B N     1 
ATOM   9847  C CA    . LEU B 1 641 ? -43.862 36.245  22.818  1.00 25.23  ? 641  LEU B CA    1 
ATOM   9848  C C     . LEU B 1 641 ? -42.918 36.208  24.027  1.00 25.12  ? 641  LEU B C     1 
ATOM   9849  O O     . LEU B 1 641 ? -41.752 36.542  23.911  1.00 24.84  ? 641  LEU B O     1 
ATOM   9850  C CB    . LEU B 1 641 ? -44.743 37.502  22.841  1.00 24.75  ? 641  LEU B CB    1 
ATOM   9851  C CG    . LEU B 1 641 ? -45.481 37.855  21.543  1.00 23.94  ? 641  LEU B CG    1 
ATOM   9852  C CD1   . LEU B 1 641 ? -46.403 39.046  21.759  1.00 22.23  ? 641  LEU B CD1   1 
ATOM   9853  C CD2   . LEU B 1 641 ? -44.512 38.109  20.411  1.00 22.77  ? 641  LEU B CD2   1 
ATOM   9854  N N     . LEU B 1 642 ? -43.429 35.779  25.173  1.00 25.43  ? 642  LEU B N     1 
ATOM   9855  C CA    . LEU B 1 642 ? -42.621 35.642  26.380  1.00 26.05  ? 642  LEU B CA    1 
ATOM   9856  C C     . LEU B 1 642 ? -41.498 34.610  26.257  1.00 26.36  ? 642  LEU B C     1 
ATOM   9857  O O     . LEU B 1 642 ? -40.360 34.881  26.652  1.00 26.34  ? 642  LEU B O     1 
ATOM   9858  C CB    . LEU B 1 642 ? -43.505 35.297  27.573  1.00 25.95  ? 642  LEU B CB    1 
ATOM   9859  C CG    . LEU B 1 642 ? -44.425 36.395  28.097  1.00 26.12  ? 642  LEU B CG    1 
ATOM   9860  C CD1   . LEU B 1 642 ? -45.386 35.776  29.120  1.00 26.83  ? 642  LEU B CD1   1 
ATOM   9861  C CD2   . LEU B 1 642 ? -43.630 37.557  28.700  1.00 25.75  ? 642  LEU B CD2   1 
ATOM   9862  N N     . GLU B 1 643 ? -41.818 33.434  25.719  1.00 26.96  ? 643  GLU B N     1 
ATOM   9863  C CA    . GLU B 1 643 ? -40.818 32.385  25.509  1.00 27.96  ? 643  GLU B CA    1 
ATOM   9864  C C     . GLU B 1 643 ? -39.704 32.833  24.574  1.00 28.01  ? 643  GLU B C     1 
ATOM   9865  O O     . GLU B 1 643 ? -38.516 32.657  24.882  1.00 27.94  ? 643  GLU B O     1 
ATOM   9866  C CB    . GLU B 1 643 ? -41.463 31.120  24.959  1.00 28.47  ? 643  GLU B CB    1 
ATOM   9867  C CG    . GLU B 1 643 ? -42.329 30.409  25.974  1.00 30.99  ? 643  GLU B CG    1 
ATOM   9868  C CD    . GLU B 1 643 ? -42.915 29.134  25.428  1.00 34.28  ? 643  GLU B CD    1 
ATOM   9869  O OE1   . GLU B 1 643 ? -42.487 28.050  25.902  1.00 35.83  ? 643  GLU B OE1   1 
ATOM   9870  O OE2   . GLU B 1 643 ? -43.787 29.220  24.525  1.00 34.16  ? 643  GLU B OE2   1 
ATOM   9871  N N     . GLU B 1 644 ? -40.095 33.417  23.439  1.00 28.03  ? 644  GLU B N     1 
ATOM   9872  C CA    . GLU B 1 644 ? -39.143 33.903  22.455  1.00 27.90  ? 644  GLU B CA    1 
ATOM   9873  C C     . GLU B 1 644 ? -38.240 34.976  23.077  1.00 28.41  ? 644  GLU B C     1 
ATOM   9874  O O     . GLU B 1 644 ? -37.029 34.929  22.901  1.00 28.07  ? 644  GLU B O     1 
ATOM   9875  C CB    . GLU B 1 644 ? -39.867 34.434  21.212  1.00 27.72  ? 644  GLU B CB    1 
ATOM   9876  C CG    . GLU B 1 644 ? -40.650 33.393  20.421  1.00 26.65  ? 644  GLU B CG    1 
ATOM   9877  C CD    . GLU B 1 644 ? -41.694 34.013  19.497  1.00 27.68  ? 644  GLU B CD    1 
ATOM   9878  O OE1   . GLU B 1 644 ? -41.943 35.228  19.593  1.00 28.81  ? 644  GLU B OE1   1 
ATOM   9879  O OE2   . GLU B 1 644 ? -42.287 33.291  18.668  1.00 28.30  ? 644  GLU B OE2   1 
ATOM   9880  N N     . LYS B 1 645 ? -38.838 35.911  23.821  1.00 29.17  ? 645  LYS B N     1 
ATOM   9881  C CA    . LYS B 1 645 ? -38.117 37.021  24.460  1.00 30.42  ? 645  LYS B CA    1 
ATOM   9882  C C     . LYS B 1 645 ? -37.063 36.553  25.462  1.00 31.20  ? 645  LYS B C     1 
ATOM   9883  O O     . LYS B 1 645 ? -35.935 37.071  25.480  1.00 31.36  ? 645  LYS B O     1 
ATOM   9884  C CB    . LYS B 1 645 ? -39.100 38.008  25.126  1.00 30.46  ? 645  LYS B CB    1 
ATOM   9885  C CG    . LYS B 1 645 ? -38.505 38.979  26.198  1.00 30.90  ? 645  LYS B CG    1 
ATOM   9886  C CD    . LYS B 1 645 ? -37.451 39.954  25.634  1.00 31.81  ? 645  LYS B CD    1 
ATOM   9887  C CE    . LYS B 1 645 ? -36.818 40.835  26.723  1.00 31.54  ? 645  LYS B CE    1 
ATOM   9888  N NZ    . LYS B 1 645 ? -36.141 40.071  27.821  1.00 31.96  ? 645  LYS B NZ    1 
ATOM   9889  N N     . GLN B 1 646 ? -37.439 35.588  26.300  1.00 31.88  ? 646  GLN B N     1 
ATOM   9890  C CA    . GLN B 1 646 ? -36.527 35.055  27.308  1.00 32.54  ? 646  GLN B CA    1 
ATOM   9891  C C     . GLN B 1 646 ? -35.366 34.327  26.630  1.00 32.92  ? 646  GLN B C     1 
ATOM   9892  O O     . GLN B 1 646 ? -34.259 34.274  27.180  1.00 32.98  ? 646  GLN B O     1 
ATOM   9893  C CB    . GLN B 1 646 ? -37.262 34.143  28.311  1.00 32.59  ? 646  GLN B CB    1 
ATOM   9894  N N     . ALA B 1 647 ? -35.620 33.792  25.433  1.00 33.17  ? 647  ALA B N     1 
ATOM   9895  C CA    . ALA B 1 647 ? -34.582 33.127  24.638  1.00 33.81  ? 647  ALA B CA    1 
ATOM   9896  C C     . ALA B 1 647 ? -33.611 34.100  23.933  1.00 34.39  ? 647  ALA B C     1 
ATOM   9897  O O     . ALA B 1 647 ? -32.436 33.775  23.757  1.00 34.74  ? 647  ALA B O     1 
ATOM   9898  C CB    . ALA B 1 647 ? -35.207 32.155  23.635  1.00 33.37  ? 647  ALA B CB    1 
ATOM   9899  N N     . ILE B 1 648 ? -34.098 35.280  23.546  1.00 34.93  ? 648  ILE B N     1 
ATOM   9900  C CA    . ILE B 1 648 ? -33.291 36.272  22.820  1.00 35.69  ? 648  ILE B CA    1 
ATOM   9901  C C     . ILE B 1 648 ? -32.585 37.238  23.773  1.00 36.08  ? 648  ILE B C     1 
ATOM   9902  O O     . ILE B 1 648 ? -31.481 36.961  24.251  1.00 36.48  ? 648  ILE B O     1 
ATOM   9903  C CB    . ILE B 1 648 ? -34.161 37.056  21.790  1.00 35.87  ? 648  ILE B CB    1 
HETATM 9904  O "O2'" . PRX C 2 .   ? -9.695  26.121  25.816  1.00 5.88   ? 999  PRX A "O2'" 1 
HETATM 9905  C "C2'" . PRX C 2 .   ? -8.923  25.865  24.658  1.00 7.67   ? 999  PRX A "C2'" 1 
HETATM 9906  C "C1'" . PRX C 2 .   ? -9.003  27.108  23.790  1.00 9.51   ? 999  PRX A "C1'" 1 
HETATM 9907  O "O4'" . PRX C 2 .   ? -7.846  27.910  24.069  1.00 8.08   ? 999  PRX A "O4'" 1 
HETATM 9908  C "C4'" . PRX C 2 .   ? -7.055  27.260  25.071  1.00 7.20   ? 999  PRX A "C4'" 1 
HETATM 9909  C "C5'" . PRX C 2 .   ? -5.590  27.484  24.790  1.00 6.83   ? 999  PRX A "C5'" 1 
HETATM 9910  O "O5'" . PRX C 2 .   ? -5.356  28.872  25.012  1.00 9.81   ? 999  PRX A "O5'" 1 
HETATM 9911  P P     . PRX C 2 .   ? -3.899  29.456  24.723  1.00 7.78   ? 999  PRX A P     1 
HETATM 9912  O O1P   . PRX C 2 .   ? -2.928  28.568  25.485  1.00 8.04   ? 999  PRX A O1P   1 
HETATM 9913  O O2P   . PRX C 2 .   ? -3.865  30.946  24.893  1.00 7.36   ? 999  PRX A O2P   1 
HETATM 9914  O O3P   . PRX C 2 .   ? -3.718  29.041  23.180  1.00 8.75   ? 999  PRX A O3P   1 
HETATM 9915  C C1P   . PRX C 2 .   ? -4.222  29.772  22.059  1.00 7.70   ? 999  PRX A C1P   1 
HETATM 9916  C C2P   . PRX C 2 .   ? -3.635  29.098  20.824  1.00 5.92   ? 999  PRX A C2P   1 
HETATM 9917  C C3P   . PRX C 2 .   ? -4.340  27.813  20.470  1.00 2.55   ? 999  PRX A C3P   1 
HETATM 9918  C "C3'" . PRX C 2 .   ? -7.454  25.797  25.008  1.00 7.07   ? 999  PRX A "C3'" 1 
HETATM 9919  O "O3'" . PRX C 2 .   ? -7.205  25.045  26.210  1.00 6.59   ? 999  PRX A "O3'" 1 
HETATM 9920  N N9    . PRX C 2 .   ? -8.959  26.723  22.364  1.00 10.65  ? 999  PRX A N9    1 
HETATM 9921  C C8    . PRX C 2 .   ? -7.904  26.931  21.555  1.00 11.30  ? 999  PRX A C8    1 
HETATM 9922  N N7    . PRX C 2 .   ? -8.210  26.476  20.322  1.00 12.44  ? 999  PRX A N7    1 
HETATM 9923  C C5    . PRX C 2 .   ? -9.466  25.974  20.370  1.00 10.96  ? 999  PRX A C5    1 
HETATM 9924  C C4    . PRX C 2 .   ? -9.941  26.127  21.667  1.00 11.17  ? 999  PRX A C4    1 
HETATM 9925  N N3    . PRX C 2 .   ? -11.196 25.688  21.987  1.00 10.01  ? 999  PRX A N3    1 
HETATM 9926  C C2    . PRX C 2 .   ? -11.956 25.112  21.048  1.00 10.94  ? 999  PRX A C2    1 
HETATM 9927  N N1    . PRX C 2 .   ? -11.519 24.952  19.784  1.00 10.45  ? 999  PRX A N1    1 
HETATM 9928  C C6    . PRX C 2 .   ? -10.284 25.374  19.430  1.00 9.86   ? 999  PRX A C6    1 
