data_2P2B
# 
_entry.id   2P2B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2P2B         pdb_00002p2b 10.2210/pdb2p2b/pdb 
RCSB  RCSB041877   ?            ?                   
WWPDB D_1000041877 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P20 . unspecified 
PDB 2P2F . unspecified 
PDB 2P2J . unspecified 
PDB 2P2M . unspecified 
PDB 2P2Q . unspecified 
# 
_pdbx_database_status.entry_id                        2P2B 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reger, A.S.'  1 ? 
primary 'Carney, J.M.' 2 ? 
primary 'Gulick, A.M.' 3 ? 
# 
_cell.entry_id           2P2B 
_cell.length_a           59.915 
_cell.length_b           143.076 
_cell.length_c           71.379 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P2B 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase'            72208.422 2   6.2.1.1 V386A ? ? 
2 non-polymer syn 'COENZYME A'                              767.534   2   ?       ?     ? ? 
3 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
4 water       nat water                                     18.015    310 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSAGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSAGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 ALA n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'according to Biochemistry, 41, 2379.' 
3 1 sample ? ? ? ? ? 'Sigma-Aldrich, C-4780'                
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P2B A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P2B B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P2B ALA A 386 ? UNP Q8ZKF6 VAL 386 'engineered mutation' 386 1 
2 2P2B ALA B 386 ? UNP Q8ZKF6 VAL 386 'engineered mutation' 386 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'                              ?                              'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'          115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P'     389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'         117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P2B 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Propyl-AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2003-03-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.10 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
# 
_reflns.entry_id                     2P2B 
_reflns.d_resolution_high            2.200 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   59117 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_netI_over_sigmaI        12.400 
_reflns.pdbx_chi_squared             0.574 
_reflns.percent_possible_obs         96.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.148 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.346 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5617 
_reflns_shell.percent_possible_all   92.60 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P2B 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    96.880 
_refine.ls_number_reflns_obs                     58947 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.168 
_refine.ls_R_factor_R_work                       0.166 
_refine.ls_R_factor_R_free                       0.211 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2980 
_refine.B_iso_mean                               24.898 
_refine.aniso_B[1][1]                            -0.760 
_refine.aniso_B[2][2]                            -0.350 
_refine.aniso_B[3][3]                            1.070 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -1.250 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.pdbx_overall_ESU_R                       0.311 
_refine.pdbx_overall_ESU_R_Free                  0.205 
_refine.overall_SU_ML                            0.136 
_refine.overall_SU_B                             10.442 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1PG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9805 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         148 
_refine_hist.number_atoms_solvent             310 
_refine_hist.number_atoms_total               10263 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10225 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      13974 1.349  1.958  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1268  6.109  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   442   35.359 23.824 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1535  14.105 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   59    18.778 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1520  0.090  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7839  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4721  0.196  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6850  0.303  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    547   0.133  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   53    0.197  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 13    0.312  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6471  0.634  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10157 1.049  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4388  1.743  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3817  2.766  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               92.370 
_refine_ls_shell.number_reflns_R_work             3914 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.177 
_refine_ls_shell.R_factor_R_free                  0.243 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             204 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                4118 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P2B 
_struct.title                     'Acetyl-CoA Synthetase, V386A mutation' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P2B 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? GLY A 128 ? TYR A 110 GLY A 128 1 ? 19 
HELX_P HELX_P8  8  VAL A 142 ? GLY A 156 ? VAL A 142 GLY A 156 1 ? 15 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 LEU A 198 ? ASN A 208 ? LEU A 198 ASN A 208 1 ? 11 
HELX_P HELX_P11 11 TRP A 237 ? ALA A 244 ? TRP A 237 ALA A 244 1 ? 8  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? TYR A 315 ? TRP A 309 TYR A 315 1 ? 7  
HELX_P HELX_P14 14 LEU A 317 ? GLY A 324 ? LEU A 317 GLY A 324 1 ? 8  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? ALA A 366 ? ALA A 357 ALA A 366 1 ? 10 
HELX_P HELX_P17 17 GLU A 367 ? ILE A 372 ? GLU A 367 ILE A 372 5 ? 6  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? ALA A 538 ? THR A 529 ALA A 538 1 ? 10 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? GLY A 621 ? MET A 611 GLY A 621 1 ? 11 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 LEU B 198 ? LEU B 206 ? LEU B 198 LEU B 206 1 ? 9  
HELX_P HELX_P36 36 TRP B 237 ? GLU B 242 ? TRP B 237 GLU B 242 1 ? 6  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? TYR B 315 ? TRP B 309 TYR B 315 1 ? 7  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? HIS B 539 ? THR B 529 HIS B 539 1 ? 11 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 ASP B 628 ? LEU B 632 ? ASP B 628 LEU B 632 5 ? 5  
HELX_P HELX_P51 51 GLY B 636 ? ALA B 647 ? GLY B 636 ALA B 647 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 6.12 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 9.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 8 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? SER A 59  ? LYS A 56  SER A 59  
A 2 SER A 66  ? TRP A 69  ? SER A 66  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? ALA A 386 ? ILE A 382 ALA A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLU A 188 ? ARG A 191 ? GLU A 188 ARG A 191 
E 2 ARG A 194 ? PRO A 197 ? ARG A 194 PRO A 197 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? ALA B 386 ? ILE B 382 ALA B 386 
K 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
L 1 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
L 2 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 5 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 6 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
L 7 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
L 8 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
M 1 GLU B 188 ? ARG B 191 ? GLU B 188 ARG B 191 
M 2 ARG B 194 ? PRO B 197 ? ARG B 194 PRO B 197 
N 1 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
N 2 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
N 3 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
N 4 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
O 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
O 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
P 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
P 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
P 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 57  ? N ASN A 57  O LYS A 68  ? O LYS A 68  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O THR A 326 ? O THR A 326 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O TYR A 355 ? O TYR A 355 
C 5 6 N LEU A 354 ? N LEU A 354 O ILE A 382 ? O ILE A 382 
C 6 7 N LEU A 383 ? N LEU A 383 O VAL A 410 ? O VAL A 410 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N THR A 185 ? N THR A 185 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 259 ? N LEU A 259 O HIS A 276 ? O HIS A 276 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N ARG A 191 ? N ARG A 191 O ARG A 194 ? O ARG A 194 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
F 3 4 N GLY A 501 ? N GLY A 501 O GLY A 514 ? O GLY A 514 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N GLU A 544 ? N GLU A 544 O THR A 564 ? O THR A 564 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N ASN B 57  ? N ASN B 57  O LYS B 68  ? O LYS B 68  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O ILE B 108 ? O ILE B 108 N ILE B 95  ? N ILE B 95  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
K 5 6 N LEU B 354 ? N LEU B 354 O GLY B 384 ? O GLY B 384 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O LEU B 235 ? O LEU B 235 N VAL B 219 ? N VAL B 219 
L 2 3 O ILE B 218 ? O ILE B 218 N THR B 185 ? N THR B 185 
L 3 4 O ILE B 184 ? O ILE B 184 N TYR B 138 ? N TYR B 138 
L 4 5 N VAL B 135 ? N VAL B 135 O SER B 160 ? O SER B 160 
L 5 6 N HIS B 159 ? N HIS B 159 O ILE B 261 ? O ILE B 261 
L 6 7 N LEU B 259 ? N LEU B 259 O HIS B 276 ? O HIS B 276 
L 7 8 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
M 1 2 N GLY B 189 ? N GLY B 189 O ILE B 196 ? O ILE B 196 
N 1 2 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
N 2 3 N ILE B 466 ? N ILE B 466 O TYR B 496 ? O TYR B 496 
N 3 4 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
O 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
P 1 2 N VAL B 548 ? N VAL B 548 O TYR B 560 ? O TYR B 560 
P 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A COA 990 ? 17 'BINDING SITE FOR RESIDUE COA A 990' 
AC2 Software B COA 991 ? 14 'BINDING SITE FOR RESIDUE COA B 991' 
AC3 Software A PRX 999 ? 15 'BINDING SITE FOR RESIDUE PRX A 999' 
AC4 Software B PRX 998 ? 15 'BINDING SITE FOR RESIDUE PRX B 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 PHE A 163 ? PHE A 163  . ? 1_555 ? 
2  AC1 17 GLY A 164 ? GLY A 164  . ? 1_555 ? 
3  AC1 17 GLY A 165 ? GLY A 165  . ? 1_555 ? 
4  AC1 17 ARG A 191 ? ARG A 191  . ? 1_555 ? 
5  AC1 17 ARG A 194 ? ARG A 194  . ? 1_555 ? 
6  AC1 17 ILE A 196 ? ILE A 196  . ? 1_555 ? 
7  AC1 17 VAL A 333 ? VAL A 333  . ? 1_555 ? 
8  AC1 17 PRO A 334 ? PRO A 334  . ? 1_555 ? 
9  AC1 17 ASN A 335 ? ASN A 335  . ? 1_555 ? 
10 AC1 17 ALA A 360 ? ALA A 360  . ? 1_555 ? 
11 AC1 17 ALA A 363 ? ALA A 363  . ? 1_555 ? 
12 AC1 17 SER A 523 ? SER A 523  . ? 1_555 ? 
13 AC1 17 HIS A 525 ? HIS A 525  . ? 1_555 ? 
14 AC1 17 ARG A 584 ? ARG A 584  . ? 1_555 ? 
15 AC1 17 PRO A 589 ? PRO A 589  . ? 1_555 ? 
16 AC1 17 HOH G .   ? HOH A 1139 . ? 1_555 ? 
17 AC1 17 HOH G .   ? HOH A 1140 . ? 1_555 ? 
18 AC2 14 PHE B 163 ? PHE B 163  . ? 1_555 ? 
19 AC2 14 GLY B 164 ? GLY B 164  . ? 1_555 ? 
20 AC2 14 GLY B 165 ? GLY B 165  . ? 1_555 ? 
21 AC2 14 ARG B 191 ? ARG B 191  . ? 1_555 ? 
22 AC2 14 ALA B 192 ? ALA B 192  . ? 1_555 ? 
23 AC2 14 ARG B 194 ? ARG B 194  . ? 1_555 ? 
24 AC2 14 ILE B 196 ? ILE B 196  . ? 1_555 ? 
25 AC2 14 VAL B 333 ? VAL B 333  . ? 1_555 ? 
26 AC2 14 PRO B 334 ? PRO B 334  . ? 1_555 ? 
27 AC2 14 ASN B 335 ? ASN B 335  . ? 1_555 ? 
28 AC2 14 TRP B 336 ? TRP B 336  . ? 1_555 ? 
29 AC2 14 SER B 523 ? SER B 523  . ? 1_555 ? 
30 AC2 14 ARG B 584 ? ARG B 584  . ? 1_555 ? 
31 AC2 14 PRO B 589 ? PRO B 589  . ? 1_555 ? 
32 AC3 15 VAL A 310 ? VAL A 310  . ? 1_555 ? 
33 AC3 15 THR A 311 ? THR A 311  . ? 1_555 ? 
34 AC3 15 GLY A 387 ? GLY A 387  . ? 1_555 ? 
35 AC3 15 GLU A 388 ? GLU A 388  . ? 1_555 ? 
36 AC3 15 PRO A 389 ? PRO A 389  . ? 1_555 ? 
37 AC3 15 ASP A 411 ? ASP A 411  . ? 1_555 ? 
38 AC3 15 THR A 412 ? THR A 412  . ? 1_555 ? 
39 AC3 15 TRP A 413 ? TRP A 413  . ? 1_555 ? 
40 AC3 15 TRP A 414 ? TRP A 414  . ? 1_555 ? 
41 AC3 15 GLN A 415 ? GLN A 415  . ? 1_555 ? 
42 AC3 15 THR A 416 ? THR A 416  . ? 1_555 ? 
43 AC3 15 ASP A 500 ? ASP A 500  . ? 1_555 ? 
44 AC3 15 ARG A 515 ? ARG A 515  . ? 1_555 ? 
45 AC3 15 ARG A 526 ? ARG A 526  . ? 1_555 ? 
46 AC3 15 HOH G .   ? HOH A 1155 . ? 1_555 ? 
47 AC4 15 THR B 311 ? THR B 311  . ? 1_555 ? 
48 AC4 15 GLY B 387 ? GLY B 387  . ? 1_555 ? 
49 AC4 15 GLU B 388 ? GLU B 388  . ? 1_555 ? 
50 AC4 15 PRO B 389 ? PRO B 389  . ? 1_555 ? 
51 AC4 15 ASP B 411 ? ASP B 411  . ? 1_555 ? 
52 AC4 15 THR B 412 ? THR B 412  . ? 1_555 ? 
53 AC4 15 TRP B 413 ? TRP B 413  . ? 1_555 ? 
54 AC4 15 TRP B 414 ? TRP B 414  . ? 1_555 ? 
55 AC4 15 GLN B 415 ? GLN B 415  . ? 1_555 ? 
56 AC4 15 THR B 416 ? THR B 416  . ? 1_555 ? 
57 AC4 15 ASP B 500 ? ASP B 500  . ? 1_555 ? 
58 AC4 15 ARG B 515 ? ARG B 515  . ? 1_555 ? 
59 AC4 15 ARG B 526 ? ARG B 526  . ? 1_555 ? 
60 AC4 15 HOH H .   ? HOH B 1070 . ? 1_555 ? 
61 AC4 15 HOH H .   ? HOH B 1110 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P2B 
_atom_sites.fract_transf_matrix[1][1]   0.016690 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000283 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006989 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014012 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . HIS A 1 5   ? 18.082  146.075 42.970  1.00 35.76 ? 5    HIS A N     1 
ATOM   2     C CA    . HIS A 1 5   ? 18.075  147.007 41.795  1.00 35.74 ? 5    HIS A CA    1 
ATOM   3     C C     . HIS A 1 5   ? 19.265  146.803 40.833  1.00 35.08 ? 5    HIS A C     1 
ATOM   4     O O     . HIS A 1 5   ? 20.437  146.981 41.208  1.00 34.46 ? 5    HIS A O     1 
ATOM   5     C CB    . HIS A 1 5   ? 18.004  148.477 42.248  1.00 36.17 ? 5    HIS A CB    1 
ATOM   6     C CG    . HIS A 1 5   ? 17.800  149.447 41.121  1.00 37.06 ? 5    HIS A CG    1 
ATOM   7     N ND1   . HIS A 1 5   ? 18.533  150.608 40.992  1.00 37.27 ? 5    HIS A ND1   1 
ATOM   8     C CD2   . HIS A 1 5   ? 16.961  149.413 40.056  1.00 37.81 ? 5    HIS A CD2   1 
ATOM   9     C CE1   . HIS A 1 5   ? 18.149  151.251 39.903  1.00 38.26 ? 5    HIS A CE1   1 
ATOM   10    N NE2   . HIS A 1 5   ? 17.199  150.546 39.314  1.00 37.78 ? 5    HIS A NE2   1 
ATOM   11    N N     . LYS A 1 6   ? 18.929  146.407 39.600  1.00 34.24 ? 6    LYS A N     1 
ATOM   12    C CA    . LYS A 1 6   ? 19.866  146.358 38.487  1.00 32.64 ? 6    LYS A CA    1 
ATOM   13    C C     . LYS A 1 6   ? 19.621  147.544 37.580  1.00 31.81 ? 6    LYS A C     1 
ATOM   14    O O     . LYS A 1 6   ? 18.476  147.840 37.243  1.00 31.59 ? 6    LYS A O     1 
ATOM   15    C CB    . LYS A 1 6   ? 19.682  145.073 37.691  1.00 32.87 ? 6    LYS A CB    1 
ATOM   16    C CG    . LYS A 1 6   ? 20.640  143.963 38.043  1.00 31.63 ? 6    LYS A CG    1 
ATOM   17    C CD    . LYS A 1 6   ? 20.160  142.647 37.437  1.00 31.47 ? 6    LYS A CD    1 
ATOM   18    C CE    . LYS A 1 6   ? 21.295  141.632 37.323  1.00 30.78 ? 6    LYS A CE    1 
ATOM   19    N NZ    . LYS A 1 6   ? 20.856  140.303 36.795  1.00 31.39 ? 6    LYS A NZ    1 
ATOM   20    N N     . HIS A 1 7   ? 20.694  148.236 37.196  1.00 30.73 ? 7    HIS A N     1 
ATOM   21    C CA    . HIS A 1 7   ? 20.596  149.301 36.210  1.00 29.47 ? 7    HIS A CA    1 
ATOM   22    C C     . HIS A 1 7   ? 20.644  148.697 34.821  1.00 28.95 ? 7    HIS A C     1 
ATOM   23    O O     . HIS A 1 7   ? 21.527  147.902 34.513  1.00 28.86 ? 7    HIS A O     1 
ATOM   24    C CB    . HIS A 1 7   ? 21.715  150.320 36.381  1.00 29.43 ? 7    HIS A CB    1 
ATOM   25    C CG    . HIS A 1 7   ? 21.599  151.139 37.625  1.00 28.67 ? 7    HIS A CG    1 
ATOM   26    N ND1   . HIS A 1 7   ? 21.047  152.400 37.635  1.00 28.80 ? 7    HIS A ND1   1 
ATOM   27    C CD2   . HIS A 1 7   ? 21.966  150.879 38.899  1.00 28.37 ? 7    HIS A CD2   1 
ATOM   28    C CE1   . HIS A 1 7   ? 21.080  152.884 38.861  1.00 26.98 ? 7    HIS A CE1   1 
ATOM   29    N NE2   . HIS A 1 7   ? 21.632  151.981 39.647  1.00 27.38 ? 7    HIS A NE2   1 
ATOM   30    N N     . ALA A 1 8   ? 19.666  149.056 33.998  1.00 28.61 ? 8    ALA A N     1 
ATOM   31    C CA    . ALA A 1 8   ? 19.622  148.610 32.611  1.00 27.98 ? 8    ALA A CA    1 
ATOM   32    C C     . ALA A 1 8   ? 20.724  149.310 31.799  1.00 27.13 ? 8    ALA A C     1 
ATOM   33    O O     . ALA A 1 8   ? 21.204  150.389 32.172  1.00 27.25 ? 8    ALA A O     1 
ATOM   34    C CB    . ALA A 1 8   ? 18.219  148.884 31.998  1.00 27.88 ? 8    ALA A CB    1 
ATOM   35    N N     . ILE A 1 9   ? 21.127  148.670 30.708  1.00 26.28 ? 9    ILE A N     1 
ATOM   36    C CA    . ILE A 1 9   ? 22.018  149.256 29.709  1.00 25.37 ? 9    ILE A CA    1 
ATOM   37    C C     . ILE A 1 9   ? 21.210  150.289 28.911  1.00 25.69 ? 9    ILE A C     1 
ATOM   38    O O     . ILE A 1 9   ? 20.229  149.939 28.255  1.00 25.83 ? 9    ILE A O     1 
ATOM   39    C CB    . ILE A 1 9   ? 22.596  148.144 28.772  1.00 24.95 ? 9    ILE A CB    1 
ATOM   40    C CG1   . ILE A 1 9   ? 23.457  147.160 29.575  1.00 23.36 ? 9    ILE A CG1   1 
ATOM   41    C CG2   . ILE A 1 9   ? 23.351  148.738 27.557  1.00 24.20 ? 9    ILE A CG2   1 
ATOM   42    C CD1   . ILE A 1 9   ? 23.267  145.707 29.171  1.00 22.02 ? 9    ILE A CD1   1 
ATOM   43    N N     . PRO A 1 10  ? 21.623  151.571 28.963  1.00 25.77 ? 10   PRO A N     1 
ATOM   44    C CA    . PRO A 1 10  ? 20.896  152.619 28.230  1.00 25.28 ? 10   PRO A CA    1 
ATOM   45    C C     . PRO A 1 10  ? 21.066  152.530 26.688  1.00 25.07 ? 10   PRO A C     1 
ATOM   46    O O     . PRO A 1 10  ? 22.065  151.974 26.192  1.00 24.64 ? 10   PRO A O     1 
ATOM   47    C CB    . PRO A 1 10  ? 21.469  153.918 28.806  1.00 25.45 ? 10   PRO A CB    1 
ATOM   48    C CG    . PRO A 1 10  ? 22.839  153.543 29.359  1.00 25.30 ? 10   PRO A CG    1 
ATOM   49    C CD    . PRO A 1 10  ? 22.806  152.086 29.693  1.00 25.55 ? 10   PRO A CD    1 
ATOM   50    N N     . ALA A 1 11  ? 20.083  153.068 25.954  1.00 24.77 ? 11   ALA A N     1 
ATOM   51    C CA    . ALA A 1 11  ? 19.971  152.895 24.500  1.00 24.21 ? 11   ALA A CA    1 
ATOM   52    C C     . ALA A 1 11  ? 21.157  153.495 23.766  1.00 24.02 ? 11   ALA A C     1 
ATOM   53    O O     . ALA A 1 11  ? 21.644  152.907 22.797  1.00 23.42 ? 11   ALA A O     1 
ATOM   54    C CB    . ALA A 1 11  ? 18.647  153.482 23.965  1.00 24.28 ? 11   ALA A CB    1 
ATOM   55    N N     . ASN A 1 12  ? 21.633  154.651 24.240  1.00 23.75 ? 12   ASN A N     1 
ATOM   56    C CA    . ASN A 1 12  ? 22.792  155.309 23.623  1.00 23.56 ? 12   ASN A CA    1 
ATOM   57    C C     . ASN A 1 12  ? 24.040  154.407 23.703  1.00 23.06 ? 12   ASN A C     1 
ATOM   58    O O     . ASN A 1 12  ? 24.835  154.364 22.774  1.00 23.30 ? 12   ASN A O     1 
ATOM   59    C CB    . ASN A 1 12  ? 23.046  156.714 24.214  1.00 22.81 ? 12   ASN A CB    1 
ATOM   60    C CG    . ASN A 1 12  ? 23.542  156.668 25.662  1.00 23.49 ? 12   ASN A CG    1 
ATOM   61    O OD1   . ASN A 1 12  ? 22.893  156.059 26.520  1.00 18.91 ? 12   ASN A OD1   1 
ATOM   62    N ND2   . ASN A 1 12  ? 24.722  157.289 25.930  1.00 21.33 ? 12   ASN A ND2   1 
ATOM   63    N N     . ILE A 1 13  ? 24.180  153.659 24.795  1.00 22.53 ? 13   ILE A N     1 
ATOM   64    C CA    . ILE A 1 13  ? 25.308  152.750 24.948  1.00 22.10 ? 13   ILE A CA    1 
ATOM   65    C C     . ILE A 1 13  ? 25.110  151.463 24.112  1.00 23.20 ? 13   ILE A C     1 
ATOM   66    O O     . ILE A 1 13  ? 26.038  150.995 23.433  1.00 23.81 ? 13   ILE A O     1 
ATOM   67    C CB    . ILE A 1 13  ? 25.607  152.454 26.461  1.00 21.72 ? 13   ILE A CB    1 
ATOM   68    C CG1   . ILE A 1 13  ? 26.082  153.734 27.181  1.00 20.55 ? 13   ILE A CG1   1 
ATOM   69    C CG2   . ILE A 1 13  ? 26.590  151.279 26.648  1.00 19.65 ? 13   ILE A CG2   1 
ATOM   70    C CD1   . ILE A 1 13  ? 27.313  154.433 26.573  1.00 18.80 ? 13   ILE A CD1   1 
ATOM   71    N N     . ALA A 1 14  ? 23.898  150.918 24.146  1.00 23.67 ? 14   ALA A N     1 
ATOM   72    C CA    . ALA A 1 14  ? 23.537  149.733 23.363  1.00 23.87 ? 14   ALA A CA    1 
ATOM   73    C C     . ALA A 1 14  ? 23.713  149.965 21.844  1.00 24.26 ? 14   ALA A C     1 
ATOM   74    O O     . ALA A 1 14  ? 24.104  149.047 21.111  1.00 24.33 ? 14   ALA A O     1 
ATOM   75    C CB    . ALA A 1 14  ? 22.124  149.298 23.688  1.00 22.83 ? 14   ALA A CB    1 
ATOM   76    N N     . ASP A 1 15  ? 23.457  151.187 21.389  1.00 24.33 ? 15   ASP A N     1 
ATOM   77    C CA    . ASP A 1 15  ? 23.607  151.536 19.979  1.00 25.57 ? 15   ASP A CA    1 
ATOM   78    C C     . ASP A 1 15  ? 25.049  151.600 19.502  1.00 25.60 ? 15   ASP A C     1 
ATOM   79    O O     . ASP A 1 15  ? 25.321  151.395 18.332  1.00 25.46 ? 15   ASP A O     1 
ATOM   80    C CB    . ASP A 1 15  ? 22.912  152.866 19.677  1.00 26.02 ? 15   ASP A CB    1 
ATOM   81    C CG    . ASP A 1 15  ? 21.410  152.717 19.548  1.00 29.31 ? 15   ASP A CG    1 
ATOM   82    O OD1   . ASP A 1 15  ? 20.847  151.724 20.081  1.00 33.19 ? 15   ASP A OD1   1 
ATOM   83    O OD2   . ASP A 1 15  ? 20.782  153.581 18.896  1.00 33.96 ? 15   ASP A OD2   1 
ATOM   84    N N     . ARG A 1 16  ? 25.969  151.901 20.410  1.00 26.01 ? 16   ARG A N     1 
ATOM   85    C CA    . ARG A 1 16  ? 27.341  152.164 20.027  1.00 26.27 ? 16   ARG A CA    1 
ATOM   86    C C     . ARG A 1 16  ? 28.351  151.118 20.549  1.00 25.44 ? 16   ARG A C     1 
ATOM   87    O O     . ARG A 1 16  ? 29.491  151.083 20.099  1.00 25.48 ? 16   ARG A O     1 
ATOM   88    C CB    . ARG A 1 16  ? 27.713  153.581 20.474  1.00 26.39 ? 16   ARG A CB    1 
ATOM   89    C CG    . ARG A 1 16  ? 27.869  153.747 22.004  1.00 28.46 ? 16   ARG A CG    1 
ATOM   90    C CD    . ARG A 1 16  ? 27.941  155.223 22.392  1.00 28.00 ? 16   ARG A CD    1 
ATOM   91    N NE    . ARG A 1 16  ? 29.323  155.692 22.336  1.00 31.98 ? 16   ARG A NE    1 
ATOM   92    C CZ    . ARG A 1 16  ? 29.834  156.495 21.404  1.00 33.53 ? 16   ARG A CZ    1 
ATOM   93    N NH1   . ARG A 1 16  ? 29.071  156.968 20.422  1.00 31.82 ? 16   ARG A NH1   1 
ATOM   94    N NH2   . ARG A 1 16  ? 31.124  156.836 21.478  1.00 32.82 ? 16   ARG A NH2   1 
ATOM   95    N N     . CYS A 1 17  ? 27.923  150.251 21.470  1.00 24.98 ? 17   CYS A N     1 
ATOM   96    C CA    . CYS A 1 17  ? 28.862  149.430 22.249  1.00 24.05 ? 17   CYS A CA    1 
ATOM   97    C C     . CYS A 1 17  ? 29.666  148.448 21.397  1.00 24.50 ? 17   CYS A C     1 
ATOM   98    O O     . CYS A 1 17  ? 29.186  147.932 20.386  1.00 24.04 ? 17   CYS A O     1 
ATOM   99    C CB    . CYS A 1 17  ? 28.150  148.700 23.414  1.00 23.59 ? 17   CYS A CB    1 
ATOM   100   S SG    . CYS A 1 17  ? 26.953  147.399 22.937  1.00 20.54 ? 17   CYS A SG    1 
ATOM   101   N N     . LEU A 1 18  ? 30.895  148.193 21.826  1.00 24.74 ? 18   LEU A N     1 
ATOM   102   C CA    . LEU A 1 18  ? 31.774  147.251 21.136  1.00 25.11 ? 18   LEU A CA    1 
ATOM   103   C C     . LEU A 1 18  ? 31.373  145.801 21.444  1.00 25.59 ? 18   LEU A C     1 
ATOM   104   O O     . LEU A 1 18  ? 31.587  144.901 20.633  1.00 26.01 ? 18   LEU A O     1 
ATOM   105   C CB    . LEU A 1 18  ? 33.242  147.528 21.512  1.00 25.12 ? 18   LEU A CB    1 
ATOM   106   C CG    . LEU A 1 18  ? 33.796  148.962 21.327  1.00 24.75 ? 18   LEU A CG    1 
ATOM   107   C CD1   . LEU A 1 18  ? 35.264  149.093 21.792  1.00 22.00 ? 18   LEU A CD1   1 
ATOM   108   C CD2   . LEU A 1 18  ? 33.645  149.440 19.870  1.00 24.13 ? 18   LEU A CD2   1 
ATOM   109   N N     . ILE A 1 19  ? 30.768  145.583 22.608  1.00 25.72 ? 19   ILE A N     1 
ATOM   110   C CA    . ILE A 1 19  ? 30.370  144.243 23.050  1.00 26.05 ? 19   ILE A CA    1 
ATOM   111   C C     . ILE A 1 19  ? 29.007  144.287 23.731  1.00 25.55 ? 19   ILE A C     1 
ATOM   112   O O     . ILE A 1 19  ? 28.818  144.995 24.730  1.00 26.14 ? 19   ILE A O     1 
ATOM   113   C CB    . ILE A 1 19  ? 31.422  143.639 24.043  1.00 26.32 ? 19   ILE A CB    1 
ATOM   114   C CG1   . ILE A 1 19  ? 32.706  143.268 23.300  1.00 27.25 ? 19   ILE A CG1   1 
ATOM   115   C CG2   . ILE A 1 19  ? 30.852  142.413 24.797  1.00 26.58 ? 19   ILE A CG2   1 
ATOM   116   C CD1   . ILE A 1 19  ? 33.694  142.516 24.139  1.00 26.86 ? 19   ILE A CD1   1 
ATOM   117   N N     . ASN A 1 20  ? 28.067  143.517 23.201  1.00 25.08 ? 20   ASN A N     1 
ATOM   118   C CA    . ASN A 1 20  ? 26.741  143.393 23.786  1.00 24.33 ? 20   ASN A CA    1 
ATOM   119   C C     . ASN A 1 20  ? 26.642  142.178 24.741  1.00 24.46 ? 20   ASN A C     1 
ATOM   120   O O     . ASN A 1 20  ? 27.618  141.422 24.890  1.00 24.71 ? 20   ASN A O     1 
ATOM   121   C CB    . ASN A 1 20  ? 25.664  143.389 22.673  1.00 24.27 ? 20   ASN A CB    1 
ATOM   122   C CG    . ASN A 1 20  ? 25.739  142.164 21.774  1.00 23.28 ? 20   ASN A CG    1 
ATOM   123   O OD1   . ASN A 1 20  ? 25.981  141.047 22.240  1.00 22.27 ? 20   ASN A OD1   1 
ATOM   124   N ND2   . ASN A 1 20  ? 25.530  142.367 20.480  1.00 21.88 ? 20   ASN A ND2   1 
ATOM   125   N N     . PRO A 1 21  ? 25.492  141.999 25.439  1.00 24.32 ? 21   PRO A N     1 
ATOM   126   C CA    . PRO A 1 21  ? 25.409  140.853 26.366  1.00 24.46 ? 21   PRO A CA    1 
ATOM   127   C C     . PRO A 1 21  ? 25.746  139.484 25.748  1.00 24.93 ? 21   PRO A C     1 
ATOM   128   O O     . PRO A 1 21  ? 26.545  138.750 26.332  1.00 25.02 ? 21   PRO A O     1 
ATOM   129   C CB    . PRO A 1 21  ? 23.968  140.918 26.884  1.00 24.45 ? 21   PRO A CB    1 
ATOM   130   C CG    . PRO A 1 21  ? 23.624  142.406 26.779  1.00 24.53 ? 21   PRO A CG    1 
ATOM   131   C CD    . PRO A 1 21  ? 24.265  142.822 25.476  1.00 24.43 ? 21   PRO A CD    1 
ATOM   132   N N     . GLU A 1 22  ? 25.184  139.179 24.576  1.00 25.57 ? 22   GLU A N     1 
ATOM   133   C CA    . GLU A 1 22  ? 25.380  137.896 23.869  1.00 26.58 ? 22   GLU A CA    1 
ATOM   134   C C     . GLU A 1 22  ? 26.844  137.657 23.499  1.00 26.54 ? 22   GLU A C     1 
ATOM   135   O O     . GLU A 1 22  ? 27.389  136.567 23.731  1.00 25.88 ? 22   GLU A O     1 
ATOM   136   C CB    . GLU A 1 22  ? 24.526  137.852 22.593  1.00 26.86 ? 22   GLU A CB    1 
ATOM   137   C CG    . GLU A 1 22  ? 23.004  137.930 22.825  1.00 30.51 ? 22   GLU A CG    1 
ATOM   138   C CD    . GLU A 1 22  ? 22.519  139.312 23.292  1.00 35.54 ? 22   GLU A CD    1 
ATOM   139   O OE1   . GLU A 1 22  ? 21.778  139.362 24.303  1.00 37.35 ? 22   GLU A OE1   1 
ATOM   140   O OE2   . GLU A 1 22  ? 22.871  140.343 22.661  1.00 36.80 ? 22   GLU A OE2   1 
ATOM   141   N N     . GLN A 1 23  ? 27.460  138.694 22.922  1.00 26.08 ? 23   GLN A N     1 
ATOM   142   C CA    . GLN A 1 23  ? 28.888  138.704 22.601  1.00 26.27 ? 23   GLN A CA    1 
ATOM   143   C C     . GLN A 1 23  ? 29.772  138.552 23.852  1.00 26.04 ? 23   GLN A C     1 
ATOM   144   O O     . GLN A 1 23  ? 30.787  137.851 23.799  1.00 26.49 ? 23   GLN A O     1 
ATOM   145   C CB    . GLN A 1 23  ? 29.266  139.973 21.806  1.00 25.47 ? 23   GLN A CB    1 
ATOM   146   C CG    . GLN A 1 23  ? 28.600  140.034 20.428  1.00 26.24 ? 23   GLN A CG    1 
ATOM   147   C CD    . GLN A 1 23  ? 28.721  141.387 19.720  1.00 26.65 ? 23   GLN A CD    1 
ATOM   148   O OE1   . GLN A 1 23  ? 29.134  142.401 20.302  1.00 25.87 ? 23   GLN A OE1   1 
ATOM   149   N NE2   . GLN A 1 23  ? 28.335  141.404 18.444  1.00 28.54 ? 23   GLN A NE2   1 
ATOM   150   N N     . TYR A 1 24  ? 29.409  139.195 24.966  1.00 25.91 ? 24   TYR A N     1 
ATOM   151   C CA    . TYR A 1 24  ? 30.155  138.974 26.223  1.00 25.81 ? 24   TYR A CA    1 
ATOM   152   C C     . TYR A 1 24  ? 30.147  137.497 26.609  1.00 25.81 ? 24   TYR A C     1 
ATOM   153   O O     . TYR A 1 24  ? 31.197  136.908 26.854  1.00 25.33 ? 24   TYR A O     1 
ATOM   154   C CB    . TYR A 1 24  ? 29.644  139.809 27.410  1.00 25.67 ? 24   TYR A CB    1 
ATOM   155   C CG    . TYR A 1 24  ? 30.218  139.299 28.714  1.00 25.74 ? 24   TYR A CG    1 
ATOM   156   C CD1   . TYR A 1 24  ? 31.458  139.748 29.175  1.00 22.99 ? 24   TYR A CD1   1 
ATOM   157   C CD2   . TYR A 1 24  ? 29.540  138.313 29.465  1.00 25.60 ? 24   TYR A CD2   1 
ATOM   158   C CE1   . TYR A 1 24  ? 32.005  139.256 30.373  1.00 24.81 ? 24   TYR A CE1   1 
ATOM   159   C CE2   . TYR A 1 24  ? 30.085  137.807 30.666  1.00 26.57 ? 24   TYR A CE2   1 
ATOM   160   C CZ    . TYR A 1 24  ? 31.318  138.278 31.103  1.00 25.90 ? 24   TYR A CZ    1 
ATOM   161   O OH    . TYR A 1 24  ? 31.851  137.777 32.272  1.00 26.25 ? 24   TYR A OH    1 
ATOM   162   N N     . GLU A 1 25  ? 28.956  136.911 26.654  1.00 26.03 ? 25   GLU A N     1 
ATOM   163   C CA    . GLU A 1 25  ? 28.793  135.509 27.025  1.00 26.45 ? 25   GLU A CA    1 
ATOM   164   C C     . GLU A 1 25  ? 29.611  134.566 26.153  1.00 25.61 ? 25   GLU A C     1 
ATOM   165   O O     . GLU A 1 25  ? 30.261  133.660 26.660  1.00 25.27 ? 25   GLU A O     1 
ATOM   166   C CB    . GLU A 1 25  ? 27.316  135.104 26.998  1.00 26.17 ? 25   GLU A CB    1 
ATOM   167   C CG    . GLU A 1 25  ? 26.436  135.930 27.924  1.00 31.46 ? 25   GLU A CG    1 
ATOM   168   C CD    . GLU A 1 25  ? 26.729  135.702 29.412  1.00 38.32 ? 25   GLU A CD    1 
ATOM   169   O OE1   . GLU A 1 25  ? 27.373  134.682 29.762  1.00 40.62 ? 25   GLU A OE1   1 
ATOM   170   O OE2   . GLU A 1 25  ? 26.313  136.551 30.238  1.00 41.98 ? 25   GLU A OE2   1 
ATOM   171   N N     . THR A 1 26  ? 29.592  134.807 24.848  1.00 25.19 ? 26   THR A N     1 
ATOM   172   C CA    . THR A 1 26  ? 30.215  133.907 23.874  1.00 25.04 ? 26   THR A CA    1 
ATOM   173   C C     . THR A 1 26  ? 31.741  133.972 23.938  1.00 24.84 ? 26   THR A C     1 
ATOM   174   O O     . THR A 1 26  ? 32.435  132.942 23.942  1.00 25.02 ? 26   THR A O     1 
ATOM   175   C CB    . THR A 1 26  ? 29.719  134.213 22.437  1.00 24.48 ? 26   THR A CB    1 
ATOM   176   O OG1   . THR A 1 26  ? 28.311  133.995 22.376  1.00 24.49 ? 26   THR A OG1   1 
ATOM   177   C CG2   . THR A 1 26  ? 30.390  133.304 21.408  1.00 23.47 ? 26   THR A CG2   1 
ATOM   178   N N     . LYS A 1 27  ? 32.247  135.197 23.942  1.00 24.85 ? 27   LYS A N     1 
ATOM   179   C CA    . LYS A 1 27  ? 33.662  135.457 24.061  1.00 24.54 ? 27   LYS A CA    1 
ATOM   180   C C     . LYS A 1 27  ? 34.193  135.024 25.422  1.00 23.82 ? 27   LYS A C     1 
ATOM   181   O O     . LYS A 1 27  ? 35.310  134.515 25.503  1.00 23.57 ? 27   LYS A O     1 
ATOM   182   C CB    . LYS A 1 27  ? 33.949  136.936 23.821  1.00 24.99 ? 27   LYS A CB    1 
ATOM   183   C CG    . LYS A 1 27  ? 33.723  137.383 22.389  1.00 26.44 ? 27   LYS A CG    1 
ATOM   184   C CD    . LYS A 1 27  ? 34.321  138.769 22.179  1.00 31.22 ? 27   LYS A CD    1 
ATOM   185   C CE    . LYS A 1 27  ? 34.399  139.128 20.676  1.00 36.57 ? 27   LYS A CE    1 
ATOM   186   N NZ    . LYS A 1 27  ? 35.487  140.129 20.380  1.00 36.93 ? 27   LYS A NZ    1 
ATOM   187   N N     . TYR A 1 28  ? 33.404  135.229 26.485  1.00 22.98 ? 28   TYR A N     1 
ATOM   188   C CA    . TYR A 1 28  ? 33.810  134.736 27.798  1.00 22.48 ? 28   TYR A CA    1 
ATOM   189   C C     . TYR A 1 28  ? 34.001  133.225 27.769  1.00 22.78 ? 28   TYR A C     1 
ATOM   190   O O     . TYR A 1 28  ? 35.052  132.732 28.176  1.00 22.84 ? 28   TYR A O     1 
ATOM   191   C CB    . TYR A 1 28  ? 32.880  135.136 28.964  1.00 21.36 ? 28   TYR A CB    1 
ATOM   192   C CG    . TYR A 1 28  ? 33.463  134.593 30.260  1.00 22.05 ? 28   TYR A CG    1 
ATOM   193   C CD1   . TYR A 1 28  ? 34.540  135.237 30.891  1.00 20.72 ? 28   TYR A CD1   1 
ATOM   194   C CD2   . TYR A 1 28  ? 33.012  133.388 30.800  1.00 23.09 ? 28   TYR A CD2   1 
ATOM   195   C CE1   . TYR A 1 28  ? 35.122  134.720 32.035  1.00 19.80 ? 28   TYR A CE1   1 
ATOM   196   C CE2   . TYR A 1 28  ? 33.576  132.866 31.966  1.00 23.63 ? 28   TYR A CE2   1 
ATOM   197   C CZ    . TYR A 1 28  ? 34.626  133.535 32.575  1.00 20.83 ? 28   TYR A CZ    1 
ATOM   198   O OH    . TYR A 1 28  ? 35.186  133.001 33.706  1.00 20.55 ? 28   TYR A OH    1 
ATOM   199   N N     . LYS A 1 29  ? 32.989  132.495 27.292  1.00 22.96 ? 29   LYS A N     1 
ATOM   200   C CA    . LYS A 1 29  ? 33.065  131.040 27.256  1.00 22.86 ? 29   LYS A CA    1 
ATOM   201   C C     . LYS A 1 29  ? 34.269  130.561 26.426  1.00 23.21 ? 29   LYS A C     1 
ATOM   202   O O     . LYS A 1 29  ? 34.983  129.646 26.850  1.00 23.90 ? 29   LYS A O     1 
ATOM   203   C CB    . LYS A 1 29  ? 31.744  130.425 26.770  1.00 22.64 ? 29   LYS A CB    1 
ATOM   204   N N     . GLN A 1 30  ? 34.510  131.182 25.267  1.00 23.10 ? 30   GLN A N     1 
ATOM   205   C CA    . GLN A 1 30  ? 35.678  130.848 24.428  1.00 23.35 ? 30   GLN A CA    1 
ATOM   206   C C     . GLN A 1 30  ? 37.047  131.154 25.071  1.00 23.20 ? 30   GLN A C     1 
ATOM   207   O O     . GLN A 1 30  ? 37.990  130.375 24.917  1.00 22.18 ? 30   GLN A O     1 
ATOM   208   C CB    . GLN A 1 30  ? 35.597  131.555 23.067  1.00 24.33 ? 30   GLN A CB    1 
ATOM   209   C CG    . GLN A 1 30  ? 36.574  130.974 22.031  1.00 26.06 ? 30   GLN A CG    1 
ATOM   210   C CD    . GLN A 1 30  ? 36.860  131.920 20.870  1.00 28.78 ? 30   GLN A CD    1 
ATOM   211   O OE1   . GLN A 1 30  ? 36.742  133.138 20.991  1.00 28.37 ? 30   GLN A OE1   1 
ATOM   212   N NE2   . GLN A 1 30  ? 37.238  131.350 19.732  1.00 30.17 ? 30   GLN A NE2   1 
ATOM   213   N N     . SER A 1 31  ? 37.160  132.300 25.758  1.00 22.63 ? 31   SER A N     1 
ATOM   214   C CA    . SER A 1 31  ? 38.381  132.654 26.506  1.00 22.68 ? 31   SER A CA    1 
ATOM   215   C C     . SER A 1 31  ? 38.732  131.605 27.569  1.00 23.51 ? 31   SER A C     1 
ATOM   216   O O     . SER A 1 31  ? 39.900  131.352 27.831  1.00 24.21 ? 31   SER A O     1 
ATOM   217   C CB    . SER A 1 31  ? 38.239  134.036 27.154  1.00 22.13 ? 31   SER A CB    1 
ATOM   218   O OG    . SER A 1 31  ? 37.338  134.012 28.238  1.00 19.55 ? 31   SER A OG    1 
ATOM   219   N N     . ILE A 1 32  ? 37.704  130.991 28.150  1.00 24.52 ? 32   ILE A N     1 
ATOM   220   C CA    . ILE A 1 32  ? 37.854  130.002 29.209  1.00 25.72 ? 32   ILE A CA    1 
ATOM   221   C C     . ILE A 1 32  ? 38.094  128.617 28.620  1.00 26.04 ? 32   ILE A C     1 
ATOM   222   O O     . ILE A 1 32  ? 39.093  127.959 28.961  1.00 26.40 ? 32   ILE A O     1 
ATOM   223   C CB    . ILE A 1 32  ? 36.614  130.036 30.164  1.00 25.80 ? 32   ILE A CB    1 
ATOM   224   C CG1   . ILE A 1 32  ? 36.653  131.277 31.066  1.00 26.61 ? 32   ILE A CG1   1 
ATOM   225   C CG2   . ILE A 1 32  ? 36.496  128.777 31.010  1.00 28.14 ? 32   ILE A CG2   1 
ATOM   226   C CD1   . ILE A 1 32  ? 37.992  131.930 31.191  1.00 24.43 ? 32   ILE A CD1   1 
ATOM   227   N N     . ASN A 1 33  ? 37.209  128.189 27.714  1.00 26.13 ? 33   ASN A N     1 
ATOM   228   C CA    . ASN A 1 33  ? 37.296  126.856 27.110  1.00 26.85 ? 33   ASN A CA    1 
ATOM   229   C C     . ASN A 1 33  ? 38.448  126.701 26.124  1.00 26.58 ? 33   ASN A C     1 
ATOM   230   O O     . ASN A 1 33  ? 39.030  125.617 25.999  1.00 26.53 ? 33   ASN A O     1 
ATOM   231   C CB    . ASN A 1 33  ? 35.989  126.477 26.411  1.00 27.25 ? 33   ASN A CB    1 
ATOM   232   C CG    . ASN A 1 33  ? 34.812  126.385 27.367  1.00 29.96 ? 33   ASN A CG    1 
ATOM   233   O OD1   . ASN A 1 33  ? 34.979  126.246 28.582  1.00 31.98 ? 33   ASN A OD1   1 
ATOM   234   N ND2   . ASN A 1 33  ? 33.606  126.460 26.815  1.00 32.21 ? 33   ASN A ND2   1 
ATOM   235   N N     . ASP A 1 34  ? 38.766  127.781 25.418  1.00 26.27 ? 34   ASP A N     1 
ATOM   236   C CA    . ASP A 1 34  ? 39.844  127.762 24.427  1.00 25.68 ? 34   ASP A CA    1 
ATOM   237   C C     . ASP A 1 34  ? 40.700  129.050 24.421  1.00 25.35 ? 34   ASP A C     1 
ATOM   238   O O     . ASP A 1 34  ? 40.678  129.813 23.446  1.00 24.50 ? 34   ASP A O     1 
ATOM   239   C CB    . ASP A 1 34  ? 39.259  127.507 23.034  1.00 25.91 ? 34   ASP A CB    1 
ATOM   240   C CG    . ASP A 1 34  ? 40.329  127.198 21.994  1.00 25.34 ? 34   ASP A CG    1 
ATOM   241   O OD1   . ASP A 1 34  ? 41.522  127.100 22.346  1.00 25.81 ? 34   ASP A OD1   1 
ATOM   242   O OD2   . ASP A 1 34  ? 39.972  127.064 20.813  1.00 26.00 ? 34   ASP A OD2   1 
ATOM   243   N N     . PRO A 1 35  ? 41.482  129.275 25.499  1.00 25.31 ? 35   PRO A N     1 
ATOM   244   C CA    . PRO A 1 35  ? 42.341  130.473 25.602  1.00 25.10 ? 35   PRO A CA    1 
ATOM   245   C C     . PRO A 1 35  ? 43.315  130.690 24.434  1.00 24.34 ? 35   PRO A C     1 
ATOM   246   O O     . PRO A 1 35  ? 43.620  131.841 24.116  1.00 23.49 ? 35   PRO A O     1 
ATOM   247   C CB    . PRO A 1 35  ? 43.128  130.247 26.903  1.00 25.02 ? 35   PRO A CB    1 
ATOM   248   C CG    . PRO A 1 35  ? 42.950  128.803 27.228  1.00 26.35 ? 35   PRO A CG    1 
ATOM   249   C CD    . PRO A 1 35  ? 41.613  128.405 26.678  1.00 25.27 ? 35   PRO A CD    1 
ATOM   250   N N     . ASP A 1 36  ? 43.793  129.618 23.799  1.00 23.95 ? 36   ASP A N     1 
ATOM   251   C CA    . ASP A 1 36  ? 44.799  129.776 22.734  1.00 23.80 ? 36   ASP A CA    1 
ATOM   252   C C     . ASP A 1 36  ? 44.215  130.371 21.459  1.00 23.41 ? 36   ASP A C     1 
ATOM   253   O O     . ASP A 1 36  ? 44.870  131.155 20.777  1.00 24.08 ? 36   ASP A O     1 
ATOM   254   C CB    . ASP A 1 36  ? 45.532  128.472 22.410  1.00 23.85 ? 36   ASP A CB    1 
ATOM   255   C CG    . ASP A 1 36  ? 46.596  128.128 23.427  1.00 24.64 ? 36   ASP A CG    1 
ATOM   256   O OD1   . ASP A 1 36  ? 46.971  126.950 23.493  1.00 26.33 ? 36   ASP A OD1   1 
ATOM   257   O OD2   . ASP A 1 36  ? 47.066  129.008 24.173  1.00 25.61 ? 36   ASP A OD2   1 
ATOM   258   N N     . THR A 1 37  ? 42.994  129.986 21.133  1.00 22.50 ? 37   THR A N     1 
ATOM   259   C CA    . THR A 1 37  ? 42.303  130.607 20.017  1.00 22.13 ? 37   THR A CA    1 
ATOM   260   C C     . THR A 1 37  ? 41.879  132.001 20.429  1.00 21.21 ? 37   THR A C     1 
ATOM   261   O O     . THR A 1 37  ? 42.169  132.961 19.714  1.00 21.18 ? 37   THR A O     1 
ATOM   262   C CB    . THR A 1 37  ? 41.085  129.772 19.563  1.00 22.21 ? 37   THR A CB    1 
ATOM   263   O OG1   . THR A 1 37  ? 41.528  128.444 19.262  1.00 22.79 ? 37   THR A OG1   1 
ATOM   264   C CG2   . THR A 1 37  ? 40.414  130.377 18.325  1.00 22.35 ? 37   THR A CG2   1 
ATOM   265   N N     . PHE A 1 38  ? 41.216  132.124 21.577  1.00 20.22 ? 38   PHE A N     1 
ATOM   266   C CA    . PHE A 1 38  ? 40.725  133.445 21.987  1.00 20.51 ? 38   PHE A CA    1 
ATOM   267   C C     . PHE A 1 38  ? 41.857  134.488 22.067  1.00 20.56 ? 38   PHE A C     1 
ATOM   268   O O     . PHE A 1 38  ? 41.796  135.537 21.429  1.00 20.10 ? 38   PHE A O     1 
ATOM   269   C CB    . PHE A 1 38  ? 39.965  133.435 23.327  1.00 19.74 ? 38   PHE A CB    1 
ATOM   270   C CG    . PHE A 1 38  ? 39.467  134.809 23.725  1.00 20.52 ? 38   PHE A CG    1 
ATOM   271   C CD1   . PHE A 1 38  ? 38.307  135.342 23.146  1.00 19.06 ? 38   PHE A CD1   1 
ATOM   272   C CD2   . PHE A 1 38  ? 40.196  135.603 24.616  1.00 18.63 ? 38   PHE A CD2   1 
ATOM   273   C CE1   . PHE A 1 38  ? 37.857  136.634 23.483  1.00 18.22 ? 38   PHE A CE1   1 
ATOM   274   C CE2   . PHE A 1 38  ? 39.762  136.901 24.950  1.00 17.14 ? 38   PHE A CE2   1 
ATOM   275   C CZ    . PHE A 1 38  ? 38.593  137.409 24.387  1.00 17.12 ? 38   PHE A CZ    1 
ATOM   276   N N     . TRP A 1 39  ? 42.878  134.180 22.851  1.00 19.82 ? 39   TRP A N     1 
ATOM   277   C CA    . TRP A 1 39  ? 43.959  135.134 23.070  1.00 20.51 ? 39   TRP A CA    1 
ATOM   278   C C     . TRP A 1 39  ? 44.917  135.177 21.871  1.00 20.28 ? 39   TRP A C     1 
ATOM   279   O O     . TRP A 1 39  ? 45.576  136.181 21.626  1.00 19.15 ? 39   TRP A O     1 
ATOM   280   C CB    . TRP A 1 39  ? 44.686  134.847 24.405  1.00 19.58 ? 39   TRP A CB    1 
ATOM   281   C CG    . TRP A 1 39  ? 43.860  135.246 25.619  1.00 19.69 ? 39   TRP A CG    1 
ATOM   282   C CD1   . TRP A 1 39  ? 43.332  134.407 26.580  1.00 20.59 ? 39   TRP A CD1   1 
ATOM   283   C CD2   . TRP A 1 39  ? 43.463  136.578 25.996  1.00 18.23 ? 39   TRP A CD2   1 
ATOM   284   N NE1   . TRP A 1 39  ? 42.651  135.144 27.526  1.00 19.60 ? 39   TRP A NE1   1 
ATOM   285   C CE2   . TRP A 1 39  ? 42.712  136.472 27.184  1.00 18.22 ? 39   TRP A CE2   1 
ATOM   286   C CE3   . TRP A 1 39  ? 43.671  137.849 25.438  1.00 19.37 ? 39   TRP A CE3   1 
ATOM   287   C CZ2   . TRP A 1 39  ? 42.169  137.586 27.824  1.00 19.53 ? 39   TRP A CZ2   1 
ATOM   288   C CZ3   . TRP A 1 39  ? 43.140  138.958 26.081  1.00 19.41 ? 39   TRP A CZ3   1 
ATOM   289   C CH2   . TRP A 1 39  ? 42.403  138.818 27.270  1.00 19.72 ? 39   TRP A CH2   1 
ATOM   290   N N     . GLY A 1 40  ? 44.979  134.079 21.126  1.00 20.69 ? 40   GLY A N     1 
ATOM   291   C CA    . GLY A 1 40  ? 45.670  134.090 19.845  1.00 21.87 ? 40   GLY A CA    1 
ATOM   292   C C     . GLY A 1 40  ? 45.093  135.161 18.918  1.00 22.14 ? 40   GLY A C     1 
ATOM   293   O O     . GLY A 1 40  ? 45.836  135.880 18.285  1.00 22.84 ? 40   GLY A O     1 
ATOM   294   N N     . GLU A 1 41  ? 43.774  135.259 18.831  1.00 21.97 ? 41   GLU A N     1 
ATOM   295   C CA    . GLU A 1 41  ? 43.144  136.274 17.980  1.00 23.12 ? 41   GLU A CA    1 
ATOM   296   C C     . GLU A 1 41  ? 43.214  137.681 18.595  1.00 22.48 ? 41   GLU A C     1 
ATOM   297   O O     . GLU A 1 41  ? 43.581  138.636 17.914  1.00 22.17 ? 41   GLU A O     1 
ATOM   298   C CB    . GLU A 1 41  ? 41.700  135.875 17.657  1.00 23.12 ? 41   GLU A CB    1 
ATOM   299   C CG    . GLU A 1 41  ? 41.616  134.728 16.582  1.00 25.75 ? 41   GLU A CG    1 
ATOM   300   C CD    . GLU A 1 41  ? 40.272  133.955 16.568  1.00 25.73 ? 41   GLU A CD    1 
ATOM   301   O OE1   . GLU A 1 41  ? 40.201  132.903 15.888  1.00 28.30 ? 41   GLU A OE1   1 
ATOM   302   O OE2   . GLU A 1 41  ? 39.305  134.388 17.235  1.00 28.13 ? 41   GLU A OE2   1 
ATOM   303   N N     . GLN A 1 42  ? 42.875  137.796 19.882  1.00 21.57 ? 42   GLN A N     1 
ATOM   304   C CA    . GLN A 1 42  ? 42.869  139.083 20.568  1.00 21.18 ? 42   GLN A CA    1 
ATOM   305   C C     . GLN A 1 42  ? 44.253  139.742 20.720  1.00 20.78 ? 42   GLN A C     1 
ATOM   306   O O     . GLN A 1 42  ? 44.327  140.954 20.940  1.00 20.67 ? 42   GLN A O     1 
ATOM   307   C CB    . GLN A 1 42  ? 42.184  138.968 21.935  1.00 20.88 ? 42   GLN A CB    1 
ATOM   308   C CG    . GLN A 1 42  ? 42.035  140.311 22.678  1.00 21.45 ? 42   GLN A CG    1 
ATOM   309   C CD    . GLN A 1 42  ? 41.253  141.375 21.883  1.00 21.77 ? 42   GLN A CD    1 
ATOM   310   O OE1   . GLN A 1 42  ? 41.571  142.580 21.930  1.00 24.25 ? 42   GLN A OE1   1 
ATOM   311   N NE2   . GLN A 1 42  ? 40.248  140.940 21.155  1.00 19.10 ? 42   GLN A NE2   1 
ATOM   312   N N     . GLY A 1 43  ? 45.330  138.959 20.626  1.00 20.27 ? 43   GLY A N     1 
ATOM   313   C CA    . GLY A 1 43  ? 46.705  139.491 20.678  1.00 20.09 ? 43   GLY A CA    1 
ATOM   314   C C     . GLY A 1 43  ? 47.067  140.400 19.510  1.00 20.53 ? 43   GLY A C     1 
ATOM   315   O O     . GLY A 1 43  ? 48.068  141.121 19.560  1.00 20.14 ? 43   GLY A O     1 
ATOM   316   N N     . LYS A 1 44  ? 46.230  140.380 18.467  1.00 21.01 ? 44   LYS A N     1 
ATOM   317   C CA    . LYS A 1 44  ? 46.427  141.167 17.230  1.00 21.40 ? 44   LYS A CA    1 
ATOM   318   C C     . LYS A 1 44  ? 45.960  142.634 17.372  1.00 21.09 ? 44   LYS A C     1 
ATOM   319   O O     . LYS A 1 44  ? 46.139  143.461 16.456  1.00 20.91 ? 44   LYS A O     1 
ATOM   320   C CB    . LYS A 1 44  ? 45.725  140.486 16.040  1.00 22.28 ? 44   LYS A CB    1 
ATOM   321   C CG    . LYS A 1 44  ? 46.092  139.007 15.795  1.00 23.36 ? 44   LYS A CG    1 
ATOM   322   C CD    . LYS A 1 44  ? 47.595  138.776 15.719  1.00 27.64 ? 44   LYS A CD    1 
ATOM   323   C CE    . LYS A 1 44  ? 47.939  137.359 15.192  1.00 28.36 ? 44   LYS A CE    1 
ATOM   324   N NZ    . LYS A 1 44  ? 47.755  137.272 13.698  1.00 29.50 ? 44   LYS A NZ    1 
ATOM   325   N N     . ILE A 1 45  ? 45.376  142.957 18.526  1.00 20.64 ? 45   ILE A N     1 
ATOM   326   C CA    . ILE A 1 45  ? 45.168  144.358 18.933  1.00 19.90 ? 45   ILE A CA    1 
ATOM   327   C C     . ILE A 1 45  ? 46.508  145.135 18.949  1.00 20.10 ? 45   ILE A C     1 
ATOM   328   O O     . ILE A 1 45  ? 46.542  146.347 18.791  1.00 21.02 ? 45   ILE A O     1 
ATOM   329   C CB    . ILE A 1 45  ? 44.473  144.441 20.320  1.00 20.16 ? 45   ILE A CB    1 
ATOM   330   C CG1   . ILE A 1 45  ? 43.898  145.850 20.564  1.00 19.33 ? 45   ILE A CG1   1 
ATOM   331   C CG2   . ILE A 1 45  ? 45.441  144.001 21.488  1.00 20.31 ? 45   ILE A CG2   1 
ATOM   332   C CD1   . ILE A 1 45  ? 42.968  145.934 21.777  1.00 17.10 ? 45   ILE A CD1   1 
ATOM   333   N N     . LEU A 1 46  ? 47.607  144.417 19.137  1.00 19.99 ? 46   LEU A N     1 
ATOM   334   C CA    . LEU A 1 46  ? 48.944  145.005 19.106  1.00 20.38 ? 46   LEU A CA    1 
ATOM   335   C C     . LEU A 1 46  ? 49.620  144.696 17.782  1.00 20.47 ? 46   LEU A C     1 
ATOM   336   O O     . LEU A 1 46  ? 49.297  143.690 17.146  1.00 19.69 ? 46   LEU A O     1 
ATOM   337   C CB    . LEU A 1 46  ? 49.798  144.427 20.233  1.00 20.27 ? 46   LEU A CB    1 
ATOM   338   C CG    . LEU A 1 46  ? 49.376  144.624 21.700  1.00 20.70 ? 46   LEU A CG    1 
ATOM   339   C CD1   . LEU A 1 46  ? 50.533  144.196 22.543  1.00 15.85 ? 46   LEU A CD1   1 
ATOM   340   C CD2   . LEU A 1 46  ? 48.981  146.078 22.037  1.00 18.32 ? 46   LEU A CD2   1 
ATOM   341   N N     . ASP A 1 47  ? 50.565  145.542 17.378  1.00 20.51 ? 47   ASP A N     1 
ATOM   342   C CA    . ASP A 1 47  ? 51.460  145.198 16.283  1.00 20.86 ? 47   ASP A CA    1 
ATOM   343   C C     . ASP A 1 47  ? 52.656  144.403 16.817  1.00 21.20 ? 47   ASP A C     1 
ATOM   344   O O     . ASP A 1 47  ? 53.340  144.850 17.730  1.00 20.87 ? 47   ASP A O     1 
ATOM   345   C CB    . ASP A 1 47  ? 52.006  146.456 15.601  1.00 20.86 ? 47   ASP A CB    1 
ATOM   346   C CG    . ASP A 1 47  ? 50.955  147.252 14.878  1.00 20.81 ? 47   ASP A CG    1 
ATOM   347   O OD1   . ASP A 1 47  ? 51.363  148.249 14.240  1.00 23.84 ? 47   ASP A OD1   1 
ATOM   348   O OD2   . ASP A 1 47  ? 49.752  146.913 14.947  1.00 18.83 ? 47   ASP A OD2   1 
ATOM   349   N N     . TRP A 1 48  ? 52.908  143.244 16.219  1.00 21.48 ? 48   TRP A N     1 
ATOM   350   C CA    . TRP A 1 48  ? 54.045  142.405 16.575  1.00 21.58 ? 48   TRP A CA    1 
ATOM   351   C C     . TRP A 1 48  ? 55.102  142.516 15.504  1.00 21.87 ? 48   TRP A C     1 
ATOM   352   O O     . TRP A 1 48  ? 54.780  142.576 14.321  1.00 21.68 ? 48   TRP A O     1 
ATOM   353   C CB    . TRP A 1 48  ? 53.610  140.942 16.779  1.00 20.94 ? 48   TRP A CB    1 
ATOM   354   C CG    . TRP A 1 48  ? 52.672  140.819 17.953  1.00 20.96 ? 48   TRP A CG    1 
ATOM   355   C CD1   . TRP A 1 48  ? 51.354  141.165 17.979  1.00 18.33 ? 48   TRP A CD1   1 
ATOM   356   C CD2   . TRP A 1 48  ? 52.992  140.357 19.277  1.00 20.56 ? 48   TRP A CD2   1 
ATOM   357   N NE1   . TRP A 1 48  ? 50.831  140.942 19.220  1.00 18.78 ? 48   TRP A NE1   1 
ATOM   358   C CE2   . TRP A 1 48  ? 51.811  140.456 20.044  1.00 18.57 ? 48   TRP A CE2   1 
ATOM   359   C CE3   . TRP A 1 48  ? 54.164  139.872 19.892  1.00 20.32 ? 48   TRP A CE3   1 
ATOM   360   C CZ2   . TRP A 1 48  ? 51.753  140.075 21.397  1.00 18.91 ? 48   TRP A CZ2   1 
ATOM   361   C CZ3   . TRP A 1 48  ? 54.106  139.502 21.240  1.00 19.37 ? 48   TRP A CZ3   1 
ATOM   362   C CH2   . TRP A 1 48  ? 52.906  139.600 21.971  1.00 19.06 ? 48   TRP A CH2   1 
ATOM   363   N N     . ILE A 1 49  ? 56.358  142.587 15.934  1.00 22.17 ? 49   ILE A N     1 
ATOM   364   C CA    . ILE A 1 49  ? 57.486  142.660 15.027  1.00 22.63 ? 49   ILE A CA    1 
ATOM   365   C C     . ILE A 1 49  ? 57.710  141.277 14.377  1.00 23.32 ? 49   ILE A C     1 
ATOM   366   O O     . ILE A 1 49  ? 57.881  141.166 13.168  1.00 23.39 ? 49   ILE A O     1 
ATOM   367   C CB    . ILE A 1 49  ? 58.735  143.241 15.731  1.00 22.39 ? 49   ILE A CB    1 
ATOM   368   C CG1   . ILE A 1 49  ? 58.422  144.683 16.182  1.00 22.29 ? 49   ILE A CG1   1 
ATOM   369   C CG2   . ILE A 1 49  ? 59.941  143.198 14.793  1.00 23.55 ? 49   ILE A CG2   1 
ATOM   370   C CD1   . ILE A 1 49  ? 59.515  145.425 16.928  1.00 21.46 ? 49   ILE A CD1   1 
ATOM   371   N N     . THR A 1 50  ? 57.698  140.233 15.194  1.00 24.23 ? 50   THR A N     1 
ATOM   372   C CA    . THR A 1 50  ? 57.603  138.879 14.711  1.00 24.53 ? 50   THR A CA    1 
ATOM   373   C C     . THR A 1 50  ? 56.421  138.254 15.442  1.00 24.75 ? 50   THR A C     1 
ATOM   374   O O     . THR A 1 50  ? 56.237  138.505 16.640  1.00 25.36 ? 50   THR A O     1 
ATOM   375   C CB    . THR A 1 50  ? 58.916  138.066 14.944  1.00 24.68 ? 50   THR A CB    1 
ATOM   376   O OG1   . THR A 1 50  ? 59.258  138.065 16.328  1.00 25.65 ? 50   THR A OG1   1 
ATOM   377   C CG2   . THR A 1 50  ? 60.061  138.651 14.166  1.00 25.08 ? 50   THR A CG2   1 
ATOM   378   N N     . PRO A 1 51  ? 55.598  137.460 14.731  1.00 25.01 ? 51   PRO A N     1 
ATOM   379   C CA    . PRO A 1 51  ? 54.388  136.903 15.334  1.00 24.98 ? 51   PRO A CA    1 
ATOM   380   C C     . PRO A 1 51  ? 54.654  135.848 16.400  1.00 25.18 ? 51   PRO A C     1 
ATOM   381   O O     . PRO A 1 51  ? 55.630  135.103 16.319  1.00 25.08 ? 51   PRO A O     1 
ATOM   382   C CB    . PRO A 1 51  ? 53.663  136.263 14.138  1.00 25.48 ? 51   PRO A CB    1 
ATOM   383   C CG    . PRO A 1 51  ? 54.740  135.934 13.170  1.00 24.51 ? 51   PRO A CG    1 
ATOM   384   C CD    . PRO A 1 51  ? 55.751  137.046 13.320  1.00 24.78 ? 51   PRO A CD    1 
ATOM   385   N N     . TYR A 1 52  ? 53.786  135.780 17.400  1.00 25.50 ? 52   TYR A N     1 
ATOM   386   C CA    . TYR A 1 52  ? 53.843  134.666 18.341  1.00 26.20 ? 52   TYR A CA    1 
ATOM   387   C C     . TYR A 1 52  ? 53.320  133.415 17.645  1.00 27.18 ? 52   TYR A C     1 
ATOM   388   O O     . TYR A 1 52  ? 52.566  133.507 16.682  1.00 26.84 ? 52   TYR A O     1 
ATOM   389   C CB    . TYR A 1 52  ? 53.027  134.951 19.613  1.00 25.57 ? 52   TYR A CB    1 
ATOM   390   C CG    . TYR A 1 52  ? 51.656  135.550 19.368  1.00 24.05 ? 52   TYR A CG    1 
ATOM   391   C CD1   . TYR A 1 52  ? 50.559  134.748 19.030  1.00 22.34 ? 52   TYR A CD1   1 
ATOM   392   C CD2   . TYR A 1 52  ? 51.454  136.919 19.501  1.00 23.38 ? 52   TYR A CD2   1 
ATOM   393   C CE1   . TYR A 1 52  ? 49.306  135.314 18.822  1.00 23.01 ? 52   TYR A CE1   1 
ATOM   394   C CE2   . TYR A 1 52  ? 50.214  137.483 19.299  1.00 22.61 ? 52   TYR A CE2   1 
ATOM   395   C CZ    . TYR A 1 52  ? 49.146  136.682 18.951  1.00 23.10 ? 52   TYR A CZ    1 
ATOM   396   O OH    . TYR A 1 52  ? 47.926  137.281 18.750  1.00 23.24 ? 52   TYR A OH    1 
ATOM   397   N N     . GLN A 1 53  ? 53.738  132.255 18.123  1.00 28.37 ? 53   GLN A N     1 
ATOM   398   C CA    . GLN A 1 53  ? 53.134  131.005 17.681  1.00 29.80 ? 53   GLN A CA    1 
ATOM   399   C C     . GLN A 1 53  ? 52.389  130.413 18.875  1.00 29.41 ? 53   GLN A C     1 
ATOM   400   O O     . GLN A 1 53  ? 51.170  130.217 18.823  1.00 29.91 ? 53   GLN A O     1 
ATOM   401   C CB    . GLN A 1 53  ? 54.204  130.042 17.168  1.00 29.95 ? 53   GLN A CB    1 
ATOM   402   C CG    . GLN A 1 53  ? 53.700  128.630 16.878  1.00 34.28 ? 53   GLN A CG    1 
ATOM   403   C CD    . GLN A 1 53  ? 53.489  128.358 15.398  1.00 38.64 ? 53   GLN A CD    1 
ATOM   404   O OE1   . GLN A 1 53  ? 53.264  127.210 15.003  1.00 40.88 ? 53   GLN A OE1   1 
ATOM   405   N NE2   . GLN A 1 53  ? 53.572  129.410 14.566  1.00 40.38 ? 53   GLN A NE2   1 
ATOM   406   N N     . LYS A 1 54  ? 53.138  130.139 19.944  1.00 28.64 ? 54   LYS A N     1 
ATOM   407   C CA    . LYS A 1 54  ? 52.567  129.711 21.212  1.00 27.96 ? 54   LYS A CA    1 
ATOM   408   C C     . LYS A 1 54  ? 51.859  130.904 21.881  1.00 26.35 ? 54   LYS A C     1 
ATOM   409   O O     . LYS A 1 54  ? 52.305  132.057 21.771  1.00 26.33 ? 54   LYS A O     1 
ATOM   410   C CB    . LYS A 1 54  ? 53.661  129.114 22.107  1.00 28.71 ? 54   LYS A CB    1 
ATOM   411   C CG    . LYS A 1 54  ? 53.183  128.597 23.471  1.00 31.56 ? 54   LYS A CG    1 
ATOM   412   C CD    . LYS A 1 54  ? 52.508  127.223 23.386  1.00 34.74 ? 54   LYS A CD    1 
ATOM   413   C CE    . LYS A 1 54  ? 52.289  126.639 24.786  1.00 35.01 ? 54   LYS A CE    1 
ATOM   414   N NZ    . LYS A 1 54  ? 52.504  125.158 24.825  1.00 33.74 ? 54   LYS A NZ    1 
ATOM   415   N N     . VAL A 1 55  ? 50.731  130.611 22.527  1.00 24.58 ? 55   VAL A N     1 
ATOM   416   C CA    . VAL A 1 55  ? 49.897  131.593 23.186  1.00 22.49 ? 55   VAL A CA    1 
ATOM   417   C C     . VAL A 1 55  ? 49.999  131.354 24.703  1.00 22.56 ? 55   VAL A C     1 
ATOM   418   O O     . VAL A 1 55  ? 50.788  132.001 25.381  1.00 22.24 ? 55   VAL A O     1 
ATOM   419   C CB    . VAL A 1 55  ? 48.414  131.549 22.647  1.00 23.20 ? 55   VAL A CB    1 
ATOM   420   C CG1   . VAL A 1 55  ? 47.511  132.586 23.358  1.00 20.90 ? 55   VAL A CG1   1 
ATOM   421   C CG2   . VAL A 1 55  ? 48.369  131.789 21.130  1.00 21.52 ? 55   VAL A CG2   1 
ATOM   422   N N     . LYS A 1 56  ? 49.243  130.402 25.237  1.00 21.89 ? 56   LYS A N     1 
ATOM   423   C CA    . LYS A 1 56  ? 49.213  130.196 26.684  1.00 21.05 ? 56   LYS A CA    1 
ATOM   424   C C     . LYS A 1 56  ? 50.194  129.101 27.123  1.00 20.46 ? 56   LYS A C     1 
ATOM   425   O O     . LYS A 1 56  ? 50.099  127.976 26.680  1.00 19.54 ? 56   LYS A O     1 
ATOM   426   C CB    . LYS A 1 56  ? 47.779  129.884 27.150  1.00 20.91 ? 56   LYS A CB    1 
ATOM   427   C CG    . LYS A 1 56  ? 47.639  129.576 28.646  1.00 21.02 ? 56   LYS A CG    1 
ATOM   428   C CD    . LYS A 1 56  ? 46.165  129.522 29.030  1.00 21.11 ? 56   LYS A CD    1 
ATOM   429   C CE    . LYS A 1 56  ? 45.963  129.335 30.517  1.00 22.12 ? 56   LYS A CE    1 
ATOM   430   N NZ    . LYS A 1 56  ? 46.667  128.104 31.002  1.00 24.00 ? 56   LYS A NZ    1 
ATOM   431   N N     . ASN A 1 57  ? 51.134  129.454 28.007  1.00 19.91 ? 57   ASN A N     1 
ATOM   432   C CA    . ASN A 1 57  ? 52.116  128.518 28.534  1.00 19.38 ? 57   ASN A CA    1 
ATOM   433   C C     . ASN A 1 57  ? 52.370  128.807 30.030  1.00 19.56 ? 57   ASN A C     1 
ATOM   434   O O     . ASN A 1 57  ? 53.335  129.481 30.377  1.00 19.46 ? 57   ASN A O     1 
ATOM   435   C CB    . ASN A 1 57  ? 53.425  128.596 27.720  1.00 18.96 ? 57   ASN A CB    1 
ATOM   436   C CG    . ASN A 1 57  ? 54.388  127.436 28.022  1.00 19.68 ? 57   ASN A CG    1 
ATOM   437   O OD1   . ASN A 1 57  ? 54.004  126.441 28.642  1.00 21.98 ? 57   ASN A OD1   1 
ATOM   438   N ND2   . ASN A 1 57  ? 55.644  127.571 27.598  1.00 14.12 ? 57   ASN A ND2   1 
ATOM   439   N N     . THR A 1 58  ? 51.507  128.276 30.897  1.00 18.75 ? 58   THR A N     1 
ATOM   440   C CA    . THR A 1 58  ? 51.469  128.659 32.303  1.00 18.36 ? 58   THR A CA    1 
ATOM   441   C C     . THR A 1 58  ? 51.253  127.458 33.230  1.00 18.82 ? 58   THR A C     1 
ATOM   442   O O     . THR A 1 58  ? 50.650  126.452 32.859  1.00 17.33 ? 58   THR A O     1 
ATOM   443   C CB    . THR A 1 58  ? 50.319  129.652 32.592  1.00 19.06 ? 58   THR A CB    1 
ATOM   444   O OG1   . THR A 1 58  ? 49.067  128.993 32.368  1.00 18.03 ? 58   THR A OG1   1 
ATOM   445   C CG2   . THR A 1 58  ? 50.405  130.931 31.705  1.00 17.38 ? 58   THR A CG2   1 
ATOM   446   N N     . SER A 1 59  ? 51.731  127.599 34.459  1.00 18.53 ? 59   SER A N     1 
ATOM   447   C CA    . SER A 1 59  ? 51.490  126.625 35.495  1.00 19.00 ? 59   SER A CA    1 
ATOM   448   C C     . SER A 1 59  ? 51.467  127.345 36.854  1.00 18.87 ? 59   SER A C     1 
ATOM   449   O O     . SER A 1 59  ? 52.322  128.207 37.118  1.00 19.35 ? 59   SER A O     1 
ATOM   450   C CB    . SER A 1 59  ? 52.600  125.582 35.451  1.00 18.99 ? 59   SER A CB    1 
ATOM   451   O OG    . SER A 1 59  ? 52.589  124.786 36.605  1.00 20.51 ? 59   SER A OG    1 
ATOM   452   N N     . PHE A 1 60  ? 50.495  126.991 37.696  1.00 18.24 ? 60   PHE A N     1 
ATOM   453   C CA    . PHE A 1 60  ? 50.415  127.492 39.080  1.00 18.07 ? 60   PHE A CA    1 
ATOM   454   C C     . PHE A 1 60  ? 50.892  126.391 40.055  1.00 18.29 ? 60   PHE A C     1 
ATOM   455   O O     . PHE A 1 60  ? 50.619  126.457 41.279  1.00 17.77 ? 60   PHE A O     1 
ATOM   456   C CB    . PHE A 1 60  ? 48.977  127.927 39.442  1.00 16.37 ? 60   PHE A CB    1 
ATOM   457   C CG    . PHE A 1 60  ? 48.509  129.188 38.750  1.00 16.39 ? 60   PHE A CG    1 
ATOM   458   C CD1   . PHE A 1 60  ? 47.168  129.579 38.843  1.00 16.00 ? 60   PHE A CD1   1 
ATOM   459   C CD2   . PHE A 1 60  ? 49.388  129.987 38.002  1.00 15.13 ? 60   PHE A CD2   1 
ATOM   460   C CE1   . PHE A 1 60  ? 46.717  130.766 38.226  1.00 16.42 ? 60   PHE A CE1   1 
ATOM   461   C CE2   . PHE A 1 60  ? 48.948  131.167 37.368  1.00 15.50 ? 60   PHE A CE2   1 
ATOM   462   C CZ    . PHE A 1 60  ? 47.603  131.546 37.473  1.00 16.25 ? 60   PHE A CZ    1 
ATOM   463   N N     . ALA A 1 61  ? 51.614  125.398 39.522  1.00 17.94 ? 61   ALA A N     1 
ATOM   464   C CA    . ALA A 1 61  ? 52.099  124.276 40.353  1.00 18.43 ? 61   ALA A CA    1 
ATOM   465   C C     . ALA A 1 61  ? 52.841  124.759 41.595  1.00 18.61 ? 61   ALA A C     1 
ATOM   466   O O     . ALA A 1 61  ? 53.650  125.693 41.491  1.00 18.46 ? 61   ALA A O     1 
ATOM   467   C CB    . ALA A 1 61  ? 52.989  123.319 39.530  1.00 18.47 ? 61   ALA A CB    1 
ATOM   468   N N     . PRO A 1 62  ? 52.554  124.146 42.782  1.00 19.18 ? 62   PRO A N     1 
ATOM   469   C CA    . PRO A 1 62  ? 53.211  124.522 44.040  1.00 19.81 ? 62   PRO A CA    1 
ATOM   470   C C     . PRO A 1 62  ? 54.730  124.608 43.933  1.00 20.19 ? 62   PRO A C     1 
ATOM   471   O O     . PRO A 1 62  ? 55.363  123.652 43.493  1.00 21.31 ? 62   PRO A O     1 
ATOM   472   C CB    . PRO A 1 62  ? 52.825  123.385 45.023  1.00 19.49 ? 62   PRO A CB    1 
ATOM   473   C CG    . PRO A 1 62  ? 51.844  122.542 44.357  1.00 19.35 ? 62   PRO A CG    1 
ATOM   474   C CD    . PRO A 1 62  ? 51.534  123.092 42.995  1.00 19.69 ? 62   PRO A CD    1 
ATOM   475   N N     . GLY A 1 63  ? 55.308  125.732 44.348  1.00 20.18 ? 63   GLY A N     1 
ATOM   476   C CA    . GLY A 1 63  ? 56.757  125.903 44.350  1.00 19.99 ? 63   GLY A CA    1 
ATOM   477   C C     . GLY A 1 63  ? 57.398  125.882 42.970  1.00 20.43 ? 63   GLY A C     1 
ATOM   478   O O     . GLY A 1 63  ? 58.620  125.853 42.857  1.00 20.46 ? 63   GLY A O     1 
ATOM   479   N N     . ASN A 1 64  ? 56.566  125.943 41.926  1.00 20.35 ? 64   ASN A N     1 
ATOM   480   C CA    . ASN A 1 64  ? 56.996  125.802 40.531  1.00 20.11 ? 64   ASN A CA    1 
ATOM   481   C C     . ASN A 1 64  ? 56.092  126.611 39.586  1.00 19.83 ? 64   ASN A C     1 
ATOM   482   O O     . ASN A 1 64  ? 55.522  126.104 38.606  1.00 19.36 ? 64   ASN A O     1 
ATOM   483   C CB    . ASN A 1 64  ? 57.039  124.320 40.152  1.00 18.75 ? 64   ASN A CB    1 
ATOM   484   C CG    . ASN A 1 64  ? 58.269  123.628 40.691  1.00 19.60 ? 64   ASN A CG    1 
ATOM   485   O OD1   . ASN A 1 64  ? 59.390  123.886 40.247  1.00 22.01 ? 64   ASN A OD1   1 
ATOM   486   N ND2   . ASN A 1 64  ? 58.076  122.736 41.644  1.00 20.55 ? 64   ASN A ND2   1 
ATOM   487   N N     . VAL A 1 65  ? 55.938  127.882 39.912  1.00 19.80 ? 65   VAL A N     1 
ATOM   488   C CA    . VAL A 1 65  ? 55.035  128.735 39.142  1.00 19.73 ? 65   VAL A CA    1 
ATOM   489   C C     . VAL A 1 65  ? 55.781  129.292 37.928  1.00 19.86 ? 65   VAL A C     1 
ATOM   490   O O     . VAL A 1 65  ? 56.892  129.813 38.069  1.00 20.06 ? 65   VAL A O     1 
ATOM   491   C CB    . VAL A 1 65  ? 54.435  129.843 40.015  1.00 19.29 ? 65   VAL A CB    1 
ATOM   492   C CG1   . VAL A 1 65  ? 53.583  130.808 39.174  1.00 18.90 ? 65   VAL A CG1   1 
ATOM   493   C CG2   . VAL A 1 65  ? 53.592  129.207 41.129  1.00 19.62 ? 65   VAL A CG2   1 
ATOM   494   N N     . SER A 1 66  ? 55.170  129.158 36.744  1.00 19.96 ? 66   SER A N     1 
ATOM   495   C CA    . SER A 1 66  ? 55.738  129.652 35.504  1.00 19.46 ? 66   SER A CA    1 
ATOM   496   C C     . SER A 1 66  ? 54.639  130.217 34.607  1.00 19.65 ? 66   SER A C     1 
ATOM   497   O O     . SER A 1 66  ? 53.745  129.497 34.190  1.00 19.31 ? 66   SER A O     1 
ATOM   498   C CB    . SER A 1 66  ? 56.467  128.524 34.769  1.00 19.93 ? 66   SER A CB    1 
ATOM   499   O OG    . SER A 1 66  ? 57.203  129.031 33.668  1.00 20.59 ? 66   SER A OG    1 
ATOM   500   N N     . ILE A 1 67  ? 54.735  131.506 34.291  1.00 19.39 ? 67   ILE A N     1 
ATOM   501   C CA    . ILE A 1 67  ? 53.698  132.181 33.535  1.00 19.35 ? 67   ILE A CA    1 
ATOM   502   C C     . ILE A 1 67  ? 54.345  132.801 32.304  1.00 19.18 ? 67   ILE A C     1 
ATOM   503   O O     . ILE A 1 67  ? 55.161  133.699 32.419  1.00 18.21 ? 67   ILE A O     1 
ATOM   504   C CB    . ILE A 1 67  ? 52.981  133.253 34.414  1.00 19.73 ? 67   ILE A CB    1 
ATOM   505   C CG1   . ILE A 1 67  ? 52.387  132.603 35.664  1.00 19.15 ? 67   ILE A CG1   1 
ATOM   506   C CG2   . ILE A 1 67  ? 51.946  134.063 33.615  1.00 18.08 ? 67   ILE A CG2   1 
ATOM   507   C CD1   . ILE A 1 67  ? 52.524  133.483 36.892  1.00 20.71 ? 67   ILE A CD1   1 
ATOM   508   N N     . LYS A 1 68  ? 53.985  132.284 31.131  1.00 18.73 ? 68   LYS A N     1 
ATOM   509   C CA    . LYS A 1 68  ? 54.417  132.858 29.855  1.00 18.45 ? 68   LYS A CA    1 
ATOM   510   C C     . LYS A 1 68  ? 53.231  132.956 28.916  1.00 18.22 ? 68   LYS A C     1 