HETATM 9929  N N6    . PRX C 2 .   ? -9.846  25.220  18.170  1.00 10.30  ? 999  PRX A N6    1 
HETATM 9930  O "O2'" . PRX D 2 .   ? -38.474 64.147  24.531  1.00 8.64   ? 998  PRX B "O2'" 1 
HETATM 9931  C "C2'" . PRX D 2 .   ? -37.851 65.426  24.570  1.00 9.89   ? 998  PRX B "C2'" 1 
HETATM 9932  C "C1'" . PRX D 2 .   ? -36.375 65.222  24.356  1.00 10.86  ? 998  PRX B "C1'" 1 
HETATM 9933  O "O4'" . PRX D 2 .   ? -36.144 65.399  22.950  1.00 9.95   ? 998  PRX B "O4'" 1 
HETATM 9934  C "C4'" . PRX D 2 .   ? -37.346 65.772  22.283  1.00 10.13  ? 998  PRX B "C4'" 1 
HETATM 9935  C "C5'" . PRX D 2 .   ? -37.031 66.844  21.249  1.00 9.79   ? 998  PRX B "C5'" 1 
HETATM 9936  O "O5'" . PRX D 2 .   ? -36.375 66.223  20.147  1.00 8.84   ? 998  PRX B "O5'" 1 
HETATM 9937  P P     . PRX D 2 .   ? -35.839 67.090  18.899  1.00 9.81   ? 998  PRX B P     1 
HETATM 9938  O O1P   . PRX D 2 .   ? -37.018 67.756  18.210  1.00 9.46   ? 998  PRX B O1P   1 
HETATM 9939  O O2P   . PRX D 2 .   ? -34.930 66.190  18.095  1.00 7.32   ? 998  PRX B O2P   1 
HETATM 9940  O O3P   . PRX D 2 .   ? -34.957 68.249  19.620  1.00 9.09   ? 998  PRX B O3P   1 
HETATM 9941  C C1P   . PRX D 2 .   ? -33.647 67.981  20.122  1.00 10.71  ? 998  PRX B C1P   1 
HETATM 9942  C C2P   . PRX D 2 .   ? -33.086 69.251  20.750  1.00 12.13  ? 998  PRX B C2P   1 
HETATM 9943  C C3P   . PRX D 2 .   ? -33.949 69.697  21.897  1.00 12.14  ? 998  PRX B C3P   1 
HETATM 9944  C "C3'" . PRX D 2 .   ? -38.263 66.278  23.382  1.00 10.81  ? 998  PRX B "C3'" 1 
HETATM 9945  O "O3'" . PRX D 2 .   ? -39.656 66.127  23.062  1.00 11.20  ? 998  PRX B "O3'" 1 
HETATM 9946  N N9    . PRX D 2 .   ? -35.631 66.253  25.126  1.00 11.29  ? 998  PRX B N9    1 
HETATM 9947  C C8    . PRX D 2 .   ? -35.046 67.343  24.603  1.00 11.29  ? 998  PRX B C8    1 
HETATM 9948  N N7    . PRX D 2 .   ? -34.473 68.029  25.611  1.00 12.33  ? 998  PRX B N7    1 
HETATM 9949  C C5    . PRX D 2 .   ? -34.703 67.354  26.760  1.00 10.12  ? 998  PRX B C5    1 
HETATM 9950  C C4    . PRX D 2 .   ? -35.441 66.240  26.442  1.00 10.09  ? 998  PRX B C4    1 
HETATM 9951  N N3    . PRX D 2 .   ? -35.823 65.372  27.419  1.00 11.50  ? 998  PRX B N3    1 
HETATM 9952  C C2    . PRX D 2 .   ? -35.485 65.605  28.693  1.00 11.56  ? 998  PRX B C2    1 
HETATM 9953  N N1    . PRX D 2 .   ? -34.752 66.679  29.017  1.00 11.60  ? 998  PRX B N1    1 
HETATM 9954  C C6    . PRX D 2 .   ? -34.350 67.569  28.084  1.00 10.55  ? 998  PRX B C6    1 
HETATM 9955  N N6    . PRX D 2 .   ? -33.626 68.658  28.453  1.00 10.95  ? 998  PRX B N6    1 
HETATM 9956  O O     . HOH E 3 .   ? -13.196 24.128  -4.118  1.00 12.47  ? 1000 HOH A O     1 
HETATM 9957  O O     . HOH E 3 .   ? -10.053 25.504  -2.001  1.00 9.58   ? 1001 HOH A O     1 
HETATM 9958  O O     . HOH E 3 .   ? -6.176  13.230  -2.908  1.00 11.44  ? 1002 HOH A O     1 
HETATM 9959  O O     . HOH E 3 .   ? -3.627  12.048  -3.148  1.00 14.97  ? 1003 HOH A O     1 
HETATM 9960  O O     . HOH E 3 .   ? -0.692  17.522  -7.091  1.00 28.23  ? 1004 HOH A O     1 
HETATM 9961  O O     . HOH E 3 .   ? 0.593   18.952  -5.386  1.00 18.76  ? 1005 HOH A O     1 
HETATM 9962  O O     . HOH E 3 .   ? -4.650  17.132  3.544   1.00 13.18  ? 1006 HOH A O     1 
HETATM 9963  O O     . HOH E 3 .   ? -2.193  18.324  3.580   1.00 15.57  ? 1007 HOH A O     1 
HETATM 9964  O O     . HOH E 3 .   ? 3.078   11.687  0.810   1.00 38.83  ? 1008 HOH A O     1 
HETATM 9965  O O     . HOH E 3 .   ? -8.804  7.716   11.770  1.00 34.08  ? 1009 HOH A O     1 
HETATM 9966  O O     . HOH E 3 .   ? -7.274  8.938   14.114  1.00 18.39  ? 1010 HOH A O     1 
HETATM 9967  O O     . HOH E 3 .   ? 5.317   12.460  7.994   1.00 23.05  ? 1011 HOH A O     1 
HETATM 9968  O O     . HOH E 3 .   ? 9.219   3.759   18.465  1.00 26.99  ? 1012 HOH A O     1 
HETATM 9969  O O     . HOH E 3 .   ? 14.970  7.269   20.049  1.00 31.23  ? 1013 HOH A O     1 
HETATM 9970  O O     . HOH E 3 .   ? 7.779   17.298  5.182   1.00 9.69   ? 1014 HOH A O     1 
HETATM 9971  O O     . HOH E 3 .   ? 15.839  10.012  7.662   1.00 20.49  ? 1015 HOH A O     1 
HETATM 9972  O O     . HOH E 3 .   ? 17.770  16.995  7.699   1.00 32.95  ? 1016 HOH A O     1 
HETATM 9973  O O     . HOH E 3 .   ? 20.556  23.864  11.881  1.00 9.71   ? 1017 HOH A O     1 
HETATM 9974  O O     . HOH E 3 .   ? 15.471  12.579  22.584  1.00 15.25  ? 1018 HOH A O     1 
HETATM 9975  O O     . HOH E 3 .   ? 9.771   7.823   25.546  1.00 17.12  ? 1019 HOH A O     1 
HETATM 9976  O O     . HOH E 3 .   ? 5.592   10.343  27.614  1.00 21.87  ? 1020 HOH A O     1 
HETATM 9977  O O     . HOH E 3 .   ? 1.800   11.868  36.534  1.00 12.58  ? 1021 HOH A O     1 
HETATM 9978  O O     . HOH E 3 .   ? 8.760   15.712  37.789  1.00 11.89  ? 1022 HOH A O     1 
HETATM 9979  O O     . HOH E 3 .   ? 10.344  17.999  31.290  1.00 23.34  ? 1023 HOH A O     1 
HETATM 9980  O O     . HOH E 3 .   ? 27.222  20.668  17.277  1.00 26.09  ? 1024 HOH A O     1 
HETATM 9981  O O     . HOH E 3 .   ? 18.202  28.526  17.456  1.00 9.06   ? 1025 HOH A O     1 
HETATM 9982  O O     . HOH E 3 .   ? 21.143  29.022  1.493   1.00 10.13  ? 1026 HOH A O     1 
HETATM 9983  O O     . HOH E 3 .   ? 22.465  32.373  -4.405  1.00 23.01  ? 1027 HOH A O     1 
HETATM 9984  O O     . HOH E 3 .   ? 23.108  32.852  -1.070  1.00 24.35  ? 1028 HOH A O     1 
HETATM 9985  O O     . HOH E 3 .   ? 17.963  27.799  -0.626  1.00 26.84  ? 1029 HOH A O     1 
HETATM 9986  O O     . HOH E 3 .   ? 22.344  23.727  -4.437  1.00 27.35  ? 1030 HOH A O     1 
HETATM 9987  O O     . HOH E 3 .   ? 15.756  33.887  -5.131  1.00 21.89  ? 1031 HOH A O     1 
HETATM 9988  O O     . HOH E 3 .   ? 18.357  33.963  -5.060  1.00 28.13  ? 1032 HOH A O     1 
HETATM 9989  O O     . HOH E 3 .   ? -5.775  46.431  2.832   1.00 14.67  ? 1033 HOH A O     1 
HETATM 9990  O O     . HOH E 3 .   ? -6.496  48.231  10.886  1.00 6.30   ? 1034 HOH A O     1 
HETATM 9991  O O     . HOH E 3 .   ? -3.357  54.294  11.019  1.00 12.78  ? 1035 HOH A O     1 
HETATM 9992  O O     . HOH E 3 .   ? 0.296   52.116  9.133   1.00 13.68  ? 1036 HOH A O     1 
HETATM 9993  O O     . HOH E 3 .   ? -6.137  51.928  6.108   1.00 14.12  ? 1037 HOH A O     1 
HETATM 9994  O O     . HOH E 3 .   ? 6.060   53.026  8.242   1.00 28.01  ? 1038 HOH A O     1 
HETATM 9995  O O     . HOH E 3 .   ? 8.494   41.970  -4.051  1.00 32.91  ? 1039 HOH A O     1 
HETATM 9996  O O     . HOH E 3 .   ? 21.555  38.469  3.742   1.00 27.67  ? 1040 HOH A O     1 
HETATM 9997  O O     . HOH E 3 .   ? 25.048  46.657  20.321  1.00 14.51  ? 1041 HOH A O     1 
HETATM 9998  O O     . HOH E 3 .   ? 27.458  38.858  24.464  1.00 22.31  ? 1042 HOH A O     1 
HETATM 9999  O O     . HOH E 3 .   ? 5.021   42.234  21.879  1.00 19.85  ? 1043 HOH A O     1 
HETATM 10000 O O     . HOH E 3 .   ? 0.369   47.029  15.830  1.00 19.06  ? 1044 HOH A O     1 
HETATM 10001 O O     . HOH E 3 .   ? 7.806   49.424  11.234  1.00 16.82  ? 1045 HOH A O     1 
HETATM 10002 O O     . HOH E 3 .   ? 7.957   49.460  9.003   1.00 31.34  ? 1046 HOH A O     1 
HETATM 10003 O O     . HOH E 3 .   ? 15.008  33.012  21.624  1.00 16.20  ? 1047 HOH A O     1 
HETATM 10004 O O     . HOH E 3 .   ? 17.289  29.537  22.073  1.00 9.50   ? 1048 HOH A O     1 
HETATM 10005 O O     . HOH E 3 .   ? 19.173  28.714  24.819  1.00 14.08  ? 1049 HOH A O     1 
HETATM 10006 O O     . HOH E 3 .   ? 8.252   34.418  23.901  1.00 11.66  ? 1050 HOH A O     1 
HETATM 10007 O O     . HOH E 3 .   ? 5.954   36.200  27.664  1.00 7.19   ? 1051 HOH A O     1 
HETATM 10008 O O     . HOH E 3 .   ? 2.628   37.824  25.719  1.00 12.52  ? 1052 HOH A O     1 
HETATM 10009 O O     . HOH E 3 .   ? 2.100   42.467  20.874  1.00 16.99  ? 1053 HOH A O     1 
HETATM 10010 O O     . HOH E 3 .   ? -5.122  44.711  26.802  1.00 20.37  ? 1054 HOH A O     1 