ATOM   511   O O     . LYS A 1 68  ? 52.403  132.048 28.851  1.00 18.45 ? 68   LYS A O     1 
ATOM   512   C CB    . LYS A 1 68  ? 55.500  131.986 29.204  1.00 18.34 ? 68   LYS A CB    1 
ATOM   513   C CG    . LYS A 1 68  ? 56.720  131.744 30.099  1.00 20.23 ? 68   LYS A CG    1 
ATOM   514   C CD    . LYS A 1 68  ? 57.639  130.729 29.465  1.00 22.16 ? 68   LYS A CD    1 
ATOM   515   C CE    . LYS A 1 68  ? 58.992  130.590 30.186  1.00 23.19 ? 68   LYS A CE    1 
ATOM   516   N NZ    . LYS A 1 68  ? 59.843  129.566 29.452  1.00 24.42 ? 68   LYS A NZ    1 
ATOM   517   N N     . TRP A 1 69  ? 53.186  134.052 28.166  1.00 17.82 ? 69   TRP A N     1 
ATOM   518   C CA    . TRP A 1 69  ? 52.154  134.304 27.171  1.00 18.04 ? 69   TRP A CA    1 
ATOM   519   C C     . TRP A 1 69  ? 52.811  134.859 25.918  1.00 18.42 ? 69   TRP A C     1 
ATOM   520   O O     . TRP A 1 69  ? 53.694  135.731 26.013  1.00 18.12 ? 69   TRP A O     1 
ATOM   521   C CB    . TRP A 1 69  ? 51.136  135.327 27.698  1.00 17.48 ? 69   TRP A CB    1 
ATOM   522   C CG    . TRP A 1 69  ? 50.125  134.743 28.645  1.00 16.92 ? 69   TRP A CG    1 
ATOM   523   C CD1   . TRP A 1 69  ? 50.243  134.627 29.995  1.00 16.77 ? 69   TRP A CD1   1 
ATOM   524   C CD2   . TRP A 1 69  ? 48.846  134.185 28.302  1.00 16.80 ? 69   TRP A CD2   1 
ATOM   525   N NE1   . TRP A 1 69  ? 49.106  134.048 30.527  1.00 17.93 ? 69   TRP A NE1   1 
ATOM   526   C CE2   . TRP A 1 69  ? 48.233  133.769 29.509  1.00 17.30 ? 69   TRP A CE2   1 
ATOM   527   C CE3   . TRP A 1 69  ? 48.152  134.012 27.089  1.00 16.92 ? 69   TRP A CE3   1 
ATOM   528   C CZ2   . TRP A 1 69  ? 46.956  133.189 29.546  1.00 17.47 ? 69   TRP A CZ2   1 
ATOM   529   C CZ3   . TRP A 1 69  ? 46.886  133.447 27.118  1.00 16.93 ? 69   TRP A CZ3   1 
ATOM   530   C CH2   . TRP A 1 69  ? 46.296  133.038 28.352  1.00 16.60 ? 69   TRP A CH2   1 
ATOM   531   N N     . TYR A 1 70  ? 52.380  134.365 24.753  1.00 18.65 ? 70   TYR A N     1 
ATOM   532   C CA    . TYR A 1 70  ? 52.908  134.821 23.454  1.00 19.06 ? 70   TYR A CA    1 
ATOM   533   C C     . TYR A 1 70  ? 54.437  134.742 23.349  1.00 20.13 ? 70   TYR A C     1 
ATOM   534   O O     . TYR A 1 70  ? 55.050  135.542 22.632  1.00 19.91 ? 70   TYR A O     1 
ATOM   535   C CB    . TYR A 1 70  ? 52.509  136.273 23.222  1.00 18.49 ? 70   TYR A CB    1 
ATOM   536   C CG    . TYR A 1 70  ? 51.034  136.580 23.332  1.00 19.09 ? 70   TYR A CG    1 
ATOM   537   C CD1   . TYR A 1 70  ? 50.552  137.445 24.330  1.00 19.41 ? 70   TYR A CD1   1 
ATOM   538   C CD2   . TYR A 1 70  ? 50.112  136.030 22.430  1.00 17.26 ? 70   TYR A CD2   1 
ATOM   539   C CE1   . TYR A 1 70  ? 49.198  137.749 24.420  1.00 17.29 ? 70   TYR A CE1   1 
ATOM   540   C CE2   . TYR A 1 70  ? 48.769  136.333 22.515  1.00 18.00 ? 70   TYR A CE2   1 
ATOM   541   C CZ    . TYR A 1 70  ? 48.312  137.189 23.505  1.00 18.18 ? 70   TYR A CZ    1 
ATOM   542   O OH    . TYR A 1 70  ? 46.964  137.485 23.569  1.00 16.54 ? 70   TYR A OH    1 
ATOM   543   N N     . GLU A 1 71  ? 55.050  133.776 24.034  1.00 20.97 ? 71   GLU A N     1 
ATOM   544   C CA    . GLU A 1 71  ? 56.464  133.886 24.411  1.00 22.69 ? 71   GLU A CA    1 
ATOM   545   C C     . GLU A 1 71  ? 57.469  134.031 23.275  1.00 24.00 ? 71   GLU A C     1 
ATOM   546   O O     . GLU A 1 71  ? 58.572  134.552 23.503  1.00 24.58 ? 71   GLU A O     1 
ATOM   547   C CB    . GLU A 1 71  ? 56.883  132.706 25.277  1.00 22.67 ? 71   GLU A CB    1 
ATOM   548   C CG    . GLU A 1 71  ? 56.886  131.391 24.524  1.00 22.65 ? 71   GLU A CG    1 
ATOM   549   C CD    . GLU A 1 71  ? 56.971  130.214 25.456  1.00 25.47 ? 71   GLU A CD    1 
ATOM   550   O OE1   . GLU A 1 71  ? 56.000  129.948 26.204  1.00 25.56 ? 71   GLU A OE1   1 
ATOM   551   O OE2   . GLU A 1 71  ? 58.015  129.554 25.438  1.00 27.58 ? 71   GLU A OE2   1 
ATOM   552   N N     . ASP A 1 72  ? 57.105  133.554 22.081  1.00 24.71 ? 72   ASP A N     1 
ATOM   553   C CA    . ASP A 1 72  ? 57.998  133.587 20.928  1.00 25.66 ? 72   ASP A CA    1 
ATOM   554   C C     . ASP A 1 72  ? 57.808  134.820 20.042  1.00 25.09 ? 72   ASP A C     1 
ATOM   555   O O     . ASP A 1 72  ? 58.588  135.043 19.114  1.00 25.51 ? 72   ASP A O     1 
ATOM   556   C CB    . ASP A 1 72  ? 57.885  132.283 20.098  1.00 27.30 ? 72   ASP A CB    1 
ATOM   557   C CG    . ASP A 1 72  ? 56.442  131.794 19.939  1.00 31.03 ? 72   ASP A CG    1 
ATOM   558   O OD1   . ASP A 1 72  ? 56.258  130.611 19.561  1.00 35.22 ? 72   ASP A OD1   1 
ATOM   559   O OD2   . ASP A 1 72  ? 55.494  132.567 20.201  1.00 33.67 ? 72   ASP A OD2   1 
ATOM   560   N N     . GLY A 1 73  ? 56.771  135.606 20.323  1.00 24.04 ? 73   GLY A N     1 
ATOM   561   C CA    . GLY A 1 73  ? 56.548  136.854 19.626  1.00 23.56 ? 73   GLY A CA    1 
ATOM   562   C C     . GLY A 1 73  ? 57.479  137.952 20.096  1.00 23.27 ? 73   GLY A C     1 
ATOM   563   O O     . GLY A 1 73  ? 57.913  137.965 21.257  1.00 22.97 ? 73   GLY A O     1 
ATOM   564   N N     . THR A 1 74  ? 57.796  138.874 19.192  1.00 22.48 ? 74   THR A N     1 
ATOM   565   C CA    . THR A 1 74  ? 58.526  140.080 19.577  1.00 22.22 ? 74   THR A CA    1 
ATOM   566   C C     . THR A 1 74  ? 57.735  141.370 19.239  1.00 21.63 ? 74   THR A C     1 
ATOM   567   O O     . THR A 1 74  ? 56.898  141.378 18.353  1.00 21.51 ? 74   THR A O     1 
ATOM   568   C CB    . THR A 1 74  ? 59.965  140.126 18.991  1.00 21.99 ? 74   THR A CB    1 
ATOM   569   O OG1   . THR A 1 74  ? 59.912  140.404 17.590  1.00 22.53 ? 74   THR A OG1   1 
ATOM   570   C CG2   . THR A 1 74  ? 60.726  138.797 19.230  1.00 22.17 ? 74   THR A CG2   1 
ATOM   571   N N     . LEU A 1 75  ? 58.026  142.453 19.953  1.00 21.11 ? 75   LEU A N     1 
ATOM   572   C CA    . LEU A 1 75  ? 57.241  143.684 19.870  1.00 20.58 ? 75   LEU A CA    1 
ATOM   573   C C     . LEU A 1 75  ? 57.916  144.822 20.643  1.00 20.50 ? 75   LEU A C     1 
ATOM   574   O O     . LEU A 1 75  ? 58.834  144.604 21.449  1.00 20.02 ? 75   LEU A O     1 
ATOM   575   C CB    . LEU A 1 75  ? 55.824  143.469 20.434  1.00 20.01 ? 75   LEU A CB    1 
ATOM   576   C CG    . LEU A 1 75  ? 55.615  143.525 21.965  1.00 19.79 ? 75   LEU A CG    1 
ATOM   577   C CD1   . LEU A 1 75  ? 54.138  143.823 22.391  1.00 15.97 ? 75   LEU A CD1   1 
ATOM   578   C CD2   . LEU A 1 75  ? 56.133  142.276 22.673  1.00 18.42 ? 75   LEU A CD2   1 
ATOM   579   N N     . ASN A 1 76  ? 57.434  146.034 20.409  1.00 20.32 ? 76   ASN A N     1 
ATOM   580   C CA    . ASN A 1 76  ? 57.869  147.192 21.172  1.00 20.77 ? 76   ASN A CA    1 
ATOM   581   C C     . ASN A 1 76  ? 56.645  147.947 21.660  1.00 20.72 ? 76   ASN A C     1 
ATOM   582   O O     . ASN A 1 76  ? 55.780  148.314 20.864  1.00 20.68 ? 76   ASN A O     1 
ATOM   583   C CB    . ASN A 1 76  ? 58.750  148.096 20.302  1.00 21.20 ? 76   ASN A CB    1 
ATOM   584   C CG    . ASN A 1 76  ? 59.540  149.080 21.111  1.00 21.32 ? 76   ASN A CG    1 
ATOM   585   O OD1   . ASN A 1 76  ? 60.715  148.846 21.422  1.00 23.31 ? 76   ASN A OD1   1 
ATOM   586   N ND2   . ASN A 1 76  ? 58.911  150.177 21.476  1.00 19.22 ? 76   ASN A ND2   1 
ATOM   587   N N     . LEU A 1 77  ? 56.568  148.136 22.975  1.00 20.65 ? 77   LEU A N     1 
ATOM   588   C CA    . LEU A 1 77  ? 55.482  148.886 23.601  1.00 20.57 ? 77   LEU A CA    1 
ATOM   589   C C     . LEU A 1 77  ? 55.397  150.328 23.111  1.00 20.20 ? 77   LEU A C     1 
ATOM   590   O O     . LEU A 1 77  ? 54.314  150.804 22.857  1.00 21.24 ? 77   LEU A O     1 
ATOM   591   C CB    . LEU A 1 77  ? 55.613  148.868 25.125  1.00 20.01 ? 77   LEU A CB    1 
ATOM   592   C CG    . LEU A 1 77  ? 54.593  149.670 25.931  1.00 18.92 ? 77   LEU A CG    1 
ATOM   593   C CD1   . LEU A 1 77  ? 54.314  148.931 27.239  1.00 17.65 ? 77   LEU A CD1   1 
ATOM   594   C CD2   . LEU A 1 77  ? 55.038  151.125 26.175  1.00 16.51 ? 77   LEU A CD2   1 
ATOM   595   N N     . ALA A 1 78  ? 56.526  151.018 22.998  1.00 19.89 ? 78   ALA A N     1 
ATOM   596   C CA    . ALA A 1 78  ? 56.519  152.419 22.550  1.00 20.15 ? 78   ALA A CA    1 
ATOM   597   C C     . ALA A 1 78  ? 56.001  152.553 21.119  1.00 19.47 ? 78   ALA A C     1 
ATOM   598   O O     . ALA A 1 78  ? 55.229  153.463 20.822  1.00 19.59 ? 78   ALA A O     1 
ATOM   599   C CB    . ALA A 1 78  ? 57.926  153.068 22.695  1.00 20.60 ? 78   ALA A CB    1 
ATOM   600   N N     . ALA A 1 79  ? 56.397  151.620 20.253  1.00 18.69 ? 79   ALA A N     1 
ATOM   601   C CA    . ALA A 1 79  ? 55.870  151.545 18.891  1.00 18.06 ? 79   ALA A CA    1 
ATOM   602   C C     . ALA A 1 79  ? 54.359  151.322 18.863  1.00 17.79 ? 79   ALA A C     1 
ATOM   603   O O     . ALA A 1 79  ? 53.652  151.909 18.039  1.00 18.66 ? 79   ALA A O     1 
ATOM   604   C CB    . ALA A 1 79  ? 56.620  150.451 18.065  1.00 17.91 ? 79   ALA A CB    1 
ATOM   605   N N     . ASN A 1 80  ? 53.853  150.498 19.771  1.00 17.20 ? 80   ASN A N     1 
ATOM   606   C CA    . ASN A 1 80  ? 52.399  150.308 19.881  1.00 17.06 ? 80   ASN A CA    1 
ATOM   607   C C     . ASN A 1 80  ? 51.622  151.499 20.458  1.00 17.39 ? 80   ASN A C     1 
ATOM   608   O O     . ASN A 1 80  ? 50.428  151.702 20.133  1.00 17.47 ? 80   ASN A O     1 
ATOM   609   C CB    . ASN A 1 80  ? 52.083  149.027 20.658  1.00 16.40 ? 80   ASN A CB    1 
ATOM   610   C CG    . ASN A 1 80  ? 52.198  147.790 19.782  1.00 18.43 ? 80   ASN A CG    1 
ATOM   611   O OD1   . ASN A 1 80  ? 51.274  147.488 19.035  1.00 16.81 ? 80   ASN A OD1   1 
ATOM   612   N ND2   . ASN A 1 80  ? 53.344  147.083 19.853  1.00 15.49 ? 80   ASN A ND2   1 
ATOM   613   N N     . CYS A 1 81  ? 52.297  152.277 21.302  1.00 16.86 ? 81   CYS A N     1 
ATOM   614   C CA    . CYS A 1 81  ? 51.673  153.427 21.971  1.00 17.11 ? 81   CYS A CA    1 
ATOM   615   C C     . CYS A 1 81  ? 51.852  154.722 21.200  1.00 17.24 ? 81   CYS A C     1 
ATOM   616   O O     . CYS A 1 81  ? 51.173  155.712 21.491  1.00 17.34 ? 81   CYS A O     1 
ATOM   617   C CB    . CYS A 1 81  ? 52.207  153.589 23.403  1.00 15.91 ? 81   CYS A CB    1 
ATOM   618   S SG    . CYS A 1 81  ? 51.712  152.203 24.482  1.00 20.31 ? 81   CYS A SG    1 
ATOM   619   N N     . LEU A 1 82  ? 52.743  154.714 20.208  1.00 17.15 ? 82   LEU A N     1 
ATOM   620   C CA    . LEU A 1 82  ? 53.136  155.964 19.532  1.00 18.22 ? 82   LEU A CA    1 
ATOM   621   C C     . LEU A 1 82  ? 53.311  155.803 18.027  1.00 18.36 ? 82   LEU A C     1 
ATOM   622   O O     . LEU A 1 82  ? 52.499  156.302 17.280  1.00 18.51 ? 82   LEU A O     1 
ATOM   623   C CB    . LEU A 1 82  ? 54.417  156.566 20.137  1.00 17.53 ? 82   LEU A CB    1 
ATOM   624   C CG    . LEU A 1 82  ? 54.428  156.687 21.658  1.00 19.86 ? 82   LEU A CG    1 
ATOM   625   C CD1   . LEU A 1 82  ? 55.865  156.651 22.169  1.00 21.66 ? 82   LEU A CD1   1 
ATOM   626   C CD2   . LEU A 1 82  ? 53.646  157.942 22.099  1.00 16.64 ? 82   LEU A CD2   1 
ATOM   627   N N     . ASP A 1 83  ? 54.353  155.088 17.610  1.00 19.06 ? 83   ASP A N     1 
ATOM   628   C CA    . ASP A 1 83  ? 54.752  155.011 16.195  1.00 19.96 ? 83   ASP A CA    1 
ATOM   629   C C     . ASP A 1 83  ? 53.595  154.658 15.258  1.00 20.22 ? 83   ASP A C     1 
ATOM   630   O O     . ASP A 1 83  ? 53.377  155.348 14.263  1.00 20.34 ? 83   ASP A O     1 
ATOM   631   C CB    . ASP A 1 83  ? 55.924  154.039 15.992  1.00 19.20 ? 83   ASP A CB    1 
ATOM   632   C CG    . ASP A 1 83  ? 57.154  154.413 16.831  1.00 21.58 ? 83   ASP A CG    1 
ATOM   633   O OD1   . ASP A 1 83  ? 58.284  154.437 16.289  1.00 23.84 ? 83   ASP A OD1   1 
ATOM   634   O OD2   . ASP A 1 83  ? 57.002  154.703 18.030  1.00 22.57 ? 83   ASP A OD2   1 
ATOM   635   N N     . ARG A 1 84  ? 52.860  153.603 15.593  1.00 20.60 ? 84   ARG A N     1 
ATOM   636   C CA    . ARG A 1 84  ? 51.825  153.046 14.716  1.00 21.57 ? 84   ARG A CA    1 
ATOM   637   C C     . ARG A 1 84  ? 50.603  153.938 14.587  1.00 22.24 ? 84   ARG A C     1 
ATOM   638   O O     . ARG A 1 84  ? 49.737  153.677 13.741  1.00 22.62 ? 84   ARG A O     1 
ATOM   639   C CB    . ARG A 1 84  ? 51.395  151.641 15.186  1.00 21.11 ? 84   ARG A CB    1 
ATOM   640   C CG    . ARG A 1 84  ? 50.647  151.595 16.518  1.00 21.27 ? 84   ARG A CG    1 
ATOM   641   C CD    . ARG A 1 84  ? 50.053  150.214 16.724  1.00 20.59 ? 84   ARG A CD    1 
ATOM   642   N NE    . ARG A 1 84  ? 49.243  150.070 17.947  1.00 20.68 ? 84   ARG A NE    1 
ATOM   643   C CZ    . ARG A 1 84  ? 48.371  149.068 18.127  1.00 20.53 ? 84   ARG A CZ    1 
ATOM   644   N NH1   . ARG A 1 84  ? 48.194  148.164 17.158  1.00 16.40 ? 84   ARG A NH1   1 
ATOM   645   N NH2   . ARG A 1 84  ? 47.656  148.972 19.247  1.00 16.61 ? 84   ARG A NH2   1 
ATOM   646   N N     . HIS A 1 85  ? 50.533  154.976 15.429  1.00 23.04 ? 85   HIS A N     1 
ATOM   647   C CA    . HIS A 1 85  ? 49.433  155.945 15.407  1.00 23.66 ? 85   HIS A CA    1 
ATOM   648   C C     . HIS A 1 85  ? 49.790  157.209 14.624  1.00 24.49 ? 85   HIS A C     1 
ATOM   649   O O     . HIS A 1 85  ? 48.960  158.090 14.474  1.00 23.65 ? 85   HIS A O     1 
ATOM   650   C CB    . HIS A 1 85  ? 48.989  156.323 16.829  1.00 22.80 ? 85   HIS A CB    1 
ATOM   651   C CG    . HIS A 1 85  ? 48.609  155.154 17.674  1.00 22.91 ? 85   HIS A CG    1 
ATOM   652   N ND1   . HIS A 1 85  ? 47.604  154.277 17.327  1.00 23.06 ? 85   HIS A ND1   1 
ATOM   653   C CD2   . HIS A 1 85  ? 49.100  154.712 18.857  1.00 24.59 ? 85   HIS A CD2   1 
ATOM   654   C CE1   . HIS A 1 85  ? 47.499  153.338 18.250  1.00 22.41 ? 85   HIS A CE1   1 
ATOM   655   N NE2   . HIS A 1 85  ? 48.394  153.579 19.192  1.00 24.26 ? 85   HIS A NE2   1 
ATOM   656   N N     . LEU A 1 86  ? 51.023  157.302 14.131  1.00 25.72 ? 86   LEU A N     1 
ATOM   657   C CA    . LEU A 1 86  ? 51.489  158.543 13.487  1.00 26.63 ? 86   LEU A CA    1 
ATOM   658   C C     . LEU A 1 86  ? 50.881  158.812 12.111  1.00 27.71 ? 86   LEU A C     1 
ATOM   659   O O     . LEU A 1 86  ? 50.464  159.935 11.817  1.00 26.93 ? 86   LEU A O     1 
ATOM   660   C CB    . LEU A 1 86  ? 53.016  158.574 13.378  1.00 26.58 ? 86   LEU A CB    1 
ATOM   661   C CG    . LEU A 1 86  ? 53.901  158.594 14.630  1.00 26.79 ? 86   LEU A CG    1 
ATOM   662   C CD1   . LEU A 1 86  ? 55.342  158.765 14.194  1.00 26.10 ? 86   LEU A CD1   1 
ATOM   663   C CD2   . LEU A 1 86  ? 53.503  159.678 15.630  1.00 27.62 ? 86   LEU A CD2   1 
ATOM   664   N N     . GLN A 1 87  ? 50.864  157.789 11.262  1.00 29.55 ? 87   GLN A N     1 
ATOM   665   C CA    . GLN A 1 87  ? 50.364  157.946 9.890   1.00 31.72 ? 87   GLN A CA    1 
ATOM   666   C C     . GLN A 1 87  ? 48.916  158.452 9.876   1.00 31.88 ? 87   GLN A C     1 
ATOM   667   O O     . GLN A 1 87  ? 48.604  159.405 9.173   1.00 32.45 ? 87   GLN A O     1 
ATOM   668   C CB    . GLN A 1 87  ? 50.506  156.655 9.068   1.00 31.29 ? 87   GLN A CB    1 
ATOM   669   C CG    . GLN A 1 87  ? 50.275  156.887 7.546   1.00 33.33 ? 87   GLN A CG    1 
ATOM   670   C CD    . GLN A 1 87  ? 50.226  155.602 6.736   1.00 34.12 ? 87   GLN A CD    1 
ATOM   671   O OE1   . GLN A 1 87  ? 50.928  154.628 7.040   1.00 36.23 ? 87   GLN A OE1   1 
ATOM   672   N NE2   . GLN A 1 87  ? 49.397  155.592 5.689   1.00 35.79 ? 87   GLN A NE2   1 
ATOM   673   N N     . GLU A 1 88  ? 48.048  157.839 10.683  1.00 32.38 ? 88   GLU A N     1 
ATOM   674   C CA    . GLU A 1 88  ? 46.632  158.198 10.675  1.00 32.71 ? 88   GLU A CA    1 
ATOM   675   C C     . GLU A 1 88  ? 46.332  159.327 11.654  1.00 31.97 ? 88   GLU A C     1 
ATOM   676   O O     . GLU A 1 88  ? 45.535  160.206 11.363  1.00 31.47 ? 88   GLU A O     1 
ATOM   677   C CB    . GLU A 1 88  ? 45.788  156.983 11.047  1.00 33.31 ? 88   GLU A CB    1 
ATOM   678   C CG    . GLU A 1 88  ? 44.749  156.609 10.023  1.00 37.71 ? 88   GLU A CG    1 
ATOM   679   C CD    . GLU A 1 88  ? 45.258  155.540 9.046   1.00 41.74 ? 88   GLU A CD    1 
ATOM   680   O OE1   . GLU A 1 88  ? 46.322  155.743 8.402   1.00 42.70 ? 88   GLU A OE1   1 
ATOM   681   O OE2   . GLU A 1 88  ? 44.590  154.488 8.937   1.00 43.54 ? 88   GLU A OE2   1 
ATOM   682   N N     . ASN A 1 89  ? 46.978  159.290 12.822  1.00 31.40 ? 89   ASN A N     1 
ATOM   683   C CA    . ASN A 1 89  ? 46.533  160.086 13.966  1.00 30.99 ? 89   ASN A CA    1 
ATOM   684   C C     . ASN A 1 89  ? 47.629  160.891 14.649  1.00 30.25 ? 89   ASN A C     1 
ATOM   685   O O     . ASN A 1 89  ? 47.514  161.210 15.827  1.00 30.10 ? 89   ASN A O     1 
ATOM   686   C CB    . ASN A 1 89  ? 45.795  159.182 14.972  1.00 30.75 ? 89   ASN A CB    1 
ATOM   687   C CG    . ASN A 1 89  ? 44.476  158.633 14.412  1.00 32.61 ? 89   ASN A CG    1 
ATOM   688   O OD1   . ASN A 1 89  ? 44.348  157.433 14.146  1.00 34.25 ? 89   ASN A OD1   1 
ATOM   689   N ND2   . ASN A 1 89  ? 43.503  159.516 14.205  1.00 32.44 ? 89   ASN A ND2   1 
ATOM   690   N N     . GLY A 1 90  ? 48.686  161.212 13.899  1.00 30.12 ? 90   GLY A N     1 
ATOM   691   C CA    . GLY A 1 90  ? 49.815  162.022 14.398  1.00 28.92 ? 90   GLY A CA    1 
ATOM   692   C C     . GLY A 1 90  ? 49.450  163.402 14.915  1.00 28.57 ? 90   GLY A C     1 
ATOM   693   O O     . GLY A 1 90  ? 50.092  163.905 15.832  1.00 28.45 ? 90   GLY A O     1 
ATOM   694   N N     . ASP A 1 91  ? 48.424  164.004 14.308  1.00 28.38 ? 91   ASP A N     1 
ATOM   695   C CA    . ASP A 1 91  ? 47.831  165.292 14.712  1.00 27.93 ? 91   ASP A CA    1 
ATOM   696   C C     . ASP A 1 91  ? 46.851  165.192 15.901  1.00 26.69 ? 91   ASP A C     1 
ATOM   697   O O     . ASP A 1 91  ? 46.586  166.176 16.578  1.00 26.01 ? 91   ASP A O     1 
ATOM   698   C CB    . ASP A 1 91  ? 47.069  165.911 13.525  1.00 28.97 ? 91   ASP A CB    1 
ATOM   699   C CG    . ASP A 1 91  ? 47.991  166.393 12.411  1.00 33.13 ? 91   ASP A CG    1 
ATOM   700   O OD1   . ASP A 1 91  ? 49.229  166.313 12.581  1.00 36.54 ? 91   ASP A OD1   1 
ATOM   701   O OD2   . ASP A 1 91  ? 47.472  166.866 11.357  1.00 38.13 ? 91   ASP A OD2   1 
ATOM   702   N N     . ARG A 1 92  ? 46.289  164.012 16.130  1.00 25.81 ? 92   ARG A N     1 
ATOM   703   C CA    . ARG A 1 92  ? 45.402  163.784 17.276  1.00 25.32 ? 92   ARG A CA    1 
ATOM   704   C C     . ARG A 1 92  ? 46.165  163.985 18.591  1.00 23.84 ? 92   ARG A C     1 
ATOM   705   O O     . ARG A 1 92  ? 47.348  163.683 18.657  1.00 24.29 ? 92   ARG A O     1 
ATOM   706   C CB    . ARG A 1 92  ? 44.788  162.382 17.197  1.00 24.96 ? 92   ARG A CB    1 
ATOM   707   C CG    . ARG A 1 92  ? 44.144  161.895 18.504  1.00 26.50 ? 92   ARG A CG    1 
ATOM   708   C CD    . ARG A 1 92  ? 43.505  160.512 18.414  1.00 27.38 ? 92   ARG A CD    1 
ATOM   709   N NE    . ARG A 1 92  ? 42.537  160.387 17.322  1.00 33.61 ? 92   ARG A NE    1 
ATOM   710   C CZ    . ARG A 1 92  ? 41.866  159.268 17.039  1.00 37.31 ? 92   ARG A CZ    1 
ATOM   711   N NH1   . ARG A 1 92  ? 42.053  158.168 17.778  1.00 39.10 ? 92   ARG A NH1   1 
ATOM   712   N NH2   . ARG A 1 92  ? 41.002  159.242 16.025  1.00 36.26 ? 92   ARG A NH2   1 
ATOM   713   N N     . THR A 1 93  ? 45.486  164.508 19.611  1.00 22.33 ? 93   THR A N     1 
ATOM   714   C CA    . THR A 1 93  ? 46.050  164.659 20.949  1.00 21.34 ? 93   THR A CA    1 
ATOM   715   C C     . THR A 1 93  ? 46.205  163.295 21.621  1.00 21.11 ? 93   THR A C     1 
ATOM   716   O O     . THR A 1 93  ? 45.249  162.517 21.686  1.00 21.40 ? 93   THR A O     1 
ATOM   717   C CB    . THR A 1 93  ? 45.180  165.598 21.821  1.00 20.91 ? 93   THR A CB    1 
ATOM   718   O OG1   . THR A 1 93  ? 44.969  166.812 21.100  1.00 19.91 ? 93   THR A OG1   1 
ATOM   719   C CG2   . THR A 1 93  ? 45.870  165.947 23.159  1.00 21.28 ? 93   THR A CG2   1 
ATOM   720   N N     . ALA A 1 94  ? 47.420  163.021 22.083  1.00 19.93 ? 94   ALA A N     1 
ATOM   721   C CA    . ALA A 1 94  ? 47.746  161.821 22.840  1.00 19.43 ? 94   ALA A CA    1 
ATOM   722   C C     . ALA A 1 94  ? 47.446  162.084 24.287  1.00 19.03 ? 94   ALA A C     1 
ATOM   723   O O     . ALA A 1 94  ? 46.735  161.298 24.935  1.00 18.80 ? 94   ALA A O     1 
ATOM   724   C CB    . ALA A 1 94  ? 49.238  161.453 22.674  1.00 18.52 ? 94   ALA A CB    1 
ATOM   725   N N     . ILE A 1 95  ? 48.006  163.185 24.787  1.00 18.32 ? 95   ILE A N     1 
ATOM   726   C CA    . ILE A 1 95  ? 47.878  163.571 26.194  1.00 18.86 ? 95   ILE A CA    1 
ATOM   727   C C     . ILE A 1 95  ? 47.361  164.995 26.341  1.00 18.91 ? 95   ILE A C     1 
ATOM   728   O O     . ILE A 1 95  ? 47.971  165.939 25.813  1.00 19.43 ? 95   ILE A O     1 
ATOM   729   C CB    . ILE A 1 95  ? 49.255  163.486 26.939  1.00 19.19 ? 95   ILE A CB    1 
ATOM   730   C CG1   . ILE A 1 95  ? 49.744  162.033 26.979  1.00 17.81 ? 95   ILE A CG1   1 
ATOM   731   C CG2   . ILE A 1 95  ? 49.151  164.108 28.347  1.00 18.15 ? 95   ILE A CG2   1 
ATOM   732   C CD1   . ILE A 1 95  ? 51.143  161.821 27.644  1.00 19.14 ? 95   ILE A CD1   1 
ATOM   733   N N     . ILE A 1 96  ? 46.244  165.160 27.055  1.00 18.72 ? 96   ILE A N     1 
ATOM   734   C CA    . ILE A 1 96  ? 45.863  166.496 27.519  1.00 18.01 ? 96   ILE A CA    1 
ATOM   735   C C     . ILE A 1 96  ? 46.435  166.630 28.936  1.00 18.20 ? 96   ILE A C     1 
ATOM   736   O O     . ILE A 1 96  ? 46.182  165.783 29.805  1.00 18.37 ? 96   ILE A O     1 
ATOM   737   C CB    . ILE A 1 96  ? 44.318  166.736 27.539  1.00 18.32 ? 96   ILE A CB    1 
ATOM   738   C CG1   . ILE A 1 96  ? 43.707  166.620 26.130  1.00 17.68 ? 96   ILE A CG1   1 
ATOM   739   C CG2   . ILE A 1 96  ? 43.977  168.088 28.214  1.00 15.85 ? 96   ILE A CG2   1 
ATOM   740   C CD1   . ILE A 1 96  ? 42.138  166.689 26.114  1.00 17.74 ? 96   ILE A CD1   1 
ATOM   741   N N     . TRP A 1 97  ? 47.239  167.663 29.164  1.00 17.69 ? 97   TRP A N     1 
ATOM   742   C CA    . TRP A 1 97  ? 47.776  167.873 30.499  1.00 18.02 ? 97   TRP A CA    1 
ATOM   743   C C     . TRP A 1 97  ? 47.057  169.059 31.099  1.00 18.66 ? 97   TRP A C     1 
ATOM   744   O O     . TRP A 1 97  ? 47.027  170.125 30.491  1.00 19.37 ? 97   TRP A O     1 
ATOM   745   C CB    . TRP A 1 97  ? 49.306  168.075 30.475  1.00 17.04 ? 97   TRP A CB    1 
ATOM   746   C CG    . TRP A 1 97  ? 49.890  168.380 31.845  1.00 17.18 ? 97   TRP A CG    1 
ATOM   747   C CD1   . TRP A 1 97  ? 50.161  167.488 32.848  1.00 16.06 ? 97   TRP A CD1   1 
ATOM   748   C CD2   . TRP A 1 97  ? 50.272  169.673 32.348  1.00 17.02 ? 97   TRP A CD2   1 
ATOM   749   N NE1   . TRP A 1 97  ? 50.671  168.149 33.943  1.00 15.06 ? 97   TRP A NE1   1 
ATOM   750   C CE2   . TRP A 1 97  ? 50.760  169.485 33.651  1.00 15.75 ? 97   TRP A CE2   1 
ATOM   751   C CE3   . TRP A 1 97  ? 50.235  170.976 31.819  1.00 15.44 ? 97   TRP A CE3   1 
ATOM   752   C CZ2   . TRP A 1 97  ? 51.205  170.541 34.428  1.00 16.50 ? 97   TRP A CZ2   1 
ATOM   753   C CZ3   . TRP A 1 97  ? 50.681  172.013 32.590  1.00 16.02 ? 97   TRP A CZ3   1 
ATOM   754   C CH2   . TRP A 1 97  ? 51.155  171.797 33.886  1.00 16.41 ? 97   TRP A CH2   1 
ATOM   755   N N     . GLU A 1 98  ? 46.437  168.855 32.261  1.00 18.71 ? 98   GLU A N     1 
ATOM   756   C CA    . GLU A 1 98  ? 45.785  169.932 33.014  1.00 18.87 ? 98   GLU A CA    1 
ATOM   757   C C     . GLU A 1 98  ? 46.599  170.203 34.277  1.00 18.67 ? 98   GLU A C     1 
ATOM   758   O O     . GLU A 1 98  ? 46.823  169.310 35.086  1.00 19.09 ? 98   GLU A O     1 
ATOM   759   C CB    . GLU A 1 98  ? 44.341  169.529 33.378  1.00 19.14 ? 98   GLU A CB    1 
ATOM   760   C CG    . GLU A 1 98  ? 43.616  170.490 34.295  1.00 19.33 ? 98   GLU A CG    1 
ATOM   761   C CD    . GLU A 1 98  ? 43.062  171.735 33.612  1.00 19.84 ? 98   GLU A CD    1 
ATOM   762   O OE1   . GLU A 1 98  ? 43.199  171.893 32.379  1.00 21.53 ? 98   GLU A OE1   1 
ATOM   763   O OE2   . GLU A 1 98  ? 42.471  172.558 34.331  1.00 18.10 ? 98   GLU A OE2   1 
ATOM   764   N N     . GLY A 1 99  ? 47.048  171.443 34.427  1.00 19.20 ? 99   GLY A N     1 
ATOM   765   C CA    . GLY A 1 99  ? 47.831  171.855 35.561  1.00 18.81 ? 99   GLY A CA    1 
ATOM   766   C C     . GLY A 1 99  ? 47.039  171.896 36.840  1.00 19.35 ? 99   GLY A C     1 
ATOM   767   O O     . GLY A 1 99  ? 45.812  171.969 36.818  1.00 19.36 ? 99   GLY A O     1 
ATOM   768   N N     . ASP A 1 100 ? 47.750  171.812 37.962  1.00 19.80 ? 100  ASP A N     1 
ATOM   769   C CA    . ASP A 1 100 ? 47.188  172.114 39.274  1.00 21.01 ? 100  ASP A CA    1 
ATOM   770   C C     . ASP A 1 100 ? 46.477  173.486 39.263  1.00 21.77 ? 100  ASP A C     1 
ATOM   771   O O     . ASP A 1 100 ? 45.407  173.639 39.841  1.00 21.52 ? 100  ASP A O     1 
ATOM   772   C CB    . ASP A 1 100 ? 48.287  172.056 40.358  1.00 20.36 ? 100  ASP A CB    1 
ATOM   773   C CG    . ASP A 1 100 ? 47.726  172.235 41.770  1.00 21.25 ? 100  ASP A CG    1 
ATOM   774   O OD1   . ASP A 1 100 ? 46.848  171.436 42.159  1.00 21.01 ? 100  ASP A OD1   1 
ATOM   775   O OD2   . ASP A 1 100 ? 48.152  173.172 42.493  1.00 20.50 ? 100  ASP A OD2   1 
ATOM   776   N N     . ASP A 1 101 ? 47.081  174.473 38.604  1.00 24.16 ? 101  ASP A N     1 
ATOM   777   C CA    . ASP A 1 101 ? 46.414  175.765 38.333  1.00 26.69 ? 101  ASP A CA    1 
ATOM   778   C C     . ASP A 1 101 ? 45.678  175.691 37.010  1.00 27.62 ? 101  ASP A C     1 
ATOM   779   O O     . ASP A 1 101 ? 46.270  175.344 36.002  1.00 26.97 ? 101  ASP A O     1 
ATOM   780   C CB    . ASP A 1 101 ? 47.426  176.906 38.233  1.00 27.35 ? 101  ASP A CB    1 
ATOM   781   C CG    . ASP A 1 101 ? 46.749  178.265 38.206  1.00 30.90 ? 101  ASP A CG    1 
ATOM   782   O OD1   . ASP A 1 101 ? 46.331  178.720 37.112  1.00 32.91 ? 101  ASP A OD1   1 
ATOM   783   O OD2   . ASP A 1 101 ? 46.604  178.863 39.300  1.00 35.29 ? 101  ASP A OD2   1 
ATOM   784   N N     . THR A 1 102 ? 44.402  176.058 36.988  1.00 29.69 ? 102  THR A N     1 
ATOM   785   C CA    . THR A 1 102 ? 43.641  175.940 35.730  1.00 32.00 ? 102  THR A CA    1 
ATOM   786   C C     . THR A 1 102 ? 44.080  176.788 34.517  1.00 32.57 ? 102  THR A C     1 
ATOM   787   O O     . THR A 1 102 ? 43.751  176.452 33.373  1.00 33.64 ? 102  THR A O     1 
ATOM   788   C CB    . THR A 1 102 ? 42.138  176.073 35.917  1.00 32.43 ? 102  THR A CB    1 
ATOM   789   O OG1   . THR A 1 102 ? 41.517  175.720 34.678  1.00 33.95 ? 102  THR A OG1   1 
ATOM   790   C CG2   . THR A 1 102 ? 41.741  177.513 36.359  1.00 33.50 ? 102  THR A CG2   1 
ATOM   791   N N     . SER A 1 103 ? 44.823  177.870 34.746  1.00 32.59 ? 103  SER A N     1 
ATOM   792   C CA    . SER A 1 103 ? 45.377  178.633 33.625  1.00 32.30 ? 103  SER A CA    1 
ATOM   793   C C     . SER A 1 103 ? 46.425  177.817 32.852  1.00 32.08 ? 103  SER A C     1 
ATOM   794   O O     . SER A 1 103 ? 46.846  178.221 31.768  1.00 31.82 ? 103  SER A O     1 
ATOM   795   C CB    . SER A 1 103 ? 46.002  179.946 34.117  1.00 32.21 ? 103  SER A CB    1 
ATOM   796   O OG    . SER A 1 103 ? 47.186  179.699 34.867  1.00 32.27 ? 103  SER A OG    1 
ATOM   797   N N     . GLN A 1 104 ? 46.859  176.691 33.429  1.00 31.82 ? 104  GLN A N     1 
ATOM   798   C CA    . GLN A 1 104 ? 47.896  175.865 32.838  1.00 31.53 ? 104  GLN A CA    1 
ATOM   799   C C     . GLN A 1 104 ? 47.322  174.578 32.256  1.00 31.00 ? 104  GLN A C     1 
ATOM   800   O O     . GLN A 1 104 ? 46.736  173.769 32.979  1.00 30.69 ? 104  GLN A O     1 
ATOM   801   C CB    . GLN A 1 104 ? 48.961  175.482 33.878  1.00 32.61 ? 104  GLN A CB    1 
ATOM   802   C CG    . GLN A 1 104 ? 49.589  176.594 34.727  1.00 34.94 ? 104  GLN A CG    1 
ATOM   803   C CD    . GLN A 1 104 ? 50.048  177.772 33.915  1.00 39.41 ? 104  GLN A CD    1 
ATOM   804   O OE1   . GLN A 1 104 ? 50.828  177.634 32.964  1.00 42.74 ? 104  GLN A OE1   1 
ATOM   805   N NE2   . GLN A 1 104 ? 49.575  178.953 34.288  1.00 41.76 ? 104  GLN A NE2   1 
ATOM   806   N N     . SER A 1 105 ? 47.504  174.384 30.952  1.00 29.95 ? 105  SER A N     1 
ATOM   807   C CA    . SER A 1 105 ? 47.210  173.103 30.298  1.00 28.99 ? 105  SER A CA    1 
ATOM   808   C C     . SER A 1 105 ? 48.027  172.986 29.019  1.00 27.96 ? 105  SER A C     1 
ATOM   809   O O     . SER A 1 105 ? 48.570  173.991 28.556  1.00 27.67 ? 105  SER A O     1 
ATOM   810   C CB    . SER A 1 105 ? 45.709  172.947 30.009  1.00 28.91 ? 105  SER A CB    1 
ATOM   811   O OG    . SER A 1 105 ? 45.294  173.832 28.976  1.00 31.01 ? 105  SER A OG    1 
ATOM   812   N N     . LYS A 1 106 ? 48.135  171.764 28.482  1.00 26.32 ? 106  LYS A N     1 
ATOM   813   C CA    . LYS A 1 106 ? 48.853  171.461 27.227  1.00 26.26 ? 106  LYS A CA    1 
ATOM   814   C C     . LYS A 1 106 ? 48.156  170.370 26.448  1.00 25.00 ? 106  LYS A C     1 
ATOM   815   O O     . LYS A 1 106 ? 47.697  169.400 27.024  1.00 25.48 ? 106  LYS A O     1 
ATOM   816   C CB    . LYS A 1 106 ? 50.286  170.945 27.480  1.00 25.94 ? 106  LYS A CB    1 
ATOM   817   C CG    . LYS A 1 106 ? 51.260  171.960 28.022  1.00 26.77 ? 106  LYS A CG    1 
ATOM   818   C CD    . LYS A 1 106 ? 52.644  171.334 28.258  1.00 28.44 ? 106  LYS A CD    1 
ATOM   819   C CE    . LYS A 1 106 ? 53.567  172.402 28.863  1.00 33.79 ? 106  LYS A CE    1 
ATOM   820   N NZ    . LYS A 1 106 ? 54.984  172.192 28.462  1.00 36.97 ? 106  LYS A NZ    1 
ATOM   821   N N     . HIS A 1 107 ? 48.108  170.518 25.134  1.00 24.42 ? 107  HIS A N     1 
ATOM   822   C CA    . HIS A 1 107 ? 47.723  169.437 24.244  1.00 24.29 ? 107  HIS A CA    1 
ATOM   823   C C     . HIS A 1 107 ? 48.979  168.882 23.564  1.00 24.11 ? 107  HIS A C     1 
ATOM   824   O O     . HIS A 1 107 ? 49.717  169.626 22.911  1.00 24.09 ? 107  HIS A O     1 
ATOM   825   C CB    . HIS A 1 107 ? 46.712  169.942 23.220  1.00 24.53 ? 107  HIS A CB    1 
ATOM   826   C CG    . HIS A 1 107 ? 45.332  170.119 23.783  1.00 26.35 ? 107  HIS A CG    1 
ATOM   827   N ND1   . HIS A 1 107 ? 45.022  171.101 24.701  1.00 26.85 ? 107  HIS A ND1   1 
ATOM   828   C CD2   . HIS A 1 107 ? 44.184  169.428 23.570  1.00 27.70 ? 107  HIS A CD2   1 
ATOM   829   C CE1   . HIS A 1 107 ? 43.748  171.004 25.035  1.00 27.39 ? 107  HIS A CE1   1 
ATOM   830   N NE2   . HIS A 1 107 ? 43.216  170.001 24.359  1.00 28.48 ? 107  HIS A NE2   1 
ATOM   831   N N     . ILE A 1 108 ? 49.239  167.588 23.759  1.00 23.25 ? 108  ILE A N     1 
ATOM   832   C CA    . ILE A 1 108 ? 50.426  166.952 23.207  1.00 22.51 ? 108  ILE A CA    1 
ATOM   833   C C     . ILE A 1 108 ? 49.952  165.877 22.236  1.00 22.60 ? 108  ILE A C     1 
ATOM   834   O O     . ILE A 1 108 ? 49.365  164.875 22.632  1.00 22.32 ? 108  ILE A O     1 
ATOM   835   C CB    . ILE A 1 108 ? 51.341  166.376 24.342  1.00 22.44 ? 108  ILE A CB    1 
ATOM   836   C CG1   . ILE A 1 108 ? 51.726  167.489 25.324  1.00 22.36 ? 108  ILE A CG1   1 
ATOM   837   C CG2   . ILE A 1 108 ? 52.603  165.693 23.791  1.00 20.86 ? 108  ILE A CG2   1 
ATOM   838   C CD1   . ILE A 1 108 ? 52.251  166.948 26.647  1.00 22.44 ? 108  ILE A CD1   1 
ATOM   839   N N     . SER A 1 109 ? 50.166  166.142 20.953  1.00 22.44 ? 109  SER A N     1 
ATOM   840   C CA    . SER A 1 109 ? 49.770  165.257 19.881  1.00 22.52 ? 109  SER A CA    1 
ATOM   841   C C     . SER A 1 109 ? 50.622  163.986 19.891  1.00 22.54 ? 109  SER A C     1 
ATOM   842   O O     . SER A 1 109 ? 51.704  163.956 20.500  1.00 22.74 ? 109  SER A O     1 
ATOM   843   C CB    . SER A 1 109 ? 49.974  165.980 18.557  1.00 22.71 ? 109  SER A CB    1 
ATOM   844   O OG    . SER A 1 109 ? 51.351  165.997 18.225  1.00 21.24 ? 109  SER A OG    1 
ATOM   845   N N     . TYR A 1 110 ? 50.132  162.944 19.229  1.00 22.15 ? 110  TYR A N     1 
ATOM   846   C CA    . TYR A 1 110 ? 50.930  161.728 19.005  1.00 22.16 ? 110  TYR A CA    1 
ATOM   847   C C     . TYR A 1 110 ? 52.300  162.016 18.407  1.00 22.49 ? 110  TYR A C     1 
ATOM   848   O O     . TYR A 1 110 ? 53.296  161.480 18.883  1.00 22.63 ? 110  TYR A O     1 
ATOM   849   C CB    . TYR A 1 110 ? 50.159  160.665 18.202  1.00 20.90 ? 110  TYR A CB    1 
ATOM   850   C CG    . TYR A 1 110 ? 49.315  159.847 19.145  1.00 20.60 ? 110  TYR A CG    1 
ATOM   851   C CD1   . TYR A 1 110 ? 47.983  160.209 19.408  1.00 18.75 ? 110  TYR A CD1   1 
ATOM   852   C CD2   . TYR A 1 110 ? 49.862  158.752 19.837  1.00 18.42 ? 110  TYR A CD2   1 
ATOM   853   C CE1   . TYR A 1 110 ? 47.217  159.494 20.318  1.00 17.81 ? 110  TYR A CE1   1 
ATOM   854   C CE2   . TYR A 1 110 ? 49.095  158.025 20.755  1.00 17.61 ? 110  TYR A CE2   1 
ATOM   855   C CZ    . TYR A 1 110 ? 47.772  158.404 20.986  1.00 18.68 ? 110  TYR A CZ    1 
ATOM   856   O OH    . TYR A 1 110 ? 47.000  157.707 21.874  1.00 17.38 ? 110  TYR A OH    1 
ATOM   857   N N     . ARG A 1 111 ? 52.340  162.881 17.394  1.00 22.93 ? 111  ARG A N     1 
ATOM   858   C CA    . ARG A 1 111 ? 53.587  163.286 16.746  1.00 24.39 ? 111  ARG A CA    1 
ATOM   859   C C     . ARG A 1 111 ? 54.588  163.918 17.716  1.00 24.01 ? 111  ARG A C     1 
ATOM   860   O O     . ARG A 1 111 ? 55.766  163.562 17.701  1.00 24.10 ? 111  ARG A O     1 
ATOM   861   C CB    . ARG A 1 111 ? 53.304  164.227 15.558  1.00 24.82 ? 111  ARG A CB    1 
ATOM   862   C CG    . ARG A 1 111 ? 54.544  164.616 14.745  1.00 28.31 ? 111  ARG A CG    1 
ATOM   863   C CD    . ARG A 1 111 ? 54.204  164.945 13.275  1.00 34.56 ? 111  ARG A CD    1 
ATOM   864   N NE    . ARG A 1 111 ? 53.770  163.758 12.522  1.00 39.30 ? 111  ARG A NE    1 
ATOM   865   C CZ    . ARG A 1 111 ? 52.561  163.604 11.974  1.00 42.42 ? 111  ARG A CZ    1 
ATOM   866   N NH1   . ARG A 1 111 ? 51.639  164.570 12.082  1.00 42.32 ? 111  ARG A NH1   1 
ATOM   867   N NH2   . ARG A 1 111 ? 52.271  162.481 11.307  1.00 42.29 ? 111  ARG A NH2   1 
ATOM   868   N N     . GLU A 1 112 ? 54.107  164.846 18.544  1.00 23.86 ? 112  GLU A N     1 
ATOM   869   C CA    . GLU A 1 112 ? 54.930  165.557 19.522  1.00 24.18 ? 112  GLU A CA    1 
ATOM   870   C C     . GLU A 1 112 ? 55.429  164.599 20.611  1.00 23.13 ? 112  GLU A C     1 
ATOM   871   O O     . GLU A 1 112 ? 56.621  164.592 20.937  1.00 24.05 ? 112  GLU A O     1 
ATOM   872   C CB    . GLU A 1 112 ? 54.174  166.766 20.125  1.00 23.44 ? 112  GLU A CB    1 
ATOM   873   C CG    . GLU A 1 112 ? 53.626  167.754 19.067  1.00 25.26 ? 112  GLU A CG    1 
ATOM   874   C CD    . GLU A 1 112 ? 52.674  168.863 19.616  1.00 27.43 ? 112  GLU A CD    1 
ATOM   875   O OE1   . GLU A 1 112 ? 51.711  168.569 20.377  1.00 27.16 ? 112  GLU A OE1   1 
ATOM   876   O OE2   . GLU A 1 112 ? 52.881  170.050 19.231  1.00 32.03 ? 112  GLU A OE2   1 
ATOM   877   N N     . LEU A 1 113 ? 54.538  163.779 21.158  1.00 21.75 ? 113  LEU A N     1 
ATOM   878   C CA    . LEU A 1 113 ? 54.953  162.774 22.144  1.00 20.31 ? 113  LEU A CA    1 
ATOM   879   C C     . LEU A 1 113 ? 56.009  161.775 21.619  1.00 19.96 ? 113  LEU A C     1 
ATOM   880   O O     . LEU A 1 113 ? 57.007  161.480 22.295  1.00 19.68 ? 113  LEU A O     1 
ATOM   881   C CB    . LEU A 1 113 ? 53.738  162.022 22.683  1.00 19.92 ? 113  LEU A CB    1 
ATOM   882   C CG    . LEU A 1 113 ? 53.938  161.153 23.936  1.00 18.87 ? 113  LEU A CG    1 
ATOM   883   C CD1   . LEU A 1 113 ? 54.507  161.958 25.132  1.00 14.30 ? 113  LEU A CD1   1 
ATOM   884   C CD2   . LEU A 1 113 ? 52.629  160.493 24.322  1.00 18.78 ? 113  LEU A CD2   1 
ATOM   885   N N     . HIS A 1 114 ? 55.772  161.253 20.422  1.00 19.68 ? 114  HIS A N     1 
ATOM   886   C CA    . HIS A 1 114 ? 56.690  160.331 19.769  1.00 19.88 ? 114  HIS A CA    1 
ATOM   887   C C     . HIS A 1 114 ? 58.066  160.959 19.658  1.00 20.22 ? 114  HIS A C     1 
ATOM   888   O O     . HIS A 1 114 ? 59.068  160.339 20.004  1.00 20.45 ? 114  HIS A O     1 
ATOM   889   C CB    . HIS A 1 114 ? 56.161  159.985 18.376  1.00 20.39 ? 114  HIS A CB    1 
ATOM   890   C CG    . HIS A 1 114 ? 57.126  159.226 17.530  1.00 19.94 ? 114  HIS A CG    1 
ATOM   891   N ND1   . HIS A 1 114 ? 57.945  159.836 16.607  1.00 23.09 ? 114  HIS A ND1   1 
ATOM   892   C CD2   . HIS A 1 114 ? 57.403  157.904 17.462  1.00 21.30 ? 114  HIS A CD2   1 
ATOM   893   C CE1   . HIS A 1 114 ? 58.675  158.921 15.995  1.00 23.22 ? 114  HIS A CE1   1 
ATOM   894   N NE2   . HIS A 1 114 ? 58.367  157.740 16.496  1.00 20.89 ? 114  HIS A NE2   1 
ATOM   895   N N     . ARG A 1 115 ? 58.107  162.207 19.200  1.00 20.21 ? 115  ARG A N     1 
ATOM   896   C CA    . ARG A 1 115 ? 59.368  162.886 18.953  1.00 21.19 ? 115  ARG A CA    1 
ATOM   897   C C     . ARG A 1 115 ? 60.157  163.039 20.252  1.00 20.78 ? 115  ARG A C     1 
ATOM   898   O O     . ARG A 1 115 ? 61.361  162.797 20.280  1.00 20.65 ? 115  ARG A O     1 
ATOM   899   C CB    . ARG A 1 115 ? 59.117  164.242 18.289  1.00 21.55 ? 115  ARG A CB    1 
ATOM   900   C CG    . ARG A 1 115 ? 60.317  165.121 18.255  1.00 25.78 ? 115  ARG A CG    1 
ATOM   901   C CD    . ARG A 1 115 ? 60.010  166.419 17.559  1.00 34.59 ? 115  ARG A CD    1 
ATOM   902   N NE    . ARG A 1 115 ? 61.123  166.866 16.708  1.00 41.06 ? 115  ARG A NE    1 
ATOM   903   C CZ    . ARG A 1 115 ? 61.379  166.400 15.484  1.00 43.34 ? 115  ARG A CZ    1 
ATOM   904   N NH1   . ARG A 1 115 ? 60.628  165.436 14.948  1.00 44.84 ? 115  ARG A NH1   1 
ATOM   905   N NH2   . ARG A 1 115 ? 62.410  166.885 14.800  1.00 45.35 ? 115  ARG A NH2   1 
ATOM   906   N N     . ASP A 1 116 ? 59.471  163.425 21.321  1.00 20.85 ? 116  ASP A N     1 
ATOM   907   C CA    . ASP A 1 116 ? 60.086  163.544 22.642  1.00 21.56 ? 116  ASP A CA    1 
ATOM   908   C C     . ASP A 1 116 ? 60.518  162.223 23.265  1.00 21.02 ? 116  ASP A C     1 
ATOM   909   O O     . ASP A 1 116 ? 61.540  162.158 23.962  1.00 21.90 ? 116  ASP A O     1 
ATOM   910   C CB    . ASP A 1 116 ? 59.165  164.286 23.587  1.00 22.11 ? 116  ASP A CB    1 
ATOM   911   C CG    . ASP A 1 116 ? 59.371  165.803 23.534  1.00 26.84 ? 116  ASP A CG    1 
ATOM   912   O OD1   . ASP A 1 116 ? 60.423  166.266 23.015  1.00 30.27 ? 116  ASP A OD1   1 
ATOM   913   O OD2   . ASP A 1 116 ? 58.483  166.530 24.038  1.00 31.77 ? 116  ASP A OD2   1 
ATOM   914   N N     . VAL A 1 117 ? 59.744  161.173 23.032  1.00 19.66 ? 117  VAL A N     1 
ATOM   915   C CA    . VAL A 1 117 ? 60.123  159.849 23.489  1.00 18.39 ? 117  VAL A CA    1 
ATOM   916   C C     . VAL A 1 117 ? 61.401  159.391 22.754  1.00 18.83 ? 117  VAL A C     1 
ATOM   917   O O     . VAL A 1 117 ? 62.310  158.838 23.385  1.00 19.00 ? 117  VAL A O     1 
ATOM   918   C CB    . VAL A 1 117 ? 58.953  158.829 23.328  1.00 18.18 ? 117  VAL A CB    1 
ATOM   919   C CG1   . VAL A 1 117 ? 59.432  157.366 23.525  1.00 16.34 ? 117  VAL A CG1   1 
ATOM   920   C CG2   . VAL A 1 117 ? 57.803  159.172 24.294  1.00 16.33 ? 117  VAL A CG2   1 
ATOM   921   N N     . CYS A 1 118 ? 61.462  159.636 21.439  1.00 18.43 ? 118  CYS A N     1 
ATOM   922   C CA    . CYS A 1 118 ? 62.646  159.338 20.626  1.00 19.20 ? 118  CYS A CA    1 
ATOM   923   C C     . CYS A 1 118 ? 63.852  160.125 21.087  1.00 18.87 ? 118  CYS A C     1 
ATOM   924   O O     . CYS A 1 118 ? 64.924  159.553 21.222  1.00 19.78 ? 118  CYS A O     1 
ATOM   925   C CB    . CYS A 1 118 ? 62.403  159.668 19.164  1.00 19.15 ? 118  CYS A CB    1 
ATOM   926   S SG    . CYS A 1 118 ? 61.287  158.555 18.393  1.00 23.25 ? 118  CYS A SG    1 
ATOM   927   N N     . ARG A 1 119 ? 63.693  161.431 21.315  1.00 18.57 ? 119  ARG A N     1 
ATOM   928   C CA    . ARG A 1 119 ? 64.787  162.237 21.871  1.00 19.20 ? 119  ARG A CA    1 
ATOM   929   C C     . ARG A 1 119 ? 65.234  161.692 23.219  1.00 19.07 ? 119  ARG A C     1 
ATOM   930   O O     . ARG A 1 119 ? 66.427  161.507 23.433  1.00 19.81 ? 119  ARG A O     1 
ATOM   931   C CB    . ARG A 1 119 ? 64.416  163.711 22.019  1.00 18.88 ? 119  ARG A CB    1 
ATOM   932   C CG    . ARG A 1 119 ? 64.326  164.462 20.724  1.00 22.11 ? 119  ARG A CG    1 
ATOM   933   C CD    . ARG A 1 119 ? 64.434  165.975 20.940  1.00 25.54 ? 119  ARG A CD    1 
ATOM   934   N NE    . ARG A 1 119 ? 63.300  166.488 21.694  1.00 29.67 ? 119  ARG A NE    1 
ATOM   935   C CZ    . ARG A 1 119 ? 63.158  167.755 22.089  1.00 32.41 ? 119  ARG A CZ    1 
ATOM   936   N NH1   . ARG A 1 119 ? 64.095  168.659 21.800  1.00 32.40 ? 119  ARG A NH1   1 
ATOM   937   N NH2   . ARG A 1 119 ? 62.074  168.120 22.775  1.00 30.94 ? 119  ARG A NH2   1 
ATOM   938   N N     . PHE A 1 120 ? 64.280  161.398 24.105  1.00 18.91 ? 120  PHE A N     1 
ATOM   939   C CA    . PHE A 1 120 ? 64.627  160.920 25.439  1.00 19.23 ? 120  PHE A CA    1 
ATOM   940   C C     . PHE A 1 120 ? 65.191  159.480 25.487  1.00 19.60 ? 120  PHE A C     1 
ATOM   941   O O     . PHE A 1 120 ? 66.044  159.178 26.334  1.00 19.40 ? 120  PHE A O     1 
ATOM   942   C CB    . PHE A 1 120 ? 63.491  161.145 26.442  1.00 19.14 ? 120  PHE A CB    1 
ATOM   943   C CG    . PHE A 1 120 ? 63.942  161.109 27.878  1.00 17.90 ? 120  PHE A CG    1 
ATOM   944   C CD1   . PHE A 1 120 ? 64.691  162.167 28.415  1.00 18.87 ? 120  PHE A CD1   1 
ATOM   945   C CD2   . PHE A 1 120 ? 63.623  160.017 28.693  1.00 16.31 ? 120  PHE A CD2   1 
ATOM   946   C CE1   . PHE A 1 120 ? 65.131  162.144 29.753  1.00 19.44 ? 120  PHE A CE1   1 
ATOM   947   C CE2   . PHE A 1 120 ? 64.050  159.969 30.028  1.00 18.09 ? 120  PHE A CE2   1 
ATOM   948   C CZ    . PHE A 1 120 ? 64.813  161.041 30.563  1.00 19.96 ? 120  PHE A CZ    1 
ATOM   949   N N     . ALA A 1 121 ? 64.761  158.626 24.561  1.00 19.88 ? 121  ALA A N     1 
ATOM   950   C CA    . ALA A 1 121 ? 65.378  157.298 24.369  1.00 19.98 ? 121  ALA A CA    1 
ATOM   951   C C     . ALA A 1 121 ? 66.878  157.408 24.029  1.00 20.55 ? 121  ALA A C     1 
ATOM   952   O O     . ALA A 1 121 ? 67.710  156.687 24.619  1.00 20.07 ? 121  ALA A O     1 
ATOM   953   C CB    . ALA A 1 121 ? 64.641  156.523 23.271  1.00 19.59 ? 121  ALA A CB    1 
ATOM   954   N N     . ASN A 1 122 ? 67.213  158.308 23.091  1.00 20.33 ? 122  ASN A N     1 
ATOM   955   C CA    . ASN A 1 122 ? 68.606  158.605 22.751  1.00 21.40 ? 122  ASN A CA    1 
ATOM   956   C C     . ASN A 1 122 ? 69.344  159.199 23.925  1.00 21.89 ? 122  ASN A C     1 
ATOM   957   O O     . ASN A 1 122 ? 70.486  158.799 24.181  1.00 22.42 ? 122  ASN A O     1 
ATOM   958   C CB    . ASN A 1 122 ? 68.754  159.507 21.512  1.00 21.31 ? 122  ASN A CB    1 
ATOM   959   C CG    . ASN A 1 122 ? 68.437  158.774 20.204  1.00 23.19 ? 122  ASN A CG    1 
ATOM   960   O OD1   . ASN A 1 122 ? 68.828  157.610 20.005  1.00 23.73 ? 122  ASN A OD1   1 
ATOM   961   N ND2   . ASN A 1 122 ? 67.715  159.452 19.305  1.00 23.37 ? 122  ASN A ND2   1 
ATOM   962   N N     . THR A 1 123 ? 68.705  160.136 24.643  1.00 22.37 ? 123  THR A N     1 
ATOM   963   C CA    . THR A 1 123 ? 69.295  160.687 25.884  1.00 22.24 ? 123  THR A CA    1 
ATOM   964   C C     . THR A 1 123 ? 69.701  159.537 26.819  1.00 21.98 ? 123  THR A C     1 
ATOM   965   O O     . THR A 1 123 ? 70.827  159.504 27.308  1.00 21.78 ? 123  THR A O     1 
ATOM   966   C CB    . THR A 1 123 ? 68.316  161.585 26.670  1.00 22.30 ? 123  THR A CB    1 
ATOM   967   O OG1   . THR A 1 123 ? 68.097  162.820 25.976  1.00 22.98 ? 123  THR A OG1   1 
ATOM   968   C CG2   . THR A 1 123 ? 68.863  161.876 28.069  1.00 21.64 ? 123  THR A CG2   1 
ATOM   969   N N     . LEU A 1 124 ? 68.764  158.624 27.076  1.00 21.28 ? 124  LEU A N     1 
ATOM   970   C CA    . LEU A 1 124 ? 69.017  157.451 27.915  1.00 21.45 ? 124  LEU A CA    1 
ATOM   971   C C     . LEU A 1 124 ? 70.191  156.605 27.367  1.00 21.87 ? 124  LEU A C     1 
ATOM   972   O O     . LEU A 1 124 ? 71.129  156.269 28.096  1.00 22.56 ? 124  LEU A O     1 
ATOM   973   C CB    . LEU A 1 124 ? 67.731  156.606 28.073  1.00 20.72 ? 124  LEU A CB    1 
ATOM   974   C CG    . LEU A 1 124 ? 66.571  157.169 28.941  1.00 20.67 ? 124  LEU A CG    1 
ATOM   975   C CD1   . LEU A 1 124 ? 65.382  156.199 29.027  1.00 19.90 ? 124  LEU A CD1   1 
ATOM   976   C CD2   . LEU A 1 124 ? 67.024  157.545 30.356  1.00 19.12 ? 124  LEU A CD2   1 
ATOM   977   N N     . LEU A 1 125 ? 70.159  156.304 26.074  1.00 22.01 ? 125  LEU A N     1 
ATOM   978   C CA    . LEU A 1 125 ? 71.188  155.466 25.460  1.00 22.19 ? 125  LEU A CA    1 
ATOM   979   C C     . LEU A 1 125 ? 72.577  156.109 25.558  1.00 22.50 ? 125  LEU A C     1 
ATOM   980   O O     . LEU A 1 125 ? 73.553  155.440 25.907  1.00 21.24 ? 125  LEU A O     1 
ATOM   981   C CB    . LEU A 1 125 ? 70.821  155.121 24.000  1.00 21.92 ? 125  LEU A CB    1 
ATOM   982   C CG    . LEU A 1 125 ? 69.693  154.087 23.813  1.00 21.88 ? 125  LEU A CG    1 
ATOM   983   C CD1   . LEU A 1 125 ? 69.184  154.088 22.368  1.00 21.82 ? 125  LEU A CD1   1 
ATOM   984   C CD2   . LEU A 1 125 ? 70.083  152.661 24.253  1.00 21.44 ? 125  LEU A CD2   1 
ATOM   985   N N     . ASP A 1 126 ? 72.640  157.409 25.252  1.00 23.65 ? 126  ASP A N     1 
ATOM   986   C CA    . ASP A 1 126 ? 73.867  158.190 25.335  1.00 24.75 ? 126  ASP A CA    1 
ATOM   987   C C     . ASP A 1 126 ? 74.369  158.262 26.761  1.00 24.53 ? 126  ASP A C     1 
ATOM   988   O O     . ASP A 1 126 ? 75.561  158.376 26.986  1.00 25.13 ? 126  ASP A O     1 
ATOM   989   C CB    . ASP A 1 126 ? 73.659  159.618 24.812  1.00 25.51 ? 126  ASP A CB    1 
ATOM   990   C CG    . ASP A 1 126 ? 73.361  159.673 23.307  1.00 28.00 ? 126  ASP A CG    1 
ATOM   991   O OD1   . ASP A 1 126 ? 73.267  158.613 22.653  1.00 31.12 ? 126  ASP A OD1   1 
ATOM   992   O OD2   . ASP A 1 126 ? 73.199  160.801 22.783  1.00 31.07 ? 126  ASP A OD2   1 
ATOM   993   N N     . LEU A 1 127 ? 73.471  158.209 27.731  1.00 24.44 ? 127  LEU A N     1 
ATOM   994   C CA    . LEU A 1 127 ? 73.898  158.223 29.142  1.00 24.19 ? 127  LEU A CA    1 
ATOM   995   C C     . LEU A 1 127 ? 74.472  156.866 29.609  1.00 23.55 ? 127  LEU A C     1 
ATOM   996   O O     . LEU A 1 127 ? 75.091  156.780 30.681  1.00 23.31 ? 127  LEU A O     1 
ATOM   997   C CB    . LEU A 1 127 ? 72.742  158.679 30.042  1.00 24.15 ? 127  LEU A CB    1 
ATOM   998   C CG    . LEU A 1 127 ? 73.068  159.487 31.291  1.00 24.76 ? 127  LEU A CG    1 
ATOM   999   C CD1   . LEU A 1 127 ? 73.920  160.723 30.979  1.00 23.55 ? 127  LEU A CD1   1 
ATOM   1000  C CD2   . LEU A 1 127 ? 71.773  159.906 31.939  1.00 25.51 ? 127  LEU A CD2   1 
ATOM   1001  N N     . GLY A 1 128 ? 74.270  155.818 28.804  1.00 22.42 ? 128  GLY A N     1 
ATOM   1002  C CA    . GLY A 1 128 ? 74.846  154.491 29.079  1.00 21.10 ? 128  GLY A CA    1 
ATOM   1003  C C     . GLY A 1 128 ? 73.807  153.472 29.517  1.00 21.24 ? 128  GLY A C     1 
ATOM   1004  O O     . GLY A 1 128 ? 74.142  152.340 29.823  1.00 20.31 ? 128  GLY A O     1 
ATOM   1005  N N     . ILE A 1 129 ? 72.540  153.893 29.557  1.00 20.56 ? 129  ILE A N     1 
ATOM   1006  C CA    . ILE A 1 129 ? 71.437  153.014 29.887  1.00 20.70 ? 129  ILE A CA    1 
ATOM   1007  C C     . ILE A 1 129 ? 71.216  152.003 28.743  1.00 20.52 ? 129  ILE A C     1 
ATOM   1008  O O     . ILE A 1 129 ? 71.135  152.371 27.567  1.00 19.72 ? 129  ILE A O     1 
ATOM   1009  C CB    . ILE A 1 129 ? 70.122  153.806 30.156  1.00 20.40 ? 129  ILE A CB    1 
ATOM   1010  C CG1   . ILE A 1 129 ? 70.306  154.904 31.230  1.00 21.68 ? 129  ILE A CG1   1 
ATOM   1011  C CG2   . ILE A 1 129 ? 68.971  152.842 30.471  1.00 20.83 ? 129  ILE A CG2   1 
ATOM   1012  C CD1   . ILE A 1 129 ? 70.925  154.452 32.603  1.00 23.50 ? 129  ILE A CD1   1 
ATOM   1013  N N     . LYS A 1 130 ? 71.121  150.735 29.119  1.00 21.35 ? 130  LYS A N     1 
ATOM   1014  C CA    . LYS A 1 130 ? 70.985  149.629 28.179  1.00 22.67 ? 130  LYS A CA    1 
ATOM   1015  C C     . LYS A 1 130 ? 69.752  148.788 28.524  1.00 22.32 ? 130  LYS A C     1 
ATOM   1016  O O     . LYS A 1 130 ? 69.250  148.849 29.638  1.00 21.13 ? 130  LYS A O     1 
ATOM   1017  C CB    . LYS A 1 130 ? 72.250  148.754 28.211  1.00 22.72 ? 130  LYS A CB    1 
ATOM   1018  C CG    . LYS A 1 130 ? 73.397  149.304 27.365  1.00 25.13 ? 130  LYS A CG    1 
ATOM   1019  C CD    . LYS A 1 130 ? 74.617  148.360 27.349  1.00 25.12 ? 130  LYS A CD    1 
ATOM   1020  C CE    . LYS A 1 130 ? 74.459  147.162 26.369  1.00 29.94 ? 130  LYS A CE    1 
ATOM   1021  N NZ    . LYS A 1 130 ? 74.495  147.521 24.908  1.00 29.24 ? 130  LYS A NZ    1 
ATOM   1022  N N     . LYS A 1 131 ? 69.285  148.008 27.547  1.00 22.88 ? 131  LYS A N     1 
ATOM   1023  C CA    . LYS A 1 131 ? 68.182  147.089 27.727  1.00 22.47 ? 131  LYS A CA    1 
ATOM   1024  C C     . LYS A 1 131 ? 68.408  146.308 29.013  1.00 22.80 ? 131  LYS A C     1 
ATOM   1025  O O     . LYS A 1 131 ? 69.512  145.830 29.260  1.00 22.81 ? 131  LYS A O     1 
ATOM   1026  C CB    . LYS A 1 131 ? 68.074  146.151 26.513  1.00 22.95 ? 131  LYS A CB    1 
ATOM   1027  C CG    . LYS A 1 131 ? 67.153  144.947 26.729  1.00 22.39 ? 131  LYS A CG    1 
ATOM   1028  C CD    . LYS A 1 131 ? 66.988  144.122 25.461  1.00 22.13 ? 131  LYS A CD    1 
ATOM   1029  C CE    . LYS A 1 131 ? 65.957  143.058 25.702  1.00 18.84 ? 131  LYS A CE    1 
ATOM   1030  N NZ    . LYS A 1 131 ? 65.772  142.153 24.554  1.00 20.27 ? 131  LYS A NZ    1 
ATOM   1031  N N     . GLY A 1 132 ? 67.372  146.228 29.847  1.00 22.68 ? 132  GLY A N     1 
ATOM   1032  C CA    . GLY A 1 132 ? 67.435  145.489 31.110  1.00 22.84 ? 132  GLY A CA    1 
ATOM   1033  C C     . GLY A 1 132 ? 67.896  146.298 32.326  1.00 23.05 ? 132  GLY A C     1 
ATOM   1034  O O     . GLY A 1 132 ? 67.692  145.859 33.461  1.00 23.58 ? 132  GLY A O     1 
ATOM   1035  N N     . ASP A 1 133 ? 68.536  147.450 32.112  1.00 21.93 ? 133  ASP A N     1 
ATOM   1036  C CA    . ASP A 1 133 ? 68.884  148.338 33.225  1.00 21.74 ? 133  ASP A CA    1 
ATOM   1037  C C     . ASP A 1 133 ? 67.596  148.831 33.881  1.00 21.34 ? 133  ASP A C     1 
ATOM   1038  O O     . ASP A 1 133 ? 66.609  149.041 33.201  1.00 20.92 ? 133  ASP A O     1 
ATOM   1039  C CB    . ASP A 1 133 ? 69.721  149.542 32.755  1.00 21.37 ? 133  ASP A CB    1 
ATOM   1040  C CG    . ASP A 1 133 ? 71.159  149.164 32.422  1.00 23.17 ? 133  ASP A CG    1 
ATOM   1041  O OD1   . ASP A 1 133 ? 71.573  148.045 32.790  1.00 24.22 ? 133  ASP A OD1   1 
ATOM   1042  O OD2   . ASP A 1 133 ? 71.874  149.974 31.788  1.00 24.28 ? 133  ASP A OD2   1 
ATOM   1043  N N     . VAL A 1 134 ? 67.610  148.974 35.206  1.00 21.08 ? 134  VAL A N     1 
ATOM   1044  C CA    . VAL A 1 134 ? 66.463  149.510 35.914  1.00 20.50 ? 134  VAL A CA    1 
ATOM   1045  C C     . VAL A 1 134 ? 66.642  151.008 36.099  1.00 20.38 ? 134  VAL A C     1 
ATOM   1046  O O     . VAL A 1 134 ? 67.717  151.483 36.489  1.00 20.76 ? 134  VAL A O     1 
ATOM   1047  C CB    . VAL A 1 134 ? 66.175  148.801 37.266  1.00 20.95 ? 134  VAL A CB    1 
ATOM   1048  C CG1   . VAL A 1 134 ? 65.003  149.494 38.007  1.00 20.77 ? 134  VAL A CG1   1 
ATOM   1049  C CG2   . VAL A 1 134 ? 65.848  147.337 37.042  1.00 18.30 ? 134  VAL A CG2   1 
ATOM   1050  N N     . VAL A 1 135 ? 65.587  151.747 35.768  1.00 19.25 ? 135  VAL A N     1 
ATOM   1051  C CA    . VAL A 1 135 ? 65.611  153.202 35.820  1.00 18.57 ? 135  VAL A CA    1 
ATOM   1052  C C     . VAL A 1 135 ? 64.549  153.628 36.810  1.00 18.41 ? 135  VAL A C     1 
ATOM   1053  O O     . VAL A 1 135 ? 63.374  153.305 36.626  1.00 18.25 ? 135  VAL A O     1 
ATOM   1054  C CB    . VAL A 1 135 ? 65.317  153.805 34.424  1.00 18.43 ? 135  VAL A CB    1 
ATOM   1055  C CG1   . VAL A 1 135 ? 65.064  155.346 34.517  1.00 18.70 ? 135  VAL A CG1   1 
ATOM   1056  C CG2   . VAL A 1 135 ? 66.457  153.488 33.467  1.00 17.97 ? 135  VAL A CG2   1 
ATOM   1057  N N     . ALA A 1 136 ? 64.945  154.323 37.869  1.00 18.48 ? 136  ALA A N     1 
ATOM   1058  C CA    . ALA A 1 136 ? 63.964  154.755 38.878  1.00 17.83 ? 136  ALA A CA    1 
ATOM   1059  C C     . ALA A 1 136 ? 63.357  156.087 38.452  1.00 17.81 ? 136  ALA A C     1 
ATOM   1060  O O     . ALA A 1 136 ? 64.096  157.014 38.110  1.00 17.83 ? 136  ALA A O     1 
ATOM   1061  C CB    . ALA A 1 136 ? 64.596  154.858 40.243  1.00 17.07 ? 136  ALA A CB    1 
ATOM   1062  N N     . ILE A 1 137 ? 62.020  156.166 38.455  1.00 16.98 ? 137  ILE A N     1 
ATOM   1063  C CA    . ILE A 1 137 ? 61.286  157.382 38.083  1.00 16.27 ? 137  ILE A CA    1 
ATOM   1064  C C     . ILE A 1 137 ? 60.464  157.907 39.299  1.00 16.62 ? 137  ILE A C     1 
ATOM   1065  O O     . ILE A 1 137 ? 59.586  157.228 39.817  1.00 16.57 ? 137  ILE A O     1 
ATOM   1066  C CB    . ILE A 1 137 ? 60.380  157.151 36.843  1.00 15.61 ? 137  ILE A CB    1 
ATOM   1067  C CG1   . ILE A 1 137 ? 61.220  156.731 35.631  1.00 16.32 ? 137  ILE A CG1   1 
ATOM   1068  C CG2   . ILE A 1 137 ? 59.568  158.410 36.499  1.00 15.14 ? 137  ILE A CG2   1 
ATOM   1069  C CD1   . ILE A 1 137 ? 60.392  156.323 34.351  1.00 16.01 ? 137  ILE A CD1   1 
ATOM   1070  N N     . TYR A 1 138 ? 60.783  159.123 39.738  1.00 16.71 ? 138  TYR A N     1 
ATOM   1071  C CA    . TYR A 1 138 ? 60.222  159.729 40.951  1.00 16.07 ? 138  TYR A CA    1 
ATOM   1072  C C     . TYR A 1 138 ? 59.764  161.131 40.542  1.00 16.33 ? 138  TYR A C     1 
ATOM   1073  O O     . TYR A 1 138 ? 60.459  162.136 40.732  1.00 14.96 ? 138  TYR A O     1 
ATOM   1074  C CB    . TYR A 1 138 ? 61.307  159.775 42.010  1.00 16.04 ? 138  TYR A CB    1 
ATOM   1075  C CG    . TYR A 1 138 ? 60.910  160.252 43.397  1.00 16.07 ? 138  TYR A CG    1 
ATOM   1076  C CD1   . TYR A 1 138 ? 59.935  159.577 44.169  1.00 15.89 ? 138  TYR A CD1   1 
ATOM   1077  C CD2   . TYR A 1 138 ? 61.548  161.354 43.958  1.00 15.02 ? 138  TYR A CD2   1 
ATOM   1078  C CE1   . TYR A 1 138 ? 59.619  160.016 45.468  1.00 16.16 ? 138  TYR A CE1   1 
ATOM   1079  C CE2   . TYR A 1 138 ? 61.243  161.795 45.237  1.00 16.21 ? 138  TYR A CE2   1 
ATOM   1080  C CZ    . TYR A 1 138 ? 60.281  161.131 45.991  1.00 15.70 ? 138  TYR A CZ    1 
ATOM   1081  O OH    . TYR A 1 138 ? 60.014  161.614 47.263  1.00 16.86 ? 138  TYR A OH    1 
ATOM   1082  N N     . MET A 1 139 ? 58.593  161.148 39.923  1.00 16.62 ? 139  MET A N     1 
ATOM   1083  C CA    . MET A 1 139 ? 58.106  162.282 39.170  1.00 17.89 ? 139  MET A CA    1 
ATOM   1084  C C     . MET A 1 139 ? 56.691  162.650 39.595  1.00 17.89 ? 139  MET A C     1 
ATOM   1085  O O     . MET A 1 139 ? 55.892  161.777 40.001  1.00 17.87 ? 139  MET A O     1 
ATOM   1086  C CB    . MET A 1 139 ? 58.064  161.932 37.668  1.00 18.52 ? 139  MET A CB    1 
ATOM   1087  C CG    . MET A 1 139 ? 59.423  161.795 36.990  1.00 20.79 ? 139  MET A CG    1 
ATOM   1088  S SD    . MET A 1 139 ? 60.140  163.385 36.711  1.00 26.39 ? 139  MET A SD    1 
ATOM   1089  C CE    . MET A 1 139 ? 59.233  163.893 35.247  1.00 24.66 ? 139  MET A CE    1 
ATOM   1090  N N     . PRO A 1 140 ? 56.337  163.926 39.421  1.00 17.49 ? 140  PRO A N     1 
ATOM   1091  C CA    . PRO A 1 140 ? 54.943  164.286 39.643  1.00 17.51 ? 140  PRO A CA    1 
ATOM   1092  C C     . PRO A 1 140 ? 54.140  164.052 38.352  1.00 17.94 ? 140  PRO A C     1 
ATOM   1093  O O     . PRO A 1 140 ? 54.664  163.506 37.363  1.00 18.40 ? 140  PRO A O     1 
ATOM   1094  C CB    . PRO A 1 140 ? 55.027  165.776 39.971  1.00 17.19 ? 140  PRO A CB    1 
ATOM   1095  C CG    . PRO A 1 140 ? 56.222  166.278 39.228  1.00 16.55 ? 140  PRO A CG    1 
ATOM   1096  C CD    . PRO A 1 140 ? 57.141  165.082 38.970  1.00 17.65 ? 140  PRO A CD    1 
ATOM   1097  N N     . MET A 1 141 ? 52.884  164.466 38.365  1.00 18.18 ? 141  MET A N     1 
ATOM   1098  C CA    . MET A 1 141 ? 51.980  164.264 37.237  1.00 17.99 ? 141  MET A CA    1 
ATOM   1099  C C     . MET A 1 141 ? 52.156  165.368 36.198  1.00 17.80 ? 141  MET A C     1 
ATOM   1100  O O     . MET A 1 141 ? 51.313  166.253 36.051  1.00 17.49 ? 141  MET A O     1 
ATOM   1101  C CB    . MET A 1 141 ? 50.533  164.183 37.733  1.00 18.09 ? 141  MET A CB    1 
ATOM   1102  C CG    . MET A 1 141 ? 50.255  162.860 38.429  1.00 18.01 ? 141  MET A CG    1 
ATOM   1103  S SD    . MET A 1 141 ? 49.907  161.594 37.201  1.00 19.48 ? 141  MET A SD    1 
ATOM   1104  C CE    . MET A 1 141 ? 48.143  161.806 36.968  1.00 19.53 ? 141  MET A CE    1 
ATOM   1105  N N     . VAL A 1 142 ? 53.292  165.289 35.514  1.00 17.79 ? 142  VAL A N     1 
ATOM   1106  C CA    . VAL A 1 142 ? 53.673  166.131 34.385  1.00 17.51 ? 142  VAL A CA    1 
ATOM   1107  C C     . VAL A 1 142 ? 53.903  165.190 33.187  1.00 17.88 ? 142  VAL A C     1 
ATOM   1108  O O     . VAL A 1 142 ? 54.164  164.004 33.391  1.00 17.72 ? 142  VAL A O     1 
ATOM   1109  C CB    . VAL A 1 142 ? 54.925  167.009 34.691  1.00 17.03 ? 142  VAL A CB    1 
ATOM   1110  C CG1   . VAL A 1 142 ? 54.600  168.003 35.807  1.00 16.57 ? 142  VAL A CG1   1 
ATOM   1111  C CG2   . VAL A 1 142 ? 56.178  166.152 35.069  1.00 15.76 ? 142  VAL A CG2   1 
ATOM   1112  N N     . PRO A 1 143 ? 53.771  165.713 31.947  1.00 17.91 ? 143  PRO A N     1 
ATOM   1113  C CA    . PRO A 1 143 ? 53.905  164.938 30.699  1.00 18.38 ? 143  PRO A CA    1 
ATOM   1114  C C     . PRO A 1 143 ? 55.256  164.232 30.559  1.00 18.57 ? 143  PRO A C     1 
ATOM   1115  O O     . PRO A 1 143 ? 55.330  163.160 29.957  1.00 18.90 ? 143  PRO A O     1 
ATOM   1116  C CB    . PRO A 1 143 ? 53.755  166.005 29.593  1.00 18.69 ? 143  PRO A CB    1 
ATOM   1117  C CG    . PRO A 1 143 ? 52.965  167.138 30.233  1.00 18.14 ? 143  PRO A CG    1 
ATOM   1118  C CD    . PRO A 1 143 ? 53.447  167.136 31.686  1.00 18.17 ? 143  PRO A CD    1 
ATOM   1119  N N     . GLU A 1 144 ? 56.299  164.841 31.117  1.00 18.39 ? 144  GLU A N     1 
ATOM   1120  C CA    . GLU A 1 144 ? 57.653  164.279 31.178  1.00 18.50 ? 144  GLU A CA    1 
ATOM   1121  C C     . GLU A 1 144 ? 57.769  162.926 31.915  1.00 17.60 ? 144  GLU A C     1 
ATOM   1122  O O     . GLU A 1 144 ? 58.661  162.149 31.611  1.00 17.91 ? 144  GLU A O     1 
ATOM   1123  C CB    . GLU A 1 144 ? 58.609  165.311 31.799  1.00 18.40 ? 144  GLU A CB    1 
ATOM   1124  C CG    . GLU A 1 144 ? 58.787  166.574 30.919  1.00 21.56 ? 144  GLU A CG    1 
ATOM   1125  C CD    . GLU A 1 144 ? 57.725  167.675 31.164  1.00 24.20 ? 144  GLU A CD    1 
ATOM   1126  O OE1   . GLU A 1 144 ? 56.831  167.519 32.020  1.00 24.22 ? 144  GLU A OE1   1 
ATOM   1127  O OE2   . GLU A 1 144 ? 57.806  168.735 30.516  1.00 26.45 ? 144  GLU A OE2   1 
ATOM   1128  N N     . ALA A 1 145 ? 56.884  162.657 32.883  1.00 16.97 ? 145  ALA A N     1 
ATOM   1129  C CA    . ALA A 1 145 ? 56.830  161.343 33.544  1.00 16.78 ? 145  ALA A CA    1 
ATOM   1130  C C     . ALA A 1 145 ? 56.475  160.269 32.519  1.00 16.88 ? 145  ALA A C     1 
ATOM   1131  O O     . ALA A 1 145 ? 57.103  159.202 32.469  1.00 17.22 ? 145  ALA A O     1 
ATOM   1132  C CB    . ALA A 1 145 ? 55.830  161.336 34.683  1.00 16.05 ? 145  ALA A CB    1 
ATOM   1133  N N     . ALA A 1 146 ? 55.504  160.603 31.674  1.00 17.03 ? 146  ALA A N     1 
ATOM   1134  C CA    . ALA A 1 146 ? 55.089  159.770 30.544  1.00 16.95 ? 146  ALA A CA    1 
ATOM   1135  C C     . ALA A 1 146 ? 56.187  159.536 29.513  1.00 16.52 ? 146  ALA A C     1 
ATOM   1136  O O     . ALA A 1 146 ? 56.379  158.420 29.052  1.00 17.54 ? 146  ALA A O     1 
ATOM   1137  C CB    . ALA A 1 146 ? 53.824  160.352 29.886  1.00 16.05 ? 146  ALA A CB    1 
ATOM   1138  N N     . VAL A 1 147 ? 56.895  160.598 29.148  1.00 16.95 ? 147  VAL A N     1 
ATOM   1139  C CA    . VAL A 1 147 ? 57.999  160.555 28.192  1.00 16.21 ? 147  VAL A CA    1 
ATOM   1140  C C     . VAL A 1 147 ? 59.089  159.627 28.736  1.00 16.32 ? 147  VAL A C     1 
ATOM   1141  O O     . VAL A 1 147 ? 59.629  158.791 28.034  1.00 16.79 ? 147  VAL A O     1 
ATOM   1142  C CB    . VAL A 1 147 ? 58.541  162.013 27.929  1.00 16.24 ? 147  VAL A CB    1 
ATOM   1143  C CG1   . VAL A 1 147 ? 59.820  161.993 27.118  1.00 15.57 ? 147  VAL A CG1   1 
ATOM   1144  C CG2   . VAL A 1 147 ? 57.470  162.871 27.212  1.00 16.01 ? 147  VAL A CG2   1 
ATOM   1145  N N     . ALA A 1 148 ? 59.375  159.746 30.021  1.00 17.22 ? 148  ALA A N     1 
ATOM   1146  C CA    . ALA A 1 148 ? 60.417  158.951 30.649  1.00 16.72 ? 148  ALA A CA    1 
ATOM   1147  C C     . ALA A 1 148 ? 60.041  157.457 30.700  1.00 17.06 ? 148  ALA A C     1 
ATOM   1148  O O     . ALA A 1 148 ? 60.882  156.597 30.412  1.00 16.82 ? 148  ALA A O     1 
ATOM   1149  C CB    . ALA A 1 148 ? 60.730  159.519 32.052  1.00 16.13 ? 148  ALA A CB    1 
ATOM   1150  N N     . MET A 1 149 ? 58.791  157.146 31.070  1.00 16.72 ? 149  MET A N     1 
ATOM   1151  C CA    . MET A 1 149 ? 58.320  155.753 31.096  1.00 16.44 ? 149  MET A CA    1 
ATOM   1152  C C     . MET A 1 149 ? 58.341  155.134 29.675  1.00 16.44 ? 149  MET A C     1 
ATOM   1153  O O     . MET A 1 149 ? 58.827  154.026 29.480  1.00 16.61 ? 149  MET A O     1 
ATOM   1154  C CB    . MET A 1 149 ? 56.917  155.665 31.701  1.00 16.46 ? 149  MET A CB    1 
ATOM   1155  C CG    . MET A 1 149 ? 56.839  155.892 33.246  1.00 15.04 ? 149  MET A CG    1 
ATOM   1156  S SD    . MET A 1 149 ? 55.140  156.167 33.775  1.00 17.47 ? 149  MET A SD    1 
ATOM   1157  C CE    . MET A 1 149 ? 54.497  154.477 33.876  1.00 14.05 ? 149  MET A CE    1 
ATOM   1158  N N     . LEU A 1 150 ? 57.867  155.883 28.689  1.00 16.34 ? 150  LEU A N     1 
ATOM   1159  C CA    . LEU A 1 150 ? 57.795  155.409 27.314  1.00 16.76 ? 150  LEU A CA    1 
ATOM   1160  C C     . LEU A 1 150 ? 59.175  155.230 26.669  1.00 16.92 ? 150  LEU A C     1 
ATOM   1161  O O     . LEU A 1 150 ? 59.389  154.242 25.963  1.00 17.03 ? 150  LEU A O     1 
ATOM   1162  C CB    . LEU A 1 150 ? 56.921  156.345 26.472  1.00 16.46 ? 150  LEU A CB    1 
ATOM   1163  C CG    . LEU A 1 150 ? 55.402  156.142 26.632  1.00 17.77 ? 150  LEU A CG    1 
ATOM   1164  C CD1   . LEU A 1 150 ? 54.650  157.427 26.259  1.00 17.27 ? 150  LEU A CD1   1 
ATOM   1165  C CD2   . LEU A 1 150 ? 54.886  154.963 25.785  1.00 16.13 ? 150  LEU A CD2   1 
ATOM   1166  N N     . ALA A 1 151 ? 60.097  156.165 26.928  1.00 16.69 ? 151  ALA A N     1 
ATOM   1167  C CA    . ALA A 1 151 ? 61.499  156.047 26.497  1.00 17.59 ? 151  ALA A CA    1 
ATOM   1168  C C     . ALA A 1 151 ? 62.196  154.795 27.025  1.00 18.21 ? 151  ALA A C     1 
ATOM   1169  O O     . ALA A 1 151 ? 62.885  154.121 26.266  1.00 18.80 ? 151  ALA A O     1 
ATOM   1170  C CB    . ALA A 1 151 ? 62.288  157.273 26.907  1.00 17.65 ? 151  ALA A CB    1 
ATOM   1171  N N     . CYS A 1 152 ? 62.019  154.504 28.322  1.00 17.98 ? 152  CYS A N     1 
ATOM   1172  C CA    . CYS A 1 152 ? 62.535  153.300 28.961  1.00 18.09 ? 152  CYS A CA    1 
ATOM   1173  C C     . CYS A 1 152 ? 62.008  152.054 28.256  1.00 18.86 ? 152  CYS A C     1 
ATOM   1174  O O     . CYS A 1 152 ? 62.790  151.214 27.818  1.00 18.89 ? 152  CYS A O     1 
ATOM   1175  C CB    . CYS A 1 152 ? 62.134  153.258 30.445  1.00 17.34 ? 152  CYS A CB    1 
ATOM   1176  S SG    . CYS A 1 152 ? 63.080  154.359 31.563  1.00 19.12 ? 152  CYS A SG    1 
ATOM   1177  N N     . ALA A 1 153 ? 60.679  151.935 28.164  1.00 18.88 ? 153  ALA A N     1 
ATOM   1178  C CA    . ALA A 1 153 ? 60.056  150.832 27.431  1.00 18.85 ? 153  ALA A CA    1 
ATOM   1179  C C     . ALA A 1 153 ? 60.595  150.737 25.987  1.00 18.93 ? 153  ALA A C     1 
ATOM   1180  O O     . ALA A 1 153 ? 60.849  149.629 25.492  1.00 19.25 ? 153  ALA A O     1 
ATOM   1181  C CB    . ALA A 1 153 ? 58.522  150.970 27.436  1.00 17.05 ? 153  ALA A CB    1 
ATOM   1182  N N     . ARG A 1 154 ? 60.769  151.884 25.331  1.00 18.44 ? 154  ARG A N     1 
ATOM   1183  C CA    . ARG A 1 154 ? 61.225  151.918 23.940  1.00 17.94 ? 154  ARG A CA    1 
ATOM   1184  C C     . ARG A 1 154 ? 62.581  151.230 23.760  1.00 18.69 ? 154  ARG A C     1 
ATOM   1185  O O     . ARG A 1 154 ? 62.780  150.516 22.767  1.00 18.27 ? 154  ARG A O     1 
ATOM   1186  C CB    . ARG A 1 154 ? 61.307  153.350 23.406  1.00 18.08 ? 154  ARG A CB    1 
ATOM   1187  C CG    . ARG A 1 154 ? 61.625  153.419 21.906  1.00 16.66 ? 154  ARG A CG    1 
ATOM   1188  C CD    . ARG A 1 154 ? 61.475  154.817 21.393  1.00 18.53 ? 154  ARG A CD    1 
ATOM   1189  N NE    . ARG A 1 154 ? 61.508  154.892 19.929  1.00 19.85 ? 154  ARG A NE    1 
ATOM   1190  C CZ    . ARG A 1 154 ? 60.439  154.820 19.133  1.00 21.17 ? 154  ARG A CZ    1 
ATOM   1191  N NH1   . ARG A 1 154 ? 59.222  154.673 19.635  1.00 19.43 ? 154  ARG A NH1   1 
ATOM   1192  N NH2   . ARG A 1 154 ? 60.588  154.918 17.813  1.00 22.90 ? 154  ARG A NH2   1 
ATOM   1193  N N     . ILE A 1 155 ? 63.486  151.432 24.726  1.00 18.04 ? 155  ILE A N     1 
ATOM   1194  C CA    . ILE A 1 155 ? 64.817  150.823 24.684  1.00 17.84 ? 155  ILE A CA    1 
ATOM   1195  C C     . ILE A 1 155 ? 64.905  149.504 25.437  1.00 18.89 ? 155  ILE A C     1 
ATOM   1196  O O     . ILE A 1 155 ? 65.963  148.890 25.474  1.00 19.62 ? 155  ILE A O     1 
ATOM   1197  C CB    . ILE A 1 155 ? 65.928  151.805 25.169  1.00 17.99 ? 155  ILE A CB    1 
ATOM   1198  C CG1   . ILE A 1 155 ? 65.782  152.150 26.661  1.00 16.08 ? 155  ILE A CG1   1 
ATOM   1199  C CG2   . ILE A 1 155 ? 65.976  153.074 24.267  1.00 15.42 ? 155  ILE A CG2   1 
ATOM   1200  C CD1   . ILE A 1 155 ? 66.965  153.004 27.216  1.00 17.30 ? 155  ILE A CD1   1 
ATOM   1201  N N     . GLY A 1 156 ? 63.801  149.041 26.029  1.00 18.96 ? 156  GLY A N     1 
ATOM   1202  C CA    . GLY A 1 156 ? 63.884  147.833 26.847  1.00 19.14 ? 156  GLY A CA    1 
ATOM   1203  C C     . GLY A 1 156 ? 64.524  148.009 28.235  1.00 18.85 ? 156  GLY A C     1 
ATOM   1204  O O     . GLY A 1 156 ? 64.857  147.014 28.901  1.00 17.93 ? 156  GLY A O     1 
ATOM   1205  N N     . ALA A 1 157 ? 64.697  149.256 28.679  1.00 18.59 ? 157  ALA A N     1 
ATOM   1206  C CA    . ALA A 1 157 ? 65.103  149.506 30.071  1.00 19.30 ? 157  ALA A CA    1 
ATOM   1207  C C     . ALA A 1 157 ? 63.870  149.201 30.906  1.00 19.38 ? 157  ALA A C     1 
ATOM   1208  O O     . ALA A 1 157 ? 62.758  149.244 30.389  1.00 20.88 ? 157  ALA A O     1 
ATOM   1209  C CB    . ALA A 1 157 ? 65.615  150.973 30.294  1.00 18.28 ? 157  ALA A CB    1 
ATOM   1210  N N     . VAL A 1 158 ? 64.060  148.849 32.171  1.00 18.92 ? 158  VAL A N     1 
ATOM   1211  C CA    . VAL A 1 158 ? 62.957  148.423 33.028  1.00 18.16 ? 158  VAL A CA    1 
ATOM   1212  C C     . VAL A 1 158 ? 62.659  149.565 34.015  1.00 18.80 ? 158  VAL A C     1 
ATOM   1213  O O     . VAL A 1 158 ? 63.397  149.769 34.979  1.00 19.44 ? 158  VAL A O     1 
ATOM   1214  C CB    . VAL A 1 158 ? 63.336  147.099 33.745  1.00 18.56 ? 158  VAL A CB    1 
ATOM   1215  C CG1   . VAL A 1 158 ? 62.273  146.666 34.798  1.00 18.48 ? 158  VAL A CG1   1 
ATOM   1216  C CG2   . VAL A 1 158 ? 63.562  146.011 32.703  1.00 16.68 ? 158  VAL A CG2   1 
ATOM   1217  N N     . HIS A 1 159 ? 61.605  150.342 33.784  1.00 18.08 ? 159  HIS A N     1 
ATOM   1218  C CA    . HIS A 1 159 ? 61.392  151.457 34.696  1.00 17.14 ? 159  HIS A CA    1 
ATOM   1219  C C     . HIS A 1 159 ? 60.836  150.963 36.014  1.00 17.22 ? 159  HIS A C     1 
ATOM   1220  O O     . HIS A 1 159 ? 60.132  149.957 36.069  1.00 17.79 ? 159  HIS A O     1 
ATOM   1221  C CB    . HIS A 1 159 ? 60.532  152.574 34.094  1.00 16.86 ? 159  HIS A CB    1 
ATOM   1222  C CG    . HIS A 1 159 ? 59.119  152.184 33.754  1.00 17.56 ? 159  HIS A CG    1 
ATOM   1223  N ND1   . HIS A 1 159 ? 58.183  151.828 34.703  1.00 16.92 ? 159  HIS A ND1   1 
ATOM   1224  C CD2   . HIS A 1 159 ? 58.467  152.170 32.565  1.00 18.65 ? 159  HIS A CD2   1 
ATOM   1225  C CE1   . HIS A 1 159 ? 57.020  151.609 34.109  1.00 18.34 ? 159  HIS A CE1   1 
ATOM   1226  N NE2   . HIS A 1 159 ? 57.164  151.817 32.813  1.00 16.39 ? 159  HIS A NE2   1 
ATOM   1227  N N     . SER A 1 160 ? 61.188  151.659 37.084  1.00 16.83 ? 160  SER A N     1 
ATOM   1228  C CA    . SER A 1 160 ? 60.544  151.457 38.372  1.00 15.99 ? 160  SER A CA    1 
ATOM   1229  C C     . SER A 1 160 ? 60.063  152.820 38.871  1.00 16.09 ? 160  SER A C     1 
ATOM   1230  O O     . SER A 1 160 ? 60.849  153.642 39.359  1.00 15.84 ? 160  SER A O     1 
ATOM   1231  C CB    . SER A 1 160 ? 61.513  150.809 39.360  1.00 15.73 ? 160  SER A CB    1 
ATOM   1232  O OG    . SER A 1 160 ? 60.902  150.655 40.622  1.00 17.28 ? 160  SER A OG    1 
ATOM   1233  N N     . VAL A 1 161 ? 58.756  153.044 38.751  1.00 16.08 ? 161  VAL A N     1 
ATOM   1234  C CA    . VAL A 1 161 ? 58.147  154.301 39.109  1.00 15.63 ? 161  VAL A CA    1 
ATOM   1235  C C     . VAL A 1 161 ? 57.832  154.319 40.612  1.00 16.59 ? 161  VAL A C     1 
ATOM   1236  O O     . VAL A 1 161 ? 57.165  153.417 41.159  1.00 16.25 ? 161  VAL A O     1 
ATOM   1237  C CB    . VAL A 1 161 ? 56.904  154.584 38.240  1.00 16.00 ? 161  VAL A CB    1 
ATOM   1238  C CG1   . VAL A 1 161 ? 56.254  155.922 38.600  1.00 14.73 ? 161  VAL A CG1   1 
ATOM   1239  C CG2   . VAL A 1 161 ? 57.286  154.582 36.744  1.00 15.07 ? 161  VAL A CG2   1 
ATOM   1240  N N     . ILE A 1 162 ? 58.349  155.346 41.277  1.00 15.79 ? 162  ILE A N     1 
ATOM   1241  C CA    . ILE A 1 162 ? 58.152  155.519 42.702  1.00 15.43 ? 162  ILE A CA    1 
ATOM   1242  C C     . ILE A 1 162 ? 57.239  156.727 42.905  1.00 15.35 ? 162  ILE A C     1 
ATOM   1243  O O     . ILE A 1 162 ? 57.589  157.833 42.525  1.00 15.89 ? 162  ILE A O     1 
ATOM   1244  C CB    . ILE A 1 162 ? 59.497  155.757 43.424  1.00 15.61 ? 162  ILE A CB    1 
ATOM   1245  C CG1   . ILE A 1 162 ? 60.492  154.618 43.105  1.00 16.51 ? 162  ILE A CG1   1 
ATOM   1246  C CG2   . ILE A 1 162 ? 59.281  155.895 44.937  1.00 14.86 ? 162  ILE A CG2   1 
ATOM   1247  C CD1   . ILE A 1 162 ? 61.957  154.908 43.497  1.00 14.45 ? 162  ILE A CD1   1 
ATOM   1248  N N     . PHE A 1 163 ? 56.060  156.489 43.473  1.00 15.49 ? 163  PHE A N     1 
ATOM   1249  C CA    . PHE A 1 163 ? 55.116  157.542 43.836  1.00 16.63 ? 163  PHE A CA    1 
ATOM   1250  C C     . PHE A 1 163 ? 55.789  158.702 44.585  1.00 16.43 ? 163  PHE A C     1 
ATOM   1251  O O     . PHE A 1 163 ? 56.509  158.472 45.562  1.00 17.31 ? 163  PHE A O     1 
ATOM   1252  C CB    . PHE A 1 163 ? 54.023  156.912 44.711  1.00 16.26 ? 163  PHE A CB    1 
ATOM   1253  C CG    . PHE A 1 163 ? 52.980  157.889 45.220  1.00 17.41 ? 163  PHE A CG    1 
ATOM   1254  C CD1   . PHE A 1 163 ? 52.169  158.592 44.341  1.00 16.76 ? 163  PHE A CD1   1 
ATOM   1255  C CD2   . PHE A 1 163 ? 52.804  158.077 46.588  1.00 18.41 ? 163  PHE A CD2   1 
ATOM   1256  C CE1   . PHE A 1 163 ? 51.205  159.461 44.809  1.00 18.00 ? 163  PHE A CE1   1 
ATOM   1257  C CE2   . PHE A 1 163 ? 51.832  158.938 47.077  1.00 19.13 ? 163  PHE A CE2   1 
ATOM   1258  C CZ    . PHE A 1 163 ? 51.035  159.638 46.185  1.00 19.34 ? 163  PHE A CZ    1 
ATOM   1259  N N     . GLY A 1 164 ? 55.506  159.939 44.175  1.00 17.06 ? 164  GLY A N     1 
ATOM   1260  C CA    . GLY A 1 164 ? 56.151  161.135 44.754  1.00 16.82 ? 164  GLY A CA    1 
ATOM   1261  C C     . GLY A 1 164 ? 55.947  161.300 46.270  1.00 17.54 ? 164  GLY A C     1 
ATOM   1262  O O     . GLY A 1 164 ? 56.722  161.992 46.944  1.00 16.97 ? 164  GLY A O     1 
ATOM   1263  N N     . GLY A 1 165 ? 54.926  160.648 46.812  1.00 17.08 ? 165  GLY A N     1 
ATOM   1264  C CA    . GLY A 1 165 ? 54.632  160.748 48.241  1.00 17.10 ? 165  GLY A CA    1 
ATOM   1265  C C     . GLY A 1 165 ? 55.454  159.844 49.137  1.00 16.99 ? 165  GLY A C     1 
ATOM   1266  O O     . GLY A 1 165 ? 55.236  159.827 50.343  1.00 18.27 ? 165  GLY A O     1 
ATOM   1267  N N     . PHE A 1 166 ? 56.370  159.072 48.561  1.00 16.58 ? 166  PHE A N     1 
ATOM   1268  C CA    . PHE A 1 166 ? 57.324  158.287 49.343  1.00 16.09 ? 166  PHE A CA    1 
ATOM   1269  C C     . PHE A 1 166 ? 58.481  159.120 49.855  1.00 16.81 ? 166  PHE A C     1 
ATOM   1270  O O     . PHE A 1 166 ? 58.998  160.010 49.161  1.00 17.09 ? 166  PHE A O     1 
ATOM   1271  C CB    . PHE A 1 166 ? 57.854  157.050 48.564  1.00 15.78 ? 166  PHE A CB    1 
ATOM   1272  C CG    . PHE A 1 166 ? 56.864  155.919 48.493  1.00 15.11 ? 166  PHE A CG    1 
ATOM   1273  C CD1   . PHE A 1 166 ? 56.460  155.254 49.651  1.00 14.68 ? 166  PHE A CD1   1 
ATOM   1274  C CD2   . PHE A 1 166 ? 56.313  155.540 47.270  1.00 15.94 ? 166  PHE A CD2   1 
ATOM   1275  C CE1   . PHE A 1 166 ? 55.513  154.210 49.593  1.00 17.35 ? 166  PHE A CE1   1 
ATOM   1276  C CE2   . PHE A 1 166 ? 55.370  154.521 47.180  1.00 17.44 ? 166  PHE A CE2   1 
ATOM   1277  C CZ    . PHE A 1 166 ? 54.953  153.843 48.349  1.00 18.02 ? 166  PHE A CZ    1 
ATOM   1278  N N     . SER A 1 167 ? 58.894  158.807 51.082  1.00 17.13 ? 167  SER A N     1 
ATOM   1279  C CA    . SER A 1 167 ? 59.963  159.510 51.769  1.00 16.83 ? 167  SER A CA    1 
ATOM   1280  C C     . SER A 1 167 ? 61.302  159.067 51.206  1.00 17.22 ? 167  SER A C     1 
ATOM   1281  O O     . SER A 1 167 ? 61.355  158.040 50.525  1.00 17.90 ? 167  SER A O     1 
ATOM   1282  C CB    . SER A 1 167 ? 59.906  159.111 53.233  1.00 16.91 ? 167  SER A CB    1 
ATOM   1283  O OG    . SER A 1 167 ? 60.388  157.776 53.383  1.00 18.49 ? 167  SER A OG    1 
ATOM   1284  N N     . PRO A 1 168 ? 62.383  159.829 51.473  1.00 17.10 ? 168  PRO A N     1 
ATOM   1285  C CA    . PRO A 1 168 ? 63.737  159.428 51.063  1.00 18.08 ? 168  PRO A CA    1 
ATOM   1286  C C     . PRO A 1 168 ? 64.146  157.982 51.452  1.00 18.30 ? 168  PRO A C     1 
ATOM   1287  O O     . PRO A 1 168 ? 64.766  157.296 50.658  1.00 18.18 ? 168  PRO A O     1 
ATOM   1288  C CB    . PRO A 1 168 ? 64.639  160.456 51.773  1.00 18.48 ? 168  PRO A CB    1 
ATOM   1289  C CG    . PRO A 1 168 ? 63.757  161.691 51.906  1.00 16.61 ? 168  PRO A CG    1 
ATOM   1290  C CD    . PRO A 1 168 ? 62.372  161.146 52.160  1.00 17.04 ? 168  PRO A CD    1 
ATOM   1291  N N     . GLU A 1 169 ? 63.780  157.532 52.648  1.00 19.02 ? 169  GLU A N     1 
ATOM   1292  C CA    . GLU A 1 169 ? 64.051  156.157 53.089  1.00 19.22 ? 169  GLU A CA    1 
ATOM   1293  C C     . GLU A 1 169 ? 63.339  155.114 52.209  1.00 18.90 ? 169  GLU A C     1 
ATOM   1294  O O     . GLU A 1 169 ? 63.947  154.120 51.802  1.00 18.89 ? 169  GLU A O     1 
ATOM   1295  C CB    . GLU A 1 169 ? 63.655  155.999 54.558  1.00 19.64 ? 169  GLU A CB    1 
ATOM   1296  C CG    . GLU A 1 169 ? 63.861  154.605 55.138  1.00 21.74 ? 169  GLU A CG    1 
ATOM   1297  C CD    . GLU A 1 169 ? 65.325  154.259 55.350  1.00 26.76 ? 169  GLU A CD    1 
ATOM   1298  O OE1   . GLU A 1 169 ? 66.178  155.183 55.478  1.00 27.03 ? 169  GLU A OE1   1 
ATOM   1299  O OE2   . GLU A 1 169 ? 65.614  153.046 55.381  1.00 30.92 ? 169  GLU A OE2   1 
ATOM   1300  N N     . ALA A 1 170 ? 62.066  155.367 51.905  1.00 17.98 ? 170  ALA A N     1 
ATOM   1301  C CA    . ALA A 1 170 ? 61.271  154.543 50.983  1.00 18.02 ? 170  ALA A CA    1 
ATOM   1302  C C     . ALA A 1 170 ? 61.840  154.551 49.554  1.00 17.51 ? 170  ALA A C     1 
ATOM   1303  O O     . ALA A 1 170 ? 61.911  153.509 48.927  1.00 18.00 ? 170  ALA A O     1 
ATOM   1304  C CB    . ALA A 1 170 ? 59.789  154.997 50.979  1.00 16.69 ? 170  ALA A CB    1 
ATOM   1305  N N     . VAL A 1 171 ? 62.219  155.725 49.054  1.00 16.88 ? 171  VAL A N     1 
ATOM   1306  C CA    . VAL A 1 171 ? 62.969  155.860 47.781  1.00 16.77 ? 171  VAL A CA    1 
ATOM   1307  C C     . VAL A 1 171 ? 64.277  155.034 47.772  1.00 16.48 ? 171  VAL A C     1 
ATOM   1308  O O     . VAL A 1 171 ? 64.534  154.285 46.835  1.00 16.08 ? 171  VAL A O     1 
ATOM   1309  C CB    . VAL A 1 171 ? 63.271  157.372 47.425  1.00 16.58 ? 171  VAL A CB    1 
ATOM   1310  C CG1   . VAL A 1 171 ? 64.189  157.485 46.221  1.00 17.08 ? 171  VAL A CG1   1 
ATOM   1311  C CG2   . VAL A 1 171 ? 61.992  158.131 47.150  1.00 16.78 ? 171  VAL A CG2   1 
ATOM   1312  N N     . ALA A 1 172 ? 65.093  155.166 48.818  1.00 16.31 ? 172  ALA A N     1 
ATOM   1313  C CA    . ALA A 1 172 ? 66.344  154.410 48.914  1.00 17.04 ? 172  ALA A CA    1 
ATOM   1314  C C     . ALA A 1 172 ? 66.139  152.881 48.921  1.00 17.75 ? 172  ALA A C     1 
ATOM   1315  O O     . ALA A 1 172 ? 66.854  152.161 48.222  1.00 18.67 ? 172  ALA A O     1 
ATOM   1316  C CB    . ALA A 1 172 ? 67.152  154.853 50.130  1.00 16.45 ? 172  ALA A CB    1 
ATOM   1317  N N     . GLY A 1 173 ? 65.175  152.386 49.701  1.00 18.31 ? 173  GLY A N     1 
ATOM   1318  C CA    . GLY A 1 173 ? 64.851  150.951 49.720  1.00 18.53 ? 173  GLY A CA    1 
ATOM   1319  C C     . GLY A 1 173 ? 64.539  150.394 48.332  1.00 19.16 ? 173  GLY A C     1 
ATOM   1320  O O     . GLY A 1 173 ? 65.054  149.337 47.945  1.00 18.45 ? 173  GLY A O     1 
ATOM   1321  N N     . ARG A 1 174 ? 63.704  151.115 47.576  1.00 19.41 ? 174  ARG A N     1 
ATOM   1322  C CA    . ARG A 1 174 ? 63.366  150.741 46.190  1.00 19.40 ? 174  ARG A CA    1 
ATOM   1323  C C     . ARG A 1 174 ? 64.565  150.790 45.233  1.00 19.56 ? 174  ARG A C     1 
ATOM   1324  O O     . ARG A 1 174 ? 64.759  149.882 44.423  1.00 20.21 ? 174  ARG A O     1 
ATOM   1325  C CB    . ARG A 1 174 ? 62.198  151.588 45.663  1.00 19.12 ? 174  ARG A CB    1 
ATOM   1326  C CG    . ARG A 1 174 ? 60.874  151.297 46.363  1.00 19.01 ? 174  ARG A CG    1 
ATOM   1327  C CD    . ARG A 1 174 ? 59.819  152.390 46.147  1.00 19.71 ? 174  ARG A CD    1 
ATOM   1328  N NE    . ARG A 1 174 ? 58.531  151.944 46.667  1.00 18.04 ? 174  ARG A NE    1 
ATOM   1329  C CZ    . ARG A 1 174 ? 58.277  151.790 47.965  1.00 20.89 ? 174  ARG A CZ    1 
ATOM   1330  N NH1   . ARG A 1 174 ? 59.200  152.098 48.864  1.00 17.96 ? 174  ARG A NH1   1 
ATOM   1331  N NH2   . ARG A 1 174 ? 57.097  151.346 48.370  1.00 21.63 ? 174  ARG A NH2   1 
ATOM   1332  N N     . ILE A 1 175 ? 65.372  151.832 45.335  1.00 19.47 ? 175  ILE A N     1 
ATOM   1333  C CA    . ILE A 1 175 ? 66.649  151.929 44.589  1.00 20.13 ? 175  ILE A CA    1 
ATOM   1334  C C     . ILE A 1 175 ? 67.630  150.777 44.884  1.00 20.43 ? 175  ILE A C     1 
ATOM   1335  O O     . ILE A 1 175 ? 68.189  150.171 43.970  1.00 20.02 ? 175  ILE A O     1 
ATOM   1336  C CB    . ILE A 1 175 ? 67.363  153.294 44.836  1.00 19.64 ? 175  ILE A CB    1 
ATOM   1337  C CG1   . ILE A 1 175 ? 66.591  154.443 44.188  1.00 19.12 ? 175  ILE A CG1   1 
ATOM   1338  C CG2   . ILE A 1 175 ? 68.799  153.269 44.324  1.00 18.45 ? 175  ILE A CG2   1 
ATOM   1339  C CD1   . ILE A 1 175 ? 67.068  155.795 44.632  1.00 21.72 ? 175  ILE A CD1   1 
ATOM   1340  N N     . ILE A 1 176 ? 67.843  150.501 46.165  1.00 21.56 ? 176  ILE A N     1 
ATOM   1341  C CA    . ILE A 1 176 ? 68.735  149.428 46.604  1.00 21.55 ? 176  ILE A CA    1 
ATOM   1342  C C     . ILE A 1 176 ? 68.263  148.066 46.073  1.00 22.60 ? 176  ILE A C     1 
ATOM   1343  O O     . ILE A 1 176 ? 69.050  147.330 45.459  1.00 22.22 ? 176  ILE A O     1 
ATOM   1344  C CB    . ILE A 1 176 ? 68.866  149.418 48.142  1.00 21.45 ? 176  ILE A CB    1 
ATOM   1345  C CG1   . ILE A 1 176 ? 69.627  150.677 48.608  1.00 20.93 ? 176  ILE A CG1   1 
ATOM   1346  C CG2   . ILE A 1 176 ? 69.525  148.088 48.651  1.00 21.67 ? 176  ILE A CG2   1 
ATOM   1347  C CD1   . ILE A 1 176 ? 69.528  150.969 50.073  1.00 18.70 ? 176  ILE A CD1   1 
ATOM   1348  N N     . ASP A 1 177 ? 66.987  147.743 46.300  1.00 22.32 ? 177  ASP A N     1 
ATOM   1349  C CA    . ASP A 1 177 ? 66.439  146.455 45.881  1.00 23.36 ? 177  ASP A CA    1 
ATOM   1350  C C     . ASP A 1 177 ? 66.515  146.239 44.363  1.00 23.69 ? 177  ASP A C     1 
ATOM   1351  O O     . ASP A 1 177 ? 66.789  145.125 43.912  1.00 23.34 ? 177  ASP A O     1 
ATOM   1352  C CB    . ASP A 1 177 ? 64.978  146.284 46.348  1.00 23.29 ? 177  ASP A CB    1 
ATOM   1353  C CG    . ASP A 1 177 ? 64.419  144.894 46.017  1.00 23.43 ? 177  ASP A CG    1 
ATOM   1354  O OD1   . ASP A 1 177 ? 63.562  144.756 45.129  1.00 24.92 ? 177  ASP A OD1   1 
ATOM   1355  O OD2   . ASP A 1 177 ? 64.849  143.922 46.649  1.00 23.93 ? 177  ASP A OD2   1 
ATOM   1356  N N     . SER A 1 178 ? 66.283  147.306 43.589  1.00 23.66 ? 178  SER A N     1 
ATOM   1357  C CA    . SER A 1 178 ? 66.244  147.214 42.119  1.00 23.73 ? 178  SER A CA    1 
ATOM   1358  C C     . SER A 1 178 ? 67.587  147.503 41.451  1.00 23.90 ? 178  SER A C     1 
ATOM   1359  O O     . SER A 1 178 ? 67.724  147.340 40.236  1.00 24.08 ? 178  SER A O     1 
ATOM   1360  C CB    . SER A 1 178 ? 65.181  148.157 41.546  1.00 23.99 ? 178  SER A CB    1 
ATOM   1361  O OG    . SER A 1 178 ? 65.503  149.511 41.843  1.00 21.92 ? 178  SER A OG    1 
ATOM   1362  N N     . SER A 1 179 ? 68.569  147.936 42.246  1.00 23.75 ? 179  SER A N     1 
ATOM   1363  C CA    . SER A 1 179 ? 69.840  148.403 41.726  1.00 23.53 ? 179  SER A CA    1 
ATOM   1364  C C     . SER A 1 179 ? 69.596  149.390 40.570  1.00 23.80 ? 179  SER A C     1 
ATOM   1365  O O     . SER A 1 179 ? 70.132  149.232 39.468  1.00 23.71 ? 179  SER A O     1 
ATOM   1366  C CB    . SER A 1 179 ? 70.730  147.214 41.284  1.00 23.97 ? 179  SER A CB    1 
ATOM   1367  O OG    . SER A 1 179 ? 71.157  146.430 42.393  1.00 24.22 ? 179  SER A OG    1 
ATOM   1368  N N     . SER A 1 180 ? 68.754  150.396 40.814  1.00 23.57 ? 180  SER A N     1 
ATOM   1369  C CA    . SER A 1 180 ? 68.472  151.402 39.800  1.00 22.78 ? 180  SER A CA    1 
ATOM   1370  C C     . SER A 1 180 ? 69.773  152.124 39.453  1.00 23.36 ? 180  SER A C     1 
ATOM   1371  O O     . SER A 1 180 ? 70.517  152.507 40.366  1.00 23.16 ? 180  SER A O     1 
ATOM   1372  C CB    . SER A 1 180 ? 67.434  152.391 40.329  1.00 23.03 ? 180  SER A CB    1 
ATOM   1373  O OG    . SER A 1 180 ? 66.172  151.770 40.514  1.00 20.70 ? 180  SER A OG    1 
ATOM   1374  N N     . ARG A 1 181 ? 70.052  152.287 38.153  1.00 23.16 ? 181  ARG A N     1 
ATOM   1375  C CA    . ARG A 1 181 ? 71.295  152.955 37.657  1.00 23.07 ? 181  ARG A CA    1 
ATOM   1376  C C     . ARG A 1 181 ? 71.155  154.471 37.534  1.00 22.17 ? 181  ARG A C     1 
ATOM   1377  O O     . ARG A 1 181 ? 72.158  155.208 37.423  1.00 21.95 ? 181  ARG A O     1 
ATOM   1378  C CB    . ARG A 1 181 ? 71.676  152.434 36.258  1.00 23.29 ? 181  ARG A CB    1 
ATOM   1379  C CG    . ARG A 1 181 ? 72.141  151.003 36.199  1.00 26.37 ? 181  ARG A CG    1 
ATOM   1380  C CD    . ARG A 1 181 ? 72.983  150.768 34.930  1.00 29.25 ? 181  ARG A CD    1 
ATOM   1381  N NE    . ARG A 1 181 ? 74.207  151.571 34.866  1.00 28.92 ? 181  ARG A NE    1 
ATOM   1382  C CZ    . ARG A 1 181 ? 74.802  151.949 33.729  1.00 30.50 ? 181  ARG A CZ    1 
ATOM   1383  N NH1   . ARG A 1 181 ? 74.284  151.621 32.543  1.00 30.84 ? 181  ARG A NH1   1 
ATOM   1384  N NH2   . ARG A 1 181 ? 75.908  152.680 33.762  1.00 28.83 ? 181  ARG A NH2   1 
ATOM   1385  N N     . LEU A 1 182 ? 69.902  154.918 37.504  1.00 21.08 ? 182  LEU A N     1 
ATOM   1386  C CA    . LEU A 1 182 ? 69.548  156.292 37.202  1.00 20.32 ? 182  LEU A CA    1 
ATOM   1387  C C     . LEU A 1 182 ? 68.247  156.628 37.911  1.00 20.25 ? 182  LEU A C     1 
ATOM   1388  O O     . LEU A 1 182 ? 67.357  155.778 38.002  1.00 20.42 ? 182  LEU A O     1 
ATOM   1389  C CB    . LEU A 1 182 ? 69.375  156.475 35.672  1.00 20.45 ? 182  LEU A CB    1 
ATOM   1390  C CG    . LEU A 1 182 ? 68.687  157.740 35.129  1.00 20.07 ? 182  LEU A CG    1 
ATOM   1391  C CD1   . LEU A 1 182 ? 69.610  158.949 35.165  1.00 20.27 ? 182  LEU A CD1   1 
ATOM   1392  C CD2   . LEU A 1 182 ? 68.129  157.552 33.739  1.00 18.99 ? 182  LEU A CD2   1 
ATOM   1393  N N     . VAL A 1 183 ? 68.156  157.855 38.430  1.00 19.76 ? 183  VAL A N     1 
ATOM   1394  C CA    . VAL A 1 183 ? 66.908  158.394 38.946  1.00 18.91 ? 183  VAL A CA    1 
ATOM   1395  C C     . VAL A 1 183 ? 66.477  159.553 38.030  1.00 19.36 ? 183  VAL A C     1 
ATOM   1396  O O     . VAL A 1 183 ? 67.289  160.428 37.687  1.00 18.94 ? 183  VAL A O     1 
ATOM   1397  C CB    . VAL A 1 183 ? 67.007  158.877 40.437  1.00 19.26 ? 183  VAL A CB    1 
ATOM   1398  C CG1   . VAL A 1 183 ? 65.629  159.337 40.982  1.00 17.13 ? 183  VAL A CG1   1 
ATOM   1399  C CG2   . VAL A 1 183 ? 67.599  157.793 41.358  1.00 18.43 ? 183  VAL A CG2   1 
ATOM   1400  N N     . ILE A 1 184 ? 65.206  159.531 37.615  1.00 18.96 ? 184  ILE A N     1 
ATOM   1401  C CA    . ILE A 1 184 ? 64.575  160.650 36.901  1.00 18.53 ? 184  ILE A CA    1 
ATOM   1402  C C     . ILE A 1 184 ? 63.531  161.336 37.805  1.00 18.25 ? 184  ILE A C     1 
ATOM   1403  O O     . ILE A 1 184 ? 62.604  160.706 38.294  1.00 19.96 ? 184  ILE A O     1 
ATOM   1404  C CB    . ILE A 1 184 ? 63.951  160.181 35.579  1.00 18.63 ? 184  ILE A CB    1 
ATOM   1405  C CG1   . ILE A 1 184 ? 65.010  159.448 34.731  1.00 17.76 ? 184  ILE A CG1   1 
ATOM   1406  C CG2   . ILE A 1 184 ? 63.330  161.360 34.823  1.00 19.17 ? 184  ILE A CG2   1 
ATOM   1407  C CD1   . ILE A 1 184 ? 64.412  158.745 33.501  1.00 18.51 ? 184  ILE A CD1   1 
ATOM   1408  N N     . THR A 1 185 ? 63.727  162.618 38.065  1.00 17.30 ? 185  THR A N     1 
ATOM   1409  C CA    . THR A 1 185 ? 62.932  163.352 39.052  1.00 16.83 ? 185  THR A CA    1 
ATOM   1410  C C     . THR A 1 185 ? 62.687  164.802 38.574  1.00 16.56 ? 185  THR A C     1 
ATOM   1411  O O     . THR A 1 185 ? 63.088  165.176 37.466  1.00 15.84 ? 185  THR A O     1 
ATOM   1412  C CB    . THR A 1 185 ? 63.592  163.272 40.498  1.00 16.84 ? 185  THR A CB    1 
ATOM   1413  O OG1   . THR A 1 185 ? 62.621  163.571 41.507  1.00 15.40 ? 185  THR A OG1   1 
ATOM   1414  C CG2   . THR A 1 185 ? 64.812  164.212 40.659  1.00 15.12 ? 185  THR A CG2   1 
ATOM   1415  N N     . ALA A 1 186 ? 62.016  165.594 39.407  1.00 16.95 ? 186  ALA A N     1 
ATOM   1416  C CA    . ALA A 1 186 ? 61.814  167.008 39.169  1.00 16.80 ? 186  ALA A CA    1 
ATOM   1417  C C     . ALA A 1 186 ? 62.321  167.735 40.402  1.00 17.61 ? 186  ALA A C     1 
ATOM   1418  O O     . ALA A 1 186 ? 62.453  167.116 41.467  1.00 18.12 ? 186  ALA A O     1 
ATOM   1419  C CB    . ALA A 1 186 ? 60.314  167.290 38.950  1.00 16.92 ? 186  ALA A CB    1 
ATOM   1420  N N     . ASP A 1 187 ? 62.594  169.035 40.294  1.00 17.35 ? 187  ASP A N     1 
ATOM   1421  C CA    . ASP A 1 187 ? 63.022  169.776 41.468  1.00 18.29 ? 187  ASP A CA    1 
ATOM   1422  C C     . ASP A 1 187 ? 61.937  169.675 42.520  1.00 18.53 ? 187  ASP A C     1 
ATOM   1423  O O     . ASP A 1 187 ? 62.215  169.253 43.648  1.00 19.85 ? 187  ASP A O     1 
ATOM   1424  C CB    . ASP A 1 187 ? 63.419  171.250 41.183  1.00 18.11 ? 187  ASP A CB    1 
ATOM   1425  C CG    . ASP A 1 187 ? 62.475  171.962 40.218  1.00 18.85 ? 187  ASP A CG    1 
ATOM   1426  O OD1   . ASP A 1 187 ? 61.309  171.537 39.996  1.00 18.82 ? 187  ASP A OD1   1 
ATOM   1427  O OD2   . ASP A 1 187 ? 62.918  172.985 39.676  1.00 20.79 ? 187  ASP A OD2   1 
ATOM   1428  N N     . GLU A 1 188 ? 60.713  170.012 42.130  1.00 18.23 ? 188  GLU A N     1 
ATOM   1429  C CA    . GLU A 1 188 ? 59.517  169.916 42.973  1.00 18.45 ? 188  GLU A CA    1 
ATOM   1430  C C     . GLU A 1 188 ? 58.321  169.516 42.118  1.00 18.56 ? 188  GLU A C     1 
ATOM   1431  O O     . GLU A 1 188 ? 58.323  169.738 40.900  1.00 17.36 ? 188  GLU A O     1 
ATOM   1432  C CB    . GLU A 1 188 ? 59.236  171.265 43.630  1.00 18.61 ? 188  GLU A CB    1 
ATOM   1433  C CG    . GLU A 1 188 ? 60.258  171.620 44.700  1.00 19.18 ? 188  GLU A CG    1 
ATOM   1434  C CD    . GLU A 1 188 ? 60.032  172.962 45.341  1.00 20.17 ? 188  GLU A CD    1 
ATOM   1435  O OE1   . GLU A 1 188 ? 59.500  173.890 44.682  1.00 22.27 ? 188  GLU A OE1   1 
ATOM   1436  O OE2   . GLU A 1 188 ? 60.454  173.112 46.504  1.00 20.39 ? 188  GLU A OE2   1 
ATOM   1437  N N     . GLY A 1 189 ? 57.319  168.909 42.752  1.00 19.22 ? 189  GLY A N     1 
ATOM   1438  C CA    . GLY A 1 189 ? 55.975  168.779 42.158  1.00 19.51 ? 189  GLY A CA    1 
ATOM   1439  C C     . GLY A 1 189 ? 55.011  169.850 42.661  1.00 20.11 ? 189  GLY A C     1 
ATOM   1440  O O     . GLY A 1 189 ? 55.271  170.543 43.668  1.00 19.90 ? 189  GLY A O     1 
ATOM   1441  N N     . VAL A 1 190 ? 53.887  170.002 41.969  1.00 20.07 ? 190  VAL A N     1 
ATOM   1442  C CA    . VAL A 1 190 ? 52.901  171.022 42.341  1.00 20.80 ? 190  VAL A CA    1 
ATOM   1443  C C     . VAL A 1 190 ? 51.569  170.325 42.580  1.00 20.87 ? 190  VAL A C     1 
ATOM   1444  O O     . VAL A 1 190 ? 51.083  169.611 41.701  1.00 20.77 ? 190  VAL A O     1 
ATOM   1445  C CB    . VAL A 1 190 ? 52.768  172.141 41.250  1.00 20.71 ? 190  VAL A CB    1 
ATOM   1446  C CG1   . VAL A 1 190 ? 51.792  173.245 41.714  1.00 21.26 ? 190  VAL A CG1   1 
ATOM   1447  C CG2   . VAL A 1 190 ? 54.125  172.758 40.959  1.00 20.43 ? 190  VAL A CG2   1 
ATOM   1448  N N     . ARG A 1 191 ? 51.008  170.487 43.776  1.00 20.67 ? 191  ARG A N     1 
ATOM   1449  C CA    . ARG A 1 191 ? 49.798  169.761 44.153  1.00 20.89 ? 191  ARG A CA    1 
ATOM   1450  C C     . ARG A 1 191 ? 48.969  170.576 45.133  1.00 21.54 ? 191  ARG A C     1 
ATOM   1451  O O     . ARG A 1 191 ? 49.458  170.937 46.208  1.00 20.92 ? 191  ARG A O     1 
ATOM   1452  C CB    . ARG A 1 191 ? 50.162  168.415 44.786  1.00 21.34 ? 191  ARG A CB    1 
ATOM   1453  C CG    . ARG A 1 191 ? 49.008  167.410 44.834  1.00 23.19 ? 191  ARG A CG    1 
ATOM   1454  C CD    . ARG A 1 191 ? 49.453  166.138 45.546  1.00 24.46 ? 191  ARG A CD    1 
ATOM   1455  N NE    . ARG A 1 191 ? 48.361  165.226 45.889  1.00 25.60 ? 191  ARG A NE    1 
ATOM   1456  C CZ    . ARG A 1 191 ? 47.645  165.305 47.011  1.00 28.59 ? 191  ARG A CZ    1 
ATOM   1457  N NH1   . ARG A 1 191 ? 47.856  166.285 47.878  1.00 28.71 ? 191  ARG A NH1   1 
ATOM   1458  N NH2   . ARG A 1 191 ? 46.689  164.427 47.256  1.00 30.37 ? 191  ARG A NH2   1 
ATOM   1459  N N     . ALA A 1 192 ? 47.718  170.837 44.754  1.00 21.23 ? 192  ALA A N     1 
ATOM   1460  C CA    . ALA A 1 192 ? 46.812  171.680 45.516  1.00 22.90 ? 192  ALA A CA    1 
ATOM   1461  C C     . ALA A 1 192 ? 47.479  172.998 45.991  1.00 23.13 ? 192  ALA A C     1 
ATOM   1462  O O     . ALA A 1 192 ? 47.426  173.344 47.156  1.00 23.38 ? 192  ALA A O     1 
ATOM   1463  C CB    . ALA A 1 192 ? 46.199  170.888 46.678  1.00 22.76 ? 192  ALA A CB    1 
ATOM   1464  N N     . GLY A 1 193 ? 48.119  173.711 45.064  1.00 24.51 ? 193  GLY A N     1 
ATOM   1465  C CA    . GLY A 1 193 ? 48.789  174.989 45.342  1.00 25.03 ? 193  GLY A CA    1 
ATOM   1466  C C     . GLY A 1 193 ? 50.116  174.901 46.080  1.00 26.42 ? 193  GLY A C     1 
ATOM   1467  O O     . GLY A 1 193 ? 50.805  175.919 46.249  1.00 26.31 ? 193  GLY A O     1 
ATOM   1468  N N     . ARG A 1 194 ? 50.484  173.693 46.503  1.00 26.73 ? 194  ARG A N     1 
ATOM   1469  C CA    . ARG A 1 194 ? 51.717  173.469 47.264  1.00 28.48 ? 194  ARG A CA    1 
ATOM   1470  C C     . ARG A 1 194 ? 52.835  172.898 46.387  1.00 27.94 ? 194  ARG A C     1 
ATOM   1471  O O     . ARG A 1 194 ? 52.578  172.124 45.471  1.00 27.89 ? 194  ARG A O     1 
ATOM   1472  C CB    . ARG A 1 194 ? 51.461  172.521 48.453  1.00 27.74 ? 194  ARG A CB    1 
ATOM   1473  C CG    . ARG A 1 194 ? 50.565  173.099 49.568  1.00 30.91 ? 194  ARG A CG    1 
ATOM   1474  C CD    . ARG A 1 194 ? 50.222  172.065 50.669  1.00 30.86 ? 194  ARG A CD    1 
ATOM   1475  N NE    . ARG A 1 194 ? 51.406  171.339 51.165  1.00 37.15 ? 194  ARG A NE    1 
ATOM   1476  C CZ    . ARG A 1 194 ? 51.365  170.306 52.014  1.00 39.13 ? 194  ARG A CZ    1 
ATOM   1477  N NH1   . ARG A 1 194 ? 52.493  169.713 52.394  1.00 39.30 ? 194  ARG A NH1   1 
ATOM   1478  N NH2   . ARG A 1 194 ? 50.195  169.857 52.481  1.00 39.89 ? 194  ARG A NH2   1 
ATOM   1479  N N     . SER A 1 195 ? 54.065  173.295 46.682  1.00 28.03 ? 195  SER A N     1 
ATOM   1480  C CA    . SER A 1 195 ? 55.256  172.738 46.042  1.00 28.50 ? 195  SER A CA    1 
ATOM   1481  C C     . SER A 1 195 ? 55.770  171.636 46.937  1.00 28.06 ? 195  SER A C     1 
ATOM   1482  O O     . SER A 1 195 ? 56.004  171.877 48.107  1.00 28.13 ? 195  SER A O     1 
ATOM   1483  C CB    . SER A 1 195 ? 56.339  173.813 45.868  1.00 28.44 ? 195  SER A CB    1 
ATOM   1484  O OG    . SER A 1 195 ? 55.999  174.701 44.805  1.00 30.18 ? 195  SER A OG    1 
ATOM   1485  N N     . ILE A 1 196 ? 55.908  170.430 46.391  1.00 27.53 ? 196  ILE A N     1 
ATOM   1486  C CA    . ILE A 1 196 ? 56.361  169.265 47.149  1.00 27.21 ? 196  ILE A CA    1 
ATOM   1487  C C     . ILE A 1 196 ? 57.794  168.941 46.736  1.00 26.82 ? 196  ILE A C     1 
ATOM   1488  O O     . ILE A 1 196 ? 58.070  168.789 45.549  1.00 26.43 ? 196  ILE A O     1 
ATOM   1489  C CB    . ILE A 1 196 ? 55.492  168.004 46.864  1.00 27.33 ? 196  ILE A CB    1 
ATOM   1490  C CG1   . ILE A 1 196 ? 53.990  168.284 47.058  1.00 28.75 ? 196  ILE A CG1   1 
ATOM   1491  C CG2   . ILE A 1 196 ? 55.990  166.796 47.664  1.00 26.83 ? 196  ILE A CG2   1 
ATOM   1492  C CD1   . ILE A 1 196 ? 53.606  168.984 48.375  1.00 30.95 ? 196  ILE A CD1   1 
ATOM   1493  N N     . PRO A 1 197 ? 58.712  168.818 47.716  1.00 26.98 ? 197  PRO A N     1 
ATOM   1494  C CA    . PRO A 1 197 ? 60.099  168.537 47.357  1.00 26.23 ? 197  PRO A CA    1 
ATOM   1495  C C     . PRO A 1 197 ? 60.165  167.145 46.723  1.00 25.34 ? 197  PRO A C     1 
ATOM   1496  O O     . PRO A 1 197 ? 59.472  166.221 47.173  1.00 26.25 ? 197  PRO A O     1 
ATOM   1497  C CB    . PRO A 1 197 ? 60.831  168.579 48.713  1.00 26.79 ? 197  PRO A CB    1 
ATOM   1498  C CG    . PRO A 1 197 ? 59.726  168.164 49.735  1.00 27.74 ? 197  PRO A CG    1 
ATOM   1499  C CD    . PRO A 1 197 ? 58.515  168.892 49.185  1.00 27.52 ? 197  PRO A CD    1 
ATOM   1500  N N     . LEU A 1 198 ? 60.917  167.014 45.638  1.00 23.12 ? 198  LEU A N     1 
ATOM   1501  C CA    . LEU A 1 198 ? 61.203  165.712 45.077  1.00 20.94 ? 198  LEU A CA    1 
ATOM   1502  C C     . LEU A 1 198 ? 62.707  165.510 45.008  1.00 19.77 ? 198  LEU A C     1 
ATOM   1503  O O     . LEU A 1 198 ? 63.220  164.547 45.583  1.00 18.65 ? 198  LEU A O     1 
ATOM   1504  C CB    . LEU A 1 198 ? 60.530  165.519 43.707  1.00 20.00 ? 198  LEU A CB    1 
ATOM   1505  C CG    . LEU A 1 198 ? 58.999  165.363 43.736  1.00 20.55 ? 198  LEU A CG    1 
ATOM   1506  C CD1   . LEU A 1 198 ? 58.452  165.441 42.324  1.00 20.07 ? 198  LEU A CD1   1 
ATOM   1507  C CD2   . LEU A 1 198 ? 58.541  164.072 44.425  1.00 19.74 ? 198  LEU A CD2   1 
ATOM   1508  N N     . LYS A 1 199 ? 63.407  166.417 44.318  1.00 19.28 ? 199  LYS A N     1 
ATOM   1509  C CA    . LYS A 1 199 ? 64.867  166.287 44.141  1.00 20.13 ? 199  LYS A CA    1 
ATOM   1510  C C     . LYS A 1 199 ? 65.622  166.221 45.485  1.00 19.64 ? 199  LYS A C     1 
ATOM   1511  O O     . LYS A 1 199 ? 66.527  165.404 45.636  1.00 19.73 ? 199  LYS A O     1 
ATOM   1512  C CB    . LYS A 1 199 ? 65.447  167.393 43.229  1.00 20.06 ? 199  LYS A CB    1 
ATOM   1513  C CG    . LYS A 1 199 ? 66.957  167.725 43.429  1.00 21.80 ? 199  LYS A CG    1 
ATOM   1514  C CD    . LYS A 1 199 ? 67.843  166.753 42.742  1.00 23.90 ? 199  LYS A CD    1 
ATOM   1515  C CE    . LYS A 1 199 ? 69.193  167.361 42.350  1.00 21.00 ? 199  LYS A CE    1 
ATOM   1516  N NZ    . LYS A 1 199 ? 70.205  167.353 43.425  1.00 22.97 ? 199  LYS A NZ    1 
ATOM   1517  N N     . LYS A 1 200 ? 65.241  167.072 46.437  1.00 19.50 ? 200  LYS A N     1 
ATOM   1518  C CA    . LYS A 1 200 ? 65.786  167.033 47.793  1.00 20.06 ? 200  LYS A CA    1 
ATOM   1519  C C     . LYS A 1 200 ? 65.647  165.632 48.421  1.00 19.80 ? 200  LYS A C     1 
ATOM   1520  O O     . LYS A 1 200 ? 66.562  165.161 49.096  1.00 19.50 ? 200  LYS A O     1 
ATOM   1521  C CB    . LYS A 1 200 ? 65.097  168.056 48.691  1.00 20.68 ? 200  LYS A CB    1 
ATOM   1522  C CG    . LYS A 1 200 ? 65.650  168.051 50.127  1.00 23.56 ? 200  LYS A CG    1 
ATOM   1523  C CD    . LYS A 1 200 ? 65.345  169.366 50.869  1.00 26.26 ? 200  LYS A CD    1 
ATOM   1524  C CE    . LYS A 1 200 ? 65.692  169.283 52.367  1.00 25.70 ? 200  LYS A CE    1 
ATOM   1525  N NZ    . LYS A 1 200 ? 67.163  169.490 52.621  1.00 27.19 ? 200  LYS A NZ    1 
ATOM   1526  N N     . ASN A 1 201 ? 64.493  164.997 48.200  1.00 18.68 ? 201  ASN A N     1 
ATOM   1527  C CA    . ASN A 1 201 ? 64.238  163.664 48.723  1.00 18.14 ? 201  ASN A CA    1 
ATOM   1528  C C     . ASN A 1 201 ? 65.191  162.655 48.098  1.00 17.50 ? 201  ASN A C     1 
ATOM   1529  O O     . ASN A 1 201 ? 65.693  161.778 48.780  1.00 17.56 ? 201  ASN A O     1 
ATOM   1530  C CB    . ASN A 1 201 ? 62.772  163.253 48.502  1.00 17.05 ? 201  ASN A CB    1 
ATOM   1531  C CG    . ASN A 1 201 ? 61.835  163.869 49.528  1.00 17.60 ? 201  ASN A CG    1 
ATOM   1532  O OD1   . ASN A 1 201 ? 62.280  164.487 50.504  1.00 18.54 ? 201  ASN A OD1   1 
ATOM   1533  N ND2   . ASN A 1 201 ? 60.531  163.713 49.312  1.00 14.56 ? 201  ASN A ND2   1 
ATOM   1534  N N     . VAL A 1 202 ? 65.444  162.811 46.806  1.00 17.39 ? 202  VAL A N     1 
ATOM   1535  C CA    . VAL A 1 202 ? 66.413  161.986 46.089  1.00 17.85 ? 202  VAL A CA    1 
ATOM   1536  C C     . VAL A 1 202 ? 67.840  162.177 46.610  1.00 18.11 ? 202  VAL A C     1 
ATOM   1537  O O     . VAL A 1 202 ? 68.590  161.185 46.739  1.00 17.86 ? 202  VAL A O     1 
ATOM   1538  C CB    . VAL A 1 202 ? 66.351  162.198 44.564  1.00 18.17 ? 202  VAL A CB    1 
ATOM   1539  C CG1   . VAL A 1 202 ? 67.495  161.427 43.852  1.00 18.02 ? 202  VAL A CG1   1 
ATOM   1540  C CG2   . VAL A 1 202 ? 64.996  161.714 44.038  1.00 17.21 ? 202  VAL A CG2   1 
ATOM   1541  N N     . ASP A 1 203 ? 68.190  163.430 46.931  1.00 18.24 ? 203  ASP A N     1 
ATOM   1542  C CA    . ASP A 1 203 ? 69.506  163.776 47.477  1.00 18.52 ? 203  ASP A CA    1 
ATOM   1543  C C     . ASP A 1 203 ? 69.661  163.049 48.789  1.00 19.04 ? 203  ASP A C     1 
ATOM   1544  O O     . ASP A 1 203 ? 70.699  162.441 49.034  1.00 19.33 ? 203  ASP A O     1 
ATOM   1545  C CB    . ASP A 1 203 ? 69.647  165.293 47.747  1.00 18.42 ? 203  ASP A CB    1 
ATOM   1546  C CG    . ASP A 1 203 ? 69.928  166.110 46.493  1.00 18.02 ? 203  ASP A CG    1 
ATOM   1547  O OD1   . ASP A 1 203 ? 70.182  165.540 45.405  1.00 16.80 ? 203  ASP A OD1   1 
ATOM   1548  O OD2   . ASP A 1 203 ? 69.864  167.351 46.604  1.00 19.49 ? 203  ASP A OD2   1 
ATOM   1549  N N     . ASP A 1 204 ? 68.633  163.137 49.637  1.00 18.86 ? 204  ASP A N     1 
ATOM   1550  C CA    . ASP A 1 204 ? 68.631  162.416 50.918  1.00 19.58 ? 204  ASP A CA    1 
ATOM   1551  C C     . ASP A 1 204 ? 68.741  160.896 50.743  1.00 19.43 ? 204  ASP A C     1 
ATOM   1552  O O     . ASP A 1 204 ? 69.530  160.254 51.425  1.00 19.71 ? 204  ASP A O     1 
ATOM   1553  C CB    . ASP A 1 204 ? 67.399  162.813 51.749  1.00 19.81 ? 204  ASP A CB    1 
ATOM   1554  C CG    . ASP A 1 204 ? 67.499  164.243 52.267  1.00 21.20 ? 204  ASP A CG    1 
ATOM   1555  O OD1   . ASP A 1 204 ? 66.499  164.808 52.751  1.00 24.61 ? 204  ASP A OD1   1 
ATOM   1556  O OD2   . ASP A 1 204 ? 68.595  164.811 52.173  1.00 20.01 ? 204  ASP A OD2   1 
ATOM   1557  N N     . ALA A 1 205 ? 67.950  160.343 49.824  1.00 19.33 ? 205  ALA A N     1 
ATOM   1558  C CA    . ALA A 1 205 ? 68.004  158.925 49.458  1.00 19.84 ? 205  ALA A CA    1 
ATOM   1559  C C     . ALA A 1 205 ? 69.417  158.447 49.084  1.00 20.46 ? 205  ALA A C     1 
ATOM   1560  O O     . ALA A 1 205 ? 69.868  157.389 49.561  1.00 20.00 ? 205  ALA A O     1 
ATOM   1561  C CB    . ALA A 1 205 ? 67.019  158.632 48.323  1.00 19.46 ? 205  ALA A CB    1 
ATOM   1562  N N     . LEU A 1 206 ? 70.125  159.232 48.264  1.00 21.19 ? 206  LEU A N     1 
ATOM   1563  C CA    . LEU A 1 206 ? 71.445  158.809 47.771  1.00 22.22 ? 206  LEU A CA    1 
ATOM   1564  C C     . LEU A 1 206 ? 72.554  158.924 48.803  1.00 22.77 ? 206  LEU A C     1 
ATOM   1565  O O     . LEU A 1 206 ? 73.647  158.423 48.567  1.00 23.63 ? 206  LEU A O     1 
ATOM   1566  C CB    . LEU A 1 206 ? 71.823  159.529 46.468  1.00 22.48 ? 206  LEU A CB    1 
ATOM   1567  C CG    . LEU A 1 206 ? 70.836  159.376 45.296  1.00 24.35 ? 206  LEU A CG    1 
ATOM   1568  C CD1   . LEU A 1 206 ? 71.385  159.970 44.029  1.00 25.35 ? 206  LEU A CD1   1 
ATOM   1569  C CD2   . LEU A 1 206 ? 70.426  157.934 45.059  1.00 26.68 ? 206  LEU A CD2   1 
ATOM   1570  N N     . LYS A 1 207 ? 72.279  159.588 49.932  1.00 23.07 ? 207  LYS A N     1 
ATOM   1571  C CA    . LYS A 1 207 ? 73.211  159.640 51.065  1.00 24.14 ? 207  LYS A CA    1 
ATOM   1572  C C     . LYS A 1 207 ? 73.253  158.344 51.886  1.00 24.25 ? 207  LYS A C     1 
ATOM   1573  O O     . LYS A 1 207 ? 74.230  158.097 52.591  1.00 24.52 ? 207  LYS A O     1 
ATOM   1574  C CB    . LYS A 1 207 ? 72.880  160.808 51.991  1.00 24.17 ? 207  LYS A CB    1 
ATOM   1575  C CG    . LYS A 1 207 ? 73.149  162.164 51.372  1.00 26.20 ? 207  LYS A CG    1 
ATOM   1576  C CD    . LYS A 1 207 ? 72.441  163.241 52.160  1.00 29.19 ? 207  LYS A CD    1 
ATOM   1577  C CE    . LYS A 1 207 ? 72.885  164.613 51.723  1.00 32.37 ? 207  LYS A CE    1 
ATOM   1578  N NZ    . LYS A 1 207 ? 72.373  165.637 52.690  1.00 35.29 ? 207  LYS A NZ    1 
ATOM   1579  N N     . ASN A 1 208 ? 72.201  157.529 51.804  1.00 24.24 ? 208  ASN A N     1 
ATOM   1580  C CA    . ASN A 1 208 ? 72.216  156.197 52.408  1.00 24.85 ? 208  ASN A CA    1 
ATOM   1581  C C     . ASN A 1 208 ? 73.408  155.406 51.842  1.00 25.13 ? 208  ASN A C     1 
ATOM   1582  O O     . ASN A 1 208 ? 73.545  155.292 50.624  1.00 24.49 ? 208  ASN A O     1 
ATOM   1583  C CB    . ASN A 1 208 ? 70.887  155.477 52.142  1.00 24.50 ? 208  ASN A CB    1 
ATOM   1584  C CG    . ASN A 1 208 ? 70.821  154.091 52.774  1.00 26.37 ? 208  ASN A CG    1 
ATOM   1585  O OD1   . ASN A 1 208 ? 71.777  153.303 52.697  1.00 28.47 ? 208  ASN A OD1   1 
ATOM   1586  N ND2   . ASN A 1 208 ? 69.676  153.772 53.382  1.00 21.81 ? 208  ASN A ND2   1 
ATOM   1587  N N     . PRO A 1 209 ? 74.284  154.867 52.729  1.00 26.24 ? 209  PRO A N     1 
ATOM   1588  C CA    . PRO A 1 209 ? 75.500  154.197 52.253  1.00 26.03 ? 209  PRO A CA    1 
ATOM   1589  C C     . PRO A 1 209 ? 75.257  152.848 51.541  1.00 26.07 ? 209  PRO A C     1 
ATOM   1590  O O     . PRO A 1 209 ? 76.183  152.304 50.941  1.00 25.97 ? 209  PRO A O     1 
ATOM   1591  C CB    . PRO A 1 209 ? 76.334  154.037 53.535  1.00 26.57 ? 209  PRO A CB    1 
ATOM   1592  C CG    . PRO A 1 209 ? 75.309  153.943 54.633  1.00 26.31 ? 209  PRO A CG    1 
ATOM   1593  C CD    . PRO A 1 209 ? 74.205  154.872 54.212  1.00 25.92 ? 209  PRO A CD    1 
ATOM   1594  N N     . ASN A 1 210 ? 74.030  152.339 51.549  1.00 25.90 ? 210  ASN A N     1 
ATOM   1595  C CA    . ASN A 1 210 ? 73.734  151.122 50.803  1.00 26.27 ? 210  ASN A CA    1 
ATOM   1596  C C     . ASN A 1 210 ? 73.278  151.356 49.362  1.00 25.63 ? 210  ASN A C     1 
ATOM   1597  O O     . ASN A 1 210 ? 73.192  150.412 48.572  1.00 25.42 ? 210  ASN A O     1 
ATOM   1598  C CB    . ASN A 1 210 ? 72.751  150.232 51.559  1.00 26.67 ? 210  ASN A CB    1 
ATOM   1599  C CG    . ASN A 1 210 ? 73.311  149.761 52.874  1.00 29.36 ? 210  ASN A CG    1 
ATOM   1600  O OD1   . ASN A 1 210 ? 74.323  149.060 52.912  1.00 30.21 ? 210  ASN A OD1   1 
ATOM   1601  N ND2   . ASN A 1 210 ? 72.669  150.165 53.973  1.00 33.21 ? 210  ASN A ND2   1 
ATOM   1602  N N     . VAL A 1 211 ? 73.015  152.615 49.021  1.00 24.97 ? 211  VAL A N     1 
ATOM   1603  C CA    . VAL A 1 211 ? 72.743  152.991 47.636  1.00 23.84 ? 211  VAL A CA    1 
ATOM   1604  C C     . VAL A 1 211 ? 74.074  153.078 46.901  1.00 23.66 ? 211  VAL A C     1 
ATOM   1605  O O     . VAL A 1 211 ? 74.897  153.968 47.175  1.00 23.78 ? 211  VAL A O     1 
ATOM   1606  C CB    . VAL A 1 211 ? 71.984  154.334 47.522  1.00 23.81 ? 211  VAL A CB    1 
ATOM   1607  C CG1   . VAL A 1 211 ? 71.820  154.722 46.039  1.00 22.45 ? 211  VAL A CG1   1 
ATOM   1608  C CG2   . VAL A 1 211 ? 70.629  154.263 48.234  1.00 22.85 ? 211  VAL A CG2   1 
ATOM   1609  N N     . THR A 1 212 ? 74.274  152.157 45.962  1.00 23.39 ? 212  THR A N     1 
ATOM   1610  C CA    . THR A 1 212 ? 75.542  152.040 45.243  1.00 24.02 ? 212  THR A CA    1 
ATOM   1611  C C     . THR A 1 212 ? 75.361  152.187 43.732  1.00 23.78 ? 212  THR A C     1 
ATOM   1612  O O     . THR A 1 212 ? 76.323  152.477 43.022  1.00 24.29 ? 212  THR A O     1 
ATOM   1613  C CB    . THR A 1 212 ? 76.251  150.658 45.522  1.00 24.31 ? 212  THR A CB    1 
ATOM   1614  O OG1   . THR A 1 212 ? 75.411  149.586 45.081  1.00 23.19 ? 212  THR A OG1   1 
ATOM   1615  C CG2   . THR A 1 212 ? 76.562  150.475 47.004  1.00 24.94 ? 212  THR A CG2   1 
ATOM   1616  N N     . SER A 1 213 ? 74.134  152.012 43.252  1.00 22.61 ? 213  SER A N     1 
ATOM   1617  C CA    . SER A 1 213 ? 73.906  151.726 41.830  1.00 22.14 ? 213  SER A CA    1 
ATOM   1618  C C     . SER A 1 213 ? 73.682  152.964 40.961  1.00 21.80 ? 213  SER A C     1 
ATOM   1619  O O     . SER A 1 213 ? 73.886  152.927 39.755  1.00 21.90 ? 213  SER A O     1 
ATOM   1620  C CB    . SER A 1 213 ? 72.734  150.758 41.685  1.00 21.89 ? 213  SER A CB    1 
ATOM   1621  O OG    . SER A 1 213 ? 71.574  151.282 42.320  1.00 21.45 ? 213  SER A OG    1 
ATOM   1622  N N     . VAL A 1 214 ? 73.282  154.058 41.593  1.00 21.22 ? 214  VAL A N     1 
ATOM   1623  C CA    . VAL A 1 214 ? 72.836  155.252 40.897  1.00 20.78 ? 214  VAL A CA    1 
ATOM   1624  C C     . VAL A 1 214 ? 74.046  156.063 40.462  1.00 20.75 ? 214  VAL A C     1 
ATOM   1625  O O     . VAL A 1 214 ? 74.876  156.448 41.288  1.00 20.97 ? 214  VAL A O     1 
ATOM   1626  C CB    . VAL A 1 214 ? 71.908  156.105 41.812  1.00 21.05 ? 214  VAL A CB    1 
ATOM   1627  C CG1   . VAL A 1 214 ? 71.489  157.405 41.132  1.00 20.79 ? 214  VAL A CG1   1 
ATOM   1628  C CG2   . VAL A 1 214 ? 70.667  155.290 42.256  1.00 19.20 ? 214  VAL A CG2   1 
ATOM   1629  N N     . GLU A 1 215 ? 74.141  156.312 39.163  1.00 20.22 ? 215  GLU A N     1 
ATOM   1630  C CA    . GLU A 1 215 ? 75.246  157.096 38.598  1.00 20.01 ? 215  GLU A CA    1 
ATOM   1631  C C     . GLU A 1 215 ? 74.832  158.506 38.243  1.00 18.98 ? 215  GLU A C     1 
ATOM   1632  O O     . GLU A 1 215 ? 75.656  159.420 38.298  1.00 18.74 ? 215  GLU A O     1 
ATOM   1633  C CB    . GLU A 1 215 ? 75.855  156.378 37.391  1.00 20.34 ? 215  GLU A CB    1 
ATOM   1634  C CG    . GLU A 1 215 ? 76.607  155.109 37.822  1.00 23.15 ? 215  GLU A CG    1 
ATOM   1635  C CD    . GLU A 1 215 ? 77.052  154.237 36.675  1.00 27.02 ? 215  GLU A CD    1 
ATOM   1636  O OE1   . GLU A 1 215 ? 77.423  153.083 36.953  1.00 31.02 ? 215  GLU A OE1   1 
ATOM   1637  O OE2   . GLU A 1 215 ? 77.044  154.693 35.509  1.00 27.90 ? 215  GLU A OE2   1 
ATOM   1638  N N     . HIS A 1 216 ? 73.553  158.687 37.905  1.00 18.14 ? 216  HIS A N     1 
ATOM   1639  C CA    . HIS A 1 216 ? 73.039  160.002 37.535  1.00 17.33 ? 216  HIS A CA    1 
ATOM   1640  C C     . HIS A 1 216 ? 71.634  160.266 38.037  1.00 17.89 ? 216  HIS A C     1 
ATOM   1641  O O     . HIS A 1 216 ? 70.852  159.339 38.311  1.00 17.44 ? 216  HIS A O     1 
ATOM   1642  C CB    . HIS A 1 216 ? 73.113  160.241 36.021  1.00 17.12 ? 216  HIS A CB    1 
ATOM   1643  C CG    . HIS A 1 216 ? 74.515  160.272 35.493  1.00 17.25 ? 216  HIS A CG    1 
ATOM   1644  N ND1   . HIS A 1 216 ? 75.351  161.349 35.670  1.00 20.23 ? 216  HIS A ND1   1 
ATOM   1645  C CD2   . HIS A 1 216 ? 75.237  159.347 34.824  1.00 18.17 ? 216  HIS A CD2   1 
ATOM   1646  C CE1   . HIS A 1 216 ? 76.523  161.104 35.108  1.00 18.72 ? 216  HIS A CE1   1 
ATOM   1647  N NE2   . HIS A 1 216 ? 76.484  159.889 34.593  1.00 20.28 ? 216  HIS A NE2   1 
ATOM   1648  N N     . VAL A 1 217 ? 71.351  161.554 38.185  1.00 17.49 ? 217  VAL A N     1 
ATOM   1649  C CA    . VAL A 1 217 ? 70.030  162.022 38.483  1.00 17.49 ? 217  VAL A CA    1 
ATOM   1650  C C     . VAL A 1 217 ? 69.673  163.039 37.400  1.00 18.05 ? 217  VAL A C     1 
ATOM   1651  O O     . VAL A 1 217 ? 70.372  164.036 37.214  1.00 18.30 ? 217  VAL A O     1 
ATOM   1652  C CB    . VAL A 1 217 ? 69.958  162.642 39.905  1.00 16.96 ? 217  VAL A CB    1 
ATOM   1653  C CG1   . VAL A 1 217 ? 68.551  163.138 40.191  1.00 16.75 ? 217  VAL A CG1   1 
ATOM   1654  C CG2   . VAL A 1 217 ? 70.384  161.602 40.957  1.00 16.03 ? 217  VAL A CG2   1 
ATOM   1655  N N     . ILE A 1 218 ? 68.598  162.759 36.671  1.00 18.70 ? 218  ILE A N     1 
ATOM   1656  C CA    . ILE A 1 218 ? 68.042  163.699 35.694  1.00 18.58 ? 218  ILE A CA    1 
ATOM   1657  C C     . ILE A 1 218 ? 66.921  164.466 36.369  1.00 19.28 ? 218  ILE A C     1 
ATOM   1658  O O     . ILE A 1 218 ? 65.992  163.879 36.917  1.00 19.02 ? 218  ILE A O     1 
ATOM   1659  C CB    . ILE A 1 218 ? 67.535  162.995 34.408  1.00 18.68 ? 218  ILE A CB    1 
ATOM   1660  C CG1   . ILE A 1 218 ? 68.725  162.343 33.674  1.00 17.49 ? 218  ILE A CG1   1 
ATOM   1661  C CG2   . ILE A 1 218 ? 66.758  163.992 33.501  1.00 17.87 ? 218  ILE A CG2   1 
ATOM   1662  C CD1   . ILE A 1 218 ? 68.339  161.597 32.400  1.00 18.54 ? 218  ILE A CD1   1 
ATOM   1663  N N     . VAL A 1 219 ? 67.034  165.792 36.328  1.00 20.03 ? 219  VAL A N     1 
ATOM   1664  C CA    . VAL A 1 219 ? 66.132  166.660 37.051  1.00 20.03 ? 219  VAL A CA    1 
ATOM   1665  C C     . VAL A 1 219 ? 65.403  167.504 36.028  1.00 20.21 ? 219  VAL A C     1 
ATOM   1666  O O     . VAL A 1 219 ? 66.025  168.138 35.152  1.00 20.40 ? 219  VAL A O     1 
ATOM   1667  C CB    . VAL A 1 219 ? 66.887  167.565 38.058  1.00 19.93 ? 219  VAL A CB    1 
ATOM   1668  C CG1   . VAL A 1 219 ? 65.913  168.257 38.977  1.00 19.15 ? 219  VAL A CG1   1 
ATOM   1669  C CG2   . VAL A 1 219 ? 67.906  166.748 38.861  1.00 20.06 ? 219  VAL A CG2   1 
ATOM   1670  N N     . LEU A 1 220 ? 64.076  167.476 36.120  1.00 20.09 ? 220  LEU A N     1 
ATOM   1671  C CA    . LEU A 1 220 ? 63.235  168.402 35.387  1.00 19.92 ? 220  LEU A CA    1 
ATOM   1672  C C     . LEU A 1 220 ? 62.986  169.649 36.239  1.00 19.73 ? 220  LEU A C     1 
ATOM   1673  O O     . LEU A 1 220 ? 62.530  169.540 37.372  1.00 18.73 ? 220  LEU A O     1 
ATOM   1674  C CB    . LEU A 1 220 ? 61.881  167.742 35.053  1.00 19.77 ? 220  LEU A CB    1 
ATOM   1675  C CG    . LEU A 1 220 ? 60.854  168.697 34.420  1.00 19.05 ? 220  LEU A CG    1 
ATOM   1676  C CD1   . LEU A 1 220 ? 61.177  168.947 32.931  1.00 19.35 ? 220  LEU A CD1   1 
ATOM   1677  C CD2   . LEU A 1 220 ? 59.413  168.176 34.595  1.00 19.87 ? 220  LEU A CD2   1 
ATOM   1678  N N     . LYS A 1 221 ? 63.259  170.826 35.687  1.00 20.18 ? 221  LYS A N     1 
ATOM   1679  C CA    . LYS A 1 221 ? 62.873  172.077 36.333  1.00 21.00 ? 221  LYS A CA    1 
ATOM   1680  C C     . LYS A 1 221 ? 61.367  172.321 36.247  1.00 20.81 ? 221  LYS A C     1 
ATOM   1681  O O     . LYS A 1 221 ? 60.867  172.826 35.244  1.00 21.35 ? 221  LYS A O     1 
ATOM   1682  C CB    . LYS A 1 221 ? 63.637  173.249 35.700  1.00 21.13 ? 221  LYS A CB    1 
ATOM   1683  C CG    . LYS A 1 221 ? 63.451  174.586 36.363  1.00 22.21 ? 221  LYS A CG    1 
ATOM   1684  C CD    . LYS A 1 221 ? 64.430  175.621 35.787  1.00 23.98 ? 221  LYS A CD    1 
ATOM   1685  C CE    . LYS A 1 221 ? 65.617  175.820 36.719  1.00 30.29 ? 221  LYS A CE    1 
ATOM   1686  N NZ    . LYS A 1 221 ? 66.901  176.260 36.027  1.00 36.20 ? 221  LYS A NZ    1 
ATOM   1687  N N     . ARG A 1 222 ? 60.635  172.003 37.315  1.00 20.60 ? 222  ARG A N     1 
ATOM   1688  C CA    . ARG A 1 222 ? 59.206  172.217 37.310  1.00 19.07 ? 222  ARG A CA    1 
ATOM   1689  C C     . ARG A 1 222 ? 58.805  173.507 38.023  1.00 19.04 ? 222  ARG A C     1 
ATOM   1690  O O     . ARG A 1 222 ? 57.804  174.122 37.663  1.00 19.05 ? 222  ARG A O     1 
ATOM   1691  C CB    . ARG A 1 222 ? 58.456  171.009 37.890  1.00 18.95 ? 222  ARG A CB    1 
ATOM   1692  C CG    . ARG A 1 222 ? 56.932  171.221 38.097  1.00 18.71 ? 222  ARG A CG    1 
ATOM   1693  C CD    . ARG A 1 222 ? 56.154  171.402 36.765  1.00 16.12 ? 222  ARG A CD    1 
ATOM   1694  N NE    . ARG A 1 222 ? 54.756  171.767 37.021  1.00 17.87 ? 222  ARG A NE    1 
ATOM   1695  C CZ    . ARG A 1 222 ? 54.295  173.006 37.163  1.00 16.75 ? 222  ARG A CZ    1 
ATOM   1696  N NH1   . ARG A 1 222 ? 55.107  174.059 37.067  1.00 17.18 ? 222  ARG A NH1   1 
ATOM   1697  N NH2   . ARG A 1 222 ? 52.997  173.202 37.378  1.00 18.65 ? 222  ARG A NH2   1 
ATOM   1698  N N     . THR A 1 223 ? 59.557  173.904 39.045  1.00 18.48 ? 223  THR A N     1 
ATOM   1699  C CA    . THR A 1 223 ? 59.203  175.085 39.848  1.00 18.17 ? 223  THR A CA    1 
ATOM   1700  C C     . THR A 1 223 ? 60.328  176.106 39.945  1.00 18.38 ? 223  THR A C     1 
ATOM   1701  O O     . THR A 1 223 ? 60.095  177.228 40.357  1.00 18.68 ? 223  THR A O     1 
ATOM   1702  C CB    . THR A 1 223 ? 58.771  174.702 41.287  1.00 18.45 ? 223  THR A CB    1 
ATOM   1703  O OG1   . THR A 1 223 ? 59.896  174.165 41.997  1.00 18.97 ? 223  THR A OG1   1 
ATOM   1704  C CG2   . THR A 1 223 ? 57.610  173.684 41.269  1.00 17.09 ? 223  THR A CG2   1 
ATOM   1705  N N     . GLY A 1 224 ? 61.548  175.716 39.587  1.00 18.67 ? 224  GLY A N     1 
ATOM   1706  C CA    . GLY A 1 224 ? 62.704  176.601 39.705  1.00 19.91 ? 224  GLY A CA    1 
ATOM   1707  C C     . GLY A 1 224 ? 63.122  176.893 41.140  1.00 21.12 ? 224  GLY A C     1 
ATOM   1708  O O     . GLY A 1 224 ? 63.821  177.881 41.393  1.00 20.36 ? 224  GLY A O     1 
ATOM   1709  N N     . SER A 1 225 ? 62.701  176.047 42.091  1.00 22.38 ? 225  SER A N     1 
ATOM   1710  C CA    . SER A 1 225 ? 63.194  176.180 43.465  1.00 24.30 ? 225  SER A CA    1 
ATOM   1711  C C     . SER A 1 225 ? 64.705  175.974 43.560  1.00 25.07 ? 225  SER A C     1 
ATOM   1712  O O     . SER A 1 225 ? 65.325  175.334 42.695  1.00 24.30 ? 225  SER A O     1 
ATOM   1713  C CB    . SER A 1 225 ? 62.467  175.225 44.393  1.00 24.84 ? 225  SER A CB    1 
ATOM   1714  O OG    . SER A 1 225 ? 61.197  175.777 44.755  1.00 28.31 ? 225  SER A OG    1 
ATOM   1715  N N     . ASP A 1 226 ? 65.291  176.538 44.607  1.00 26.68 ? 226  ASP A N     1 
ATOM   1716  C CA    . ASP A 1 226 ? 66.720  176.413 44.854  1.00 28.36 ? 226  ASP A CA    1 
ATOM   1717  C C     . ASP A 1 226 ? 66.983  174.986 45.275  1.00 28.14 ? 226  ASP A C     1 
ATOM   1718  O O     . ASP A 1 226 ? 66.476  174.535 46.279  1.00 29.05 ? 226  ASP A O     1 
ATOM   1719  C CB    . ASP A 1 226 ? 67.160  177.349 45.983  1.00 29.40 ? 226  ASP A CB    1 
ATOM   1720  C CG    . ASP A 1 226 ? 67.182  178.812 45.565  1.00 32.68 ? 226  ASP A CG    1 
ATOM   1721  O OD1   . ASP A 1 226 ? 67.790  179.131 44.514  1.00 35.98 ? 226  ASP A OD1   1 
ATOM   1722  O OD2   . ASP A 1 226 ? 66.614  179.648 46.308  1.00 36.88 ? 226  ASP A OD2   1 
ATOM   1723  N N     . ILE A 1 227 ? 67.743  174.250 44.492  1.00 28.17 ? 227  ILE A N     1 
ATOM   1724  C CA    . ILE A 1 227 ? 68.072  172.900 44.917  1.00 27.48 ? 227  ILE A CA    1 
ATOM   1725  C C     . ILE A 1 227 ? 69.581  172.798 45.075  1.00 27.96 ? 227  ILE A C     1 
ATOM   1726  O O     . ILE A 1 227 ? 70.321  173.648 44.577  1.00 27.55 ? 227  ILE A O     1 
ATOM   1727  C CB    . ILE A 1 227 ? 67.493  171.830 43.953  1.00 27.60 ? 227  ILE A CB    1 
ATOM   1728  C CG1   . ILE A 1 227 ? 67.958  172.077 42.511  1.00 26.91 ? 227  ILE A CG1   1 
ATOM   1729  C CG2   . ILE A 1 227 ? 65.929  171.759 44.055  1.00 24.70 ? 227  ILE A CG2   1 
ATOM   1730  C CD1   . ILE A 1 227 ? 67.568  170.941 41.564  1.00 26.92 ? 227  ILE A CD1   1 
ATOM   1731  N N     . ASP A 1 228 ? 70.036  171.790 45.810  1.00 28.28 ? 228  ASP A N     1 
ATOM   1732  C CA    . ASP A 1 228 ? 71.449  171.473 45.829  1.00 27.79 ? 228  ASP A CA    1 
ATOM   1733  C C     . ASP A 1 228 ? 71.715  170.698 44.548  1.00 28.13 ? 228  ASP A C     1 
ATOM   1734  O O     . ASP A 1 228 ? 70.857  169.932 44.080  1.00 28.21 ? 228  ASP A O     1 
ATOM   1735  C CB    . ASP A 1 228 ? 71.822  170.675 47.082  1.00 28.18 ? 228  ASP A CB    1 
ATOM   1736  C CG    . ASP A 1 228 ? 71.417  171.395 48.380  1.00 28.09 ? 228  ASP A CG    1 
ATOM   1737  O OD1   . ASP A 1 228 ? 70.762  170.768 49.240  1.00 28.18 ? 228  ASP A OD1   1 
ATOM   1738  O OD2   . ASP A 1 228 ? 71.719  172.596 48.523  1.00 28.18 ? 228  ASP A OD2   1 
ATOM   1739  N N     . TRP A 1 229 ? 72.879  170.948 43.966  1.00 27.59 ? 229  TRP A N     1 
ATOM   1740  C CA    . TRP A 1 229 ? 73.287  170.369 42.714  1.00 28.17 ? 229  TRP A CA    1 
ATOM   1741  C C     . TRP A 1 229 ? 74.638  169.691 42.900  1.00 28.95 ? 229  TRP A C     1 
ATOM   1742  O O     . TRP A 1 229 ? 75.589  170.308 43.399  1.00 29.05 ? 229  TRP A O     1 
ATOM   1743  C CB    . TRP A 1 229 ? 73.393  171.467 41.660  1.00 27.75 ? 229  TRP A CB    1 
ATOM   1744  C CG    . TRP A 1 229 ? 73.378  170.943 40.248  1.00 28.22 ? 229  TRP A CG    1 
ATOM   1745  C CD1   . TRP A 1 229 ? 74.451  170.824 39.398  1.00 27.74 ? 229  TRP A CD1   1 
ATOM   1746  C CD2   . TRP A 1 229 ? 72.236  170.466 39.520  1.00 26.86 ? 229  TRP A CD2   1 
ATOM   1747  N NE1   . TRP A 1 229 ? 74.043  170.301 38.193  1.00 27.53 ? 229  TRP A NE1   1 
ATOM   1748  C CE2   . TRP A 1 229 ? 72.688  170.081 38.238  1.00 28.32 ? 229  TRP A CE2   1 
ATOM   1749  C CE3   . TRP A 1 229 ? 70.876  170.337 39.822  1.00 27.92 ? 229  TRP A CE3   1 
ATOM   1750  C CZ2   . TRP A 1 229 ? 71.822  169.562 37.263  1.00 28.09 ? 229  TRP A CZ2   1 
ATOM   1751  C CZ3   . TRP A 1 229 ? 70.021  169.820 38.860  1.00 26.73 ? 229  TRP A CZ3   1 
ATOM   1752  C CH2   . TRP A 1 229 ? 70.497  169.439 37.599  1.00 27.99 ? 229  TRP A CH2   1 
ATOM   1753  N N     . GLN A 1 230 ? 74.720  168.420 42.518  1.00 29.30 ? 230  GLN A N     1 
ATOM   1754  C CA    . GLN A 1 230 ? 76.005  167.745 42.453  1.00 30.08 ? 230  GLN A CA    1 
ATOM   1755  C C     . GLN A 1 230 ? 76.448  167.696 40.993  1.00 30.50 ? 230  GLN A C     1 
ATOM   1756  O O     . GLN A 1 230 ? 75.833  167.001 40.176  1.00 31.02 ? 230  GLN A O     1 
ATOM   1757  C CB    . GLN A 1 230 ? 75.919  166.349 43.062  1.00 29.99 ? 230  GLN A CB    1 
ATOM   1758  C CG    . GLN A 1 230 ? 77.271  165.634 43.147  1.00 31.46 ? 230  GLN A CG    1 
ATOM   1759  C CD    . GLN A 1 230 ? 77.185  164.276 43.804  1.00 31.14 ? 230  GLN A CD    1 
ATOM   1760  O OE1   . GLN A 1 230 ? 76.556  164.116 44.854  1.00 33.75 ? 230  GLN A OE1   1 
ATOM   1761  N NE2   . GLN A 1 230 ? 77.827  163.283 43.196  1.00 32.13 ? 230  GLN A NE2   1 
ATOM   1762  N N     . GLU A 1 231 ? 77.499  168.453 40.663  1.00 30.83 ? 231  GLU A N     1 
ATOM   1763  C CA    . GLU A 1 231 ? 77.988  168.546 39.294  1.00 30.93 ? 231  GLU A CA    1 
ATOM   1764  C C     . GLU A 1 231 ? 78.475  167.188 38.841  1.00 30.00 ? 231  GLU A C     1 
ATOM   1765  O O     . GLU A 1 231 ? 79.187  166.499 39.573  1.00 29.95 ? 231  GLU A O     1 
ATOM   1766  C CB    . GLU A 1 231 ? 79.121  169.582 39.156  1.00 32.00 ? 231  GLU A CB    1 
ATOM   1767  C CG    . GLU A 1 231 ? 79.110  170.308 37.814  1.00 34.50 ? 231  GLU A CG    1 
ATOM   1768  C CD    . GLU A 1 231 ? 77.849  171.136 37.632  1.00 39.32 ? 231  GLU A CD    1 
ATOM   1769  O OE1   . GLU A 1 231 ? 77.729  172.199 38.292  1.00 40.46 ? 231  GLU A OE1   1 
ATOM   1770  O OE2   . GLU A 1 231 ? 76.959  170.711 36.848  1.00 42.73 ? 231  GLU A OE2   1 
ATOM   1771  N N     . GLY A 1 232 ? 78.068  166.794 37.639  1.00 29.16 ? 232  GLY A N     1 
ATOM   1772  C CA    . GLY A 1 232 ? 78.433  165.489 37.117  1.00 28.07 ? 232  GLY A CA    1 
ATOM   1773  C C     . GLY A 1 232 ? 77.273  164.526 37.273  1.00 27.05 ? 232  GLY A C     1 
ATOM   1774  O O     . GLY A 1 232 ? 76.732  164.054 36.270  1.00 27.37 ? 232  GLY A O     1 
ATOM   1775  N N     . ARG A 1 233 ? 76.900  164.240 38.524  1.00 25.38 ? 233  ARG A N     1 
ATOM   1776  C CA    . ARG A 1 233 ? 75.791  163.329 38.822  1.00 24.03 ? 233  ARG A CA    1 
ATOM   1777  C C     . ARG A 1 233 ? 74.470  163.887 38.275  1.00 22.90 ? 233  ARG A C     1 
ATOM   1778  O O     . ARG A 1 233 ? 73.798  163.243 37.461  1.00 22.38 ? 233  ARG A O     1 
ATOM   1779  C CB    . ARG A 1 233 ? 75.685  163.065 40.337  1.00 23.80 ? 233  ARG A CB    1 
ATOM   1780  C CG    . ARG A 1 233 ? 74.777  161.868 40.707  1.00 23.81 ? 233  ARG A CG    1 
ATOM   1781  C CD    . ARG A 1 233 ? 74.379  161.906 42.187  1.00 24.06 ? 233  ARG A CD    1 
ATOM   1782  N NE    . ARG A 1 233 ? 73.556  163.082 42.509  1.00 23.53 ? 233  ARG A NE    1 
ATOM   1783  C CZ    . ARG A 1 233 ? 73.177  163.427 43.732  1.00 23.51 ? 233  ARG A CZ    1 
ATOM   1784  N NH1   . ARG A 1 233 ? 73.529  162.691 44.776  1.00 24.29 ? 233  ARG A NH1   1 
ATOM   1785  N NH2   . ARG A 1 233 ? 72.439  164.510 43.915  1.00 21.49 ? 233  ARG A NH2   1 
ATOM   1786  N N     . ASP A 1 234 ? 74.141  165.100 38.710  1.00 21.85 ? 234  ASP A N     1 
ATOM   1787  C CA    . ASP A 1 234 ? 72.881  165.767 38.391  1.00 21.56 ? 234  ASP A CA    1 
ATOM   1788  C C     . ASP A 1 234 ? 72.926  166.399 37.003  1.00 21.85 ? 234  ASP A C     1 
ATOM   1789  O O     . ASP A 1 234 ? 73.920  167.006 36.643  1.00 21.79 ? 234  ASP A O     1 
ATOM   1790  C CB    . ASP A 1 234 ? 72.519  166.789 39.492  1.00 20.67 ? 234  ASP A CB    1 
ATOM   1791  C CG    . ASP A 1 234 ? 72.385  166.133 40.889  1.00 20.94 ? 234  ASP A CG    1 
ATOM   1792  O OD1   . ASP A 1 234 ? 72.200  164.893 40.945  1.00 18.49 ? 234  ASP A OD1   1 
ATOM   1793  O OD2   . ASP A 1 234 ? 72.451  166.841 41.932  1.00 19.11 ? 234  ASP A OD2   1 
ATOM   1794  N N     . LEU A 1 235 ? 71.838  166.241 36.236  1.00 22.14 ? 235  LEU A N     1 
ATOM   1795  C CA    . LEU A 1 235 ? 71.728  166.747 34.857  1.00 21.81 ? 235  LEU A CA    1 
ATOM   1796  C C     . LEU A 1 235 ? 70.326  167.316 34.625  1.00 22.17 ? 235  LEU A C     1 
ATOM   1797  O O     . LEU A 1 235 ? 69.353  166.688 35.012  1.00 22.53 ? 235  LEU A O     1 
ATOM   1798  C CB    . LEU A 1 235 ? 71.991  165.602 33.860  1.00 21.90 ? 235  LEU A CB    1 
ATOM   1799  C CG    . LEU A 1 235 ? 73.338  164.860 33.972  1.00 20.99 ? 235  LEU A CG    1 
ATOM   1800  C CD1   . LEU A 1 235 ? 73.285  163.531 33.238  1.00 22.04 ? 235  LEU A CD1   1 
ATOM   1801  C CD2   . LEU A 1 235 ? 74.455  165.738 33.424  1.00 20.68 ? 235  LEU A CD2   1 
ATOM   1802  N N     . TRP A 1 236 ? 70.212  168.497 34.014  1.00 22.10 ? 236  TRP A N     1 
ATOM   1803  C CA    . TRP A 1 236 ? 68.900  169.055 33.720  1.00 22.59 ? 236  TRP A CA    1 
ATOM   1804  C C     . TRP A 1 236 ? 68.280  168.340 32.521  1.00 22.89 ? 236  TRP A C     1 
ATOM   1805  O O     . TRP A 1 236 ? 68.952  168.077 31.514  1.00 22.97 ? 236  TRP A O     1 
ATOM   1806  C CB    . TRP A 1 236 ? 68.918  170.581 33.462  1.00 22.37 ? 236  TRP A CB    1 
ATOM   1807  C CG    . TRP A 1 236 ? 69.237  171.449 34.663  1.00 23.43 ? 236  TRP A CG    1 
ATOM   1808  C CD1   . TRP A 1 236 ? 70.393  172.172 34.870  1.00 23.57 ? 236  TRP A CD1   1 
ATOM   1809  C CD2   . TRP A 1 236 ? 68.401  171.709 35.812  1.00 21.74 ? 236  TRP A CD2   1 
ATOM   1810  N NE1   . TRP A 1 236 ? 70.316  172.863 36.064  1.00 22.43 ? 236  TRP A NE1   1 
ATOM   1811  C CE2   . TRP A 1 236 ? 69.117  172.587 36.662  1.00 23.28 ? 236  TRP A CE2   1 
ATOM   1812  C CE3   . TRP A 1 236 ? 67.132  171.277 36.206  1.00 21.54 ? 236  TRP A CE3   1 
ATOM   1813  C CZ2   . TRP A 1 236 ? 68.601  173.035 37.879  1.00 24.03 ? 236  TRP A CZ2   1 
ATOM   1814  C CZ3   . TRP A 1 236 ? 66.618  171.726 37.401  1.00 22.62 ? 236  TRP A CZ3   1 
ATOM   1815  C CH2   . TRP A 1 236 ? 67.343  172.602 38.224  1.00 23.20 ? 236  TRP A CH2   1 
ATOM   1816  N N     . TRP A 1 237 ? 66.993  168.037 32.648  1.00 23.24 ? 237  TRP A N     1 
ATOM   1817  C CA    . TRP A 1 237 ? 66.207  167.418 31.586  1.00 24.35 ? 237  TRP A CA    1 
ATOM   1818  C C     . TRP A 1 237 ? 66.313  168.210 30.268  1.00 25.55 ? 237  TRP A C     1 
ATOM   1819  O O     . TRP A 1 237 ? 66.677  167.645 29.226  1.00 25.99 ? 237  TRP A O     1 
ATOM   1820  C CB    . TRP A 1 237 ? 64.749  167.263 32.042  1.00 23.11 ? 237  TRP A CB    1 
ATOM   1821  C CG    . TRP A 1 237 ? 63.794  166.750 30.990  1.00 22.50 ? 237  TRP A CG    1 
ATOM   1822  C CD1   . TRP A 1 237 ? 63.380  167.418 29.877  1.00 23.30 ? 237  TRP A CD1   1 
ATOM   1823  C CD2   . TRP A 1 237 ? 63.111  165.487 30.972  1.00 20.47 ? 237  TRP A CD2   1 
ATOM   1824  N NE1   . TRP A 1 237 ? 62.491  166.653 29.161  1.00 23.52 ? 237  TRP A NE1   1 
ATOM   1825  C CE2   . TRP A 1 237 ? 62.319  165.455 29.799  1.00 22.47 ? 237  TRP A CE2   1 
ATOM   1826  C CE3   . TRP A 1 237 ? 63.082  164.381 31.835  1.00 22.58 ? 237  TRP A CE3   1 
ATOM   1827  C CZ2   . TRP A 1 237 ? 61.510  164.355 29.455  1.00 21.81 ? 237  TRP A CZ2   1 
ATOM   1828  C CZ3   . TRP A 1 237 ? 62.274  163.285 31.494  1.00 22.20 ? 237  TRP A CZ3   1 
ATOM   1829  C CH2   . TRP A 1 237 ? 61.497  163.291 30.314  1.00 21.69 ? 237  TRP A CH2   1 
ATOM   1830  N N     . ARG A 1 238 ? 65.997  169.502 30.328  1.00 26.73 ? 238  ARG A N     1 
ATOM   1831  C CA    . ARG A 1 238 ? 66.082  170.412 29.181  1.00 28.49 ? 238  ARG A CA    1 
ATOM   1832  C C     . ARG A 1 238 ? 67.454  170.375 28.500  1.00 28.24 ? 238  ARG A C     1 
ATOM   1833  O O     . ARG A 1 238 ? 67.513  170.270 27.284  1.00 27.84 ? 238  ARG A O     1 
ATOM   1834  C CB    . ARG A 1 238 ? 65.753  171.848 29.608  1.00 29.42 ? 238  ARG A CB    1 