HETATM 10011 O O     . HOH E 3 .   ? 0.025   49.367  35.299  1.00 12.86  ? 1055 HOH A O     1 
HETATM 10012 O O     . HOH E 3 .   ? 4.646   48.242  38.358  1.00 20.28  ? 1056 HOH A O     1 
HETATM 10013 O O     . HOH E 3 .   ? 23.662  39.973  30.217  1.00 25.79  ? 1057 HOH A O     1 
HETATM 10014 O O     . HOH E 3 .   ? 5.123   55.413  24.557  1.00 16.65  ? 1058 HOH A O     1 
HETATM 10015 O O     . HOH E 3 .   ? 2.186   49.379  15.111  1.00 11.30  ? 1059 HOH A O     1 
HETATM 10016 O O     . HOH E 3 .   ? -5.630  58.760  12.367  1.00 26.47  ? 1060 HOH A O     1 
HETATM 10017 O O     . HOH E 3 .   ? 10.015  58.708  19.205  1.00 15.59  ? 1061 HOH A O     1 
HETATM 10018 O O     . HOH E 3 .   ? 19.867  57.106  12.738  1.00 47.69  ? 1062 HOH A O     1 
HETATM 10019 O O     . HOH E 3 .   ? 28.760  44.108  14.782  1.00 20.35  ? 1063 HOH A O     1 
HETATM 10020 O O     . HOH E 3 .   ? 2.556   37.058  28.290  1.00 15.66  ? 1064 HOH A O     1 
HETATM 10021 O O     . HOH E 3 .   ? -2.952  36.477  30.240  1.00 18.85  ? 1065 HOH A O     1 
HETATM 10022 O O     . HOH E 3 .   ? -2.879  33.347  28.945  1.00 7.76   ? 1066 HOH A O     1 
HETATM 10023 O O     . HOH E 3 .   ? -10.304 25.147  38.404  1.00 45.64  ? 1067 HOH A O     1 
HETATM 10024 O O     . HOH E 3 .   ? -3.183  33.115  35.726  1.00 13.83  ? 1068 HOH A O     1 
HETATM 10025 O O     . HOH E 3 .   ? 9.036   22.652  23.402  1.00 16.21  ? 1069 HOH A O     1 
HETATM 10026 O O     . HOH E 3 .   ? 1.012   35.214  8.716   1.00 6.21   ? 1070 HOH A O     1 
HETATM 10027 O O     . HOH E 3 .   ? -1.380  39.435  10.991  1.00 10.47  ? 1071 HOH A O     1 
HETATM 10028 O O     . HOH E 3 .   ? -15.542 48.962  2.650   1.00 12.69  ? 1072 HOH A O     1 
HETATM 10029 O O     . HOH E 3 .   ? -11.451 49.059  4.955   1.00 15.96  ? 1073 HOH A O     1 
HETATM 10030 O O     . HOH E 3 .   ? -13.464 41.559  5.817   1.00 2.36   ? 1074 HOH A O     1 
HETATM 10031 O O     . HOH E 3 .   ? -8.561  37.347  -3.335  1.00 9.35   ? 1075 HOH A O     1 
HETATM 10032 O O     . HOH E 3 .   ? 1.616   41.479  -2.166  1.00 16.08  ? 1076 HOH A O     1 
HETATM 10033 O O     . HOH E 3 .   ? -1.397  34.232  -4.358  1.00 13.63  ? 1077 HOH A O     1 
HETATM 10034 O O     . HOH E 3 .   ? -18.737 31.334  17.368  1.00 12.22  ? 1078 HOH A O     1 
HETATM 10035 O O     . HOH E 3 .   ? -21.833 37.689  15.140  1.00 13.54  ? 1079 HOH A O     1 
HETATM 10036 O O     . HOH E 3 .   ? -19.122 43.869  14.655  1.00 11.12  ? 1080 HOH A O     1 
HETATM 10037 O O     . HOH E 3 .   ? -23.563 38.163  5.557   1.00 9.43   ? 1081 HOH A O     1 
HETATM 10038 O O     . HOH E 3 .   ? -17.591 42.267  -4.277  1.00 18.75  ? 1082 HOH A O     1 
HETATM 10039 O O     . HOH E 3 .   ? -12.819 32.758  -1.006  1.00 12.99  ? 1083 HOH A O     1 
HETATM 10040 O O     . HOH E 3 .   ? 21.668  23.322  -1.696  1.00 33.44  ? 1084 HOH A O     1 
HETATM 10041 O O     . HOH E 3 .   ? -15.234 27.936  2.117   1.00 16.15  ? 1085 HOH A O     1 
HETATM 10042 O O     . HOH E 3 .   ? -24.013 31.105  6.119   1.00 21.94  ? 1086 HOH A O     1 
HETATM 10043 O O     . HOH E 3 .   ? -14.866 22.643  1.917   1.00 15.37  ? 1087 HOH A O     1 
HETATM 10044 O O     . HOH E 3 .   ? -13.843 20.229  2.993   1.00 11.61  ? 1088 HOH A O     1 
HETATM 10045 O O     . HOH E 3 .   ? -11.718 19.133  3.947   1.00 12.08  ? 1089 HOH A O     1 
HETATM 10046 O O     . HOH E 3 .   ? 5.412   23.106  17.865  1.00 12.91  ? 1090 HOH A O     1 
HETATM 10047 O O     . HOH E 3 .   ? -5.198  15.620  12.439  1.00 12.26  ? 1091 HOH A O     1 
HETATM 10048 O O     . HOH E 3 .   ? -8.108  13.658  -1.002  1.00 14.00  ? 1092 HOH A O     1 
HETATM 10049 O O     . HOH E 3 .   ? -11.833 11.537  4.559   1.00 14.68  ? 1093 HOH A O     1 
HETATM 10050 O O     . HOH E 3 .   ? -22.377 13.983  12.785  1.00 28.99  ? 1094 HOH A O     1 
HETATM 10051 O O     . HOH E 3 .   ? -22.089 20.881  13.027  1.00 19.69  ? 1095 HOH A O     1 
HETATM 10052 O O     . HOH E 3 .   ? 0.316   12.009  22.205  1.00 9.30   ? 1096 HOH A O     1 
HETATM 10053 O O     . HOH E 3 .   ? -11.165 8.227   25.572  1.00 16.50  ? 1097 HOH A O     1 
HETATM 10054 O O     . HOH E 3 .   ? -17.469 12.368  36.528  1.00 32.10  ? 1098 HOH A O     1 
HETATM 10055 O O     . HOH E 3 .   ? -15.928 7.706   19.461  1.00 19.92  ? 1099 HOH A O     1 
HETATM 10056 O O     . HOH E 3 .   ? -16.776 12.038  31.797  1.00 20.04  ? 1100 HOH A O     1 
HETATM 10057 O O     . HOH E 3 .   ? -16.665 15.887  31.975  1.00 37.67  ? 1101 HOH A O     1 
HETATM 10058 O O     . HOH E 3 .   ? -0.349  6.068   25.353  1.00 33.83  ? 1102 HOH A O     1 
HETATM 10059 O O     . HOH E 3 .   ? 12.670  17.885  30.320  1.00 30.13  ? 1103 HOH A O     1 
HETATM 10060 O O     . HOH E 3 .   ? 12.337  24.248  34.891  1.00 17.26  ? 1104 HOH A O     1 
HETATM 10061 O O     . HOH E 3 .   ? 13.325  19.468  42.685  1.00 29.72  ? 1105 HOH A O     1 
HETATM 10062 O O     . HOH E 3 .   ? -4.546  22.604  33.918  1.00 31.28  ? 1106 HOH A O     1 
HETATM 10063 O O     . HOH E 3 .   ? -2.651  18.083  36.722  1.00 28.33  ? 1107 HOH A O     1 
HETATM 10064 O O     . HOH E 3 .   ? -2.764  15.150  34.584  1.00 18.57  ? 1108 HOH A O     1 
HETATM 10065 O O     . HOH E 3 .   ? 4.593   8.185   31.542  1.00 38.10  ? 1109 HOH A O     1 
HETATM 10066 O O     . HOH E 3 .   ? -20.752 11.934  21.813  1.00 18.67  ? 1110 HOH A O     1 
HETATM 10067 O O     . HOH E 3 .   ? -20.771 11.026  14.614  1.00 28.47  ? 1111 HOH A O     1 
HETATM 10068 O O     . HOH E 3 .   ? -14.479 21.376  18.347  1.00 5.32   ? 1112 HOH A O     1 
HETATM 10069 O O     . HOH E 3 .   ? -16.791 22.394  29.051  1.00 30.84  ? 1113 HOH A O     1 
HETATM 10070 O O     . HOH E 3 .   ? -13.741 29.027  29.764  1.00 14.05  ? 1114 HOH A O     1 
HETATM 10071 O O     . HOH E 3 .   ? -3.532  39.570  38.854  1.00 20.23  ? 1115 HOH A O     1 
HETATM 10072 O O     . HOH E 3 .   ? -8.553  45.631  48.904  1.00 7.38   ? 1116 HOH A O     1 
HETATM 10073 O O     . HOH E 3 .   ? -8.874  45.947  51.761  1.00 24.52  ? 1117 HOH A O     1 
HETATM 10074 O O     . HOH E 3 .   ? -22.051 31.946  33.845  1.00 18.04  ? 1118 HOH A O     1 
HETATM 10075 O O     . HOH E 3 .   ? -19.660 31.105  30.194  1.00 24.83  ? 1119 HOH A O     1 
HETATM 10076 O O     . HOH E 3 .   ? -14.505 56.964  38.300  1.00 18.72  ? 1120 HOH A O     1 
HETATM 10077 O O     . HOH E 3 .   ? -24.061 37.254  14.115  1.00 14.39  ? 1121 HOH A O     1 
HETATM 10078 O O     . HOH E 3 .   ? -21.313 20.268  0.927   1.00 51.38  ? 1122 HOH A O     1 
HETATM 10079 O O     . HOH E 3 .   ? 29.671  37.879  14.489  1.00 17.79  ? 1123 HOH A O     1 
HETATM 10080 O O     . HOH E 3 .   ? 20.243  27.894  27.113  1.00 34.52  ? 1124 HOH A O     1 
HETATM 10081 O O     . HOH E 3 .   ? 20.835  25.313  27.634  1.00 21.75  ? 1125 HOH A O     1 
HETATM 10082 O O     . HOH E 3 .   ? -0.380  35.700  29.900  1.00 22.79  ? 1126 HOH A O     1 
HETATM 10083 O O     . HOH E 3 .   ? -7.698  44.109  50.653  1.00 26.95  ? 1127 HOH A O     1 
HETATM 10084 O O     . HOH E 3 .   ? -8.404  31.101  38.230  1.00 35.71  ? 1128 HOH A O     1 
HETATM 10085 O O     . HOH E 3 .   ? 7.085   31.667  35.613  1.00 15.25  ? 1129 HOH A O     1 
HETATM 10086 O O     . HOH E 3 .   ? 11.053  21.375  21.562  1.00 13.26  ? 1130 HOH A O     1 
HETATM 10087 O O     . HOH E 3 .   ? 17.574  27.971  20.024  1.00 13.14  ? 1131 HOH A O     1 
HETATM 10088 O O     . HOH E 3 .   ? 4.606   33.814  -4.118  1.00 21.15  ? 1132 HOH A O     1 
HETATM 10089 O O     . HOH E 3 .   ? -4.224  37.731  18.417  1.00 13.12  ? 1133 HOH A O     1 
HETATM 10090 O O     . HOH E 3 .   ? 13.375  27.454  0.698   1.00 24.21  ? 1134 HOH A O     1 
HETATM 10091 O O     . HOH E 3 .   ? -11.400 51.436  3.581   1.00 17.77  ? 1135 HOH A O     1 
HETATM 10092 O O     . HOH E 3 .   ? -17.563 47.502  4.030   1.00 15.41  ? 1136 HOH A O     1 