ATOM   1835  C CG    . ARG A 1 238 ? 65.619  172.856 28.463  1.00 33.66 ? 238  ARG A CG    1 
ATOM   1836  C CD    . ARG A 1 238 ? 65.937  174.270 28.961  1.00 40.17 ? 238  ARG A CD    1 
ATOM   1837  N NE    . ARG A 1 238 ? 65.870  175.293 27.915  1.00 44.38 ? 238  ARG A NE    1 
ATOM   1838  C CZ    . ARG A 1 238 ? 64.820  176.088 27.695  1.00 46.67 ? 238  ARG A CZ    1 
ATOM   1839  N NH1   . ARG A 1 238 ? 63.717  175.996 28.438  1.00 46.87 ? 238  ARG A NH1   1 
ATOM   1840  N NH2   . ARG A 1 238 ? 64.869  176.984 26.720  1.00 48.29 ? 238  ARG A NH2   1 
ATOM   1841  N N     . ASP A 1 239 ? 68.543  170.449 29.276  1.00 28.32 ? 239  ASP A N     1 
ATOM   1842  C CA    . ASP A 1 239 ? 69.905  170.358 28.707  1.00 28.77 ? 239  ASP A CA    1 
ATOM   1843  C C     . ASP A 1 239 ? 70.110  169.079 27.880  1.00 28.58 ? 239  ASP A C     1 
ATOM   1844  O O     . ASP A 1 239 ? 70.656  169.127 26.778  1.00 28.72 ? 239  ASP A O     1 
ATOM   1845  C CB    . ASP A 1 239 ? 70.987  170.427 29.799  1.00 29.05 ? 239  ASP A CB    1 
ATOM   1846  C CG    . ASP A 1 239 ? 71.067  171.796 30.492  1.00 30.06 ? 239  ASP A CG    1 
ATOM   1847  O OD1   . ASP A 1 239 ? 70.446  172.780 30.025  1.00 30.57 ? 239  ASP A OD1   1 
ATOM   1848  O OD2   . ASP A 1 239 ? 71.773  171.873 31.522  1.00 31.11 ? 239  ASP A OD2   1 
ATOM   1849  N N     . LEU A 1 240 ? 69.667  167.942 28.418  1.00 27.87 ? 240  LEU A N     1 
ATOM   1850  C CA    . LEU A 1 240 ? 69.881  166.659 27.764  1.00 27.55 ? 240  LEU A CA    1 
ATOM   1851  C C     . LEU A 1 240 ? 69.023  166.435 26.522  1.00 27.84 ? 240  LEU A C     1 
ATOM   1852  O O     . LEU A 1 240 ? 69.533  166.010 25.491  1.00 27.70 ? 240  LEU A O     1 
ATOM   1853  C CB    . LEU A 1 240 ? 69.689  165.493 28.742  1.00 27.04 ? 240  LEU A CB    1 
ATOM   1854  C CG    . LEU A 1 240 ? 70.697  165.273 29.867  1.00 25.72 ? 240  LEU A CG    1 
ATOM   1855  C CD1   . LEU A 1 240 ? 70.199  164.122 30.735  1.00 26.06 ? 240  LEU A CD1   1 
ATOM   1856  C CD2   . LEU A 1 240 ? 72.091  164.985 29.358  1.00 24.97 ? 240  LEU A CD2   1 
ATOM   1857  N N     . ILE A 1 241 ? 67.726  166.704 26.629  1.00 28.49 ? 241  ILE A N     1 
ATOM   1858  C CA    . ILE A 1 241 ? 66.782  166.316 25.591  1.00 29.09 ? 241  ILE A CA    1 
ATOM   1859  C C     . ILE A 1 241 ? 67.001  167.163 24.336  1.00 30.29 ? 241  ILE A C     1 
ATOM   1860  O O     . ILE A 1 241 ? 66.837  166.677 23.208  1.00 30.15 ? 241  ILE A O     1 
ATOM   1861  C CB    . ILE A 1 241 ? 65.292  166.327 26.093  1.00 28.64 ? 241  ILE A CB    1 
ATOM   1862  C CG1   . ILE A 1 241 ? 64.401  165.484 25.166  1.00 28.83 ? 241  ILE A CG1   1 
ATOM   1863  C CG2   . ILE A 1 241 ? 64.747  167.769 26.289  1.00 27.39 ? 241  ILE A CG2   1 
ATOM   1864  C CD1   . ILE A 1 241 ? 63.009  165.092 25.761  1.00 29.06 ? 241  ILE A CD1   1 
ATOM   1865  N N     . GLU A 1 242 ? 67.401  168.416 24.551  1.00 31.29 ? 242  GLU A N     1 
ATOM   1866  C CA    . GLU A 1 242 ? 67.673  169.352 23.461  1.00 33.35 ? 242  GLU A CA    1 
ATOM   1867  C C     . GLU A 1 242 ? 68.953  169.008 22.686  1.00 33.06 ? 242  GLU A C     1 
ATOM   1868  O O     . GLU A 1 242 ? 69.107  169.439 21.555  1.00 33.86 ? 242  GLU A O     1 
ATOM   1869  C CB    . GLU A 1 242 ? 67.647  170.815 23.954  1.00 32.85 ? 242  GLU A CB    1 
ATOM   1870  C CG    . GLU A 1 242 ? 66.243  171.254 24.412  1.00 34.69 ? 242  GLU A CG    1 
ATOM   1871  C CD    . GLU A 1 242 ? 66.136  172.741 24.787  1.00 36.14 ? 242  GLU A CD    1 
ATOM   1872  O OE1   . GLU A 1 242 ? 67.191  173.426 24.874  1.00 39.40 ? 242  GLU A OE1   1 
ATOM   1873  O OE2   . GLU A 1 242 ? 64.984  173.220 25.002  1.00 37.89 ? 242  GLU A OE2   1 
ATOM   1874  N N     . LYS A 1 243 ? 69.850  168.220 23.271  1.00 33.27 ? 243  LYS A N     1 
ATOM   1875  C CA    . LYS A 1 243 ? 71.058  167.781 22.552  1.00 33.38 ? 243  LYS A CA    1 
ATOM   1876  C C     . LYS A 1 243 ? 70.820  166.466 21.795  1.00 33.69 ? 243  LYS A C     1 
ATOM   1877  O O     . LYS A 1 243 ? 71.578  166.112 20.882  1.00 33.63 ? 243  LYS A O     1 
ATOM   1878  C CB    . LYS A 1 243 ? 72.254  167.639 23.502  1.00 33.24 ? 243  LYS A CB    1 
ATOM   1879  N N     . ALA A 1 244 ? 69.751  165.758 22.162  1.00 33.43 ? 244  ALA A N     1 
ATOM   1880  C CA    . ALA A 1 244 ? 69.475  164.446 21.598  1.00 32.79 ? 244  ALA A CA    1 
ATOM   1881  C C     . ALA A 1 244 ? 68.767  164.511 20.253  1.00 32.39 ? 244  ALA A C     1 
ATOM   1882  O O     . ALA A 1 244 ? 67.900  165.353 20.018  1.00 32.03 ? 244  ALA A O     1 
ATOM   1883  C CB    . ALA A 1 244 ? 68.694  163.584 22.579  1.00 33.01 ? 244  ALA A CB    1 
ATOM   1884  N N     . SER A 1 245 ? 69.175  163.602 19.375  1.00 31.83 ? 245  SER A N     1 
ATOM   1885  C CA    . SER A 1 245 ? 68.534  163.375 18.095  1.00 31.24 ? 245  SER A CA    1 
ATOM   1886  C C     . SER A 1 245 ? 67.097  162.881 18.282  1.00 30.73 ? 245  SER A C     1 
ATOM   1887  O O     . SER A 1 245 ? 66.856  162.003 19.116  1.00 30.79 ? 245  SER A O     1 
ATOM   1888  C CB    . SER A 1 245 ? 69.355  162.340 17.326  1.00 31.19 ? 245  SER A CB    1 
ATOM   1889  O OG    . SER A 1 245 ? 68.541  161.624 16.433  1.00 31.83 ? 245  SER A OG    1 
ATOM   1890  N N     . PRO A 1 246 ? 66.137  163.439 17.512  1.00 30.50 ? 246  PRO A N     1 
ATOM   1891  C CA    . PRO A 1 246 ? 64.738  163.000 17.573  1.00 30.41 ? 246  PRO A CA    1 
ATOM   1892  C C     . PRO A 1 246 ? 64.454  161.762 16.734  1.00 30.20 ? 246  PRO A C     1 
ATOM   1893  O O     . PRO A 1 246 ? 63.296  161.362 16.637  1.00 30.14 ? 246  PRO A O     1 
ATOM   1894  C CB    . PRO A 1 246 ? 63.984  164.182 16.952  1.00 30.50 ? 246  PRO A CB    1 
ATOM   1895  C CG    . PRO A 1 246 ? 64.925  164.662 15.896  1.00 30.21 ? 246  PRO A CG    1 
ATOM   1896  C CD    . PRO A 1 246 ? 66.308  164.526 16.524  1.00 30.79 ? 246  PRO A CD    1 
ATOM   1897  N N     . GLU A 1 247 ? 65.485  161.189 16.105  1.00 30.20 ? 247  GLU A N     1 
ATOM   1898  C CA    . GLU A 1 247 ? 65.322  159.960 15.322  1.00 30.48 ? 247  GLU A CA    1 
ATOM   1899  C C     . GLU A 1 247 ? 65.780  158.755 16.137  1.00 29.45 ? 247  GLU A C     1 
ATOM   1900  O O     . GLU A 1 247 ? 66.943  158.683 16.584  1.00 29.07 ? 247  GLU A O     1 
ATOM   1901  C CB    . GLU A 1 247 ? 66.039  160.027 13.958  1.00 31.04 ? 247  GLU A CB    1 
ATOM   1902  C CG    . GLU A 1 247 ? 65.724  161.278 13.084  1.00 34.89 ? 247  GLU A CG    1 
ATOM   1903  C CD    . GLU A 1 247 ? 64.216  161.535 12.832  1.00 41.49 ? 247  GLU A CD    1 
ATOM   1904  O OE1   . GLU A 1 247 ? 63.424  160.556 12.676  1.00 44.18 ? 247  GLU A OE1   1 
ATOM   1905  O OE2   . GLU A 1 247 ? 63.820  162.738 12.770  1.00 42.58 ? 247  GLU A OE2   1 
ATOM   1906  N N     . HIS A 1 248 ? 64.843  157.843 16.381  1.00 28.01 ? 248  HIS A N     1 
ATOM   1907  C CA    . HIS A 1 248 ? 65.150  156.609 17.108  1.00 27.21 ? 248  HIS A CA    1 
ATOM   1908  C C     . HIS A 1 248 ? 64.371  155.415 16.571  1.00 27.25 ? 248  HIS A C     1 
ATOM   1909  O O     . HIS A 1 248 ? 63.154  155.451 16.488  1.00 27.11 ? 248  HIS A O     1 
ATOM   1910  C CB    . HIS A 1 248 ? 64.953  156.744 18.626  1.00 26.56 ? 248  HIS A CB    1 
ATOM   1911  C CG    . HIS A 1 248 ? 65.321  155.503 19.369  1.00 25.30 ? 248  HIS A CG    1 
ATOM   1912  N ND1   . HIS A 1 248 ? 64.403  154.521 19.673  1.00 24.63 ? 248  HIS A ND1   1 
ATOM   1913  C CD2   . HIS A 1 248 ? 66.518  155.046 19.804  1.00 23.92 ? 248  HIS A CD2   1 
ATOM   1914  C CE1   . HIS A 1 248 ? 65.014  153.525 20.293  1.00 24.75 ? 248  HIS A CE1   1 
ATOM   1915  N NE2   . HIS A 1 248 ? 66.299  153.816 20.378  1.00 24.99 ? 248  HIS A NE2   1 
ATOM   1916  N N     . GLN A 1 249 ? 65.101  154.366 16.203  1.00 27.50 ? 249  GLN A N     1 
ATOM   1917  C CA    . GLN A 1 249 ? 64.522  153.138 15.674  1.00 28.21 ? 249  GLN A CA    1 
ATOM   1918  C C     . GLN A 1 249 ? 64.215  152.176 16.807  1.00 27.91 ? 249  GLN A C     1 
ATOM   1919  O O     . GLN A 1 249 ? 65.135  151.747 17.529  1.00 27.68 ? 249  GLN A O     1 
ATOM   1920  C CB    . GLN A 1 249 ? 65.486  152.481 14.671  1.00 28.77 ? 249  GLN A CB    1 
ATOM   1921  C CG    . GLN A 1 249 ? 65.675  153.323 13.382  1.00 32.06 ? 249  GLN A CG    1 
ATOM   1922  C CD    . GLN A 1 249 ? 64.336  153.797 12.817  1.00 35.91 ? 249  GLN A CD    1 
ATOM   1923  O OE1   . GLN A 1 249 ? 64.044  154.999 12.784  1.00 36.30 ? 249  GLN A OE1   1 
ATOM   1924  N NE2   . GLN A 1 249 ? 63.504  152.841 12.396  1.00 36.99 ? 249  GLN A NE2   1 
ATOM   1925  N N     . PRO A 1 250 ? 62.929  151.818 16.970  1.00 27.82 ? 250  PRO A N     1 
ATOM   1926  C CA    . PRO A 1 250 ? 62.630  150.941 18.088  1.00 28.40 ? 250  PRO A CA    1 
ATOM   1927  C C     . PRO A 1 250 ? 63.100  149.514 17.759  1.00 29.02 ? 250  PRO A C     1 
ATOM   1928  O O     . PRO A 1 250 ? 62.914  149.043 16.631  1.00 29.62 ? 250  PRO A O     1 
ATOM   1929  C CB    . PRO A 1 250 ? 61.104  151.018 18.221  1.00 27.57 ? 250  PRO A CB    1 
ATOM   1930  C CG    . PRO A 1 250 ? 60.602  151.506 16.924  1.00 28.34 ? 250  PRO A CG    1 
ATOM   1931  C CD    . PRO A 1 250 ? 61.740  152.131 16.156  1.00 27.84 ? 250  PRO A CD    1 
ATOM   1932  N N     . GLU A 1 251 ? 63.716  148.853 18.731  1.00 29.16 ? 251  GLU A N     1 
ATOM   1933  C CA    . GLU A 1 251 ? 64.142  147.463 18.568  1.00 29.20 ? 251  GLU A CA    1 
ATOM   1934  C C     . GLU A 1 251 ? 63.090  146.511 19.109  1.00 28.30 ? 251  GLU A C     1 
ATOM   1935  O O     . GLU A 1 251 ? 62.255  146.894 19.939  1.00 28.40 ? 251  GLU A O     1 
ATOM   1936  C CB    . GLU A 1 251 ? 65.449  147.223 19.309  1.00 29.57 ? 251  GLU A CB    1 
ATOM   1937  C CG    . GLU A 1 251 ? 66.636  148.035 18.783  1.00 33.74 ? 251  GLU A CG    1 
ATOM   1938  C CD    . GLU A 1 251 ? 67.204  147.468 17.501  1.00 37.88 ? 251  GLU A CD    1 
ATOM   1939  O OE1   . GLU A 1 251 ? 67.058  146.240 17.286  1.00 40.93 ? 251  GLU A OE1   1 
ATOM   1940  O OE2   . GLU A 1 251 ? 67.792  148.247 16.715  1.00 37.91 ? 251  GLU A OE2   1 
ATOM   1941  N N     . ALA A 1 252 ? 63.157  145.262 18.657  1.00 27.28 ? 252  ALA A N     1 
ATOM   1942  C CA    . ALA A 1 252 ? 62.193  144.253 19.049  1.00 26.32 ? 252  ALA A CA    1 
ATOM   1943  C C     . ALA A 1 252 ? 62.500  143.763 20.456  1.00 25.00 ? 252  ALA A C     1 
ATOM   1944  O O     . ALA A 1 252 ? 63.633  143.437 20.756  1.00 24.98 ? 252  ALA A O     1 
ATOM   1945  C CB    . ALA A 1 252 ? 62.216  143.079 18.054  1.00 26.26 ? 252  ALA A CB    1 
ATOM   1946  N N     . MET A 1 253 ? 61.490  143.724 21.315  1.00 23.81 ? 253  MET A N     1 
ATOM   1947  C CA    . MET A 1 253 ? 61.642  143.093 22.613  1.00 22.95 ? 253  MET A CA    1 
ATOM   1948  C C     . MET A 1 253 ? 60.913  141.760 22.550  1.00 23.04 ? 253  MET A C     1 
ATOM   1949  O O     . MET A 1 253 ? 59.847  141.687 21.908  1.00 22.72 ? 253  MET A O     1 
ATOM   1950  C CB    . MET A 1 253 ? 61.048  143.972 23.714  1.00 22.62 ? 253  MET A CB    1 
ATOM   1951  C CG    . MET A 1 253 ? 61.602  145.398 23.740  1.00 21.67 ? 253  MET A CG    1 
ATOM   1952  S SD    . MET A 1 253 ? 63.393  145.479 24.037  1.00 23.00 ? 253  MET A SD    1 
ATOM   1953  C CE    . MET A 1 253 ? 63.784  147.001 23.163  1.00 23.72 ? 253  MET A CE    1 
ATOM   1954  N N     . ASN A 1 254 ? 61.461  140.715 23.189  1.00 22.37 ? 254  ASN A N     1 
ATOM   1955  C CA    . ASN A 1 254 ? 60.699  139.466 23.347  1.00 22.66 ? 254  ASN A CA    1 
ATOM   1956  C C     . ASN A 1 254 ? 59.430  139.730 24.168  1.00 21.89 ? 254  ASN A C     1 
ATOM   1957  O O     . ASN A 1 254 ? 59.377  140.656 24.970  1.00 21.36 ? 254  ASN A O     1 
ATOM   1958  C CB    . ASN A 1 254 ? 61.553  138.352 23.979  1.00 23.91 ? 254  ASN A CB    1 
ATOM   1959  C CG    . ASN A 1 254 ? 60.838  136.987 24.000  1.00 27.51 ? 254  ASN A CG    1 
ATOM   1960  O OD1   . ASN A 1 254 ? 60.267  136.572 25.028  1.00 27.69 ? 254  ASN A OD1   1 
ATOM   1961  N ND2   . ASN A 1 254 ? 60.848  136.289 22.842  1.00 30.58 ? 254  ASN A ND2   1 
ATOM   1962  N N     . ALA A 1 255 ? 58.404  138.915 23.976  1.00 21.04 ? 255  ALA A N     1 
ATOM   1963  C CA    . ALA A 1 255 ? 57.165  139.076 24.733  1.00 19.83 ? 255  ALA A CA    1 
ATOM   1964  C C     . ALA A 1 255 ? 57.387  138.975 26.249  1.00 19.73 ? 255  ALA A C     1 
ATOM   1965  O O     . ALA A 1 255 ? 56.613  139.554 27.040  1.00 18.96 ? 255  ALA A O     1 
ATOM   1966  C CB    . ALA A 1 255 ? 56.120  138.046 24.280  1.00 18.91 ? 255  ALA A CB    1 
ATOM   1967  N N     . GLU A 1 256 ? 58.419  138.226 26.649  1.00 18.63 ? 256  GLU A N     1 
ATOM   1968  C CA    . GLU A 1 256 ? 58.692  137.992 28.064  1.00 18.80 ? 256  GLU A CA    1 
ATOM   1969  C C     . GLU A 1 256 ? 59.853  138.824 28.601  1.00 18.89 ? 256  GLU A C     1 
ATOM   1970  O O     . GLU A 1 256 ? 60.344  138.576 29.700  1.00 18.41 ? 256  GLU A O     1 
ATOM   1971  C CB    . GLU A 1 256 ? 58.928  136.498 28.361  1.00 18.63 ? 256  GLU A CB    1 
ATOM   1972  C CG    . GLU A 1 256 ? 57.667  135.629 28.254  1.00 17.90 ? 256  GLU A CG    1 
ATOM   1973  C CD    . GLU A 1 256 ? 56.517  136.105 29.126  1.00 18.39 ? 256  GLU A CD    1 
ATOM   1974  O OE1   . GLU A 1 256 ? 56.743  136.861 30.097  1.00 19.10 ? 256  GLU A OE1   1 
ATOM   1975  O OE2   . GLU A 1 256 ? 55.352  135.740 28.832  1.00 20.68 ? 256  GLU A OE2   1 
ATOM   1976  N N     . ASP A 1 257 ? 60.281  139.816 27.834  1.00 19.08 ? 257  ASP A N     1 
ATOM   1977  C CA    . ASP A 1 257 ? 61.285  140.752 28.339  1.00 19.78 ? 257  ASP A CA    1 
ATOM   1978  C C     . ASP A 1 257 ? 60.619  141.590 29.444  1.00 19.78 ? 257  ASP A C     1 
ATOM   1979  O O     . ASP A 1 257 ? 59.478  141.998 29.289  1.00 18.56 ? 257  ASP A O     1 
ATOM   1980  C CB    . ASP A 1 257 ? 61.802  141.648 27.213  1.00 19.27 ? 257  ASP A CB    1 
ATOM   1981  C CG    . ASP A 1 257 ? 62.965  141.027 26.449  1.00 19.04 ? 257  ASP A CG    1 
ATOM   1982  O OD1   . ASP A 1 257 ? 63.656  140.171 27.009  1.00 19.33 ? 257  ASP A OD1   1 
ATOM   1983  O OD2   . ASP A 1 257 ? 63.217  141.426 25.300  1.00 19.42 ? 257  ASP A OD2   1 
ATOM   1984  N N     . PRO A 1 258 ? 61.316  141.795 30.577  1.00 20.38 ? 258  PRO A N     1 
ATOM   1985  C CA    . PRO A 1 258 ? 60.776  142.679 31.609  1.00 20.62 ? 258  PRO A CA    1 
ATOM   1986  C C     . PRO A 1 258 ? 60.466  144.101 31.104  1.00 20.67 ? 258  PRO A C     1 
ATOM   1987  O O     . PRO A 1 258 ? 61.252  144.706 30.356  1.00 20.76 ? 258  PRO A O     1 
ATOM   1988  C CB    . PRO A 1 258 ? 61.864  142.682 32.698  1.00 20.78 ? 258  PRO A CB    1 
ATOM   1989  C CG    . PRO A 1 258 ? 63.099  142.069 32.042  1.00 20.76 ? 258  PRO A CG    1 
ATOM   1990  C CD    . PRO A 1 258 ? 62.599  141.171 30.978  1.00 21.02 ? 258  PRO A CD    1 
ATOM   1991  N N     . LEU A 1 259 ? 59.287  144.593 31.490  1.00 19.95 ? 259  LEU A N     1 
ATOM   1992  C CA    . LEU A 1 259 ? 58.840  145.929 31.119  1.00 19.03 ? 259  LEU A CA    1 
ATOM   1993  C C     . LEU A 1 259 ? 58.970  146.887 32.301  1.00 18.18 ? 259  LEU A C     1 
ATOM   1994  O O     . LEU A 1 259 ? 59.595  147.940 32.187  1.00 17.37 ? 259  LEU A O     1 
ATOM   1995  C CB    . LEU A 1 259 ? 57.402  145.902 30.582  1.00 19.68 ? 259  LEU A CB    1 
ATOM   1996  C CG    . LEU A 1 259 ? 56.781  147.248 30.221  1.00 19.69 ? 259  LEU A CG    1 
ATOM   1997  C CD1   . LEU A 1 259 ? 57.483  147.833 28.994  1.00 19.41 ? 259  LEU A CD1   1 
ATOM   1998  C CD2   . LEU A 1 259 ? 55.270  147.078 30.010  1.00 17.98 ? 259  LEU A CD2   1 
ATOM   1999  N N     . PHE A 1 260 ? 58.396  146.517 33.439  1.00 17.53 ? 260  PHE A N     1 
ATOM   2000  C CA    . PHE A 1 260 ? 58.522  147.359 34.619  1.00 17.91 ? 260  PHE A CA    1 
ATOM   2001  C C     . PHE A 1 260 ? 58.451  146.590 35.927  1.00 18.64 ? 260  PHE A C     1 
ATOM   2002  O O     . PHE A 1 260 ? 57.966  145.465 35.965  1.00 18.83 ? 260  PHE A O     1 
ATOM   2003  C CB    . PHE A 1 260 ? 57.521  148.523 34.595  1.00 16.80 ? 260  PHE A CB    1 
ATOM   2004  C CG    . PHE A 1 260 ? 56.056  148.127 34.761  1.00 16.63 ? 260  PHE A CG    1 
ATOM   2005  C CD1   . PHE A 1 260 ? 55.507  147.881 36.037  1.00 17.25 ? 260  PHE A CD1   1 
ATOM   2006  C CD2   . PHE A 1 260 ? 55.209  148.093 33.657  1.00 15.38 ? 260  PHE A CD2   1 
ATOM   2007  C CE1   . PHE A 1 260 ? 54.116  147.564 36.204  1.00 15.01 ? 260  PHE A CE1   1 
ATOM   2008  C CE2   . PHE A 1 260 ? 53.837  147.788 33.805  1.00 14.47 ? 260  PHE A CE2   1 
ATOM   2009  C CZ    . PHE A 1 260 ? 53.299  147.498 35.075  1.00 15.73 ? 260  PHE A CZ    1 
ATOM   2010  N N     . ILE A 1 261 ? 58.981  147.216 36.968  1.00 19.95 ? 261  ILE A N     1 
ATOM   2011  C CA    . ILE A 1 261 ? 58.843  146.799 38.370  1.00 21.31 ? 261  ILE A CA    1 
ATOM   2012  C C     . ILE A 1 261 ? 57.992  147.852 39.080  1.00 20.01 ? 261  ILE A C     1 
ATOM   2013  O O     . ILE A 1 261 ? 58.179  149.068 38.877  1.00 20.28 ? 261  ILE A O     1 
ATOM   2014  C CB    . ILE A 1 261 ? 60.222  146.784 39.106  1.00 21.76 ? 261  ILE A CB    1 
ATOM   2015  C CG1   . ILE A 1 261 ? 61.262  146.000 38.331  1.00 24.17 ? 261  ILE A CG1   1 
ATOM   2016  C CG2   . ILE A 1 261 ? 60.079  146.201 40.496  1.00 24.64 ? 261  ILE A CG2   1 
ATOM   2017  C CD1   . ILE A 1 261 ? 60.738  144.707 37.801  1.00 26.45 ? 261  ILE A CD1   1 
ATOM   2018  N N     . LEU A 1 262 ? 57.057  147.392 39.902  1.00 19.17 ? 262  LEU A N     1 
ATOM   2019  C CA    . LEU A 1 262 ? 56.245  148.294 40.706  1.00 18.43 ? 262  LEU A CA    1 
ATOM   2020  C C     . LEU A 1 262 ? 56.222  147.787 42.136  1.00 18.25 ? 262  LEU A C     1 
ATOM   2021  O O     . LEU A 1 262 ? 55.654  146.722 42.426  1.00 17.99 ? 262  LEU A O     1 
ATOM   2022  C CB    . LEU A 1 262 ? 54.790  148.373 40.178  1.00 18.78 ? 262  LEU A CB    1 
ATOM   2023  C CG    . LEU A 1 262 ? 54.202  149.755 39.944  1.00 18.99 ? 262  LEU A CG    1 
ATOM   2024  C CD1   . LEU A 1 262 ? 52.700  149.686 39.618  1.00 15.57 ? 262  LEU A CD1   1 
ATOM   2025  C CD2   . LEU A 1 262 ? 54.541  150.804 41.025  1.00 16.73 ? 262  LEU A CD2   1 
ATOM   2026  N N     . TYR A 1 263 ? 56.833  148.554 43.032  1.00 18.08 ? 263  TYR A N     1 
ATOM   2027  C CA    . TYR A 1 263 ? 56.873  148.152 44.435  1.00 18.43 ? 263  TYR A CA    1 
ATOM   2028  C C     . TYR A 1 263 ? 55.475  148.198 45.037  1.00 19.27 ? 263  TYR A C     1 
ATOM   2029  O O     . TYR A 1 263 ? 54.730  149.163 44.831  1.00 20.34 ? 263  TYR A O     1 
ATOM   2030  C CB    . TYR A 1 263 ? 57.959  148.926 45.210  1.00 17.65 ? 263  TYR A CB    1 
ATOM   2031  C CG    . TYR A 1 263 ? 59.310  148.374 44.852  1.00 16.36 ? 263  TYR A CG    1 
ATOM   2032  C CD1   . TYR A 1 263 ? 60.027  148.884 43.767  1.00 17.33 ? 263  TYR A CD1   1 
ATOM   2033  C CD2   . TYR A 1 263 ? 59.839  147.284 45.532  1.00 14.87 ? 263  TYR A CD2   1 
ATOM   2034  C CE1   . TYR A 1 263 ? 61.256  148.350 43.388  1.00 15.75 ? 263  TYR A CE1   1 
ATOM   2035  C CE2   . TYR A 1 263 ? 61.068  146.738 45.161  1.00 17.45 ? 263  TYR A CE2   1 
ATOM   2036  C CZ    . TYR A 1 263 ? 61.761  147.286 44.087  1.00 17.13 ? 263  TYR A CZ    1 
ATOM   2037  O OH    . TYR A 1 263 ? 62.944  146.761 43.703  1.00 17.71 ? 263  TYR A OH    1 
ATOM   2038  N N     . THR A 1 264 ? 55.103  147.114 45.711  1.00 19.89 ? 264  THR A N     1 
ATOM   2039  C CA    . THR A 1 264 ? 53.740  146.895 46.187  1.00 19.88 ? 264  THR A CA    1 
ATOM   2040  C C     . THR A 1 264 ? 53.848  146.287 47.563  1.00 20.43 ? 264  THR A C     1 
ATOM   2041  O O     . THR A 1 264 ? 54.647  145.364 47.771  1.00 20.35 ? 264  THR A O     1 
ATOM   2042  C CB    . THR A 1 264 ? 52.978  145.890 45.285  1.00 19.84 ? 264  THR A CB    1 
ATOM   2043  O OG1   . THR A 1 264 ? 53.214  146.231 43.923  1.00 20.72 ? 264  THR A OG1   1 
ATOM   2044  C CG2   . THR A 1 264 ? 51.490  145.944 45.548  1.00 19.50 ? 264  THR A CG2   1 
ATOM   2045  N N     . SER A 1 265 ? 53.054  146.828 48.492  1.00 20.58 ? 265  SER A N     1 
ATOM   2046  C CA    . SER A 1 265 ? 53.016  146.407 49.890  1.00 20.67 ? 265  SER A CA    1 
ATOM   2047  C C     . SER A 1 265 ? 52.350  145.039 50.082  1.00 21.80 ? 265  SER A C     1 
ATOM   2048  O O     . SER A 1 265 ? 51.326  144.715 49.456  1.00 21.51 ? 265  SER A O     1 
ATOM   2049  C CB    . SER A 1 265 ? 52.274  147.461 50.715  1.00 20.70 ? 265  SER A CB    1 
ATOM   2050  O OG    . SER A 1 265 ? 53.065  148.635 50.881  1.00 19.89 ? 265  SER A OG    1 
ATOM   2051  N N     . GLY A 1 266 ? 52.931  144.236 50.963  1.00 22.91 ? 266  GLY A N     1 
ATOM   2052  C CA    . GLY A 1 266 ? 52.362  142.926 51.250  1.00 24.09 ? 266  GLY A CA    1 
ATOM   2053  C C     . GLY A 1 266 ? 51.898  142.792 52.682  1.00 24.71 ? 266  GLY A C     1 
ATOM   2054  O O     . GLY A 1 266 ? 52.115  143.692 53.507  1.00 24.49 ? 266  GLY A O     1 
ATOM   2055  N N     . SER A 1 267 ? 51.268  141.651 52.954  1.00 25.65 ? 267  SER A N     1 
ATOM   2056  C CA    . SER A 1 267 ? 50.838  141.231 54.287  1.00 26.75 ? 267  SER A CA    1 
ATOM   2057  C C     . SER A 1 267 ? 52.004  141.186 55.268  1.00 27.09 ? 267  SER A C     1 
ATOM   2058  O O     . SER A 1 267 ? 51.867  141.573 56.423  1.00 28.14 ? 267  SER A O     1 
ATOM   2059  C CB    . SER A 1 267 ? 50.202  139.846 54.196  1.00 26.75 ? 267  SER A CB    1 
ATOM   2060  O OG    . SER A 1 267 ? 49.291  139.650 55.245  1.00 28.09 ? 267  SER A OG    1 
ATOM   2061  N N     . THR A 1 268 ? 53.147  140.696 54.802  1.00 27.37 ? 268  THR A N     1 
ATOM   2062  C CA    . THR A 1 268 ? 54.367  140.684 55.590  1.00 27.79 ? 268  THR A CA    1 
ATOM   2063  C C     . THR A 1 268 ? 55.462  141.360 54.782  1.00 27.25 ? 268  THR A C     1 
ATOM   2064  O O     . THR A 1 268 ? 55.295  141.615 53.574  1.00 27.31 ? 268  THR A O     1 
ATOM   2065  C CB    . THR A 1 268 ? 54.825  139.241 56.000  1.00 28.46 ? 268  THR A CB    1 
ATOM   2066  O OG1   . THR A 1 268 ? 55.084  138.447 54.830  1.00 29.29 ? 268  THR A OG1   1 
ATOM   2067  C CG2   . THR A 1 268 ? 53.763  138.551 56.869  1.00 29.64 ? 268  THR A CG2   1 
ATOM   2068  N N     . GLY A 1 269 ? 56.550  141.688 55.471  1.00 26.49 ? 269  GLY A N     1 
ATOM   2069  C CA    . GLY A 1 269 ? 57.747  142.226 54.856  1.00 26.21 ? 269  GLY A CA    1 
ATOM   2070  C C     . GLY A 1 269 ? 57.579  143.629 54.317  1.00 26.20 ? 269  GLY A C     1 
ATOM   2071  O O     . GLY A 1 269 ? 56.536  144.276 54.490  1.00 26.85 ? 269  GLY A O     1 
ATOM   2072  N N     . LYS A 1 270 ? 58.621  144.092 53.656  1.00 25.17 ? 270  LYS A N     1 
ATOM   2073  C CA    . LYS A 1 270 ? 58.604  145.371 52.996  1.00 25.24 ? 270  LYS A CA    1 
ATOM   2074  C C     . LYS A 1 270 ? 58.135  145.227 51.531  1.00 24.07 ? 270  LYS A C     1 
ATOM   2075  O O     . LYS A 1 270 ? 58.104  144.103 50.995  1.00 23.19 ? 270  LYS A O     1 
ATOM   2076  C CB    . LYS A 1 270 ? 59.985  146.029 53.142  1.00 25.90 ? 270  LYS A CB    1 
ATOM   2077  C CG    . LYS A 1 270 ? 59.988  147.031 54.347  1.00 30.04 ? 270  LYS A CG    1 
ATOM   2078  C CD    . LYS A 1 270 ? 61.198  146.897 55.233  1.00 35.05 ? 270  LYS A CD    1 
ATOM   2079  C CE    . LYS A 1 270 ? 62.245  147.949 54.899  1.00 37.25 ? 270  LYS A CE    1 
ATOM   2080  N NZ    . LYS A 1 270 ? 63.472  147.713 55.733  1.00 38.30 ? 270  LYS A NZ    1 
ATOM   2081  N N     . PRO A 1 271 ? 57.761  146.355 50.884  1.00 23.07 ? 271  PRO A N     1 
ATOM   2082  C CA    . PRO A 1 271 ? 57.239  146.236 49.526  1.00 22.17 ? 271  PRO A CA    1 
ATOM   2083  C C     . PRO A 1 271 ? 58.171  145.446 48.601  1.00 21.17 ? 271  PRO A C     1 
ATOM   2084  O O     . PRO A 1 271 ? 59.397  145.580 48.675  1.00 21.23 ? 271  PRO A O     1 
ATOM   2085  C CB    . PRO A 1 271 ? 57.087  147.690 49.068  1.00 22.00 ? 271  PRO A CB    1 
ATOM   2086  C CG    . PRO A 1 271 ? 56.928  148.476 50.335  1.00 22.67 ? 271  PRO A CG    1 
ATOM   2087  C CD    . PRO A 1 271 ? 57.808  147.768 51.335  1.00 23.35 ? 271  PRO A CD    1 
ATOM   2088  N N     . LYS A 1 272 ? 57.582  144.596 47.773  1.00 19.72 ? 272  LYS A N     1 
ATOM   2089  C CA    . LYS A 1 272 ? 58.344  143.841 46.783  1.00 19.65 ? 272  LYS A CA    1 
ATOM   2090  C C     . LYS A 1 272 ? 58.077  144.375 45.389  1.00 18.40 ? 272  LYS A C     1 
ATOM   2091  O O     . LYS A 1 272 ? 57.009  144.891 45.133  1.00 17.52 ? 272  LYS A O     1 
ATOM   2092  C CB    . LYS A 1 272 ? 57.979  142.346 46.858  1.00 19.25 ? 272  LYS A CB    1 
ATOM   2093  C CG    . LYS A 1 272 ? 58.388  141.676 48.175  1.00 20.51 ? 272  LYS A CG    1 
ATOM   2094  C CD    . LYS A 1 272 ? 59.889  141.584 48.306  1.00 22.50 ? 272  LYS A CD    1 
ATOM   2095  C CE    . LYS A 1 272 ? 60.307  141.488 49.769  1.00 25.64 ? 272  LYS A CE    1 
ATOM   2096  N NZ    . LYS A 1 272 ? 61.742  141.082 49.807  1.00 27.77 ? 272  LYS A NZ    1 
ATOM   2097  N N     . GLY A 1 273 ? 59.044  144.209 44.492  1.00 18.27 ? 273  GLY A N     1 
ATOM   2098  C CA    . GLY A 1 273 ? 58.934  144.701 43.131  1.00 18.43 ? 273  GLY A CA    1 
ATOM   2099  C C     . GLY A 1 273 ? 58.117  143.792 42.225  1.00 18.42 ? 273  GLY A C     1 
ATOM   2100  O O     . GLY A 1 273 ? 58.654  142.860 41.668  1.00 18.14 ? 273  GLY A O     1 
ATOM   2101  N N     . VAL A 1 274 ? 56.824  144.076 42.074  1.00 18.29 ? 274  VAL A N     1 
ATOM   2102  C CA    . VAL A 1 274 ? 55.975  143.283 41.192  1.00 18.17 ? 274  VAL A CA    1 
ATOM   2103  C C     . VAL A 1 274 ? 56.412  143.527 39.762  1.00 17.79 ? 274  VAL A C     1 
ATOM   2104  O O     . VAL A 1 274 ? 56.430  144.654 39.304  1.00 18.35 ? 274  VAL A O     1 
ATOM   2105  C CB    . VAL A 1 274 ? 54.451  143.598 41.383  1.00 18.58 ? 274  VAL A CB    1 
ATOM   2106  C CG1   . VAL A 1 274 ? 53.601  142.865 40.338  1.00 16.97 ? 274  VAL A CG1   1 
ATOM   2107  C CG2   . VAL A 1 274 ? 54.009  143.210 42.792  1.00 16.88 ? 274  VAL A CG2   1 
ATOM   2108  N N     . LEU A 1 275 ? 56.744  142.445 39.063  1.00 18.30 ? 275  LEU A N     1 
ATOM   2109  C CA    . LEU A 1 275 ? 57.370  142.527 37.741  1.00 17.64 ? 275  LEU A CA    1 
ATOM   2110  C C     . LEU A 1 275 ? 56.423  142.116 36.626  1.00 17.20 ? 275  LEU A C     1 
ATOM   2111  O O     . LEU A 1 275 ? 55.878  141.015 36.638  1.00 16.97 ? 275  LEU A O     1 
ATOM   2112  C CB    . LEU A 1 275 ? 58.664  141.699 37.693  1.00 17.16 ? 275  LEU A CB    1 
ATOM   2113  C CG    . LEU A 1 275 ? 59.520  141.834 36.422  1.00 18.39 ? 275  LEU A CG    1 
ATOM   2114  C CD1   . LEU A 1 275 ? 60.974  141.520 36.781  1.00 18.61 ? 275  LEU A CD1   1 
ATOM   2115  C CD2   . LEU A 1 275 ? 59.047  140.966 35.233  1.00 14.94 ? 275  LEU A CD2   1 
ATOM   2116  N N     . HIS A 1 276 ? 56.249  143.044 35.681  1.00 16.87 ? 276  HIS A N     1 
ATOM   2117  C CA    . HIS A 1 276 ? 55.489  142.846 34.462  1.00 17.29 ? 276  HIS A CA    1 
ATOM   2118  C C     . HIS A 1 276 ? 56.396  142.702 33.245  1.00 17.15 ? 276  HIS A C     1 
ATOM   2119  O O     . HIS A 1 276 ? 57.381  143.439 33.099  1.00 17.33 ? 276  HIS A O     1 
ATOM   2120  C CB    . HIS A 1 276 ? 54.424  143.943 34.269  1.00 16.72 ? 276  HIS A CB    1 
ATOM   2121  C CG    . HIS A 1 276 ? 53.233  143.741 35.153  1.00 16.03 ? 276  HIS A CG    1 
ATOM   2122  N ND1   . HIS A 1 276 ? 52.232  142.841 34.852  1.00 16.15 ? 276  HIS A ND1   1 
ATOM   2123  C CD2   . HIS A 1 276 ? 52.906  144.279 36.353  1.00 15.42 ? 276  HIS A CD2   1 
ATOM   2124  C CE1   . HIS A 1 276 ? 51.337  142.838 35.824  1.00 14.23 ? 276  HIS A CE1   1 
ATOM   2125  N NE2   . HIS A 1 276 ? 51.724  143.702 36.751  1.00 13.67 ? 276  HIS A NE2   1 
ATOM   2126  N N     . THR A 1 277 ? 56.072  141.726 32.392  1.00 16.03 ? 277  THR A N     1 
ATOM   2127  C CA    . THR A 1 277 ? 56.737  141.644 31.112  1.00 15.37 ? 277  THR A CA    1 
ATOM   2128  C C     . THR A 1 277 ? 55.983  142.485 30.073  1.00 16.24 ? 277  THR A C     1 
ATOM   2129  O O     . THR A 1 277 ? 55.139  143.335 30.441  1.00 16.56 ? 277  THR A O     1 
ATOM   2130  C CB    . THR A 1 277 ? 57.048  140.199 30.689  1.00 15.11 ? 277  THR A CB    1 
ATOM   2131  O OG1   . THR A 1 277 ? 55.831  139.454 30.530  1.00 13.05 ? 277  THR A OG1   1 
ATOM   2132  C CG2   . THR A 1 277 ? 57.994  139.529 31.745  1.00 12.60 ? 277  THR A CG2   1 
ATOM   2133  N N     . THR A 1 278 ? 56.289  142.264 28.796  1.00 16.14 ? 278  THR A N     1 
ATOM   2134  C CA    . THR A 1 278 ? 55.868  143.177 27.747  1.00 16.18 ? 278  THR A CA    1 
ATOM   2135  C C     . THR A 1 278 ? 54.585  142.779 26.998  1.00 16.87 ? 278  THR A C     1 
ATOM   2136  O O     . THR A 1 278 ? 53.620  143.545 26.965  1.00 16.73 ? 278  THR A O     1 
ATOM   2137  C CB    . THR A 1 278 ? 57.030  143.385 26.749  1.00 16.93 ? 278  THR A CB    1 
ATOM   2138  O OG1   . THR A 1 278 ? 58.203  143.842 27.463  1.00 14.45 ? 278  THR A OG1   1 
ATOM   2139  C CG2   . THR A 1 278 ? 56.638  144.377 25.656  1.00 15.13 ? 278  THR A CG2   1 
ATOM   2140  N N     . GLY A 1 279 ? 54.583  141.581 26.404  1.00 17.00 ? 279  GLY A N     1 
ATOM   2141  C CA    . GLY A 1 279 ? 53.535  141.159 25.469  1.00 16.41 ? 279  GLY A CA    1 
ATOM   2142  C C     . GLY A 1 279 ? 52.151  140.997 26.071  1.00 16.35 ? 279  GLY A C     1 
ATOM   2143  O O     . GLY A 1 279 ? 51.236  141.764 25.769  1.00 15.83 ? 279  GLY A O     1 
ATOM   2144  N N     . GLY A 1 280 ? 51.997  139.982 26.915  1.00 16.57 ? 280  GLY A N     1 
ATOM   2145  C CA    . GLY A 1 280 ? 50.724  139.720 27.585  1.00 17.40 ? 280  GLY A CA    1 
ATOM   2146  C C     . GLY A 1 280 ? 50.208  140.921 28.357  1.00 17.64 ? 280  GLY A C     1 
ATOM   2147  O O     . GLY A 1 280 ? 48.999  141.224 28.321  1.00 18.41 ? 280  GLY A O     1 
ATOM   2148  N N     . TYR A 1 281 ? 51.102  141.589 29.082  1.00 17.95 ? 281  TYR A N     1 
ATOM   2149  C CA    . TYR A 1 281 ? 50.722  142.795 29.824  1.00 17.51 ? 281  TYR A CA    1 
ATOM   2150  C C     . TYR A 1 281 ? 50.058  143.817 28.905  1.00 17.80 ? 281  TYR A C     1 
ATOM   2151  O O     . TYR A 1 281 ? 48.977  144.365 29.208  1.00 18.38 ? 281  TYR A O     1 
ATOM   2152  C CB    . TYR A 1 281 ? 51.939  143.454 30.515  1.00 17.74 ? 281  TYR A CB    1 
ATOM   2153  C CG    . TYR A 1 281 ? 51.591  144.833 31.032  1.00 17.85 ? 281  TYR A CG    1 
ATOM   2154  C CD1   . TYR A 1 281 ? 50.853  144.973 32.200  1.00 16.42 ? 281  TYR A CD1   1 
ATOM   2155  C CD2   . TYR A 1 281 ? 51.926  145.993 30.305  1.00 18.01 ? 281  TYR A CD2   1 
ATOM   2156  C CE1   . TYR A 1 281 ? 50.485  146.239 32.685  1.00 18.20 ? 281  TYR A CE1   1 
ATOM   2157  C CE2   . TYR A 1 281 ? 51.551  147.279 30.784  1.00 17.92 ? 281  TYR A CE2   1 
ATOM   2158  C CZ    . TYR A 1 281 ? 50.836  147.376 31.978  1.00 17.89 ? 281  TYR A CZ    1 
ATOM   2159  O OH    . TYR A 1 281 ? 50.429  148.587 32.472  1.00 17.11 ? 281  TYR A OH    1 
ATOM   2160  N N     . LEU A 1 282 ? 50.719  144.124 27.793  1.00 17.72 ? 282  LEU A N     1 
ATOM   2161  C CA    . LEU A 1 282 ? 50.202  145.173 26.927  1.00 16.53 ? 282  LEU A CA    1 
ATOM   2162  C C     . LEU A 1 282 ? 48.951  144.744 26.139  1.00 16.52 ? 282  LEU A C     1 
ATOM   2163  O O     . LEU A 1 282 ? 48.056  145.563 25.942  1.00 17.54 ? 282  LEU A O     1 
ATOM   2164  C CB    . LEU A 1 282 ? 51.294  145.726 26.019  1.00 16.46 ? 282  LEU A CB    1 
ATOM   2165  C CG    . LEU A 1 282 ? 50.862  147.029 25.318  1.00 16.22 ? 282  LEU A CG    1 
ATOM   2166  C CD1   . LEU A 1 282 ? 50.680  148.141 26.346  1.00 14.11 ? 282  LEU A CD1   1 
ATOM   2167  C CD2   . LEU A 1 282 ? 51.854  147.436 24.245  1.00 15.39 ? 282  LEU A CD2   1 
ATOM   2168  N N     . VAL A 1 283 ? 48.885  143.486 25.685  1.00 16.12 ? 283  VAL A N     1 
ATOM   2169  C CA    . VAL A 1 283 ? 47.642  142.937 25.091  1.00 15.94 ? 283  VAL A CA    1 
ATOM   2170  C C     . VAL A 1 283 ? 46.487  143.095 26.080  1.00 16.31 ? 283  VAL A C     1 
ATOM   2171  O O     . VAL A 1 283 ? 45.391  143.560 25.727  1.00 16.52 ? 283  VAL A O     1 
ATOM   2172  C CB    . VAL A 1 283 ? 47.747  141.414 24.744  1.00 16.42 ? 283  VAL A CB    1 
ATOM   2173  C CG1   . VAL A 1 283 ? 46.351  140.820 24.465  1.00 15.60 ? 283  VAL A CG1   1 
ATOM   2174  C CG2   . VAL A 1 283 ? 48.681  141.178 23.552  1.00 14.79 ? 283  VAL A CG2   1 
ATOM   2175  N N     . TYR A 1 284 ? 46.756  142.738 27.331  1.00 16.57 ? 284  TYR A N     1 
ATOM   2176  C CA    . TYR A 1 284 ? 45.745  142.770 28.390  1.00 17.13 ? 284  TYR A CA    1 
ATOM   2177  C C     . TYR A 1 284 ? 45.294  144.191 28.786  1.00 17.07 ? 284  TYR A C     1 
ATOM   2178  O O     . TYR A 1 284 ? 44.113  144.412 28.999  1.00 17.48 ? 284  TYR A O     1 
ATOM   2179  C CB    . TYR A 1 284 ? 46.199  141.927 29.604  1.00 16.74 ? 284  TYR A CB    1 
ATOM   2180  C CG    . TYR A 1 284 ? 45.030  141.450 30.444  1.00 17.79 ? 284  TYR A CG    1 
ATOM   2181  C CD1   . TYR A 1 284 ? 44.763  142.028 31.700  1.00 16.18 ? 284  TYR A CD1   1 
ATOM   2182  C CD2   . TYR A 1 284 ? 44.150  140.467 29.965  1.00 17.16 ? 284  TYR A CD2   1 
ATOM   2183  C CE1   . TYR A 1 284 ? 43.670  141.613 32.466  1.00 14.99 ? 284  TYR A CE1   1 
ATOM   2184  C CE2   . TYR A 1 284 ? 43.045  140.068 30.714  1.00 16.76 ? 284  TYR A CE2   1 
ATOM   2185  C CZ    . TYR A 1 284 ? 42.813  140.644 31.977  1.00 17.68 ? 284  TYR A CZ    1 
ATOM   2186  O OH    . TYR A 1 284 ? 41.706  140.254 32.743  1.00 15.84 ? 284  TYR A OH    1 
ATOM   2187  N N     . ALA A 1 285 ? 46.221  145.148 28.870  1.00 17.46 ? 285  ALA A N     1 
ATOM   2188  C CA    . ALA A 1 285 ? 45.881  146.562 29.185  1.00 17.50 ? 285  ALA A CA    1 
ATOM   2189  C C     . ALA A 1 285 ? 45.083  147.247 28.060  1.00 17.75 ? 285  ALA A C     1 
ATOM   2190  O O     . ALA A 1 285 ? 44.091  147.937 28.320  1.00 17.49 ? 285  ALA A O     1 
ATOM   2191  C CB    . ALA A 1 285 ? 47.137  147.377 29.522  1.00 16.69 ? 285  ALA A CB    1 
ATOM   2192  N N     . ALA A 1 286 ? 45.500  147.012 26.813  1.00 18.40 ? 286  ALA A N     1 
ATOM   2193  C CA    . ALA A 1 286 ? 44.790  147.546 25.642  1.00 18.96 ? 286  ALA A CA    1 
ATOM   2194  C C     . ALA A 1 286 ? 43.413  146.893 25.483  1.00 19.22 ? 286  ALA A C     1 
ATOM   2195  O O     . ALA A 1 286 ? 42.439  147.564 25.150  1.00 19.22 ? 286  ALA A O     1 
ATOM   2196  C CB    . ALA A 1 286 ? 45.621  147.331 24.356  1.00 18.46 ? 286  ALA A CB    1 
ATOM   2197  N N     . THR A 1 287 ? 43.341  145.581 25.714  1.00 18.93 ? 287  THR A N     1 
ATOM   2198  C CA    . THR A 1 287 ? 42.075  144.849 25.571  1.00 18.68 ? 287  THR A CA    1 
ATOM   2199  C C     . THR A 1 287 ? 41.025  145.261 26.630  1.00 18.77 ? 287  THR A C     1 
ATOM   2200  O O     . THR A 1 287 ? 39.858  145.514 26.282  1.00 18.39 ? 287  THR A O     1 
ATOM   2201  C CB    . THR A 1 287 ? 42.310  143.330 25.550  1.00 18.17 ? 287  THR A CB    1 
ATOM   2202  O OG1   . THR A 1 287 ? 43.167  143.012 24.439  1.00 18.90 ? 287  THR A OG1   1 
ATOM   2203  C CG2   . THR A 1 287 ? 41.014  142.568 25.408  1.00 16.81 ? 287  THR A CG2   1 
ATOM   2204  N N     . THR A 1 288 ? 41.440  145.302 27.903  1.00 18.71 ? 288  THR A N     1 
ATOM   2205  C CA    . THR A 1 288 ? 40.564  145.713 29.006  1.00 18.13 ? 288  THR A CA    1 
ATOM   2206  C C     . THR A 1 288 ? 40.149  147.198 28.908  1.00 18.40 ? 288  THR A C     1 
ATOM   2207  O O     . THR A 1 288 ? 38.979  147.525 29.138  1.00 18.29 ? 288  THR A O     1 
ATOM   2208  C CB    . THR A 1 288 ? 41.226  145.471 30.382  1.00 17.85 ? 288  THR A CB    1 
ATOM   2209  O OG1   . THR A 1 288 ? 42.579  145.936 30.367  1.00 17.35 ? 288  THR A OG1   1 
ATOM   2210  C CG2   . THR A 1 288 ? 41.233  144.019 30.713  1.00 17.71 ? 288  THR A CG2   1 
ATOM   2211  N N     . PHE A 1 289 ? 41.099  148.076 28.571  1.00 18.48 ? 289  PHE A N     1 
ATOM   2212  C CA    . PHE A 1 289 ? 40.826  149.512 28.371  1.00 19.11 ? 289  PHE A CA    1 
ATOM   2213  C C     . PHE A 1 289 ? 39.747  149.681 27.308  1.00 19.90 ? 289  PHE A C     1 
ATOM   2214  O O     . PHE A 1 289 ? 38.752  150.378 27.525  1.00 19.64 ? 289  PHE A O     1 
ATOM   2215  C CB    . PHE A 1 289 ? 42.094  150.311 27.948  1.00 17.95 ? 289  PHE A CB    1 
ATOM   2216  C CG    . PHE A 1 289 ? 41.780  151.708 27.428  1.00 18.79 ? 289  PHE A CG    1 
ATOM   2217  C CD1   . PHE A 1 289 ? 41.662  152.798 28.316  1.00 16.87 ? 289  PHE A CD1   1 
ATOM   2218  C CD2   . PHE A 1 289 ? 41.538  151.925 26.072  1.00 16.77 ? 289  PHE A CD2   1 
ATOM   2219  C CE1   . PHE A 1 289 ? 41.328  154.089 27.847  1.00 16.05 ? 289  PHE A CE1   1 
ATOM   2220  C CE2   . PHE A 1 289 ? 41.207  153.218 25.586  1.00 19.36 ? 289  PHE A CE2   1 
ATOM   2221  C CZ    . PHE A 1 289 ? 41.097  154.299 26.479  1.00 17.48 ? 289  PHE A CZ    1 
ATOM   2222  N N     . LYS A 1 290 ? 39.966  149.050 26.149  1.00 20.78 ? 290  LYS A N     1 
ATOM   2223  C CA    . LYS A 1 290 ? 39.066  149.192 25.007  1.00 21.26 ? 290  LYS A CA    1 
ATOM   2224  C C     . LYS A 1 290 ? 37.621  148.775 25.308  1.00 21.26 ? 290  LYS A C     1 
ATOM   2225  O O     . LYS A 1 290 ? 36.691  149.515 24.995  1.00 21.65 ? 290  LYS A O     1 
ATOM   2226  C CB    . LYS A 1 290 ? 39.605  148.423 23.804  1.00 21.62 ? 290  LYS A CB    1 
ATOM   2227  C CG    . LYS A 1 290 ? 38.827  148.637 22.499  1.00 22.21 ? 290  LYS A CG    1 
ATOM   2228  C CD    . LYS A 1 290 ? 39.264  147.605 21.482  1.00 23.87 ? 290  LYS A CD    1 
ATOM   2229  C CE    . LYS A 1 290 ? 39.324  148.207 20.106  1.00 29.38 ? 290  LYS A CE    1 
ATOM   2230  N NZ    . LYS A 1 290 ? 39.812  147.210 19.106  1.00 29.90 ? 290  LYS A NZ    1 
ATOM   2231  N N     . TYR A 1 291 ? 37.437  147.611 25.926  1.00 21.39 ? 291  TYR A N     1 
ATOM   2232  C CA    . TYR A 1 291 ? 36.081  147.047 26.094  1.00 21.56 ? 291  TYR A CA    1 
ATOM   2233  C C     . TYR A 1 291 ? 35.319  147.507 27.335  1.00 20.38 ? 291  TYR A C     1 
ATOM   2234  O O     . TYR A 1 291 ? 34.086  147.639 27.313  1.00 20.13 ? 291  TYR A O     1 
ATOM   2235  C CB    . TYR A 1 291 ? 36.108  145.501 26.002  1.00 22.66 ? 291  TYR A CB    1 
ATOM   2236  C CG    . TYR A 1 291 ? 36.497  145.039 24.631  1.00 23.93 ? 291  TYR A CG    1 
ATOM   2237  C CD1   . TYR A 1 291 ? 37.616  144.247 24.437  1.00 27.82 ? 291  TYR A CD1   1 
ATOM   2238  C CD2   . TYR A 1 291 ? 35.772  145.442 23.515  1.00 27.07 ? 291  TYR A CD2   1 
ATOM   2239  C CE1   . TYR A 1 291 ? 37.997  143.849 23.162  1.00 30.03 ? 291  TYR A CE1   1 
ATOM   2240  C CE2   . TYR A 1 291 ? 36.143  145.058 22.236  1.00 27.19 ? 291  TYR A CE2   1 
ATOM   2241  C CZ    . TYR A 1 291 ? 37.262  144.271 22.067  1.00 27.25 ? 291  TYR A CZ    1 
ATOM   2242  O OH    . TYR A 1 291 ? 37.641  143.871 20.808  1.00 28.15 ? 291  TYR A OH    1 
ATOM   2243  N N     . VAL A 1 292 ? 36.050  147.717 28.419  1.00 20.03 ? 292  VAL A N     1 
ATOM   2244  C CA    . VAL A 1 292 ? 35.454  148.144 29.678  1.00 19.47 ? 292  VAL A CA    1 
ATOM   2245  C C     . VAL A 1 292 ? 35.064  149.618 29.597  1.00 19.54 ? 292  VAL A C     1 
ATOM   2246  O O     . VAL A 1 292 ? 34.028  150.009 30.111  1.00 19.15 ? 292  VAL A O     1 
ATOM   2247  C CB    . VAL A 1 292 ? 36.405  147.837 30.850  1.00 19.78 ? 292  VAL A CB    1 
ATOM   2248  C CG1   . VAL A 1 292 ? 35.992  148.543 32.160  1.00 19.83 ? 292  VAL A CG1   1 
ATOM   2249  C CG2   . VAL A 1 292 ? 36.530  146.318 31.019  1.00 19.86 ? 292  VAL A CG2   1 
ATOM   2250  N N     . PHE A 1 293 ? 35.881  150.435 28.935  1.00 19.92 ? 293  PHE A N     1 
ATOM   2251  C CA    . PHE A 1 293 ? 35.516  151.846 28.756  1.00 20.18 ? 293  PHE A CA    1 
ATOM   2252  C C     . PHE A 1 293 ? 34.746  152.111 27.464  1.00 20.66 ? 293  PHE A C     1 
ATOM   2253  O O     . PHE A 1 293 ? 34.292  153.234 27.225  1.00 19.48 ? 293  PHE A O     1 
ATOM   2254  C CB    . PHE A 1 293 ? 36.740  152.750 28.872  1.00 20.28 ? 293  PHE A CB    1 
ATOM   2255  C CG    . PHE A 1 293 ? 37.374  152.721 30.238  1.00 20.20 ? 293  PHE A CG    1 
ATOM   2256  C CD1   . PHE A 1 293 ? 38.675  152.240 30.405  1.00 17.98 ? 293  PHE A CD1   1 
ATOM   2257  C CD2   . PHE A 1 293 ? 36.647  153.130 31.365  1.00 20.59 ? 293  PHE A CD2   1 
ATOM   2258  C CE1   . PHE A 1 293 ? 39.268  152.194 31.661  1.00 18.58 ? 293  PHE A CE1   1 
ATOM   2259  C CE2   . PHE A 1 293 ? 37.223  153.076 32.641  1.00 21.83 ? 293  PHE A CE2   1 
ATOM   2260  C CZ    . PHE A 1 293 ? 38.545  152.602 32.785  1.00 20.76 ? 293  PHE A CZ    1 
ATOM   2261  N N     . ASP A 1 294 ? 34.612  151.062 26.642  1.00 21.37 ? 294  ASP A N     1 
ATOM   2262  C CA    . ASP A 1 294 ? 33.864  151.103 25.389  1.00 22.18 ? 294  ASP A CA    1 
ATOM   2263  C C     . ASP A 1 294 ? 34.455  152.205 24.501  1.00 22.25 ? 294  ASP A C     1 
ATOM   2264  O O     . ASP A 1 294 ? 33.738  153.053 23.961  1.00 21.67 ? 294  ASP A O     1 
ATOM   2265  C CB    . ASP A 1 294 ? 32.363  151.306 25.649  1.00 22.33 ? 294  ASP A CB    1 
ATOM   2266  C CG    . ASP A 1 294 ? 31.507  150.911 24.454  1.00 24.13 ? 294  ASP A CG    1 
ATOM   2267  O OD1   . ASP A 1 294 ? 30.744  151.762 23.953  1.00 23.29 ? 294  ASP A OD1   1 
ATOM   2268  O OD2   . ASP A 1 294 ? 31.611  149.743 24.010  1.00 26.74 ? 294  ASP A OD2   1 
ATOM   2269  N N     . TYR A 1 295 ? 35.781  152.179 24.372  1.00 22.46 ? 295  TYR A N     1 
ATOM   2270  C CA    . TYR A 1 295 ? 36.499  153.268 23.747  1.00 22.99 ? 295  TYR A CA    1 
ATOM   2271  C C     . TYR A 1 295 ? 36.251  153.354 22.227  1.00 23.09 ? 295  TYR A C     1 
ATOM   2272  O O     . TYR A 1 295 ? 36.422  152.362 21.495  1.00 22.75 ? 295  TYR A O     1 
ATOM   2273  C CB    . TYR A 1 295 ? 38.009  153.239 24.083  1.00 24.24 ? 295  TYR A CB    1 
ATOM   2274  C CG    . TYR A 1 295 ? 38.737  154.216 23.211  1.00 25.25 ? 295  TYR A CG    1 
ATOM   2275  C CD1   . TYR A 1 295 ? 38.841  155.565 23.553  1.00 26.29 ? 295  TYR A CD1   1 
ATOM   2276  C CD2   . TYR A 1 295 ? 39.228  153.804 21.991  1.00 26.99 ? 295  TYR A CD2   1 
ATOM   2277  C CE1   . TYR A 1 295 ? 39.478  156.476 22.674  1.00 28.36 ? 295  TYR A CE1   1 
ATOM   2278  C CE2   . TYR A 1 295 ? 39.841  154.671 21.135  1.00 29.91 ? 295  TYR A CE2   1 
ATOM   2279  C CZ    . TYR A 1 295 ? 39.959  155.998 21.458  1.00 27.02 ? 295  TYR A CZ    1 
ATOM   2280  O OH    . TYR A 1 295 ? 40.581  156.788 20.513  1.00 28.17 ? 295  TYR A OH    1 
ATOM   2281  N N     . HIS A 1 296 ? 35.819  154.537 21.776  1.00 22.31 ? 296  HIS A N     1 
ATOM   2282  C CA    . HIS A 1 296 ? 35.641  154.839 20.349  1.00 22.39 ? 296  HIS A CA    1 
ATOM   2283  C C     . HIS A 1 296 ? 36.613  155.942 19.941  1.00 22.35 ? 296  HIS A C     1 
ATOM   2284  O O     . HIS A 1 296 ? 36.867  156.853 20.727  1.00 22.71 ? 296  HIS A O     1 
ATOM   2285  C CB    . HIS A 1 296 ? 34.214  155.328 20.060  1.00 22.15 ? 296  HIS A CB    1 
ATOM   2286  C CG    . HIS A 1 296 ? 33.188  154.240 20.066  1.00 22.47 ? 296  HIS A CG    1 
ATOM   2287  N ND1   . HIS A 1 296 ? 32.759  153.631 21.227  1.00 23.47 ? 296  HIS A ND1   1 
ATOM   2288  C CD2   . HIS A 1 296 ? 32.517  153.639 19.057  1.00 22.32 ? 296  HIS A CD2   1 
ATOM   2289  C CE1   . HIS A 1 296 ? 31.855  152.716 20.934  1.00 24.29 ? 296  HIS A CE1   1 
ATOM   2290  N NE2   . HIS A 1 296 ? 31.706  152.686 19.622  1.00 25.27 ? 296  HIS A NE2   1 
ATOM   2291  N N     . PRO A 1 297 ? 37.159  155.872 18.716  1.00 22.76 ? 297  PRO A N     1 
ATOM   2292  C CA    . PRO A 1 297 ? 38.077  156.924 18.296  1.00 23.28 ? 297  PRO A CA    1 
ATOM   2293  C C     . PRO A 1 297 ? 37.475  158.308 18.536  1.00 22.64 ? 297  PRO A C     1 
ATOM   2294  O O     . PRO A 1 297 ? 36.308  158.548 18.232  1.00 21.71 ? 297  PRO A O     1 
ATOM   2295  C CB    . PRO A 1 297 ? 38.267  156.641 16.799  1.00 23.47 ? 297  PRO A CB    1 
ATOM   2296  C CG    . PRO A 1 297 ? 38.115  155.183 16.710  1.00 24.29 ? 297  PRO A CG    1 
ATOM   2297  C CD    . PRO A 1 297 ? 36.998  154.849 17.662  1.00 23.01 ? 297  PRO A CD    1 
ATOM   2298  N N     . GLY A 1 298 ? 38.266  159.190 19.130  1.00 22.95 ? 298  GLY A N     1 
ATOM   2299  C CA    . GLY A 1 298 ? 37.801  160.552 19.421  1.00 22.47 ? 298  GLY A CA    1 
ATOM   2300  C C     . GLY A 1 298 ? 37.269  160.741 20.841  1.00 22.32 ? 298  GLY A C     1 
ATOM   2301  O O     . GLY A 1 298 ? 37.013  161.869 21.242  1.00 22.96 ? 298  GLY A O     1 
ATOM   2302  N N     . ASP A 1 299 ? 37.081  159.654 21.601  1.00 21.53 ? 299  ASP A N     1 
ATOM   2303  C CA    . ASP A 1 299 ? 36.645  159.772 22.998  1.00 20.72 ? 299  ASP A CA    1 
ATOM   2304  C C     . ASP A 1 299 ? 37.725  160.454 23.830  1.00 20.33 ? 299  ASP A C     1 
ATOM   2305  O O     . ASP A 1 299 ? 38.925  160.147 23.686  1.00 19.93 ? 299  ASP A O     1 
ATOM   2306  C CB    . ASP A 1 299 ? 36.373  158.403 23.606  1.00 20.98 ? 299  ASP A CB    1 
ATOM   2307  C CG    . ASP A 1 299 ? 35.053  157.778 23.132  1.00 22.23 ? 299  ASP A CG    1 
ATOM   2308  O OD1   . ASP A 1 299 ? 34.221  158.446 22.465  1.00 21.23 ? 299  ASP A OD1   1 
ATOM   2309  O OD2   . ASP A 1 299 ? 34.862  156.584 23.443  1.00 22.63 ? 299  ASP A OD2   1 
ATOM   2310  N N     . ILE A 1 300 ? 37.317  161.374 24.703  1.00 19.98 ? 300  ILE A N     1 
ATOM   2311  C CA    . ILE A 1 300 ? 38.278  162.007 25.611  1.00 19.93 ? 300  ILE A CA    1 
ATOM   2312  C C     . ILE A 1 300 ? 38.241  161.210 26.898  1.00 19.59 ? 300  ILE A C     1 
ATOM   2313  O O     . ILE A 1 300 ? 37.202  161.103 27.516  1.00 19.82 ? 300  ILE A O     1 
ATOM   2314  C CB    . ILE A 1 300 ? 37.992  163.511 25.847  1.00 19.79 ? 300  ILE A CB    1 
ATOM   2315  C CG1   . ILE A 1 300 ? 37.767  164.261 24.522  1.00 21.50 ? 300  ILE A CG1   1 
ATOM   2316  C CG2   . ILE A 1 300 ? 39.103  164.170 26.689  1.00 19.83 ? 300  ILE A CG2   1 
ATOM   2317  C CD1   . ILE A 1 300 ? 38.975  164.289 23.534  1.00 22.76 ? 300  ILE A CD1   1 
ATOM   2318  N N     . TYR A 1 301 ? 39.378  160.624 27.274  1.00 19.47 ? 301  TYR A N     1 
ATOM   2319  C CA    . TYR A 1 301 ? 39.444  159.726 28.424  1.00 19.25 ? 301  TYR A CA    1 
ATOM   2320  C C     . TYR A 1 301 ? 40.247  160.322 29.573  1.00 19.14 ? 301  TYR A C     1 
ATOM   2321  O O     . TYR A 1 301 ? 41.336  160.901 29.360  1.00 19.41 ? 301  TYR A O     1 
ATOM   2322  C CB    . TYR A 1 301 ? 40.062  158.390 27.988  1.00 19.68 ? 301  TYR A CB    1 
ATOM   2323  C CG    . TYR A 1 301 ? 40.416  157.446 29.103  1.00 18.23 ? 301  TYR A CG    1 
ATOM   2324  C CD1   . TYR A 1 301 ? 41.741  157.336 29.543  1.00 18.84 ? 301  TYR A CD1   1 
ATOM   2325  C CD2   . TYR A 1 301 ? 39.447  156.646 29.701  1.00 16.99 ? 301  TYR A CD2   1 
ATOM   2326  C CE1   . TYR A 1 301 ? 42.098  156.443 30.551  1.00 17.61 ? 301  TYR A CE1   1 
ATOM   2327  C CE2   . TYR A 1 301 ? 39.775  155.757 30.730  1.00 16.83 ? 301  TYR A CE2   1 
ATOM   2328  C CZ    . TYR A 1 301 ? 41.117  155.671 31.144  1.00 19.18 ? 301  TYR A CZ    1 
ATOM   2329  O OH    . TYR A 1 301 ? 41.479  154.812 32.137  1.00 20.10 ? 301  TYR A OH    1 
ATOM   2330  N N     . TRP A 1 302 ? 39.720  160.174 30.788  1.00 18.66 ? 302  TRP A N     1 
ATOM   2331  C CA    . TRP A 1 302 ? 40.395  160.708 31.986  1.00 18.21 ? 302  TRP A CA    1 
ATOM   2332  C C     . TRP A 1 302 ? 40.450  159.735 33.143  1.00 18.09 ? 302  TRP A C     1 
ATOM   2333  O O     . TRP A 1 302 ? 39.455  159.474 33.796  1.00 18.05 ? 302  TRP A O     1 
ATOM   2334  C CB    . TRP A 1 302 ? 39.792  162.050 32.444  1.00 17.22 ? 302  TRP A CB    1 
ATOM   2335  C CG    . TRP A 1 302 ? 40.563  162.681 33.585  1.00 17.12 ? 302  TRP A CG    1 
ATOM   2336  C CD1   . TRP A 1 302 ? 41.875  162.440 33.932  1.00 15.70 ? 302  TRP A CD1   1 
ATOM   2337  C CD2   . TRP A 1 302 ? 40.096  163.709 34.488  1.00 17.61 ? 302  TRP A CD2   1 
ATOM   2338  N NE1   . TRP A 1 302 ? 42.234  163.229 35.004  1.00 15.51 ? 302  TRP A NE1   1 
ATOM   2339  C CE2   . TRP A 1 302 ? 41.168  164.020 35.360  1.00 17.82 ? 302  TRP A CE2   1 
ATOM   2340  C CE3   . TRP A 1 302 ? 38.871  164.388 34.648  1.00 18.19 ? 302  TRP A CE3   1 
ATOM   2341  C CZ2   . TRP A 1 302 ? 41.045  164.970 36.400  1.00 18.72 ? 302  TRP A CZ2   1 
ATOM   2342  C CZ3   . TRP A 1 302 ? 38.749  165.328 35.688  1.00 17.28 ? 302  TRP A CZ3   1 
ATOM   2343  C CH2   . TRP A 1 302 ? 39.833  165.610 36.546  1.00 17.03 ? 302  TRP A CH2   1 
ATOM   2344  N N     . CYS A 1 303 ? 41.644  159.207 33.384  1.00 18.83 ? 303  CYS A N     1 
ATOM   2345  C CA    . CYS A 1 303 ? 41.930  158.454 34.600  1.00 19.06 ? 303  CYS A CA    1 
ATOM   2346  C C     . CYS A 1 303 ? 42.665  159.398 35.572  1.00 19.67 ? 303  CYS A C     1 
ATOM   2347  O O     . CYS A 1 303 ? 43.688  159.990 35.200  1.00 20.77 ? 303  CYS A O     1 
ATOM   2348  C CB    . CYS A 1 303 ? 42.786  157.232 34.253  1.00 18.71 ? 303  CYS A CB    1 
ATOM   2349  S SG    . CYS A 1 303 ? 43.453  156.407 35.672  1.00 19.02 ? 303  CYS A SG    1 
ATOM   2350  N N     . THR A 1 304 ? 42.168  159.512 36.806  1.00 19.39 ? 304  THR A N     1 
ATOM   2351  C CA    . THR A 1 304 ? 42.718  160.436 37.814  1.00 19.74 ? 304  THR A CA    1 
ATOM   2352  C C     . THR A 1 304 ? 43.880  159.851 38.632  1.00 19.79 ? 304  THR A C     1 
ATOM   2353  O O     . THR A 1 304 ? 44.512  160.568 39.405  1.00 19.26 ? 304  THR A O     1 
ATOM   2354  C CB    . THR A 1 304 ? 41.625  160.890 38.809  1.00 19.10 ? 304  THR A CB    1 
ATOM   2355  O OG1   . THR A 1 304 ? 41.076  159.743 39.451  1.00 20.28 ? 304  THR A OG1   1 
ATOM   2356  C CG2   . THR A 1 304 ? 40.485  161.595 38.093  1.00 19.33 ? 304  THR A CG2   1 
ATOM   2357  N N     . ALA A 1 305 ? 44.146  158.554 38.467  1.00 19.80 ? 305  ALA A N     1 
ATOM   2358  C CA    . ALA A 1 305 ? 45.191  157.866 39.250  1.00 19.73 ? 305  ALA A CA    1 
ATOM   2359  C C     . ALA A 1 305 ? 46.591  158.370 38.963  1.00 20.15 ? 305  ALA A C     1 
ATOM   2360  O O     . ALA A 1 305 ? 46.935  158.652 37.810  1.00 20.37 ? 305  ALA A O     1 
ATOM   2361  C CB    . ALA A 1 305 ? 45.155  156.384 38.991  1.00 19.33 ? 305  ALA A CB    1 
ATOM   2362  N N     . ASP A 1 306 ? 47.405  158.428 40.011  1.00 19.20 ? 306  ASP A N     1 
ATOM   2363  C CA    . ASP A 1 306 ? 48.806  158.758 39.854  1.00 19.62 ? 306  ASP A CA    1 
ATOM   2364  C C     . ASP A 1 306 ? 49.590  157.766 39.013  1.00 19.21 ? 306  ASP A C     1 
ATOM   2365  O O     . ASP A 1 306 ? 49.379  156.555 39.071  1.00 19.34 ? 306  ASP A O     1 
ATOM   2366  C CB    . ASP A 1 306 ? 49.502  158.893 41.204  1.00 19.30 ? 306  ASP A CB    1 
ATOM   2367  C CG    . ASP A 1 306 ? 50.732  159.786 41.122  1.00 19.82 ? 306  ASP A CG    1 
ATOM   2368  O OD1   . ASP A 1 306 ? 51.892  159.287 40.991  1.00 17.73 ? 306  ASP A OD1   1 
ATOM   2369  O OD2   . ASP A 1 306 ? 50.512  160.998 41.169  1.00 20.17 ? 306  ASP A OD2   1 
ATOM   2370  N N     . VAL A 1 307 ? 50.535  158.312 38.271  1.00 18.90 ? 307  VAL A N     1 
ATOM   2371  C CA    . VAL A 1 307 ? 51.475  157.556 37.451  1.00 19.76 ? 307  VAL A CA    1 
ATOM   2372  C C     . VAL A 1 307 ? 52.331  156.589 38.301  1.00 19.98 ? 307  VAL A C     1 
ATOM   2373  O O     . VAL A 1 307 ? 52.794  155.549 37.816  1.00 20.05 ? 307  VAL A O     1 
ATOM   2374  C CB    . VAL A 1 307 ? 52.301  158.585 36.612  1.00 20.44 ? 307  VAL A CB    1 
ATOM   2375  C CG1   . VAL A 1 307 ? 53.481  159.185 37.398  1.00 20.50 ? 307  VAL A CG1   1 
ATOM   2376  C CG2   . VAL A 1 307 ? 52.720  158.015 35.329  1.00 21.85 ? 307  VAL A CG2   1 
ATOM   2377  N N     . GLY A 1 308 ? 52.486  156.918 39.586  1.00 20.06 ? 308  GLY A N     1 
ATOM   2378  C CA    . GLY A 1 308 ? 53.179  156.065 40.567  1.00 20.27 ? 308  GLY A CA    1 
ATOM   2379  C C     . GLY A 1 308 ? 52.469  154.805 41.039  1.00 20.75 ? 308  GLY A C     1 
ATOM   2380  O O     . GLY A 1 308 ? 53.081  153.978 41.746  1.00 20.71 ? 308  GLY A O     1 
ATOM   2381  N N     . TRP A 1 309 ? 51.185  154.658 40.660  1.00 20.68 ? 309  TRP A N     1 
ATOM   2382  C CA    . TRP A 1 309 ? 50.389  153.461 40.948  1.00 19.82 ? 309  TRP A CA    1 
ATOM   2383  C C     . TRP A 1 309 ? 50.082  152.678 39.670  1.00 18.80 ? 309  TRP A C     1 
ATOM   2384  O O     . TRP A 1 309 ? 50.079  153.253 38.592  1.00 18.76 ? 309  TRP A O     1 
ATOM   2385  C CB    . TRP A 1 309 ? 49.074  153.851 41.661  1.00 21.13 ? 309  TRP A CB    1 
ATOM   2386  C CG    . TRP A 1 309 ? 49.295  154.737 42.867  1.00 22.68 ? 309  TRP A CG    1 
ATOM   2387  C CD1   . TRP A 1 309 ? 48.755  155.982 43.089  1.00 22.70 ? 309  TRP A CD1   1 
ATOM   2388  C CD2   . TRP A 1 309 ? 50.140  154.458 43.995  1.00 22.16 ? 309  TRP A CD2   1 
ATOM   2389  N NE1   . TRP A 1 309 ? 49.214  156.484 44.284  1.00 22.59 ? 309  TRP A NE1   1 
ATOM   2390  C CE2   . TRP A 1 309 ? 50.050  155.567 44.867  1.00 22.80 ? 309  TRP A CE2   1 
ATOM   2391  C CE3   . TRP A 1 309 ? 50.943  153.364 44.366  1.00 25.04 ? 309  TRP A CE3   1 
ATOM   2392  C CZ2   . TRP A 1 309 ? 50.736  155.619 46.095  1.00 24.70 ? 309  TRP A CZ2   1 
ATOM   2393  C CZ3   . TRP A 1 309 ? 51.654  153.420 45.587  1.00 23.49 ? 309  TRP A CZ3   1 
ATOM   2394  C CH2   . TRP A 1 309 ? 51.537  154.549 46.433  1.00 23.78 ? 309  TRP A CH2   1 
ATOM   2395  N N     . VAL A 1 310 ? 49.783  151.381 39.798  1.00 17.56 ? 310  VAL A N     1 
ATOM   2396  C CA    . VAL A 1 310 ? 49.507  150.524 38.642  1.00 16.75 ? 310  VAL A CA    1 
ATOM   2397  C C     . VAL A 1 310 ? 48.380  151.057 37.727  1.00 17.46 ? 310  VAL A C     1 
ATOM   2398  O O     . VAL A 1 310 ? 48.437  150.907 36.504  1.00 16.74 ? 310  VAL A O     1 
ATOM   2399  C CB    . VAL A 1 310 ? 49.234  149.041 39.062  1.00 16.94 ? 310  VAL A CB    1 
ATOM   2400  C CG1   . VAL A 1 310 ? 47.870  148.878 39.831  1.00 13.89 ? 310  VAL A CG1   1 
ATOM   2401  C CG2   . VAL A 1 310 ? 49.346  148.113 37.841  1.00 17.07 ? 310  VAL A CG2   1 
ATOM   2402  N N     . THR A 1 311 ? 47.367  151.683 38.326  1.00 17.99 ? 311  THR A N     1 
ATOM   2403  C CA    . THR A 1 311 ? 46.243  152.228 37.563  1.00 18.06 ? 311  THR A CA    1 
ATOM   2404  C C     . THR A 1 311 ? 46.759  153.271 36.610  1.00 18.37 ? 311  THR A C     1 
ATOM   2405  O O     . THR A 1 311 ? 46.274  153.372 35.483  1.00 19.82 ? 311  THR A O     1 
ATOM   2406  C CB    . THR A 1 311 ? 45.148  152.833 38.501  1.00 18.08 ? 311  THR A CB    1 
ATOM   2407  O OG1   . THR A 1 311 ? 44.765  151.828 39.428  1.00 19.84 ? 311  THR A OG1   1 
ATOM   2408  C CG2   . THR A 1 311 ? 43.882  153.255 37.738  1.00 16.17 ? 311  THR A CG2   1 
ATOM   2409  N N     . GLY A 1 312 ? 47.740  154.047 37.074  1.00 19.16 ? 312  GLY A N     1 
ATOM   2410  C CA    . GLY A 1 312 ? 48.426  155.038 36.263  1.00 18.60 ? 312  GLY A CA    1 
ATOM   2411  C C     . GLY A 1 312 ? 49.308  154.421 35.185  1.00 18.94 ? 312  GLY A C     1 
ATOM   2412  O O     . GLY A 1 312 ? 49.493  155.015 34.139  1.00 20.18 ? 312  GLY A O     1 
ATOM   2413  N N     . HIS A 1 313 ? 49.872  153.245 35.434  1.00 18.11 ? 313  HIS A N     1 
ATOM   2414  C CA    . HIS A 1 313 ? 50.620  152.521 34.401  1.00 17.48 ? 313  HIS A CA    1 
ATOM   2415  C C     . HIS A 1 313 ? 49.646  152.006 33.336  1.00 17.13 ? 313  HIS A C     1 
ATOM   2416  O O     . HIS A 1 313 ? 49.783  152.336 32.170  1.00 17.54 ? 313  HIS A O     1 
ATOM   2417  C CB    . HIS A 1 313 ? 51.387  151.324 35.006  1.00 16.93 ? 313  HIS A CB    1 
ATOM   2418  C CG    . HIS A 1 313 ? 52.599  151.703 35.808  1.00 16.87 ? 313  HIS A CG    1 
ATOM   2419  N ND1   . HIS A 1 313 ? 52.595  152.705 36.755  1.00 16.83 ? 313  HIS A ND1   1 
ATOM   2420  C CD2   . HIS A 1 313 ? 53.839  151.165 35.841  1.00 17.85 ? 313  HIS A CD2   1 
ATOM   2421  C CE1   . HIS A 1 313 ? 53.792  152.791 37.308  1.00 18.10 ? 313  HIS A CE1   1 
ATOM   2422  N NE2   . HIS A 1 313 ? 54.563  151.858 36.779  1.00 17.91 ? 313  HIS A NE2   1 
ATOM   2423  N N     . SER A 1 314 ? 48.658  151.202 33.738  1.00 16.97 ? 314  SER A N     1 
ATOM   2424  C CA    . SER A 1 314 ? 47.832  150.475 32.760  1.00 16.56 ? 314  SER A CA    1 
ATOM   2425  C C     . SER A 1 314 ? 46.752  151.346 32.107  1.00 16.84 ? 314  SER A C     1 
ATOM   2426  O O     . SER A 1 314 ? 46.409  151.114 30.950  1.00 16.15 ? 314  SER A O     1 
ATOM   2427  C CB    . SER A 1 314 ? 47.177  149.220 33.374  1.00 16.69 ? 314  SER A CB    1 
ATOM   2428  O OG    . SER A 1 314 ? 48.120  148.325 33.970  1.00 17.22 ? 314  SER A OG    1 
ATOM   2429  N N     . TYR A 1 315 ? 46.200  152.317 32.850  1.00 16.97 ? 315  TYR A N     1 
ATOM   2430  C CA    . TYR A 1 315 ? 44.976  152.991 32.395  1.00 18.04 ? 315  TYR A CA    1 
ATOM   2431  C C     . TYR A 1 315 ? 45.072  154.513 32.312  1.00 18.84 ? 315  TYR A C     1 
ATOM   2432  O O     . TYR A 1 315 ? 44.154  155.161 31.856  1.00 20.66 ? 315  TYR A O     1 
ATOM   2433  C CB    . TYR A 1 315 ? 43.749  152.529 33.203  1.00 17.28 ? 315  TYR A CB    1 
ATOM   2434  C CG    . TYR A 1 315 ? 43.559  151.028 33.097  1.00 16.79 ? 315  TYR A CG    1 
ATOM   2435  C CD1   . TYR A 1 315 ? 43.828  150.180 34.192  1.00 14.81 ? 315  TYR A CD1   1 
ATOM   2436  C CD2   . TYR A 1 315 ? 43.177  150.444 31.886  1.00 15.71 ? 315  TYR A CD2   1 
ATOM   2437  C CE1   . TYR A 1 315 ? 43.700  148.798 34.077  1.00 11.25 ? 315  TYR A CE1   1 
ATOM   2438  C CE2   . TYR A 1 315 ? 43.021  149.051 31.777  1.00 15.46 ? 315  TYR A CE2   1 
ATOM   2439  C CZ    . TYR A 1 315 ? 43.297  148.248 32.867  1.00 14.04 ? 315  TYR A CZ    1 
ATOM   2440  O OH    . TYR A 1 315 ? 43.148  146.884 32.749  1.00 16.00 ? 315  TYR A OH    1 
ATOM   2441  N N     . LEU A 1 316 ? 46.188  155.073 32.739  1.00 19.13 ? 316  LEU A N     1 
ATOM   2442  C CA    . LEU A 1 316 ? 46.506  156.458 32.407  1.00 19.69 ? 316  LEU A CA    1 
ATOM   2443  C C     . LEU A 1 316 ? 47.300  156.457 31.119  1.00 19.21 ? 316  LEU A C     1 
ATOM   2444  O O     . LEU A 1 316 ? 46.993  157.201 30.185  1.00 19.35 ? 316  LEU A O     1 
ATOM   2445  C CB    . LEU A 1 316 ? 47.288  157.145 33.527  1.00 19.09 ? 316  LEU A CB    1 
ATOM   2446  C CG    . LEU A 1 316 ? 47.588  158.631 33.265  1.00 22.78 ? 316  LEU A CG    1 
ATOM   2447  C CD1   . LEU A 1 316 ? 46.501  159.503 33.829  1.00 23.42 ? 316  LEU A CD1   1 
ATOM   2448  C CD2   . LEU A 1 316 ? 48.910  159.020 33.886  1.00 23.56 ? 316  LEU A CD2   1 
ATOM   2449  N N     . LEU A 1 317 ? 48.300  155.586 31.051  1.00 19.36 ? 317  LEU A N     1 
ATOM   2450  C CA    . LEU A 1 317 ? 49.242  155.650 29.951  1.00 19.25 ? 317  LEU A CA    1 
ATOM   2451  C C     . LEU A 1 317 ? 49.127  154.531 28.946  1.00 19.17 ? 317  LEU A C     1 
ATOM   2452  O O     . LEU A 1 317 ? 48.792  154.786 27.794  1.00 19.47 ? 317  LEU A O     1 
ATOM   2453  C CB    . LEU A 1 317 ? 50.666  155.694 30.487  1.00 20.54 ? 317  LEU A CB    1 
ATOM   2454  C CG    . LEU A 1 317 ? 51.081  157.016 31.110  1.00 23.15 ? 317  LEU A CG    1 
ATOM   2455  C CD1   . LEU A 1 317 ? 52.598  156.945 31.389  1.00 24.25 ? 317  LEU A CD1   1 
ATOM   2456  C CD2   . LEU A 1 317 ? 50.719  158.187 30.157  1.00 24.34 ? 317  LEU A CD2   1 
ATOM   2457  N N     . TYR A 1 318 ? 49.389  153.297 29.377  1.00 18.18 ? 318  TYR A N     1 
ATOM   2458  C CA    . TYR A 1 318 ? 49.686  152.214 28.440  1.00 17.65 ? 318  TYR A CA    1 
ATOM   2459  C C     . TYR A 1 318 ? 48.490  151.679 27.658  1.00 17.79 ? 318  TYR A C     1 
ATOM   2460  O O     . TYR A 1 318 ? 48.555  151.591 26.442  1.00 16.15 ? 318  TYR A O     1 
ATOM   2461  C CB    . TYR A 1 318 ? 50.483  151.086 29.121  1.00 17.19 ? 318  TYR A CB    1 
ATOM   2462  C CG    . TYR A 1 318 ? 51.908  151.492 29.510  1.00 18.92 ? 318  TYR A CG    1 
ATOM   2463  C CD1   . TYR A 1 318 ? 52.651  152.369 28.714  1.00 17.65 ? 318  TYR A CD1   1 
ATOM   2464  C CD2   . TYR A 1 318 ? 52.517  150.982 30.666  1.00 18.61 ? 318  TYR A CD2   1 
ATOM   2465  C CE1   . TYR A 1 318 ? 53.955  152.726 29.054  1.00 18.38 ? 318  TYR A CE1   1 
ATOM   2466  C CE2   . TYR A 1 318 ? 53.834  151.328 31.004  1.00 18.53 ? 318  TYR A CE2   1 
ATOM   2467  C CZ    . TYR A 1 318 ? 54.536  152.210 30.194  1.00 19.26 ? 318  TYR A CZ    1 
ATOM   2468  O OH    . TYR A 1 318 ? 55.835  152.562 30.509  1.00 20.96 ? 318  TYR A OH    1 
ATOM   2469  N N     . GLY A 1 319 ? 47.416  151.310 28.367  1.00 18.23 ? 319  GLY A N     1 
ATOM   2470  C CA    . GLY A 1 319 ? 46.144  150.915 27.741  1.00 18.48 ? 319  GLY A CA    1 
ATOM   2471  C C     . GLY A 1 319 ? 45.609  151.963 26.771  1.00 18.62 ? 319  GLY A C     1 
ATOM   2472  O O     . GLY A 1 319 ? 45.306  151.630 25.620  1.00 19.40 ? 319  GLY A O     1 
ATOM   2473  N N     . PRO A 1 320 ? 45.431  153.216 27.227  1.00 17.88 ? 320  PRO A N     1 
ATOM   2474  C CA    . PRO A 1 320 ? 44.922  154.265 26.320  1.00 18.34 ? 320  PRO A CA    1 
ATOM   2475  C C     . PRO A 1 320 ? 45.807  154.535 25.110  1.00 17.82 ? 320  PRO A C     1 
ATOM   2476  O O     . PRO A 1 320 ? 45.290  154.629 24.016  1.00 18.54 ? 320  PRO A O     1 
ATOM   2477  C CB    . PRO A 1 320 ? 44.859  155.540 27.195  1.00 17.70 ? 320  PRO A CB    1 
ATOM   2478  C CG    . PRO A 1 320 ? 44.960  155.086 28.589  1.00 18.29 ? 320  PRO A CG    1 
ATOM   2479  C CD    . PRO A 1 320 ? 45.585  153.693 28.605  1.00 19.13 ? 320  PRO A CD    1 
ATOM   2480  N N     . LEU A 1 321 ? 47.116  154.688 25.304  1.00 17.09 ? 321  LEU A N     1 
ATOM   2481  C CA    . LEU A 1 321 ? 47.989  155.030 24.180  1.00 16.92 ? 321  LEU A CA    1 
ATOM   2482  C C     . LEU A 1 321 ? 48.096  153.894 23.185  1.00 16.60 ? 321  LEU A C     1 
ATOM   2483  O O     . LEU A 1 321 ? 48.131  154.150 21.986  1.00 16.82 ? 321  LEU A O     1 
ATOM   2484  C CB    . LEU A 1 321 ? 49.370  155.517 24.630  1.00 15.94 ? 321  LEU A CB    1 
ATOM   2485  C CG    . LEU A 1 321 ? 49.366  156.796 25.484  1.00 16.85 ? 321  LEU A CG    1 
ATOM   2486  C CD1   . LEU A 1 321 ? 50.784  157.128 25.994  1.00 14.70 ? 321  LEU A CD1   1 
ATOM   2487  C CD2   . LEU A 1 321 ? 48.774  157.956 24.739  1.00 15.03 ? 321  LEU A CD2   1 
ATOM   2488  N N     . ALA A 1 322 ? 48.125  152.657 23.675  1.00 16.15 ? 322  ALA A N     1 
ATOM   2489  C CA    . ALA A 1 322 ? 48.071  151.507 22.796  1.00 17.95 ? 322  ALA A CA    1 
ATOM   2490  C C     . ALA A 1 322 ? 46.876  151.609 21.871  1.00 18.70 ? 322  ALA A C     1 
ATOM   2491  O O     . ALA A 1 322 ? 46.970  151.258 20.703  1.00 19.13 ? 322  ALA A O     1 
ATOM   2492  C CB    . ALA A 1 322 ? 48.048  150.184 23.582  1.00 17.42 ? 322  ALA A CB    1 
ATOM   2493  N N     . CYS A 1 323 ? 45.754  152.114 22.390  1.00 19.57 ? 323  CYS A N     1 
ATOM   2494  C CA    . CYS A 1 323 ? 44.512  152.150 21.615  1.00 19.95 ? 323  CYS A CA    1 
ATOM   2495  C C     . CYS A 1 323 ? 44.368  153.413 20.779  1.00 20.13 ? 323  CYS A C     1 
ATOM   2496  O O     . CYS A 1 323 ? 43.444  153.503 19.977  1.00 19.29 ? 323  CYS A O     1 