HETATM 10093 O O     . HOH E 3 .   ? -10.601 44.269  -2.489  1.00 12.09  ? 1137 HOH A O     1 
HETATM 10094 O O     . HOH E 3 .   ? -25.908 41.753  13.240  1.00 11.17  ? 1138 HOH A O     1 
HETATM 10095 O O     . HOH E 3 .   ? -14.156 46.844  -0.285  1.00 16.33  ? 1139 HOH A O     1 
HETATM 10096 O O     . HOH E 3 .   ? -8.362  38.315  -6.194  1.00 24.49  ? 1140 HOH A O     1 
HETATM 10097 O O     . HOH E 3 .   ? -12.363 30.969  -5.280  1.00 29.80  ? 1141 HOH A O     1 
HETATM 10098 O O     . HOH E 3 .   ? -12.054 30.697  -2.616  1.00 13.08  ? 1142 HOH A O     1 
HETATM 10099 O O     . HOH E 3 .   ? -10.165 27.777  -4.548  1.00 26.53  ? 1143 HOH A O     1 
HETATM 10100 O O     . HOH E 3 .   ? -14.675 32.110  23.425  1.00 47.00  ? 1144 HOH A O     1 
HETATM 10101 O O     . HOH E 3 .   ? -24.547 30.791  9.132   1.00 17.86  ? 1145 HOH A O     1 
HETATM 10102 O O     . HOH E 3 .   ? -26.002 28.165  9.416   1.00 27.67  ? 1146 HOH A O     1 
HETATM 10103 O O     . HOH E 3 .   ? -22.938 35.356  -0.619  1.00 27.02  ? 1147 HOH A O     1 
HETATM 10104 O O     . HOH E 3 .   ? -14.941 23.343  13.405  1.00 11.20  ? 1148 HOH A O     1 
HETATM 10105 O O     . HOH E 3 .   ? -14.424 20.277  10.992  1.00 8.57   ? 1149 HOH A O     1 
HETATM 10106 O O     . HOH E 3 .   ? -13.015 22.650  10.665  1.00 12.06  ? 1150 HOH A O     1 
HETATM 10107 O O     . HOH E 3 .   ? -12.877 12.026  6.870   1.00 21.93  ? 1151 HOH A O     1 
HETATM 10108 O O     . HOH E 3 .   ? 3.195   8.839   19.961  1.00 28.39  ? 1152 HOH A O     1 
HETATM 10109 O O     . HOH E 3 .   ? -14.553 18.284  34.908  1.00 23.06  ? 1153 HOH A O     1 
HETATM 10110 O O     . HOH E 3 .   ? 13.426  26.880  33.895  1.00 15.24  ? 1154 HOH A O     1 
HETATM 10111 O O     . HOH E 3 .   ? -17.150 17.822  28.976  1.00 26.15  ? 1155 HOH A O     1 
HETATM 10112 O O     . HOH E 3 .   ? -21.431 14.590  15.827  1.00 23.97  ? 1156 HOH A O     1 
HETATM 10113 O O     . HOH E 3 .   ? -11.053 31.735  40.893  1.00 29.26  ? 1157 HOH A O     1 
HETATM 10114 O O     . HOH E 3 .   ? -16.663 30.768  35.165  1.00 27.40  ? 1158 HOH A O     1 
HETATM 10115 O O     . HOH E 3 .   ? -12.791 42.167  28.953  1.00 31.14  ? 1159 HOH A O     1 
HETATM 10116 O O     . HOH E 3 .   ? -8.892  53.387  38.903  1.00 16.62  ? 1160 HOH A O     1 
HETATM 10117 O O     . HOH E 3 .   ? -15.126 45.061  29.621  1.00 17.77  ? 1161 HOH A O     1 
HETATM 10118 O O     . HOH E 3 .   ? -25.787 41.558  49.303  1.00 21.40  ? 1162 HOH A O     1 
HETATM 10119 O O     . HOH E 3 .   ? -5.103  9.826   38.734  1.00 25.42  ? 1163 HOH A O     1 
HETATM 10120 O O     . HOH E 3 .   ? 10.949  23.227  40.744  1.00 28.18  ? 1164 HOH A O     1 
HETATM 10121 O O     . HOH E 3 .   ? -21.030 20.421  9.064   1.00 11.81  ? 1165 HOH A O     1 
HETATM 10122 O O     . HOH E 3 .   ? -3.400  23.805  -1.361  1.00 17.80  ? 1166 HOH A O     1 
HETATM 10123 O O     . HOH E 3 .   ? -1.786  13.095  -1.488  1.00 14.00  ? 1167 HOH A O     1 
HETATM 10124 O O     . HOH E 3 .   ? 1.557   8.298   3.710   1.00 25.89  ? 1168 HOH A O     1 
HETATM 10125 O O     . HOH E 3 .   ? -9.100  9.393   7.301   1.00 23.96  ? 1169 HOH A O     1 
HETATM 10126 O O     . HOH E 3 .   ? 3.618   6.268   7.362   1.00 25.04  ? 1170 HOH A O     1 
HETATM 10127 O O     . HOH E 3 .   ? 7.517   1.858   11.522  1.00 23.19  ? 1171 HOH A O     1 
HETATM 10128 O O     . HOH E 3 .   ? 7.452   10.336  8.629   1.00 17.15  ? 1172 HOH A O     1 
HETATM 10129 O O     . HOH E 3 .   ? 4.660   10.948  19.825  1.00 62.79  ? 1173 HOH A O     1 
HETATM 10130 O O     . HOH E 3 .   ? 15.723  19.742  5.791   1.00 20.26  ? 1174 HOH A O     1 
HETATM 10131 O O     . HOH E 3 .   ? 11.782  21.464  4.722   1.00 20.19  ? 1175 HOH A O     1 
HETATM 10132 O O     . HOH E 3 .   ? 20.429  15.407  9.831   1.00 17.84  ? 1176 HOH A O     1 
HETATM 10133 O O     . HOH E 3 .   ? 23.431  22.264  8.464   1.00 26.85  ? 1177 HOH A O     1 
HETATM 10134 O O     . HOH E 3 .   ? 21.986  24.591  9.786   1.00 14.77  ? 1178 HOH A O     1 
HETATM 10135 O O     . HOH E 3 .   ? 23.729  26.579  9.947   1.00 24.74  ? 1179 HOH A O     1 
HETATM 10136 O O     . HOH E 3 .   ? 24.663  11.802  15.145  1.00 29.43  ? 1180 HOH A O     1 
HETATM 10137 O O     . HOH E 3 .   ? 9.431   7.094   33.704  1.00 34.11  ? 1181 HOH A O     1 
HETATM 10138 O O     . HOH E 3 .   ? 8.305   17.216  39.760  1.00 20.49  ? 1182 HOH A O     1 
HETATM 10139 O O     . HOH E 3 .   ? 13.922  19.125  21.115  1.00 8.50   ? 1183 HOH A O     1 
HETATM 10140 O O     . HOH E 3 .   ? -20.107 18.337  0.960   1.00 15.75  ? 1184 HOH A O     1 
HETATM 10141 O O     . HOH E 3 .   ? 18.913  29.191  -7.923  1.00 24.41  ? 1185 HOH A O     1 
HETATM 10142 O O     . HOH E 3 .   ? 12.742  32.592  -5.366  1.00 32.77  ? 1186 HOH A O     1 
HETATM 10143 O O     . HOH E 3 .   ? 7.874   36.216  -3.343  1.00 11.81  ? 1187 HOH A O     1 
HETATM 10144 O O     . HOH E 3 .   ? 6.187   31.709  -1.605  1.00 29.25  ? 1188 HOH A O     1 
HETATM 10145 O O     . HOH E 3 .   ? 5.599   35.400  -2.471  1.00 16.46  ? 1189 HOH A O     1 
HETATM 10146 O O     . HOH E 3 .   ? -4.607  55.556  9.146   1.00 22.88  ? 1190 HOH A O     1 
HETATM 10147 O O     . HOH E 3 .   ? 18.233  36.403  31.994  1.00 20.40  ? 1191 HOH A O     1 
HETATM 10148 O O     . HOH E 3 .   ? 0.604   44.200  19.136  1.00 31.88  ? 1192 HOH A O     1 
HETATM 10149 O O     . HOH E 3 .   ? -2.479  42.964  13.658  1.00 15.02  ? 1193 HOH A O     1 
HETATM 10150 O O     . HOH E 3 .   ? 24.717  31.715  16.913  1.00 19.75  ? 1194 HOH A O     1 
HETATM 10151 O O     . HOH E 3 .   ? -2.107  49.038  28.132  1.00 30.03  ? 1195 HOH A O     1 
HETATM 10152 O O     . HOH E 3 .   ? 13.898  41.957  37.481  1.00 14.02  ? 1196 HOH A O     1 
HETATM 10153 O O     . HOH E 3 .   ? 13.929  39.425  38.772  1.00 14.43  ? 1197 HOH A O     1 
HETATM 10154 O O     . HOH E 3 .   ? 11.726  56.480  32.838  1.00 39.39  ? 1198 HOH A O     1 
HETATM 10155 O O     . HOH E 3 .   ? 11.657  53.923  33.897  1.00 15.40  ? 1199 HOH A O     1 
HETATM 10156 O O     . HOH E 3 .   ? 11.764  61.352  21.882  1.00 30.49  ? 1200 HOH A O     1 
HETATM 10157 O O     . HOH E 3 .   ? 8.585   57.464  27.434  1.00 27.36  ? 1201 HOH A O     1 
HETATM 10158 O O     . HOH E 3 .   ? 16.529  46.797  36.357  1.00 18.78  ? 1202 HOH A O     1 
HETATM 10159 O O     . HOH E 3 .   ? -4.709  6.944   24.706  1.00 25.25  ? 1203 HOH A O     1 
HETATM 10160 O O     . HOH E 3 .   ? 20.785  55.283  20.670  1.00 18.40  ? 1204 HOH A O     1 
HETATM 10161 O O     . HOH E 3 .   ? 22.663  55.868  12.839  1.00 25.41  ? 1205 HOH A O     1 
HETATM 10162 O O     . HOH E 3 .   ? 30.781  39.570  12.499  1.00 19.18  ? 1206 HOH A O     1 
HETATM 10163 O O     . HOH E 3 .   ? 2.754   9.243   1.609   1.00 17.28  ? 1207 HOH A O     1 
HETATM 10164 O O     . HOH E 3 .   ? 1.070   2.634   9.269   1.00 13.04  ? 1208 HOH A O     1 
HETATM 10165 O O     . HOH E 3 .   ? 2.097   1.020   11.846  1.00 25.18  ? 1209 HOH A O     1 
HETATM 10166 O O     . HOH E 3 .   ? 19.495  12.019  12.288  1.00 37.55  ? 1210 HOH A O     1 
HETATM 10167 O O     . HOH E 3 .   ? 19.340  14.479  12.009  1.00 16.70  ? 1211 HOH A O     1 
HETATM 10168 O O     . HOH E 3 .   ? 28.671  21.954  15.640  1.00 23.89  ? 1212 HOH A O     1 
HETATM 10169 O O     . HOH E 3 .   ? 18.343  12.079  28.605  1.00 30.29  ? 1213 HOH A O     1 
HETATM 10170 O O     . HOH E 3 .   ? -4.807  39.599  20.672  1.00 14.71  ? 1214 HOH A O     1 
HETATM 10171 O O     . HOH E 3 .   ? 15.431  24.368  1.937   1.00 29.47  ? 1215 HOH A O     1 
HETATM 10172 O O     . HOH E 3 .   ? 22.981  25.053  -0.415  1.00 32.51  ? 1216 HOH A O     1 
HETATM 10173 O O     . HOH E 3 .   ? 14.429  29.196  -7.098  1.00 21.19  ? 1217 HOH A O     1 
HETATM 10174 O O     . HOH E 3 .   ? 10.581  39.786  -1.950  1.00 18.47  ? 1218 HOH A O     1 
HETATM 10175 O O     . HOH E 3 .   ? 7.051   29.248  -6.668  1.00 22.40  ? 1219 HOH A O     1 
HETATM 10176 O O     . HOH E 3 .   ? -0.270  56.732  8.220   1.00 16.61  ? 1220 HOH A O     1 
HETATM 10177 O O     . HOH E 3 .   ? -2.570  52.772  -0.661  1.00 23.08  ? 1221 HOH A O     1 
HETATM 10178 O O     . HOH E 3 .   ? -3.339  49.776  -0.844  1.00 26.88  ? 1222 HOH A O     1 
HETATM 10179 O O     . HOH E 3 .   ? 0.932   49.927  0.175   1.00 34.84  ? 1223 HOH A O     1 
HETATM 10180 O O     . HOH E 3 .   ? 19.864  41.889  1.204   1.00 38.13  ? 1224 HOH A O     1 
HETATM 10181 O O     . HOH E 3 .   ? 14.273  43.780  8.031   1.00 30.97  ? 1225 HOH A O     1 
HETATM 10182 O O     . HOH E 3 .   ? 18.988  29.655  20.042  1.00 167.72 ? 1226 HOH A O     1 
HETATM 10183 O O     . HOH E 3 .   ? 26.401  33.125  18.552  1.00 30.51  ? 1227 HOH A O     1 
HETATM 10184 O O     . HOH E 3 .   ? 19.118  28.535  29.694  1.00 26.94  ? 1228 HOH A O     1 
HETATM 10185 O O     . HOH E 3 .   ? 16.648  34.195  33.462  1.00 18.25  ? 1229 HOH A O     1 
HETATM 10186 O O     . HOH E 3 .   ? 12.513  57.257  30.521  1.00 36.91  ? 1230 HOH A O     1 
HETATM 10187 O O     . HOH E 3 .   ? 14.680  53.501  15.561  1.00 2.00   ? 1231 HOH A O     1 
HETATM 10188 O O     . HOH E 3 .   ? 18.498  61.799  28.702  1.00 41.42  ? 1232 HOH A O     1 
HETATM 10189 O O     . HOH E 3 .   ? -2.691  38.214  32.440  1.00 17.13  ? 1233 HOH A O     1 
HETATM 10190 O O     . HOH E 3 .   ? -4.367  36.613  27.850  1.00 17.70  ? 1234 HOH A O     1 
HETATM 10191 O O     . HOH E 3 .   ? -3.832  25.909  34.543  1.00 23.90  ? 1235 HOH A O     1 
HETATM 10192 O O     . HOH E 3 .   ? -3.153  40.432  12.571  1.00 11.71  ? 1236 HOH A O     1 
HETATM 10193 O O     . HOH E 3 .   ? 8.312   23.553  2.452   1.00 21.84  ? 1237 HOH A O     1 
HETATM 10194 O O     . HOH E 3 .   ? -2.771  45.669  16.372  1.00 44.23  ? 1238 HOH A O     1 
HETATM 10195 O O     . HOH E 3 .   ? -16.753 44.355  12.456  1.00 32.17  ? 1239 HOH A O     1 
HETATM 10196 O O     . HOH E 3 .   ? -7.912  48.818  2.661   1.00 14.67  ? 1240 HOH A O     1 
HETATM 10197 O O     . HOH E 3 .   ? -3.077  35.290  -7.584  1.00 27.93  ? 1241 HOH A O     1 
HETATM 10198 O O     . HOH E 3 .   ? -9.600  33.311  19.603  1.00 26.92  ? 1242 HOH A O     1 
HETATM 10199 O O     . HOH E 3 .   ? -25.056 45.217  3.198   1.00 14.10  ? 1243 HOH A O     1 
HETATM 10200 O O     . HOH E 3 .   ? -26.786 43.277  2.932   1.00 22.30  ? 1244 HOH A O     1 
HETATM 10201 O O     . HOH E 3 .   ? -26.564 41.848  0.692   1.00 18.73  ? 1245 HOH A O     1 
HETATM 10202 O O     . HOH E 3 .   ? -22.931 45.272  1.531   1.00 15.29  ? 1246 HOH A O     1 
HETATM 10203 O O     . HOH E 3 .   ? -19.524 43.536  -3.283  1.00 25.93  ? 1247 HOH A O     1 
HETATM 10204 O O     . HOH E 3 .   ? -20.335 33.469  20.946  1.00 21.08  ? 1248 HOH A O     1 
HETATM 10205 O O     . HOH E 3 .   ? -10.758 10.676  8.285   1.00 26.80  ? 1249 HOH A O     1 
HETATM 10206 O O     . HOH E 3 .   ? -2.481  14.520  36.048  1.00 72.13  ? 1250 HOH A O     1 
HETATM 10207 O O     . HOH E 3 .   ? -9.219  6.326   25.555  1.00 24.57  ? 1251 HOH A O     1 
HETATM 10208 O O     . HOH E 3 .   ? -21.826 12.364  24.022  1.00 27.60  ? 1252 HOH A O     1 
HETATM 10209 O O     . HOH E 3 .   ? -2.300  38.736  36.444  1.00 20.64  ? 1253 HOH A O     1 
HETATM 10210 O O     . HOH E 3 .   ? -5.055  40.755  46.215  1.00 30.33  ? 1254 HOH A O     1 
HETATM 10211 O O     . HOH E 3 .   ? -1.561  47.324  43.239  1.00 29.55  ? 1255 HOH A O     1 
HETATM 10212 O O     . HOH E 3 .   ? -5.456  48.447  50.937  1.00 31.97  ? 1256 HOH A O     1 
HETATM 10213 O O     . HOH E 3 .   ? -9.807  54.488  46.001  1.00 24.18  ? 1257 HOH A O     1 
HETATM 10214 O O     . HOH E 3 .   ? -10.004 40.280  26.157  1.00 17.80  ? 1258 HOH A O     1 
HETATM 10215 O O     . HOH E 3 .   ? -20.533 45.524  49.201  1.00 27.88  ? 1259 HOH A O     1 
HETATM 10216 O O     . HOH E 3 .   ? -10.815 48.951  29.874  1.00 17.99  ? 1260 HOH A O     1 
HETATM 10217 O O     . HOH E 3 .   ? -11.922 45.641  27.163  1.00 24.88  ? 1261 HOH A O     1 
HETATM 10218 O O     . HOH E 3 .   ? -3.849  58.625  18.580  1.00 26.73  ? 1262 HOH A O     1 
HETATM 10219 O O     . HOH E 3 .   ? -5.134  59.577  16.042  1.00 28.50  ? 1263 HOH A O     1 
HETATM 10220 O O     . HOH E 3 .   ? 16.517  60.425  21.761  1.00 31.54  ? 1264 HOH A O     1 
HETATM 10221 O O     . HOH E 3 .   ? 13.554  49.313  39.074  1.00 31.37  ? 1265 HOH A O     1 
HETATM 10222 O O     . HOH E 3 .   ? -19.154 21.138  1.126   1.00 24.15  ? 1266 HOH A O     1 
HETATM 10223 O O     . HOH E 3 .   ? -5.826  21.646  -7.623  1.00 24.45  ? 1267 HOH A O     1 
HETATM 10224 O O     . HOH E 3 .   ? -0.113  32.183  24.067  1.00 11.39  ? 1268 HOH A O     1 
HETATM 10225 O O     . HOH E 3 .   ? -2.716  32.390  20.380  1.00 17.97  ? 1269 HOH A O     1 
HETATM 10226 O O     . HOH E 3 .   ? -4.261  34.254  19.182  1.00 23.96  ? 1270 HOH A O     1 
HETATM 10227 O O     . HOH E 3 .   ? -4.606  34.881  23.069  1.00 18.89  ? 1271 HOH A O     1 
HETATM 10228 O O     . HOH E 3 .   ? -8.330  31.159  25.118  1.00 28.00  ? 1272 HOH A O     1 
HETATM 10229 O O     . HOH E 3 .   ? 4.956   16.528  1.578   1.00 22.07  ? 1273 HOH A O     1 
HETATM 10230 O O     . HOH E 3 .   ? 6.332   18.699  0.430   1.00 37.94  ? 1274 HOH A O     1 
HETATM 10231 O O     . HOH E 3 .   ? 20.519  25.313  7.542   1.00 33.09  ? 1275 HOH A O     1 
HETATM 10232 O O     . HOH E 3 .   ? 12.614  9.712   31.081  1.00 27.14  ? 1276 HOH A O     1 
HETATM 10233 O O     . HOH E 3 .   ? 19.182  17.260  26.256  1.00 34.35  ? 1277 HOH A O     1 
HETATM 10234 O O     . HOH E 3 .   ? 20.512  21.541  26.497  1.00 31.56  ? 1278 HOH A O     1 
HETATM 10235 O O     . HOH E 3 .   ? 24.920  33.825  7.423   1.00 21.65  ? 1279 HOH A O     1 
HETATM 10236 O O     . HOH E 3 .   ? 1.455   38.919  -2.667  1.00 22.71  ? 1280 HOH A O     1 
HETATM 10237 O O     . HOH E 3 .   ? -7.921  50.603  4.436   1.00 23.04  ? 1281 HOH A O     1 
HETATM 10238 O O     . HOH E 3 .   ? 22.830  36.605  1.128   1.00 22.72  ? 1282 HOH A O     1 
HETATM 10239 O O     . HOH E 3 .   ? 26.622  33.804  23.775  1.00 18.68  ? 1283 HOH A O     1 
HETATM 10240 O O     . HOH E 3 .   ? 0.719   47.201  20.538  1.00 28.20  ? 1284 HOH A O     1 
HETATM 10241 O O     . HOH E 3 .   ? 26.285  29.510  21.332  1.00 24.40  ? 1285 HOH A O     1 
HETATM 10242 O O     . HOH E 3 .   ? 25.625  27.091  21.538  1.00 21.94  ? 1286 HOH A O     1 
HETATM 10243 O O     . HOH E 3 .   ? -0.349  39.902  34.525  1.00 28.39  ? 1287 HOH A O     1 
HETATM 10244 O O     . HOH E 3 .   ? -3.457  46.381  21.872  1.00 22.06  ? 1288 HOH A O     1 
HETATM 10245 O O     . HOH E 3 .   ? -0.410  41.917  36.671  1.00 18.05  ? 1289 HOH A O     1 
HETATM 10246 O O     . HOH E 3 .   ? 0.398   41.900  39.061  1.00 30.76  ? 1290 HOH A O     1 
HETATM 10247 O O     . HOH E 3 .   ? 2.367   38.888  36.160  1.00 33.19  ? 1291 HOH A O     1 
HETATM 10248 O O     . HOH E 3 .   ? 3.424   36.847  36.037  1.00 27.95  ? 1292 HOH A O     1 
HETATM 10249 O O     . HOH E 3 .   ? -5.583  32.488  37.895  1.00 14.66  ? 1293 HOH A O     1 
HETATM 10250 O O     . HOH E 3 .   ? -1.188  30.368  36.441  1.00 9.72   ? 1294 HOH A O     1 
HETATM 10251 O O     . HOH E 3 .   ? 0.636   26.541  36.973  1.00 21.73  ? 1295 HOH A O     1 
HETATM 10252 O O     . HOH E 3 .   ? -2.546  26.899  37.028  1.00 30.61  ? 1296 HOH A O     1 
HETATM 10253 O O     . HOH E 3 .   ? -6.347  45.193  -4.175  1.00 19.51  ? 1297 HOH A O     1 
HETATM 10254 O O     . HOH E 3 .   ? -3.106  26.687  -0.667  1.00 37.12  ? 1298 HOH A O     1 
HETATM 10255 O O     . HOH E 3 .   ? -11.753 27.577  16.286  1.00 10.91  ? 1299 HOH A O     1 
HETATM 10256 O O     . HOH E 3 .   ? -25.526 38.399  13.263  1.00 28.32  ? 1300 HOH A O     1 