ATOM   2497  C CB    . CYS A 1 323 ? 43.294  151.964 22.523  1.00 19.77 ? 323  CYS A CB    1 
ATOM   2498  S SG    . CYS A 1 323 ? 43.122  150.249 23.069  1.00 20.66 ? 323  CYS A SG    1 
ATOM   2499  N N     . GLY A 1 324 ? 45.290  154.368 20.946  1.00 19.72 ? 324  GLY A N     1 
ATOM   2500  C CA    . GLY A 1 324 ? 45.258  155.604 20.156  1.00 19.71 ? 324  GLY A CA    1 
ATOM   2501  C C     . GLY A 1 324 ? 44.309  156.643 20.726  1.00 19.75 ? 324  GLY A C     1 
ATOM   2502  O O     . GLY A 1 324 ? 43.862  157.562 20.020  1.00 19.84 ? 324  GLY A O     1 
ATOM   2503  N N     . ALA A 1 325 ? 44.006  156.509 22.017  1.00 19.41 ? 325  ALA A N     1 
ATOM   2504  C CA    . ALA A 1 325 ? 43.102  157.437 22.723  1.00 18.04 ? 325  ALA A CA    1 
ATOM   2505  C C     . ALA A 1 325 ? 43.755  158.771 23.010  1.00 17.41 ? 325  ALA A C     1 
ATOM   2506  O O     . ALA A 1 325 ? 44.979  158.899 22.990  1.00 17.57 ? 325  ALA A O     1 
ATOM   2507  C CB    . ALA A 1 325 ? 42.618  156.807 24.054  1.00 17.76 ? 325  ALA A CB    1 
ATOM   2508  N N     . THR A 1 326 ? 42.919  159.760 23.293  1.00 17.11 ? 326  THR A N     1 
ATOM   2509  C CA    . THR A 1 326 ? 43.338  160.970 23.968  1.00 16.41 ? 326  THR A CA    1 
ATOM   2510  C C     . THR A 1 326 ? 43.158  160.702 25.468  1.00 17.13 ? 326  THR A C     1 
ATOM   2511  O O     . THR A 1 326 ? 42.056  160.450 25.910  1.00 17.09 ? 326  THR A O     1 
ATOM   2512  C CB    . THR A 1 326 ? 42.475  162.157 23.551  1.00 15.86 ? 326  THR A CB    1 
ATOM   2513  O OG1   . THR A 1 326 ? 42.655  162.404 22.150  1.00 16.77 ? 326  THR A OG1   1 
ATOM   2514  C CG2   . THR A 1 326 ? 42.840  163.409 24.338  1.00 14.66 ? 326  THR A CG2   1 
ATOM   2515  N N     . THR A 1 327 ? 44.254  160.752 26.227  1.00 16.99 ? 327  THR A N     1 
ATOM   2516  C CA    . THR A 1 327 ? 44.227  160.487 27.653  1.00 17.21 ? 327  THR A CA    1 
ATOM   2517  C C     . THR A 1 327 ? 44.578  161.766 28.412  1.00 17.91 ? 327  THR A C     1 
ATOM   2518  O O     . THR A 1 327 ? 45.441  162.521 27.993  1.00 18.46 ? 327  THR A O     1 
ATOM   2519  C CB    . THR A 1 327 ? 45.146  159.272 28.033  1.00 16.81 ? 327  THR A CB    1 
ATOM   2520  O OG1   . THR A 1 327 ? 44.878  158.867 29.380  1.00 16.54 ? 327  THR A OG1   1 
ATOM   2521  C CG2   . THR A 1 327 ? 46.664  159.600 27.881  1.00 17.28 ? 327  THR A CG2   1 
ATOM   2522  N N     . LEU A 1 328 ? 43.877  162.040 29.502  1.00 17.98 ? 328  LEU A N     1 
ATOM   2523  C CA    . LEU A 1 328 ? 44.114  163.277 30.233  1.00 18.08 ? 328  LEU A CA    1 
ATOM   2524  C C     . LEU A 1 328 ? 44.972  163.000 31.481  1.00 18.04 ? 328  LEU A C     1 
ATOM   2525  O O     . LEU A 1 328 ? 44.703  162.071 32.257  1.00 18.39 ? 328  LEU A O     1 
ATOM   2526  C CB    . LEU A 1 328 ? 42.776  163.955 30.590  1.00 17.94 ? 328  LEU A CB    1 
ATOM   2527  C CG    . LEU A 1 328 ? 42.670  165.420 31.078  1.00 18.52 ? 328  LEU A CG    1 
ATOM   2528  C CD1   . LEU A 1 328 ? 41.225  165.848 30.987  1.00 19.51 ? 328  LEU A CD1   1 
ATOM   2529  C CD2   . LEU A 1 328 ? 43.160  165.639 32.499  1.00 17.61 ? 328  LEU A CD2   1 
ATOM   2530  N N     . MET A 1 329 ? 46.016  163.797 31.657  1.00 17.87 ? 329  MET A N     1 
ATOM   2531  C CA    . MET A 1 329 ? 46.843  163.712 32.852  1.00 18.07 ? 329  MET A CA    1 
ATOM   2532  C C     . MET A 1 329 ? 46.649  164.969 33.685  1.00 17.43 ? 329  MET A C     1 
ATOM   2533  O O     . MET A 1 329 ? 46.968  166.078 33.245  1.00 17.98 ? 329  MET A O     1 
ATOM   2534  C CB    . MET A 1 329 ? 48.323  163.504 32.490  1.00 17.27 ? 329  MET A CB    1 
ATOM   2535  C CG    . MET A 1 329 ? 49.232  163.640 33.695  1.00 18.44 ? 329  MET A CG    1 
ATOM   2536  S SD    . MET A 1 329 ? 50.993  163.663 33.346  1.00 20.47 ? 329  MET A SD    1 
ATOM   2537  C CE    . MET A 1 329 ? 51.313  161.909 33.124  1.00 19.81 ? 329  MET A CE    1 
ATOM   2538  N N     . PHE A 1 330 ? 46.100  164.808 34.875  1.00 17.16 ? 330  PHE A N     1 
ATOM   2539  C CA    . PHE A 1 330 ? 45.820  165.959 35.734  1.00 17.16 ? 330  PHE A CA    1 
ATOM   2540  C C     . PHE A 1 330 ? 46.896  166.061 36.798  1.00 17.04 ? 330  PHE A C     1 
ATOM   2541  O O     . PHE A 1 330 ? 47.237  165.077 37.421  1.00 16.64 ? 330  PHE A O     1 
ATOM   2542  C CB    . PHE A 1 330 ? 44.418  165.818 36.331  1.00 16.78 ? 330  PHE A CB    1 
ATOM   2543  C CG    . PHE A 1 330 ? 44.037  166.890 37.324  1.00 16.68 ? 330  PHE A CG    1 
ATOM   2544  C CD1   . PHE A 1 330 ? 44.201  168.249 37.035  1.00 18.01 ? 330  PHE A CD1   1 
ATOM   2545  C CD2   . PHE A 1 330 ? 43.445  166.536 38.530  1.00 15.67 ? 330  PHE A CD2   1 
ATOM   2546  C CE1   . PHE A 1 330 ? 43.813  169.237 37.962  1.00 17.60 ? 330  PHE A CE1   1 
ATOM   2547  C CE2   . PHE A 1 330 ? 43.036  167.510 39.441  1.00 14.70 ? 330  PHE A CE2   1 
ATOM   2548  C CZ    . PHE A 1 330 ? 43.227  168.858 39.162  1.00 15.69 ? 330  PHE A CZ    1 
ATOM   2549  N N     . GLU A 1 331 ? 47.442  167.253 36.987  1.00 17.67 ? 331  GLU A N     1 
ATOM   2550  C CA    . GLU A 1 331 ? 48.554  167.440 37.916  1.00 17.45 ? 331  GLU A CA    1 
ATOM   2551  C C     . GLU A 1 331 ? 48.117  167.490 39.399  1.00 18.33 ? 331  GLU A C     1 
ATOM   2552  O O     . GLU A 1 331 ? 48.917  167.199 40.310  1.00 16.96 ? 331  GLU A O     1 
ATOM   2553  C CB    . GLU A 1 331 ? 49.290  168.736 37.553  1.00 17.60 ? 331  GLU A CB    1 
ATOM   2554  C CG    . GLU A 1 331 ? 50.629  168.982 38.310  1.00 17.54 ? 331  GLU A CG    1 
ATOM   2555  C CD    . GLU A 1 331 ? 51.312  170.262 37.893  1.00 17.14 ? 331  GLU A CD    1 
ATOM   2556  O OE1   . GLU A 1 331 ? 50.606  171.268 37.663  1.00 13.83 ? 331  GLU A OE1   1 
ATOM   2557  O OE2   . GLU A 1 331 ? 52.562  170.269 37.795  1.00 18.18 ? 331  GLU A OE2   1 
ATOM   2558  N N     . GLY A 1 332 ? 46.873  167.917 39.636  1.00 18.80 ? 332  GLY A N     1 
ATOM   2559  C CA    . GLY A 1 332 ? 46.454  168.305 40.984  1.00 19.00 ? 332  GLY A CA    1 
ATOM   2560  C C     . GLY A 1 332 ? 45.514  167.321 41.657  1.00 19.94 ? 332  GLY A C     1 
ATOM   2561  O O     . GLY A 1 332 ? 45.643  166.102 41.528  1.00 18.73 ? 332  GLY A O     1 
ATOM   2562  N N     . VAL A 1 333 ? 44.559  167.871 42.392  1.00 20.02 ? 333  VAL A N     1 
ATOM   2563  C CA    . VAL A 1 333 ? 43.582  167.066 43.108  1.00 21.25 ? 333  VAL A CA    1 
ATOM   2564  C C     . VAL A 1 333 ? 42.155  167.517 42.709  1.00 21.60 ? 333  VAL A C     1 
ATOM   2565  O O     . VAL A 1 333 ? 41.944  168.699 42.372  1.00 21.78 ? 333  VAL A O     1 
ATOM   2566  C CB    . VAL A 1 333 ? 43.814  167.133 44.667  1.00 21.44 ? 333  VAL A CB    1 
ATOM   2567  C CG1   . VAL A 1 333 ? 45.244  166.659 45.038  1.00 21.24 ? 333  VAL A CG1   1 
ATOM   2568  C CG2   . VAL A 1 333 ? 43.596  168.529 45.168  1.00 21.91 ? 333  VAL A CG2   1 
ATOM   2569  N N     . PRO A 1 334 ? 41.189  166.580 42.731  1.00 21.87 ? 334  PRO A N     1 
ATOM   2570  C CA    . PRO A 1 334 ? 39.811  166.788 42.244  1.00 21.57 ? 334  PRO A CA    1 
ATOM   2571  C C     . PRO A 1 334 ? 39.015  167.865 42.968  1.00 21.36 ? 334  PRO A C     1 
ATOM   2572  O O     . PRO A 1 334 ? 38.011  168.330 42.450  1.00 20.45 ? 334  PRO A O     1 
ATOM   2573  C CB    . PRO A 1 334 ? 39.145  165.420 42.470  1.00 21.67 ? 334  PRO A CB    1 
ATOM   2574  C CG    . PRO A 1 334 ? 39.981  164.753 43.509  1.00 22.79 ? 334  PRO A CG    1 
ATOM   2575  C CD    . PRO A 1 334 ? 41.393  165.186 43.181  1.00 21.55 ? 334  PRO A CD    1 
ATOM   2576  N N     . ASN A 1 335 ? 39.455  168.245 44.162  1.00 21.70 ? 335  ASN A N     1 
ATOM   2577  C CA    . ASN A 1 335 ? 38.768  169.259 44.925  1.00 21.86 ? 335  ASN A CA    1 
ATOM   2578  C C     . ASN A 1 335 ? 39.648  170.475 45.283  1.00 22.05 ? 335  ASN A C     1 
ATOM   2579  O O     . ASN A 1 335 ? 39.438  171.105 46.317  1.00 21.35 ? 335  ASN A O     1 
ATOM   2580  C CB    . ASN A 1 335 ? 38.123  168.629 46.171  1.00 21.95 ? 335  ASN A CB    1 
ATOM   2581  C CG    . ASN A 1 335 ? 39.112  167.825 47.011  1.00 23.04 ? 335  ASN A CG    1 
ATOM   2582  O OD1   . ASN A 1 335 ? 38.728  167.181 48.001  1.00 27.45 ? 335  ASN A OD1   1 
ATOM   2583  N ND2   . ASN A 1 335 ? 40.381  167.873 46.644  1.00 17.98 ? 335  ASN A ND2   1 
ATOM   2584  N N     . TRP A 1 336 ? 40.640  170.791 44.445  1.00 22.11 ? 336  TRP A N     1 
ATOM   2585  C CA    . TRP A 1 336 ? 41.376  172.046 44.628  1.00 22.55 ? 336  TRP A CA    1 
ATOM   2586  C C     . TRP A 1 336 ? 41.454  172.822 43.332  1.00 21.98 ? 336  TRP A C     1 
ATOM   2587  O O     . TRP A 1 336 ? 41.854  172.255 42.320  1.00 22.21 ? 336  TRP A O     1 
ATOM   2588  C CB    . TRP A 1 336 ? 42.775  171.817 45.198  1.00 23.30 ? 336  TRP A CB    1 
ATOM   2589  C CG    . TRP A 1 336 ? 43.411  173.103 45.659  1.00 24.74 ? 336  TRP A CG    1 
ATOM   2590  C CD1   . TRP A 1 336 ? 43.359  173.636 46.919  1.00 25.55 ? 336  TRP A CD1   1 
ATOM   2591  C CD2   . TRP A 1 336 ? 44.168  174.032 44.856  1.00 24.13 ? 336  TRP A CD2   1 
ATOM   2592  N NE1   . TRP A 1 336 ? 44.040  174.837 46.947  1.00 25.80 ? 336  TRP A NE1   1 
ATOM   2593  C CE2   . TRP A 1 336 ? 44.552  175.095 45.700  1.00 25.31 ? 336  TRP A CE2   1 
ATOM   2594  C CE3   . TRP A 1 336 ? 44.571  174.053 43.510  1.00 25.43 ? 336  TRP A CE3   1 
ATOM   2595  C CZ2   . TRP A 1 336 ? 45.320  176.184 45.244  1.00 25.94 ? 336  TRP A CZ2   1 
ATOM   2596  C CZ3   . TRP A 1 336 ? 45.326  175.147 43.046  1.00 26.14 ? 336  TRP A CZ3   1 
ATOM   2597  C CH2   . TRP A 1 336 ? 45.693  176.195 43.919  1.00 25.88 ? 336  TRP A CH2   1 
ATOM   2598  N N     . PRO A 1 337 ? 41.126  174.134 43.357  1.00 21.83 ? 337  PRO A N     1 
ATOM   2599  C CA    . PRO A 1 337 ? 40.792  175.051 44.476  1.00 21.68 ? 337  PRO A CA    1 
ATOM   2600  C C     . PRO A 1 337 ? 39.463  174.822 45.201  1.00 21.89 ? 337  PRO A C     1 
ATOM   2601  O O     . PRO A 1 337 ? 39.328  175.248 46.344  1.00 22.03 ? 337  PRO A O     1 
ATOM   2602  C CB    . PRO A 1 337 ? 40.779  176.446 43.821  1.00 21.20 ? 337  PRO A CB    1 
ATOM   2603  C CG    . PRO A 1 337 ? 41.401  176.284 42.492  1.00 22.13 ? 337  PRO A CG    1 
ATOM   2604  C CD    . PRO A 1 337 ? 41.141  174.852 42.073  1.00 21.62 ? 337  PRO A CD    1 
ATOM   2605  N N     . THR A 1 338 ? 38.493  174.182 44.543  1.00 21.64 ? 338  THR A N     1 
ATOM   2606  C CA    . THR A 1 338 ? 37.180  173.955 45.139  1.00 21.66 ? 338  THR A CA    1 
ATOM   2607  C C     . THR A 1 338 ? 36.726  172.533 44.809  1.00 21.15 ? 338  THR A C     1 
ATOM   2608  O O     . THR A 1 338 ? 37.271  171.925 43.907  1.00 21.36 ? 338  THR A O     1 
ATOM   2609  C CB    . THR A 1 338 ? 36.107  174.945 44.593  1.00 21.74 ? 338  THR A CB    1 
ATOM   2610  O OG1   . THR A 1 338 ? 35.832  174.637 43.220  1.00 21.33 ? 338  THR A OG1   1 
ATOM   2611  C CG2   . THR A 1 338 ? 36.560  176.386 44.713  1.00 21.53 ? 338  THR A CG2   1 
ATOM   2612  N N     . PRO A 1 339 ? 35.702  172.026 45.514  1.00 21.18 ? 339  PRO A N     1 
ATOM   2613  C CA    . PRO A 1 339 ? 35.107  170.701 45.235  1.00 20.53 ? 339  PRO A CA    1 
ATOM   2614  C C     . PRO A 1 339 ? 34.633  170.522 43.784  1.00 20.02 ? 339  PRO A C     1 
ATOM   2615  O O     . PRO A 1 339 ? 34.518  169.383 43.307  1.00 19.84 ? 339  PRO A O     1 
ATOM   2616  C CB    . PRO A 1 339 ? 33.889  170.652 46.173  1.00 20.08 ? 339  PRO A CB    1 
ATOM   2617  C CG    . PRO A 1 339 ? 34.210  171.610 47.272  1.00 21.10 ? 339  PRO A CG    1 
ATOM   2618  C CD    . PRO A 1 339 ? 35.016  172.717 46.635  1.00 21.12 ? 339  PRO A CD    1 
ATOM   2619  N N     . ALA A 1 340 ? 34.360  171.626 43.086  1.00 19.27 ? 340  ALA A N     1 
ATOM   2620  C CA    . ALA A 1 340 ? 33.891  171.551 41.702  1.00 18.74 ? 340  ALA A CA    1 
ATOM   2621  C C     . ALA A 1 340 ? 35.039  171.304 40.715  1.00 18.48 ? 340  ALA A C     1 
ATOM   2622  O O     . ALA A 1 340 ? 34.797  171.165 39.516  1.00 18.18 ? 340  ALA A O     1 
ATOM   2623  C CB    . ALA A 1 340 ? 33.104  172.818 41.322  1.00 18.38 ? 340  ALA A CB    1 
ATOM   2624  N N     . ARG A 1 341 ? 36.282  171.246 41.203  1.00 18.52 ? 341  ARG A N     1 
ATOM   2625  C CA    . ARG A 1 341 ? 37.417  171.143 40.278  1.00 18.55 ? 341  ARG A CA    1 
ATOM   2626  C C     . ARG A 1 341 ? 37.278  169.978 39.308  1.00 17.65 ? 341  ARG A C     1 
ATOM   2627  O O     . ARG A 1 341 ? 37.325  170.180 38.106  1.00 17.61 ? 341  ARG A O     1 
ATOM   2628  C CB    . ARG A 1 341 ? 38.783  171.085 40.978  1.00 18.80 ? 341  ARG A CB    1 
ATOM   2629  C CG    . ARG A 1 341 ? 39.960  171.105 39.973  1.00 18.70 ? 341  ARG A CG    1 
ATOM   2630  C CD    . ARG A 1 341 ? 40.070  172.488 39.315  1.00 18.13 ? 341  ARG A CD    1 
ATOM   2631  N NE    . ARG A 1 341 ? 41.011  172.542 38.201  1.00 17.64 ? 341  ARG A NE    1 
ATOM   2632  C CZ    . ARG A 1 341 ? 42.339  172.592 38.325  1.00 16.93 ? 341  ARG A CZ    1 
ATOM   2633  N NH1   . ARG A 1 341 ? 42.904  172.584 39.530  1.00 15.88 ? 341  ARG A NH1   1 
ATOM   2634  N NH2   . ARG A 1 341 ? 43.105  172.650 37.237  1.00 14.55 ? 341  ARG A NH2   1 
ATOM   2635  N N     . MET A 1 342 ? 37.084  168.765 39.812  1.00 17.43 ? 342  MET A N     1 
ATOM   2636  C CA    . MET A 1 342 ? 36.987  167.614 38.910  1.00 17.93 ? 342  MET A CA    1 
ATOM   2637  C C     . MET A 1 342 ? 35.992  167.817 37.762  1.00 18.32 ? 342  MET A C     1 
ATOM   2638  O O     . MET A 1 342 ? 36.322  167.529 36.609  1.00 18.46 ? 342  MET A O     1 
ATOM   2639  C CB    . MET A 1 342 ? 36.649  166.339 39.672  1.00 18.03 ? 342  MET A CB    1 
ATOM   2640  C CG    . MET A 1 342 ? 36.736  165.080 38.799  1.00 16.92 ? 342  MET A CG    1 
ATOM   2641  S SD    . MET A 1 342 ? 36.242  163.622 39.724  1.00 20.09 ? 342  MET A SD    1 
ATOM   2642  C CE    . MET A 1 342 ? 34.455  163.806 39.758  1.00 16.57 ? 342  MET A CE    1 
ATOM   2643  N N     . CYS A 1 343 ? 34.786  168.315 38.072  1.00 18.53 ? 343  CYS A N     1 
ATOM   2644  C CA    . CYS A 1 343 ? 33.763  168.537 37.040  1.00 19.23 ? 343  CYS A CA    1 
ATOM   2645  C C     . CYS A 1 343 ? 34.045  169.714 36.122  1.00 18.74 ? 343  CYS A C     1 
ATOM   2646  O O     . CYS A 1 343 ? 33.667  169.689 34.968  1.00 19.30 ? 343  CYS A O     1 
ATOM   2647  C CB    . CYS A 1 343 ? 32.356  168.619 37.647  1.00 18.88 ? 343  CYS A CB    1 
ATOM   2648  S SG    . CYS A 1 343 ? 31.832  167.026 38.269  1.00 22.69 ? 343  CYS A SG    1 
ATOM   2649  N N     . GLN A 1 344 ? 34.708  170.740 36.640  1.00 19.17 ? 344  GLN A N     1 
ATOM   2650  C CA    . GLN A 1 344 ? 35.293  171.805 35.812  1.00 19.13 ? 344  GLN A CA    1 
ATOM   2651  C C     . GLN A 1 344 ? 36.278  171.302 34.741  1.00 18.25 ? 344  GLN A C     1 
ATOM   2652  O O     . GLN A 1 344 ? 36.271  171.787 33.619  1.00 18.29 ? 344  GLN A O     1 
ATOM   2653  C CB    . GLN A 1 344 ? 35.952  172.873 36.703  1.00 18.43 ? 344  GLN A CB    1 
ATOM   2654  C CG    . GLN A 1 344 ? 34.912  173.609 37.559  1.00 20.49 ? 344  GLN A CG    1 
ATOM   2655  C CD    . GLN A 1 344 ? 35.503  174.492 38.645  1.00 21.01 ? 344  GLN A CD    1 
ATOM   2656  O OE1   . GLN A 1 344 ? 34.802  175.361 39.187  1.00 22.38 ? 344  GLN A OE1   1 
ATOM   2657  N NE2   . GLN A 1 344 ? 36.786  174.278 38.978  1.00 21.35 ? 344  GLN A NE2   1 
ATOM   2658  N N     . VAL A 1 345 ? 37.103  170.325 35.090  1.00 18.18 ? 345  VAL A N     1 
ATOM   2659  C CA    . VAL A 1 345 ? 38.104  169.765 34.150  1.00 17.84 ? 345  VAL A CA    1 
ATOM   2660  C C     . VAL A 1 345 ? 37.385  168.966 33.068  1.00 17.67 ? 345  VAL A C     1 
ATOM   2661  O O     . VAL A 1 345 ? 37.701  169.085 31.885  1.00 17.24 ? 345  VAL A O     1 
ATOM   2662  C CB    . VAL A 1 345 ? 39.171  168.869 34.899  1.00 18.07 ? 345  VAL A CB    1 
ATOM   2663  C CG1   . VAL A 1 345 ? 40.209  168.194 33.897  1.00 16.97 ? 345  VAL A CG1   1 
ATOM   2664  C CG2   . VAL A 1 345 ? 39.907  169.687 35.965  1.00 17.06 ? 345  VAL A CG2   1 
ATOM   2665  N N     . VAL A 1 346 ? 36.402  168.167 33.501  1.00 17.76 ? 346  VAL A N     1 
ATOM   2666  C CA    . VAL A 1 346 ? 35.491  167.429 32.613  1.00 17.40 ? 346  VAL A CA    1 
ATOM   2667  C C     . VAL A 1 346 ? 34.879  168.343 31.554  1.00 18.21 ? 346  VAL A C     1 
ATOM   2668  O O     . VAL A 1 346 ? 34.906  168.020 30.380  1.00 17.73 ? 346  VAL A O     1 
ATOM   2669  C CB    . VAL A 1 346 ? 34.402  166.694 33.443  1.00 17.56 ? 346  VAL A CB    1 
ATOM   2670  C CG1   . VAL A 1 346 ? 33.158  166.342 32.605  1.00 17.09 ? 346  VAL A CG1   1 
ATOM   2671  C CG2   . VAL A 1 346 ? 35.013  165.436 34.108  1.00 15.46 ? 346  VAL A CG2   1 
ATOM   2672  N N     . ASP A 1 347 ? 34.364  169.504 31.973  1.00 19.23 ? 347  ASP A N     1 
ATOM   2673  C CA    . ASP A 1 347 ? 33.780  170.478 31.042  1.00 19.78 ? 347  ASP A CA    1 
ATOM   2674  C C     . ASP A 1 347 ? 34.833  171.153 30.187  1.00 19.68 ? 347  ASP A C     1 
ATOM   2675  O O     . ASP A 1 347 ? 34.646  171.320 28.993  1.00 20.45 ? 347  ASP A O     1 
ATOM   2676  C CB    . ASP A 1 347 ? 33.050  171.590 31.806  1.00 20.31 ? 347  ASP A CB    1 
ATOM   2677  C CG    . ASP A 1 347 ? 31.729  171.137 32.400  1.00 21.07 ? 347  ASP A CG    1 
ATOM   2678  O OD1   . ASP A 1 347 ? 31.255  170.029 32.047  1.00 18.88 ? 347  ASP A OD1   1 
ATOM   2679  O OD2   . ASP A 1 347 ? 31.189  171.916 33.231  1.00 21.72 ? 347  ASP A OD2   1 
ATOM   2680  N N     . LYS A 1 348 ? 35.923  171.586 30.814  1.00 20.14 ? 348  LYS A N     1 
ATOM   2681  C CA    . LYS A 1 348 ? 36.969  172.324 30.109  1.00 19.86 ? 348  LYS A CA    1 
ATOM   2682  C C     . LYS A 1 348 ? 37.479  171.512 28.908  1.00 19.80 ? 348  LYS A C     1 
ATOM   2683  O O     . LYS A 1 348 ? 37.690  172.059 27.826  1.00 19.30 ? 348  LYS A O     1 
ATOM   2684  C CB    . LYS A 1 348 ? 38.105  172.648 31.072  1.00 20.28 ? 348  LYS A CB    1 
ATOM   2685  C CG    . LYS A 1 348 ? 39.189  173.557 30.480  1.00 21.64 ? 348  LYS A CG    1 
ATOM   2686  C CD    . LYS A 1 348 ? 40.363  173.682 31.445  1.00 22.81 ? 348  LYS A CD    1 
ATOM   2687  C CE    . LYS A 1 348 ? 41.510  174.460 30.834  1.00 23.78 ? 348  LYS A CE    1 
ATOM   2688  N NZ    . LYS A 1 348 ? 42.647  174.584 31.800  1.00 25.29 ? 348  LYS A NZ    1 
ATOM   2689  N N     . HIS A 1 349 ? 37.674  170.210 29.114  1.00 19.39 ? 349  HIS A N     1 
ATOM   2690  C CA    . HIS A 1 349 ? 38.235  169.338 28.083  1.00 20.00 ? 349  HIS A CA    1 
ATOM   2691  C C     . HIS A 1 349 ? 37.234  168.384 27.452  1.00 20.44 ? 349  HIS A C     1 
ATOM   2692  O O     . HIS A 1 349 ? 37.610  167.546 26.627  1.00 21.53 ? 349  HIS A O     1 
ATOM   2693  C CB    . HIS A 1 349 ? 39.433  168.572 28.622  1.00 19.42 ? 349  HIS A CB    1 
ATOM   2694  C CG    . HIS A 1 349 ? 40.509  169.464 29.153  1.00 17.87 ? 349  HIS A CG    1 
ATOM   2695  N ND1   . HIS A 1 349 ? 41.232  170.308 28.341  1.00 14.00 ? 349  HIS A ND1   1 
ATOM   2696  C CD2   . HIS A 1 349 ? 40.980  169.651 30.416  1.00 17.03 ? 349  HIS A CD2   1 
ATOM   2697  C CE1   . HIS A 1 349 ? 42.106  170.977 29.077  1.00 16.27 ? 349  HIS A CE1   1 
ATOM   2698  N NE2   . HIS A 1 349 ? 41.977  170.596 30.339  1.00 16.74 ? 349  HIS A NE2   1 
ATOM   2699  N N     . GLN A 1 350 ? 35.963  168.521 27.828  1.00 20.37 ? 350  GLN A N     1 
ATOM   2700  C CA    . GLN A 1 350 ? 34.896  167.689 27.294  1.00 20.08 ? 350  GLN A CA    1 
ATOM   2701  C C     . GLN A 1 350 ? 35.195  166.210 27.468  1.00 19.95 ? 350  GLN A C     1 
ATOM   2702  O O     . GLN A 1 350 ? 35.087  165.429 26.510  1.00 19.92 ? 350  GLN A O     1 
ATOM   2703  C CB    . GLN A 1 350 ? 34.629  168.036 25.816  1.00 20.25 ? 350  GLN A CB    1 
ATOM   2704  C CG    . GLN A 1 350 ? 34.186  169.483 25.630  1.00 19.99 ? 350  GLN A CG    1 
ATOM   2705  C CD    . GLN A 1 350 ? 32.754  169.694 26.045  1.00 21.57 ? 350  GLN A CD    1 
ATOM   2706  O OE1   . GLN A 1 350 ? 32.478  170.283 27.091  1.00 24.49 ? 350  GLN A OE1   1 
ATOM   2707  N NE2   . GLN A 1 350 ? 31.824  169.193 25.239  1.00 21.66 ? 350  GLN A NE2   1 
ATOM   2708  N N     . VAL A 1 351 ? 35.580  165.822 28.688  1.00 19.33 ? 351  VAL A N     1 
ATOM   2709  C CA    . VAL A 1 351 ? 35.857  164.402 28.984  1.00 18.63 ? 351  VAL A CA    1 
ATOM   2710  C C     . VAL A 1 351 ? 34.614  163.533 28.733  1.00 18.81 ? 351  VAL A C     1 
ATOM   2711  O O     . VAL A 1 351 ? 33.515  163.861 29.211  1.00 18.41 ? 351  VAL A O     1 
ATOM   2712  C CB    . VAL A 1 351 ? 36.358  164.214 30.436  1.00 19.02 ? 351  VAL A CB    1 
ATOM   2713  C CG1   . VAL A 1 351 ? 36.512  162.737 30.788  1.00 18.91 ? 351  VAL A CG1   1 
ATOM   2714  C CG2   . VAL A 1 351 ? 37.675  164.956 30.654  1.00 17.33 ? 351  VAL A CG2   1 
ATOM   2715  N N     . ASN A 1 352 ? 34.792  162.454 27.962  1.00 18.20 ? 352  ASN A N     1 
ATOM   2716  C CA    . ASN A 1 352 ? 33.720  161.467 27.710  1.00 18.44 ? 352  ASN A CA    1 
ATOM   2717  C C     . ASN A 1 352 ? 33.769  160.246 28.620  1.00 18.08 ? 352  ASN A C     1 
ATOM   2718  O O     . ASN A 1 352 ? 32.735  159.632 28.879  1.00 18.56 ? 352  ASN A O     1 
ATOM   2719  C CB    . ASN A 1 352 ? 33.722  160.984 26.257  1.00 17.82 ? 352  ASN A CB    1 
ATOM   2720  C CG    . ASN A 1 352 ? 33.780  162.127 25.263  1.00 18.94 ? 352  ASN A CG    1 
ATOM   2721  O OD1   . ASN A 1 352 ? 34.757  162.256 24.531  1.00 19.35 ? 352  ASN A OD1   1 
ATOM   2722  N ND2   . ASN A 1 352 ? 32.745  162.985 25.255  1.00 15.58 ? 352  ASN A ND2   1 
ATOM   2723  N N     . ILE A 1 353 ? 34.973  159.881 29.072  1.00 17.52 ? 353  ILE A N     1 
ATOM   2724  C CA    . ILE A 1 353 ? 35.164  158.762 29.981  1.00 16.81 ? 353  ILE A CA    1 
ATOM   2725  C C     . ILE A 1 353 ? 35.966  159.224 31.187  1.00 17.19 ? 353  ILE A C     1 
ATOM   2726  O O     . ILE A 1 353 ? 37.101  159.696 31.048  1.00 17.10 ? 353  ILE A O     1 
ATOM   2727  C CB    . ILE A 1 353 ? 35.876  157.550 29.283  1.00 17.44 ? 353  ILE A CB    1 
ATOM   2728  C CG1   . ILE A 1 353 ? 35.206  157.188 27.947  1.00 17.68 ? 353  ILE A CG1   1 
ATOM   2729  C CG2   . ILE A 1 353 ? 35.950  156.332 30.239  1.00 15.01 ? 353  ILE A CG2   1 
ATOM   2730  C CD1   . ILE A 1 353 ? 36.200  156.591 26.925  1.00 17.57 ? 353  ILE A CD1   1 
ATOM   2731  N N     . LEU A 1 354 ? 35.362  159.106 32.369  1.00 17.96 ? 354  LEU A N     1 
ATOM   2732  C CA    . LEU A 1 354 ? 35.993  159.487 33.639  1.00 18.59 ? 354  LEU A CA    1 
ATOM   2733  C C     . LEU A 1 354 ? 36.233  158.258 34.543  1.00 18.62 ? 354  LEU A C     1 
ATOM   2734  O O     . LEU A 1 354 ? 35.305  157.543 34.895  1.00 18.70 ? 354  LEU A O     1 
ATOM   2735  C CB    . LEU A 1 354 ? 35.144  160.522 34.375  1.00 18.62 ? 354  LEU A CB    1 
ATOM   2736  C CG    . LEU A 1 354 ? 35.579  160.916 35.797  1.00 20.29 ? 354  LEU A CG    1 
ATOM   2737  C CD1   . LEU A 1 354 ? 36.980  161.608 35.839  1.00 20.73 ? 354  LEU A CD1   1 
ATOM   2738  C CD2   . LEU A 1 354 ? 34.504  161.801 36.437  1.00 18.52 ? 354  LEU A CD2   1 
ATOM   2739  N N     . TYR A 1 355 ? 37.486  158.029 34.917  1.00 17.99 ? 355  TYR A N     1 
ATOM   2740  C CA    . TYR A 1 355 ? 37.840  156.844 35.704  1.00 18.05 ? 355  TYR A CA    1 
ATOM   2741  C C     . TYR A 1 355 ? 38.529  157.277 36.999  1.00 17.64 ? 355  TYR A C     1 
ATOM   2742  O O     . TYR A 1 355 ? 39.676  157.700 36.988  1.00 16.95 ? 355  TYR A O     1 
ATOM   2743  C CB    . TYR A 1 355 ? 38.732  155.918 34.855  1.00 17.47 ? 355  TYR A CB    1 
ATOM   2744  C CG    . TYR A 1 355 ? 39.172  154.617 35.483  1.00 17.18 ? 355  TYR A CG    1 
ATOM   2745  C CD1   . TYR A 1 355 ? 38.293  153.829 36.256  1.00 16.82 ? 355  TYR A CD1   1 
ATOM   2746  C CD2   . TYR A 1 355 ? 40.446  154.120 35.231  1.00 17.13 ? 355  TYR A CD2   1 
ATOM   2747  C CE1   . TYR A 1 355 ? 38.705  152.616 36.814  1.00 15.24 ? 355  TYR A CE1   1 
ATOM   2748  C CE2   . TYR A 1 355 ? 40.868  152.872 35.759  1.00 16.55 ? 355  TYR A CE2   1 
ATOM   2749  C CZ    . TYR A 1 355 ? 40.001  152.146 36.547  1.00 17.85 ? 355  TYR A CZ    1 
ATOM   2750  O OH    . TYR A 1 355 ? 40.437  150.950 37.059  1.00 18.56 ? 355  TYR A OH    1 
ATOM   2751  N N     . THR A 1 356 ? 37.821  157.165 38.116  1.00 17.76 ? 356  THR A N     1 
ATOM   2752  C CA    . THR A 1 356 ? 38.340  157.683 39.377  1.00 18.43 ? 356  THR A CA    1 
ATOM   2753  C C     . THR A 1 356 ? 38.302  156.693 40.544  1.00 19.27 ? 356  THR A C     1 
ATOM   2754  O O     . THR A 1 356 ? 38.187  155.501 40.321  1.00 20.15 ? 356  THR A O     1 
ATOM   2755  C CB    . THR A 1 356 ? 37.758  159.090 39.714  1.00 18.08 ? 356  THR A CB    1 
ATOM   2756  O OG1   . THR A 1 356 ? 38.558  159.704 40.732  1.00 18.16 ? 356  THR A OG1   1 
ATOM   2757  C CG2   . THR A 1 356 ? 36.294  159.024 40.146  1.00 18.01 ? 356  THR A CG2   1 
ATOM   2758  N N     . ALA A 1 357 ? 38.475  157.180 41.770  1.00 20.62 ? 357  ALA A N     1 
ATOM   2759  C CA    . ALA A 1 357 ? 38.575  156.346 42.963  1.00 20.83 ? 357  ALA A CA    1 
ATOM   2760  C C     . ALA A 1 357 ? 37.511  156.662 44.014  1.00 20.51 ? 357  ALA A C     1 
ATOM   2761  O O     . ALA A 1 357 ? 37.125  157.816 44.187  1.00 20.37 ? 357  ALA A O     1 
ATOM   2762  C CB    . ALA A 1 357 ? 39.970  156.509 43.582  1.00 21.10 ? 357  ALA A CB    1 
ATOM   2763  N N     . PRO A 1 358 ? 37.048  155.633 44.750  1.00 20.84 ? 358  PRO A N     1 
ATOM   2764  C CA    . PRO A 1 358 ? 36.051  155.886 45.796  1.00 21.02 ? 358  PRO A CA    1 
ATOM   2765  C C     . PRO A 1 358 ? 36.441  156.925 46.879  1.00 21.60 ? 358  PRO A C     1 
ATOM   2766  O O     . PRO A 1 358 ? 35.556  157.604 47.385  1.00 21.41 ? 358  PRO A O     1 
ATOM   2767  C CB    . PRO A 1 358 ? 35.818  154.493 46.403  1.00 20.89 ? 358  PRO A CB    1 
ATOM   2768  C CG    . PRO A 1 358 ? 36.129  153.543 45.252  1.00 20.46 ? 358  PRO A CG    1 
ATOM   2769  C CD    . PRO A 1 358 ? 37.344  154.192 44.620  1.00 20.51 ? 358  PRO A CD    1 
ATOM   2770  N N     . THR A 1 359 ? 37.725  157.062 47.232  1.00 21.61 ? 359  THR A N     1 
ATOM   2771  C CA    . THR A 1 359 ? 38.087  158.091 48.224  1.00 21.61 ? 359  THR A CA    1 
ATOM   2772  C C     . THR A 1 359 ? 37.790  159.484 47.682  1.00 20.88 ? 359  THR A C     1 
ATOM   2773  O O     . THR A 1 359 ? 37.241  160.323 48.380  1.00 21.22 ? 359  THR A O     1 
ATOM   2774  C CB    . THR A 1 359 ? 39.549  157.977 48.714  1.00 21.83 ? 359  THR A CB    1 
ATOM   2775  O OG1   . THR A 1 359 ? 39.718  156.729 49.395  1.00 23.71 ? 359  THR A OG1   1 
ATOM   2776  C CG2   . THR A 1 359 ? 39.869  159.108 49.702  1.00 21.79 ? 359  THR A CG2   1 
ATOM   2777  N N     . ALA A 1 360 ? 38.121  159.713 46.414  1.00 20.63 ? 360  ALA A N     1 
ATOM   2778  C CA    . ALA A 1 360 ? 37.862  161.004 45.778  1.00 19.76 ? 360  ALA A CA    1 
ATOM   2779  C C     . ALA A 1 360 ? 36.357  161.256 45.697  1.00 19.52 ? 360  ALA A C     1 
ATOM   2780  O O     . ALA A 1 360 ? 35.878  162.320 46.050  1.00 20.21 ? 360  ALA A O     1 
ATOM   2781  C CB    . ALA A 1 360 ? 38.505  161.047 44.406  1.00 19.37 ? 360  ALA A CB    1 
ATOM   2782  N N     . ILE A 1 361 ? 35.611  160.252 45.255  1.00 19.70 ? 361  ILE A N     1 
ATOM   2783  C CA    . ILE A 1 361 ? 34.141  160.323 45.193  1.00 19.08 ? 361  ILE A CA    1 
ATOM   2784  C C     . ILE A 1 361 ? 33.529  160.682 46.551  1.00 19.15 ? 361  ILE A C     1 
ATOM   2785  O O     . ILE A 1 361 ? 32.617  161.514 46.620  1.00 18.99 ? 361  ILE A O     1 
ATOM   2786  C CB    . ILE A 1 361 ? 33.519  158.993 44.641  1.00 18.42 ? 361  ILE A CB    1 
ATOM   2787  C CG1   . ILE A 1 361 ? 33.922  158.791 43.170  1.00 19.17 ? 361  ILE A CG1   1 
ATOM   2788  C CG2   . ILE A 1 361 ? 31.976  158.976 44.849  1.00 18.03 ? 361  ILE A CG2   1 
ATOM   2789  C CD1   . ILE A 1 361 ? 33.847  157.311 42.638  1.00 18.85 ? 361  ILE A CD1   1 
ATOM   2790  N N     . ARG A 1 362 ? 34.030  160.043 47.613  1.00 18.73 ? 362  ARG A N     1 
ATOM   2791  C CA    . ARG A 1 362 ? 33.523  160.260 48.967  1.00 18.70 ? 362  ARG A CA    1 
ATOM   2792  C C     . ARG A 1 362 ? 33.931  161.635 49.492  1.00 18.79 ? 362  ARG A C     1 
ATOM   2793  O O     . ARG A 1 362 ? 33.148  162.292 50.153  1.00 18.61 ? 362  ARG A O     1 
ATOM   2794  C CB    . ARG A 1 362 ? 34.016  159.163 49.909  1.00 18.34 ? 362  ARG A CB    1 
ATOM   2795  C CG    . ARG A 1 362 ? 33.368  157.804 49.649  1.00 18.36 ? 362  ARG A CG    1 
ATOM   2796  C CD    . ARG A 1 362 ? 33.720  156.805 50.751  1.00 20.39 ? 362  ARG A CD    1 
ATOM   2797  N NE    . ARG A 1 362 ? 35.158  156.519 50.778  1.00 22.75 ? 362  ARG A NE    1 
ATOM   2798  C CZ    . ARG A 1 362 ? 35.696  155.368 50.390  1.00 23.59 ? 362  ARG A CZ    1 
ATOM   2799  N NH1   . ARG A 1 362 ? 34.933  154.363 49.942  1.00 24.85 ? 362  ARG A NH1   1 
ATOM   2800  N NH2   . ARG A 1 362 ? 37.001  155.220 50.466  1.00 26.13 ? 362  ARG A NH2   1 
ATOM   2801  N N     . ALA A 1 363 ? 35.147  162.083 49.174  1.00 18.87 ? 363  ALA A N     1 
ATOM   2802  C CA    . ALA A 1 363 ? 35.544  163.461 49.514  1.00 19.09 ? 363  ALA A CA    1 
ATOM   2803  C C     . ALA A 1 363 ? 34.661  164.499 48.805  1.00 19.24 ? 363  ALA A C     1 
ATOM   2804  O O     . ALA A 1 363 ? 34.264  165.473 49.420  1.00 18.67 ? 363  ALA A O     1 
ATOM   2805  C CB    . ALA A 1 363 ? 37.018  163.709 49.225  1.00 18.71 ? 363  ALA A CB    1 
ATOM   2806  N N     . LEU A 1 364 ? 34.340  164.286 47.529  1.00 19.80 ? 364  LEU A N     1 
ATOM   2807  C CA    . LEU A 1 364 ? 33.463  165.223 46.815  1.00 20.89 ? 364  LEU A CA    1 
ATOM   2808  C C     . LEU A 1 364 ? 32.009  165.154 47.292  1.00 21.64 ? 364  LEU A C     1 
ATOM   2809  O O     . LEU A 1 364 ? 31.339  166.184 47.388  1.00 21.52 ? 364  LEU A O     1 
ATOM   2810  C CB    . LEU A 1 364 ? 33.517  164.992 45.310  1.00 21.66 ? 364  LEU A CB    1 
ATOM   2811  C CG    . LEU A 1 364 ? 34.882  165.099 44.593  1.00 22.64 ? 364  LEU A CG    1 
ATOM   2812  C CD1   . LEU A 1 364 ? 34.694  164.737 43.144  1.00 20.28 ? 364  LEU A CD1   1 
ATOM   2813  C CD2   . LEU A 1 364 ? 35.474  166.484 44.699  1.00 19.92 ? 364  LEU A CD2   1 
ATOM   2814  N N     . MET A 1 365 ? 31.528  163.945 47.581  1.00 21.94 ? 365  MET A N     1 
ATOM   2815  C CA    . MET A 1 365 ? 30.158  163.715 48.101  1.00 23.26 ? 365  MET A CA    1 
ATOM   2816  C C     . MET A 1 365 ? 29.968  164.407 49.460  1.00 22.72 ? 365  MET A C     1 
ATOM   2817  O O     . MET A 1 365 ? 28.916  164.953 49.765  1.00 21.92 ? 365  MET A O     1 
ATOM   2818  C CB    . MET A 1 365 ? 29.909  162.206 48.223  1.00 22.61 ? 365  MET A CB    1 
ATOM   2819  C CG    . MET A 1 365 ? 28.503  161.806 48.623  1.00 24.95 ? 365  MET A CG    1 
ATOM   2820  S SD    . MET A 1 365 ? 28.235  160.011 48.522  1.00 25.82 ? 365  MET A SD    1 
ATOM   2821  C CE    . MET A 1 365 ? 29.450  159.450 49.707  1.00 26.71 ? 365  MET A CE    1 
ATOM   2822  N N     . ALA A 1 366 ? 31.020  164.403 50.266  1.00 23.20 ? 366  ALA A N     1 
ATOM   2823  C CA    . ALA A 1 366 ? 30.987  165.091 51.541  1.00 23.94 ? 366  ALA A CA    1 
ATOM   2824  C C     . ALA A 1 366 ? 30.722  166.594 51.342  1.00 23.90 ? 366  ALA A C     1 
ATOM   2825  O O     . ALA A 1 366 ? 30.323  167.288 52.266  1.00 23.18 ? 366  ALA A O     1 
ATOM   2826  C CB    . ALA A 1 366 ? 32.289  164.845 52.292  1.00 23.84 ? 366  ALA A CB    1 
ATOM   2827  N N     . GLU A 1 367 ? 30.941  167.076 50.121  1.00 24.37 ? 367  GLU A N     1 
ATOM   2828  C CA    . GLU A 1 367 ? 30.683  168.477 49.796  1.00 25.06 ? 367  GLU A CA    1 
ATOM   2829  C C     . GLU A 1 367 ? 29.324  168.681 49.135  1.00 24.95 ? 367  GLU A C     1 
ATOM   2830  O O     . GLU A 1 367 ? 28.992  169.799 48.728  1.00 25.53 ? 367  GLU A O     1 
ATOM   2831  C CB    . GLU A 1 367 ? 31.820  169.070 48.961  1.00 24.65 ? 367  GLU A CB    1 
ATOM   2832  C CG    . GLU A 1 367 ? 33.174  169.101 49.699  1.00 26.87 ? 367  GLU A CG    1 
ATOM   2833  C CD    . GLU A 1 367 ? 33.099  169.856 51.018  1.00 29.98 ? 367  GLU A CD    1 
ATOM   2834  O OE1   . GLU A 1 367 ? 32.206  170.720 51.153  1.00 29.56 ? 367  GLU A OE1   1 
ATOM   2835  O OE2   . GLU A 1 367 ? 33.915  169.572 51.922  1.00 30.33 ? 367  GLU A OE2   1 
ATOM   2836  N N     . GLY A 1 368 ? 28.536  167.603 49.051  1.00 25.18 ? 368  GLY A N     1 
ATOM   2837  C CA    . GLY A 1 368 ? 27.207  167.641 48.435  1.00 24.37 ? 368  GLY A CA    1 
ATOM   2838  C C     . GLY A 1 368 ? 27.288  168.259 47.048  1.00 24.33 ? 368  GLY A C     1 
ATOM   2839  O O     . GLY A 1 368 ? 28.186  167.932 46.267  1.00 24.61 ? 368  GLY A O     1 
ATOM   2840  N N     . ASP A 1 369 ? 26.387  169.193 46.767  1.00 23.73 ? 369  ASP A N     1 
ATOM   2841  C CA    . ASP A 1 369 ? 26.255  169.803 45.440  1.00 23.42 ? 369  ASP A CA    1 
ATOM   2842  C C     . ASP A 1 369 ? 27.337  170.813 45.067  1.00 22.59 ? 369  ASP A C     1 
ATOM   2843  O O     . ASP A 1 369 ? 27.400  171.231 43.922  1.00 22.06 ? 369  ASP A O     1 
ATOM   2844  C CB    . ASP A 1 369 ? 24.864  170.453 45.277  1.00 23.51 ? 369  ASP A CB    1 
ATOM   2845  C CG    . ASP A 1 369 ? 23.766  169.440 44.976  1.00 24.56 ? 369  ASP A CG    1 
ATOM   2846  O OD1   . ASP A 1 369 ? 24.036  168.230 44.782  1.00 25.52 ? 369  ASP A OD1   1 
ATOM   2847  O OD2   . ASP A 1 369 ? 22.606  169.872 44.915  1.00 26.31 ? 369  ASP A OD2   1 
ATOM   2848  N N     . LYS A 1 370 ? 28.159  171.232 46.021  1.00 22.52 ? 370  LYS A N     1 
ATOM   2849  C CA    . LYS A 1 370 ? 29.333  172.045 45.690  1.00 23.25 ? 370  LYS A CA    1 
ATOM   2850  C C     . LYS A 1 370 ? 30.278  171.329 44.709  1.00 23.31 ? 370  LYS A C     1 
ATOM   2851  O O     . LYS A 1 370 ? 31.027  171.978 43.985  1.00 23.41 ? 370  LYS A O     1 
ATOM   2852  C CB    . LYS A 1 370 ? 30.093  172.470 46.955  1.00 23.73 ? 370  LYS A CB    1 
ATOM   2853  N N     . ALA A 1 371 ? 30.218  169.999 44.669  1.00 23.12 ? 371  ALA A N     1 
ATOM   2854  C CA    . ALA A 1 371 ? 31.015  169.214 43.706  1.00 23.29 ? 371  ALA A CA    1 
ATOM   2855  C C     . ALA A 1 371 ? 30.610  169.420 42.242  1.00 23.29 ? 371  ALA A C     1 
ATOM   2856  O O     . ALA A 1 371 ? 31.434  169.235 41.348  1.00 23.12 ? 371  ALA A O     1 
ATOM   2857  C CB    . ALA A 1 371 ? 30.991  167.735 44.065  1.00 22.73 ? 371  ALA A CB    1 
ATOM   2858  N N     . ILE A 1 372 ? 29.354  169.794 41.993  1.00 23.09 ? 372  ILE A N     1 
ATOM   2859  C CA    . ILE A 1 372 ? 28.857  169.954 40.607  1.00 23.99 ? 372  ILE A CA    1 
ATOM   2860  C C     . ILE A 1 372 ? 28.378  171.384 40.275  1.00 24.42 ? 372  ILE A C     1 
ATOM   2861  O O     . ILE A 1 372 ? 27.953  171.677 39.138  1.00 24.26 ? 372  ILE A O     1 
ATOM   2862  C CB    . ILE A 1 372 ? 27.702  168.974 40.281  1.00 23.80 ? 372  ILE A CB    1 
ATOM   2863  C CG1   . ILE A 1 372 ? 26.498  169.258 41.209  1.00 22.82 ? 372  ILE A CG1   1 
ATOM   2864  C CG2   . ILE A 1 372 ? 28.203  167.526 40.326  1.00 24.14 ? 372  ILE A CG2   1 
ATOM   2865  C CD1   . ILE A 1 372 ? 25.205  168.593 40.796  1.00 24.66 ? 372  ILE A CD1   1 
ATOM   2866  N N     . GLU A 1 373 ? 28.431  172.253 41.275  1.00 24.49 ? 373  GLU A N     1 
ATOM   2867  C CA    . GLU A 1 373 ? 27.950  173.609 41.142  1.00 25.33 ? 373  GLU A CA    1 
ATOM   2868  C C     . GLU A 1 373 ? 28.642  174.344 40.015  1.00 24.45 ? 373  GLU A C     1 
ATOM   2869  O O     . GLU A 1 373 ? 29.873  174.428 39.969  1.00 24.06 ? 373  GLU A O     1 
ATOM   2870  C CB    . GLU A 1 373 ? 28.159  174.353 42.449  1.00 26.19 ? 373  GLU A CB    1 
ATOM   2871  C CG    . GLU A 1 373 ? 27.396  175.652 42.536  1.00 31.04 ? 373  GLU A CG    1 
ATOM   2872  C CD    . GLU A 1 373 ? 27.575  176.284 43.894  1.00 37.24 ? 373  GLU A CD    1 
ATOM   2873  O OE1   . GLU A 1 373 ? 26.934  175.794 44.862  1.00 38.42 ? 373  GLU A OE1   1 
ATOM   2874  O OE2   . GLU A 1 373 ? 28.368  177.250 43.984  1.00 39.10 ? 373  GLU A OE2   1 
ATOM   2875  N N     . GLY A 1 374 ? 27.837  174.853 39.088  1.00 24.00 ? 374  GLY A N     1 
ATOM   2876  C CA    . GLY A 1 374 ? 28.356  175.647 37.978  1.00 22.63 ? 374  GLY A CA    1 
ATOM   2877  C C     . GLY A 1 374 ? 28.902  174.814 36.841  1.00 22.28 ? 374  GLY A C     1 
ATOM   2878  O O     . GLY A 1 374 ? 29.473  175.370 35.887  1.00 22.38 ? 374  GLY A O     1 
ATOM   2879  N N     . THR A 1 375 ? 28.741  173.486 36.926  1.00 21.09 ? 375  THR A N     1 
ATOM   2880  C CA    . THR A 1 375 ? 29.257  172.587 35.881  1.00 19.98 ? 375  THR A CA    1 
ATOM   2881  C C     . THR A 1 375 ? 28.140  171.946 35.075  1.00 19.67 ? 375  THR A C     1 
ATOM   2882  O O     . THR A 1 375 ? 26.993  171.875 35.527  1.00 19.32 ? 375  THR A O     1 
ATOM   2883  C CB    . THR A 1 375 ? 30.228  171.504 36.431  1.00 19.83 ? 375  THR A CB    1 
ATOM   2884  O OG1   . THR A 1 375 ? 29.497  170.508 37.171  1.00 17.80 ? 375  THR A OG1   1 
ATOM   2885  C CG2   . THR A 1 375 ? 31.320  172.140 37.303  1.00 19.09 ? 375  THR A CG2   1 
ATOM   2886  N N     . ASP A 1 376 ? 28.476  171.469 33.883  1.00 19.76 ? 376  ASP A N     1 
ATOM   2887  C CA    . ASP A 1 376 ? 27.468  170.941 32.954  1.00 20.22 ? 376  ASP A CA    1 
ATOM   2888  C C     . ASP A 1 376 ? 27.511  169.405 32.933  1.00 20.12 ? 376  ASP A C     1 
ATOM   2889  O O     . ASP A 1 376 ? 26.470  168.765 33.028  1.00 20.14 ? 376  ASP A O     1 
ATOM   2890  C CB    . ASP A 1 376 ? 27.684  171.530 31.546  1.00 21.08 ? 376  ASP A CB    1 
ATOM   2891  C CG    . ASP A 1 376 ? 26.727  170.951 30.495  1.00 23.16 ? 376  ASP A CG    1 
ATOM   2892  O OD1   . ASP A 1 376 ? 26.733  169.738 30.255  1.00 26.40 ? 376  ASP A OD1   1 
ATOM   2893  O OD2   . ASP A 1 376 ? 25.984  171.717 29.856  1.00 28.96 ? 376  ASP A OD2   1 
ATOM   2894  N N     . ARG A 1 377 ? 28.713  168.838 32.801  1.00 19.41 ? 377  ARG A N     1 
ATOM   2895  C CA    . ARG A 1 377 ? 28.942  167.380 32.775  1.00 19.29 ? 377  ARG A CA    1 
ATOM   2896  C C     . ARG A 1 377 ? 28.389  166.586 31.568  1.00 19.45 ? 377  ARG A C     1 
ATOM   2897  O O     . ARG A 1 377 ? 28.532  165.367 31.535  1.00 18.76 ? 377  ARG A O     1 
ATOM   2898  C CB    . ARG A 1 377 ? 28.488  166.727 34.107  1.00 19.26 ? 377  ARG A CB    1 
ATOM   2899  C CG    . ARG A 1 377 ? 29.372  167.063 35.326  1.00 19.01 ? 377  ARG A CG    1 
ATOM   2900  C CD    . ARG A 1 377 ? 28.600  167.142 36.646  1.00 19.43 ? 377  ARG A CD    1 
ATOM   2901  N NE    . ARG A 1 377 ? 27.727  168.312 36.643  1.00 22.21 ? 377  ARG A NE    1 
ATOM   2902  C CZ    . ARG A 1 377 ? 26.402  168.261 36.756  1.00 23.32 ? 377  ARG A CZ    1 
ATOM   2903  N NH1   . ARG A 1 377 ? 25.774  167.099 36.946  1.00 22.16 ? 377  ARG A NH1   1 
ATOM   2904  N NH2   . ARG A 1 377 ? 25.704  169.379 36.705  1.00 22.90 ? 377  ARG A NH2   1 
ATOM   2905  N N     . SER A 1 378 ? 27.777  167.261 30.586  1.00 19.66 ? 378  SER A N     1 
ATOM   2906  C CA    . SER A 1 378 ? 27.083  166.566 29.449  1.00 19.94 ? 378  SER A CA    1 
ATOM   2907  C C     . SER A 1 378 ? 27.945  165.694 28.555  1.00 19.50 ? 378  SER A C     1 
ATOM   2908  O O     . SER A 1 378 ? 27.434  164.764 27.939  1.00 19.81 ? 378  SER A O     1 
ATOM   2909  C CB    . SER A 1 378 ? 26.369  167.578 28.527  1.00 20.18 ? 378  SER A CB    1 
ATOM   2910  O OG    . SER A 1 378 ? 25.469  168.376 29.263  1.00 21.04 ? 378  SER A OG    1 
ATOM   2911  N N     . SER A 1 379 ? 29.230  166.028 28.438  1.00 19.63 ? 379  SER A N     1 
ATOM   2912  C CA    . SER A 1 379 ? 30.175  165.258 27.590  1.00 19.18 ? 379  SER A CA    1 
ATOM   2913  C C     . SER A 1 379 ? 30.372  163.821 28.039  1.00 19.01 ? 379  SER A C     1 
ATOM   2914  O O     . SER A 1 379 ? 30.796  162.965 27.236  1.00 19.54 ? 379  SER A O     1 
ATOM   2915  C CB    . SER A 1 379 ? 31.523  165.969 27.452  1.00 18.12 ? 379  SER A CB    1 
ATOM   2916  O OG    . SER A 1 379 ? 32.102  166.252 28.719  1.00 19.08 ? 379  SER A OG    1 
ATOM   2917  N N     . LEU A 1 380 ? 30.052  163.552 29.303  1.00 18.47 ? 380  LEU A N     1 
ATOM   2918  C CA    . LEU A 1 380 ? 30.261  162.239 29.911  1.00 18.44 ? 380  LEU A CA    1 
ATOM   2919  C C     . LEU A 1 380 ? 29.299  161.175 29.386  1.00 19.58 ? 380  LEU A C     1 
ATOM   2920  O O     . LEU A 1 380 ? 28.055  161.377 29.400  1.00 18.93 ? 380  LEU A O     1 
ATOM   2921  C CB    . LEU A 1 380 ? 30.144  162.325 31.422  1.00 18.10 ? 380  LEU A CB    1 
ATOM   2922  C CG    . LEU A 1 380 ? 31.262  163.051 32.180  1.00 16.90 ? 380  LEU A CG    1 
ATOM   2923  C CD1   . LEU A 1 380 ? 30.840  163.210 33.639  1.00 14.21 ? 380  LEU A CD1   1 
ATOM   2924  C CD2   . LEU A 1 380 ? 32.615  162.335 32.040  1.00 11.75 ? 380  LEU A CD2   1 
ATOM   2925  N N     . ARG A 1 381 ? 29.897  160.073 28.915  1.00 19.47 ? 381  ARG A N     1 
ATOM   2926  C CA    . ARG A 1 381 ? 29.190  158.858 28.516  1.00 20.65 ? 381  ARG A CA    1 
ATOM   2927  C C     . ARG A 1 381 ? 29.510  157.654 29.422  1.00 20.26 ? 381  ARG A C     1 
ATOM   2928  O O     . ARG A 1 381 ? 28.695  156.745 29.542  1.00 20.84 ? 381  ARG A O     1 
ATOM   2929  C CB    . ARG A 1 381 ? 29.529  158.484 27.067  1.00 20.62 ? 381  ARG A CB    1 
ATOM   2930  C CG    . ARG A 1 381 ? 28.813  159.343 26.009  1.00 22.95 ? 381  ARG A CG    1 
ATOM   2931  C CD    . ARG A 1 381 ? 29.019  158.790 24.597  1.00 22.90 ? 381  ARG A CD    1 
ATOM   2932  N NE    . ARG A 1 381 ? 30.415  158.936 24.160  1.00 25.48 ? 381  ARG A NE    1 
ATOM   2933  C CZ    . ARG A 1 381 ? 30.944  160.040 23.634  1.00 24.95 ? 381  ARG A CZ    1 
ATOM   2934  N NH1   . ARG A 1 381 ? 30.200  161.134 23.461  1.00 26.01 ? 381  ARG A NH1   1 
ATOM   2935  N NH2   . ARG A 1 381 ? 32.223  160.041 23.271  1.00 22.19 ? 381  ARG A NH2   1 
ATOM   2936  N N     . ILE A 1 382 ? 30.688  157.631 30.050  1.00 20.07 ? 382  ILE A N     1 
ATOM   2937  C CA    . ILE A 1 382 ? 31.119  156.459 30.835  1.00 19.65 ? 382  ILE A CA    1 
ATOM   2938  C C     . ILE A 1 382 ? 31.853  156.869 32.106  1.00 19.95 ? 382  ILE A C     1 
ATOM   2939  O O     . ILE A 1 382 ? 32.750  157.733 32.089  1.00 19.53 ? 382  ILE A O     1 
ATOM   2940  C CB    . ILE A 1 382 ? 32.026  155.492 29.996  1.00 19.91 ? 382  ILE A CB    1 
ATOM   2941  C CG1   . ILE A 1 382 ? 31.339  155.021 28.702  1.00 20.57 ? 382  ILE A CG1   1 
ATOM   2942  C CG2   . ILE A 1 382 ? 32.485  154.301 30.828  1.00 18.78 ? 382  ILE A CG2   1 
ATOM   2943  C CD1   . ILE A 1 382 ? 30.331  153.873 28.913  1.00 20.47 ? 382  ILE A CD1   1 
ATOM   2944  N N     . LEU A 1 383 ? 31.474  156.245 33.216  1.00 20.22 ? 383  LEU A N     1 
ATOM   2945  C CA    . LEU A 1 383 ? 32.154  156.468 34.493  1.00 19.96 ? 383  LEU A CA    1 
ATOM   2946  C C     . LEU A 1 383 ? 32.830  155.192 34.956  1.00 20.17 ? 383  LEU A C     1 
ATOM   2947  O O     . LEU A 1 383 ? 32.318  154.106 34.701  1.00 20.34 ? 383  LEU A O     1 
ATOM   2948  C CB    . LEU A 1 383 ? 31.137  156.921 35.557  1.00 20.07 ? 383  LEU A CB    1 
ATOM   2949  C CG    . LEU A 1 383 ? 30.433  158.255 35.330  1.00 18.74 ? 383  LEU A CG    1 
ATOM   2950  C CD1   . LEU A 1 383 ? 29.565  158.553 36.523  1.00 17.45 ? 383  LEU A CD1   1 
ATOM   2951  C CD2   . LEU A 1 383 ? 31.464  159.338 35.136  1.00 17.29 ? 383  LEU A CD2   1 
ATOM   2952  N N     . GLY A 1 384 ? 33.946  155.336 35.679  1.00 20.21 ? 384  GLY A N     1 
ATOM   2953  C CA    . GLY A 1 384 ? 34.654  154.214 36.285  1.00 20.10 ? 384  GLY A CA    1 
ATOM   2954  C C     . GLY A 1 384 ? 35.066  154.449 37.739  1.00 20.51 ? 384  GLY A C     1 
ATOM   2955  O O     . GLY A 1 384 ? 35.222  155.583 38.191  1.00 19.96 ? 384  GLY A O     1 
ATOM   2956  N N     . SER A 1 385 ? 35.240  153.358 38.479  1.00 21.14 ? 385  SER A N     1 
ATOM   2957  C CA    . SER A 1 385 ? 35.768  153.430 39.836  1.00 21.80 ? 385  SER A CA    1 
ATOM   2958  C C     . SER A 1 385 ? 36.663  152.231 40.116  1.00 22.32 ? 385  SER A C     1 
ATOM   2959  O O     . SER A 1 385 ? 36.323  151.115 39.714  1.00 21.96 ? 385  SER A O     1 
ATOM   2960  C CB    . SER A 1 385 ? 34.611  153.462 40.833  1.00 22.07 ? 385  SER A CB    1 
ATOM   2961  O OG    . SER A 1 385 ? 35.073  153.360 42.165  1.00 22.17 ? 385  SER A OG    1 
ATOM   2962  N N     . ALA A 1 386 ? 37.802  152.450 40.797  1.00 22.68 ? 386  ALA A N     1 
ATOM   2963  C CA    . ALA A 1 386 ? 38.705  151.332 41.164  1.00 23.08 ? 386  ALA A CA    1 
ATOM   2964  C C     . ALA A 1 386 ? 39.514  151.604 42.424  1.00 23.72 ? 386  ALA A C     1 
ATOM   2965  O O     . ALA A 1 386 ? 39.612  152.757 42.871  1.00 23.68 ? 386  ALA A O     1 
ATOM   2966  C CB    . ALA A 1 386 ? 39.648  151.001 40.017  1.00 22.88 ? 386  ALA A CB    1 
ATOM   2967  N N     . GLY A 1 387 ? 40.096  150.546 43.001  1.00 24.19 ? 387  GLY A N     1 
ATOM   2968  C CA    . GLY A 1 387 ? 41.111  150.745 44.037  1.00 23.95 ? 387  GLY A CA    1 
ATOM   2969  C C     . GLY A 1 387 ? 40.673  150.356 45.426  1.00 24.46 ? 387  GLY A C     1 
ATOM   2970  O O     . GLY A 1 387 ? 41.513  150.042 46.290  1.00 23.11 ? 387  GLY A O     1 
ATOM   2971  N N     . GLU A 1 388 ? 39.356  150.379 45.635  1.00 24.30 ? 388  GLU A N     1 
ATOM   2972  C CA    . GLU A 1 388 ? 38.768  150.109 46.941  1.00 25.07 ? 388  GLU A CA    1 
ATOM   2973  C C     . GLU A 1 388 ? 37.277  149.866 46.753  1.00 24.97 ? 388  GLU A C     1 
ATOM   2974  O O     . GLU A 1 388 ? 36.719  150.228 45.713  1.00 24.01 ? 388  GLU A O     1 
ATOM   2975  C CB    . GLU A 1 388 ? 39.040  151.271 47.925  1.00 25.49 ? 388  GLU A CB    1 
ATOM   2976  C CG    . GLU A 1 388 ? 38.450  152.570 47.473  1.00 27.29 ? 388  GLU A CG    1 
ATOM   2977  C CD    . GLU A 1 388 ? 39.057  153.809 48.105  1.00 30.09 ? 388  GLU A CD    1 
ATOM   2978  O OE1   . GLU A 1 388 ? 38.955  153.949 49.344  1.00 30.40 ? 388  GLU A OE1   1 
ATOM   2979  O OE2   . GLU A 1 388 ? 39.588  154.667 47.334  1.00 30.70 ? 388  GLU A OE2   1 
ATOM   2980  N N     . PRO A 1 389 ? 36.636  149.215 47.742  1.00 25.59 ? 389  PRO A N     1 
ATOM   2981  C CA    . PRO A 1 389 ? 35.180  149.037 47.658  1.00 25.94 ? 389  PRO A CA    1 
ATOM   2982  C C     . PRO A 1 389 ? 34.457  150.387 47.643  1.00 26.64 ? 389  PRO A C     1 
ATOM   2983  O O     . PRO A 1 389 ? 34.945  151.369 48.216  1.00 27.08 ? 389  PRO A O     1 
ATOM   2984  C CB    . PRO A 1 389 ? 34.836  148.235 48.929  1.00 25.94 ? 389  PRO A CB    1 
ATOM   2985  C CG    . PRO A 1 389 ? 36.178  147.587 49.353  1.00 25.58 ? 389  PRO A CG    1 
ATOM   2986  C CD    . PRO A 1 389 ? 37.210  148.604 48.966  1.00 25.57 ? 389  PRO A CD    1 
ATOM   2987  N N     . ILE A 1 390 ? 33.332  150.430 46.938  1.00 26.56 ? 390  ILE A N     1 
ATOM   2988  C CA    . ILE A 1 390 ? 32.454  151.584 46.922  1.00 26.75 ? 390  ILE A CA    1 
ATOM   2989  C C     . ILE A 1 390 ? 31.070  151.140 47.463  1.00 27.14 ? 390  ILE A C     1 
ATOM   2990  O O     . ILE A 1 390 ? 30.465  150.201 46.944  1.00 26.59 ? 390  ILE A O     1 
ATOM   2991  C CB    . ILE A 1 390 ? 32.441  152.250 45.480  1.00 26.24 ? 390  ILE A CB    1 
ATOM   2992  C CG1   . ILE A 1 390 ? 31.672  153.576 45.455  1.00 27.00 ? 390  ILE A CG1   1 
ATOM   2993  C CG2   . ILE A 1 390 ? 31.974  151.285 44.396  1.00 27.07 ? 390  ILE A CG2   1 
ATOM   2994  C CD1   . ILE A 1 390 ? 31.837  154.391 44.129  1.00 25.96 ? 390  ILE A CD1   1 
ATOM   2995  N N     . ASN A 1 391 ? 30.583  151.772 48.528  1.00 27.91 ? 391  ASN A N     1 
ATOM   2996  C CA    . ASN A 1 391 ? 29.237  151.422 49.000  1.00 28.92 ? 391  ASN A CA    1 
ATOM   2997  C C     . ASN A 1 391 ? 28.151  151.891 48.029  1.00 28.74 ? 391  ASN A C     1 
ATOM   2998  O O     . ASN A 1 391 ? 28.376  152.813 47.239  1.00 29.07 ? 391  ASN A O     1 
ATOM   2999  C CB    . ASN A 1 391 ? 28.966  151.792 50.484  1.00 29.13 ? 391  ASN A CB    1 
ATOM   3000  C CG    . ASN A 1 391 ? 28.722  153.278 50.717  1.00 31.97 ? 391  ASN A CG    1 
ATOM   3001  O OD1   . ASN A 1 391 ? 28.504  154.053 49.788  1.00 32.41 ? 391  ASN A OD1   1 
ATOM   3002  N ND2   . ASN A 1 391 ? 28.762  153.681 51.994  1.00 34.74 ? 391  ASN A ND2   1 
ATOM   3003  N N     . PRO A 1 392 ? 26.992  151.202 48.033  1.00 28.61 ? 392  PRO A N     1 
ATOM   3004  C CA    . PRO A 1 392 ? 25.864  151.571 47.174  1.00 28.14 ? 392  PRO A CA    1 
ATOM   3005  C C     . PRO A 1 392 ? 25.534  153.070 47.183  1.00 27.69 ? 392  PRO A C     1 
ATOM   3006  O O     . PRO A 1 392 ? 25.160  153.612 46.142  1.00 27.04 ? 392  PRO A O     1 
ATOM   3007  C CB    . PRO A 1 392 ? 24.706  150.751 47.758  1.00 28.22 ? 392  PRO A CB    1 
ATOM   3008  C CG    . PRO A 1 392 ? 25.398  149.516 48.292  1.00 28.55 ? 392  PRO A CG    1 
ATOM   3009  C CD    . PRO A 1 392 ? 26.708  149.991 48.829  1.00 27.96 ? 392  PRO A CD    1 
ATOM   3010  N N     . GLU A 1 393 ? 25.674  153.727 48.332  1.00 27.06 ? 393  GLU A N     1 
ATOM   3011  C CA    . GLU A 1 393 ? 25.309  155.140 48.457  1.00 27.63 ? 393  GLU A CA    1 
ATOM   3012  C C     . GLU A 1 393 ? 26.274  156.046 47.683  1.00 25.15 ? 393  GLU A C     1 
ATOM   3013  O O     . GLU A 1 393 ? 25.854  156.966 46.990  1.00 24.55 ? 393  GLU A O     1 
ATOM   3014  C CB    . GLU A 1 393 ? 25.250  155.553 49.936  1.00 27.75 ? 393  GLU A CB    1 
ATOM   3015  C CG    . GLU A 1 393 ? 24.817  157.000 50.170  1.00 30.94 ? 393  GLU A CG    1 
ATOM   3016  C CD    . GLU A 1 393 ? 25.008  157.453 51.619  1.00 32.02 ? 393  GLU A CD    1 
ATOM   3017  O OE1   . GLU A 1 393 ? 25.321  156.594 52.487  1.00 36.22 ? 393  GLU A OE1   1 
ATOM   3018  O OE2   . GLU A 1 393 ? 24.824  158.672 51.887  1.00 36.09 ? 393  GLU A OE2   1 
ATOM   3019  N N     . ALA A 1 394 ? 27.565  155.773 47.798  1.00 23.68 ? 394  ALA A N     1 
ATOM   3020  C CA    . ALA A 1 394 ? 28.571  156.543 47.086  1.00 22.13 ? 394  ALA A CA    1 
ATOM   3021  C C     . ALA A 1 394 ? 28.489  156.275 45.560  1.00 21.51 ? 394  ALA A C     1 
ATOM   3022  O O     . ALA A 1 394 ? 28.629  157.205 44.747  1.00 20.66 ? 394  ALA A O     1 
ATOM   3023  C CB    . ALA A 1 394 ? 29.952  156.227 47.628  1.00 21.48 ? 394  ALA A CB    1 
ATOM   3024  N N     . TRP A 1 395 ? 28.264  155.009 45.195  1.00 20.68 ? 395  TRP A N     1 
ATOM   3025  C CA    . TRP A 1 395 ? 28.081  154.591 43.800  1.00 20.60 ? 395  TRP A CA    1 
ATOM   3026  C C     . TRP A 1 395 ? 26.890  155.368 43.203  1.00 20.47 ? 395  TRP A C     1 
ATOM   3027  O O     . TRP A 1 395 ? 26.985  155.943 42.113  1.00 20.54 ? 395  TRP A O     1 
ATOM   3028  C CB    . TRP A 1 395 ? 27.856  153.072 43.756  1.00 20.88 ? 395  TRP A CB    1 
ATOM   3029  C CG    . TRP A 1 395 ? 27.857  152.416 42.397  1.00 21.57 ? 395  TRP A CG    1 
ATOM   3030  C CD1   . TRP A 1 395 ? 28.843  151.618 41.877  1.00 22.11 ? 395  TRP A CD1   1 
ATOM   3031  C CD2   . TRP A 1 395 ? 26.822  152.467 41.400  1.00 20.98 ? 395  TRP A CD2   1 
ATOM   3032  N NE1   . TRP A 1 395 ? 28.495  151.184 40.630  1.00 21.39 ? 395  TRP A NE1   1 
ATOM   3033  C CE2   . TRP A 1 395 ? 27.263  151.690 40.305  1.00 21.66 ? 395  TRP A CE2   1 
ATOM   3034  C CE3   . TRP A 1 395 ? 25.573  153.102 41.321  1.00 21.82 ? 395  TRP A CE3   1 
ATOM   3035  C CZ2   . TRP A 1 395 ? 26.500  151.527 39.137  1.00 20.42 ? 395  TRP A CZ2   1 
ATOM   3036  C CZ3   . TRP A 1 395 ? 24.807  152.940 40.157  1.00 21.57 ? 395  TRP A CZ3   1 
ATOM   3037  C CH2   . TRP A 1 395 ? 25.278  152.156 39.087  1.00 21.43 ? 395  TRP A CH2   1 
ATOM   3038  N N     . GLU A 1 396 ? 25.797  155.439 43.952  1.00 19.64 ? 396  GLU A N     1 
ATOM   3039  C CA    . GLU A 1 396 ? 24.597  156.142 43.502  1.00 20.26 ? 396  GLU A CA    1 
ATOM   3040  C C     . GLU A 1 396 ? 24.761  157.656 43.385  1.00 19.39 ? 396  GLU A C     1 
ATOM   3041  O O     . GLU A 1 396 ? 24.249  158.279 42.442  1.00 18.46 ? 396  GLU A O     1 
ATOM   3042  C CB    . GLU A 1 396 ? 23.394  155.809 44.406  1.00 20.21 ? 396  GLU A CB    1 
ATOM   3043  C CG    . GLU A 1 396 ? 22.853  154.368 44.236  1.00 22.73 ? 396  GLU A CG    1 
ATOM   3044  C CD    . GLU A 1 396 ? 22.292  154.077 42.843  1.00 26.42 ? 396  GLU A CD    1 
ATOM   3045  O OE1   . GLU A 1 396 ? 21.796  155.008 42.168  1.00 29.21 ? 396  GLU A OE1   1 
ATOM   3046  O OE2   . GLU A 1 396 ? 22.338  152.899 42.419  1.00 30.05 ? 396  GLU A OE2   1 
ATOM   3047  N N     . TRP A 1 397 ? 25.431  158.250 44.361  1.00 18.99 ? 397  TRP A N     1 
ATOM   3048  C CA    . TRP A 1 397 ? 25.792  159.667 44.273  1.00 20.06 ? 397  TRP A CA    1 
ATOM   3049  C C     . TRP A 1 397 ? 26.638  159.930 43.011  1.00 19.81 ? 397  TRP A C     1 
ATOM   3050  O O     . TRP A 1 397 ? 26.350  160.839 42.258  1.00 20.18 ? 397  TRP A O     1 
ATOM   3051  C CB    . TRP A 1 397 ? 26.537  160.106 45.539  1.00 19.58 ? 397  TRP A CB    1 
ATOM   3052  C CG    . TRP A 1 397 ? 26.774  161.582 45.589  1.00 21.26 ? 397  TRP A CG    1 
ATOM   3053  C CD1   . TRP A 1 397 ? 25.967  162.523 46.157  1.00 20.47 ? 397  TRP A CD1   1 
ATOM   3054  C CD2   . TRP A 1 397 ? 27.898  162.296 45.035  1.00 21.52 ? 397  TRP A CD2   1 
ATOM   3055  N NE1   . TRP A 1 397 ? 26.514  163.777 45.996  1.00 20.66 ? 397  TRP A NE1   1 
ATOM   3056  C CE2   . TRP A 1 397 ? 27.696  163.671 45.314  1.00 20.42 ? 397  TRP A CE2   1 
ATOM   3057  C CE3   . TRP A 1 397 ? 29.051  161.907 44.329  1.00 19.98 ? 397  TRP A CE3   1 
ATOM   3058  C CZ2   . TRP A 1 397 ? 28.607  164.665 44.915  1.00 20.37 ? 397  TRP A CZ2   1 
ATOM   3059  C CZ3   . TRP A 1 397 ? 29.958  162.896 43.928  1.00 19.96 ? 397  TRP A CZ3   1 
ATOM   3060  C CH2   . TRP A 1 397 ? 29.725  164.264 44.229  1.00 19.68 ? 397  TRP A CH2   1 
ATOM   3061  N N     . TYR A 1 398 ? 27.664  159.108 42.790  1.00 19.70 ? 398  TYR A N     1 
ATOM   3062  C CA    . TYR A 1 398 ? 28.500  159.159 41.589  1.00 20.36 ? 398  TYR A CA    1 
ATOM   3063  C C     . TYR A 1 398 ? 27.693  159.049 40.277  1.00 20.89 ? 398  TYR A C     1 
ATOM   3064  O O     . TYR A 1 398 ? 27.855  159.866 39.364  1.00 20.58 ? 398  TYR A O     1 
ATOM   3065  C CB    . TYR A 1 398 ? 29.534  158.025 41.673  1.00 19.37 ? 398  TYR A CB    1 
ATOM   3066  C CG    . TYR A 1 398 ? 30.652  158.041 40.655  1.00 19.09 ? 398  TYR A CG    1 
ATOM   3067  C CD1   . TYR A 1 398 ? 31.301  159.227 40.315  1.00 18.72 ? 398  TYR A CD1   1 
ATOM   3068  C CD2   . TYR A 1 398 ? 31.116  156.845 40.097  1.00 17.38 ? 398  TYR A CD2   1 
ATOM   3069  C CE1   . TYR A 1 398 ? 32.345  159.242 39.414  1.00 18.94 ? 398  TYR A CE1   1 
ATOM   3070  C CE2   . TYR A 1 398 ? 32.150  156.844 39.194  1.00 17.91 ? 398  TYR A CE2   1 
ATOM   3071  C CZ    . TYR A 1 398 ? 32.765  158.039 38.853  1.00 17.97 ? 398  TYR A CZ    1 
ATOM   3072  O OH    . TYR A 1 398 ? 33.801  158.032 37.966  1.00 18.37 ? 398  TYR A OH    1 
ATOM   3073  N N     . TRP A 1 399 ? 26.835  158.032 40.203  1.00 21.44 ? 399  TRP A N     1 
ATOM   3074  C CA    . TRP A 1 399 ? 26.015  157.732 39.020  1.00 21.95 ? 399  TRP A CA    1 
ATOM   3075  C C     . TRP A 1 399 ? 25.054  158.883 38.703  1.00 22.77 ? 399  TRP A C     1 
ATOM   3076  O O     . TRP A 1 399 ? 24.853  159.226 37.525  1.00 22.31 ? 399  TRP A O     1 
ATOM   3077  C CB    . TRP A 1 399 ? 25.231  156.424 39.262  1.00 22.76 ? 399  TRP A CB    1 
ATOM   3078  C CG    . TRP A 1 399 ? 24.321  156.004 38.139  1.00 22.86 ? 399  TRP A CG    1 
ATOM   3079  C CD1   . TRP A 1 399 ? 24.692  155.397 36.980  1.00 24.04 ? 399  TRP A CD1   1 
ATOM   3080  C CD2   . TRP A 1 399 ? 22.896  156.171 38.068  1.00 23.64 ? 399  TRP A CD2   1 
ATOM   3081  N NE1   . TRP A 1 399 ? 23.591  155.173 36.186  1.00 24.90 ? 399  TRP A NE1   1 
ATOM   3082  C CE2   . TRP A 1 399 ? 22.477  155.650 36.826  1.00 23.54 ? 399  TRP A CE2   1 
ATOM   3083  C CE3   . TRP A 1 399 ? 21.931  156.712 38.937  1.00 24.17 ? 399  TRP A CE3   1 
ATOM   3084  C CZ2   . TRP A 1 399 ? 21.130  155.637 36.430  1.00 25.01 ? 399  TRP A CZ2   1 
ATOM   3085  C CZ3   . TRP A 1 399 ? 20.576  156.718 38.527  1.00 23.63 ? 399  TRP A CZ3   1 
ATOM   3086  C CH2   . TRP A 1 399 ? 20.199  156.186 37.289  1.00 24.21 ? 399  TRP A CH2   1 
ATOM   3087  N N     . LYS A 1 400 ? 24.487  159.480 39.760  1.00 22.50 ? 400  LYS A N     1 
ATOM   3088  C CA    . LYS A 1 400 ? 23.506  160.566 39.652  1.00 23.03 ? 400  LYS A CA    1 
ATOM   3089  C C     . LYS A 1 400 ? 24.107  161.975 39.439  1.00 22.48 ? 400  LYS A C     1 
ATOM   3090  O O     . LYS A 1 400 ? 23.709  162.704 38.528  1.00 21.85 ? 400  LYS A O     1 
ATOM   3091  C CB    . LYS A 1 400 ? 22.634  160.595 40.916  1.00 23.52 ? 400  LYS A CB    1 
ATOM   3092  C CG    . LYS A 1 400 ? 21.435  161.489 40.788  1.00 27.85 ? 400  LYS A CG    1 
ATOM   3093  C CD    . LYS A 1 400 ? 21.152  162.261 42.053  1.00 33.77 ? 400  LYS A CD    1 
ATOM   3094  C CE    . LYS A 1 400 ? 20.424  161.419 43.087  1.00 37.36 ? 400  LYS A CE    1 
ATOM   3095  N NZ    . LYS A 1 400 ? 20.193  162.225 44.324  1.00 38.52 ? 400  LYS A NZ    1 
ATOM   3096  N N     . LYS A 1 401 ? 25.040  162.368 40.294  1.00 21.64 ? 401  LYS A N     1 
ATOM   3097  C CA    . LYS A 1 401 ? 25.512  163.763 40.304  1.00 21.60 ? 401  LYS A CA    1 
ATOM   3098  C C     . LYS A 1 401 ? 26.549  164.018 39.214  1.00 21.08 ? 401  LYS A C     1 
ATOM   3099  O O     . LYS A 1 401 ? 26.496  165.039 38.511  1.00 20.46 ? 401  LYS A O     1 
ATOM   3100  C CB    . LYS A 1 401 ? 26.077  164.120 41.670  1.00 21.30 ? 401  LYS A CB    1 
ATOM   3101  C CG    . LYS A 1 401 ? 25.053  163.991 42.771  1.00 21.74 ? 401  LYS A CG    1 
ATOM   3102  C CD    . LYS A 1 401 ? 24.078  165.132 42.724  1.00 22.98 ? 401  LYS A CD    1 
ATOM   3103  C CE    . LYS A 1 401 ? 23.003  164.980 43.789  1.00 24.53 ? 401  LYS A CE    1 
ATOM   3104  N NZ    . LYS A 1 401 ? 22.417  166.298 44.081  1.00 24.40 ? 401  LYS A NZ    1 
ATOM   3105  N N     . ILE A 1 402 ? 27.475  163.067 39.077  1.00 20.27 ? 402  ILE A N     1 
ATOM   3106  C CA    . ILE A 1 402 ? 28.534  163.153 38.082  1.00 19.53 ? 402  ILE A CA    1 
ATOM   3107  C C     . ILE A 1 402 ? 28.046  162.674 36.708  1.00 19.29 ? 402  ILE A C     1 
ATOM   3108  O O     . ILE A 1 402 ? 28.249  163.356 35.716  1.00 19.11 ? 402  ILE A O     1 
ATOM   3109  C CB    . ILE A 1 402 ? 29.836  162.418 38.522  1.00 19.41 ? 402  ILE A CB    1 
ATOM   3110  C CG1   . ILE A 1 402 ? 30.223  162.762 39.970  1.00 17.59 ? 402  ILE A CG1   1 
ATOM   3111  C CG2   . ILE A 1 402 ? 30.996  162.772 37.570  1.00 20.25 ? 402  ILE A CG2   1 
ATOM   3112  C CD1   . ILE A 1 402 ? 30.291  164.289 40.298  1.00 16.63 ? 402  ILE A CD1   1 
ATOM   3113  N N     . GLY A 1 403 ? 27.388  161.521 36.652  1.00 18.72 ? 403  GLY A N     1 
ATOM   3114  C CA    . GLY A 1 403 ? 26.978  160.964 35.368  1.00 19.06 ? 403  GLY A CA    1 
ATOM   3115  C C     . GLY A 1 403 ? 25.594  161.403 34.908  1.00 19.24 ? 403  GLY A C     1 
ATOM   3116  O O     . GLY A 1 403 ? 25.149  161.065 33.801  1.00 18.31 ? 403  GLY A O     1 
ATOM   3117  N N     . LYS A 1 404 ? 24.905  162.141 35.772  1.00 18.77 ? 404  LYS A N     1 
ATOM   3118  C CA    . LYS A 1 404 ? 23.580  162.663 35.464  1.00 19.62 ? 404  LYS A CA    1 
ATOM   3119  C C     . LYS A 1 404 ? 22.621  161.559 35.103  1.00 19.69 ? 404  LYS A C     1 
ATOM   3120  O O     . LYS A 1 404 ? 21.747  161.772 34.261  1.00 19.96 ? 404  LYS A O     1 
ATOM   3121  C CB    . LYS A 1 404 ? 23.637  163.700 34.334  1.00 19.69 ? 404  LYS A CB    1 
ATOM   3122  C CG    . LYS A 1 404 ? 24.448  164.944 34.679  1.00 21.26 ? 404  LYS A CG    1 
ATOM   3123  C CD    . LYS A 1 404 ? 24.731  165.751 33.420  1.00 25.29 ? 404  LYS A CD    1 
ATOM   3124  C CE    . LYS A 1 404 ? 23.571  166.626 33.031  1.00 28.24 ? 404  LYS A CE    1 
ATOM   3125  N NZ    . LYS A 1 404 ? 23.912  167.434 31.812  1.00 31.39 ? 404  LYS A NZ    1 
ATOM   3126  N N     . GLU A 1 405 ? 22.812  160.388 35.724  1.00 19.78 ? 405  GLU A N     1 
ATOM   3127  C CA    . GLU A 1 405 ? 21.969  159.195 35.552  1.00 20.99 ? 405  GLU A CA    1 
ATOM   3128  C C     . GLU A 1 405 ? 22.011  158.587 34.142  1.00 21.23 ? 405  GLU A C     1 
ATOM   3129  O O     . GLU A 1 405 ? 21.185  157.764 33.799  1.00 21.85 ? 405  GLU A O     1 
ATOM   3130  C CB    . GLU A 1 405 ? 20.505  159.480 35.979  1.00 21.39 ? 405  GLU A CB    1 
ATOM   3131  C CG    . GLU A 1 405 ? 20.367  160.191 37.332  1.00 20.77 ? 405  GLU A CG    1 
ATOM   3132  C CD    . GLU A 1 405 ? 18.965  160.083 37.955  1.00 21.57 ? 405  GLU A CD    1 
ATOM   3133  O OE1   . GLU A 1 405 ? 18.611  160.934 38.794  1.00 25.59 ? 405  GLU A OE1   1 
ATOM   3134  O OE2   . GLU A 1 405 ? 18.224  159.148 37.637  1.00 19.33 ? 405  GLU A OE2   1 
ATOM   3135  N N     . LYS A 1 406 ? 22.994  158.991 33.350  1.00 21.83 ? 406  LYS A N     1 
ATOM   3136  C CA    . LYS A 1 406 ? 23.080  158.682 31.924  1.00 22.47 ? 406  LYS A CA    1 
ATOM   3137  C C     . LYS A 1 406 ? 24.274  157.785 31.613  1.00 22.33 ? 406  LYS A C     1 
ATOM   3138  O O     . LYS A 1 406 ? 24.355  157.243 30.510  1.00 22.54 ? 406  LYS A O     1 
ATOM   3139  C CB    . LYS A 1 406 ? 23.210  159.985 31.112  1.00 22.61 ? 406  LYS A CB    1 
ATOM   3140  C CG    . LYS A 1 406 ? 21.913  160.827 31.109  1.00 24.30 ? 406  LYS A CG    1 
ATOM   3141  C CD    . LYS A 1 406 ? 22.049  162.169 30.425  1.00 23.70 ? 406  LYS A CD    1 
ATOM   3142  C CE    . LYS A 1 406 ? 20.676  162.865 30.393  1.00 25.68 ? 406  LYS A CE    1 
ATOM   3143  N NZ    . LYS A 1 406 ? 20.739  164.254 29.864  1.00 27.76 ? 406  LYS A NZ    1 
ATOM   3144  N N     . CYS A 1 407 ? 25.187  157.626 32.582  1.00 21.53 ? 407  CYS A N     1 
ATOM   3145  C CA    . CYS A 1 407 ? 26.455  156.910 32.350  1.00 20.87 ? 407  CYS A CA    1 
ATOM   3146  C C     . CYS A 1 407 ? 26.562  155.645 33.171  1.00 20.17 ? 407  CYS A C     1 
ATOM   3147  O O     . CYS A 1 407 ? 26.447  155.707 34.393  1.00 20.37 ? 407  CYS A O     1 
ATOM   3148  C CB    . CYS A 1 407 ? 27.660  157.809 32.680  1.00 20.49 ? 407  CYS A CB    1 
ATOM   3149  S SG    . CYS A 1 407 ? 27.670  159.369 31.786  1.00 21.12 ? 407  CYS A SG    1 
ATOM   3150  N N     . PRO A 1 408 ? 26.805  154.492 32.508  1.00 19.89 ? 408  PRO A N     1 
ATOM   3151  C CA    . PRO A 1 408 ? 27.143  153.287 33.265  1.00 19.58 ? 408  PRO A CA    1 
ATOM   3152  C C     . PRO A 1 408 ? 28.387  153.547 34.096  1.00 19.24 ? 408  PRO A C     1 
ATOM   3153  O O     . PRO A 1 408 ? 29.267  154.324 33.664  1.00 18.92 ? 408  PRO A O     1 
ATOM   3154  C CB    . PRO A 1 408 ? 27.464  152.253 32.170  1.00 19.78 ? 408  PRO A CB    1 
ATOM   3155  C CG    . PRO A 1 408 ? 26.713  152.755 30.953  1.00 19.89 ? 408  PRO A CG    1 
ATOM   3156  C CD    . PRO A 1 408 ? 26.785  154.244 31.050  1.00 19.55 ? 408  PRO A CD    1 
ATOM   3157  N N     . VAL A 1 409 ? 28.444  152.919 35.270  1.00 18.60 ? 409  VAL A N     1 
ATOM   3158  C CA    . VAL A 1 409 ? 29.617  152.974 36.146  1.00 18.24 ? 409  VAL A CA    1 
ATOM   3159  C C     . VAL A 1 409 ? 30.315  151.625 36.067  1.00 18.90 ? 409  VAL A C     1 
ATOM   3160  O O     . VAL A 1 409 ? 29.704  150.585 36.352  1.00 18.93 ? 409  VAL A O     1 
ATOM   3161  C CB    . VAL A 1 409 ? 29.252  153.310 37.643  1.00 17.73 ? 409  VAL A CB    1 
ATOM   3162  C CG1   . VAL A 1 409 ? 30.481  153.208 38.531  1.00 18.06 ? 409  VAL A CG1   1 
ATOM   3163  C CG2   . VAL A 1 409 ? 28.660  154.718 37.765  1.00 17.07 ? 409  VAL A CG2   1 
ATOM   3164  N N     . VAL A 1 410 ? 31.582  151.626 35.649  1.00 18.70 ? 410  VAL A N     1 
ATOM   3165  C CA    . VAL A 1 410 ? 32.336  150.393 35.631  1.00 18.69 ? 410  VAL A CA    1 
ATOM   3166  C C     . VAL A 1 410 ? 33.236  150.309 36.869  1.00 18.96 ? 410  VAL A C     1 
ATOM   3167  O O     . VAL A 1 410 ? 34.239  151.004 36.988  1.00 18.67 ? 410  VAL A O     1 
ATOM   3168  C CB    . VAL A 1 410 ? 33.115  150.153 34.306  1.00 19.00 ? 410  VAL A CB    1 
ATOM   3169  C CG1   . VAL A 1 410 ? 32.142  150.011 33.125  1.00 18.99 ? 410  VAL A CG1   1 
ATOM   3170  C CG2   . VAL A 1 410 ? 34.183  151.263 34.057  1.00 17.34 ? 410  VAL A CG2   1 
ATOM   3171  N N     . ASP A 1 411 ? 32.823  149.466 37.799  1.00 18.86 ? 411  ASP A N     1 
ATOM   3172  C CA    . ASP A 1 411 ? 33.575  149.229 39.013  1.00 19.40 ? 411  ASP A CA    1 
ATOM   3173  C C     . ASP A 1 411 ? 34.530  148.062 38.747  1.00 19.29 ? 411  ASP A C     1 
ATOM   3174  O O     . ASP A 1 411 ? 34.120  146.913 38.671  1.00 18.43 ? 411  ASP A O     1 
ATOM   3175  C CB    . ASP A 1 411 ? 32.606  148.960 40.174  1.00 18.82 ? 411  ASP A CB    1 
ATOM   3176  C CG    . ASP A 1 411 ? 33.319  148.673 41.481  1.00 20.80 ? 411  ASP A CG    1 
ATOM   3177  O OD1   . ASP A 1 411 ? 34.535  148.966 41.590  1.00 18.70 ? 411  ASP A OD1   1 
ATOM   3178  O OD2   . ASP A 1 411 ? 32.646  148.166 42.403  1.00 23.20 ? 411  ASP A OD2   1 
ATOM   3179  N N     . THR A 1 412 ? 35.805  148.401 38.574  1.00 19.48 ? 412  THR A N     1 
ATOM   3180  C CA    . THR A 1 412 ? 36.832  147.459 38.146  1.00 19.74 ? 412  THR A CA    1 
ATOM   3181  C C     . THR A 1 412 ? 37.655  146.939 39.351  1.00 19.33 ? 412  THR A C     1 
ATOM   3182  O O     . THR A 1 412 ? 38.464  147.693 39.922  1.00 19.71 ? 412  THR A O     1 
ATOM   3183  C CB    . THR A 1 412 ? 37.831  148.154 37.148  1.00 20.00 ? 412  THR A CB    1 
ATOM   3184  O OG1   . THR A 1 412 ? 38.548  149.188 37.832  1.00 19.82 ? 412  THR A OG1   1 
ATOM   3185  C CG2   . THR A 1 412 ? 37.121  148.771 35.918  1.00 19.85 ? 412  THR A CG2   1 
ATOM   3186  N N     . TRP A 1 413 ? 37.439  145.684 39.752  1.00 18.15 ? 413  TRP A N     1 
ATOM   3187  C CA    . TRP A 1 413 ? 38.325  145.024 40.725  1.00 17.09 ? 413  TRP A CA    1 
ATOM   3188  C C     . TRP A 1 413 ? 39.568  144.457 40.025  1.00 17.04 ? 413  TRP A C     1 
ATOM   3189  O O     . TRP A 1 413 ? 39.458  143.765 39.024  1.00 17.09 ? 413  TRP A O     1 
ATOM   3190  C CB    . TRP A 1 413 ? 37.633  143.869 41.472  1.00 17.44 ? 413  TRP A CB    1 
ATOM   3191  C CG    . TRP A 1 413 ? 38.605  143.194 42.402  1.00 16.51 ? 413  TRP A CG    1 
ATOM   3192  C CD1   . TRP A 1 413 ? 39.012  143.643 43.627  1.00 14.88 ? 413  TRP A CD1   1 
ATOM   3193  C CD2   . TRP A 1 413 ? 39.373  142.015 42.130  1.00 16.73 ? 413  TRP A CD2   1 
ATOM   3194  N NE1   . TRP A 1 413 ? 39.950  142.794 44.154  1.00 14.81 ? 413  TRP A NE1   1 
ATOM   3195  C CE2   . TRP A 1 413 ? 40.204  141.794 43.258  1.00 15.12 ? 413  TRP A CE2   1 
ATOM   3196  C CE3   . TRP A 1 413 ? 39.415  141.101 41.056  1.00 16.67 ? 413  TRP A CE3   1 
ATOM   3197  C CZ2   . TRP A 1 413 ? 41.052  140.700 43.357  1.00 14.70 ? 413  TRP A CZ2   1 
ATOM   3198  C CZ3   . TRP A 1 413 ? 40.277  140.021 41.144  1.00 15.81 ? 413  TRP A CZ3   1 
ATOM   3199  C CH2   . TRP A 1 413 ? 41.081  139.825 42.297  1.00 16.13 ? 413  TRP A CH2   1 
ATOM   3200  N N     . TRP A 1 414 ? 40.749  144.786 40.542  1.00 16.96 ? 414  TRP A N     1 
ATOM   3201  C CA    . TRP A 1 414 ? 42.009  144.179 40.085  1.00 16.92 ? 414  TRP A CA    1 
ATOM   3202  C C     . TRP A 1 414 ? 43.118  144.586 41.056  1.00 16.64 ? 414  TRP A C     1 
ATOM   3203  O O     . TRP A 1 414 ? 42.808  145.144 42.129  1.00 16.95 ? 414  TRP A O     1 
ATOM   3204  C CB    . TRP A 1 414 ? 42.327  144.537 38.621  1.00 15.82 ? 414  TRP A CB    1 
ATOM   3205  C CG    . TRP A 1 414 ? 42.502  146.002 38.380  1.00 16.55 ? 414  TRP A CG    1 
ATOM   3206  C CD1   . TRP A 1 414 ? 41.558  146.985 38.538  1.00 14.40 ? 414  TRP A CD1   1 
ATOM   3207  C CD2   . TRP A 1 414 ? 43.695  146.655 37.904  1.00 14.61 ? 414  TRP A CD2   1 
ATOM   3208  N NE1   . TRP A 1 414 ? 42.098  148.200 38.202  1.00 15.33 ? 414  TRP A NE1   1 
ATOM   3209  C CE2   . TRP A 1 414 ? 43.411  148.031 37.830  1.00 14.30 ? 414  TRP A CE2   1 
ATOM   3210  C CE3   . TRP A 1 414 ? 44.980  146.206 37.561  1.00 14.66 ? 414  TRP A CE3   1 
ATOM   3211  C CZ2   . TRP A 1 414 ? 44.362  148.973 37.411  1.00 15.11 ? 414  TRP A CZ2   1 
ATOM   3212  C CZ3   . TRP A 1 414 ? 45.935  147.143 37.138  1.00 15.28 ? 414  TRP A CZ3   1 
ATOM   3213  C CH2   . TRP A 1 414 ? 45.611  148.512 37.054  1.00 14.35 ? 414  TRP A CH2   1 
ATOM   3214  N N     . GLN A 1 415 ? 44.375  144.278 40.703  1.00 16.59 ? 415  GLN A N     1 
ATOM   3215  C CA    . GLN A 1 415 ? 45.531  144.423 41.591  1.00 16.80 ? 415  GLN A CA    1 
ATOM   3216  C C     . GLN A 1 415 ? 46.795  144.655 40.793  1.00 17.77 ? 415  GLN A C     1 
ATOM   3217  O O     . GLN A 1 415 ? 46.859  144.309 39.607  1.00 18.19 ? 415  GLN A O     1 
ATOM   3218  C CB    . GLN A 1 415 ? 45.778  143.152 42.414  1.00 17.40 ? 415  GLN A CB    1 
ATOM   3219  C CG    . GLN A 1 415 ? 44.552  142.490 43.022  1.00 15.92 ? 415  GLN A CG    1 
ATOM   3220  C CD    . GLN A 1 415 ? 44.933  141.297 43.845  1.00 16.60 ? 415  GLN A CD    1 
ATOM   3221  O OE1   . GLN A 1 415 ? 45.314  140.259 43.298  1.00 17.36 ? 415  GLN A OE1   1 
ATOM   3222  N NE2   . GLN A 1 415 ? 44.823  141.417 45.166  1.00 14.71 ? 415  GLN A NE2   1 
ATOM   3223  N N     . THR A 1 416 ? 47.828  145.195 41.451  1.00 17.40 ? 416  THR A N     1 
ATOM   3224  C CA    . THR A 1 416 ? 49.119  145.376 40.787  1.00 17.63 ? 416  THR A CA    1 
ATOM   3225  C C     . THR A 1 416 ? 49.535  144.054 40.106  1.00 18.02 ? 416  THR A C     1 
ATOM   3226  O O     . THR A 1 416 ? 50.027  144.041 38.963  1.00 18.10 ? 416  THR A O     1 
ATOM   3227  C CB    . THR A 1 416 ? 50.214  145.896 41.775  1.00 16.90 ? 416  THR A CB    1 
ATOM   3228  O OG1   . THR A 1 416 ? 49.710  147.039 42.484  1.00 15.96 ? 416  THR A OG1   1 
ATOM   3229  C CG2   . THR A 1 416 ? 51.469  146.299 41.018  1.00 16.91 ? 416  THR A CG2   1 
ATOM   3230  N N     . GLU A 1 417 ? 49.297  142.952 40.814  1.00 17.58 ? 417  GLU A N     1 
ATOM   3231  C CA    . GLU A 1 417 ? 49.718  141.624 40.388  1.00 18.25 ? 417  GLU A CA    1 
ATOM   3232  C C     . GLU A 1 417 ? 48.930  141.077 39.179  1.00 18.70 ? 417  GLU A C     1 
ATOM   3233  O O     . GLU A 1 417 ? 49.307  140.068 38.585  1.00 18.53 ? 417  GLU A O     1 
ATOM   3234  C CB    . GLU A 1 417 ? 49.679  140.646 41.589  1.00 18.47 ? 417  GLU A CB    1 
ATOM   3235  C CG    . GLU A 1 417 ? 50.623  141.038 42.765  1.00 18.19 ? 417  GLU A CG    1 
ATOM   3236  C CD    . GLU A 1 417 ? 49.920  141.835 43.871  1.00 20.61 ? 417  GLU A CD    1 
ATOM   3237  O OE1   . GLU A 1 417 ? 49.054  142.655 43.556  1.00 18.63 ? 417  GLU A OE1   1 
ATOM   3238  O OE2   . GLU A 1 417 ? 50.220  141.643 45.074  1.00 21.64 ? 417  GLU A OE2   1 
ATOM   3239  N N     . THR A 1 418 ? 47.849  141.755 38.794  1.00 18.90 ? 418  THR A N     1 
ATOM   3240  C CA    . THR A 1 418 ? 47.015  141.247 37.721  1.00 18.65 ? 418  THR A CA    1 
ATOM   3241  C C     . THR A 1 418 ? 47.168  142.026 36.421  1.00 19.02 ? 418  THR A C     1 
ATOM   3242  O O     . THR A 1 418 ? 46.621  141.621 35.409  1.00 19.67 ? 418  THR A O     1 
ATOM   3243  C CB    . THR A 1 418 ? 45.502  141.141 38.109  1.00 19.22 ? 418  THR A CB    1 
ATOM   3244  O OG1   . THR A 1 418 ? 44.892  142.430 38.100  1.00 18.27 ? 418  THR A OG1   1 
ATOM   3245  C CG2   . THR A 1 418 ? 45.274  140.438 39.483  1.00 17.71 ? 418  THR A CG2   1 
ATOM   3246  N N     . GLY A 1 419 ? 47.909  143.138 36.445  1.00 19.04 ? 419  GLY A N     1 
ATOM   3247  C CA    . GLY A 1 419 ? 48.224  143.895 35.223  1.00 18.14 ? 419  GLY A CA    1 
ATOM   3248  C C     . GLY A 1 419 ? 47.065  144.733 34.706  1.00 17.83 ? 419  GLY A C     1 
ATOM   3249  O O     . GLY A 1 419 ? 47.261  145.884 34.290  1.00 18.25 ? 419  GLY A O     1 
ATOM   3250  N N     . GLY A 1 420 ? 45.865  144.155 34.723  1.00 16.98 ? 420  GLY A N     1 
ATOM   3251  C CA    . GLY A 1 420 ? 44.656  144.826 34.236  1.00 16.81 ? 420  GLY A CA    1 
ATOM   3252  C C     . GLY A 1 420 ? 43.394  144.331 34.937  1.00 17.00 ? 420  GLY A C     1 
ATOM   3253  O O     . GLY A 1 420 ? 43.472  143.469 35.800  1.00 16.64 ? 420  GLY A O     1 
ATOM   3254  N N     . PHE A 1 421 ? 42.247  144.906 34.556  1.00 17.02 ? 421  PHE A N     1 
ATOM   3255  C CA    . PHE A 1 421 ? 40.917  144.593 35.088  1.00 17.25 ? 421  PHE A CA    1 
ATOM   3256  C C     . PHE A 1 421 ? 40.626  143.095 35.150  1.00 17.18 ? 421  PHE A C     1 
ATOM   3257  O O     . PHE A 1 421 ? 40.919  142.363 34.221  1.00 17.00 ? 421  PHE A O     1 
ATOM   3258  C CB    . PHE A 1 421 ? 39.843  145.261 34.216  1.00 17.39 ? 421  PHE A CB    1 
ATOM   3259  C CG    . PHE A 1 421 ? 39.990  146.755 34.076  1.00 17.29 ? 421  PHE A CG    1 
ATOM   3260  C CD1   . PHE A 1 421 ? 39.462  147.409 32.960  1.00 17.44 ? 421  PHE A CD1   1 
ATOM   3261  C CD2   . PHE A 1 421 ? 40.638  147.515 35.056  1.00 16.28 ? 421  PHE A CD2   1 
ATOM   3262  C CE1   . PHE A 1 421 ? 39.573  148.787 32.821  1.00 16.00 ? 421  PHE A CE1   1 
ATOM   3263  C CE2   . PHE A 1 421 ? 40.755  148.905 34.922  1.00 14.19 ? 421  PHE A CE2   1 
ATOM   3264  C CZ    . PHE A 1 421 ? 40.220  149.537 33.808  1.00 16.02 ? 421  PHE A CZ    1 
ATOM   3265  N N     . MET A 1 422 ? 40.022  142.653 36.245  1.00 17.56 ? 422  MET A N     1 
ATOM   3266  C CA    . MET A 1 422 ? 39.792  141.227 36.461  1.00 17.16 ? 422  MET A CA    1 
ATOM   3267  C C     . MET A 1 422 ? 38.315  140.879 36.538  1.00 16.66 ? 422  MET A C     1 
ATOM   3268  O O     . MET A 1 422 ? 37.849  139.943 35.895  1.00 17.70 ? 422  MET A O     1 
ATOM   3269  C CB    . MET A 1 422 ? 40.538  140.763 37.723  1.00 16.83 ? 422  MET A CB    1 
ATOM   3270  C CG    . MET A 1 422 ? 42.069  140.839 37.596  1.00 15.84 ? 422  MET A CG    1 
ATOM   3271  S SD    . MET A 1 422 ? 42.760  139.658 36.408  1.00 18.65 ? 422  MET A SD    1 
ATOM   3272  C CE    . MET A 1 422 ? 42.472  138.118 37.314  1.00 15.90 ? 422  MET A CE    1 
ATOM   3273  N N     . ILE A 1 423 ? 37.585  141.610 37.361  1.00 17.54 ? 423  ILE A N     1 
ATOM   3274  C CA    . ILE A 1 423 ? 36.150  141.421 37.530  1.00 17.82 ? 423  ILE A CA    1 
ATOM   3275  C C     . ILE A 1 423 ? 35.589  142.818 37.377  1.00 18.51 ? 423  ILE A C     1 
ATOM   3276  O O     . ILE A 1 423 ? 35.948  143.726 38.121  1.00 19.53 ? 423  ILE A O     1 
ATOM   3277  C CB    . ILE A 1 423 ? 35.784  140.812 38.906  1.00 18.10 ? 423  ILE A CB    1 
ATOM   3278  C CG1   . ILE A 1 423 ? 36.484  139.452 39.107  1.00 19.02 ? 423  ILE A CG1   1 
ATOM   3279  C CG2   . ILE A 1 423 ? 34.267  140.628 39.039  1.00 16.61 ? 423  ILE A CG2   1 
ATOM   3280  C CD1   . ILE A 1 423 ? 36.316  138.852 40.520  1.00 18.05 ? 423  ILE A CD1   1 
ATOM   3281  N N     . THR A 1 424 ? 34.764  143.008 36.362  1.00 18.64 ? 424  THR A N     1 
ATOM   3282  C CA    . THR A 1 424 ? 34.349  144.342 35.981  1.00 18.33 ? 424  THR A CA    1 
ATOM   3283  C C     . THR A 1 424 ? 33.124  144.222 35.104  1.00 18.89 ? 424  THR A C     1 
ATOM   3284  O O     . THR A 1 424 ? 33.028  143.260 34.333  1.00 18.74 ? 424  THR A O     1 
ATOM   3285  C CB    . THR A 1 424 ? 35.480  145.107 35.203  1.00 18.68 ? 424  THR A CB    1 
ATOM   3286  O OG1   . THR A 1 424 ? 34.988  146.370 34.758  1.00 17.47 ? 424  THR A OG1   1 
ATOM   3287  C CG2   . THR A 1 424 ? 35.994  144.315 33.991  1.00 16.99 ? 424  THR A CG2   1 
ATOM   3288  N N     . PRO A 1 425 ? 32.210  145.223 35.180  1.00 19.06 ? 425  PRO A N     1 
ATOM   3289  C CA    . PRO A 1 425 ? 31.155  145.332 34.176  1.00 18.86 ? 425  PRO A CA    1 
ATOM   3290  C C     . PRO A 1 425 ? 31.752  145.727 32.826  1.00 18.77 ? 425  PRO A C     1 
ATOM   3291  O O     . PRO A 1 425 ? 32.854  146.290 32.772  1.00 16.87 ? 425  PRO A O     1 
ATOM   3292  C CB    . PRO A 1 425 ? 30.276  146.492 34.683  1.00 19.08 ? 425  PRO A CB    1 
ATOM   3293  C CG    . PRO A 1 425 ? 30.788  146.899 35.975  1.00 18.19 ? 425  PRO A CG    1 
ATOM   3294  C CD    . PRO A 1 425 ? 32.161  146.331 36.156  1.00 18.74 ? 425  PRO A CD    1 
ATOM   3295  N N     . LEU A 1 426 ? 31.030  145.403 31.752  1.00 19.17 ? 426  LEU A N     1 
ATOM   3296  C CA    . LEU A 1 426 ? 31.276  145.996 30.443  1.00 19.84 ? 426  LEU A CA    1 
ATOM   3297  C C     . LEU A 1 426 ? 29.988  146.737 30.216  1.00 19.49 ? 426  LEU A C     1 
ATOM   3298  O O     . LEU A 1 426 ? 28.942  146.163 30.445  1.00 19.69 ? 426  LEU A O     1 
ATOM   3299  C CB    . LEU A 1 426 ? 31.532  144.937 29.348  1.00 19.71 ? 426  LEU A CB    1 
ATOM   3300  C CG    . LEU A 1 426 ? 32.982  144.408 29.161  1.00 20.64 ? 426  LEU A CG    1 
ATOM   3301  C CD1   . LEU A 1 426 ? 33.454  143.599 30.360  1.00 16.37 ? 426  LEU A CD1   1 
ATOM   3302  C CD2   . LEU A 1 426 ? 33.116  143.571 27.879  1.00 20.21 ? 426  LEU A CD2   1 
ATOM   3303  N N     . PRO A 1 427 ? 30.061  148.014 29.777  1.00 19.39 ? 427  PRO A N     1 
ATOM   3304  C CA    . PRO A 1 427 ? 28.941  148.959 29.852  1.00 19.75 ? 427  PRO A CA    1 
ATOM   3305  C C     . PRO A 1 427 ? 27.748  148.610 28.951  1.00 19.84 ? 427  PRO A C     1 
ATOM   3306  O O     . PRO A 1 427 ? 26.617  148.920 29.305  1.00 20.86 ? 427  PRO A O     1 
ATOM   3307  C CB    . PRO A 1 427 ? 29.542  150.278 29.355  1.00 19.25 ? 427  PRO A CB    1 
ATOM   3308  C CG    . PRO A 1 427 ? 30.981  150.057 29.227  1.00 19.19 ? 427  PRO A CG    1 
ATOM   3309  C CD    . PRO A 1 427 ? 31.227  148.613 29.106  1.00 19.26 ? 427  PRO A CD    1 
ATOM   3310  N N     . GLY A 1 428 ? 28.003  148.020 27.789  1.00 19.94 ? 428  GLY A N     1 
ATOM   3311  C CA    . GLY A 1 428 ? 26.928  147.615 26.898  1.00 20.19 ? 428  GLY A CA    1 
ATOM   3312  C C     . GLY A 1 428 ? 26.593  146.146 27.013  1.00 20.83 ? 428  GLY A C     1 
ATOM   3313  O O     . GLY A 1 428 ? 25.732  145.661 26.276  1.00 21.36 ? 428  GLY A O     1 
ATOM   3314  N N     . ALA A 1 429 ? 27.268  145.428 27.924  1.00 20.95 ? 429  ALA A N     1 
ATOM   3315  C CA    . ALA A 1 429 ? 27.096  143.979 28.029  1.00 21.48 ? 429  ALA A CA    1 
ATOM   3316  C C     . ALA A 1 429 ? 26.480  143.529 29.348  1.00 22.03 ? 429  ALA A C     1 
ATOM   3317  O O     . ALA A 1 429 ? 25.783  142.509 29.387  1.00 21.26 ? 429  ALA A O     1 
ATOM   3318  C CB    . ALA A 1 429 ? 28.430  143.261 27.799  1.00 21.64 ? 429  ALA A CB    1 
ATOM   3319  N N     . ILE A 1 430 ? 26.764  144.270 30.429  1.00 22.62 ? 430  ILE A N     1 
ATOM   3320  C CA    . ILE A 1 430 ? 26.397  143.830 31.786  1.00 22.93 ? 430  ILE A CA    1 
ATOM   3321  C C     . ILE A 1 430 ? 25.604  144.910 32.525  1.00 23.27 ? 430  ILE A C     1 
ATOM   3322  O O     . ILE A 1 430 ? 25.971  146.085 32.505  1.00 23.64 ? 430  ILE A O     1 
ATOM   3323  C CB    . ILE A 1 430 ? 27.662  143.373 32.614  1.00 23.34 ? 430  ILE A CB    1 
ATOM   3324  C CG1   . ILE A 1 430 ? 28.370  142.180 31.927  1.00 23.06 ? 430  ILE A CG1   1 
ATOM   3325  C CG2   . ILE A 1 430 ? 27.281  142.992 34.060  1.00 22.80 ? 430  ILE A CG2   1 
ATOM   3326  C CD1   . ILE A 1 430 ? 29.809  141.913 32.394  1.00 22.46 ? 430  ILE A CD1   1 
ATOM   3327  N N     . GLU A 1 431 ? 24.505  144.491 33.150  1.00 23.26 ? 431  GLU A N     1 
ATOM   3328  C CA    . GLU A 1 431 ? 23.635  145.350 33.930  1.00 23.37 ? 431  GLU A CA    1 
ATOM   3329  C C     . GLU A 1 431 ? 24.207  145.570 35.327  1.00 23.01 ? 431  GLU A C     1 
ATOM   3330  O O     . GLU A 1 431 ? 24.677  144.637 35.974  1.00 23.24 ? 431  GLU A O     1 
ATOM   3331  C CB    . GLU A 1 431 ? 22.244  144.723 34.024  1.00 23.24 ? 431  GLU A CB    1 
ATOM   3332  C CG    . GLU A 1 431 ? 21.439  144.775 32.726  1.00 23.89 ? 431  GLU A CG    1 
ATOM   3333  C CD    . GLU A 1 431 ? 19.983  144.324 32.915  1.00 24.50 ? 431  GLU A CD    1 
ATOM   3334  O OE1   . GLU A 1 431 ? 19.716  143.526 33.839  1.00 24.87 ? 431  GLU A OE1   1 
ATOM   3335  O OE2   . GLU A 1 431 ? 19.106  144.779 32.145  1.00 23.95 ? 431  GLU A OE2   1 
ATOM   3336  N N     . LEU A 1 432 ? 24.140  146.802 35.807  1.00 22.99 ? 432  LEU A N     1 
ATOM   3337  C CA    . LEU A 1 432 ? 24.941  147.205 36.982  1.00 22.20 ? 432  LEU A CA    1 
ATOM   3338  C C     . LEU A 1 432 ? 24.235  146.991 38.322  1.00 22.59 ? 432  LEU A C     1 
ATOM   3339  O O     . LEU A 1 432 ? 23.020  147.161 38.432  1.00 22.18 ? 432  LEU A O     1 
ATOM   3340  C CB    . LEU A 1 432 ? 25.374  148.659 36.838  1.00 21.35 ? 432  LEU A CB    1 
ATOM   3341  C CG    . LEU A 1 432 ? 25.995  148.952 35.476  1.00 19.66 ? 432  LEU A CG    1 
ATOM   3342  C CD1   . LEU A 1 432 ? 26.319  150.393 35.365  1.00 17.00 ? 432  LEU A CD1   1 
ATOM   3343  C CD2   . LEU A 1 432 ? 27.236  148.084 35.240  1.00 19.34 ? 432  LEU A CD2   1 
ATOM   3344  N N     . LYS A 1 433 ? 25.001  146.574 39.328  1.00 22.42 ? 433  LYS A N     1 
ATOM   3345  C CA    . LYS A 1 433 ? 24.522  146.647 40.699  1.00 22.21 ? 433  LYS A CA    1 
ATOM   3346  C C     . LYS A 1 433 ? 25.470  147.556 41.469  1.00 22.01 ? 433  LYS A C     1 
ATOM   3347  O O     . LYS A 1 433 ? 26.704  147.355 41.455  1.00 22.17 ? 433  LYS A O     1 
ATOM   3348  C CB    . LYS A 1 433 ? 24.475  145.265 41.344  1.00 22.69 ? 433  LYS A CB    1 
ATOM   3349  C CG    . LYS A 1 433 ? 23.487  144.319 40.716  1.00 23.34 ? 433  LYS A CG    1 
ATOM   3350  C CD    . LYS A 1 433 ? 23.246  143.130 41.621  1.00 23.63 ? 433  LYS A CD    1 
ATOM   3351  C CE    . LYS A 1 433 ? 22.828  141.928 40.810  1.00 24.17 ? 433  LYS A CE    1 
ATOM   3352  N NZ    . LYS A 1 433 ? 22.446  140.775 41.681  1.00 22.69 ? 433  LYS A NZ    1 
ATOM   3353  N N     . ALA A 1 434 ? 24.894  148.550 42.132  1.00 21.16 ? 434  ALA A N     1 
ATOM   3354  C CA    . ALA A 1 434 ? 25.640  149.512 42.949  1.00 20.52 ? 434  ALA A CA    1 
ATOM   3355  C C     . ALA A 1 434 ? 26.535  148.827 43.982  1.00 20.08 ? 434  ALA A C     1 
ATOM   3356  O O     . ALA A 1 434 ? 26.051  148.183 44.896  1.00 20.19 ? 434  ALA A O     1 
ATOM   3357  C CB    . ALA A 1 434 ? 24.667  150.469 43.624  1.00 20.54 ? 434  ALA A CB    1 
ATOM   3358  N N     . GLY A 1 435 ? 27.848  148.941 43.819  1.00 19.85 ? 435  GLY A N     1 
ATOM   3359  C CA    . GLY A 1 435 ? 28.777  148.316 44.756  1.00 19.13 ? 435  GLY A CA    1 
ATOM   3360  C C     . GLY A 1 435 ? 29.331  146.964 44.333  1.00 19.37 ? 435  GLY A C     1 
ATOM   3361  O O     . GLY A 1 435 ? 30.158  146.390 45.060  1.00 19.69 ? 435  GLY A O     1 
ATOM   3362  N N     . SER A 1 436 ? 28.886  146.451 43.173  1.00 18.56 ? 436  SER A N     1 
ATOM   3363  C CA    . SER A 1 436 ? 29.341  145.159 42.633  1.00 18.41 ? 436  SER A CA    1 
ATOM   3364  C C     . SER A 1 436 ? 30.293  145.325 41.452  1.00 19.35 ? 436  SER A C     1 
ATOM   3365  O O     . SER A 1 436 ? 29.998  146.078 40.530  1.00 19.62 ? 436  SER A O     1 
ATOM   3366  C CB    . SER A 1 436 ? 28.141  144.301 42.171  1.00 19.13 ? 436  SER A CB    1 
ATOM   3367  O OG    . SER A 1 436 ? 28.551  143.049 41.662  1.00 16.33 ? 436  SER A OG    1 
ATOM   3368  N N     . ALA A 1 437 ? 31.437  144.630 41.490  1.00 19.34 ? 437  ALA A N     1 
ATOM   3369  C CA    . ALA A 1 437 ? 32.356  144.570 40.350  1.00 19.75 ? 437  ALA A CA    1 
ATOM   3370  C C     . ALA A 1 437 ? 31.738  143.749 39.222  1.00 19.65 ? 437  ALA A C     1 
ATOM   3371  O O     . ALA A 1 437 ? 32.159  143.856 38.069  1.00 20.14 ? 437  ALA A O     1 
ATOM   3372  C CB    . ALA A 1 437 ? 33.701  143.985 40.758  1.00 19.83 ? 437  ALA A CB    1 
ATOM   3373  N N     . THR A 1 438 ? 30.727  142.962 39.584  1.00 18.67 ? 438  THR A N     1 
ATOM   3374  C CA    . THR A 1 438 ? 29.922  142.124 38.681  1.00 18.54 ? 438  THR A CA    1 
ATOM   3375  C C     . THR A 1 438 ? 30.643  140.835 38.252  1.00 18.62 ? 438  THR A C     1 
ATOM   3376  O O     . THR A 1 438 ? 30.867  139.962 39.098  1.00 18.95 ? 438  THR A O     1 
ATOM   3377  C CB    . THR A 1 438 ? 29.240  142.910 37.488  1.00 18.04 ? 438  THR A CB    1 
ATOM   3378  O OG1   . THR A 1 438 ? 30.213  143.262 36.501  1.00 18.76 ? 438  THR A OG1   1 
ATOM   3379  C CG2   . THR A 1 438 ? 28.518  144.169 37.980  1.00 17.08 ? 438  THR A CG2   1 
ATOM   3380  N N     . ARG A 1 439 ? 31.016  140.731 36.976  1.00 18.17 ? 439  ARG A N     1 
ATOM   3381  C CA    . ARG A 1 439 ? 31.455  139.471 36.381  1.00 18.66 ? 439  ARG A CA    1 
ATOM   3382  C C     . ARG A 1 439 ? 32.921  139.467 35.931  1.00 18.46 ? 439  ARG A C     1 
ATOM   3383  O O     . ARG A 1 439 ? 33.466  140.524 35.573  1.00 18.04 ? 439  ARG A O     1 
ATOM   3384  C CB    . ARG A 1 439 ? 30.576  139.144 35.153  1.00 19.61 ? 439  ARG A CB    1 
ATOM   3385  C CG    . ARG A 1 439 ? 29.086  138.970 35.445  1.00 23.01 ? 439  ARG A CG    1 
ATOM   3386  C CD    . ARG A 1 439 ? 28.486  137.988 34.432  1.00 31.91 ? 439  ARG A CD    1 
ATOM   3387  N NE    . ARG A 1 439 ? 27.012  138.002 34.381  1.00 36.43 ? 439  ARG A NE    1 
ATOM   3388  C CZ    . ARG A 1 439 ? 26.215  137.220 35.114  1.00 37.69 ? 439  ARG A CZ    1 
ATOM   3389  N NH1   . ARG A 1 439 ? 26.729  136.361 35.988  1.00 37.49 ? 439  ARG A NH1   1 
ATOM   3390  N NH2   . ARG A 1 439 ? 24.891  137.302 34.975  1.00 39.67 ? 439  ARG A NH2   1 
ATOM   3391  N N     . PRO A 1 440 ? 33.549  138.274 35.894  1.00 17.54 ? 440  PRO A N     1 
ATOM   3392  C CA    . PRO A 1 440 ? 34.950  138.183 35.421  1.00 17.72 ? 440  PRO A CA    1 
ATOM   3393  C C     . PRO A 1 440 ? 35.159  138.648 33.968  1.00 17.95 ? 440  PRO A C     1 
ATOM   3394  O O     . PRO A 1 440 ? 34.303  138.432 33.104  1.00 18.04 ? 440  PRO A O     1 
ATOM   3395  C CB    . PRO A 1 440 ? 35.271  136.688 35.523  1.00 17.22 ? 440  PRO A CB    1 
ATOM   3396  C CG    . PRO A 1 440 ? 33.845  135.982 35.451  1.00 18.31 ? 440  PRO A CG    1 
ATOM   3397  C CD    . PRO A 1 440 ? 32.996  136.959 36.273  1.00 17.44 ? 440  PRO A CD    1 
ATOM   3398  N N     . PHE A 1 441 ? 36.290  139.301 33.722  1.00 17.57 ? 441  PHE A N     1 
ATOM   3399  C CA    . PHE A 1 441 ? 36.706  139.641 32.374  1.00 17.63 ? 441  PHE A CA    1 
ATOM   3400  C C     . PHE A 1 441 ? 37.075  138.359 31.619  1.00 18.07 ? 441  PHE A C     1 
ATOM   3401  O O     . PHE A 1 441 ? 37.253  137.291 32.229  1.00 18.19 ? 441  PHE A O     1 
ATOM   3402  C CB    . PHE A 1 441 ? 37.887  140.638 32.399  1.00 15.94 ? 441  PHE A CB    1 
ATOM   3403  C CG    . PHE A 1 441 ? 38.131  141.315 31.067  1.00 17.08 ? 441  PHE A CG    1 
ATOM   3404  C CD1   . PHE A 1 441 ? 37.226  142.276 30.580  1.00 15.43 ? 441  PHE A CD1   1 
ATOM   3405  C CD2   . PHE A 1 441 ? 39.243  140.982 30.282  1.00 15.13 ? 441  PHE A CD2   1 
ATOM   3406  C CE1   . PHE A 1 441 ? 37.434  142.873 29.337  1.00 16.66 ? 441  PHE A CE1   1 
ATOM   3407  C CE2   . PHE A 1 441 ? 39.462  141.589 29.033  1.00 15.23 ? 441  PHE A CE2   1 
ATOM   3408  C CZ    . PHE A 1 441 ? 38.561  142.521 28.555  1.00 16.29 ? 441  PHE A CZ    1 
ATOM   3409  N N     . PHE A 1 442 ? 37.168  138.480 30.295  1.00 18.67 ? 442  PHE A N     1 
ATOM   3410  C CA    . PHE A 1 442 ? 37.663  137.433 29.412  1.00 19.11 ? 442  PHE A CA    1 
ATOM   3411  C C     . PHE A 1 442 ? 38.969  136.895 29.927  1.00 18.92 ? 442  PHE A C     1 
ATOM   3412  O O     . PHE A 1 442 ? 39.876  137.671 30.237  1.00 18.03 ? 442  PHE A O     1 
ATOM   3413  C CB    . PHE A 1 442 ? 37.849  137.960 27.981  1.00 19.75 ? 442  PHE A CB    1 
ATOM   3414  C CG    . PHE A 1 442 ? 36.620  138.631 27.428  1.00 21.55 ? 442  PHE A CG    1 
ATOM   3415  C CD1   . PHE A 1 442 ? 36.715  139.857 26.781  1.00 22.71 ? 442  PHE A CD1   1 
ATOM   3416  C CD2   . PHE A 1 442 ? 35.354  138.053 27.613  1.00 23.41 ? 442  PHE A CD2   1 
ATOM   3417  C CE1   . PHE A 1 442 ? 35.566  140.490 26.285  1.00 24.16 ? 442  PHE A CE1   1 
ATOM   3418  C CE2   . PHE A 1 442 ? 34.192  138.678 27.138  1.00 24.61 ? 442  PHE A CE2   1 
ATOM   3419  C CZ    . PHE A 1 442 ? 34.301  139.909 26.466  1.00 22.86 ? 442  PHE A CZ    1 
ATOM   3420  N N     . GLY A 1 443 ? 39.023  135.562 30.030  1.00 18.84 ? 443  GLY A N     1 
ATOM   3421  C CA    . GLY A 1 443 ? 40.219  134.818 30.446  1.00 19.60 ? 443  GLY A CA    1 
ATOM   3422  C C     . GLY A 1 443 ? 40.395  134.710 31.960  1.00 19.75 ? 443  GLY A C     1 
ATOM   3423  O O     . GLY A 1 443 ? 41.369  134.106 32.443  1.00 20.01 ? 443  GLY A O     1 
ATOM   3424  N N     . VAL A 1 444 ? 39.457  135.290 32.709  1.00 19.38 ? 444  VAL A N     1 
ATOM   3425  C CA    . VAL A 1 444 ? 39.545  135.319 34.177  1.00 19.99 ? 444  VAL A CA    1 
ATOM   3426  C C     . VAL A 1 444 ? 38.598  134.288 34.791  1.00 20.46 ? 444  VAL A C     1 
ATOM   3427  O O     . VAL A 1 444 ? 37.393  134.360 34.563  1.00 20.69 ? 444  VAL A O     1 
ATOM   3428  C CB    . VAL A 1 444 ? 39.263  136.729 34.761  1.00 19.42 ? 444  VAL A CB    1 
ATOM   3429  C CG1   . VAL A 1 444 ? 39.294  136.689 36.276  1.00 18.82 ? 444  VAL A CG1   1 
ATOM   3430  C CG2   . VAL A 1 444 ? 40.292  137.735 34.239  1.00 19.17 ? 444  VAL A CG2   1 
ATOM   3431  N N     . GLN A 1 445 ? 39.137  133.334 35.559  1.00 20.99 ? 445  GLN A N     1 
ATOM   3432  C CA    . GLN A 1 445 ? 38.295  132.334 36.235  1.00 21.22 ? 445  GLN A CA    1 
ATOM   3433  C C     . GLN A 1 445 ? 38.395  132.478 37.748  1.00 21.48 ? 445  GLN A C     1 
ATOM   3434  O O     . GLN A 1 445 ? 39.271  131.865 38.367  1.00 20.99 ? 445  GLN A O     1 
ATOM   3435  C CB    . GLN A 1 445 ? 38.672  130.912 35.813  1.00 21.49 ? 445  GLN A CB    1 
ATOM   3436  C CG    . GLN A 1 445 ? 38.611  130.673 34.323  1.00 22.12 ? 445  GLN A CG    1 
ATOM   3437  C CD    . GLN A 1 445 ? 39.149  129.297 33.898  1.00 23.08 ? 445  GLN A CD    1 
ATOM   3438  O OE1   . GLN A 1 445 ? 38.580  128.264 34.248  1.00 26.05 ? 445  GLN A OE1   1 
ATOM   3439  N NE2   . GLN A 1 445 ? 40.203  129.295 33.082  1.00 23.32 ? 445  GLN A NE2   1 
ATOM   3440  N N     . PRO A 1 446 ? 37.483  133.281 38.355  1.00 21.80 ? 446  PRO A N     1 
ATOM   3441  C CA    . PRO A 1 446 ? 37.504  133.452 39.791  1.00 21.70 ? 446  PRO A CA    1 
ATOM   3442  C C     . PRO A 1 446 ? 36.836  132.273 40.502  1.00 22.59 ? 446  PRO A C     1 
ATOM   3443  O O     . PRO A 1 446 ? 36.062  131.527 39.884  1.00 22.47 ? 446  PRO A O     1 
ATOM   3444  C CB    . PRO A 1 446 ? 36.693  134.736 40.000  1.00 21.81 ? 446  PRO A CB    1 
ATOM   3445  C CG    . PRO A 1 446 ? 35.717  134.750 38.881  1.00 22.46 ? 446  PRO A CG    1 
ATOM   3446  C CD    . PRO A 1 446 ? 36.375  134.032 37.724  1.00 21.75 ? 446  PRO A CD    1 
ATOM   3447  N N     . ALA A 1 447 ? 37.144  132.101 41.786  1.00 22.35 ? 447  ALA A N     1 
ATOM   3448  C CA    . ALA A 1 447 ? 36.402  131.173 42.640  1.00 22.45 ? 447  ALA A CA    1 
ATOM   3449  C C     . ALA A 1 447 ? 36.500  131.666 44.071  1.00 22.26 ? 447  ALA A C     1 
ATOM   3450  O O     . ALA A 1 447 ? 37.349  132.501 44.398  1.00 21.83 ? 447  ALA A O     1 
ATOM   3451  C CB    . ALA A 1 447 ? 36.930  129.707 42.520  1.00 22.15 ? 447  ALA A CB    1 
ATOM   3452  N N     . LEU A 1 448 ? 35.616  131.145 44.914  1.00 21.99 ? 448  LEU A N     1 
ATOM   3453  C CA    . LEU A 1 448 ? 35.594  131.471 46.323  1.00 22.14 ? 448  LEU A CA    1 
ATOM   3454  C C     . LEU A 1 448 ? 35.848  130.168 47.063  1.00 22.57 ? 448  LEU A C     1 
ATOM   3455  O O     . LEU A 1 448 ? 35.130  129.206 46.872  1.00 21.80 ? 448  LEU A O     1 
ATOM   3456  C CB    . LEU A 1 448 ? 34.252  132.103 46.704  1.00 21.61 ? 448  LEU A CB    1 
ATOM   3457  C CG    . LEU A 1 448 ? 33.869  133.385 45.930  1.00 22.52 ? 448  LEU A CG    1 
ATOM   3458  C CD1   . LEU A 1 448 ? 32.573  133.988 46.454  1.00 18.72 ? 448  LEU A CD1   1 
ATOM   3459  C CD2   . LEU A 1 448 ? 35.008  134.435 45.947  1.00 19.02 ? 448  LEU A CD2   1 
ATOM   3460  N N     . VAL A 1 449 ? 36.915  130.143 47.859  1.00 23.00 ? 449  VAL A N     1 
ATOM   3461  C CA    . VAL A 1 449 ? 37.300  128.962 48.595  1.00 23.81 ? 449  VAL A CA    1 
ATOM   3462  C C     . VAL A 1 449 ? 37.277  129.275 50.090  1.00 25.24 ? 449  VAL A C     1 
ATOM   3463  O O     . VAL A 1 449 ? 37.525  130.413 50.507  1.00 25.66 ? 449  VAL A O     1 
ATOM   3464  C CB    . VAL A 1 449 ? 38.710  128.407 48.148  1.00 23.83 ? 449  VAL A CB    1 
ATOM   3465  C CG1   . VAL A 1 449 ? 38.718  128.008 46.664  1.00 23.28 ? 449  VAL A CG1   1 
ATOM   3466  C CG2   . VAL A 1 449 ? 39.817  129.406 48.422  1.00 22.20 ? 449  VAL A CG2   1 
ATOM   3467  N N     . ASP A 1 450 ? 36.973  128.268 50.901  1.00 26.90 ? 450  ASP A N     1 
ATOM   3468  C CA    . ASP A 1 450 ? 37.052  128.415 52.350  1.00 28.14 ? 450  ASP A CA    1 
ATOM   3469  C C     . ASP A 1 450 ? 38.536  128.400 52.771  1.00 29.13 ? 450  ASP A C     1 
ATOM   3470  O O     . ASP A 1 450 ? 39.415  128.173 51.921  1.00 29.59 ? 450  ASP A O     1 
ATOM   3471  C CB    . ASP A 1 450 ? 36.227  127.318 53.035  1.00 28.23 ? 450  ASP A CB    1 
ATOM   3472  C CG    . ASP A 1 450 ? 36.722  125.906 52.716  1.00 29.16 ? 450  ASP A CG    1 
ATOM   3473  O OD1   . ASP A 1 450 ? 37.903  125.727 52.360  1.00 29.55 ? 450  ASP A OD1   1 
ATOM   3474  O OD2   . ASP A 1 450 ? 35.921  124.957 52.827  1.00 30.65 ? 450  ASP A OD2   1 
ATOM   3475  N N     . ASN A 1 451 ? 38.824  128.632 54.054  1.00 29.70 ? 451  ASN A N     1 
ATOM   3476  C CA    . ASN A 1 451 ? 40.216  128.715 54.528  1.00 30.84 ? 451  ASN A CA    1 
ATOM   3477  C C     . ASN A 1 451 ? 41.048  127.442 54.327  1.00 31.45 ? 451  ASN A C     1 
ATOM   3478  O O     . ASN A 1 451 ? 42.280  127.476 54.426  1.00 31.62 ? 451  ASN A O     1 
ATOM   3479  C CB    . ASN A 1 451 ? 40.277  129.174 55.989  1.00 30.59 ? 451  ASN A CB    1 
ATOM   3480  C CG    . ASN A 1 451 ? 39.890  130.622 56.157  1.00 31.68 ? 451  ASN A CG    1 
ATOM   3481  O OD1   . ASN A 1 451 ? 39.583  131.315 55.190  1.00 33.34 ? 451  ASN A OD1   1 
ATOM   3482  N ND2   . ASN A 1 451 ? 39.898  131.092 57.389  1.00 33.28 ? 451  ASN A ND2   1 
ATOM   3483  N N     . GLU A 1 452 ? 40.358  126.340 54.040  1.00 32.13 ? 452  GLU A N     1 
ATOM   3484  C CA    . GLU A 1 452 ? 40.969  125.038 53.752  1.00 33.01 ? 452  GLU A CA    1 
ATOM   3485  C C     . GLU A 1 452 ? 41.142  124.804 52.261  1.00 32.59 ? 452  GLU A C     1 
ATOM   3486  O O     . GLU A 1 452 ? 41.683  123.778 51.858  1.00 33.18 ? 452  GLU A O     1 
ATOM   3487  C CB    . GLU A 1 452 ? 40.106  123.890 54.318  1.00 33.07 ? 452  GLU A CB    1 
ATOM   3488  C CG    . GLU A 1 452 ? 39.957  123.888 55.830  1.00 36.17 ? 452  GLU A CG    1 
ATOM   3489  C CD    . GLU A 1 452 ? 39.214  125.113 56.348  1.00 40.12 ? 452  GLU A CD    1 
ATOM   3490  O OE1   . GLU A 1 452 ? 38.088  125.390 55.867  1.00 42.09 ? 452  GLU A OE1   1 
ATOM   3491  O OE2   . GLU A 1 452 ? 39.770  125.808 57.227  1.00 41.63 ? 452  GLU A OE2   1 
ATOM   3492  N N     . GLY A 1 453 ? 40.640  125.718 51.440  1.00 32.28 ? 453  GLY A N     1 
ATOM   3493  C CA    . GLY A 1 453 ? 40.819  125.598 49.996  1.00 32.07 ? 453  GLY A CA    1 
ATOM   3494  C C     . GLY A 1 453 ? 39.698  124.971 49.194  1.00 31.92 ? 453  GLY A C     1 
ATOM   3495  O O     . GLY A 1 453 ? 39.858  124.764 47.991  1.00 31.47 ? 453  GLY A O     1 
ATOM   3496  N N     . HIS A 1 454 ? 38.563  124.690 49.836  1.00 32.41 ? 454  HIS A N     1 
ATOM   3497  C CA    . HIS A 1 454 ? 37.428  124.071 49.135  1.00 33.31 ? 454  HIS A CA    1 
ATOM   3498  C C     . HIS A 1 454 ? 36.583  125.120 48.422  1.00 33.20 ? 454  HIS A C     1 
ATOM   3499  O O     . HIS A 1 454 ? 36.139  126.080 49.047  1.00 33.59 ? 454  HIS A O     1 
ATOM   3500  C CB    . HIS A 1 454 ? 36.535  123.241 50.071  1.00 33.47 ? 454  HIS A CB    1 
ATOM   3501  C CG    . HIS A 1 454 ? 37.279  122.239 50.903  1.00 35.78 ? 454  HIS A CG    1 
ATOM   3502  N ND1   . HIS A 1 454 ? 37.431  122.372 52.268  1.00 37.52 ? 454  HIS A ND1   1 
ATOM   3503  C CD2   . HIS A 1 454 ? 37.912  121.088 50.564  1.00 36.48 ? 454  HIS A CD2   1 
ATOM   3504  C CE1   . HIS A 1 454 ? 38.128  121.350 52.734  1.00 37.72 ? 454  HIS A CE1   1 
ATOM   3505  N NE2   . HIS A 1 454 ? 38.435  120.560 51.721  1.00 38.03 ? 454  HIS A NE2   1 
ATOM   3506  N N     . PRO A 1 455 ? 36.349  124.932 47.111  1.00 33.19 ? 455  PRO A N     1 
ATOM   3507  C CA    . PRO A 1 455 ? 35.510  125.860 46.365  1.00 33.26 ? 455  PRO A CA    1 
ATOM   3508  C C     . PRO A 1 455 ? 34.094  125.874 46.919  1.00 33.18 ? 455  PRO A C     1 
ATOM   3509  O O     . PRO A 1 455 ? 33.545  124.825 47.254  1.00 32.75 ? 455  PRO A O     1 
ATOM   3510  C CB    . PRO A 1 455 ? 35.524  125.300 44.934  1.00 33.40 ? 455  PRO A CB    1 
ATOM   3511  C CG    . PRO A 1 455 ? 36.717  124.391 44.874  1.00 33.78 ? 455  PRO A CG    1 
ATOM   3512  C CD    . PRO A 1 455 ? 36.869  123.844 46.262  1.00 33.45 ? 455  PRO A CD    1 
ATOM   3513  N N     . GLN A 1 456 ? 33.526  127.071 47.019  1.00 32.70 ? 456  GLN A N     1 
ATOM   3514  C CA    . GLN A 1 456 ? 32.170  127.256 47.489  1.00 32.26 ? 456  GLN A CA    1 
ATOM   3515  C C     . GLN A 1 456 ? 31.266  127.558 46.292  1.00 31.67 ? 456  GLN A C     1 
ATOM   3516  O O     . GLN A 1 456 ? 31.545  128.462 45.525  1.00 31.73 ? 456  GLN A O     1 
ATOM   3517  C CB    . GLN A 1 456 ? 32.118  128.384 48.525  1.00 32.52 ? 456  GLN A CB    1 
ATOM   3518  C CG    . GLN A 1 456 ? 32.996  128.186 49.764  1.00 33.62 ? 456  GLN A CG    1 
ATOM   3519  C CD    . GLN A 1 456 ? 32.782  126.840 50.464  1.00 36.29 ? 456  GLN A CD    1 
ATOM   3520  O OE1   . GLN A 1 456 ? 33.744  126.183 50.839  1.00 38.01 ? 456  GLN A OE1   1 
ATOM   3521  N NE2   . GLN A 1 456 ? 31.526  126.422 50.621  1.00 35.55 ? 456  GLN A NE2   1 
ATOM   3522  N N     . GLU A 1 457 ? 30.196  126.791 46.119  1.00 31.21 ? 457  GLU A N     1 
ATOM   3523  C CA    . GLU A 1 457 ? 29.296  126.997 44.977  1.00 31.05 ? 457  GLU A CA    1 
ATOM   3524  C C     . GLU A 1 457 ? 28.055  127.834 45.348  1.00 30.72 ? 457  GLU A C     1 
ATOM   3525  O O     . GLU A 1 457 ? 27.734  127.998 46.533  1.00 30.92 ? 457  GLU A O     1 
ATOM   3526  C CB    . GLU A 1 457 ? 28.909  125.652 44.350  1.00 31.26 ? 457  GLU A CB    1 
ATOM   3527  N N     . GLY A 1 458 ? 27.368  128.374 44.340  1.00 30.50 ? 458  GLY A N     1 
ATOM   3528  C CA    . GLY A 1 458 ? 26.153  129.174 44.571  1.00 29.40 ? 458  GLY A CA    1 
ATOM   3529  C C     . GLY A 1 458 ? 26.418  130.516 45.245  1.00 29.41 ? 458  GLY A C     1 
ATOM   3530  O O     . GLY A 1 458 ? 27.565  131.000 45.273  1.00 28.93 ? 458  GLY A O     1 
ATOM   3531  N N     . ALA A 1 459 ? 25.352  131.133 45.754  1.00 28.83 ? 459  ALA A N     1 
ATOM   3532  C CA    . ALA A 1 459 ? 25.455  132.370 46.503  1.00 28.74 ? 459  ALA A CA    1 
ATOM   3533  C C     . ALA A 1 459 ? 26.201  132.027 47.765  1.00 28.88 ? 459  ALA A C     1 
ATOM   3534  O O     . ALA A 1 459 ? 25.772  131.173 48.545  1.00 28.81 ? 459  ALA A O     1 
ATOM   3535  C CB    . ALA A 1 459 ? 24.094  132.935 46.823  1.00 28.74 ? 459  ALA A CB    1 
ATOM   3536  N N     . THR A 1 460 ? 27.346  132.680 47.937  1.00 28.93 ? 460  THR A N     1 
ATOM   3537  C CA    . THR A 1 460 ? 28.299  132.321 48.969  1.00 28.62 ? 460  THR A CA    1 
ATOM   3538  C C     . THR A 1 460 ? 29.356  133.409 49.137  1.00 28.60 ? 460  THR A C     1 
ATOM   3539  O O     . THR A 1 460 ? 29.305  134.454 48.474  1.00 28.23 ? 460  THR A O     1 
ATOM   3540  C CB    . THR A 1 460 ? 28.965  130.939 48.661  1.00 28.52 ? 460  THR A CB    1 
ATOM   3541  O OG1   . THR A 1 460 ? 29.630  130.461 49.830  1.00 28.61 ? 460  THR A OG1   1 
ATOM   3542  C CG2   . THR A 1 460 ? 29.947  131.016 47.508  1.00 28.40 ? 460  THR A CG2   1 
ATOM   3543  N N     . GLU A 1 461 ? 30.283  133.171 50.056  1.00 28.11 ? 461  GLU A N     1 
ATOM   3544  C CA    . GLU A 1 461 ? 31.439  134.018 50.215  1.00 28.75 ? 461  GLU A CA    1 
ATOM   3545  C C     . GLU A 1 461 ? 32.635  133.191 50.629  1.00 27.31 ? 461  GLU A C     1 
ATOM   3546  O O     . GLU A 1 461 ? 32.486  132.070 51.101  1.00 27.00 ? 461  GLU A O     1 
ATOM   3547  C CB    . GLU A 1 461 ? 31.182  135.179 51.191  1.00 28.78 ? 461  GLU A CB    1 
ATOM   3548  C CG    . GLU A 1 461 ? 30.666  134.820 52.563  1.00 31.11 ? 461  GLU A CG    1 
ATOM   3549  C CD    . GLU A 1 461 ? 30.421  136.075 53.401  1.00 32.29 ? 461  GLU A CD    1 
ATOM   3550  O OE1   . GLU A 1 461 ? 31.365  136.891 53.529  1.00 37.53 ? 461  GLU A OE1   1 
ATOM   3551  O OE2   . GLU A 1 461 ? 29.289  136.262 53.916  1.00 36.34 ? 461  GLU A OE2   1 
ATOM   3552  N N     . GLY A 1 462 ? 33.821  133.762 50.436  1.00 26.36 ? 462  GLY A N     1 
ATOM   3553  C CA    . GLY A 1 462 ? 35.072  133.099 50.770  1.00 24.41 ? 462  GLY A CA    1 
ATOM   3554  C C     . GLY A 1 462 ? 36.270  133.877 50.254  1.00 23.19 ? 462  GLY A C     1 
ATOM   3555  O O     . GLY A 1 462 ? 36.172  135.055 49.920  1.00 22.11 ? 462  GLY A O     1 
ATOM   3556  N N     . ASN A 1 463 ? 37.406  133.189 50.208  1.00 22.39 ? 463  ASN A N     1 
ATOM   3557  C CA    . ASN A 1 463 ? 38.661  133.750 49.726  1.00 20.90 ? 463  ASN A CA    1 
ATOM   3558  C C     . ASN A 1 463 ? 38.650  133.797 48.216  1.00 20.03 ? 463  ASN A C     1 
ATOM   3559  O O     . ASN A 1 463 ? 38.400  132.793 47.565  1.00 20.01 ? 463  ASN A O     1 
ATOM   3560  C CB    . ASN A 1 463 ? 39.814  132.910 50.242  1.00 20.76 ? 463  ASN A CB    1 
ATOM   3561  C CG    . ASN A 1 463 ? 39.853  132.877 51.752  1.00 21.71 ? 463  ASN A CG    1 
ATOM   3562  O OD1   . ASN A 1 463 ? 40.142  133.886 52.388  1.00 22.62 ? 463  ASN A OD1   1 
ATOM   3563  N ND2   . ASN A 1 463 ? 39.525  131.736 52.333  1.00 21.81 ? 463  ASN A ND2   1 
ATOM   3564  N N     . LEU A 1 464 ? 38.920  134.969 47.662  1.00 18.91 ? 464  LEU A N     1 
ATOM   3565  C CA    . LEU A 1 464 ? 38.870  135.140 46.221  1.00 18.55 ? 464  LEU A CA    1 
ATOM   3566  C C     . LEU A 1 464 ? 40.176  134.689 45.557  1.00 18.64 ? 464  LEU A C     1 
ATOM   3567  O O     . LEU A 1 464 ? 41.246  135.282 45.762  1.00 17.99 ? 464  LEU A O     1 
ATOM   3568  C CB    . LEU A 1 464 ? 38.535  136.599 45.865  1.00 18.33 ? 464  LEU A CB    1 
ATOM   3569  C CG    . LEU A 1 464 ? 38.529  136.996 44.389  1.00 18.87 ? 464  LEU A CG    1 
ATOM   3570  C CD1   . LEU A 1 464 ? 37.524  136.152 43.522  1.00 16.89 ? 464  LEU A CD1   1 
ATOM   3571  C CD2   . LEU A 1 464 ? 38.260  138.472 44.269  1.00 17.23 ? 464  LEU A CD2   1 
ATOM   3572  N N     . VAL A 1 465 ? 40.061  133.646 44.750  1.00 18.84 ? 465  VAL A N     1 
ATOM   3573  C CA    . VAL A 1 465 ? 41.201  133.092 44.042  1.00 19.80 ? 465  VAL A CA    1 
ATOM   3574  C C     . VAL A 1 465 ? 40.893  133.204 42.558  1.00 19.97 ? 465  VAL A C     1 
ATOM   3575  O O     . VAL A 1 465 ? 39.732  133.400 42.164  1.00 19.72 ? 465  VAL A O     1 
ATOM   3576  C CB    . VAL A 1 465 ? 41.512  131.591 44.403  1.00 19.92 ? 465  VAL A CB    1 
ATOM   3577  C CG1   . VAL A 1 465 ? 41.984  131.427 45.841  1.00 18.87 ? 465  VAL A CG1   1 
ATOM   3578  C CG2   . VAL A 1 465 ? 40.310  130.652 44.097  1.00 20.96 ? 465  VAL A CG2   1 
ATOM   3579  N N     . ILE A 1 466 ? 41.954  133.123 41.759  1.00 19.69 ? 466  ILE A N     1 
ATOM   3580  C CA    . ILE A 1 466 ? 41.844  132.965 40.320  1.00 18.99 ? 466  ILE A CA    1 
ATOM   3581  C C     . ILE A 1 466 ? 42.508  131.625 39.993  1.00 19.27 ? 466  ILE A C     1 
ATOM   3582  O O     . ILE A 1 466 ? 43.645  131.382 40.388  1.00 19.14 ? 466  ILE A O     1 
ATOM   3583  C CB    . ILE A 1 466 ? 42.492  134.151 39.538  1.00 18.62 ? 466  ILE A CB    1 
ATOM   3584  C CG1   . ILE A 1 466 ? 42.113  135.525 40.139  1.00 16.68 ? 466  ILE A CG1   1 
ATOM   3585  C CG2   . ILE A 1 466 ? 42.197  134.043 38.019  1.00 17.44 ? 466  ILE A CG2   1 
ATOM   3586  C CD1   . ILE A 1 466 ? 40.594  135.932 40.083  1.00 16.73 ? 466  ILE A CD1   1 
ATOM   3587  N N     . THR A 1 467 ? 41.785  130.761 39.278  1.00 18.90 ? 467  THR A N     1 
ATOM   3588  C CA    . THR A 1 467 ? 42.181  129.376 39.108  1.00 19.40 ? 467  THR A CA    1 
ATOM   3589  C C     . THR A 1 467 ? 42.994  129.072 37.843  1.00 19.17 ? 467  THR A C     1 
ATOM   3590  O O     . THR A 1 467 ? 43.447  127.940 37.646  1.00 18.61 ? 467  THR A O     1 
ATOM   3591  C CB    . THR A 1 467 ? 40.928  128.414 39.189  1.00 19.70 ? 467  THR A CB    1 
ATOM   3592  O OG1   . THR A 1 467 ? 40.068  128.655 38.073  1.00 19.27 ? 467  THR A OG1   1 
ATOM   3593  C CG2   . THR A 1 467 ? 40.158  128.640 40.474  1.00 19.77 ? 467  THR A CG2   1 
ATOM   3594  N N     . ASP A 1 468 ? 43.188  130.066 36.980  1.00 19.68 ? 468  ASP A N     1 
ATOM   3595  C CA    . ASP A 1 468 ? 44.087  129.895 35.842  1.00 19.87 ? 468  ASP A CA    1 
ATOM   3596  C C     . ASP A 1 468 ? 44.701  131.243 35.519  1.00 19.94 ? 468  ASP A C     1 
ATOM   3597  O O     . ASP A 1 468 ? 44.235  132.248 36.032  1.00 18.90 ? 468  ASP A O     1 
ATOM   3598  C CB    . ASP A 1 468 ? 43.332  129.324 34.628  1.00 19.93 ? 468  ASP A CB    1 
ATOM   3599  C CG    . ASP A 1 468 ? 44.215  128.434 33.744  1.00 22.88 ? 468  ASP A CG    1 
ATOM   3600  O OD1   . ASP A 1 468 ? 45.446  128.634 33.700  1.00 23.75 ? 468  ASP A OD1   1 
ATOM   3601  O OD2   . ASP A 1 468 ? 43.666  127.525 33.077  1.00 24.34 ? 468  ASP A OD2   1 
ATOM   3602  N N     . SER A 1 469 ? 45.725  131.259 34.651  1.00 19.47 ? 469  SER A N     1 
ATOM   3603  C CA    . SER A 1 469 ? 46.398  132.502 34.250  1.00 19.21 ? 469  SER A CA    1 
ATOM   3604  C C     . SER A 1 469 ? 45.567  133.334 33.248  1.00 19.43 ? 469  SER A C     1 
ATOM   3605  O O     . SER A 1 469 ? 44.560  132.857 32.706  1.00 19.57 ? 469  SER A O     1 
ATOM   3606  C CB    . SER A 1 469 ? 47.766  132.161 33.667  1.00 19.00 ? 469  SER A CB    1 
ATOM   3607  O OG    . SER A 1 469 ? 48.627  133.284 33.647  1.00 17.73 ? 469  SER A OG    1 
ATOM   3608  N N     . TRP A 1 470 ? 46.001  134.571 33.029  1.00 18.56 ? 470  TRP A N     1 
ATOM   3609  C CA    . TRP A 1 470 ? 45.429  135.507 32.058  1.00 18.15 ? 470  TRP A CA    1 
ATOM   3610  C C     . TRP A 1 470 ? 46.649  136.327 31.565  1.00 18.47 ? 470  TRP A C     1 
ATOM   3611  O O     . TRP A 1 470 ? 47.664  136.421 32.294  1.00 18.71 ? 470  TRP A O     1 
ATOM   3612  C CB    . TRP A 1 470 ? 44.375  136.414 32.732  1.00 18.08 ? 470  TRP A CB    1 
ATOM   3613  C CG    . TRP A 1 470 ? 44.949  137.208 33.897  1.00 16.29 ? 470  TRP A CG    1 
ATOM   3614  C CD1   . TRP A 1 470 ? 45.372  138.502 33.884  1.00 14.57 ? 470  TRP A CD1   1 
ATOM   3615  C CD2   . TRP A 1 470 ? 45.190  136.721 35.212  1.00 15.31 ? 470  TRP A CD2   1 
ATOM   3616  N NE1   . TRP A 1 470 ? 45.850  138.857 35.121  1.00 13.51 ? 470  TRP A NE1   1 
ATOM   3617  C CE2   . TRP A 1 470 ? 45.768  137.772 35.949  1.00 15.35 ? 470  TRP A CE2   1 
ATOM   3618  C CE3   . TRP A 1 470 ? 44.978  135.487 35.845  1.00 15.54 ? 470  TRP A CE3   1 
ATOM   3619  C CZ2   . TRP A 1 470 ? 46.120  137.632 37.296  1.00 16.96 ? 470  TRP A CZ2   1 
ATOM   3620  C CZ3   . TRP A 1 470 ? 45.337  135.348 37.164  1.00 15.28 ? 470  TRP A CZ3   1 
ATOM   3621  C CH2   . TRP A 1 470 ? 45.904  136.414 37.877  1.00 17.04 ? 470  TRP A CH2   1 
ATOM   3622  N N     . PRO A 1 471 ? 46.602  136.865 30.321  1.00 18.22 ? 471  PRO A N     1 
ATOM   3623  C CA    . PRO A 1 471 ? 47.820  137.478 29.730  1.00 17.83 ? 471  PRO A CA    1 
ATOM   3624  C C     . PRO A 1 471 ? 48.539  138.560 30.539  1.00 17.76 ? 471  PRO A C     1 
ATOM   3625  O O     . PRO A 1 471 ? 49.769  138.663 30.444  1.00 17.62 ? 471  PRO A O     1 
ATOM   3626  C CB    . PRO A 1 471 ? 47.316  138.049 28.385  1.00 17.91 ? 471  PRO A CB    1 
ATOM   3627  C CG    . PRO A 1 471 ? 46.153  137.143 28.049  1.00 17.90 ? 471  PRO A CG    1 
ATOM   3628  C CD    . PRO A 1 471 ? 45.476  136.870 29.365  1.00 17.88 ? 471  PRO A CD    1 
ATOM   3629  N N     . GLY A 1 472 ? 47.785  139.354 31.306  1.00 17.53 ? 472  GLY A N     1 
ATOM   3630  C CA    . GLY A 1 472 ? 48.325  140.483 32.032  1.00 17.40 ? 472  GLY A CA    1 
ATOM   3631  C C     . GLY A 1 472 ? 48.937  140.148 33.379  1.00 18.29 ? 472  GLY A C     1 
ATOM   3632  O O     . GLY A 1 472 ? 49.424  141.035 34.054  1.00 19.10 ? 472  GLY A O     1 
ATOM   3633  N N     . GLN A 1 473 ? 48.919  138.876 33.774  1.00 17.89 ? 473  GLN A N     1 
ATOM   3634  C CA    . GLN A 1 473 ? 49.390  138.466 35.103  1.00 17.43 ? 473  GLN A CA    1 
ATOM   3635  C C     . GLN A 1 473 ? 50.857  138.844 35.360  1.00 18.21 ? 473  GLN A C     1 
ATOM   3636  O O     . GLN A 1 473 ? 51.730  138.672 34.464  1.00 17.13 ? 473  GLN A O     1 
ATOM   3637  C CB    . GLN A 1 473 ? 49.202  136.950 35.294  1.00 16.97 ? 473  GLN A CB    1 
ATOM   3638  C CG    . GLN A 1 473 ? 49.482  136.511 36.722  1.00 15.77 ? 473  GLN A CG    1 
ATOM   3639  C CD    . GLN A 1 473 ? 49.140  135.069 36.996  1.00 16.67 ? 473  GLN A CD    1 
ATOM   3640  O OE1   . GLN A 1 473 ? 48.878  134.289 36.079  1.00 17.07 ? 473  GLN A OE1   1 
ATOM   3641  N NE2   . GLN A 1 473 ? 49.151  134.695 38.274  1.00 17.14 ? 473  GLN A NE2   1 
ATOM   3642  N N     . ALA A 1 474 ? 51.128  139.358 36.571  1.00 17.64 ? 474  ALA A N     1 
ATOM   3643  C CA    . ALA A 1 474 ? 52.507  139.603 36.999  1.00 17.99 ? 474  ALA A CA    1 
ATOM   3644  C C     . ALA A 1 474 ? 53.301  138.292 36.929  1.00 18.85 ? 474  ALA A C     1 
ATOM   3645  O O     . ALA A 1 474 ? 52.796  137.217 37.318  1.00 18.57 ? 474  ALA A O     1 
ATOM   3646  C CB    . ALA A 1 474 ? 52.552  140.175 38.414  1.00 18.18 ? 474  ALA A CB    1 
ATOM   3647  N N     . ARG A 1 475 ? 54.532  138.383 36.420  1.00 18.63 ? 475  ARG A N     1 
ATOM   3648  C CA    . ARG A 1 475 ? 55.320  137.187 36.147  1.00 18.25 ? 475  ARG A CA    1 
ATOM   3649  C C     . ARG A 1 475 ? 56.169  136.736 37.317  1.00 17.93 ? 475  ARG A C     1 
ATOM   3650  O O     . ARG A 1 475 ? 56.465  135.551 37.440  1.00 18.74 ? 475  ARG A O     1 
ATOM   3651  C CB    . ARG A 1 475 ? 56.210  137.365 34.920  1.00 18.37 ? 475  ARG A CB    1 
ATOM   3652  C CG    . ARG A 1 475 ? 55.478  137.734 33.661  1.00 17.48 ? 475  ARG A CG    1 
ATOM   3653  C CD    . ARG A 1 475 ? 54.407  136.745 33.314  1.00 16.54 ? 475  ARG A CD    1 
ATOM   3654  N NE    . ARG A 1 475 ? 54.125  136.825 31.889  1.00 18.43 ? 475  ARG A NE    1 
ATOM   3655  C CZ    . ARG A 1 475 ? 52.996  137.256 31.337  1.00 18.78 ? 475  ARG A CZ    1 
ATOM   3656  N NH1   . ARG A 1 475 ? 51.971  137.643 32.088  1.00 18.76 ? 475  ARG A NH1   1 
ATOM   3657  N NH2   . ARG A 1 475 ? 52.891  137.273 30.011  1.00 17.01 ? 475  ARG A NH2   1 
ATOM   3658  N N     . THR A 1 476 ? 56.572  137.678 38.161  1.00 18.02 ? 476  THR A N     1 
ATOM   3659  C CA    . THR A 1 476 ? 57.427  137.379 39.301  1.00 18.04 ? 476  THR A CA    1 
ATOM   3660  C C     . THR A 1 476 ? 57.511  138.597 40.215  1.00 18.05 ? 476  THR A C     1 
ATOM   3661  O O     . THR A 1 476 ? 56.839  139.601 39.958  1.00 18.08 ? 476  THR A O     1 
ATOM   3662  C CB    . THR A 1 476 ? 58.851  136.921 38.843  1.00 18.54 ? 476  THR A CB    1 
ATOM   3663  O OG1   . THR A 1 476 ? 59.514  136.276 39.936  1.00 19.33 ? 476  THR A OG1   1 
ATOM   3664  C CG2   . THR A 1 476 ? 59.699  138.117 38.346  1.00 16.47 ? 476  THR A CG2   1 
ATOM   3665  N N     . LEU A 1 477 ? 58.302  138.477 41.288  1.00 17.40 ? 477  LEU A N     1 
ATOM   3666  C CA    . LEU A 1 477 ? 58.706  139.606 42.141  1.00 17.50 ? 477  LEU A CA    1 
ATOM   3667  C C     . LEU A 1 477 ? 60.193  139.788 41.877  1.00 17.44 ? 477  LEU A C     1 
ATOM   3668  O O     . LEU A 1 477 ? 60.939  138.818 41.914  1.00 17.40 ? 477  LEU A O     1 
ATOM   3669  C CB    . LEU A 1 477 ? 58.508  139.302 43.642  1.00 16.96 ? 477  LEU A CB    1 
ATOM   3670  C CG    . LEU A 1 477 ? 57.086  139.086 44.200  1.00 16.77 ? 477  LEU A CG    1 
ATOM   3671  C CD1   . LEU A 1 477 ? 57.082  138.684 45.679  1.00 13.24 ? 477  LEU A CD1   1 
ATOM   3672  C CD2   . LEU A 1 477 ? 56.192  140.307 43.960  1.00 13.34 ? 477  LEU A CD2   1 
ATOM   3673  N N     . PHE A 1 478 ? 60.621  141.009 41.573  1.00 17.49 ? 478  PHE A N     1 
ATOM   3674  C CA    . PHE A 1 478 ? 62.012  141.251 41.221  1.00 17.39 ? 478  PHE A CA    1 
ATOM   3675  C C     . PHE A 1 478 ? 62.969  140.628 42.246  1.00 17.88 ? 478  PHE A C     1 
ATOM   3676  O O     . PHE A 1 478 ? 62.878  140.875 43.453  1.00 17.46 ? 478  PHE A O     1 
ATOM   3677  C CB    . PHE A 1 478 ? 62.268  142.743 41.077  1.00 17.65 ? 478  PHE A CB    1 
ATOM   3678  C CG    . PHE A 1 478 ? 63.646  143.090 40.539  1.00 18.18 ? 478  PHE A CG    1 
ATOM   3679  C CD1   . PHE A 1 478 ? 63.905  143.047 39.185  1.00 19.85 ? 478  PHE A CD1   1 
ATOM   3680  C CD2   . PHE A 1 478 ? 64.665  143.462 41.392  1.00 18.86 ? 478  PHE A CD2   1 
ATOM   3681  C CE1   . PHE A 1 478 ? 65.168  143.370 38.684  1.00 21.74 ? 478  PHE A CE1   1 
ATOM   3682  C CE2   . PHE A 1 478 ? 65.926  143.792 40.907  1.00 21.39 ? 478  PHE A CE2   1 
ATOM   3683  C CZ    . PHE A 1 478 ? 66.176  143.753 39.543  1.00 20.48 ? 478  PHE A CZ    1 
ATOM   3684  N N     . GLY A 1 479 ? 63.881  139.808 41.753  1.00 18.56 ? 479  GLY A N     1 
ATOM   3685  C CA    . GLY A 1 479 ? 64.923  139.213 42.593  1.00 19.87 ? 479  GLY A CA    1 
ATOM   3686  C C     . GLY A 1 479 ? 64.411  138.144 43.547  1.00 20.65 ? 479  GLY A C     1 
ATOM   3687  O O     . GLY A 1 479 ? 65.153  137.663 44.399  1.00 20.94 ? 479  GLY A O     1 
ATOM   3688  N N     . ASP A 1 480 ? 63.147  137.755 43.424  1.00 20.66 ? 480  ASP A N     1 
ATOM   3689  C CA    . ASP A 1 480 ? 62.621  136.835 44.431  1.00 21.53 ? 480  ASP A CA    1 
ATOM   3690  C C     . ASP A 1 480 ? 61.454  136.005 43.927  1.00 20.95 ? 480  ASP A C     1 
ATOM   3691  O O     . ASP A 1 480 ? 60.331  136.186 44.382  1.00 20.74 ? 480  ASP A O     1 
ATOM   3692  C CB    . ASP A 1 480 ? 62.201  137.637 45.673  1.00 21.94 ? 480  ASP A CB    1 
ATOM   3693  C CG    . ASP A 1 480 ? 62.278  136.827 46.954  1.00 24.18 ? 480  ASP A CG    1 
ATOM   3694  O OD1   . ASP A 1 480 ? 62.402  135.562 46.922  1.00 24.27 ? 480  ASP A OD1   1 
ATOM   3695  O OD2   . ASP A 1 480 ? 62.181  137.488 48.005  1.00 27.15 ? 480  ASP A OD2   1 
ATOM   3696  N N     . HIS A 1 481 ? 61.719  135.097 42.995  1.00 20.70 ? 481  HIS A N     1 
ATOM   3697  C CA    . HIS A 1 481 ? 60.663  134.225 42.475  1.00 21.16 ? 481  HIS A CA    1 
ATOM   3698  C C     . HIS A 1 481 ? 60.084  133.297 43.542  1.00 20.97 ? 481  HIS A C     1 
ATOM   3699  O O     . HIS A 1 481 ? 58.898  132.972 43.517  1.00 20.12 ? 481  HIS A O     1 
ATOM   3700  C CB    . HIS A 1 481 ? 61.137  133.390 41.271  1.00 21.13 ? 481  HIS A CB    1 
ATOM   3701  C CG    . HIS A 1 481 ? 60.004  132.755 40.528  1.00 21.24 ? 481  HIS A CG    1 
ATOM   3702  N ND1   . HIS A 1 481 ? 59.055  133.498 39.856  1.00 21.61 ? 481  HIS A ND1   1 
ATOM   3703  C CD2   . HIS A 1 481 ? 59.629  131.457 40.401  1.00 22.17 ? 481  HIS A CD2   1 
ATOM   3704  C CE1   . HIS A 1 481 ? 58.155  132.684 39.330  1.00 22.90 ? 481  HIS A CE1   1 
ATOM   3705  N NE2   . HIS A 1 481 ? 58.484  131.442 39.636  1.00 22.77 ? 481  HIS A NE2   1 
ATOM   3706  N N     . GLU A 1 482 ? 60.934  132.858 44.464  1.00 21.43 ? 482  GLU A N     1 
ATOM   3707  C CA    . GLU A 1 482 ? 60.493  131.998 45.560  1.00 21.87 ? 482  GLU A CA    1 
ATOM   3708  C C     . GLU A 1 482 ? 59.451  132.685 46.449  1.00 21.44 ? 482  GLU A C     1 
ATOM   3709  O O     . GLU A 1 482 ? 58.458  132.060 46.833  1.00 21.38 ? 482  GLU A O     1 
ATOM   3710  C CB    . GLU A 1 482 ? 61.695  131.525 46.399  1.00 22.85 ? 482  GLU A CB    1 
ATOM   3711  C CG    . GLU A 1 482 ? 62.727  130.695 45.639  1.00 25.99 ? 482  GLU A CG    1 
ATOM   3712  C CD    . GLU A 1 482 ? 62.087  129.523 44.960  1.00 32.65 ? 482  GLU A CD    1 
ATOM   3713  O OE1   . GLU A 1 482 ? 62.135  129.481 43.701  1.00 37.68 ? 482  GLU A OE1   1 
ATOM   3714  O OE2   . GLU A 1 482 ? 61.482  128.672 45.674  1.00 34.43 ? 482  GLU A OE2   1 
ATOM   3715  N N     . ARG A 1 483 ? 59.674  133.951 46.800  1.00 20.64 ? 483  ARG A N     1 
ATOM   3716  C CA    . ARG A 1 483 ? 58.664  134.698 47.574  1.00 20.86 ? 483  ARG A CA    1 
ATOM   3717  C C     . ARG A 1 483 ? 57.353  134.923 46.776  1.00 19.88 ? 483  ARG A C     1 
ATOM   3718  O O     . ARG A 1 483 ? 56.263  134.895 47.347  1.00 20.17 ? 483  ARG A O     1 
ATOM   3719  C CB    . ARG A 1 483 ? 59.231  136.019 48.122  1.00 20.70 ? 483  ARG A CB    1 
ATOM   3720  C CG    . ARG A 1 483 ? 58.267  136.768 49.089  1.00 24.77 ? 483  ARG A CG    1 
ATOM   3721  C CD    . ARG A 1 483 ? 58.463  136.373 50.577  1.00 32.40 ? 483  ARG A CD    1 
ATOM   3722  N NE    . ARG A 1 483 ? 58.925  137.531 51.358  1.00 37.63 ? 483  ARG A NE    1 
ATOM   3723  C CZ    . ARG A 1 483 ? 60.194  137.939 51.479  1.00 38.19 ? 483  ARG A CZ    1 
ATOM   3724  N NH1   . ARG A 1 483 ? 61.203  137.271 50.904  1.00 34.86 ? 483  ARG A NH1   1 
ATOM   3725  N NH2   . ARG A 1 483 ? 60.447  139.036 52.201  1.00 39.78 ? 483  ARG A NH2   1 
ATOM   3726  N N     . PHE A 1 484 ? 57.467  135.123 45.462  1.00 19.24 ? 484  PHE A N     1 
ATOM   3727  C CA    . PHE A 1 484 ? 56.312  135.237 44.558  1.00 18.76 ? 484  PHE A CA    1 
ATOM   3728  C C     . PHE A 1 484 ? 55.449  133.967 44.646  1.00 19.35 ? 484  PHE A C     1 
ATOM   3729  O O     . PHE A 1 484 ? 54.236  134.025 44.850  1.00 18.83 ? 484  PHE A O     1 
ATOM   3730  C CB    . PHE A 1 484 ? 56.836  135.466 43.122  1.00 18.81 ? 484  PHE A CB    1 
ATOM   3731  C CG    . PHE A 1 484 ? 55.775  135.498 42.070  1.00 18.45 ? 484  PHE A CG    1 
ATOM   3732  C CD1   . PHE A 1 484 ? 54.907  136.581 41.970  1.00 17.97 ? 484  PHE A CD1   1 
ATOM   3733  C CD2   . PHE A 1 484 ? 55.644  134.437 41.161  1.00 19.38 ? 484  PHE A CD2   1 
ATOM   3734  C CE1   . PHE A 1 484 ? 53.911  136.628 40.966  1.00 18.69 ? 484  PHE A CE1   1 
ATOM   3735  C CE2   . PHE A 1 484 ? 54.674  134.468 40.170  1.00 17.26 ? 484  PHE A CE2   1 
ATOM   3736  C CZ    . PHE A 1 484 ? 53.791  135.565 40.076  1.00 17.94 ? 484  PHE A CZ    1 
ATOM   3737  N N     . GLU A 1 485 ? 56.094  132.810 44.536  1.00 19.26 ? 485  GLU A N     1 
ATOM   3738  C CA    . GLU A 1 485 ? 55.408  131.514 44.662  1.00 19.96 ? 485  GLU A CA    1 
ATOM   3739  C C     . GLU A 1 485 ? 54.788  131.276 46.025  1.00 20.44 ? 485  GLU A C     1 
ATOM   3740  O O     . GLU A 1 485 ? 53.671  130.777 46.127  1.00 20.83 ? 485  GLU A O     1 
ATOM   3741  C CB    . GLU A 1 485 ? 56.374  130.382 44.367  1.00 19.36 ? 485  GLU A CB    1 
ATOM   3742  C CG    . GLU A 1 485 ? 56.901  130.475 42.977  1.00 19.15 ? 485  GLU A CG    1 
ATOM   3743  C CD    . GLU A 1 485 ? 57.915  129.430 42.678  1.00 20.69 ? 485  GLU A CD    1 
ATOM   3744  O OE1   . GLU A 1 485 ? 58.698  129.083 43.603  1.00 23.75 ? 485  GLU A OE1   1 
ATOM   3745  O OE2   . GLU A 1 485 ? 57.926  128.964 41.520  1.00 16.12 ? 485  GLU A OE2   1 
ATOM   3746  N N     . GLN A 1 486 ? 55.508  131.641 47.069  1.00 20.65 ? 486  GLN A N     1 
ATOM   3747  C CA    . GLN A 1 486 ? 54.998  131.513 48.413  1.00 22.02 ? 486  GLN A CA    1 
ATOM   3748  C C     . GLN A 1 486 ? 53.766  132.417 48.702  1.00 22.38 ? 486  GLN A C     1 
ATOM   3749  O O     . GLN A 1 486 ? 52.734  131.931 49.196  1.00 22.01 ? 486  GLN A O     1 
ATOM   3750  C CB    . GLN A 1 486 ? 56.140  131.783 49.375  1.00 22.81 ? 486  GLN A CB    1 
ATOM   3751  C CG    . GLN A 1 486 ? 55.745  132.034 50.792  1.00 27.59 ? 486  GLN A CG    1 
ATOM   3752  C CD    . GLN A 1 486 ? 56.434  131.073 51.710  1.00 33.65 ? 486  GLN A CD    1 
ATOM   3753  O OE1   . GLN A 1 486 ? 57.636  130.804 51.562  1.00 36.76 ? 486  GLN A OE1   1 
ATOM   3754  N NE2   . GLN A 1 486 ? 55.672  130.507 52.644  1.00 35.26 ? 486  GLN A NE2   1 
ATOM   3755  N N     . THR A 1 487 ? 53.884  133.713 48.384  1.00 21.53 ? 487  THR A N     1 
ATOM   3756  C CA    . THR A 1 487 ? 52.868  134.725 48.717  1.00 20.78 ? 487  THR A CA    1 
ATOM   3757  C C     . THR A 1 487 ? 51.544  134.456 48.025  1.00 20.23 ? 487  THR A C     1 
ATOM   3758  O O     . THR A 1 487 ? 50.485  134.533 48.645  1.00 20.34 ? 487  THR A O     1 
ATOM   3759  C CB    . THR A 1 487 ? 53.359  136.136 48.314  1.00 20.95 ? 487  THR A CB    1 
ATOM   3760  O OG1   . THR A 1 487 ? 54.653  136.336 48.851  1.00 20.28 ? 487  THR A OG1   1 
ATOM   3761  C CG2   . THR A 1 487 ? 52.423  137.267 48.802  1.00 22.18 ? 487  THR A CG2   1 
ATOM   3762  N N     . TYR A 1 488 ? 51.611  134.095 46.749  1.00 19.30 ? 488  TYR A N     1 
ATOM   3763  C CA    . TYR A 1 488 ? 50.415  134.034 45.929  1.00 18.50 ? 488  TYR A CA    1 
ATOM   3764  C C     . TYR A 1 488 ? 49.908  132.620 45.663  1.00 18.83 ? 488  TYR A C     1 
ATOM   3765  O O     . TYR A 1 488 ? 48.702  132.433 45.512  1.00 18.36 ? 488  TYR A O     1 
ATOM   3766  C CB    . TYR A 1 488 ? 50.641  134.804 44.620  1.00 18.86 ? 488  TYR A CB    1 
ATOM   3767  C CG    . TYR A 1 488 ? 51.089  136.240 44.843  1.00 17.92 ? 488  TYR A CG    1 
ATOM   3768  C CD1   . TYR A 1 488 ? 52.405  136.623 44.591  1.00 17.72 ? 488  TYR A CD1   1 
ATOM   3769  C CD2   . TYR A 1 488 ? 50.205  137.195 45.361  1.00 17.06 ? 488  TYR A CD2   1 
ATOM   3770  C CE1   . TYR A 1 488 ? 52.835  137.938 44.802  1.00 19.07 ? 488  TYR A CE1   1 
ATOM   3771  C CE2   . TYR A 1 488 ? 50.619  138.504 45.588  1.00 18.52 ? 488  TYR A CE2   1 
ATOM   3772  C CZ    . TYR A 1 488 ? 51.933  138.863 45.315  1.00 19.59 ? 488  TYR A CZ    1 
ATOM   3773  O OH    . TYR A 1 488 ? 52.336  140.150 45.530  1.00 19.95 ? 488  TYR A OH    1 
ATOM   3774  N N     . PHE A 1 489 ? 50.811  131.637 45.639  1.00 18.27 ? 489  PHE A N     1 
ATOM   3775  C CA    . PHE A 1 489 ? 50.457  130.300 45.180  1.00 19.63 ? 489  PHE A CA    1 
ATOM   3776  C C     . PHE A 1 489 ? 50.645  129.184 46.191  1.00 19.91 ? 489  PHE A C     1 
ATOM   3777  O O     . PHE A 1 489 ? 50.488  128.018 45.835  1.00 20.51 ? 489  PHE A O     1 
ATOM   3778  C CB    . PHE A 1 489 ? 51.173  129.945 43.883  1.00 18.89 ? 489  PHE A CB    1 
ATOM   3779  C CG    . PHE A 1 489 ? 51.037  130.990 42.814  1.00 19.77 ? 489  PHE A CG    1 
ATOM   3780  C CD1   . PHE A 1 489 ? 51.942  132.062 42.745  1.00 18.41 ? 489  PHE A CD1   1 
ATOM   3781  C CD2   . PHE A 1 489 ? 50.014  130.909 41.874  1.00 18.50 ? 489  PHE A CD2   1 
ATOM   3782  C CE1   . PHE A 1 489 ? 51.830  133.025 41.739  1.00 19.54 ? 489  PHE A CE1   1 
ATOM   3783  C CE2   . PHE A 1 489 ? 49.908  131.863 40.876  1.00 19.79 ? 489  PHE A CE2   1 
ATOM   3784  C CZ    . PHE A 1 489 ? 50.817  132.931 40.815  1.00 17.56 ? 489  PHE A CZ    1 
ATOM   3785  N N     . SER A 1 490 ? 50.912  129.530 47.451  1.00 20.35 ? 490  SER A N     1 
ATOM   3786  C CA    . SER A 1 490 ? 51.059  128.499 48.496  1.00 20.85 ? 490  SER A CA    1 
ATOM   3787  C C     . SER A 1 490 ? 49.859  128.261 49.416  1.00 20.93 ? 490  SER A C     1 
ATOM   3788  O O     . SER A 1 490 ? 49.709  127.158 49.952  1.00 21.24 ? 490  SER A O     1 
ATOM   3789  C CB    . SER A 1 490 ? 52.319  128.728 49.319  1.00 20.85 ? 490  SER A CB    1 
ATOM   3790  O OG    . SER A 1 490 ? 52.081  129.684 50.325  1.00 22.42 ? 490  SER A OG    1 
ATOM   3791  N N     . THR A 1 491 ? 49.019  129.278 49.621  1.00 21.77 ? 491  THR A N     1 
ATOM   3792  C CA    . THR A 1 491 ? 47.846  129.132 50.499  1.00 21.67 ? 491  THR A CA    1 
ATOM   3793  C C     . THR A 1 491 ? 46.842  128.134 49.899  1.00 22.09 ? 491  THR A C     1 
ATOM   3794  O O     . THR A 1 491 ? 46.392  127.219 50.580  1.00 21.99 ? 491  THR A O     1 
ATOM   3795  C CB    . THR A 1 491 ? 47.154  130.506 50.832  1.00 22.17 ? 491  THR A CB    1 
ATOM   3796  O OG1   . THR A 1 491 ? 48.129  131.478 51.249  1.00 21.48 ? 491  THR A OG1   1 
ATOM   3797  C CG2   . THR A 1 491 ? 46.114  130.334 51.958  1.00 22.08 ? 491  THR A CG2   1 
ATOM   3798  N N     . PHE A 1 492 ? 46.515  128.302 48.617  1.00 22.16 ? 492  PHE A N     1 
ATOM   3799  C CA    . PHE A 1 492 ? 45.579  127.407 47.943  1.00 22.35 ? 492  PHE A CA    1 
ATOM   3800  C C     . PHE A 1 492 ? 46.255  126.855 46.704  1.00 22.47 ? 492  PHE A C     1 
ATOM   3801  O O     . PHE A 1 492 ? 46.456  127.579 45.724  1.00 23.07 ? 492  PHE A O     1 
ATOM   3802  C CB    . PHE A 1 492 ? 44.241  128.125 47.631  1.00 21.75 ? 492  PHE A CB    1 
ATOM   3803  C CG    . PHE A 1 492 ? 43.633  128.815 48.833  1.00 22.09 ? 492  PHE A CG    1 
ATOM   3804  C CD1   . PHE A 1 492 ? 43.577  130.209 48.904  1.00 21.28 ? 492  PHE A CD1   1 
ATOM   3805  C CD2   . PHE A 1 492 ? 43.181  128.069 49.929  1.00 21.71 ? 492  PHE A CD2   1 
ATOM   3806  C CE1   . PHE A 1 492 ? 43.041  130.849 50.034  1.00 21.98 ? 492  PHE A CE1   1 
ATOM   3807  C CE2   . PHE A 1 492 ? 42.641  128.704 51.069  1.00 21.25 ? 492  PHE A CE2   1 
ATOM   3808  C CZ    . PHE A 1 492 ? 42.575  130.091 51.124  1.00 20.47 ? 492  PHE A CZ    1 
ATOM   3809  N N     . LYS A 1 493 ? 46.608  125.572 46.758  1.00 22.65 ? 493  LYS A N     1 
ATOM   3810  C CA    . LYS A 1 493 ? 47.530  124.978 45.792  1.00 22.99 ? 493  LYS A CA    1 
ATOM   3811  C C     . LYS A 1 493 ? 46.965  125.008 44.373  1.00 22.65 ? 493  LYS A C     1 
ATOM   3812  O O     . LYS A 1 493 ? 45.764  124.787 44.163  1.00 22.08 ? 493  LYS A O     1 
ATOM   3813  C CB    . LYS A 1 493 ? 47.926  123.559 46.221  1.00 23.20 ? 493  LYS A CB    1 
ATOM   3814  C CG    . LYS A 1 493 ? 49.019  123.537 47.310  1.00 22.92 ? 493  LYS A CG    1 
ATOM   3815  C CD    . LYS A 1 493 ? 49.427  122.076 47.604  1.00 25.69 ? 493  LYS A CD    1 
ATOM   3816  C CE    . LYS A 1 493 ? 50.557  121.971 48.650  1.00 28.17 ? 493  LYS A CE    1 
ATOM   3817  N NZ    . LYS A 1 493 ? 50.156  122.514 50.020  1.00 32.52 ? 493  LYS A NZ    1 
ATOM   3818  N N     . ASN A 1 494 ? 47.838  125.301 43.410  1.00 22.16 ? 494  ASN A N     1 
ATOM   3819  C CA    . ASN A 1 494 ? 47.441  125.469 42.001  1.00 22.12 ? 494  ASN A CA    1 