HETATM 10257 O O     . HOH E 3 .   ? -22.553 47.515  8.792   1.00 28.27  ? 1301 HOH A O     1 
HETATM 10258 O O     . HOH E 3 .   ? -15.585 23.316  -0.382  1.00 32.07  ? 1302 HOH A O     1 
HETATM 10259 O O     . HOH E 3 .   ? -4.040  24.235  29.966  1.00 19.23  ? 1303 HOH A O     1 
HETATM 10260 O O     . HOH E 3 .   ? -11.206 18.258  36.653  1.00 26.46  ? 1304 HOH A O     1 
HETATM 10261 O O     . HOH E 3 .   ? -0.282  7.292   29.514  1.00 23.10  ? 1305 HOH A O     1 
HETATM 10262 O O     . HOH E 3 .   ? -13.450 28.137  27.338  1.00 14.22  ? 1306 HOH A O     1 
HETATM 10263 O O     . HOH E 3 .   ? -11.022 28.418  26.193  1.00 37.22  ? 1307 HOH A O     1 
HETATM 10264 O O     . HOH E 3 .   ? -20.128 38.748  50.266  1.00 31.78  ? 1308 HOH A O     1 
HETATM 10265 O O     . HOH E 3 .   ? -25.687 43.005  38.855  1.00 27.46  ? 1309 HOH A O     1 
HETATM 10266 O O     . HOH E 3 .   ? -21.705 36.318  52.590  1.00 25.23  ? 1310 HOH A O     1 
HETATM 10267 O O     . HOH E 3 .   ? -2.430  32.613  26.527  1.00 10.27  ? 1311 HOH A O     1 
HETATM 10268 O O     . HOH E 3 .   ? 0.564   32.382  26.537  1.00 17.24  ? 1312 HOH A O     1 
HETATM 10269 O O     . HOH E 3 .   ? -7.201  25.352  -6.342  1.00 31.38  ? 1313 HOH A O     1 
HETATM 10270 O O     . HOH E 3 .   ? 13.421  12.055  29.323  1.00 27.72  ? 1314 HOH A O     1 
HETATM 10271 O O     . HOH E 3 .   ? 1.696   54.621  31.052  1.00 20.51  ? 1315 HOH A O     1 
HETATM 10272 O O     . HOH E 3 .   ? 5.366   43.046  41.130  1.00 25.40  ? 1316 HOH A O     1 
HETATM 10273 O O     . HOH E 3 .   ? 14.511  49.227  36.408  1.00 28.40  ? 1317 HOH A O     1 
HETATM 10274 O O     . HOH E 3 .   ? 9.404   51.858  11.885  1.00 25.84  ? 1318 HOH A O     1 
HETATM 10275 O O     . HOH E 3 .   ? 13.485  62.402  29.118  1.00 30.97  ? 1319 HOH A O     1 
HETATM 10276 O O     . HOH E 3 .   ? 21.126  56.683  25.810  1.00 22.91  ? 1320 HOH A O     1 
HETATM 10277 O O     . HOH E 3 .   ? 15.388  51.148  34.744  1.00 21.12  ? 1321 HOH A O     1 
HETATM 10278 O O     . HOH E 3 .   ? 20.844  57.191  22.851  1.00 30.95  ? 1322 HOH A O     1 
HETATM 10279 O O     . HOH E 3 .   ? 25.443  48.314  9.708   1.00 23.60  ? 1323 HOH A O     1 
HETATM 10280 O O     . HOH E 3 .   ? 26.231  36.468  7.470   1.00 22.81  ? 1324 HOH A O     1 
HETATM 10281 O O     . HOH E 3 .   ? -7.860  45.239  -1.684  1.00 14.92  ? 1325 HOH A O     1 
HETATM 10282 O O     . HOH E 3 .   ? -11.910 46.445  -2.161  1.00 17.21  ? 1326 HOH A O     1 
HETATM 10283 O O     . HOH E 3 .   ? -25.178 25.840  11.069  1.00 23.14  ? 1327 HOH A O     1 
HETATM 10284 O O     . HOH E 3 .   ? -25.289 26.689  15.967  1.00 30.81  ? 1328 HOH A O     1 
HETATM 10285 O O     . HOH E 3 .   ? -13.268 23.796  18.165  1.00 23.59  ? 1329 HOH A O     1 
HETATM 10286 O O     . HOH E 3 .   ? 3.673   8.229   28.844  1.00 36.00  ? 1330 HOH A O     1 
HETATM 10287 O O     . HOH E 3 .   ? -30.003 34.711  37.357  1.00 26.55  ? 1331 HOH A O     1 
HETATM 10288 O O     . HOH E 3 .   ? 31.830  43.634  18.822  1.00 19.97  ? 1332 HOH A O     1 
HETATM 10289 O O     . HOH E 3 .   ? 6.470   58.896  27.023  1.00 28.86  ? 1333 HOH A O     1 
HETATM 10290 O O     . HOH F 3 .   ? -60.975 45.336  16.453  1.00 34.21  ? 999  HOH B O     1 
HETATM 10291 O O     . HOH F 3 .   ? -33.067 67.004  43.300  1.00 26.47  ? 1000 HOH B O     1 
HETATM 10292 O O     . HOH F 3 .   ? -43.350 64.539  11.975  1.00 24.96  ? 1001 HOH B O     1 
HETATM 10293 O O     . HOH F 3 .   ? -11.928 54.874  14.144  1.00 20.58  ? 1002 HOH B O     1 
HETATM 10294 O O     . HOH F 3 .   ? -9.108  55.922  7.702   1.00 11.69  ? 1003 HOH B O     1 
HETATM 10295 O O     . HOH F 3 .   ? -25.716 41.910  5.053   1.00 7.72   ? 1004 HOH B O     1 
HETATM 10296 O O     . HOH F 3 .   ? -25.967 39.271  5.683   1.00 14.92  ? 1005 HOH B O     1 
HETATM 10297 O O     . HOH F 3 .   ? -5.586  64.296  9.104   1.00 25.30  ? 1006 HOH B O     1 
HETATM 10298 O O     . HOH F 3 .   ? -18.898 79.236  37.306  1.00 22.37  ? 1007 HOH B O     1 
HETATM 10299 O O     . HOH F 3 .   ? -42.969 85.362  38.115  1.00 37.64  ? 1008 HOH B O     1 
HETATM 10300 O O     . HOH F 3 .   ? -50.069 91.824  25.177  1.00 15.22  ? 1009 HOH B O     1 
HETATM 10301 O O     . HOH F 3 .   ? -30.543 95.348  17.716  1.00 19.03  ? 1010 HOH B O     1 
HETATM 10302 O O     . HOH F 3 .   ? -41.087 98.311  16.346  1.00 24.82  ? 1011 HOH B O     1 
HETATM 10303 O O     . HOH F 3 .   ? -47.387 89.590  14.336  1.00 19.70  ? 1012 HOH B O     1 
HETATM 10304 O O     . HOH F 3 .   ? -52.764 86.635  19.958  1.00 27.60  ? 1013 HOH B O     1 
HETATM 10305 O O     . HOH F 3 .   ? -52.663 84.570  13.428  1.00 30.72  ? 1014 HOH B O     1 
HETATM 10306 O O     . HOH F 3 .   ? -52.217 88.146  9.742   1.00 39.54  ? 1015 HOH B O     1 
HETATM 10307 O O     . HOH F 3 .   ? -52.625 81.638  20.924  1.00 26.48  ? 1016 HOH B O     1 
HETATM 10308 O O     . HOH F 3 .   ? -56.760 73.195  19.065  1.00 18.16  ? 1017 HOH B O     1 
HETATM 10309 O O     . HOH F 3 .   ? -42.003 86.357  13.053  1.00 20.60  ? 1018 HOH B O     1 
HETATM 10310 O O     . HOH F 3 .   ? -38.701 96.360  4.230   1.00 35.61  ? 1019 HOH B O     1 
HETATM 10311 O O     . HOH F 3 .   ? -21.110 92.459  17.785  1.00 27.14  ? 1020 HOH B O     1 
HETATM 10312 O O     . HOH F 3 .   ? -20.784 96.300  15.367  1.00 23.71  ? 1021 HOH B O     1 
HETATM 10313 O O     . HOH F 3 .   ? -11.530 87.083  18.579  1.00 23.33  ? 1022 HOH B O     1 
HETATM 10314 O O     . HOH F 3 .   ? -9.387  66.637  10.928  1.00 22.87  ? 1023 HOH B O     1 
HETATM 10315 O O     . HOH F 3 .   ? -8.334  69.059  20.797  1.00 17.20  ? 1024 HOH B O     1 
HETATM 10316 O O     . HOH F 3 .   ? -8.171  78.848  20.240  1.00 22.98  ? 1025 HOH B O     1 
HETATM 10317 O O     . HOH F 3 .   ? -25.860 83.468  -14.267 1.00 38.82  ? 1026 HOH B O     1 
HETATM 10318 O O     . HOH F 3 .   ? -38.107 82.663  2.185   1.00 18.24  ? 1027 HOH B O     1 
HETATM 10319 O O     . HOH F 3 .   ? -35.250 82.655  4.336   1.00 18.41  ? 1028 HOH B O     1 
HETATM 10320 O O     . HOH F 3 .   ? -15.868 66.534  8.243   1.00 10.48  ? 1029 HOH B O     1 
HETATM 10321 O O     . HOH F 3 .   ? -17.673 66.186  10.260  1.00 15.18  ? 1030 HOH B O     1 
HETATM 10322 O O     . HOH F 3 .   ? -12.815 72.443  6.129   1.00 26.60  ? 1031 HOH B O     1 
HETATM 10323 O O     . HOH F 3 .   ? -32.315 79.916  4.555   1.00 24.37  ? 1032 HOH B O     1 
HETATM 10324 O O     . HOH F 3 .   ? -34.121 68.953  6.737   1.00 13.24  ? 1033 HOH B O     1 
HETATM 10325 O O     . HOH F 3 .   ? -31.123 66.847  9.230   1.00 12.15  ? 1034 HOH B O     1 
HETATM 10326 O O     . HOH F 3 .   ? -25.731 68.623  6.775   1.00 21.90  ? 1035 HOH B O     1 
HETATM 10327 O O     . HOH F 3 .   ? -26.737 57.637  10.933  1.00 16.87  ? 1036 HOH B O     1 
HETATM 10328 O O     . HOH F 3 .   ? -29.951 54.403  0.688   1.00 12.20  ? 1037 HOH B O     1 
HETATM 10329 O O     . HOH F 3 .   ? -32.974 56.296  -3.196  1.00 27.54  ? 1038 HOH B O     1 
HETATM 10330 O O     . HOH F 3 .   ? -33.231 94.250  26.048  1.00 34.92  ? 1039 HOH B O     1 
HETATM 10331 O O     . HOH F 3 .   ? -31.164 91.341  25.171  1.00 37.31  ? 1040 HOH B O     1 
HETATM 10332 O O     . HOH F 3 .   ? -22.350 55.697  -6.623  1.00 22.92  ? 1041 HOH B O     1 
HETATM 10333 O O     . HOH F 3 .   ? -23.774 58.096  5.552   1.00 31.10  ? 1042 HOH B O     1 
HETATM 10334 O O     . HOH F 3 .   ? -13.845 72.850  -3.121  1.00 11.25  ? 1043 HOH B O     1 
HETATM 10335 O O     . HOH F 3 .   ? -12.414 64.949  -3.947  1.00 16.14  ? 1044 HOH B O     1 
HETATM 10336 O O     . HOH F 3 .   ? -16.110 64.798  -15.848 1.00 40.76  ? 1045 HOH B O     1 
HETATM 10337 O O     . HOH F 3 .   ? -19.952 70.394  -14.293 1.00 17.62  ? 1046 HOH B O     1 
HETATM 10338 O O     . HOH F 3 .   ? -17.444 92.039  1.369   1.00 29.73  ? 1047 HOH B O     1 