ATOM   3820  C C     . ASN A 1 494 ? 46.496  126.635 41.748  1.00 20.90 ? 494  ASN A C     1 
ATOM   3821  O O     . ASN A 1 494 ? 45.856  126.683 40.690  1.00 19.96 ? 494  ASN A O     1 
ATOM   3822  C CB    . ASN A 1 494 ? 46.852  124.159 41.415  1.00 23.17 ? 494  ASN A CB    1 
ATOM   3823  C CG    . ASN A 1 494 ? 47.833  123.005 41.484  1.00 24.73 ? 494  ASN A CG    1 
ATOM   3824  O OD1   . ASN A 1 494 ? 48.827  123.000 40.772  1.00 29.07 ? 494  ASN A OD1   1 
ATOM   3825  N ND2   . ASN A 1 494 ? 47.565  122.034 42.351  1.00 26.67 ? 494  ASN A ND2   1 
ATOM   3826  N N     . MET A 1 495 ? 46.405  127.564 42.707  1.00 20.10 ? 495  MET A N     1 
ATOM   3827  C CA    . MET A 1 495 ? 45.575  128.783 42.518  1.00 21.06 ? 495  MET A CA    1 
ATOM   3828  C C     . MET A 1 495 ? 46.310  130.077 42.885  1.00 19.85 ? 495  MET A C     1 
ATOM   3829  O O     . MET A 1 495 ? 47.182  130.090 43.765  1.00 19.21 ? 495  MET A O     1 
ATOM   3830  C CB    . MET A 1 495 ? 44.253  128.700 43.290  1.00 19.71 ? 495  MET A CB    1 
ATOM   3831  C CG    . MET A 1 495 ? 43.346  127.497 42.923  1.00 22.22 ? 495  MET A CG    1 
ATOM   3832  S SD    . MET A 1 495 ? 42.002  127.302 44.116  1.00 26.61 ? 495  MET A SD    1 
ATOM   3833  C CE    . MET A 1 495 ? 42.481  125.873 45.095  1.00 31.38 ? 495  MET A CE    1 
ATOM   3834  N N     . TYR A 1 496 ? 45.950  131.160 42.192  1.00 19.00 ? 496  TYR A N     1 
ATOM   3835  C CA    . TYR A 1 496 ? 46.407  132.503 42.537  1.00 18.15 ? 496  TYR A CA    1 
ATOM   3836  C C     . TYR A 1 496 ? 45.502  133.052 43.636  1.00 17.97 ? 496  TYR A C     1 
ATOM   3837  O O     . TYR A 1 496 ? 44.295  133.172 43.443  1.00 17.88 ? 496  TYR A O     1 
ATOM   3838  C CB    . TYR A 1 496 ? 46.394  133.444 41.310  1.00 17.47 ? 496  TYR A CB    1 
ATOM   3839  C CG    . TYR A 1 496 ? 46.669  134.878 41.713  1.00 17.64 ? 496  TYR A CG    1 
ATOM   3840  C CD1   . TYR A 1 496 ? 47.960  135.290 42.055  1.00 16.46 ? 496  TYR A CD1   1 
ATOM   3841  C CD2   . TYR A 1 496 ? 45.632  135.820 41.788  1.00 16.47 ? 496  TYR A CD2   1 
ATOM   3842  C CE1   . TYR A 1 496 ? 48.205  136.589 42.473  1.00 18.01 ? 496  TYR A CE1   1 
ATOM   3843  C CE2   . TYR A 1 496 ? 45.875  137.135 42.204  1.00 17.07 ? 496  TYR A CE2   1 
ATOM   3844  C CZ    . TYR A 1 496 ? 47.162  137.513 42.545  1.00 17.87 ? 496  TYR A CZ    1 
ATOM   3845  O OH    . TYR A 1 496 ? 47.415  138.812 42.963  1.00 16.87 ? 496  TYR A OH    1 
ATOM   3846  N N     . PHE A 1 497 ? 46.079  133.384 44.785  1.00 17.81 ? 497  PHE A N     1 
ATOM   3847  C CA    . PHE A 1 497 ? 45.295  133.918 45.906  1.00 18.25 ? 497  PHE A CA    1 
ATOM   3848  C C     . PHE A 1 497 ? 45.484  135.419 45.924  1.00 18.32 ? 497  PHE A C     1 
ATOM   3849  O O     . PHE A 1 497 ? 46.604  135.907 46.063  1.00 18.19 ? 497  PHE A O     1 
ATOM   3850  C CB    . PHE A 1 497 ? 45.708  133.298 47.260  1.00 17.56 ? 497  PHE A CB    1 
ATOM   3851  C CG    . PHE A 1 497 ? 44.967  133.866 48.466  1.00 17.34 ? 497  PHE A CG    1 
ATOM   3852  C CD1   . PHE A 1 497 ? 43.629  134.279 48.374  1.00 17.08 ? 497  PHE A CD1   1 
ATOM   3853  C CD2   . PHE A 1 497 ? 45.606  133.946 49.714  1.00 19.56 ? 497  PHE A CD2   1 
ATOM   3854  C CE1   . PHE A 1 497 ? 42.945  134.782 49.486  1.00 16.58 ? 497  PHE A CE1   1 
ATOM   3855  C CE2   . PHE A 1 497 ? 44.924  134.452 50.856  1.00 20.11 ? 497  PHE A CE2   1 
ATOM   3856  C CZ    . PHE A 1 497 ? 43.596  134.866 50.735  1.00 18.36 ? 497  PHE A CZ    1 
ATOM   3857  N N     . SER A 1 498 ? 44.377  136.138 45.782  1.00 18.81 ? 498  SER A N     1 
ATOM   3858  C CA    . SER A 1 498 ? 44.391  137.583 45.651  1.00 18.91 ? 498  SER A CA    1 
ATOM   3859  C C     . SER A 1 498 ? 44.602  138.285 46.997  1.00 19.20 ? 498  SER A C     1 
ATOM   3860  O O     . SER A 1 498 ? 45.061  139.436 47.048  1.00 19.37 ? 498  SER A O     1 
ATOM   3861  C CB    . SER A 1 498 ? 43.077  138.021 45.036  1.00 18.88 ? 498  SER A CB    1 
ATOM   3862  O OG    . SER A 1 498 ? 42.069  137.844 46.000  1.00 19.64 ? 498  SER A OG    1 
ATOM   3863  N N     . GLY A 1 499 ? 44.238  137.598 48.080  1.00 18.93 ? 499  GLY A N     1 
ATOM   3864  C CA    . GLY A 1 499 ? 44.337  138.138 49.429  1.00 18.85 ? 499  GLY A CA    1 
ATOM   3865  C C     . GLY A 1 499 ? 43.119  138.954 49.811  1.00 19.03 ? 499  GLY A C     1 
ATOM   3866  O O     . GLY A 1 499 ? 43.095  139.563 50.871  1.00 19.26 ? 499  GLY A O     1 
ATOM   3867  N N     . ASP A 1 500 ? 42.123  138.974 48.922  1.00 19.69 ? 500  ASP A N     1 
ATOM   3868  C CA    . ASP A 1 500 ? 40.822  139.588 49.137  1.00 19.34 ? 500  ASP A CA    1 
ATOM   3869  C C     . ASP A 1 500 ? 39.786  138.550 49.473  1.00 19.84 ? 500  ASP A C     1 
ATOM   3870  O O     . ASP A 1 500 ? 39.919  137.375 49.094  1.00 19.11 ? 500  ASP A O     1 
ATOM   3871  C CB    . ASP A 1 500 ? 40.328  140.280 47.858  1.00 19.83 ? 500  ASP A CB    1 
ATOM   3872  C CG    . ASP A 1 500 ? 40.928  141.625 47.663  1.00 19.91 ? 500  ASP A CG    1 
ATOM   3873  O OD1   . ASP A 1 500 ? 41.000  142.375 48.651  1.00 19.49 ? 500  ASP A OD1   1 
ATOM   3874  O OD2   . ASP A 1 500 ? 41.288  141.941 46.511  1.00 20.28 ? 500  ASP A OD2   1 
ATOM   3875  N N     . GLY A 1 501 ? 38.730  139.020 50.142  1.00 20.02 ? 501  GLY A N     1 
ATOM   3876  C CA    . GLY A 1 501 ? 37.527  138.246 50.396  1.00 21.21 ? 501  GLY A CA    1 
ATOM   3877  C C     . GLY A 1 501 ? 36.485  138.789 49.436  1.00 22.58 ? 501  GLY A C     1 
ATOM   3878  O O     . GLY A 1 501 ? 36.602  139.929 48.950  1.00 22.53 ? 501  GLY A O     1 
ATOM   3879  N N     . ALA A 1 502 ? 35.491  137.966 49.115  1.00 23.12 ? 502  ALA A N     1 
ATOM   3880  C CA    . ALA A 1 502 ? 34.385  138.410 48.276  1.00 24.01 ? 502  ALA A CA    1 
ATOM   3881  C C     . ALA A 1 502 ? 33.157  137.552 48.523  1.00 24.67 ? 502  ALA A C     1 
ATOM   3882  O O     . ALA A 1 502 ? 33.281  136.418 48.994  1.00 24.57 ? 502  ALA A O     1 
ATOM   3883  C CB    . ALA A 1 502 ? 34.771  138.366 46.801  1.00 23.96 ? 502  ALA A CB    1 
ATOM   3884  N N     . ARG A 1 503 ? 31.986  138.114 48.221  1.00 25.32 ? 503  ARG A N     1 
ATOM   3885  C CA    . ARG A 1 503 ? 30.740  137.358 48.106  1.00 26.61 ? 503  ARG A CA    1 
ATOM   3886  C C     . ARG A 1 503 ? 30.390  137.189 46.633  1.00 26.09 ? 503  ARG A C     1 
ATOM   3887  O O     . ARG A 1 503 ? 30.691  138.062 45.810  1.00 26.70 ? 503  ARG A O     1 
ATOM   3888  C CB    . ARG A 1 503 ? 29.575  138.091 48.773  1.00 26.37 ? 503  ARG A CB    1 
ATOM   3889  C CG    . ARG A 1 503 ? 29.891  138.814 50.079  1.00 28.55 ? 503  ARG A CG    1 
ATOM   3890  C CD    . ARG A 1 503 ? 28.592  139.220 50.805  1.00 30.59 ? 503  ARG A CD    1 
ATOM   3891  N NE    . ARG A 1 503 ? 27.756  140.172 50.047  1.00 37.04 ? 503  ARG A NE    1 
ATOM   3892  C CZ    . ARG A 1 503 ? 27.960  141.497 49.996  1.00 39.12 ? 503  ARG A CZ    1 
ATOM   3893  N NH1   . ARG A 1 503 ? 28.989  142.054 50.635  1.00 37.07 ? 503  ARG A NH1   1 
ATOM   3894  N NH2   . ARG A 1 503 ? 27.137  142.274 49.284  1.00 39.86 ? 503  ARG A NH2   1 
ATOM   3895  N N     . ARG A 1 504 ? 29.774  136.064 46.291  1.00 25.62 ? 504  ARG A N     1 
ATOM   3896  C CA    . ARG A 1 504 ? 29.085  135.931 45.003  1.00 25.43 ? 504  ARG A CA    1 
ATOM   3897  C C     . ARG A 1 504 ? 27.578  135.825 45.273  1.00 24.54 ? 504  ARG A C     1 
ATOM   3898  O O     . ARG A 1 504 ? 27.176  135.008 46.090  1.00 24.48 ? 504  ARG A O     1 
ATOM   3899  C CB    . ARG A 1 504 ? 29.577  134.697 44.242  1.00 25.52 ? 504  ARG A CB    1 
ATOM   3900  C CG    . ARG A 1 504 ? 29.086  134.635 42.795  1.00 24.71 ? 504  ARG A CG    1 
ATOM   3901  C CD    . ARG A 1 504 ? 29.756  133.504 42.066  1.00 28.19 ? 504  ARG A CD    1 
ATOM   3902  N NE    . ARG A 1 504 ? 29.660  132.260 42.829  1.00 26.69 ? 504  ARG A NE    1 
ATOM   3903  C CZ    . ARG A 1 504 ? 30.686  131.494 43.189  1.00 26.88 ? 504  ARG A CZ    1 
ATOM   3904  N NH1   . ARG A 1 504 ? 31.942  131.782 42.831  1.00 22.67 ? 504  ARG A NH1   1 
ATOM   3905  N NH2   . ARG A 1 504 ? 30.436  130.398 43.898  1.00 27.62 ? 504  ARG A NH2   1 
ATOM   3906  N N     . ASP A 1 505 ? 26.763  136.661 44.619  1.00 24.08 ? 505  ASP A N     1 
ATOM   3907  C CA    . ASP A 1 505 ? 25.307  136.655 44.853  1.00 24.09 ? 505  ASP A CA    1 
ATOM   3908  C C     . ASP A 1 505 ? 24.596  135.646 43.945  1.00 24.63 ? 505  ASP A C     1 
ATOM   3909  O O     . ASP A 1 505 ? 25.246  135.006 43.112  1.00 24.52 ? 505  ASP A O     1 
ATOM   3910  C CB    . ASP A 1 505 ? 24.689  138.069 44.748  1.00 23.74 ? 505  ASP A CB    1 
ATOM   3911  C CG    . ASP A 1 505 ? 24.681  138.631 43.307  1.00 23.05 ? 505  ASP A CG    1 
ATOM   3912  O OD1   . ASP A 1 505 ? 24.866  137.880 42.340  1.00 21.89 ? 505  ASP A OD1   1 
ATOM   3913  O OD2   . ASP A 1 505 ? 24.454  139.846 43.139  1.00 22.32 ? 505  ASP A OD2   1 
ATOM   3914  N N     . GLU A 1 506 ? 23.272  135.531 44.097  1.00 25.19 ? 506  GLU A N     1 
ATOM   3915  C CA    . GLU A 1 506 ? 22.442  134.581 43.325  1.00 26.80 ? 506  GLU A CA    1 
ATOM   3916  C C     . GLU A 1 506 ? 22.556  134.739 41.798  1.00 25.72 ? 506  GLU A C     1 
ATOM   3917  O O     . GLU A 1 506 ? 22.288  133.797 41.056  1.00 25.80 ? 506  GLU A O     1 
ATOM   3918  C CB    . GLU A 1 506 ? 20.961  134.585 43.809  1.00 26.33 ? 506  GLU A CB    1 
ATOM   3919  C CG    . GLU A 1 506 ? 20.238  135.965 43.740  1.00 28.81 ? 506  GLU A CG    1 
ATOM   3920  C CD    . GLU A 1 506 ? 18.984  136.087 44.651  1.00 30.65 ? 506  GLU A CD    1 
ATOM   3921  O OE1   . GLU A 1 506 ? 18.281  137.126 44.557  1.00 35.34 ? 506  GLU A OE1   1 
ATOM   3922  O OE2   . GLU A 1 506 ? 18.685  135.164 45.456  1.00 35.71 ? 506  GLU A OE2   1 
ATOM   3923  N N     . ASP A 1 507 ? 22.982  135.918 41.339  1.00 25.54 ? 507  ASP A N     1 
ATOM   3924  C CA    . ASP A 1 507 ? 23.150  136.186 39.897  1.00 25.05 ? 507  ASP A CA    1 
ATOM   3925  C C     . ASP A 1 507 ? 24.539  135.828 39.368  1.00 24.61 ? 507  ASP A C     1 
ATOM   3926  O O     . ASP A 1 507 ? 24.767  135.834 38.161  1.00 25.15 ? 507  ASP A O     1 
ATOM   3927  C CB    . ASP A 1 507 ? 22.813  137.651 39.566  1.00 24.89 ? 507  ASP A CB    1 
ATOM   3928  C CG    . ASP A 1 507 ? 21.325  137.960 39.710  1.00 25.16 ? 507  ASP A CG    1 
ATOM   3929  O OD1   . ASP A 1 507 ? 20.514  137.007 39.685  1.00 23.53 ? 507  ASP A OD1   1 
ATOM   3930  O OD2   . ASP A 1 507 ? 20.974  139.154 39.845  1.00 23.81 ? 507  ASP A OD2   1 
ATOM   3931  N N     . GLY A 1 508 ? 25.460  135.519 40.272  1.00 24.12 ? 508  GLY A N     1 
ATOM   3932  C CA    . GLY A 1 508 ? 26.843  135.250 39.897  1.00 23.15 ? 508  GLY A CA    1 
ATOM   3933  C C     . GLY A 1 508 ? 27.724  136.495 39.857  1.00 22.41 ? 508  GLY A C     1 
ATOM   3934  O O     . GLY A 1 508 ? 28.866  136.421 39.390  1.00 22.24 ? 508  GLY A O     1 
ATOM   3935  N N     . TYR A 1 509 ? 27.189  137.628 40.331  1.00 21.77 ? 509  TYR A N     1 
ATOM   3936  C CA    . TYR A 1 509 ? 27.922  138.901 40.454  1.00 21.35 ? 509  TYR A CA    1 
ATOM   3937  C C     . TYR A 1 509 ? 28.794  138.884 41.708  1.00 21.39 ? 509  TYR A C     1 
ATOM   3938  O O     . TYR A 1 509 ? 28.341  138.459 42.768  1.00 21.25 ? 509  TYR A O     1 
ATOM   3939  C CB    . TYR A 1 509 ? 26.945  140.093 40.571  1.00 21.04 ? 509  TYR A CB    1 
ATOM   3940  C CG    . TYR A 1 509 ? 26.286  140.577 39.285  1.00 20.67 ? 509  TYR A CG    1 
ATOM   3941  C CD1   . TYR A 1 509 ? 25.787  139.676 38.328  1.00 22.98 ? 509  TYR A CD1   1 
ATOM   3942  C CD2   . TYR A 1 509 ? 26.110  141.935 39.057  1.00 20.49 ? 509  TYR A CD2   1 
ATOM   3943  C CE1   . TYR A 1 509 ? 25.152  140.134 37.158  1.00 23.02 ? 509  TYR A CE1   1 
ATOM   3944  C CE2   . TYR A 1 509 ? 25.475  142.410 37.911  1.00 19.38 ? 509  TYR A CE2   1 
ATOM   3945  C CZ    . TYR A 1 509 ? 25.011  141.512 36.955  1.00 22.41 ? 509  TYR A CZ    1 
ATOM   3946  O OH    . TYR A 1 509 ? 24.405  141.994 35.816  1.00 20.97 ? 509  TYR A OH    1 
ATOM   3947  N N     . TYR A 1 510 ? 30.034  139.361 41.591  1.00 21.37 ? 510  TYR A N     1 
ATOM   3948  C CA    . TYR A 1 510 ? 30.953  139.400 42.735  1.00 21.31 ? 510  TYR A CA    1 
ATOM   3949  C C     . TYR A 1 510 ? 30.916  140.719 43.471  1.00 21.52 ? 510  TYR A C     1 
ATOM   3950  O O     . TYR A 1 510 ? 30.757  141.789 42.869  1.00 21.87 ? 510  TYR A O     1 
ATOM   3951  C CB    . TYR A 1 510 ? 32.394  139.061 42.320  1.00 21.47 ? 510  TYR A CB    1 
ATOM   3952  C CG    . TYR A 1 510 ? 32.597  137.606 41.928  1.00 21.68 ? 510  TYR A CG    1 
ATOM   3953  C CD1   . TYR A 1 510 ? 32.279  137.145 40.635  1.00 20.49 ? 510  TYR A CD1   1 
ATOM   3954  C CD2   . TYR A 1 510 ? 33.093  136.684 42.854  1.00 21.69 ? 510  TYR A CD2   1 
ATOM   3955  C CE1   . TYR A 1 510 ? 32.468  135.788 40.280  1.00 20.88 ? 510  TYR A CE1   1 
ATOM   3956  C CE2   . TYR A 1 510 ? 33.285  135.326 42.508  1.00 20.94 ? 510  TYR A CE2   1 
ATOM   3957  C CZ    . TYR A 1 510 ? 32.972  134.886 41.229  1.00 21.95 ? 510  TYR A CZ    1 
ATOM   3958  O OH    . TYR A 1 510 ? 33.167  133.532 40.908  1.00 23.31 ? 510  TYR A OH    1 
ATOM   3959  N N     . TRP A 1 511 ? 31.044  140.626 44.787  1.00 21.79 ? 511  TRP A N     1 
ATOM   3960  C CA    . TRP A 1 511 ? 31.022  141.760 45.675  1.00 22.30 ? 511  TRP A CA    1 
ATOM   3961  C C     . TRP A 1 511 ? 32.297  141.617 46.500  1.00 23.49 ? 511  TRP A C     1 
ATOM   3962  O O     . TRP A 1 511 ? 32.388  140.747 47.369  1.00 23.38 ? 511  TRP A O     1 
ATOM   3963  C CB    . TRP A 1 511 ? 29.796  141.680 46.582  1.00 22.05 ? 511  TRP A CB    1 
ATOM   3964  C CG    . TRP A 1 511 ? 28.468  141.798 45.878  1.00 21.20 ? 511  TRP A CG    1 
ATOM   3965  C CD1   . TRP A 1 511 ? 27.820  140.829 45.183  1.00 20.14 ? 511  TRP A CD1   1 
ATOM   3966  C CD2   . TRP A 1 511 ? 27.628  142.970 45.827  1.00 20.45 ? 511  TRP A CD2   1 
ATOM   3967  N NE1   . TRP A 1 511 ? 26.623  141.319 44.684  1.00 22.48 ? 511  TRP A NE1   1 
ATOM   3968  C CE2   . TRP A 1 511 ? 26.483  142.631 45.071  1.00 20.97 ? 511  TRP A CE2   1 
ATOM   3969  C CE3   . TRP A 1 511 ? 27.744  144.274 46.343  1.00 19.77 ? 511  TRP A CE3   1 
ATOM   3970  C CZ2   . TRP A 1 511 ? 25.453  143.547 44.817  1.00 21.28 ? 511  TRP A CZ2   1 
ATOM   3971  C CZ3   . TRP A 1 511 ? 26.723  145.189 46.088  1.00 20.99 ? 511  TRP A CZ3   1 
ATOM   3972  C CH2   . TRP A 1 511 ? 25.588  144.820 45.331  1.00 20.81 ? 511  TRP A CH2   1 
ATOM   3973  N N     . ILE A 1 512 ? 33.294  142.446 46.209  1.00 25.02 ? 512  ILE A N     1 
ATOM   3974  C CA    . ILE A 1 512 ? 34.572  142.364 46.921  1.00 26.26 ? 512  ILE A CA    1 
ATOM   3975  C C     . ILE A 1 512 ? 34.474  143.057 48.281  1.00 26.62 ? 512  ILE A C     1 
ATOM   3976  O O     . ILE A 1 512 ? 34.170  144.244 48.365  1.00 27.41 ? 512  ILE A O     1 
ATOM   3977  C CB    . ILE A 1 512 ? 35.766  142.891 46.066  1.00 27.13 ? 512  ILE A CB    1 
ATOM   3978  C CG1   . ILE A 1 512 ? 36.061  141.928 44.895  1.00 28.15 ? 512  ILE A CG1   1 
ATOM   3979  C CG2   . ILE A 1 512 ? 37.039  143.007 46.911  1.00 24.52 ? 512  ILE A CG2   1 
ATOM   3980  C CD1   . ILE A 1 512 ? 35.204  142.134 43.677  1.00 31.36 ? 512  ILE A CD1   1 
ATOM   3981  N N     . THR A 1 513 ? 34.721  142.308 49.347  1.00 26.71 ? 513  THR A N     1 
ATOM   3982  C CA    . THR A 1 513 ? 34.591  142.869 50.692  1.00 27.11 ? 513  THR A CA    1 
ATOM   3983  C C     . THR A 1 513 ? 35.891  143.593 51.174  1.00 26.95 ? 513  THR A C     1 
ATOM   3984  O O     . THR A 1 513 ? 35.841  144.592 51.919  1.00 27.04 ? 513  THR A O     1 
ATOM   3985  C CB    . THR A 1 513 ? 34.032  141.813 51.671  1.00 27.02 ? 513  THR A CB    1 
ATOM   3986  O OG1   . THR A 1 513 ? 34.691  140.561 51.471  1.00 27.91 ? 513  THR A OG1   1 
ATOM   3987  C CG2   . THR A 1 513 ? 32.541  141.552 51.371  1.00 28.67 ? 513  THR A CG2   1 
ATOM   3988  N N     . GLY A 1 514 ? 37.041  143.134 50.693  1.00 25.76 ? 514  GLY A N     1 
ATOM   3989  C CA    . GLY A 1 514 ? 38.313  143.761 51.034  1.00 24.48 ? 514  GLY A CA    1 
ATOM   3990  C C     . GLY A 1 514 ? 39.363  142.729 51.391  1.00 23.33 ? 514  GLY A C     1 
ATOM   3991  O O     . GLY A 1 514 ? 39.106  141.527 51.300  1.00 22.36 ? 514  GLY A O     1 
ATOM   3992  N N     . ARG A 1 515 ? 40.543  143.202 51.802  1.00 22.57 ? 515  ARG A N     1 
ATOM   3993  C CA    . ARG A 1 515 ? 41.647  142.311 52.127  1.00 22.55 ? 515  ARG A CA    1 
ATOM   3994  C C     . ARG A 1 515 ? 41.313  141.410 53.329  1.00 22.10 ? 515  ARG A C     1 
ATOM   3995  O O     . ARG A 1 515 ? 40.786  141.879 54.337  1.00 21.53 ? 515  ARG A O     1 
ATOM   3996  C CB    . ARG A 1 515 ? 42.945  143.095 52.397  1.00 21.93 ? 515  ARG A CB    1 
ATOM   3997  C CG    . ARG A 1 515 ? 43.410  144.016 51.284  1.00 20.65 ? 515  ARG A CG    1 
ATOM   3998  C CD    . ARG A 1 515 ? 43.789  143.256 50.003  1.00 19.93 ? 515  ARG A CD    1 
ATOM   3999  N NE    . ARG A 1 515 ? 44.925  142.340 50.163  1.00 17.98 ? 515  ARG A NE    1 
ATOM   4000  C CZ    . ARG A 1 515 ? 45.813  142.132 49.207  1.00 15.38 ? 515  ARG A CZ    1 
ATOM   4001  N NH1   . ARG A 1 515 ? 45.685  142.782 48.051  1.00 14.91 ? 515  ARG A NH1   1 
ATOM   4002  N NH2   . ARG A 1 515 ? 46.826  141.292 49.403  1.00 15.45 ? 515  ARG A NH2   1 
ATOM   4003  N N     . VAL A 1 516 ? 41.617  140.128 53.214  1.00 21.80 ? 516  VAL A N     1 
ATOM   4004  C CA    . VAL A 1 516 ? 41.516  139.233 54.384  1.00 22.21 ? 516  VAL A CA    1 
ATOM   4005  C C     . VAL A 1 516 ? 42.886  138.942 54.983  1.00 22.75 ? 516  VAL A C     1 
ATOM   4006  O O     . VAL A 1 516 ? 42.996  138.221 55.988  1.00 22.73 ? 516  VAL A O     1 
ATOM   4007  C CB    . VAL A 1 516 ? 40.741  137.914 54.101  1.00 22.01 ? 516  VAL A CB    1 
ATOM   4008  C CG1   . VAL A 1 516 ? 39.253  138.212 53.805  1.00 22.27 ? 516  VAL A CG1   1 
ATOM   4009  C CG2   . VAL A 1 516 ? 41.404  137.109 53.004  1.00 22.07 ? 516  VAL A CG2   1 
ATOM   4010  N N     . ASP A 1 517 ? 43.928  139.496 54.354  1.00 22.87 ? 517  ASP A N     1 
ATOM   4011  C CA    . ASP A 1 517 ? 45.258  139.446 54.931  1.00 23.17 ? 517  ASP A CA    1 
ATOM   4012  C C     . ASP A 1 517 ? 45.517  140.719 55.776  1.00 23.77 ? 517  ASP A C     1 
ATOM   4013  O O     . ASP A 1 517 ? 44.573  141.432 56.152  1.00 23.49 ? 517  ASP A O     1 
ATOM   4014  C CB    . ASP A 1 517 ? 46.345  139.098 53.878  1.00 22.78 ? 517  ASP A CB    1 
ATOM   4015  C CG    . ASP A 1 517 ? 46.366  140.037 52.675  1.00 22.91 ? 517  ASP A CG    1 
ATOM   4016  O OD1   . ASP A 1 517 ? 47.144  139.788 51.732  1.00 23.77 ? 517  ASP A OD1   1 
ATOM   4017  O OD2   . ASP A 1 517 ? 45.642  141.030 52.644  1.00 23.73 ? 517  ASP A OD2   1 
ATOM   4018  N N     . ASP A 1 518 ? 46.767  140.991 56.120  1.00 23.99 ? 518  ASP A N     1 
ATOM   4019  C CA    . ASP A 1 518 ? 47.061  142.168 56.933  1.00 24.35 ? 518  ASP A CA    1 
ATOM   4020  C C     . ASP A 1 518 ? 47.449  143.393 56.094  1.00 24.32 ? 518  ASP A C     1 
ATOM   4021  O O     . ASP A 1 518 ? 48.388  144.117 56.413  1.00 25.20 ? 518  ASP A O     1 
ATOM   4022  C CB    . ASP A 1 518 ? 48.155  141.818 57.929  1.00 24.88 ? 518  ASP A CB    1 
ATOM   4023  C CG    . ASP A 1 518 ? 47.673  140.880 58.999  1.00 26.25 ? 518  ASP A CG    1 
ATOM   4024  O OD1   . ASP A 1 518 ? 46.445  140.837 59.258  1.00 28.82 ? 518  ASP A OD1   1 
ATOM   4025  O OD2   . ASP A 1 518 ? 48.533  140.197 59.593  1.00 30.44 ? 518  ASP A OD2   1 
ATOM   4026  N N     . VAL A 1 519 ? 46.713  143.616 55.016  1.00 24.03 ? 519  VAL A N     1 
ATOM   4027  C CA    . VAL A 1 519 ? 46.980  144.723 54.104  1.00 23.16 ? 519  VAL A CA    1 
ATOM   4028  C C     . VAL A 1 519 ? 45.888  145.756 54.314  1.00 23.38 ? 519  VAL A C     1 
ATOM   4029  O O     . VAL A 1 519 ? 44.699  145.420 54.398  1.00 22.87 ? 519  VAL A O     1 
ATOM   4030  C CB    . VAL A 1 519 ? 47.016  144.234 52.642  1.00 22.62 ? 519  VAL A CB    1 
ATOM   4031  C CG1   . VAL A 1 519 ? 47.095  145.394 51.683  1.00 21.85 ? 519  VAL A CG1   1 
ATOM   4032  C CG2   . VAL A 1 519 ? 48.176  143.275 52.429  1.00 22.08 ? 519  VAL A CG2   1 
ATOM   4033  N N     . LEU A 1 520 ? 46.301  147.015 54.417  1.00 23.62 ? 520  LEU A N     1 
ATOM   4034  C CA    . LEU A 1 520 ? 45.371  148.085 54.650  1.00 24.41 ? 520  LEU A CA    1 
ATOM   4035  C C     . LEU A 1 520 ? 44.990  148.787 53.357  1.00 24.76 ? 520  LEU A C     1 
ATOM   4036  O O     . LEU A 1 520 ? 45.722  148.722 52.363  1.00 24.37 ? 520  LEU A O     1 
ATOM   4037  C CB    . LEU A 1 520 ? 45.953  149.089 55.646  1.00 24.38 ? 520  LEU A CB    1 
ATOM   4038  C CG    . LEU A 1 520 ? 46.256  148.562 57.042  1.00 26.23 ? 520  LEU A CG    1 
ATOM   4039  C CD1   . LEU A 1 520 ? 46.882  149.661 57.869  1.00 27.87 ? 520  LEU A CD1   1 
ATOM   4040  C CD2   . LEU A 1 520 ? 45.007  147.968 57.728  1.00 29.27 ? 520  LEU A CD2   1 
ATOM   4041  N N     . ASN A 1 521 ? 43.842  149.462 53.391  1.00 25.19 ? 521  ASN A N     1 
ATOM   4042  C CA    . ASN A 1 521 ? 43.447  150.367 52.313  1.00 25.85 ? 521  ASN A CA    1 
ATOM   4043  C C     . ASN A 1 521 ? 43.168  151.738 52.876  1.00 25.39 ? 521  ASN A C     1 
ATOM   4044  O O     . ASN A 1 521 ? 42.099  151.978 53.437  1.00 25.50 ? 521  ASN A O     1 
ATOM   4045  C CB    . ASN A 1 521 ? 42.200  149.896 51.576  1.00 26.39 ? 521  ASN A CB    1 
ATOM   4046  C CG    . ASN A 1 521 ? 41.663  150.971 50.640  1.00 29.07 ? 521  ASN A CG    1 
ATOM   4047  O OD1   . ASN A 1 521 ? 42.388  151.460 49.781  1.00 29.12 ? 521  ASN A OD1   1 
ATOM   4048  N ND2   . ASN A 1 521 ? 40.410  151.393 50.852  1.00 31.87 ? 521  ASN A ND2   1 
ATOM   4049  N N     . VAL A 1 522 ? 44.128  152.632 52.702  1.00 25.06 ? 522  VAL A N     1 
ATOM   4050  C CA    . VAL A 1 522 ? 44.111  153.941 53.336  1.00 25.91 ? 522  VAL A CA    1 
ATOM   4051  C C     . VAL A 1 522 ? 44.018  154.972 52.222  1.00 25.96 ? 522  VAL A C     1 
ATOM   4052  O O     . VAL A 1 522 ? 44.998  155.227 51.513  1.00 25.21 ? 522  VAL A O     1 
ATOM   4053  C CB    . VAL A 1 522 ? 45.398  154.156 54.208  1.00 25.41 ? 522  VAL A CB    1 
ATOM   4054  C CG1   . VAL A 1 522 ? 45.443  155.562 54.799  1.00 26.90 ? 522  VAL A CG1   1 
ATOM   4055  C CG2   . VAL A 1 522 ? 45.444  153.143 55.317  1.00 25.66 ? 522  VAL A CG2   1 
ATOM   4056  N N     . SER A 1 523 ? 42.821  155.527 52.056  1.00 26.02 ? 523  SER A N     1 
ATOM   4057  C CA    . SER A 1 523 ? 42.525  156.477 50.984  1.00 26.48 ? 523  SER A CA    1 
ATOM   4058  C C     . SER A 1 523 ? 42.859  155.921 49.607  1.00 26.25 ? 523  SER A C     1 
ATOM   4059  O O     . SER A 1 523 ? 43.357  156.658 48.749  1.00 26.60 ? 523  SER A O     1 
ATOM   4060  C CB    . SER A 1 523 ? 43.244  157.814 51.191  1.00 26.57 ? 523  SER A CB    1 
ATOM   4061  O OG    . SER A 1 523 ? 43.082  158.257 52.526  1.00 29.40 ? 523  SER A OG    1 
ATOM   4062  N N     . GLY A 1 524 ? 42.572  154.638 49.395  1.00 25.52 ? 524  GLY A N     1 
ATOM   4063  C CA    . GLY A 1 524 ? 42.868  153.984 48.132  1.00 25.50 ? 524  GLY A CA    1 
ATOM   4064  C C     . GLY A 1 524 ? 44.321  153.544 47.993  1.00 25.82 ? 524  GLY A C     1 
ATOM   4065  O O     . GLY A 1 524 ? 44.743  153.161 46.902  1.00 26.60 ? 524  GLY A O     1 
ATOM   4066  N N     . HIS A 1 525 ? 45.090  153.620 49.080  1.00 25.14 ? 525  HIS A N     1 
ATOM   4067  C CA    . HIS A 1 525 ? 46.504  153.226 49.069  1.00 25.15 ? 525  HIS A CA    1 
ATOM   4068  C C     . HIS A 1 525 ? 46.679  151.914 49.799  1.00 24.14 ? 525  HIS A C     1 
ATOM   4069  O O     . HIS A 1 525 ? 46.255  151.755 50.940  1.00 23.09 ? 525  HIS A O     1 
ATOM   4070  C CB    . HIS A 1 525 ? 47.409  154.286 49.713  1.00 25.61 ? 525  HIS A CB    1 
ATOM   4071  C CG    . HIS A 1 525 ? 47.405  155.608 49.006  1.00 28.31 ? 525  HIS A CG    1 
ATOM   4072  N ND1   . HIS A 1 525 ? 47.017  156.783 49.622  1.00 31.76 ? 525  HIS A ND1   1 
ATOM   4073  C CD2   . HIS A 1 525 ? 47.734  155.943 47.737  1.00 29.39 ? 525  HIS A CD2   1 
ATOM   4074  C CE1   . HIS A 1 525 ? 47.117  157.785 48.764  1.00 31.44 ? 525  HIS A CE1   1 
ATOM   4075  N NE2   . HIS A 1 525 ? 47.551  157.303 47.614  1.00 31.48 ? 525  HIS A NE2   1 
ATOM   4076  N N     . ARG A 1 526 ? 47.326  150.982 49.117  1.00 23.51 ? 526  ARG A N     1 
ATOM   4077  C CA    . ARG A 1 526 ? 47.598  149.679 49.642  1.00 23.14 ? 526  ARG A CA    1 
ATOM   4078  C C     . ARG A 1 526 ? 48.880  149.752 50.472  1.00 23.72 ? 526  ARG A C     1 
ATOM   4079  O O     . ARG A 1 526 ? 49.938  150.116 49.955  1.00 24.25 ? 526  ARG A O     1 
ATOM   4080  C CB    . ARG A 1 526 ? 47.748  148.718 48.464  1.00 23.01 ? 526  ARG A CB    1 
ATOM   4081  C CG    . ARG A 1 526 ? 48.106  147.297 48.816  1.00 20.02 ? 526  ARG A CG    1 
ATOM   4082  C CD    . ARG A 1 526 ? 48.231  146.487 47.512  1.00 16.18 ? 526  ARG A CD    1 
ATOM   4083  N NE    . ARG A 1 526 ? 48.969  145.243 47.739  1.00 13.99 ? 526  ARG A NE    1 
ATOM   4084  C CZ    . ARG A 1 526 ? 49.027  144.229 46.887  1.00 13.73 ? 526  ARG A CZ    1 
ATOM   4085  N NH1   . ARG A 1 526 ? 48.398  144.279 45.692  1.00 9.03  ? 526  ARG A NH1   1 
ATOM   4086  N NH2   . ARG A 1 526 ? 49.754  143.168 47.231  1.00 12.61 ? 526  ARG A NH2   1 
ATOM   4087  N N     . LEU A 1 527 ? 48.770  149.419 51.752  1.00 23.92 ? 527  LEU A N     1 
ATOM   4088  C CA    . LEU A 1 527 ? 49.901  149.442 52.694  1.00 24.79 ? 527  LEU A CA    1 
ATOM   4089  C C     . LEU A 1 527 ? 49.872  148.178 53.571  1.00 24.55 ? 527  LEU A C     1 
ATOM   4090  O O     . LEU A 1 527 ? 48.792  147.689 53.919  1.00 25.30 ? 527  LEU A O     1 
ATOM   4091  C CB    . LEU A 1 527 ? 49.838  150.704 53.578  1.00 25.17 ? 527  LEU A CB    1 
ATOM   4092  C CG    . LEU A 1 527 ? 50.125  152.061 52.885  1.00 26.67 ? 527  LEU A CG    1 
ATOM   4093  C CD1   . LEU A 1 527 ? 49.580  153.280 53.679  1.00 25.45 ? 527  LEU A CD1   1 
ATOM   4094  C CD2   . LEU A 1 527 ? 51.628  152.218 52.569  1.00 26.89 ? 527  LEU A CD2   1 
ATOM   4095  N N     . GLY A 1 528 ? 51.039  147.659 53.938  1.00 23.84 ? 528  GLY A N     1 
ATOM   4096  C CA    . GLY A 1 528 ? 51.129  146.460 54.785  1.00 23.07 ? 528  GLY A CA    1 
ATOM   4097  C C     . GLY A 1 528 ? 51.180  146.862 56.243  1.00 23.27 ? 528  GLY A C     1 
ATOM   4098  O O     . GLY A 1 528 ? 51.817  147.855 56.596  1.00 23.10 ? 528  GLY A O     1 
ATOM   4099  N N     . THR A 1 529 ? 50.474  146.142 57.109  1.00 23.20 ? 529  THR A N     1 
ATOM   4100  C CA    . THR A 1 529 ? 50.526  146.507 58.532  1.00 23.59 ? 529  THR A CA    1 
ATOM   4101  C C     . THR A 1 529 ? 51.934  146.225 59.054  1.00 22.89 ? 529  THR A C     1 
ATOM   4102  O O     . THR A 1 529 ? 52.442  146.962 59.888  1.00 22.56 ? 529  THR A O     1 
ATOM   4103  C CB    . THR A 1 529 ? 49.436  145.808 59.394  1.00 23.62 ? 529  THR A CB    1 
ATOM   4104  O OG1   . THR A 1 529 ? 49.631  144.397 59.368  1.00 25.00 ? 529  THR A OG1   1 
ATOM   4105  C CG2   . THR A 1 529 ? 48.049  146.116 58.854  1.00 23.44 ? 529  THR A CG2   1 
ATOM   4106  N N     . ALA A 1 530 ? 52.571  145.184 58.509  1.00 22.62 ? 530  ALA A N     1 
ATOM   4107  C CA    . ALA A 1 530 ? 53.897  144.768 58.959  1.00 22.30 ? 530  ALA A CA    1 
ATOM   4108  C C     . ALA A 1 530 ? 54.921  145.855 58.721  1.00 21.98 ? 530  ALA A C     1 
ATOM   4109  O O     . ALA A 1 530 ? 55.692  146.161 59.623  1.00 21.01 ? 530  ALA A O     1 
ATOM   4110  C CB    . ALA A 1 530 ? 54.336  143.463 58.305  1.00 22.47 ? 530  ALA A CB    1 
ATOM   4111  N N     . GLU A 1 531 ? 54.929  146.443 57.522  1.00 21.75 ? 531  GLU A N     1 
ATOM   4112  C CA    . GLU A 1 531 ? 55.941  147.462 57.216  1.00 22.23 ? 531  GLU A CA    1 
ATOM   4113  C C     . GLU A 1 531 ? 55.796  148.715 58.100  1.00 22.14 ? 531  GLU A C     1 
ATOM   4114  O O     . GLU A 1 531 ? 56.801  149.343 58.474  1.00 22.88 ? 531  GLU A O     1 
ATOM   4115  C CB    . GLU A 1 531 ? 55.920  147.829 55.734  1.00 22.54 ? 531  GLU A CB    1 
ATOM   4116  C CG    . GLU A 1 531 ? 54.688  148.546 55.317  1.00 24.51 ? 531  GLU A CG    1 
ATOM   4117  C CD    . GLU A 1 531 ? 54.708  148.905 53.864  1.00 26.27 ? 531  GLU A CD    1 
ATOM   4118  O OE1   . GLU A 1 531 ? 55.632  149.644 53.434  1.00 26.46 ? 531  GLU A OE1   1 
ATOM   4119  O OE2   . GLU A 1 531 ? 53.784  148.461 53.167  1.00 25.70 ? 531  GLU A OE2   1 
ATOM   4120  N N     . ILE A 1 532 ? 54.557  149.084 58.422  1.00 21.38 ? 532  ILE A N     1 
ATOM   4121  C CA    . ILE A 1 532 ? 54.308  150.215 59.317  1.00 20.70 ? 532  ILE A CA    1 
ATOM   4122  C C     . ILE A 1 532 ? 54.790  149.855 60.732  1.00 20.29 ? 532  ILE A C     1 
ATOM   4123  O O     . ILE A 1 532 ? 55.342  150.691 61.421  1.00 20.00 ? 532  ILE A O     1 
ATOM   4124  C CB    . ILE A 1 532 ? 52.828  150.656 59.318  1.00 20.46 ? 532  ILE A CB    1 
ATOM   4125  C CG1   . ILE A 1 532 ? 52.387  151.015 57.903  1.00 20.69 ? 532  ILE A CG1   1 
ATOM   4126  C CG2   . ILE A 1 532 ? 52.613  151.881 60.279  1.00 20.56 ? 532  ILE A CG2   1 
ATOM   4127  C CD1   . ILE A 1 532 ? 50.864  151.219 57.716  1.00 21.54 ? 532  ILE A CD1   1 
ATOM   4128  N N     . GLU A 1 533 ? 54.586  148.604 61.156  1.00 20.82 ? 533  GLU A N     1 
ATOM   4129  C CA    . GLU A 1 533 ? 55.094  148.140 62.458  1.00 20.05 ? 533  GLU A CA    1 
ATOM   4130  C C     . GLU A 1 533 ? 56.626  148.118 62.506  1.00 20.07 ? 533  GLU A C     1 
ATOM   4131  O O     . GLU A 1 533 ? 57.228  148.577 63.490  1.00 20.42 ? 533  GLU A O     1 
ATOM   4132  C CB    . GLU A 1 533 ? 54.516  146.780 62.801  1.00 20.94 ? 533  GLU A CB    1 
ATOM   4133  C CG    . GLU A 1 533 ? 53.014  146.819 63.135  1.00 20.83 ? 533  GLU A CG    1 
ATOM   4134  C CD    . GLU A 1 533 ? 52.362  145.437 63.075  1.00 21.95 ? 533  GLU A CD    1 
ATOM   4135  O OE1   . GLU A 1 533 ? 53.059  144.434 62.766  1.00 23.12 ? 533  GLU A OE1   1 
ATOM   4136  O OE2   . GLU A 1 533 ? 51.156  145.349 63.375  1.00 21.55 ? 533  GLU A OE2   1 
ATOM   4137  N N     . SER A 1 534 ? 57.257  147.639 61.440  1.00 19.75 ? 534  SER A N     1 
ATOM   4138  C CA    . SER A 1 534 ? 58.709  147.741 61.288  1.00 21.12 ? 534  SER A CA    1 
ATOM   4139  C C     . SER A 1 534 ? 59.224  149.164 61.378  1.00 20.00 ? 534  SER A C     1 
ATOM   4140  O O     . SER A 1 534 ? 60.204  149.387 62.038  1.00 19.44 ? 534  SER A O     1 
ATOM   4141  C CB    . SER A 1 534 ? 59.191  147.150 59.952  1.00 20.74 ? 534  SER A CB    1 
ATOM   4142  O OG    . SER A 1 534 ? 58.867  145.794 59.903  1.00 25.93 ? 534  SER A OG    1 
ATOM   4143  N N     . ALA A 1 535 ? 58.590  150.093 60.657  1.00 20.64 ? 535  ALA A N     1 
ATOM   4144  C CA    . ALA A 1 535 ? 58.954  151.524 60.700  1.00 20.85 ? 535  ALA A CA    1 
ATOM   4145  C C     . ALA A 1 535 ? 58.890  152.088 62.133  1.00 21.01 ? 535  ALA A C     1 
ATOM   4146  O O     . ALA A 1 535 ? 59.822  152.788 62.569  1.00 21.37 ? 535  ALA A O     1 
ATOM   4147  C CB    . ALA A 1 535 ? 58.050  152.340 59.775  1.00 20.75 ? 535  ALA A CB    1 
ATOM   4148  N N     . LEU A 1 536 ? 57.811  151.773 62.851  1.00 20.48 ? 536  LEU A N     1 
ATOM   4149  C CA    . LEU A 1 536 ? 57.627  152.229 64.234  1.00 21.38 ? 536  LEU A CA    1 
ATOM   4150  C C     . LEU A 1 536 ? 58.710  151.653 65.170  1.00 21.90 ? 536  LEU A C     1 
ATOM   4151  O O     . LEU A 1 536 ? 59.369  152.395 65.876  1.00 22.23 ? 536  LEU A O     1 
ATOM   4152  C CB    . LEU A 1 536 ? 56.210  151.906 64.756  1.00 20.85 ? 536  LEU A CB    1 
ATOM   4153  C CG    . LEU A 1 536 ? 54.989  152.693 64.196  1.00 20.95 ? 536  LEU A CG    1 
ATOM   4154  C CD1   . LEU A 1 536 ? 53.706  151.887 64.363  1.00 17.77 ? 536  LEU A CD1   1 
ATOM   4155  C CD2   . LEU A 1 536 ? 54.809  154.080 64.859  1.00 18.66 ? 536  LEU A CD2   1 
ATOM   4156  N N     . VAL A 1 537 ? 58.921  150.338 65.121  1.00 23.12 ? 537  VAL A N     1 
ATOM   4157  C CA    . VAL A 1 537 ? 59.870  149.659 65.998  1.00 23.77 ? 537  VAL A CA    1 
ATOM   4158  C C     . VAL A 1 537 ? 61.326  150.075 65.754  1.00 23.71 ? 537  VAL A C     1 
ATOM   4159  O O     . VAL A 1 537 ? 62.162  149.954 66.643  1.00 24.00 ? 537  VAL A O     1 
ATOM   4160  C CB    . VAL A 1 537 ? 59.664  148.117 65.955  1.00 24.07 ? 537  VAL A CB    1 
ATOM   4161  C CG1   . VAL A 1 537 ? 60.772  147.400 66.688  1.00 26.13 ? 537  VAL A CG1   1 
ATOM   4162  C CG2   . VAL A 1 537 ? 58.366  147.773 66.605  1.00 23.77 ? 537  VAL A CG2   1 
ATOM   4163  N N     . ALA A 1 538 ? 61.617  150.583 64.556  1.00 23.97 ? 538  ALA A N     1 
ATOM   4164  C CA    . ALA A 1 538 ? 62.934  151.133 64.228  1.00 24.03 ? 538  ALA A CA    1 
ATOM   4165  C C     . ALA A 1 538 ? 63.278  152.380 65.042  1.00 24.07 ? 538  ALA A C     1 
ATOM   4166  O O     . ALA A 1 538 ? 64.467  152.693 65.208  1.00 24.11 ? 538  ALA A O     1 
ATOM   4167  C CB    . ALA A 1 538 ? 63.043  151.426 62.714  1.00 23.51 ? 538  ALA A CB    1 
ATOM   4168  N N     . HIS A 1 539 ? 62.250  153.095 65.526  1.00 24.26 ? 539  HIS A N     1 
ATOM   4169  C CA    . HIS A 1 539 ? 62.447  154.266 66.395  1.00 24.05 ? 539  HIS A CA    1 
ATOM   4170  C C     . HIS A 1 539 ? 63.135  153.865 67.713  1.00 24.66 ? 539  HIS A C     1 
ATOM   4171  O O     . HIS A 1 539 ? 62.683  152.933 68.375  1.00 23.85 ? 539  HIS A O     1 
ATOM   4172  C CB    . HIS A 1 539 ? 61.105  154.971 66.681  1.00 23.71 ? 539  HIS A CB    1 
ATOM   4173  C CG    . HIS A 1 539 ? 61.261  156.305 67.335  1.00 22.69 ? 539  HIS A CG    1 
ATOM   4174  N ND1   . HIS A 1 539 ? 61.562  156.443 68.674  1.00 22.18 ? 539  HIS A ND1   1 
ATOM   4175  C CD2   . HIS A 1 539 ? 61.211  157.560 66.827  1.00 23.12 ? 539  HIS A CD2   1 
ATOM   4176  C CE1   . HIS A 1 539 ? 61.680  157.727 68.964  1.00 24.13 ? 539  HIS A CE1   1 
ATOM   4177  N NE2   . HIS A 1 539 ? 61.478  158.426 67.858  1.00 22.77 ? 539  HIS A NE2   1 
ATOM   4178  N N     . PRO A 1 540 ? 64.215  154.583 68.105  1.00 25.44 ? 540  PRO A N     1 
ATOM   4179  C CA    . PRO A 1 540 ? 65.032  154.204 69.276  1.00 25.96 ? 540  PRO A CA    1 
ATOM   4180  C C     . PRO A 1 540 ? 64.264  154.100 70.597  1.00 26.14 ? 540  PRO A C     1 
ATOM   4181  O O     . PRO A 1 540 ? 64.757  153.471 71.550  1.00 26.83 ? 540  PRO A O     1 
ATOM   4182  C CB    . PRO A 1 540 ? 66.061  155.343 69.397  1.00 26.34 ? 540  PRO A CB    1 
ATOM   4183  C CG    . PRO A 1 540 ? 66.078  156.031 68.066  1.00 26.24 ? 540  PRO A CG    1 
ATOM   4184  C CD    . PRO A 1 540 ? 64.723  155.801 67.435  1.00 25.70 ? 540  PRO A CD    1 
ATOM   4185  N N     . LYS A 1 541 ? 63.090  154.716 70.663  1.00 25.78 ? 541  LYS A N     1 
ATOM   4186  C CA    . LYS A 1 541 ? 62.294  154.729 71.893  1.00 25.80 ? 541  LYS A CA    1 
ATOM   4187  C C     . LYS A 1 541 ? 61.147  153.717 71.868  1.00 25.00 ? 541  LYS A C     1 
ATOM   4188  O O     . LYS A 1 541 ? 60.494  153.469 72.889  1.00 25.01 ? 541  LYS A O     1 
ATOM   4189  C CB    . LYS A 1 541 ? 61.791  156.148 72.214  1.00 25.71 ? 541  LYS A CB    1 
ATOM   4190  C CG    . LYS A 1 541 ? 62.897  157.089 72.726  1.00 26.94 ? 541  LYS A CG    1 
ATOM   4191  C CD    . LYS A 1 541 ? 62.499  158.563 72.636  1.00 26.84 ? 541  LYS A CD    1 
ATOM   4192  C CE    . LYS A 1 541 ? 63.348  159.473 73.556  1.00 30.84 ? 541  LYS A CE    1 
ATOM   4193  N NZ    . LYS A 1 541 ? 64.638  159.943 72.960  1.00 31.96 ? 541  LYS A NZ    1 
ATOM   4194  N N     . ILE A 1 542 ? 60.938  153.096 70.712  1.00 24.25 ? 542  ILE A N     1 
ATOM   4195  C CA    . ILE A 1 542 ? 59.849  152.148 70.546  1.00 23.85 ? 542  ILE A CA    1 
ATOM   4196  C C     . ILE A 1 542 ? 60.326  150.692 70.585  1.00 23.61 ? 542  ILE A C     1 
ATOM   4197  O O     . ILE A 1 542 ? 61.228  150.288 69.832  1.00 23.15 ? 542  ILE A O     1 
ATOM   4198  C CB    . ILE A 1 542 ? 59.019  152.427 69.244  1.00 24.03 ? 542  ILE A CB    1 
ATOM   4199  C CG1   . ILE A 1 542 ? 58.396  153.831 69.306  1.00 23.59 ? 542  ILE A CG1   1 
ATOM   4200  C CG2   . ILE A 1 542 ? 57.939  151.320 69.032  1.00 22.70 ? 542  ILE A CG2   1 
ATOM   4201  C CD1   . ILE A 1 542 ? 57.654  154.270 68.004  1.00 24.23 ? 542  ILE A CD1   1 
ATOM   4202  N N     . ALA A 1 543 ? 59.692  149.917 71.462  1.00 23.31 ? 543  ALA A N     1 
ATOM   4203  C CA    . ALA A 1 543 ? 60.002  148.503 71.653  1.00 23.47 ? 543  ALA A CA    1 
ATOM   4204  C C     . ALA A 1 543 ? 59.116  147.657 70.769  1.00 23.70 ? 543  ALA A C     1 
ATOM   4205  O O     . ALA A 1 543 ? 59.586  146.743 70.091  1.00 22.99 ? 543  ALA A O     1 
ATOM   4206  C CB    . ALA A 1 543 ? 59.783  148.114 73.087  1.00 23.23 ? 543  ALA A CB    1 
ATOM   4207  N N     . GLU A 1 544 ? 57.821  147.972 70.781  1.00 24.22 ? 544  GLU A N     1 
ATOM   4208  C CA    . GLU A 1 544 ? 56.851  147.174 70.048  1.00 24.70 ? 544  GLU A CA    1 
ATOM   4209  C C     . GLU A 1 544 ? 55.649  147.970 69.513  1.00 24.35 ? 544  GLU A C     1 
ATOM   4210  O O     . GLU A 1 544 ? 55.245  148.970 70.102  1.00 24.46 ? 544  GLU A O     1 
ATOM   4211  C CB    . GLU A 1 544 ? 56.404  146.021 70.939  1.00 24.38 ? 544  GLU A CB    1 
ATOM   4212  C CG    . GLU A 1 544 ? 56.160  144.776 70.149  1.00 28.84 ? 544  GLU A CG    1 
ATOM   4213  C CD    . GLU A 1 544 ? 55.730  143.597 70.991  1.00 31.58 ? 544  GLU A CD    1 
ATOM   4214  O OE1   . GLU A 1 544 ? 55.601  143.727 72.238  1.00 30.84 ? 544  GLU A OE1   1 
ATOM   4215  O OE2   . GLU A 1 544 ? 55.524  142.538 70.369  1.00 33.60 ? 544  GLU A OE2   1 
ATOM   4216  N N     . ALA A 1 545 ? 55.088  147.527 68.388  1.00 24.30 ? 545  ALA A N     1 
ATOM   4217  C CA    . ALA A 1 545 ? 53.899  148.155 67.818  1.00 24.25 ? 545  ALA A CA    1 
ATOM   4218  C C     . ALA A 1 545 ? 53.005  147.139 67.126  1.00 24.11 ? 545  ALA A C     1 
ATOM   4219  O O     . ALA A 1 545 ? 53.485  146.132 66.634  1.00 24.46 ? 545  ALA A O     1 
ATOM   4220  C CB    . ALA A 1 545 ? 54.292  149.295 66.820  1.00 24.17 ? 545  ALA A CB    1 
ATOM   4221  N N     . ALA A 1 546 ? 51.705  147.421 67.105  1.00 23.79 ? 546  ALA A N     1 
ATOM   4222  C CA    . ALA A 1 546 ? 50.702  146.606 66.404  1.00 23.19 ? 546  ALA A CA    1 
ATOM   4223  C C     . ALA A 1 546 ? 49.776  147.586 65.693  1.00 22.54 ? 546  ALA A C     1 
ATOM   4224  O O     . ALA A 1 546 ? 49.189  148.463 66.332  1.00 22.40 ? 546  ALA A O     1 
ATOM   4225  C CB    . ALA A 1 546 ? 49.919  145.730 67.389  1.00 22.56 ? 546  ALA A CB    1 
ATOM   4226  N N     . VAL A 1 547 ? 49.692  147.464 64.366  1.00 21.90 ? 547  VAL A N     1 
ATOM   4227  C CA    . VAL A 1 547 ? 48.943  148.410 63.552  1.00 20.97 ? 547  VAL A CA    1 
ATOM   4228  C C     . VAL A 1 547 ? 47.692  147.750 62.973  1.00 20.93 ? 547  VAL A C     1 
ATOM   4229  O O     . VAL A 1 547 ? 47.763  146.659 62.424  1.00 20.46 ? 547  VAL A O     1 
ATOM   4230  C CB    . VAL A 1 547 ? 49.814  148.987 62.416  1.00 20.86 ? 547  VAL A CB    1 
ATOM   4231  C CG1   . VAL A 1 547 ? 48.954  149.762 61.425  1.00 21.14 ? 547  VAL A CG1   1 
ATOM   4232  C CG2   . VAL A 1 547 ? 50.920  149.891 63.005  1.00 21.00 ? 547  VAL A CG2   1 
ATOM   4233  N N     . VAL A 1 548 ? 46.549  148.420 63.116  1.00 20.63 ? 548  VAL A N     1 
ATOM   4234  C CA    . VAL A 1 548 ? 45.304  147.968 62.508  1.00 20.79 ? 548  VAL A CA    1 
ATOM   4235  C C     . VAL A 1 548 ? 44.686  149.093 61.690  1.00 20.93 ? 548  VAL A C     1 
ATOM   4236  O O     . VAL A 1 548 ? 45.069  150.262 61.816  1.00 20.51 ? 548  VAL A O     1 
ATOM   4237  C CB    . VAL A 1 548 ? 44.281  147.417 63.565  1.00 20.87 ? 548  VAL A CB    1 
ATOM   4238  C CG1   . VAL A 1 548 ? 44.784  146.140 64.181  1.00 19.54 ? 548  VAL A CG1   1 
ATOM   4239  C CG2   . VAL A 1 548 ? 43.994  148.449 64.652  1.00 21.41 ? 548  VAL A CG2   1 
ATOM   4240  N N     . GLY A 1 549 ? 43.749  148.726 60.824  1.00 21.27 ? 549  GLY A N     1 
ATOM   4241  C CA    . GLY A 1 549 ? 42.918  149.710 60.166  1.00 22.31 ? 549  GLY A CA    1 
ATOM   4242  C C     . GLY A 1 549 ? 41.590  149.795 60.888  1.00 22.88 ? 549  GLY A C     1 
ATOM   4243  O O     . GLY A 1 549 ? 41.082  148.789 61.410  1.00 23.78 ? 549  GLY A O     1 
ATOM   4244  N N     . ILE A 1 550 ? 41.056  151.008 60.947  1.00 22.76 ? 550  ILE A N     1 
ATOM   4245  C CA    . ILE A 1 550 ? 39.708  151.267 61.427  1.00 22.71 ? 550  ILE A CA    1 
ATOM   4246  C C     . ILE A 1 550 ? 38.879  151.941 60.304  1.00 23.64 ? 550  ILE A C     1 
ATOM   4247  O O     . ILE A 1 550 ? 39.432  152.646 59.442  1.00 22.96 ? 550  ILE A O     1 
ATOM   4248  C CB    . ILE A 1 550 ? 39.711  152.118 62.738  1.00 22.39 ? 550  ILE A CB    1 
ATOM   4249  C CG1   . ILE A 1 550 ? 40.450  153.438 62.541  1.00 20.84 ? 550  ILE A CG1   1 
ATOM   4250  C CG2   . ILE A 1 550 ? 40.349  151.338 63.885  1.00 22.52 ? 550  ILE A CG2   1 
ATOM   4251  C CD1   . ILE A 1 550 ? 40.158  154.478 63.606  1.00 23.09 ? 550  ILE A CD1   1 
ATOM   4252  N N     . PRO A 1 551 ? 37.558  151.692 60.286  1.00 24.45 ? 551  PRO A N     1 
ATOM   4253  C CA    . PRO A 1 551 ? 36.702  152.369 59.317  1.00 25.49 ? 551  PRO A CA    1 
ATOM   4254  C C     . PRO A 1 551 ? 36.841  153.883 59.378  1.00 26.00 ? 551  PRO A C     1 
ATOM   4255  O O     . PRO A 1 551 ? 37.020  154.458 60.436  1.00 26.42 ? 551  PRO A O     1 
ATOM   4256  C CB    . PRO A 1 551 ? 35.290  151.923 59.716  1.00 25.16 ? 551  PRO A CB    1 
ATOM   4257  C CG    . PRO A 1 551 ? 35.507  150.566 60.325  1.00 25.75 ? 551  PRO A CG    1 
ATOM   4258  C CD    . PRO A 1 551 ? 36.803  150.724 61.107  1.00 24.72 ? 551  PRO A CD    1 
ATOM   4259  N N     . HIS A 1 552 ? 36.805  154.513 58.221  1.00 26.55 ? 552  HIS A N     1 
ATOM   4260  C CA    . HIS A 1 552 ? 36.827  155.955 58.143  1.00 26.60 ? 552  HIS A CA    1 
ATOM   4261  C C     . HIS A 1 552 ? 35.923  156.320 56.965  1.00 26.58 ? 552  HIS A C     1 
ATOM   4262  O O     . HIS A 1 552 ? 36.005  155.682 55.907  1.00 26.17 ? 552  HIS A O     1 
ATOM   4263  C CB    . HIS A 1 552 ? 38.254  156.455 57.912  1.00 26.82 ? 552  HIS A CB    1 
ATOM   4264  C CG    . HIS A 1 552 ? 38.371  157.941 57.932  1.00 26.84 ? 552  HIS A CG    1 
ATOM   4265  N ND1   . HIS A 1 552 ? 38.786  158.636 59.047  1.00 29.14 ? 552  HIS A ND1   1 
ATOM   4266  C CD2   . HIS A 1 552 ? 38.067  158.870 56.999  1.00 28.66 ? 552  HIS A CD2   1 
ATOM   4267  C CE1   . HIS A 1 552 ? 38.765  159.931 58.786  1.00 28.81 ? 552  HIS A CE1   1 
ATOM   4268  N NE2   . HIS A 1 552 ? 38.336  160.100 57.549  1.00 28.73 ? 552  HIS A NE2   1 
ATOM   4269  N N     . ALA A 1 553 ? 35.077  157.335 57.160  1.00 26.28 ? 553  ALA A N     1 
ATOM   4270  C CA    . ALA A 1 553 ? 34.027  157.708 56.208  1.00 26.34 ? 553  ALA A CA    1 
ATOM   4271  C C     . ALA A 1 553 ? 34.522  158.182 54.845  1.00 26.30 ? 553  ALA A C     1 
ATOM   4272  O O     . ALA A 1 553 ? 33.858  157.952 53.826  1.00 26.59 ? 553  ALA A O     1 
ATOM   4273  C CB    . ALA A 1 553 ? 33.105  158.776 56.821  1.00 26.41 ? 553  ALA A CB    1 
ATOM   4274  N N     . ILE A 1 554 ? 35.645  158.897 54.831  1.00 25.94 ? 554  ILE A N     1 
ATOM   4275  C CA    . ILE A 1 554 ? 36.243  159.353 53.569  1.00 25.55 ? 554  ILE A CA    1 
ATOM   4276  C C     . ILE A 1 554 ? 37.322  158.380 53.083  1.00 24.44 ? 554  ILE A C     1 
ATOM   4277  O O     . ILE A 1 554 ? 37.234  157.856 51.983  1.00 23.69 ? 554  ILE A O     1 
ATOM   4278  C CB    . ILE A 1 554 ? 36.819  160.802 53.639  1.00 25.25 ? 554  ILE A CB    1 
ATOM   4279  C CG1   . ILE A 1 554 ? 35.823  161.773 54.290  1.00 26.33 ? 554  ILE A CG1   1 
ATOM   4280  C CG2   . ILE A 1 554 ? 37.223  161.283 52.232  1.00 26.24 ? 554  ILE A CG2   1 
ATOM   4281  C CD1   . ILE A 1 554 ? 34.394  161.688 53.743  1.00 26.28 ? 554  ILE A CD1   1 
ATOM   4282  N N     . LYS A 1 555 ? 38.298  158.133 53.948  1.00 24.19 ? 555  LYS A N     1 
ATOM   4283  C CA    . LYS A 1 555 ? 39.488  157.348 53.622  1.00 24.72 ? 555  LYS A CA    1 
ATOM   4284  C C     . LYS A 1 555 ? 39.267  155.844 53.470  1.00 23.47 ? 555  LYS A C     1 
ATOM   4285  O O     . LYS A 1 555 ? 40.147  155.162 53.018  1.00 24.02 ? 555  LYS A O     1 
ATOM   4286  C CB    . LYS A 1 555 ? 40.566  157.543 54.684  1.00 24.68 ? 555  LYS A CB    1 
ATOM   4287  C CG    . LYS A 1 555 ? 40.948  158.964 55.026  1.00 27.89 ? 555  LYS A CG    1 
ATOM   4288  C CD    . LYS A 1 555 ? 42.219  158.925 55.879  1.00 33.70 ? 555  LYS A CD    1 
ATOM   4289  C CE    . LYS A 1 555 ? 42.221  160.002 56.961  1.00 37.22 ? 555  LYS A CE    1 
ATOM   4290  N NZ    . LYS A 1 555 ? 43.537  160.025 57.676  1.00 39.45 ? 555  LYS A NZ    1 
ATOM   4291  N N     . GLY A 1 556 ? 38.114  155.325 53.870  1.00 23.36 ? 556  GLY A N     1 
ATOM   4292  C CA    . GLY A 1 556 ? 37.883  153.868 53.887  1.00 22.50 ? 556  GLY A CA    1 
ATOM   4293  C C     . GLY A 1 556 ? 38.432  153.260 55.164  1.00 21.90 ? 556  GLY A C     1 
ATOM   4294  O O     . GLY A 1 556 ? 37.675  152.766 55.991  1.00 22.02 ? 556  GLY A O     1 
ATOM   4295  N N     . GLN A 1 557 ? 39.760  153.265 55.294  1.00 21.71 ? 557  GLN A N     1 
ATOM   4296  C CA    . GLN A 1 557 ? 40.431  152.917 56.537  1.00 21.79 ? 557  GLN A CA    1 
ATOM   4297  C C     . GLN A 1 557 ? 41.386  154.015 56.977  1.00 21.79 ? 557  GLN A C     1 
ATOM   4298  O O     . GLN A 1 557 ? 42.079  154.609 56.150  1.00 21.86 ? 557  GLN A O     1 
ATOM   4299  C CB    . GLN A 1 557 ? 41.213  151.613 56.401  1.00 21.98 ? 557  GLN A CB    1 
ATOM   4300  C CG    . GLN A 1 557 ? 40.360  150.351 56.345  1.00 21.90 ? 557  GLN A CG    1 
ATOM   4301  C CD    . GLN A 1 557 ? 41.207  149.116 56.455  1.00 21.87 ? 557  GLN A CD    1 
ATOM   4302  O OE1   . GLN A 1 557 ? 42.169  148.976 55.737  1.00 24.13 ? 557  GLN A OE1   1 
ATOM   4303  N NE2   . GLN A 1 557 ? 40.871  148.232 57.383  1.00 21.52 ? 557  GLN A NE2   1 
ATOM   4304  N N     . ALA A 1 558 ? 41.398  154.278 58.284  1.00 21.44 ? 558  ALA A N     1 
ATOM   4305  C CA    . ALA A 1 558 ? 42.425  155.084 58.934  1.00 20.96 ? 558  ALA A CA    1 
ATOM   4306  C C     . ALA A 1 558 ? 43.376  154.148 59.684  1.00 20.54 ? 558  ALA A C     1 
ATOM   4307  O O     . ALA A 1 558 ? 42.988  153.067 60.089  1.00 20.17 ? 558  ALA A O     1 
ATOM   4308  C CB    . ALA A 1 558 ? 41.774  156.095 59.924  1.00 21.28 ? 558  ALA A CB    1 
ATOM   4309  N N     . ILE A 1 559 ? 44.597  154.616 59.904  1.00 20.88 ? 559  ILE A N     1 
ATOM   4310  C CA    . ILE A 1 559 ? 45.658  153.865 60.571  1.00 20.61 ? 559  ILE A CA    1 
ATOM   4311  C C     . ILE A 1 559 ? 45.682  154.061 62.088  1.00 21.21 ? 559  ILE A C     1 
ATOM   4312  O O     . ILE A 1 559 ? 45.897  155.173 62.599  1.00 20.70 ? 559  ILE A O     1 
ATOM   4313  C CB    . ILE A 1 559 ? 47.050  154.214 59.972  1.00 20.68 ? 559  ILE A CB    1 
ATOM   4314  C CG1   . ILE A 1 559 ? 47.058  153.936 58.463  1.00 20.16 ? 559  ILE A CG1   1 
ATOM   4315  C CG2   . ILE A 1 559 ? 48.139  153.409 60.668  1.00 18.79 ? 559  ILE A CG2   1 
ATOM   4316  C CD1   . ILE A 1 559 ? 48.222  154.594 57.705  1.00 19.72 ? 559  ILE A CD1   1 
ATOM   4317  N N     . TYR A 1 560 ? 45.484  152.954 62.795  1.00 21.27 ? 560  TYR A N     1 
ATOM   4318  C CA    . TYR A 1 560 ? 45.447  152.947 64.239  1.00 20.89 ? 560  TYR A CA    1 
ATOM   4319  C C     . TYR A 1 560 ? 46.630  152.109 64.765  1.00 21.17 ? 560  TYR A C     1 
ATOM   4320  O O     . TYR A 1 560 ? 46.678  150.893 64.553  1.00 20.12 ? 560  TYR A O     1 
ATOM   4321  C CB    . TYR A 1 560 ? 44.117  152.353 64.692  1.00 21.73 ? 560  TYR A CB    1 
ATOM   4322  C CG    . TYR A 1 560 ? 43.810  152.515 66.159  1.00 22.23 ? 560  TYR A CG    1 
ATOM   4323  C CD1   . TYR A 1 560 ? 44.544  151.835 67.133  1.00 22.56 ? 560  TYR A CD1   1 
ATOM   4324  C CD2   . TYR A 1 560 ? 42.782  153.352 66.577  1.00 23.45 ? 560  TYR A CD2   1 
ATOM   4325  C CE1   . TYR A 1 560 ? 44.258  151.993 68.499  1.00 22.51 ? 560  TYR A CE1   1 
ATOM   4326  C CE2   . TYR A 1 560 ? 42.481  153.508 67.930  1.00 23.63 ? 560  TYR A CE2   1 
ATOM   4327  C CZ    . TYR A 1 560 ? 43.224  152.836 68.884  1.00 23.99 ? 560  TYR A CZ    1 
ATOM   4328  O OH    . TYR A 1 560 ? 42.915  153.006 70.222  1.00 23.18 ? 560  TYR A OH    1 
ATOM   4329  N N     . ALA A 1 561 ? 47.564  152.775 65.457  1.00 20.83 ? 561  ALA A N     1 
ATOM   4330  C CA    . ALA A 1 561 ? 48.788  152.157 65.953  1.00 20.99 ? 561  ALA A CA    1 
ATOM   4331  C C     . ALA A 1 561 ? 48.862  152.076 67.475  1.00 21.23 ? 561  ALA A C     1 
ATOM   4332  O O     . ALA A 1 561 ? 48.887  153.094 68.173  1.00 21.01 ? 561  ALA A O     1 
ATOM   4333  C CB    . ALA A 1 561 ? 50.043  152.876 65.402  1.00 20.46 ? 561  ALA A CB    1 
ATOM   4334  N N     . TYR A 1 562 ? 48.915  150.839 67.960  1.00 21.69 ? 562  TYR A N     1 
ATOM   4335  C CA    . TYR A 1 562 ? 49.256  150.520 69.335  1.00 22.54 ? 562  TYR A CA    1 
ATOM   4336  C C     . TYR A 1 562 ? 50.772  150.476 69.479  1.00 23.24 ? 562  TYR A C     1 
ATOM   4337  O O     . TYR A 1 562 ? 51.439  149.716 68.779  1.00 22.60 ? 562  TYR A O     1 
ATOM   4338  C CB    . TYR A 1 562 ? 48.705  149.145 69.680  1.00 23.02 ? 562  TYR A CB    1 
ATOM   4339  C CG    . TYR A 1 562 ? 47.194  149.017 69.629  1.00 23.88 ? 562  TYR A CG    1 
ATOM   4340  C CD1   . TYR A 1 562 ? 46.517  148.841 68.419  1.00 23.18 ? 562  TYR A CD1   1 
ATOM   4341  C CD2   . TYR A 1 562 ? 46.451  149.036 70.799  1.00 23.48 ? 562  TYR A CD2   1 
ATOM   4342  C CE1   . TYR A 1 562 ? 45.134  148.696 68.384  1.00 24.25 ? 562  TYR A CE1   1 
ATOM   4343  C CE2   . TYR A 1 562 ? 45.065  148.907 70.776  1.00 25.27 ? 562  TYR A CE2   1 
ATOM   4344  C CZ    . TYR A 1 562 ? 44.413  148.733 69.576  1.00 24.59 ? 562  TYR A CZ    1 
ATOM   4345  O OH    . TYR A 1 562 ? 43.042  148.591 69.597  1.00 24.93 ? 562  TYR A OH    1 
ATOM   4346  N N     . VAL A 1 563 ? 51.314  151.293 70.387  1.00 24.00 ? 563  VAL A N     1 
ATOM   4347  C CA    . VAL A 1 563 ? 52.755  151.455 70.513  1.00 24.14 ? 563  VAL A CA    1 
ATOM   4348  C C     . VAL A 1 563 ? 53.206  151.203 71.961  1.00 24.86 ? 563  VAL A C     1 
ATOM   4349  O O     . VAL A 1 563 ? 52.611  151.725 72.910  1.00 24.59 ? 563  VAL A O     1 
ATOM   4350  C CB    . VAL A 1 563 ? 53.207  152.851 70.006  1.00 24.30 ? 563  VAL A CB    1 
ATOM   4351  C CG1   . VAL A 1 563 ? 54.726  153.001 70.027  1.00 23.63 ? 563  VAL A CG1   1 
ATOM   4352  C CG2   . VAL A 1 563 ? 52.712  153.092 68.580  1.00 24.11 ? 563  VAL A CG2   1 
ATOM   4353  N N     . THR A 1 564 ? 54.234  150.369 72.110  1.00 25.10 ? 564  THR A N     1 
ATOM   4354  C CA    . THR A 1 564 ? 54.867  150.096 73.407  1.00 25.54 ? 564  THR A CA    1 
ATOM   4355  C C     . THR A 1 564 ? 56.231  150.766 73.416  1.00 26.64 ? 564  THR A C     1 
ATOM   4356  O O     . THR A 1 564 ? 57.087  150.475 72.570  1.00 25.98 ? 564  THR A O     1 
ATOM   4357  C CB    . THR A 1 564 ? 55.019  148.562 73.676  1.00 25.30 ? 564  THR A CB    1 
ATOM   4358  O OG1   . THR A 1 564 ? 53.722  147.958 73.759  1.00 25.08 ? 564  THR A OG1   1 
ATOM   4359  C CG2   . THR A 1 564 ? 55.758  148.297 74.997  1.00 24.69 ? 564  THR A CG2   1 
ATOM   4360  N N     . LEU A 1 565 ? 56.416  151.677 74.370  1.00 28.66 ? 565  LEU A N     1 
ATOM   4361  C CA    . LEU A 1 565 ? 57.685  152.394 74.560  1.00 30.16 ? 565  LEU A CA    1 
ATOM   4362  C C     . LEU A 1 565 ? 58.688  151.536 75.322  1.00 31.53 ? 565  LEU A C     1 
ATOM   4363  O O     . LEU A 1 565 ? 58.296  150.687 76.133  1.00 31.64 ? 565  LEU A O     1 
ATOM   4364  C CB    . LEU A 1 565 ? 57.451  153.721 75.306  1.00 29.74 ? 565  LEU A CB    1 
ATOM   4365  C CG    . LEU A 1 565 ? 56.655  154.766 74.505  1.00 30.42 ? 565  LEU A CG    1 
ATOM   4366  C CD1   . LEU A 1 565 ? 56.309  155.991 75.338  1.00 29.61 ? 565  LEU A CD1   1 
ATOM   4367  C CD2   . LEU A 1 565 ? 57.394  155.159 73.227  1.00 26.78 ? 565  LEU A CD2   1 
ATOM   4368  N N     . ASN A 1 566 ? 59.975  151.737 75.035  1.00 33.16 ? 566  ASN A N     1 
ATOM   4369  C CA    . ASN A 1 566 ? 61.050  151.181 75.855  1.00 34.93 ? 566  ASN A CA    1 
ATOM   4370  C C     . ASN A 1 566 ? 60.914  151.688 77.294  1.00 36.22 ? 566  ASN A C     1 
ATOM   4371  O O     . ASN A 1 566 ? 60.380  152.783 77.512  1.00 36.30 ? 566  ASN A O     1 
ATOM   4372  C CB    . ASN A 1 566 ? 62.425  151.590 75.291  1.00 35.17 ? 566  ASN A CB    1 
ATOM   4373  C CG    . ASN A 1 566 ? 62.756  150.892 73.989  1.00 35.56 ? 566  ASN A CG    1 
ATOM   4374  O OD1   . ASN A 1 566 ? 62.401  149.731 73.783  1.00 38.09 ? 566  ASN A OD1   1 
ATOM   4375  N ND2   . ASN A 1 566 ? 63.446  151.592 73.102  1.00 36.97 ? 566  ASN A ND2   1 
ATOM   4376  N N     . HIS A 1 567 ? 61.374  150.898 78.269  1.00 37.73 ? 567  HIS A N     1 
ATOM   4377  C CA    . HIS A 1 567 ? 61.377  151.328 79.679  1.00 39.09 ? 567  HIS A CA    1 
ATOM   4378  C C     . HIS A 1 567 ? 62.103  152.655 79.817  1.00 39.81 ? 567  HIS A C     1 
ATOM   4379  O O     . HIS A 1 567 ? 63.106  152.912 79.132  1.00 40.21 ? 567  HIS A O     1 
ATOM   4380  C CB    . HIS A 1 567 ? 62.033  150.279 80.592  1.00 39.27 ? 567  HIS A CB    1 
ATOM   4381  C CG    . HIS A 1 567 ? 61.217  149.036 80.774  1.00 40.42 ? 567  HIS A CG    1 
ATOM   4382  N ND1   . HIS A 1 567 ? 61.503  148.095 81.740  1.00 42.80 ? 567  HIS A ND1   1 
ATOM   4383  C CD2   . HIS A 1 567 ? 60.120  148.581 80.119  1.00 41.87 ? 567  HIS A CD2   1 
ATOM   4384  C CE1   . HIS A 1 567 ? 60.625  147.108 81.663  1.00 43.59 ? 567  HIS A CE1   1 
ATOM   4385  N NE2   . HIS A 1 567 ? 59.776  147.377 80.686  1.00 41.81 ? 567  HIS A NE2   1 
ATOM   4386  N N     . GLY A 1 568 ? 61.572  153.515 80.676  1.00 40.22 ? 568  GLY A N     1 
ATOM   4387  C CA    . GLY A 1 568 ? 62.201  154.797 80.933  1.00 41.04 ? 568  GLY A CA    1 
ATOM   4388  C C     . GLY A 1 568 ? 61.818  155.891 79.958  1.00 41.40 ? 568  GLY A C     1 
ATOM   4389  O O     . GLY A 1 568 ? 62.390  156.986 80.008  1.00 41.76 ? 568  GLY A O     1 
ATOM   4390  N N     . GLU A 1 569 ? 60.859  155.604 79.074  1.00 41.58 ? 569  GLU A N     1 
ATOM   4391  C CA    . GLU A 1 569 ? 60.276  156.635 78.194  1.00 41.55 ? 569  GLU A CA    1 
ATOM   4392  C C     . GLU A 1 569 ? 58.787  156.843 78.498  1.00 41.27 ? 569  GLU A C     1 
ATOM   4393  O O     . GLU A 1 569 ? 58.060  155.875 78.772  1.00 41.77 ? 569  GLU A O     1 
ATOM   4394  C CB    . GLU A 1 569 ? 60.464  156.284 76.716  1.00 41.41 ? 569  GLU A CB    1 
ATOM   4395  C CG    . GLU A 1 569 ? 61.843  155.733 76.348  1.00 42.13 ? 569  GLU A CG    1 
ATOM   4396  C CD    . GLU A 1 569 ? 62.933  156.790 76.311  1.00 43.15 ? 569  GLU A CD    1 
ATOM   4397  O OE1   . GLU A 1 569 ? 62.609  158.005 76.360  1.00 44.52 ? 569  GLU A OE1   1 
ATOM   4398  O OE2   . GLU A 1 569 ? 64.117  156.397 76.222  1.00 41.84 ? 569  GLU A OE2   1 
ATOM   4399  N N     . GLU A 1 570 ? 58.342  158.100 78.450  1.00 40.24 ? 570  GLU A N     1 
ATOM   4400  C CA    . GLU A 1 570 ? 56.935  158.439 78.688  1.00 39.62 ? 570  GLU A CA    1 
ATOM   4401  C C     . GLU A 1 570 ? 56.298  159.104 77.467  1.00 37.52 ? 570  GLU A C     1 
ATOM   4402  O O     . GLU A 1 570 ? 56.998  159.757 76.681  1.00 37.39 ? 570  GLU A O     1 
ATOM   4403  C CB    . GLU A 1 570 ? 56.785  159.375 79.895  1.00 39.71 ? 570  GLU A CB    1 
ATOM   4404  C CG    . GLU A 1 570 ? 56.738  158.679 81.249  1.00 41.46 ? 570  GLU A CG    1 
ATOM   4405  C CD    . GLU A 1 570 ? 56.498  159.654 82.399  1.00 42.36 ? 570  GLU A CD    1 
ATOM   4406  O OE1   . GLU A 1 570 ? 55.718  160.631 82.200  1.00 44.99 ? 570  GLU A OE1   1 
ATOM   4407  O OE2   . GLU A 1 570 ? 57.092  159.446 83.495  1.00 44.02 ? 570  GLU A OE2   1 
ATOM   4408  N N     . PRO A 1 571 ? 54.969  158.928 77.302  1.00 35.41 ? 571  PRO A N     1 
ATOM   4409  C CA    . PRO A 1 571 ? 54.179  159.706 76.344  1.00 33.65 ? 571  PRO A CA    1 
ATOM   4410  C C     . PRO A 1 571 ? 54.123  161.218 76.653  1.00 31.66 ? 571  PRO A C     1 
ATOM   4411  O O     . PRO A 1 571 ? 53.880  161.617 77.791  1.00 31.32 ? 571  PRO A O     1 
ATOM   4412  C CB    . PRO A 1 571 ? 52.776  159.089 76.465  1.00 34.06 ? 571  PRO A CB    1 
ATOM   4413  C CG    . PRO A 1 571 ? 53.006  157.737 77.081  1.00 34.38 ? 571  PRO A CG    1 
ATOM   4414  C CD    . PRO A 1 571 ? 54.138  157.932 78.008  1.00 35.08 ? 571  PRO A CD    1 
ATOM   4415  N N     . SER A 1 572 ? 54.348  162.033 75.622  1.00 28.92 ? 572  SER A N     1 
ATOM   4416  C CA    . SER A 1 572 ? 54.241  163.486 75.699  1.00 26.40 ? 572  SER A CA    1 
ATOM   4417  C C     . SER A 1 572 ? 53.717  163.984 74.351  1.00 24.28 ? 572  SER A C     1 
ATOM   4418  O O     . SER A 1 572 ? 53.732  163.238 73.374  1.00 23.72 ? 572  SER A O     1 
ATOM   4419  C CB    . SER A 1 572 ? 55.608  164.120 76.023  1.00 26.25 ? 572  SER A CB    1 
ATOM   4420  O OG    . SER A 1 572 ? 56.554  163.808 75.012  1.00 26.24 ? 572  SER A OG    1 
ATOM   4421  N N     . PRO A 1 573 ? 53.205  165.228 74.302  1.00 22.84 ? 573  PRO A N     1 
ATOM   4422  C CA    . PRO A 1 573 ? 52.939  165.859 73.007  1.00 21.27 ? 573  PRO A CA    1 
ATOM   4423  C C     . PRO A 1 573 ? 54.137  165.739 72.034  1.00 20.75 ? 573  PRO A C     1 
ATOM   4424  O O     . PRO A 1 573 ? 53.944  165.408 70.846  1.00 20.27 ? 573  PRO A O     1 
ATOM   4425  C CB    . PRO A 1 573 ? 52.664  167.322 73.382  1.00 21.50 ? 573  PRO A CB    1 
ATOM   4426  C CG    . PRO A 1 573 ? 52.083  167.250 74.758  1.00 22.28 ? 573  PRO A CG    1 
ATOM   4427  C CD    . PRO A 1 573 ? 52.809  166.094 75.438  1.00 22.86 ? 573  PRO A CD    1 
ATOM   4428  N N     . GLU A 1 574 ? 55.350  165.976 72.540  1.00 19.49 ? 574  GLU A N     1 
ATOM   4429  C CA    . GLU A 1 574 ? 56.564  165.877 71.739  1.00 19.26 ? 574  GLU A CA    1 
ATOM   4430  C C     . GLU A 1 574 ? 56.758  164.481 71.157  1.00 18.99 ? 574  GLU A C     1 
ATOM   4431  O O     . GLU A 1 574 ? 57.028  164.335 69.961  1.00 18.44 ? 574  GLU A O     1 
ATOM   4432  C CB    . GLU A 1 574 ? 57.793  166.285 72.567  1.00 19.69 ? 574  GLU A CB    1 
ATOM   4433  C CG    . GLU A 1 574 ? 59.089  166.388 71.770  1.00 20.16 ? 574  GLU A CG    1 
ATOM   4434  C CD    . GLU A 1 574 ? 59.697  165.035 71.446  1.00 23.33 ? 574  GLU A CD    1 
ATOM   4435  O OE1   . GLU A 1 574 ? 59.629  164.119 72.313  1.00 24.65 ? 574  GLU A OE1   1 
ATOM   4436  O OE2   . GLU A 1 574 ? 60.247  164.886 70.331  1.00 22.35 ? 574  GLU A OE2   1 
ATOM   4437  N N     . LEU A 1 575 ? 56.630  163.454 71.993  1.00 18.51 ? 575  LEU A N     1 
ATOM   4438  C CA    . LEU A 1 575 ? 56.867  162.095 71.520  1.00 19.35 ? 575  LEU A CA    1 
ATOM   4439  C C     . LEU A 1 575 ? 55.802  161.651 70.547  1.00 19.09 ? 575  LEU A C     1 
ATOM   4440  O O     . LEU A 1 575 ? 56.107  160.994 69.553  1.00 19.98 ? 575  LEU A O     1 
ATOM   4441  C CB    . LEU A 1 575 ? 57.028  161.103 72.671  1.00 19.20 ? 575  LEU A CB    1 
ATOM   4442  C CG    . LEU A 1 575 ? 57.498  159.693 72.274  1.00 21.43 ? 575  LEU A CG    1 
ATOM   4443  C CD1   . LEU A 1 575 ? 58.880  159.670 71.526  1.00 19.34 ? 575  LEU A CD1   1 
ATOM   4444  C CD2   . LEU A 1 575 ? 57.545  158.870 73.544  1.00 22.56 ? 575  LEU A CD2   1 
ATOM   4445  N N     . TYR A 1 576 ? 54.561  162.045 70.820  1.00 19.75 ? 576  TYR A N     1 
ATOM   4446  C CA    . TYR A 1 576 ? 53.468  161.874 69.899  1.00 20.06 ? 576  TYR A CA    1 
ATOM   4447  C C     . TYR A 1 576 ? 53.838  162.392 68.504  1.00 19.88 ? 576  TYR A C     1 
ATOM   4448  O O     . TYR A 1 576 ? 53.721  161.648 67.510  1.00 18.73 ? 576  TYR A O     1 
ATOM   4449  C CB    . TYR A 1 576 ? 52.216  162.620 70.388  1.00 21.39 ? 576  TYR A CB    1 
ATOM   4450  C CG    . TYR A 1 576 ? 50.952  162.055 69.781  1.00 24.09 ? 576  TYR A CG    1 
ATOM   4451  C CD1   . TYR A 1 576 ? 50.311  160.989 70.404  1.00 25.78 ? 576  TYR A CD1   1 
ATOM   4452  C CD2   . TYR A 1 576 ? 50.406  162.559 68.576  1.00 25.16 ? 576  TYR A CD2   1 
ATOM   4453  C CE1   . TYR A 1 576 ? 49.153  160.426 69.886  1.00 26.26 ? 576  TYR A CE1   1 
ATOM   4454  C CE2   . TYR A 1 576 ? 49.215  161.974 68.020  1.00 26.14 ? 576  TYR A CE2   1 
ATOM   4455  C CZ    . TYR A 1 576 ? 48.614  160.891 68.700  1.00 25.69 ? 576  TYR A CZ    1 
ATOM   4456  O OH    . TYR A 1 576 ? 47.453  160.238 68.266  1.00 26.37 ? 576  TYR A OH    1 
ATOM   4457  N N     . ALA A 1 577 ? 54.250  163.669 68.439  1.00 18.64 ? 577  ALA A N     1 
ATOM   4458  C CA    . ALA A 1 577 ? 54.608  164.297 67.165  1.00 19.12 ? 577  ALA A CA    1 
ATOM   4459  C C     . ALA A 1 577 ? 55.815  163.601 66.525  1.00 18.85 ? 577  ALA A C     1 
ATOM   4460  O O     . ALA A 1 577 ? 55.812  163.357 65.339  1.00 19.21 ? 577  ALA A O     1 
ATOM   4461  C CB    . ALA A 1 577 ? 54.872  165.811 67.338  1.00 18.13 ? 577  ALA A CB    1 
ATOM   4462  N N     . GLU A 1 578 ? 56.833  163.277 67.319  1.00 19.07 ? 578  GLU A N     1 
ATOM   4463  C CA    . GLU A 1 578 ? 58.060  162.636 66.807  1.00 19.77 ? 578  GLU A CA    1 
ATOM   4464  C C     . GLU A 1 578 ? 57.787  161.257 66.194  1.00 19.56 ? 578  GLU A C     1 
ATOM   4465  O O     . GLU A 1 578 ? 58.325  160.916 65.147  1.00 19.59 ? 578  GLU A O     1 
ATOM   4466  C CB    . GLU A 1 578 ? 59.098  162.506 67.910  1.00 19.22 ? 578  GLU A CB    1 
ATOM   4467  C CG    . GLU A 1 578 ? 60.517  162.121 67.458  1.00 20.42 ? 578  GLU A CG    1 
ATOM   4468  C CD    . GLU A 1 578 ? 61.432  161.868 68.661  1.00 21.37 ? 578  GLU A CD    1 
ATOM   4469  O OE1   . GLU A 1 578 ? 61.366  162.627 69.640  1.00 22.53 ? 578  GLU A OE1   1 
ATOM   4470  O OE2   . GLU A 1 578 ? 62.190  160.886 68.648  1.00 26.46 ? 578  GLU A OE2   1 
ATOM   4471  N N     . VAL A 1 579 ? 56.927  160.498 66.847  1.00 20.14 ? 579  VAL A N     1 
ATOM   4472  C CA    . VAL A 1 579 ? 56.577  159.160 66.396  1.00 20.36 ? 579  VAL A CA    1 
ATOM   4473  C C     . VAL A 1 579 ? 55.767  159.185 65.096  1.00 21.19 ? 579  VAL A C     1 
ATOM   4474  O O     . VAL A 1 579 ? 56.049  158.414 64.178  1.00 20.53 ? 579  VAL A O     1 
ATOM   4475  C CB    . VAL A 1 579 ? 55.896  158.362 67.523  1.00 20.61 ? 579  VAL A CB    1 
ATOM   4476  C CG1   . VAL A 1 579 ? 55.204  157.080 66.990  1.00 17.82 ? 579  VAL A CG1   1 
ATOM   4477  C CG2   . VAL A 1 579 ? 56.948  158.010 68.612  1.00 21.24 ? 579  VAL A CG2   1 
ATOM   4478  N N     . ARG A 1 580 ? 54.793  160.090 64.998  1.00 22.07 ? 580  ARG A N     1 
ATOM   4479  C CA    . ARG A 1 580 ? 54.100  160.279 63.724  1.00 23.50 ? 580  ARG A CA    1 
ATOM   4480  C C     . ARG A 1 580 ? 55.052  160.715 62.595  1.00 22.98 ? 580  ARG A C     1 
ATOM   4481  O O     . ARG A 1 580 ? 54.971  160.201 61.494  1.00 22.72 ? 580  ARG A O     1 