HETATM 10339 O O     . HOH F 3 .   ? -44.937 86.045  4.393   1.00 32.29  ? 1048 HOH B O     1 
HETATM 10340 O O     . HOH F 3 .   ? -32.645 73.180  7.690   1.00 15.48  ? 1049 HOH B O     1 
HETATM 10341 O O     . HOH F 3 .   ? -33.814 68.291  14.622  1.00 9.30   ? 1050 HOH B O     1 
HETATM 10342 O O     . HOH F 3 .   ? -35.053 65.815  15.368  1.00 5.15   ? 1051 HOH B O     1 
HETATM 10343 O O     . HOH F 3 .   ? -36.303 63.542  14.111  1.00 13.81  ? 1052 HOH B O     1 
HETATM 10344 O O     . HOH F 3 .   ? -41.564 60.005  11.392  1.00 16.53  ? 1053 HOH B O     1 
HETATM 10345 O O     . HOH F 3 .   ? -42.899 57.268  12.767  1.00 16.48  ? 1054 HOH B O     1 
HETATM 10346 O O     . HOH F 3 .   ? -47.675 55.409  10.477  1.00 19.50  ? 1055 HOH B O     1 
HETATM 10347 O O     . HOH F 3 .   ? -44.118 61.990  11.057  1.00 17.13  ? 1056 HOH B O     1 
HETATM 10348 O O     . HOH F 3 .   ? -40.642 80.061  13.656  1.00 17.40  ? 1057 HOH B O     1 
HETATM 10349 O O     . HOH F 3 .   ? -40.355 82.808  13.422  1.00 9.38   ? 1058 HOH B O     1 
HETATM 10350 O O     . HOH F 3 .   ? -35.870 80.040  18.364  1.00 16.57  ? 1059 HOH B O     1 
HETATM 10351 O O     . HOH F 3 .   ? -12.637 85.109  20.814  1.00 44.20  ? 1060 HOH B O     1 
HETATM 10352 O O     . HOH F 3 .   ? -12.692 86.282  23.345  1.00 19.04  ? 1061 HOH B O     1 
HETATM 10353 O O     . HOH F 3 .   ? -20.758 75.994  19.573  1.00 14.05  ? 1062 HOH B O     1 
HETATM 10354 O O     . HOH F 3 .   ? -19.178 71.215  17.766  1.00 7.22   ? 1063 HOH B O     1 
HETATM 10355 O O     . HOH F 3 .   ? -19.417 68.206  17.931  1.00 16.29  ? 1064 HOH B O     1 
HETATM 10356 O O     . HOH F 3 .   ? -21.441 65.858  14.818  1.00 12.26  ? 1065 HOH B O     1 
HETATM 10357 O O     . HOH F 3 .   ? -18.844 67.063  15.491  1.00 17.99  ? 1066 HOH B O     1 
HETATM 10358 O O     . HOH F 3 .   ? -23.785 66.467  21.256  1.00 22.26  ? 1067 HOH B O     1 
HETATM 10359 O O     . HOH F 3 .   ? -16.544 86.824  21.772  1.00 29.34  ? 1068 HOH B O     1 
HETATM 10360 O O     . HOH F 3 .   ? -12.899 63.091  17.166  1.00 17.50  ? 1069 HOH B O     1 
HETATM 10361 O O     . HOH F 3 .   ? -7.728  62.704  22.545  1.00 13.88  ? 1070 HOH B O     1 
HETATM 10362 O O     . HOH F 3 .   ? -8.026  59.366  28.512  1.00 13.21  ? 1071 HOH B O     1 
HETATM 10363 O O     . HOH F 3 .   ? -13.355 64.554  27.894  1.00 13.59  ? 1072 HOH B O     1 
HETATM 10364 O O     . HOH F 3 .   ? -23.636 57.030  25.771  1.00 19.48  ? 1073 HOH B O     1 
HETATM 10365 O O     . HOH F 3 .   ? -22.178 55.838  31.900  1.00 7.16   ? 1074 HOH B O     1 
HETATM 10366 O O     . HOH F 3 .   ? -17.482 55.088  27.132  1.00 16.72  ? 1075 HOH B O     1 
HETATM 10367 O O     . HOH F 3 .   ? -14.888 59.493  37.262  1.00 12.23  ? 1076 HOH B O     1 
HETATM 10368 O O     . HOH F 3 .   ? -12.100 56.108  37.004  1.00 16.61  ? 1077 HOH B O     1 
HETATM 10369 O O     . HOH F 3 .   ? -9.974  74.898  30.389  1.00 25.61  ? 1078 HOH B O     1 
HETATM 10370 O O     . HOH F 3 .   ? -14.787 75.899  36.276  1.00 11.53  ? 1079 HOH B O     1 
HETATM 10371 O O     . HOH F 3 .   ? -14.285 73.154  35.191  1.00 14.70  ? 1080 HOH B O     1 
HETATM 10372 O O     . HOH F 3 .   ? -30.657 67.214  29.232  1.00 12.60  ? 1081 HOH B O     1 
HETATM 10373 O O     . HOH F 3 .   ? -28.229 60.160  31.677  1.00 18.45  ? 1082 HOH B O     1 
HETATM 10374 O O     . HOH F 3 .   ? -19.903 72.327  37.893  1.00 13.64  ? 1083 HOH B O     1 
HETATM 10375 O O     . HOH F 3 .   ? -29.745 71.509  35.515  1.00 9.60   ? 1084 HOH B O     1 
HETATM 10376 O O     . HOH F 3 .   ? -31.105 68.637  35.327  1.00 12.92  ? 1085 HOH B O     1 
HETATM 10377 O O     . HOH F 3 .   ? -36.302 79.644  32.535  1.00 22.22  ? 1086 HOH B O     1 
HETATM 10378 O O     . HOH F 3 .   ? -29.145 83.910  35.050  1.00 19.21  ? 1087 HOH B O     1 
HETATM 10379 O O     . HOH F 3 .   ? -27.652 77.908  39.307  1.00 18.60  ? 1088 HOH B O     1 
HETATM 10380 O O     . HOH F 3 .   ? -27.816 85.568  41.522  1.00 24.89  ? 1089 HOH B O     1 
HETATM 10381 O O     . HOH F 3 .   ? -36.794 82.126  40.600  1.00 23.86  ? 1090 HOH B O     1 
HETATM 10382 O O     . HOH F 3 .   ? -29.575 68.327  43.326  1.00 17.40  ? 1091 HOH B O     1 
HETATM 10383 O O     . HOH F 3 .   ? -36.250 67.346  33.635  1.00 9.37   ? 1092 HOH B O     1 
HETATM 10384 O O     . HOH F 3 .   ? -46.535 79.891  25.938  1.00 9.78   ? 1093 HOH B O     1 
HETATM 10385 O O     . HOH F 3 .   ? -45.909 76.091  35.506  1.00 20.60  ? 1094 HOH B O     1 
HETATM 10386 O O     . HOH F 3 .   ? -54.291 60.202  32.602  1.00 29.35  ? 1095 HOH B O     1 
HETATM 10387 O O     . HOH F 3 .   ? -53.238 61.144  25.086  1.00 27.13  ? 1096 HOH B O     1 
HETATM 10388 O O     . HOH F 3 .   ? -47.141 65.972  5.139   1.00 37.83  ? 1097 HOH B O     1 
HETATM 10389 O O     . HOH F 3 .   ? -52.225 66.760  19.241  1.00 18.93  ? 1098 HOH B O     1 
HETATM 10390 O O     . HOH F 3 .   ? -53.027 69.150  21.532  1.00 17.36  ? 1099 HOH B O     1 
HETATM 10391 O O     . HOH F 3 .   ? -43.178 66.764  19.265  1.00 17.85  ? 1100 HOH B O     1 
HETATM 10392 O O     . HOH F 3 .   ? -46.002 75.066  40.689  1.00 39.01  ? 1101 HOH B O     1 
HETATM 10393 O O     . HOH F 3 .   ? -33.557 58.295  25.695  1.00 26.48  ? 1102 HOH B O     1 
HETATM 10394 O O     . HOH F 3 .   ? -41.617 42.973  2.476   1.00 5.01   ? 1103 HOH B O     1 
HETATM 10395 O O     . HOH F 3 .   ? -41.203 44.047  0.279   1.00 23.12  ? 1104 HOH B O     1 
HETATM 10396 O O     . HOH F 3 .   ? -42.737 41.378  1.104   1.00 23.58  ? 1105 HOH B O     1 
HETATM 10397 O O     . HOH F 3 .   ? -44.018 43.537  2.018   1.00 34.93  ? 1106 HOH B O     1 
HETATM 10398 O O     . HOH F 3 .   ? -40.068 48.823  26.226  1.00 23.55  ? 1107 HOH B O     1 
HETATM 10399 O O     . HOH F 3 .   ? -37.583 52.674  26.984  1.00 8.83   ? 1108 HOH B O     1 
HETATM 10400 O O     . HOH F 3 .   ? -47.004 37.738  13.503  1.00 18.07  ? 1109 HOH B O     1 
HETATM 10401 O O     . HOH F 3 .   ? -39.816 33.071  11.576  1.00 22.54  ? 1110 HOH B O     1 
HETATM 10402 O O     . HOH F 3 .   ? -46.202 35.881  3.538   1.00 17.94  ? 1111 HOH B O     1 
HETATM 10403 O O     . HOH F 3 .   ? -44.032 34.414  0.816   1.00 11.98  ? 1112 HOH B O     1 
HETATM 10404 O O     . HOH F 3 .   ? -29.204 44.303  3.605   1.00 12.65  ? 1113 HOH B O     1 
HETATM 10405 O O     . HOH F 3 .   ? -37.977 53.552  4.870   1.00 34.97  ? 1114 HOH B O     1 
HETATM 10406 O O     . HOH F 3 .   ? -25.649 49.706  10.862  1.00 19.66  ? 1115 HOH B O     1 
HETATM 10407 O O     . HOH F 3 .   ? -29.044 56.587  16.878  1.00 22.09  ? 1116 HOH B O     1 
HETATM 10408 O O     . HOH F 3 .   ? -44.159 33.050  16.881  1.00 20.03  ? 1117 HOH B O     1 
HETATM 10409 O O     . HOH F 3 .   ? -44.836 30.635  15.973  1.00 29.96  ? 1118 HOH B O     1 
HETATM 10410 O O     . HOH F 3 .   ? -26.566 32.343  8.455   1.00 17.75  ? 1119 HOH B O     1 
HETATM 10411 O O     . HOH F 3 .   ? -17.762 51.964  33.436  1.00 17.60  ? 1120 HOH B O     1 
HETATM 10412 O O     . HOH F 3 .   ? -54.823 84.469  14.895  1.00 38.15  ? 1121 HOH B O     1 
HETATM 10413 O O     . HOH F 3 .   ? -21.842 96.998  11.041  1.00 23.56  ? 1122 HOH B O     1 
HETATM 10414 O O     . HOH F 3 .   ? -6.735  64.377  16.783  1.00 16.26  ? 1123 HOH B O     1 
HETATM 10415 O O     . HOH F 3 .   ? -6.252  64.412  19.534  1.00 19.33  ? 1124 HOH B O     1 
HETATM 10416 O O     . HOH F 3 .   ? -4.523  73.923  15.794  1.00 28.14  ? 1125 HOH B O     1 
HETATM 10417 O O     . HOH F 3 .   ? -16.267 91.073  5.177   1.00 40.63  ? 1126 HOH B O     1 
HETATM 10418 O O     . HOH F 3 .   ? -18.129 60.270  -1.421  1.00 17.73  ? 1127 HOH B O     1 
HETATM 10419 O O     . HOH F 3 .   ? -16.810 66.350  -19.431 1.00 27.39  ? 1128 HOH B O     1 
HETATM 10420 O O     . HOH F 3 .   ? -16.706 73.087  -10.813 1.00 17.72  ? 1129 HOH B O     1 
HETATM 10421 O O     . HOH F 3 .   ? -24.609 95.143  4.732   1.00 31.89  ? 1130 HOH B O     1 
HETATM 10422 O O     . HOH F 3 .   ? -43.994 65.660  13.891  1.00 27.79  ? 1131 HOH B O     1 
HETATM 10423 O O     . HOH F 3 .   ? -45.222 63.883  16.152  1.00 25.84  ? 1132 HOH B O     1 
HETATM 10424 O O     . HOH F 3 .   ? -28.466 85.236  32.706  1.00 18.70  ? 1133 HOH B O     1 
HETATM 10425 O O     . HOH F 3 .   ? -16.090 87.600  28.281  1.00 39.85  ? 1134 HOH B O     1 
HETATM 10426 O O     . HOH F 3 .   ? -9.719  80.630  22.357  1.00 24.68  ? 1135 HOH B O     1 
HETATM 10427 O O     . HOH F 3 .   ? -5.985  61.279  26.492  1.00 21.62  ? 1136 HOH B O     1 
HETATM 10428 O O     . HOH F 3 .   ? -7.164  75.770  31.134  1.00 23.97  ? 1137 HOH B O     1 
HETATM 10429 O O     . HOH F 3 .   ? -5.029  64.723  28.011  1.00 21.82  ? 1138 HOH B O     1 
HETATM 10430 O O     . HOH F 3 .   ? -18.464 77.933  43.436  1.00 21.20  ? 1139 HOH B O     1 
HETATM 10431 O O     . HOH F 3 .   ? -31.633 71.555  37.521  1.00 14.70  ? 1140 HOH B O     1 
HETATM 10432 O O     . HOH F 3 .   ? -28.364 66.343  43.729  1.00 25.07  ? 1141 HOH B O     1 
HETATM 10433 O O     . HOH F 3 .   ? -34.683 62.598  37.141  1.00 28.92  ? 1142 HOH B O     1 
HETATM 10434 O O     . HOH F 3 .   ? -47.297 84.299  25.039  1.00 28.49  ? 1143 HOH B O     1 
HETATM 10435 O O     . HOH F 3 .   ? -50.714 71.675  35.214  1.00 13.41  ? 1144 HOH B O     1 
HETATM 10436 O O     . HOH F 3 .   ? -58.320 65.412  37.097  1.00 23.69  ? 1145 HOH B O     1 
HETATM 10437 O O     . HOH F 3 .   ? -52.111 62.808  34.718  1.00 20.41  ? 1146 HOH B O     1 
HETATM 10438 O O     . HOH F 3 .   ? -49.412 60.884  32.149  1.00 23.62  ? 1147 HOH B O     1 
HETATM 10439 O O     . HOH F 3 .   ? -53.450 71.512  4.939   1.00 28.72  ? 1148 HOH B O     1 
HETATM 10440 O O     . HOH F 3 .   ? -58.821 75.999  26.424  1.00 35.04  ? 1149 HOH B O     1 
HETATM 10441 O O     . HOH F 3 .   ? -41.778 52.313  22.139  1.00 11.48  ? 1150 HOH B O     1 
HETATM 10442 O O     . HOH F 3 .   ? -33.245 61.427  13.840  1.00 13.68  ? 1151 HOH B O     1 
HETATM 10443 O O     . HOH F 3 .   ? -32.460 63.559  15.836  1.00 14.60  ? 1152 HOH B O     1 
HETATM 10444 O O     . HOH F 3 .   ? -29.320 55.657  30.039  1.00 17.68  ? 1153 HOH B O     1 
HETATM 10445 O O     . HOH F 3 .   ? -28.265 48.544  28.909  1.00 30.41  ? 1154 HOH B O     1 
HETATM 10446 O O     . HOH F 3 .   ? -41.259 35.047  10.930  1.00 21.84  ? 1155 HOH B O     1 
HETATM 10447 O O     . HOH F 3 .   ? -30.573 35.642  3.312   1.00 24.17  ? 1156 HOH B O     1 
HETATM 10448 O O     . HOH F 3 .   ? -27.228 38.516  3.188   1.00 17.48  ? 1157 HOH B O     1 
HETATM 10449 O O     . HOH F 3 .   ? -26.642 54.122  5.040   1.00 24.81  ? 1158 HOH B O     1 
HETATM 10450 O O     . HOH F 3 .   ? -29.546 52.562  16.538  1.00 22.65  ? 1159 HOH B O     1 
HETATM 10451 O O     . HOH F 3 .   ? -27.909 48.888  16.684  1.00 20.45  ? 1160 HOH B O     1 
HETATM 10452 O O     . HOH F 3 .   ? -25.524 46.940  10.690  1.00 29.77  ? 1161 HOH B O     1 
HETATM 10453 O O     . HOH F 3 .   ? -36.500 34.008  20.378  1.00 24.61  ? 1162 HOH B O     1 
HETATM 10454 O O     . HOH F 3 .   ? -37.591 31.320  20.416  1.00 33.75  ? 1163 HOH B O     1 
HETATM 10455 O O     . HOH F 3 .   ? -14.263 54.623  6.654   1.00 21.02  ? 1164 HOH B O     1 
HETATM 10456 O O     . HOH F 3 .   ? -25.909 74.321  47.186  1.00 33.72  ? 1165 HOH B O     1 
HETATM 10457 O O     . HOH F 3 .   ? -23.463 67.338  45.145  1.00 20.40  ? 1166 HOH B O     1 
HETATM 10458 O O     . HOH F 3 .   ? -21.146 83.874  33.340  1.00 29.43  ? 1167 HOH B O     1 
HETATM 10459 O O     . HOH F 3 .   ? -36.067 93.213  34.655  1.00 24.89  ? 1168 HOH B O     1 
HETATM 10460 O O     . HOH F 3 .   ? -50.453 85.319  27.392  1.00 38.60  ? 1169 HOH B O     1 
HETATM 10461 O O     . HOH F 3 .   ? -32.534 93.680  23.636  1.00 19.80  ? 1170 HOH B O     1 
HETATM 10462 O O     . HOH F 3 .   ? -26.824 91.108  22.191  1.00 21.53  ? 1171 HOH B O     1 
HETATM 10463 O O     . HOH F 3 .   ? -57.651 70.829  10.195  1.00 51.59  ? 1172 HOH B O     1 
HETATM 10464 O O     . HOH F 3 .   ? -33.108 86.252  6.403   1.00 20.92  ? 1173 HOH B O     1 
HETATM 10465 O O     . HOH F 3 .   ? -35.486 84.847  6.080   1.00 25.66  ? 1174 HOH B O     1 
HETATM 10466 O O     . HOH F 3 .   ? -24.773 95.061  17.537  1.00 23.48  ? 1175 HOH B O     1 
HETATM 10467 O O     . HOH F 3 .   ? -10.739 83.230  20.284  1.00 27.87  ? 1176 HOH B O     1 
HETATM 10468 O O     . HOH F 3 .   ? -6.555  61.477  12.704  1.00 24.62  ? 1177 HOH B O     1 
HETATM 10469 O O     . HOH F 3 .   ? -8.411  64.710  9.324   1.00 23.24  ? 1178 HOH B O     1 
HETATM 10470 O O     . HOH F 3 .   ? -8.392  71.201  6.738   1.00 24.88  ? 1179 HOH B O     1 
HETATM 10471 O O     . HOH F 3 .   ? -40.303 83.092  0.487   1.00 23.16  ? 1180 HOH B O     1 
HETATM 10472 O O     . HOH F 3 .   ? -38.304 73.756  -7.391  1.00 29.27  ? 1181 HOH B O     1 
HETATM 10473 O O     . HOH F 3 .   ? -22.210 61.671  11.326  1.00 23.25  ? 1182 HOH B O     1 
HETATM 10474 O O     . HOH F 3 .   ? -26.133 60.621  -9.814  1.00 20.69  ? 1183 HOH B O     1 
HETATM 10475 O O     . HOH F 3 .   ? -23.728 60.032  -10.595 1.00 22.08  ? 1184 HOH B O     1 
HETATM 10476 O O     . HOH F 3 .   ? -33.127 65.673  -10.434 1.00 22.37  ? 1185 HOH B O     1 
HETATM 10477 O O     . HOH F 3 .   ? -17.449 70.673  -14.330 1.00 25.73  ? 1186 HOH B O     1 
HETATM 10478 O O     . HOH F 3 .   ? -11.323 70.302  -8.545  1.00 43.73  ? 1187 HOH B O     1 
HETATM 10479 O O     . HOH F 3 .   ? -20.560 81.687  -9.264  1.00 31.88  ? 1188 HOH B O     1 
HETATM 10480 O O     . HOH F 3 .   ? -25.501 65.857  17.640  1.00 16.97  ? 1189 HOH B O     1 
HETATM 10481 O O     . HOH F 3 .   ? -25.615 63.568  15.896  1.00 14.66  ? 1190 HOH B O     1 
HETATM 10482 O O     . HOH F 3 .   ? -4.644  77.522  25.385  1.00 19.57  ? 1191 HOH B O     1 
HETATM 10483 O O     . HOH F 3 .   ? -29.178 64.237  23.442  1.00 28.10  ? 1192 HOH B O     1 
HETATM 10484 O O     . HOH F 3 .   ? -22.582 56.640  23.194  1.00 20.25  ? 1193 HOH B O     1 
HETATM 10485 O O     . HOH F 3 .   ? -5.566  64.778  35.695  1.00 18.55  ? 1194 HOH B O     1 
HETATM 10486 O O     . HOH F 3 .   ? -32.115 64.964  42.023  1.00 27.58  ? 1195 HOH B O     1 
HETATM 10487 O O     . HOH F 3 .   ? -23.403 75.198  40.408  1.00 21.65  ? 1196 HOH B O     1 
HETATM 10488 O O     . HOH F 3 .   ? -33.307 81.486  43.109  1.00 20.81  ? 1197 HOH B O     1 
HETATM 10489 O O     . HOH F 3 .   ? -51.325 61.136  24.768  1.00 23.66  ? 1198 HOH B O     1 
HETATM 10490 O O     . HOH F 3 .   ? -50.018 59.776  28.140  1.00 23.74  ? 1199 HOH B O     1 
HETATM 10491 O O     . HOH F 3 .   ? -49.181 78.888  12.134  1.00 26.22  ? 1200 HOH B O     1 
HETATM 10492 O O     . HOH F 3 .   ? -38.476 67.133  43.153  1.00 19.98  ? 1201 HOH B O     1 
HETATM 10493 O O     . HOH F 3 .   ? -32.726 38.575  0.892   1.00 27.39  ? 1202 HOH B O     1 
HETATM 10494 O O     . HOH F 3 .   ? -48.245 37.922  7.839   1.00 19.63  ? 1203 HOH B O     1 
HETATM 10495 O O     . HOH F 3 .   ? -35.050 33.066  4.334   1.00 19.44  ? 1204 HOH B O     1 
HETATM 10496 O O     . HOH F 3 .   ? -31.141 34.965  14.050  1.00 21.48  ? 1205 HOH B O     1 
HETATM 10497 O O     . HOH F 3 .   ? -23.136 45.017  15.183  1.00 19.01  ? 1206 HOH B O     1 
HETATM 10498 O O     . HOH F 3 .   ? -26.346 49.013  5.006   1.00 22.97  ? 1207 HOH B O     1 
HETATM 10499 O O     . HOH F 3 .   ? -28.956 46.677  2.516   1.00 13.17  ? 1208 HOH B O     1 
HETATM 10500 O O     . HOH F 3 .   ? -35.497 36.038  17.798  1.00 22.59  ? 1209 HOH B O     1 
HETATM 10501 O O     . HOH F 3 .   ? -51.138 47.985  12.962  1.00 24.51  ? 1210 HOH B O     1 
HETATM 10502 O O     . HOH F 3 .   ? -30.870 68.860  18.253  1.00 34.39  ? 1211 HOH B O     1 
HETATM 10503 O O