ATOM   4482  C CB    . ARG A 1 580 ? 52.953  161.275 63.861  1.00 23.67 ? 580  ARG A CB    1 
ATOM   4483  C CG    . ARG A 1 580 ? 51.836  160.780 64.759  1.00 27.00 ? 580  ARG A CG    1 
ATOM   4484  C CD    . ARG A 1 580 ? 50.505  161.273 64.257  1.00 32.49 ? 580  ARG A CD    1 
ATOM   4485  N NE    . ARG A 1 580 ? 50.595  162.658 63.818  1.00 36.09 ? 580  ARG A NE    1 
ATOM   4486  C CZ    . ARG A 1 580 ? 49.926  163.152 62.788  1.00 38.70 ? 580  ARG A CZ    1 
ATOM   4487  N NH1   . ARG A 1 580 ? 49.130  162.371 62.071  1.00 40.51 ? 580  ARG A NH1   1 
ATOM   4488  N NH2   . ARG A 1 580 ? 50.069  164.429 62.466  1.00 42.65 ? 580  ARG A NH2   1 
ATOM   4489  N N     . ASN A 1 581 ? 55.936  161.671 62.878  1.00 22.81 ? 581  ASN A N     1 
ATOM   4490  C CA    . ASN A 1 581 ? 56.922  162.120 61.897  1.00 22.65 ? 581  ASN A CA    1 
ATOM   4491  C C     . ASN A 1 581 ? 57.935  161.065 61.554  1.00 22.05 ? 581  ASN A C     1 
ATOM   4492  O O     . ASN A 1 581 ? 58.483  161.073 60.456  1.00 21.98 ? 581  ASN A O     1 
ATOM   4493  C CB    . ASN A 1 581 ? 57.649  163.370 62.369  1.00 22.75 ? 581  ASN A CB    1 
ATOM   4494  C CG    . ASN A 1 581 ? 56.856  164.612 62.102  1.00 24.96 ? 581  ASN A CG    1 
ATOM   4495  O OD1   . ASN A 1 581 ? 55.883  164.578 61.351  1.00 26.69 ? 581  ASN A OD1   1 
ATOM   4496  N ND2   . ASN A 1 581 ? 57.249  165.719 62.723  1.00 25.78 ? 581  ASN A ND2   1 
ATOM   4497  N N     . TRP A 1 582 ? 58.209  160.181 62.504  1.00 21.10 ? 582  TRP A N     1 
ATOM   4498  C CA    . TRP A 1 582 ? 59.102  159.055 62.237  1.00 21.18 ? 582  TRP A CA    1 
ATOM   4499  C C     . TRP A 1 582 ? 58.519  158.137 61.159  1.00 20.98 ? 582  TRP A C     1 
ATOM   4500  O O     . TRP A 1 582 ? 59.246  157.659 60.303  1.00 21.71 ? 582  TRP A O     1 
ATOM   4501  C CB    . TRP A 1 582 ? 59.391  158.273 63.522  1.00 20.70 ? 582  TRP A CB    1 
ATOM   4502  C CG    . TRP A 1 582 ? 60.303  157.120 63.350  1.00 20.51 ? 582  TRP A CG    1 
ATOM   4503  C CD1   . TRP A 1 582 ? 59.944  155.821 63.186  1.00 20.52 ? 582  TRP A CD1   1 
ATOM   4504  C CD2   . TRP A 1 582 ? 61.739  157.151 63.331  1.00 20.94 ? 582  TRP A CD2   1 
ATOM   4505  N NE1   . TRP A 1 582 ? 61.060  155.029 63.061  1.00 19.27 ? 582  TRP A NE1   1 
ATOM   4506  C CE2   . TRP A 1 582 ? 62.179  155.816 63.158  1.00 19.97 ? 582  TRP A CE2   1 
ATOM   4507  C CE3   . TRP A 1 582 ? 62.699  158.180 63.444  1.00 21.29 ? 582  TRP A CE3   1 
ATOM   4508  C CZ2   . TRP A 1 582 ? 63.541  155.470 63.093  1.00 19.37 ? 582  TRP A CZ2   1 
ATOM   4509  C CZ3   . TRP A 1 582 ? 64.051  157.843 63.390  1.00 21.63 ? 582  TRP A CZ3   1 
ATOM   4510  C CH2   . TRP A 1 582 ? 64.461  156.485 63.212  1.00 20.86 ? 582  TRP A CH2   1 
ATOM   4511  N N     . VAL A 1 583 ? 57.216  157.898 61.173  1.00 20.85 ? 583  VAL A N     1 
ATOM   4512  C CA    . VAL A 1 583 ? 56.613  157.056 60.129  1.00 21.18 ? 583  VAL A CA    1 
ATOM   4513  C C     . VAL A 1 583 ? 56.593  157.783 58.801  1.00 21.43 ? 583  VAL A C     1 
ATOM   4514  O O     . VAL A 1 583 ? 56.820  157.178 57.754  1.00 22.21 ? 583  VAL A O     1 
ATOM   4515  C CB    . VAL A 1 583 ? 55.187  156.582 60.488  1.00 22.00 ? 583  VAL A CB    1 
ATOM   4516  C CG1   . VAL A 1 583 ? 54.559  155.802 59.313  1.00 21.71 ? 583  VAL A CG1   1 
ATOM   4517  C CG2   . VAL A 1 583 ? 55.196  155.705 61.763  1.00 20.40 ? 583  VAL A CG2   1 
ATOM   4518  N N     . ARG A 1 584 ? 56.337  159.084 58.842  1.00 21.43 ? 584  ARG A N     1 
ATOM   4519  C CA    . ARG A 1 584 ? 56.400  159.924 57.647  1.00 21.76 ? 584  ARG A CA    1 
ATOM   4520  C C     . ARG A 1 584 ? 57.794  159.866 57.011  1.00 21.90 ? 584  ARG A C     1 
ATOM   4521  O O     . ARG A 1 584 ? 57.927  159.881 55.793  1.00 22.66 ? 584  ARG A O     1 
ATOM   4522  C CB    . ARG A 1 584 ? 56.057  161.367 58.009  1.00 21.70 ? 584  ARG A CB    1 
ATOM   4523  C CG    . ARG A 1 584 ? 55.831  162.277 56.801  1.00 24.16 ? 584  ARG A CG    1 
ATOM   4524  C CD    . ARG A 1 584 ? 55.756  163.741 57.224  1.00 28.51 ? 584  ARG A CD    1 
ATOM   4525  N NE    . ARG A 1 584 ? 55.028  164.555 56.250  1.00 32.06 ? 584  ARG A NE    1 
ATOM   4526  C CZ    . ARG A 1 584 ? 55.522  164.932 55.078  1.00 33.53 ? 584  ARG A CZ    1 
ATOM   4527  N NH1   . ARG A 1 584 ? 56.751  164.561 54.728  1.00 35.81 ? 584  ARG A NH1   1 
ATOM   4528  N NH2   . ARG A 1 584 ? 54.788  165.665 54.251  1.00 32.71 ? 584  ARG A NH2   1 
ATOM   4529  N N     . LYS A 1 585 ? 58.825  159.796 57.846  1.00 21.19 ? 585  LYS A N     1 
ATOM   4530  C CA    . LYS A 1 585 ? 60.209  159.749 57.386  1.00 21.37 ? 585  LYS A CA    1 
ATOM   4531  C C     . LYS A 1 585 ? 60.574  158.346 56.842  1.00 20.67 ? 585  LYS A C     1 
ATOM   4532  O O     . LYS A 1 585 ? 61.265  158.216 55.838  1.00 20.19 ? 585  LYS A O     1 
ATOM   4533  C CB    . LYS A 1 585 ? 61.134  160.147 58.546  1.00 20.98 ? 585  LYS A CB    1 
ATOM   4534  C CG    . LYS A 1 585 ? 62.614  159.957 58.281  1.00 23.33 ? 585  LYS A CG    1 
ATOM   4535  N N     . GLU A 1 586 ? 60.088  157.312 57.516  1.00 19.50 ? 586  GLU A N     1 
ATOM   4536  C CA    . GLU A 1 586 ? 60.366  155.932 57.139  1.00 19.79 ? 586  GLU A CA    1 
ATOM   4537  C C     . GLU A 1 586 ? 59.679  155.535 55.834  1.00 19.56 ? 586  GLU A C     1 
ATOM   4538  O O     . GLU A 1 586 ? 60.306  154.929 54.965  1.00 19.47 ? 586  GLU A O     1 
ATOM   4539  C CB    . GLU A 1 586 ? 59.994  154.992 58.284  1.00 19.27 ? 586  GLU A CB    1 
ATOM   4540  C CG    . GLU A 1 586 ? 60.885  155.171 59.531  1.00 21.39 ? 586  GLU A CG    1 
ATOM   4541  C CD    . GLU A 1 586 ? 62.353  154.922 59.237  1.00 26.57 ? 586  GLU A CD    1 
ATOM   4542  O OE1   . GLU A 1 586 ? 62.784  153.762 59.346  1.00 27.38 ? 586  GLU A OE1   1 
ATOM   4543  O OE2   . GLU A 1 586 ? 63.067  155.882 58.856  1.00 29.35 ? 586  GLU A OE2   1 
ATOM   4544  N N     . ILE A 1 587 ? 58.417  155.937 55.684  1.00 19.19 ? 587  ILE A N     1 
ATOM   4545  C CA    . ILE A 1 587 ? 57.593  155.518 54.558  1.00 18.65 ? 587  ILE A CA    1 
ATOM   4546  C C     . ILE A 1 587 ? 57.067  156.693 53.716  1.00 18.70 ? 587  ILE A C     1 
ATOM   4547  O O     . ILE A 1 587 ? 57.339  156.790 52.519  1.00 19.01 ? 587  ILE A O     1 
ATOM   4548  C CB    . ILE A 1 587 ? 56.439  154.585 55.039  1.00 18.44 ? 587  ILE A CB    1 
ATOM   4549  C CG1   . ILE A 1 587 ? 57.016  153.350 55.779  1.00 18.50 ? 587  ILE A CG1   1 
ATOM   4550  C CG2   . ILE A 1 587 ? 55.577  154.153 53.837  1.00 16.54 ? 587  ILE A CG2   1 
ATOM   4551  C CD1   . ILE A 1 587 ? 55.948  152.497 56.552  1.00 18.62 ? 587  ILE A CD1   1 
ATOM   4552  N N     . GLY A 1 588 ? 56.332  157.590 54.360  1.00 19.01 ? 588  GLY A N     1 
ATOM   4553  C CA    . GLY A 1 588 ? 55.792  158.790 53.742  1.00 18.54 ? 588  GLY A CA    1 
ATOM   4554  C C     . GLY A 1 588 ? 54.495  159.149 54.486  1.00 19.59 ? 588  GLY A C     1 
ATOM   4555  O O     . GLY A 1 588 ? 54.006  158.344 55.283  1.00 17.93 ? 588  GLY A O     1 
ATOM   4556  N N     . PRO A 1 589 ? 53.939  160.351 54.227  1.00 20.51 ? 589  PRO A N     1 
ATOM   4557  C CA    . PRO A 1 589 ? 52.706  160.828 54.887  1.00 22.03 ? 589  PRO A CA    1 
ATOM   4558  C C     . PRO A 1 589 ? 51.495  159.901 54.742  1.00 23.31 ? 589  PRO A C     1 
ATOM   4559  O O     . PRO A 1 589 ? 50.691  159.808 55.686  1.00 23.97 ? 589  PRO A O     1 
ATOM   4560  C CB    . PRO A 1 589 ? 52.432  162.185 54.232  1.00 22.42 ? 589  PRO A CB    1 
ATOM   4561  C CG    . PRO A 1 589 ? 53.323  162.241 53.003  1.00 22.64 ? 589  PRO A CG    1 
ATOM   4562  C CD    . PRO A 1 589 ? 54.493  161.334 53.284  1.00 20.06 ? 589  PRO A CD    1 
ATOM   4563  N N     . LEU A 1 590 ? 51.384  159.180 53.616  1.00 23.91 ? 590  LEU A N     1 
ATOM   4564  C CA    . LEU A 1 590 ? 50.306  158.191 53.438  1.00 25.06 ? 590  LEU A CA    1 
ATOM   4565  C C     . LEU A 1 590 ? 50.252  157.087 54.512  1.00 25.79 ? 590  LEU A C     1 
ATOM   4566  O O     . LEU A 1 590 ? 49.186  156.506 54.764  1.00 27.07 ? 590  LEU A O     1 
ATOM   4567  C CB    . LEU A 1 590 ? 50.356  157.559 52.038  1.00 25.22 ? 590  LEU A CB    1 
ATOM   4568  N N     . ALA A 1 591 ? 51.382  156.798 55.143  1.00 25.66 ? 591  ALA A N     1 
ATOM   4569  C CA    . ALA A 1 591 ? 51.456  155.705 56.100  1.00 26.62 ? 591  ALA A CA    1 
ATOM   4570  C C     . ALA A 1 591 ? 51.414  156.162 57.551  1.00 27.13 ? 591  ALA A C     1 
ATOM   4571  O O     . ALA A 1 591 ? 51.537  155.344 58.458  1.00 27.62 ? 591  ALA A O     1 
ATOM   4572  C CB    . ALA A 1 591 ? 52.709  154.862 55.849  1.00 26.16 ? 591  ALA A CB    1 
ATOM   4573  N N     . THR A 1 592 ? 51.259  157.462 57.774  1.00 27.55 ? 592  THR A N     1 
ATOM   4574  C CA    . THR A 1 592 ? 51.268  158.014 59.125  1.00 28.71 ? 592  THR A CA    1 
ATOM   4575  C C     . THR A 1 592 ? 50.029  157.597 59.941  1.00 28.15 ? 592  THR A C     1 
ATOM   4576  O O     . THR A 1 592 ? 48.895  157.754 59.491  1.00 27.63 ? 592  THR A O     1 
ATOM   4577  C CB    . THR A 1 592 ? 51.441  159.543 59.101  1.00 28.88 ? 592  THR A CB    1 
ATOM   4578  O OG1   . THR A 1 592 ? 52.620  159.856 58.351  1.00 32.81 ? 592  THR A OG1   1 
ATOM   4579  C CG2   . THR A 1 592 ? 51.647  160.083 60.488  1.00 31.19 ? 592  THR A CG2   1 
ATOM   4580  N N     . PRO A 1 593 ? 50.256  157.032 61.141  1.00 27.96 ? 593  PRO A N     1 
ATOM   4581  C CA    . PRO A 1 593 ? 49.115  156.696 61.974  1.00 27.46 ? 593  PRO A CA    1 
ATOM   4582  C C     . PRO A 1 593 ? 48.249  157.920 62.212  1.00 27.40 ? 593  PRO A C     1 
ATOM   4583  O O     . PRO A 1 593 ? 48.761  159.009 62.472  1.00 27.08 ? 593  PRO A O     1 
ATOM   4584  C CB    . PRO A 1 593 ? 49.749  156.204 63.282  1.00 26.96 ? 593  PRO A CB    1 
ATOM   4585  C CG    . PRO A 1 593 ? 51.099  155.738 62.892  1.00 27.31 ? 593  PRO A CG    1 
ATOM   4586  C CD    . PRO A 1 593 ? 51.535  156.629 61.758  1.00 28.12 ? 593  PRO A CD    1 
ATOM   4587  N N     . ASP A 1 594 ? 46.945  157.720 62.100  1.00 26.89 ? 594  ASP A N     1 
ATOM   4588  C CA    . ASP A 1 594 ? 45.975  158.715 62.509  1.00 27.53 ? 594  ASP A CA    1 
ATOM   4589  C C     . ASP A 1 594 ? 45.781  158.706 64.025  1.00 26.71 ? 594  ASP A C     1 
ATOM   4590  O O     . ASP A 1 594 ? 45.456  159.726 64.609  1.00 26.91 ? 594  ASP A O     1 
ATOM   4591  C CB    . ASP A 1 594 ? 44.667  158.465 61.778  1.00 27.78 ? 594  ASP A CB    1 
ATOM   4592  C CG    . ASP A 1 594 ? 44.844  158.564 60.280  1.00 29.39 ? 594  ASP A CG    1 
ATOM   4593  O OD1   . ASP A 1 594 ? 45.013  159.707 59.813  1.00 28.96 ? 594  ASP A OD1   1 
ATOM   4594  O OD2   . ASP A 1 594 ? 44.883  157.510 59.584  1.00 31.60 ? 594  ASP A OD2   1 
ATOM   4595  N N     . VAL A 1 595 ? 45.987  157.551 64.647  1.00 25.94 ? 595  VAL A N     1 
ATOM   4596  C CA    . VAL A 1 595 ? 45.891  157.408 66.098  1.00 25.66 ? 595  VAL A CA    1 
ATOM   4597  C C     . VAL A 1 595 ? 47.133  156.692 66.631  1.00 25.32 ? 595  VAL A C     1 
ATOM   4598  O O     . VAL A 1 595 ? 47.521  155.655 66.086  1.00 25.40 ? 595  VAL A O     1 
ATOM   4599  C CB    . VAL A 1 595 ? 44.668  156.542 66.517  1.00 26.15 ? 595  VAL A CB    1 
ATOM   4600  C CG1   . VAL A 1 595 ? 44.585  156.412 68.061  1.00 25.62 ? 595  VAL A CG1   1 
ATOM   4601  C CG2   . VAL A 1 595 ? 43.349  157.076 65.931  1.00 25.98 ? 595  VAL A CG2   1 
ATOM   4602  N N     . LEU A 1 596 ? 47.740  157.239 67.687  1.00 24.72 ? 596  LEU A N     1 
ATOM   4603  C CA    . LEU A 1 596 ? 48.704  156.511 68.495  1.00 24.64 ? 596  LEU A CA    1 
ATOM   4604  C C     . LEU A 1 596 ? 48.116  156.163 69.852  1.00 24.93 ? 596  LEU A C     1 
ATOM   4605  O O     . LEU A 1 596 ? 47.787  157.039 70.646  1.00 24.94 ? 596  LEU A O     1 
ATOM   4606  C CB    . LEU A 1 596 ? 50.029  157.280 68.662  1.00 24.24 ? 596  LEU A CB    1 
ATOM   4607  C CG    . LEU A 1 596 ? 50.744  157.694 67.376  1.00 25.14 ? 596  LEU A CG    1 
ATOM   4608  C CD1   . LEU A 1 596 ? 51.954  158.606 67.666  1.00 23.53 ? 596  LEU A CD1   1 
ATOM   4609  C CD2   . LEU A 1 596 ? 51.152  156.446 66.573  1.00 24.53 ? 596  LEU A CD2   1 
ATOM   4610  N N     . HIS A 1 597 ? 48.012  154.862 70.118  1.00 25.19 ? 597  HIS A N     1 
ATOM   4611  C CA    . HIS A 1 597 ? 47.502  154.364 71.368  1.00 24.29 ? 597  HIS A CA    1 
ATOM   4612  C C     . HIS A 1 597 ? 48.689  153.762 72.095  1.00 23.96 ? 597  HIS A C     1 
ATOM   4613  O O     . HIS A 1 597 ? 49.207  152.711 71.687  1.00 23.88 ? 597  HIS A O     1 
ATOM   4614  C CB    . HIS A 1 597 ? 46.437  153.316 71.060  1.00 24.92 ? 597  HIS A CB    1 
ATOM   4615  C CG    . HIS A 1 597 ? 45.918  152.575 72.255  1.00 25.57 ? 597  HIS A CG    1 
ATOM   4616  N ND1   . HIS A 1 597 ? 44.611  152.142 72.341  1.00 27.74 ? 597  HIS A ND1   1 
ATOM   4617  C CD2   . HIS A 1 597 ? 46.523  152.169 73.395  1.00 26.19 ? 597  HIS A CD2   1 
ATOM   4618  C CE1   . HIS A 1 597 ? 44.433  151.506 73.484  1.00 26.88 ? 597  HIS A CE1   1 
ATOM   4619  N NE2   . HIS A 1 597 ? 45.580  151.503 74.139  1.00 26.61 ? 597  HIS A NE2   1 
ATOM   4620  N N     . TRP A 1 598 ? 49.128  154.430 73.160  1.00 23.72 ? 598  TRP A N     1 
ATOM   4621  C CA    . TRP A 1 598 ? 50.282  153.980 73.962  1.00 24.50 ? 598  TRP A CA    1 
ATOM   4622  C C     . TRP A 1 598 ? 49.866  152.897 74.931  1.00 24.29 ? 598  TRP A C     1 
ATOM   4623  O O     . TRP A 1 598 ? 48.914  153.071 75.677  1.00 24.71 ? 598  TRP A O     1 
ATOM   4624  C CB    . TRP A 1 598 ? 50.880  155.108 74.784  1.00 24.62 ? 598  TRP A CB    1 
ATOM   4625  C CG    . TRP A 1 598 ? 51.129  156.359 74.058  1.00 24.48 ? 598  TRP A CG    1 
ATOM   4626  C CD1   . TRP A 1 598 ? 50.431  157.531 74.179  1.00 24.92 ? 598  TRP A CD1   1 
ATOM   4627  C CD2   . TRP A 1 598 ? 52.160  156.592 73.103  1.00 24.52 ? 598  TRP A CD2   1 
ATOM   4628  N NE1   . TRP A 1 598 ? 50.961  158.477 73.343  1.00 26.79 ? 598  TRP A NE1   1 
ATOM   4629  C CE2   . TRP A 1 598 ? 52.033  157.930 72.676  1.00 26.45 ? 598  TRP A CE2   1 
ATOM   4630  C CE3   . TRP A 1 598 ? 53.183  155.799 72.562  1.00 24.32 ? 598  TRP A CE3   1 
ATOM   4631  C CZ2   . TRP A 1 598 ? 52.899  158.501 71.722  1.00 26.33 ? 598  TRP A CZ2   1 
ATOM   4632  C CZ3   . TRP A 1 598 ? 54.045  156.365 71.614  1.00 25.12 ? 598  TRP A CZ3   1 
ATOM   4633  C CH2   . TRP A 1 598 ? 53.891  157.699 71.206  1.00 25.96 ? 598  TRP A CH2   1 
ATOM   4634  N N     . THR A 1 599 ? 50.597  151.794 74.938  1.00 24.95 ? 599  THR A N     1 
ATOM   4635  C CA    . THR A 1 599 ? 50.209  150.632 75.744  1.00 25.77 ? 599  THR A CA    1 
ATOM   4636  C C     . THR A 1 599 ? 51.385  149.754 76.176  1.00 26.83 ? 599  THR A C     1 
ATOM   4637  O O     . THR A 1 599 ? 52.392  149.645 75.476  1.00 26.51 ? 599  THR A O     1 
ATOM   4638  C CB    . THR A 1 599 ? 49.113  149.764 74.993  1.00 25.61 ? 599  THR A CB    1 
ATOM   4639  O OG1   . THR A 1 599 ? 48.529  148.803 75.889  1.00 25.36 ? 599  THR A OG1   1 
ATOM   4640  C CG2   . THR A 1 599 ? 49.671  149.072 73.737  1.00 24.52 ? 599  THR A CG2   1 
ATOM   4641  N N     . ASP A 1 600 ? 51.250  149.120 77.334  1.00 28.37 ? 600  ASP A N     1 
ATOM   4642  C CA    . ASP A 1 600 ? 52.138  148.007 77.687  1.00 29.96 ? 600  ASP A CA    1 
ATOM   4643  C C     . ASP A 1 600 ? 51.395  146.672 77.584  1.00 29.89 ? 600  ASP A C     1 
ATOM   4644  O O     . ASP A 1 600 ? 51.828  145.651 78.111  1.00 30.50 ? 600  ASP A O     1 
ATOM   4645  C CB    . ASP A 1 600 ? 52.724  148.247 79.074  1.00 30.38 ? 600  ASP A CB    1 
ATOM   4646  C CG    . ASP A 1 600 ? 53.540  149.525 79.127  1.00 33.91 ? 600  ASP A CG    1 
ATOM   4647  O OD1   . ASP A 1 600 ? 54.494  149.649 78.312  1.00 36.33 ? 600  ASP A OD1   1 
ATOM   4648  O OD2   . ASP A 1 600 ? 53.222  150.411 79.964  1.00 36.84 ? 600  ASP A OD2   1 
ATOM   4649  N N     . SER A 1 601 ? 50.280  146.675 76.869  1.00 30.14 ? 601  SER A N     1 
ATOM   4650  C CA    . SER A 1 601 ? 49.374  145.530 76.917  1.00 30.34 ? 601  SER A CA    1 
ATOM   4651  C C     . SER A 1 601 ? 49.033  144.939 75.561  1.00 30.22 ? 601  SER A C     1 
ATOM   4652  O O     . SER A 1 601 ? 47.872  144.598 75.301  1.00 30.54 ? 601  SER A O     1 
ATOM   4653  C CB    . SER A 1 601 ? 48.100  145.914 77.676  1.00 30.28 ? 601  SER A CB    1 
ATOM   4654  O OG    . SER A 1 601 ? 48.405  146.186 79.031  1.00 30.25 ? 601  SER A OG    1 
ATOM   4655  N N     . LEU A 1 602 ? 50.030  144.803 74.689  1.00 29.99 ? 602  LEU A N     1 
ATOM   4656  C CA    . LEU A 1 602 ? 49.797  144.098 73.424  1.00 29.66 ? 602  LEU A CA    1 
ATOM   4657  C C     . LEU A 1 602 ? 49.370  142.650 73.700  1.00 30.17 ? 602  LEU A C     1 
ATOM   4658  O O     . LEU A 1 602 ? 50.049  141.942 74.452  1.00 29.98 ? 602  LEU A O     1 
ATOM   4659  C CB    . LEU A 1 602 ? 51.036  144.146 72.525  1.00 29.56 ? 602  LEU A CB    1 
ATOM   4660  C CG    . LEU A 1 602 ? 51.376  145.539 71.979  1.00 27.08 ? 602  LEU A CG    1 
ATOM   4661  C CD1   . LEU A 1 602 ? 52.615  145.466 71.143  1.00 25.96 ? 602  LEU A CD1   1 
ATOM   4662  C CD2   . LEU A 1 602 ? 50.205  146.086 71.173  1.00 26.13 ? 602  LEU A CD2   1 
ATOM   4663  N N     . PRO A 1 603 ? 48.224  142.216 73.127  1.00 30.57 ? 603  PRO A N     1 
ATOM   4664  C CA    . PRO A 1 603 ? 47.807  140.821 73.291  1.00 30.80 ? 603  PRO A CA    1 
ATOM   4665  C C     . PRO A 1 603 ? 48.696  139.888 72.473  1.00 31.40 ? 603  PRO A C     1 
ATOM   4666  O O     . PRO A 1 603 ? 49.011  140.179 71.314  1.00 31.31 ? 603  PRO A O     1 
ATOM   4667  C CB    . PRO A 1 603 ? 46.375  140.818 72.758  1.00 31.05 ? 603  PRO A CB    1 
ATOM   4668  C CG    . PRO A 1 603 ? 46.309  141.941 71.825  1.00 30.18 ? 603  PRO A CG    1 
ATOM   4669  C CD    . PRO A 1 603 ? 47.262  142.981 72.315  1.00 30.58 ? 603  PRO A CD    1 
ATOM   4670  N N     . LYS A 1 604 ? 49.128  138.798 73.096  1.00 31.66 ? 604  LYS A N     1 
ATOM   4671  C CA    . LYS A 1 604 ? 50.038  137.863 72.466  1.00 32.21 ? 604  LYS A CA    1 
ATOM   4672  C C     . LYS A 1 604 ? 49.595  136.447 72.784  1.00 32.13 ? 604  LYS A C     1 
ATOM   4673  O O     . LYS A 1 604 ? 48.968  136.207 73.817  1.00 32.08 ? 604  LYS A O     1 
ATOM   4674  C CB    . LYS A 1 604 ? 51.467  138.094 72.970  1.00 32.48 ? 604  LYS A CB    1 
ATOM   4675  C CG    . LYS A 1 604 ? 52.130  139.358 72.420  1.00 34.48 ? 604  LYS A CG    1 
ATOM   4676  C CD    . LYS A 1 604 ? 53.463  139.589 73.094  1.00 38.23 ? 604  LYS A CD    1 
ATOM   4677  C CE    . LYS A 1 604 ? 54.284  140.639 72.367  1.00 39.76 ? 604  LYS A CE    1 
ATOM   4678  N NZ    . LYS A 1 604 ? 55.680  140.719 72.946  1.00 42.58 ? 604  LYS A NZ    1 
ATOM   4679  N N     . THR A 1 605 ? 49.896  135.522 71.873  1.00 32.18 ? 605  THR A N     1 
ATOM   4680  C CA    . THR A 1 605 ? 49.710  134.094 72.107  1.00 31.84 ? 605  THR A CA    1 
ATOM   4681  C C     . THR A 1 605 ? 50.889  133.650 72.957  1.00 31.81 ? 605  THR A C     1 
ATOM   4682  O O     . THR A 1 605 ? 51.870  134.382 73.093  1.00 31.20 ? 605  THR A O     1 
ATOM   4683  C CB    . THR A 1 605 ? 49.731  133.292 70.792  1.00 31.87 ? 605  THR A CB    1 
ATOM   4684  O OG1   . THR A 1 605 ? 51.055  133.321 70.241  1.00 32.17 ? 605  THR A OG1   1 
ATOM   4685  C CG2   . THR A 1 605 ? 48.735  133.856 69.773  1.00 31.31 ? 605  THR A CG2   1 
ATOM   4686  N N     . ARG A 1 606 ? 50.810  132.448 73.517  1.00 32.13 ? 606  ARG A N     1 
ATOM   4687  C CA    . ARG A 1 606 ? 51.869  131.942 74.382  1.00 32.59 ? 606  ARG A CA    1 
ATOM   4688  C C     . ARG A 1 606 ? 53.245  131.784 73.700  1.00 32.89 ? 606  ARG A C     1 
ATOM   4689  O O     . ARG A 1 606 ? 54.282  131.831 74.367  1.00 32.01 ? 606  ARG A O     1 
ATOM   4690  C CB    . ARG A 1 606 ? 51.402  130.656 75.051  1.00 32.96 ? 606  ARG A CB    1 
ATOM   4691  C CG    . ARG A 1 606 ? 50.384  130.916 76.140  1.00 34.00 ? 606  ARG A CG    1 
ATOM   4692  C CD    . ARG A 1 606 ? 49.984  129.648 76.850  1.00 37.67 ? 606  ARG A CD    1 
ATOM   4693  N NE    . ARG A 1 606 ? 49.143  129.940 78.011  1.00 39.79 ? 606  ARG A NE    1 
ATOM   4694  C CZ    . ARG A 1 606 ? 47.840  130.214 77.945  1.00 41.50 ? 606  ARG A CZ    1 
ATOM   4695  N NH1   . ARG A 1 606 ? 47.218  130.236 76.771  1.00 40.88 ? 606  ARG A NH1   1 
ATOM   4696  N NH2   . ARG A 1 606 ? 47.153  130.461 79.058  1.00 43.21 ? 606  ARG A NH2   1 
ATOM   4697  N N     . SER A 1 607 ? 53.245  131.635 72.373  1.00 33.71 ? 607  SER A N     1 
ATOM   4698  C CA    . SER A 1 607 ? 54.489  131.573 71.583  1.00 34.86 ? 607  SER A CA    1 
ATOM   4699  C C     . SER A 1 607 ? 55.039  132.966 71.244  1.00 35.34 ? 607  SER A C     1 
ATOM   4700  O O     . SER A 1 607 ? 56.126  133.095 70.665  1.00 35.59 ? 607  SER A O     1 
ATOM   4701  C CB    . SER A 1 607 ? 54.297  130.736 70.309  1.00 35.00 ? 607  SER A CB    1 
ATOM   4702  O OG    . SER A 1 607 ? 53.801  131.531 69.235  1.00 36.86 ? 607  SER A OG    1 
ATOM   4703  N N     . GLY A 1 608 ? 54.280  133.999 71.601  1.00 35.68 ? 608  GLY A N     1 
ATOM   4704  C CA    . GLY A 1 608 ? 54.761  135.372 71.566  1.00 35.97 ? 608  GLY A CA    1 
ATOM   4705  C C     . GLY A 1 608 ? 54.233  136.153 70.388  1.00 36.50 ? 608  GLY A C     1 
ATOM   4706  O O     . GLY A 1 608 ? 54.686  137.274 70.132  1.00 36.14 ? 608  GLY A O     1 
ATOM   4707  N N     . LYS A 1 609 ? 53.270  135.565 69.677  1.00 36.95 ? 609  LYS A N     1 
ATOM   4708  C CA    . LYS A 1 609 ? 52.748  136.144 68.440  1.00 37.76 ? 609  LYS A CA    1 
ATOM   4709  C C     . LYS A 1 609 ? 51.603  137.116 68.719  1.00 38.16 ? 609  LYS A C     1 
ATOM   4710  O O     . LYS A 1 609 ? 50.601  136.747 69.338  1.00 38.33 ? 609  LYS A O     1 
ATOM   4711  C CB    . LYS A 1 609 ? 52.298  135.038 67.474  1.00 37.54 ? 609  LYS A CB    1 
ATOM   4712  N N     . ILE A 1 610 ? 51.750  138.356 68.261  1.00 38.79 ? 610  ILE A N     1 
ATOM   4713  C CA    . ILE A 1 610 ? 50.715  139.369 68.495  1.00 39.68 ? 610  ILE A CA    1 
ATOM   4714  C C     . ILE A 1 610 ? 49.428  139.019 67.739  1.00 39.84 ? 610  ILE A C     1 
ATOM   4715  O O     . ILE A 1 610 ? 49.454  138.758 66.530  1.00 40.36 ? 610  ILE A O     1 
ATOM   4716  C CB    . ILE A 1 610 ? 51.233  140.853 68.273  1.00 39.82 ? 610  ILE A CB    1 
ATOM   4717  C CG1   . ILE A 1 610 ? 50.291  141.895 68.897  1.00 39.79 ? 610  ILE A CG1   1 
ATOM   4718  C CG2   . ILE A 1 610 ? 51.560  141.146 66.812  1.00 40.83 ? 610  ILE A CG2   1 
ATOM   4719  C CD1   . ILE A 1 610 ? 48.980  142.109 68.157  1.00 38.48 ? 610  ILE A CD1   1 
ATOM   4720  N N     . MET A 1 611 ? 48.325  138.976 68.487  1.00 40.03 ? 611  MET A N     1 
ATOM   4721  C CA    . MET A 1 611 ? 47.005  138.613 67.977  1.00 40.06 ? 611  MET A CA    1 
ATOM   4722  C C     . MET A 1 611 ? 46.169  139.864 67.665  1.00 40.08 ? 611  MET A C     1 
ATOM   4723  O O     . MET A 1 611 ? 45.612  140.490 68.578  1.00 40.34 ? 611  MET A O     1 
ATOM   4724  C CB    . MET A 1 611 ? 46.291  137.715 68.995  1.00 40.28 ? 611  MET A CB    1 
ATOM   4725  N N     . ARG A 1 612 ? 46.077  140.207 66.374  1.00 39.51 ? 612  ARG A N     1 
ATOM   4726  C CA    . ARG A 1 612 ? 45.528  141.499 65.909  1.00 39.13 ? 612  ARG A CA    1 
ATOM   4727  C C     . ARG A 1 612 ? 44.017  141.606 65.796  1.00 38.07 ? 612  ARG A C     1 
ATOM   4728  O O     . ARG A 1 612 ? 43.491  142.719 65.692  1.00 37.74 ? 612  ARG A O     1 
ATOM   4729  C CB    . ARG A 1 612 ? 46.137  141.908 64.556  1.00 39.19 ? 612  ARG A CB    1 
ATOM   4730  C CG    . ARG A 1 612 ? 47.475  142.589 64.668  1.00 40.17 ? 612  ARG A CG    1 
ATOM   4731  C CD    . ARG A 1 612 ? 48.062  142.945 63.299  1.00 40.28 ? 612  ARG A CD    1 
ATOM   4732  N NE    . ARG A 1 612 ? 49.516  142.900 63.385  1.00 42.65 ? 612  ARG A NE    1 
ATOM   4733  C CZ    . ARG A 1 612 ? 50.244  141.815 63.137  1.00 45.41 ? 612  ARG A CZ    1 
ATOM   4734  N NH1   . ARG A 1 612 ? 49.662  140.685 62.737  1.00 45.73 ? 612  ARG A NH1   1 
ATOM   4735  N NH2   . ARG A 1 612 ? 51.565  141.862 63.268  1.00 46.38 ? 612  ARG A NH2   1 
ATOM   4736  N N     . ARG A 1 613 ? 43.336  140.464 65.787  1.00 37.22 ? 613  ARG A N     1 
ATOM   4737  C CA    . ARG A 1 613 ? 41.879  140.411 65.645  1.00 36.72 ? 613  ARG A CA    1 
ATOM   4738  C C     . ARG A 1 613 ? 41.184  141.255 66.710  1.00 36.05 ? 613  ARG A C     1 
ATOM   4739  O O     . ARG A 1 613 ? 40.297  142.067 66.408  1.00 35.98 ? 613  ARG A O     1 
ATOM   4740  C CB    . ARG A 1 613 ? 41.379  138.951 65.716  1.00 36.99 ? 613  ARG A CB    1 
ATOM   4741  N N     . ILE A 1 614 ? 41.607  141.052 67.954  1.00 35.27 ? 614  ILE A N     1 
ATOM   4742  C CA    . ILE A 1 614 ? 41.084  141.773 69.113  1.00 34.50 ? 614  ILE A CA    1 
ATOM   4743  C C     . ILE A 1 614 ? 41.454  143.271 69.095  1.00 33.49 ? 614  ILE A C     1 
ATOM   4744  O O     . ILE A 1 614 ? 40.633  144.127 69.444  1.00 33.28 ? 614  ILE A O     1 
ATOM   4745  C CB    . ILE A 1 614 ? 41.473  141.042 70.444  1.00 34.79 ? 614  ILE A CB    1 
ATOM   4746  C CG1   . ILE A 1 614 ? 40.679  141.576 71.636  1.00 35.98 ? 614  ILE A CG1   1 
ATOM   4747  C CG2   . ILE A 1 614 ? 42.982  141.049 70.701  1.00 35.16 ? 614  ILE A CG2   1 
ATOM   4748  C CD1   . ILE A 1 614 ? 39.605  140.608 72.135  1.00 36.05 ? 614  ILE A CD1   1 
ATOM   4749  N N     . LEU A 1 615 ? 42.667  143.588 68.649  1.00 32.13 ? 615  LEU A N     1 
ATOM   4750  C CA    . LEU A 1 615 ? 43.094  144.975 68.524  1.00 31.24 ? 615  LEU A CA    1 
ATOM   4751  C C     . LEU A 1 615 ? 42.216  145.713 67.504  1.00 31.13 ? 615  LEU A C     1 
ATOM   4752  O O     . LEU A 1 615 ? 41.806  146.852 67.718  1.00 30.56 ? 615  LEU A O     1 
ATOM   4753  C CB    . LEU A 1 615 ? 44.570  145.043 68.122  1.00 30.57 ? 615  LEU A CB    1 
ATOM   4754  C CG    . LEU A 1 615 ? 45.585  144.591 69.173  1.00 30.12 ? 615  LEU A CG    1 
ATOM   4755  C CD1   . LEU A 1 615 ? 46.968  144.720 68.613  1.00 28.08 ? 615  LEU A CD1   1 
ATOM   4756  C CD2   . LEU A 1 615 ? 45.459  145.411 70.447  1.00 28.22 ? 615  LEU A CD2   1 
ATOM   4757  N N     . ARG A 1 616 ? 41.936  145.018 66.408  1.00 31.43 ? 616  ARG A N     1 
ATOM   4758  C CA    . ARG A 1 616 ? 41.055  145.465 65.334  1.00 32.48 ? 616  ARG A CA    1 
ATOM   4759  C C     . ARG A 1 616 ? 39.685  145.813 65.909  1.00 31.30 ? 616  ARG A C     1 
ATOM   4760  O O     . ARG A 1 616 ? 39.181  146.893 65.673  1.00 31.53 ? 616  ARG A O     1 
ATOM   4761  C CB    . ARG A 1 616 ? 40.948  144.335 64.296  1.00 32.09 ? 616  ARG A CB    1 
ATOM   4762  C CG    . ARG A 1 616 ? 40.720  144.741 62.857  1.00 35.18 ? 616  ARG A CG    1 
ATOM   4763  C CD    . ARG A 1 616 ? 41.018  143.564 61.885  1.00 35.14 ? 616  ARG A CD    1 
ATOM   4764  N NE    . ARG A 1 616 ? 42.446  143.471 61.552  1.00 39.68 ? 616  ARG A NE    1 
ATOM   4765  C CZ    . ARG A 1 616 ? 43.195  142.368 61.627  1.00 41.57 ? 616  ARG A CZ    1 
ATOM   4766  N NH1   . ARG A 1 616 ? 42.665  141.210 62.008  1.00 41.14 ? 616  ARG A NH1   1 
ATOM   4767  N NH2   . ARG A 1 616 ? 44.490  142.425 61.296  1.00 42.79 ? 616  ARG A NH2   1 
ATOM   4768  N N     . LYS A 1 617 ? 39.107  144.904 66.688  1.00 30.96 ? 617  LYS A N     1 
ATOM   4769  C CA    . LYS A 1 617 ? 37.783  145.114 67.297  1.00 30.59 ? 617  LYS A CA    1 
ATOM   4770  C C     . LYS A 1 617 ? 37.739  146.269 68.318  1.00 30.01 ? 617  LYS A C     1 
ATOM   4771  O O     . LYS A 1 617 ? 36.866  147.135 68.254  1.00 29.11 ? 617  LYS A O     1 
ATOM   4772  C CB    . LYS A 1 617 ? 37.259  143.802 67.899  1.00 30.47 ? 617  LYS A CB    1 
ATOM   4773  N N     . ILE A 1 618 ? 38.695  146.292 69.239  1.00 30.38 ? 618  ILE A N     1 
ATOM   4774  C CA    . ILE A 1 618 ? 38.814  147.398 70.211  1.00 30.58 ? 618  ILE A CA    1 
ATOM   4775  C C     . ILE A 1 618 ? 38.997  148.772 69.522  1.00 30.81 ? 618  ILE A C     1 
ATOM   4776  O O     . ILE A 1 618 ? 38.326  149.733 69.857  1.00 30.59 ? 618  ILE A O     1 
ATOM   4777  C CB    . ILE A 1 618 ? 39.965  147.141 71.240  1.00 30.42 ? 618  ILE A CB    1 
ATOM   4778  C CG1   . ILE A 1 618 ? 39.696  145.858 72.041  1.00 30.58 ? 618  ILE A CG1   1 
ATOM   4779  C CG2   . ILE A 1 618 ? 40.151  148.345 72.186  1.00 30.50 ? 618  ILE A CG2   1 
ATOM   4780  C CD1   . ILE A 1 618 ? 40.929  145.284 72.754  1.00 29.73 ? 618  ILE A CD1   1 
ATOM   4781  N N     . ALA A 1 619 ? 39.900  148.854 68.552  1.00 31.56 ? 619  ALA A N     1 
ATOM   4782  C CA    . ALA A 1 619 ? 40.177  150.128 67.875  1.00 32.12 ? 619  ALA A CA    1 
ATOM   4783  C C     . ALA A 1 619 ? 38.948  150.694 67.165  1.00 32.66 ? 619  ALA A C     1 
ATOM   4784  O O     . ALA A 1 619 ? 38.734  151.908 67.166  1.00 32.67 ? 619  ALA A O     1 
ATOM   4785  C CB    . ALA A 1 619 ? 41.344  149.979 66.900  1.00 31.68 ? 619  ALA A CB    1 
ATOM   4786  N N     . ALA A 1 620 ? 38.163  149.800 66.558  1.00 33.57 ? 620  ALA A N     1 
ATOM   4787  C CA    . ALA A 1 620 ? 36.920  150.142 65.856  1.00 34.36 ? 620  ALA A CA    1 
ATOM   4788  C C     . ALA A 1 620 ? 35.773  150.511 66.799  1.00 34.92 ? 620  ALA A C     1 
ATOM   4789  O O     . ALA A 1 620 ? 34.859  151.235 66.410  1.00 35.37 ? 620  ALA A O     1 
ATOM   4790  C CB    . ALA A 1 620 ? 36.494  148.979 64.957  1.00 34.01 ? 620  ALA A CB    1 
ATOM   4791  N N     . GLY A 1 621 ? 35.818  149.999 68.027  1.00 35.88 ? 621  GLY A N     1 
ATOM   4792  C CA    . GLY A 1 621 ? 34.722  150.147 68.991  1.00 36.77 ? 621  GLY A CA    1 
ATOM   4793  C C     . GLY A 1 621 ? 33.922  148.860 69.183  1.00 37.34 ? 621  GLY A C     1 
ATOM   4794  O O     . GLY A 1 621 ? 33.402  148.609 70.270  1.00 37.54 ? 621  GLY A O     1 
ATOM   4795  N N     . ASP A 1 622 ? 33.818  148.055 68.119  1.00 38.00 ? 622  ASP A N     1 
ATOM   4796  C CA    . ASP A 1 622 ? 33.123  146.760 68.138  1.00 38.04 ? 622  ASP A CA    1 
ATOM   4797  C C     . ASP A 1 622 ? 33.819  145.741 69.044  1.00 38.27 ? 622  ASP A C     1 
ATOM   4798  O O     . ASP A 1 622 ? 33.640  145.748 70.266  1.00 38.02 ? 622  ASP A O     1 
ATOM   4799  C CB    . ASP A 1 622 ? 33.015  146.189 66.723  1.00 38.09 ? 622  ASP A CB    1 
ATOM   4800  N N     . ALA A 1 633 ? 48.346  134.642 76.319  1.00 34.84 ? 633  ALA A N     1 
ATOM   4801  C CA    . ALA A 1 633 ? 49.393  134.589 77.339  1.00 35.16 ? 633  ALA A CA    1 
ATOM   4802  C C     . ALA A 1 633 ? 48.983  135.321 78.617  1.00 35.34 ? 633  ALA A C     1 
ATOM   4803  O O     . ALA A 1 633 ? 49.174  134.806 79.722  1.00 35.37 ? 633  ALA A O     1 
ATOM   4804  N N     . ASP A 1 634 ? 48.426  136.521 78.459  1.00 35.40 ? 634  ASP A N     1 
ATOM   4805  C CA    . ASP A 1 634 ? 47.927  137.316 79.584  1.00 35.48 ? 634  ASP A CA    1 
ATOM   4806  C C     . ASP A 1 634 ? 46.575  137.947 79.222  1.00 35.57 ? 634  ASP A C     1 
ATOM   4807  O O     . ASP A 1 634 ? 46.525  139.035 78.622  1.00 35.24 ? 634  ASP A O     1 
ATOM   4808  C CB    . ASP A 1 634 ? 48.953  138.379 79.993  1.00 35.62 ? 634  ASP A CB    1 
ATOM   4809  C CG    . ASP A 1 634 ? 48.399  139.392 80.984  1.00 35.75 ? 634  ASP A CG    1 
ATOM   4810  O OD1   . ASP A 1 634 ? 47.310  139.167 81.556  1.00 36.09 ? 634  ASP A OD1   1 
ATOM   4811  O OD2   . ASP A 1 634 ? 49.066  140.427 81.187  1.00 36.54 ? 634  ASP A OD2   1 
ATOM   4812  N N     . PRO A 1 635 ? 45.471  137.255 79.577  1.00 35.48 ? 635  PRO A N     1 
ATOM   4813  C CA    . PRO A 1 635 ? 44.111  137.679 79.204  1.00 35.41 ? 635  PRO A CA    1 
ATOM   4814  C C     . PRO A 1 635 ? 43.710  139.021 79.821  1.00 35.12 ? 635  PRO A C     1 
ATOM   4815  O O     . PRO A 1 635 ? 42.783  139.671 79.333  1.00 34.70 ? 635  PRO A O     1 
ATOM   4816  C CB    . PRO A 1 635 ? 43.222  136.540 79.722  1.00 35.50 ? 635  PRO A CB    1 
ATOM   4817  C CG    . PRO A 1 635 ? 44.039  135.863 80.783  1.00 36.10 ? 635  PRO A CG    1 
ATOM   4818  C CD    . PRO A 1 635 ? 45.469  136.000 80.352  1.00 35.77 ? 635  PRO A CD    1 
ATOM   4819  N N     . GLY A 1 636 ? 44.423  139.427 80.872  1.00 34.87 ? 636  GLY A N     1 
ATOM   4820  C CA    . GLY A 1 636 ? 44.229  140.732 81.492  1.00 35.03 ? 636  GLY A CA    1 
ATOM   4821  C C     . GLY A 1 636 ? 44.450  141.919 80.563  1.00 35.04 ? 636  GLY A C     1 
ATOM   4822  O O     . GLY A 1 636 ? 43.981  143.023 80.855  1.00 35.10 ? 636  GLY A O     1 
ATOM   4823  N N     . VAL A 1 637 ? 45.137  141.709 79.437  1.00 34.97 ? 637  VAL A N     1 
ATOM   4824  C CA    . VAL A 1 637 ? 45.481  142.829 78.549  1.00 34.92 ? 637  VAL A CA    1 
ATOM   4825  C C     . VAL A 1 637 ? 44.252  143.489 77.916  1.00 35.15 ? 637  VAL A C     1 
ATOM   4826  O O     . VAL A 1 637 ? 44.254  144.702 77.699  1.00 34.70 ? 637  VAL A O     1 
ATOM   4827  C CB    . VAL A 1 637 ? 46.528  142.476 77.447  1.00 34.52 ? 637  VAL A CB    1 
ATOM   4828  C CG1   . VAL A 1 637 ? 47.876  142.066 78.066  1.00 34.54 ? 637  VAL A CG1   1 
ATOM   4829  C CG2   . VAL A 1 637 ? 46.000  141.421 76.500  1.00 35.10 ? 637  VAL A CG2   1 
ATOM   4830  N N     . VAL A 1 638 ? 43.212  142.692 77.645  1.00 35.62 ? 638  VAL A N     1 
ATOM   4831  C CA    . VAL A 1 638 ? 41.989  143.184 76.983  1.00 36.28 ? 638  VAL A CA    1 
ATOM   4832  C C     . VAL A 1 638 ? 41.287  144.260 77.824  1.00 36.66 ? 638  VAL A C     1 
ATOM   4833  O O     . VAL A 1 638 ? 40.840  145.284 77.292  1.00 36.23 ? 638  VAL A O     1 
ATOM   4834  C CB    . VAL A 1 638 ? 40.998  142.036 76.598  1.00 36.31 ? 638  VAL A CB    1 
ATOM   4835  C CG1   . VAL A 1 638 ? 39.780  142.597 75.869  1.00 36.08 ? 638  VAL A CG1   1 
ATOM   4836  C CG2   . VAL A 1 638 ? 41.681  141.002 75.711  1.00 36.04 ? 638  VAL A CG2   1 
ATOM   4837  N N     . GLU A 1 639 ? 41.234  144.043 79.136  1.00 37.38 ? 639  GLU A N     1 
ATOM   4838  C CA    . GLU A 1 639 ? 40.654  145.034 80.045  1.00 38.39 ? 639  GLU A CA    1 
ATOM   4839  C C     . GLU A 1 639 ? 41.440  146.349 80.076  1.00 38.14 ? 639  GLU A C     1 
ATOM   4840  O O     . GLU A 1 639 ? 40.849  147.428 79.936  1.00 38.21 ? 639  GLU A O     1 
ATOM   4841  C CB    . GLU A 1 639 ? 40.462  144.463 81.457  1.00 39.03 ? 639  GLU A CB    1 
ATOM   4842  C CG    . GLU A 1 639 ? 39.683  145.388 82.398  1.00 41.64 ? 639  GLU A CG    1 
ATOM   4843  C CD    . GLU A 1 639 ? 38.411  145.970 81.760  1.00 44.95 ? 639  GLU A CD    1 
ATOM   4844  O OE1   . GLU A 1 639 ? 37.722  145.251 80.990  1.00 46.07 ? 639  GLU A OE1   1 
ATOM   4845  O OE2   . GLU A 1 639 ? 38.105  147.153 82.034  1.00 45.75 ? 639  GLU A OE2   1 
ATOM   4846  N N     . LYS A 1 640 ? 42.760  146.262 80.241  1.00 37.78 ? 640  LYS A N     1 
ATOM   4847  C CA    . LYS A 1 640 ? 43.601  147.449 80.152  1.00 37.62 ? 640  LYS A CA    1 
ATOM   4848  C C     . LYS A 1 640 ? 43.387  148.175 78.814  1.00 37.69 ? 640  LYS A C     1 
ATOM   4849  O O     . LYS A 1 640 ? 43.192  149.394 78.805  1.00 37.47 ? 640  LYS A O     1 
ATOM   4850  C CB    . LYS A 1 640 ? 45.080  147.115 80.400  1.00 37.44 ? 640  LYS A CB    1 
ATOM   4851  N N     . LEU A 1 641 ? 43.399  147.418 77.708  1.00 37.77 ? 641  LEU A N     1 
ATOM   4852  C CA    . LEU A 1 641 ? 43.202  147.948 76.342  1.00 38.12 ? 641  LEU A CA    1 
ATOM   4853  C C     . LEU A 1 641 ? 41.863  148.671 76.152  1.00 38.65 ? 641  LEU A C     1 
ATOM   4854  O O     . LEU A 1 641 ? 41.799  149.702 75.469  1.00 38.72 ? 641  LEU A O     1 
ATOM   4855  C CB    . LEU A 1 641 ? 43.358  146.842 75.276  1.00 37.58 ? 641  LEU A CB    1 
ATOM   4856  C CG    . LEU A 1 641 ? 44.767  146.327 74.965  1.00 37.01 ? 641  LEU A CG    1 
ATOM   4857  C CD1   . LEU A 1 641 ? 44.717  144.934 74.366  1.00 36.78 ? 641  LEU A CD1   1 
ATOM   4858  C CD2   . LEU A 1 641 ? 45.528  147.285 74.053  1.00 36.64 ? 641  LEU A CD2   1 
ATOM   4859  N N     . LEU A 1 642 ? 40.811  148.124 76.759  1.00 39.41 ? 642  LEU A N     1 
ATOM   4860  C CA    . LEU A 1 642 ? 39.470  148.730 76.732  1.00 40.02 ? 642  LEU A CA    1 
ATOM   4861  C C     . LEU A 1 642 ? 39.415  150.123 77.369  1.00 40.05 ? 642  LEU A C     1 
ATOM   4862  O O     . LEU A 1 642 ? 38.884  151.049 76.759  1.00 40.02 ? 642  LEU A O     1 
ATOM   4863  C CB    . LEU A 1 642 ? 38.433  147.799 77.375  1.00 39.85 ? 642  LEU A CB    1 
ATOM   4864  C CG    . LEU A 1 642 ? 38.179  146.466 76.658  1.00 40.25 ? 642  LEU A CG    1 
ATOM   4865  C CD1   . LEU A 1 642 ? 37.434  145.484 77.572  1.00 40.68 ? 642  LEU A CD1   1 
ATOM   4866  C CD2   . LEU A 1 642 ? 37.445  146.647 75.327  1.00 40.68 ? 642  LEU A CD2   1 
ATOM   4867  N N     . GLU A 1 643 ? 39.969  150.268 78.576  1.00 40.44 ? 643  GLU A N     1 
ATOM   4868  C CA    . GLU A 1 643 ? 40.000  151.560 79.281  1.00 40.76 ? 643  GLU A CA    1 
ATOM   4869  C C     . GLU A 1 643 ? 40.916  152.597 78.602  1.00 41.26 ? 643  GLU A C     1 
ATOM   4870  O O     . GLU A 1 643 ? 40.569  153.786 78.524  1.00 41.35 ? 643  GLU A O     1 
ATOM   4871  C CB    . GLU A 1 643 ? 40.395  151.369 80.750  1.00 40.95 ? 643  GLU A CB    1 
ATOM   4872  N N     . GLU A 1 644 ? 42.074  152.144 78.115  1.00 41.56 ? 644  GLU A N     1 
ATOM   4873  C CA    . GLU A 1 644 ? 42.994  152.981 77.338  1.00 42.14 ? 644  GLU A CA    1 
ATOM   4874  C C     . GLU A 1 644 ? 42.331  153.568 76.088  1.00 42.60 ? 644  GLU A C     1 
ATOM   4875  O O     . GLU A 1 644 ? 42.522  154.743 75.768  1.00 42.44 ? 644  GLU A O     1 
ATOM   4876  C CB    . GLU A 1 644 ? 44.219  152.177 76.910  1.00 42.09 ? 644  GLU A CB    1 
ATOM   4877  C CG    . GLU A 1 644 ? 45.244  151.902 77.994  1.00 42.45 ? 644  GLU A CG    1 
ATOM   4878  C CD    . GLU A 1 644 ? 46.263  150.855 77.564  1.00 42.18 ? 644  GLU A CD    1 
ATOM   4879  O OE1   . GLU A 1 644 ? 46.126  150.302 76.452  1.00 42.82 ? 644  GLU A OE1   1 
ATOM   4880  O OE2   . GLU A 1 644 ? 47.196  150.571 78.338  1.00 41.32 ? 644  GLU A OE2   1 
ATOM   4881  N N     . LYS A 1 645 ? 41.568  152.735 75.379  1.00 43.42 ? 645  LYS A N     1 
ATOM   4882  C CA    . LYS A 1 645 ? 40.829  153.158 74.187  1.00 44.17 ? 645  LYS A CA    1 
ATOM   4883  C C     . LYS A 1 645 ? 39.774  154.215 74.520  1.00 44.72 ? 645  LYS A C     1 
ATOM   4884  O O     . LYS A 1 645 ? 39.644  155.215 73.797  1.00 44.50 ? 645  LYS A O     1 
ATOM   4885  C CB    . LYS A 1 645 ? 40.168  151.962 73.509  1.00 44.22 ? 645  LYS A CB    1 
ATOM   4886  C CG    . LYS A 1 645 ? 39.972  152.135 72.014  1.00 45.23 ? 645  LYS A CG    1 
ATOM   4887  C CD    . LYS A 1 645 ? 38.681  152.845 71.678  1.00 46.70 ? 645  LYS A CD    1 
ATOM   4888  C CE    . LYS A 1 645 ? 38.672  153.293 70.221  1.00 47.86 ? 645  LYS A CE    1 
ATOM   4889  N NZ    . LYS A 1 645 ? 37.314  153.749 69.816  1.00 47.42 ? 645  LYS A NZ    1 
ATOM   4890  N N     . GLN A 1 646 ? 39.044  153.993 75.617  1.00 45.28 ? 646  GLN A N     1 
ATOM   4891  C CA    . GLN A 1 646 ? 38.001  154.914 76.079  1.00 45.98 ? 646  GLN A CA    1 
ATOM   4892  C C     . GLN A 1 646 ? 38.547  156.309 76.418  1.00 46.25 ? 646  GLN A C     1 
ATOM   4893  O O     . GLN A 1 646 ? 37.818  157.302 76.308  1.00 46.15 ? 646  GLN A O     1 
ATOM   4894  C CB    . GLN A 1 646 ? 37.240  154.325 77.276  1.00 45.87 ? 646  GLN A CB    1 
ATOM   4895  N N     . ALA A 1 647 ? 39.826  156.371 76.805  1.00 46.46 ? 647  ALA A N     1 
ATOM   4896  C CA    . ALA A 1 647 ? 40.513  157.634 77.117  1.00 46.62 ? 647  ALA A CA    1 
ATOM   4897  C C     . ALA A 1 647 ? 41.246  158.257 75.916  1.00 46.83 ? 647  ALA A C     1 
ATOM   4898  O O     . ALA A 1 647 ? 40.722  158.322 74.796  1.00 46.97 ? 647  ALA A O     1 
ATOM   4899  C CB    . ALA A 1 647 ? 41.485  157.426 78.268  1.00 46.57 ? 647  ALA A CB    1 
ATOM   4900  N N     . HIS B 1 5   ? 100.391 126.068 79.951  1.00 45.48 ? 5    HIS B N     1 
ATOM   4901  C CA    . HIS B 1 5   ? 99.928  124.654 80.092  1.00 45.07 ? 5    HIS B CA    1 
ATOM   4902  C C     . HIS B 1 5   ? 99.005  124.251 78.927  1.00 45.01 ? 5    HIS B C     1 
ATOM   4903  O O     . HIS B 1 5   ? 97.978  123.588 79.115  1.00 45.06 ? 5    HIS B O     1 
ATOM   4904  C CB    . HIS B 1 5   ? 99.243  124.455 81.441  1.00 45.19 ? 5    HIS B CB    1 
ATOM   4905  N N     . LYS B 1 6   ? 99.383  124.663 77.720  1.00 44.69 ? 6    LYS B N     1 
ATOM   4906  C CA    . LYS B 1 6   ? 98.627  124.322 76.523  1.00 44.29 ? 6    LYS B CA    1 
ATOM   4907  C C     . LYS B 1 6   ? 99.083  122.993 75.921  1.00 44.24 ? 6    LYS B C     1 
ATOM   4908  O O     . LYS B 1 6   ? 100.278 122.672 75.911  1.00 44.40 ? 6    LYS B O     1 
ATOM   4909  C CB    . LYS B 1 6   ? 98.720  125.432 75.472  1.00 44.14 ? 6    LYS B CB    1 
ATOM   4910  C CG    . LYS B 1 6   ? 98.095  126.758 75.882  1.00 43.86 ? 6    LYS B CG    1 
ATOM   4911  C CD    . LYS B 1 6   ? 98.431  127.845 74.856  1.00 44.42 ? 6    LYS B CD    1 
ATOM   4912  C CE    . LYS B 1 6   ? 97.637  129.121 75.091  1.00 44.08 ? 6    LYS B CE    1 
ATOM   4913  N NZ    . LYS B 1 6   ? 97.717  130.077 73.942  1.00 43.92 ? 6    LYS B NZ    1 
ATOM   4914  N N     . HIS B 1 7   ? 98.111  122.220 75.446  1.00 43.97 ? 7    HIS B N     1 
ATOM   4915  C CA    . HIS B 1 7   ? 98.368  121.041 74.629  1.00 43.64 ? 7    HIS B CA    1 
ATOM   4916  C C     . HIS B 1 7   ? 98.327  121.462 73.164  1.00 43.19 ? 7    HIS B C     1 
ATOM   4917  O O     . HIS B 1 7   ? 97.324  122.014 72.701  1.00 43.03 ? 7    HIS B O     1 
ATOM   4918  C CB    . HIS B 1 7   ? 97.329  119.958 74.920  1.00 43.55 ? 7    HIS B CB    1 
ATOM   4919  C CG    . HIS B 1 7   ? 97.428  119.389 76.303  1.00 45.02 ? 7    HIS B CG    1 
ATOM   4920  N ND1   . HIS B 1 7   ? 97.923  118.127 76.555  1.00 46.36 ? 7    HIS B ND1   1 
ATOM   4921  C CD2   . HIS B 1 7   ? 97.110  119.916 77.512  1.00 46.01 ? 7    HIS B CD2   1 
ATOM   4922  C CE1   . HIS B 1 7   ? 97.899  117.897 77.857  1.00 46.94 ? 7    HIS B CE1   1 
ATOM   4923  N NE2   . HIS B 1 7   ? 97.410  118.967 78.460  1.00 47.35 ? 7    HIS B NE2   1 
ATOM   4924  N N     . ALA B 1 8   ? 99.421  121.216 72.443  1.00 42.53 ? 8    ALA B N     1 
ATOM   4925  C CA    . ALA B 1 8   ? 99.514  121.582 71.027  1.00 41.80 ? 8    ALA B CA    1 
ATOM   4926  C C     . ALA B 1 8   ? 98.458  120.881 70.168  1.00 41.36 ? 8    ALA B C     1 
ATOM   4927  O O     . ALA B 1 8   ? 97.990  119.777 70.501  1.00 40.62 ? 8    ALA B O     1 
ATOM   4928  C CB    . ALA B 1 8   ? 100.917 121.311 70.483  1.00 41.87 ? 8    ALA B CB    1 
ATOM   4929  N N     . ILE B 1 9   ? 98.082  121.551 69.078  1.00 40.71 ? 9    ILE B N     1 
ATOM   4930  C CA    . ILE B 1 9   ? 97.197  120.991 68.062  1.00 40.37 ? 9    ILE B CA    1 
ATOM   4931  C C     . ILE B 1 9   ? 97.929  119.849 67.347  1.00 40.14 ? 9    ILE B C     1 
ATOM   4932  O O     . ILE B 1 9   ? 98.931  120.090 66.666  1.00 40.50 ? 9    ILE B O     1 
ATOM   4933  C CB    . ILE B 1 9   ? 96.747  122.081 67.030  1.00 40.34 ? 9    ILE B CB    1 
ATOM   4934  C CG1   . ILE B 1 9   ? 95.930  123.180 67.713  1.00 40.17 ? 9    ILE B CG1   1 
ATOM   4935  C CG2   . ILE B 1 9   ? 95.965  121.455 65.871  1.00 39.67 ? 9    ILE B CG2   1 
ATOM   4936  C CD1   . ILE B 1 9   ? 95.877  124.488 66.929  1.00 40.15 ? 9    ILE B CD1   1 
ATOM   4937  N N     . PRO B 1 10  ? 97.428  118.602 67.486  1.00 40.10 ? 10   PRO B N     1 
ATOM   4938  C CA    . PRO B 1 10  ? 98.141  117.465 66.888  1.00 40.00 ? 10   PRO B CA    1 
ATOM   4939  C C     . PRO B 1 10  ? 98.298  117.655 65.377  1.00 39.80 ? 10   PRO B C     1 
ATOM   4940  O O     . PRO B 1 10  ? 97.454  118.301 64.755  1.00 39.58 ? 10   PRO B O     1 
ATOM   4941  C CB    . PRO B 1 10  ? 97.229  116.272 67.193  1.00 40.11 ? 10   PRO B CB    1 
ATOM   4942  C CG    . PRO B 1 10  ? 96.416  116.700 68.376  1.00 39.95 ? 10   PRO B CG    1 
ATOM   4943  C CD    . PRO B 1 10  ? 96.187  118.172 68.161  1.00 40.07 ? 10   PRO B CD    1 
ATOM   4944  N N     . ALA B 1 11  ? 99.372  117.109 64.805  1.00 39.51 ? 11   ALA B N     1 
ATOM   4945  C CA    . ALA B 1 11  ? 99.664  117.291 63.375  1.00 39.29 ? 11   ALA B CA    1 
ATOM   4946  C C     . ALA B 1 11  ? 98.588  116.710 62.448  1.00 38.78 ? 11   ALA B C     1 
ATOM   4947  O O     . ALA B 1 11  ? 98.279  117.308 61.408  1.00 38.38 ? 11   ALA B O     1 
ATOM   4948  C CB    . ALA B 1 11  ? 101.033 116.722 63.023  1.00 39.54 ? 11   ALA B CB    1 
ATOM   4949  N N     . ASN B 1 12  ? 98.041  115.549 62.821  1.00 37.78 ? 12   ASN B N     1 
ATOM   4950  C CA    . ASN B 1 12  ? 96.964  114.914 62.053  1.00 37.22 ? 12   ASN B CA    1 
ATOM   4951  C C     . ASN B 1 12  ? 95.715  115.821 61.988  1.00 36.93 ? 12   ASN B C     1 
ATOM   4952  O O     . ASN B 1 12  ? 95.043  115.925 60.944  1.00 36.74 ? 12   ASN B O     1 
ATOM   4953  C CB    . ASN B 1 12  ? 96.635  113.510 62.612  1.00 37.06 ? 12   ASN B CB    1 
ATOM   4954  C CG    . ASN B 1 12  ? 95.929  113.554 63.973  1.00 37.02 ? 12   ASN B CG    1 
ATOM   4955  O OD1   . ASN B 1 12  ? 96.431  114.139 64.933  1.00 35.93 ? 12   ASN B OD1   1 
ATOM   4956  N ND2   . ASN B 1 12  ? 94.752  112.935 64.050  1.00 36.07 ? 12   ASN B ND2   1 
ATOM   4957  N N     . ILE B 1 13  ? 95.435  116.500 63.099  1.00 36.24 ? 13   ILE B N     1 
ATOM   4958  C CA    . ILE B 1 13  ? 94.306  117.425 63.174  1.00 35.54 ? 13   ILE B CA    1 
ATOM   4959  C C     . ILE B 1 13  ? 94.526  118.685 62.319  1.00 35.51 ? 13   ILE B C     1 
ATOM   4960  O O     . ILE B 1 13  ? 93.673  119.012 61.492  1.00 34.94 ? 13   ILE B O     1 
ATOM   4961  C CB    . ILE B 1 13  ? 93.926  117.760 64.638  1.00 35.15 ? 13   ILE B CB    1 
ATOM   4962  C CG1   . ILE B 1 13  ? 93.404  116.504 65.360  1.00 34.25 ? 13   ILE B CG1   1 
ATOM   4963  C CG2   . ILE B 1 13  ? 92.898  118.880 64.685  1.00 35.15 ? 13   ILE B CG2   1 
ATOM   4964  C CD1   . ILE B 1 13  ? 92.160  115.842 64.729  1.00 31.11 ? 13   ILE B CD1   1 
ATOM   4965  N N     . ALA B 1 14  ? 95.664  119.367 62.507  1.00 35.52 ? 14   ALA B N     1 
ATOM   4966  C CA    . ALA B 1 14  ? 96.009  120.565 61.715  1.00 35.79 ? 14   ALA B CA    1 
ATOM   4967  C C     . ALA B 1 14  ? 96.113  120.281 60.221  1.00 35.91 ? 14   ALA B C     1 
ATOM   4968  O O     . ALA B 1 14  ? 95.876  121.183 59.403  1.00 36.34 ? 14   ALA B O     1 
ATOM   4969  C CB    . ALA B 1 14  ? 97.297  121.225 62.226  1.00 35.79 ? 14   ALA B CB    1 
ATOM   4970  N N     . ASP B 1 15  ? 96.466  119.038 59.874  1.00 35.79 ? 15   ASP B N     1 
ATOM   4971  C CA    . ASP B 1 15  ? 96.517  118.576 58.474  1.00 35.78 ? 15   ASP B CA    1 
ATOM   4972  C C     . ASP B 1 15  ? 95.155  118.561 57.793  1.00 35.80 ? 15   ASP B C     1 
ATOM   4973  O O     . ASP B 1 15  ? 95.038  118.919 56.621  1.00 35.50 ? 15   ASP B O     1 
ATOM   4974  C CB    . ASP B 1 15  ? 97.115  117.169 58.371  1.00 35.57 ? 15   ASP B CB    1 
ATOM   4975  C CG    . ASP B 1 15  ? 98.624  117.179 58.167  1.00 35.84 ? 15   ASP B CG    1 
ATOM   4976  O OD1   . ASP B 1 15  ? 99.240  118.264 58.112  1.00 34.89 ? 15   ASP B OD1   1 
ATOM   4977  O OD2   . ASP B 1 15  ? 99.197  116.079 58.061  1.00 36.39 ? 15   ASP B OD2   1 
ATOM   4978  N N     . ARG B 1 16  ? 94.138  118.125 58.530  1.00 35.54 ? 16   ARG B N     1 
ATOM   4979  C CA    . ARG B 1 16  ? 92.817  117.880 57.956  1.00 35.59 ? 16   ARG B CA    1 
ATOM   4980  C C     . ARG B 1 16  ? 91.763  118.935 58.305  1.00 35.06 ? 16   ARG B C     1 
ATOM   4981  O O     . ARG B 1 16  ? 90.672  118.897 57.753  1.00 35.24 ? 16   ARG B O     1 
ATOM   4982  C CB    . ARG B 1 16  ? 92.312  116.491 58.382  1.00 35.55 ? 16   ARG B CB    1 
ATOM   4983  N N     . CYS B 1 17  ? 92.100  119.879 59.188  1.00 34.81 ? 17   CYS B N     1 
ATOM   4984  C CA    . CYS B 1 17  ? 91.099  120.746 59.831  1.00 34.30 ? 17   CYS B CA    1 
ATOM   4985  C C     . CYS B 1 17  ? 90.373  121.716 58.899  1.00 34.56 ? 17   CYS B C     1 
ATOM   4986  O O     . CYS B 1 17  ? 90.904  122.120 57.857  1.00 34.34 ? 17   CYS B O     1 
ATOM   4987  C CB    . CYS B 1 17  ? 91.666  121.472 61.070  1.00 34.18 ? 17   CYS B CB    1 
ATOM   4988  S SG    . CYS B 1 17  ? 92.892  122.797 60.782  1.00 34.09 ? 17   CYS B SG    1 
ATOM   4989  N N     . LEU B 1 18  ? 89.144  122.066 59.284  1.00 34.41 ? 18   LEU B N     1 
ATOM   4990  C CA    . LEU B 1 18  ? 88.321  123.007 58.524  1.00 34.43 ? 18   LEU B CA    1 
ATOM   4991  C C     . LEU B 1 18  ? 88.689  124.456 58.860  1.00 34.50 ? 18   LEU B C     1 
ATOM   4992  O O     . LEU B 1 18  ? 88.578  125.349 58.015  1.00 33.42 ? 18   LEU B O     1 
ATOM   4993  C CB    . LEU B 1 18  ? 86.830  122.744 58.788  1.00 34.21 ? 18   LEU B CB    1 
ATOM   4994  C CG    . LEU B 1 18  ? 86.269  121.363 58.410  1.00 34.36 ? 18   LEU B CG    1 
ATOM   4995  C CD1   . LEU B 1 18  ? 84.779  121.316 58.708  1.00 35.15 ? 18   LEU B CD1   1 
ATOM   4996  C CD2   . LEU B 1 18  ? 86.524  120.988 56.955  1.00 34.49 ? 18   LEU B CD2   1 
ATOM   4997  N N     . ILE B 1 19  ? 89.126  124.664 60.107  1.00 34.99 ? 19   ILE B N     1 
ATOM   4998  C CA    . ILE B 1 19  ? 89.513  125.986 60.621  1.00 35.49 ? 19   ILE B CA    1 
ATOM   4999  C C     . ILE B 1 19  ? 90.875  125.943 61.334  1.00 35.28 ? 19   ILE B C     1 
ATOM   5000  O O     . ILE B 1 19  ? 90.968  125.377 62.426  1.00 34.66 ? 19   ILE B O     1 
ATOM   5001  C CB    . ILE B 1 19  ? 88.478  126.552 61.673  1.00 35.72 ? 19   ILE B CB    1 
ATOM   5002  C CG1   . ILE B 1 19  ? 87.015  126.383 61.232  1.00 35.91 ? 19   ILE B CG1   1 
ATOM   5003  C CG2   . ILE B 1 19  ? 88.818  128.016 62.044  1.00 35.51 ? 19   ILE B CG2   1 
ATOM   5004  C CD1   . ILE B 1 19  ? 86.577  127.279 60.089  1.00 36.88 ? 19   ILE B CD1   1 
ATOM   5005  N N     . ASN B 1 20  ? 91.900  126.570 60.739  1.00 35.16 ? 20   ASN B N     1 
ATOM   5006  C CA    . ASN B 1 20  ? 93.202  126.756 61.404  1.00 35.50 ? 20   ASN B CA    1 
ATOM   5007  C C     . ASN B 1 20  ? 93.210  128.002 62.324  1.00 35.22 ? 20   ASN B C     1 
ATOM   5008  O O     . ASN B 1 20  ? 92.238  128.755 62.322  1.00 35.26 ? 20   ASN B O     1 
ATOM   5009  C CB    . ASN B 1 20  ? 94.373  126.723 60.399  1.00 35.88 ? 20   ASN B CB    1 
ATOM   5010  C CG    . ASN B 1 20  ? 94.457  127.965 59.519  1.00 37.29 ? 20   ASN B CG    1 
ATOM   5011  O OD1   . ASN B 1 20  ? 94.318  129.099 59.988  1.00 39.24 ? 20   ASN B OD1   1 
ATOM   5012  N ND2   . ASN B 1 20  ? 94.723  127.752 58.231  1.00 38.33 ? 20   ASN B ND2   1 
ATOM   5013  N N     . PRO B 1 21  ? 94.274  128.204 63.137  1.00 35.00 ? 21   PRO B N     1 
ATOM   5014  C CA    . PRO B 1 21  ? 94.220  129.327 64.095  1.00 35.07 ? 21   PRO B CA    1 
ATOM   5015  C C     . PRO B 1 21  ? 93.949  130.699 63.467  1.00 35.27 ? 21   PRO B C     1 
ATOM   5016  O O     . PRO B 1 21  ? 93.232  131.511 64.066  1.00 35.64 ? 21   PRO B O     1 
ATOM   5017  C CB    . PRO B 1 21  ? 95.609  129.311 64.745  1.00 34.97 ? 21   PRO B CB    1 
ATOM   5018  C CG    . PRO B 1 21  ? 96.099  127.914 64.550  1.00 35.00 ? 21   PRO B CG    1 
ATOM   5019  C CD    . PRO B 1 21  ? 95.534  127.441 63.256  1.00 34.76 ? 21   PRO B CD    1 
ATOM   5020  N N     . GLU B 1 22  ? 94.508  130.946 62.278  1.00 35.14 ? 22   GLU B N     1 
ATOM   5021  C CA    . GLU B 1 22  ? 94.412  132.247 61.621  1.00 34.91 ? 22   GLU B CA    1 
ATOM   5022  C C     . GLU B 1 22  ? 93.008  132.500 61.061  1.00 34.76 ? 22   GLU B C     1 
ATOM   5023  O O     . GLU B 1 22  ? 92.459  133.597 61.228  1.00 34.45 ? 22   GLU B O     1 
ATOM   5024  C CB    . GLU B 1 22  ? 95.487  132.386 60.528  1.00 34.95 ? 22   GLU B CB    1 
ATOM   5025  N N     . GLN B 1 23  ? 92.451  131.480 60.401  1.00 34.60 ? 23   GLN B N     1 
ATOM   5026  C CA    . GLN B 1 23  ? 91.055  131.458 59.939  1.00 34.72 ? 23   GLN B CA    1 
ATOM   5027  C C     . GLN B 1 23  ? 90.032  131.726 61.050  1.00 34.51 ? 23   GLN B C     1 
ATOM   5028  O O     . GLN B 1 23  ? 89.059  132.456 60.828  1.00 34.46 ? 23   GLN B O     1 
ATOM   5029  C CB    . GLN B 1 23  ? 90.732  130.111 59.287  1.00 34.68 ? 23   GLN B CB    1 
ATOM   5030  C CG    . GLN B 1 23  ? 91.177  129.979 57.850  1.00 35.75 ? 23   GLN B CG    1 
ATOM   5031  C CD    . GLN B 1 23  ? 91.567  128.557 57.475  1.00 37.68 ? 23   GLN B CD    1 
ATOM   5032  O OE1   . GLN B 1 23  ? 92.404  128.347 56.598  1.00 41.59 ? 23   GLN B OE1   1 
ATOM   5033  N NE2   . GLN B 1 23  ? 90.977  127.581 58.136  1.00 38.13 ? 23   GLN B NE2   1 
ATOM   5034  N N     . TYR B 1 24  ? 90.244  131.117 62.223  1.00 33.95 ? 24   TYR B N     1 
ATOM   5035  C CA    . TYR B 1 24  ? 89.398  131.356 63.397  1.00 33.39 ? 24   TYR B CA    1 
ATOM   5036  C C     . TYR B 1 24  ? 89.473  132.820 63.814  1.00 33.41 ? 24   TYR B C     1 
ATOM   5037  O O     . TYR B 1 24  ? 88.446  133.442 64.097  1.00 33.15 ? 24   TYR B O     1 
ATOM   5038  C CB    . TYR B 1 24  ? 89.776  130.468 64.613  1.00 33.02 ? 24   TYR B CB    1 
ATOM   5039  C CG    . TYR B 1 24  ? 89.179  131.034 65.899  1.00 32.91 ? 24   TYR B CG    1 
ATOM   5040  C CD1   . TYR B 1 24  ? 87.849  130.776 66.248  1.00 31.88 ? 24   TYR B CD1   1 
ATOM   5041  C CD2   . TYR B 1 24  ? 89.921  131.901 66.726  1.00 33.49 ? 24   TYR B CD2   1 
ATOM   5042  C CE1   . TYR B 1 24  ? 87.282  131.327 67.409  1.00 32.07 ? 24   TYR B CE1   1 
ATOM   5043  C CE2   . TYR B 1 24  ? 89.353  132.470 67.890  1.00 32.91 ? 24   TYR B CE2   1 
ATOM   5044  C CZ    . TYR B 1 24  ? 88.030  132.170 68.218  1.00 32.49 ? 24   TYR B CZ    1 
ATOM   5045  O OH    . TYR B 1 24  ? 87.455  132.725 69.341  1.00 32.66 ? 24   TYR B OH    1 
ATOM   5046  N N     . GLU B 1 25  ? 90.696  133.348 63.885  1.00 33.23 ? 25   GLU B N     1 
ATOM   5047  C CA    . GLU B 1 25  ? 90.927  134.717 64.329  1.00 33.21 ? 25   GLU B CA    1 
ATOM   5048  C C     . GLU B 1 25  ? 90.273  135.721 63.373  1.00 33.33 ? 25   GLU B C     1 
ATOM   5049  O O     . GLU B 1 25  ? 89.623  136.666 63.834  1.00 33.51 ? 25   GLU B O     1 
ATOM   5050  C CB    . GLU B 1 25  ? 92.431  134.995 64.512  1.00 32.94 ? 25   GLU B CB    1 
ATOM   5051  N N     . THR B 1 26  ? 90.409  135.514 62.059  1.00 33.36 ? 26   THR B N     1 
ATOM   5052  C CA    . THR B 1 26  ? 89.839  136.478 61.107  1.00 33.62 ? 26   THR B CA    1 
ATOM   5053  C C     . THR B 1 26  ? 88.323  136.314 60.934  1.00 33.46 ? 26   THR B C     1 
ATOM   5054  O O     . THR B 1 26  ? 87.596  137.308 60.938  1.00 33.42 ? 26   THR B O     1 
ATOM   5055  C CB    . THR B 1 26  ? 90.619  136.612 59.737  1.00 33.94 ? 26   THR B CB    1 
ATOM   5056  O OG1   . THR B 1 26  ? 90.172  135.636 58.790  1.00 35.17 ? 26   THR B OG1   1 
ATOM   5057  C CG2   . THR B 1 26  ? 92.131  136.501 59.923  1.00 33.84 ? 26   THR B CG2   1 
ATOM   5058  N N     . LYS B 1 27  ? 87.840  135.074 60.831  1.00 33.39 ? 27   LYS B N     1 
ATOM   5059  C CA    . LYS B 1 27  ? 86.387  134.827 60.849  1.00 33.15 ? 27   LYS B CA    1 
ATOM   5060  C C     . LYS B 1 27  ? 85.740  135.335 62.147  1.00 32.42 ? 27   LYS B C     1 
ATOM   5061  O O     . LYS B 1 27  ? 84.644  135.901 62.118  1.00 31.84 ? 27   LYS B O     1 
ATOM   5062  C CB    . LYS B 1 27  ? 86.052  133.349 60.661  1.00 33.45 ? 27   LYS B CB    1 
ATOM   5063  C CG    . LYS B 1 27  ? 86.182  132.817 59.255  1.00 35.23 ? 27   LYS B CG    1 
ATOM   5064  C CD    . LYS B 1 27  ? 85.864  131.313 59.259  1.00 38.52 ? 27   LYS B CD    1 
ATOM   5065  C CE    . LYS B 1 27  ? 85.589  130.779 57.851  1.00 41.63 ? 27   LYS B CE    1 
ATOM   5066  N NZ    . LYS B 1 27  ? 85.025  129.386 57.873  1.00 42.46 ? 27   LYS B NZ    1 
ATOM   5067  N N     . TYR B 1 28  ? 86.419  135.141 63.277  1.00 31.82 ? 28   TYR B N     1 
ATOM   5068  C CA    . TYR B 1 28  ? 85.871  135.612 64.549  1.00 31.46 ? 28   TYR B CA    1 
ATOM   5069  C C     . TYR B 1 28  ? 85.695  137.126 64.492  1.00 31.61 ? 28   TYR B C     1 
ATOM   5070  O O     . TYR B 1 28  ? 84.633  137.640 64.855  1.00 31.88 ? 28   TYR B O     1 
ATOM   5071  C CB    . TYR B 1 28  ? 86.703  135.201 65.784  1.00 30.40 ? 28   TYR B CB    1 
ATOM   5072  C CG    . TYR B 1 28  ? 86.080  135.747 67.053  1.00 29.94 ? 28   TYR B CG    1 
ATOM   5073  C CD1   . TYR B 1 28  ? 84.976  135.113 67.636  1.00 27.82 ? 28   TYR B CD1   1 
ATOM   5074  C CD2   . TYR B 1 28  ? 86.538  136.938 67.625  1.00 29.45 ? 28   TYR B CD2   1 
ATOM   5075  C CE1   . TYR B 1 28  ? 84.372  135.622 68.759  1.00 27.70 ? 28   TYR B CE1   1 
ATOM   5076  C CE2   . TYR B 1 28  ? 85.926  137.470 68.755  1.00 29.40 ? 28   TYR B CE2   1 
ATOM   5077  C CZ    . TYR B 1 28  ? 84.840  136.795 69.324  1.00 29.32 ? 28   TYR B CZ    1 
ATOM   5078  O OH    . TYR B 1 28  ? 84.222  137.300 70.454  1.00 29.68 ? 28   TYR B OH    1 
ATOM   5079  N N     . LYS B 1 29  ? 86.747  137.814 64.037  1.00 31.67 ? 29   LYS B N     1 
ATOM   5080  C CA    . LYS B 1 29  ? 86.771  139.270 63.917  1.00 31.81 ? 29   LYS B CA    1 
ATOM   5081  C C     . LYS B 1 29  ? 85.586  139.783 63.117  1.00 31.55 ? 29   LYS B C     1 
ATOM   5082  O O     . LYS B 1 29  ? 84.882  140.664 63.588  1.00 32.06 ? 29   LYS B O     1 
ATOM   5083  C CB    . LYS B 1 29  ? 88.102  139.754 63.302  1.00 31.86 ? 29   LYS B CB    1 
ATOM   5084  C CG    . LYS B 1 29  ? 88.186  141.254 63.054  1.00 32.45 ? 29   LYS B CG    1 
ATOM   5085  N N     . GLN B 1 30  ? 85.382  139.219 61.923  1.00 31.18 ? 30   GLN B N     1 
ATOM   5086  C CA    . GLN B 1 30  ? 84.281  139.577 61.040  1.00 31.46 ? 30   GLN B CA    1 
ATOM   5087  C C     . GLN B 1 30  ? 82.897  139.230 61.624  1.00 31.37 ? 30   GLN B C     1 
ATOM   5088  O O     . GLN B 1 30  ? 81.932  139.970 61.394  1.00 30.77 ? 30   GLN B O     1 
ATOM   5089  C CB    . GLN B 1 30  ? 84.440  138.911 59.664  1.00 31.54 ? 30   GLN B CB    1 
ATOM   5090  C CG    . GLN B 1 30  ? 83.526  139.514 58.590  1.00 32.27 ? 30   GLN B CG    1 
ATOM   5091  C CD    . GLN B 1 30  ? 83.417  138.676 57.314  1.00 32.87 ? 30   GLN B CD    1 
ATOM   5092  O OE1   . GLN B 1 30  ? 83.319  139.228 56.211  1.00 34.13 ? 30   GLN B OE1   1 
ATOM   5093  N NE2   . GLN B 1 30  ? 83.421  137.349 57.455  1.00 33.59 ? 30   GLN B NE2   1 
ATOM   5094  N N     . SER B 1 31  ? 82.804  138.110 62.353  1.00 30.89 ? 31   SER B N     1 
ATOM   5095  C CA    . SER B 1 31  ? 81.543  137.693 62.981  1.00 31.20 ? 31   SER B CA    1 
ATOM   5096  C C     . SER B 1 31  ? 81.073  138.759 63.972  1.00 32.04 ? 31   SER B C     1 
ATOM   5097  O O     . SER B 1 31  ? 79.878  138.988 64.135  1.00 31.73 ? 31   SER B O     1 
ATOM   5098  C CB    . SER B 1 31  ? 81.675  136.310 63.671  1.00 31.13 ? 31   SER B CB    1 
ATOM   5099  O OG    . SER B 1 31  ? 82.451  136.345 64.869  1.00 28.53 ? 31   SER B OG    1 
ATOM   5100  N N     . ILE B 1 32  ? 82.040  139.411 64.611  1.00 32.86 ? 32   ILE B N     1 
ATOM   5101  C CA    . ILE B 1 32  ? 81.801  140.375 65.675  1.00 33.94 ? 32   ILE B CA    1 
ATOM   5102  C C     . ILE B 1 32  ? 81.626  141.795 65.126  1.00 34.71 ? 32   ILE B C     1 
ATOM   5103  O O     . ILE B 1 32  ? 80.730  142.520 65.557  1.00 35.33 ? 32   ILE B O     1 
ATOM   5104  C CB    . ILE B 1 32  ? 82.953  140.293 66.733  1.00 34.21 ? 32   ILE B CB    1 
ATOM   5105  C CG1   . ILE B 1 32  ? 82.924  138.931 67.435  1.00 33.95 ? 32   ILE B CG1   1 
ATOM   5106  C CG2   . ILE B 1 32  ? 82.911  141.447 67.750  1.00 34.98 ? 32   ILE B CG2   1 
ATOM   5107  C CD1   . ILE B 1 32  ? 81.543  138.432 67.841  1.00 31.65 ? 32   ILE B CD1   1 
ATOM   5108  N N     . ASN B 1 33  ? 82.454  142.165 64.152  1.00 35.12 ? 33   ASN B N     1 
ATOM   5109  C CA    . ASN B 1 33  ? 82.436  143.515 63.570  1.00 35.83 ? 33   ASN B CA    1 
ATOM   5110  C C     . ASN B 1 33  ? 81.336  143.696 62.530  1.00 35.49 ? 33   ASN B C     1 
ATOM   5111  O O     . ASN B 1 33  ? 80.624  144.713 62.533  1.00 36.02 ? 33   ASN B O     1 
ATOM   5112  C CB    . ASN B 1 33  ? 83.796  143.865 62.939  1.00 35.76 ? 33   ASN B CB    1 
ATOM   5113  C CG    . ASN B 1 33  ? 84.819  144.343 63.959  1.00 37.71 ? 33   ASN B CG    1 
ATOM   5114  O OD1   . ASN B 1 33  ? 85.116  143.662 64.947  1.00 37.80 ? 33   ASN B OD1   1 
ATOM   5115  N ND2   . ASN B 1 33  ? 85.381  145.525 63.709  1.00 39.66 ? 33   ASN B ND2   1 
ATOM   5116  N N     . ASP B 1 34  ? 81.221  142.719 61.631  1.00 34.50 ? 34   ASP B N     1 
ATOM   5117  C CA    . ASP B 1 34  ? 80.201  142.729 60.590  1.00 33.61 ? 34   ASP B CA    1 
ATOM   5118  C C     . ASP B 1 34  ? 79.350  141.439 60.658  1.00 32.98 ? 34   ASP B C     1 
ATOM   5119  O O     . ASP B 1 34  ? 79.497  140.545 59.815  1.00 32.23 ? 34   ASP B O     1 
ATOM   5120  C CB    . ASP B 1 34  ? 80.868  142.890 59.227  1.00 33.46 ? 34   ASP B CB    1 
ATOM   5121  C CG    . ASP B 1 34  ? 79.879  143.151 58.107  1.00 34.37 ? 34   ASP B CG    1 
ATOM   5122  O OD1   . ASP B 1 34  ? 78.645  143.245 58.353  1.00 33.25 ? 34   ASP B OD1   1 
ATOM   5123  O OD2   . ASP B 1 34  ? 80.356  143.247 56.957  1.00 33.74 ? 34   ASP B OD2   1 
ATOM   5124  N N     . PRO B 1 35  ? 78.464  141.341 61.672  1.00 32.54 ? 35   PRO B N     1 
ATOM   5125  C CA    . PRO B 1 35  ? 77.634  140.139 61.844  1.00 32.66 ? 35   PRO B CA    1 
ATOM   5126  C C     . PRO B 1 35  ? 76.734  139.852 60.645  1.00 32.44 ? 35   PRO B C     1 
ATOM   5127  O O     . PRO B 1 35  ? 76.605  138.694 60.248  1.00 32.85 ? 35   PRO B O     1 
ATOM   5128  C CB    . PRO B 1 35  ? 76.802  140.448 63.094  1.00 32.53 ? 35   PRO B CB    1 
ATOM   5129  C CG    . PRO B 1 35  ? 76.819  141.926 63.223  1.00 33.16 ? 35   PRO B CG    1 
ATOM   5130  C CD    . PRO B 1 35  ? 78.183  142.345 62.713  1.00 32.63 ? 35   PRO B CD    1 
ATOM   5131  N N     . ASP B 1 36  ? 76.151  140.901 60.068  1.00 32.41 ? 36   ASP B N     1 
ATOM   5132  C CA    . ASP B 1 36  ? 75.299  140.800 58.884  1.00 32.10 ? 36   ASP B CA    1 
ATOM   5133  C C     . ASP B 1 36  ? 75.945  140.108 57.691  1.00 31.52 ? 36   ASP B C     1 
ATOM   5134  O O     . ASP B 1 36  ? 75.309  139.271 57.044  1.00 32.08 ? 36   ASP B O     1 
ATOM   5135  C CB    . ASP B 1 36  ? 74.742  142.177 58.482  1.00 32.38 ? 36   ASP B CB    1 
ATOM   5136  C CG    . ASP B 1 36  ? 73.523  142.569 59.302  1.00 34.39 ? 36   ASP B CG    1 
ATOM   5137  O OD1   . ASP B 1 36  ? 72.986  143.662 59.081  1.00 37.18 ? 36   ASP B OD1   1 
ATOM   5138  O OD2   . ASP B 1 36  ? 73.086  141.781 60.174  1.00 37.39 ? 36   ASP B OD2   1 
ATOM   5139  N N     . THR B 1 37  ? 77.186  140.467 57.390  1.00 30.55 ? 37   THR B N     1 
ATOM   5140  C CA    . THR B 1 37  ? 77.938  139.815 56.325  1.00 29.92 ? 37   THR B CA    1 
ATOM   5141  C C     . THR B 1 37  ? 78.326  138.393 56.734  1.00 29.63 ? 37   THR B C     1 
ATOM   5142  O O     . THR B 1 37  ? 78.231  137.464 55.922  1.00 29.84 ? 37   THR B O     1 
ATOM   5143  C CB    . THR B 1 37  ? 79.225  140.603 55.976  1.00 30.01 ? 37   THR B CB    1 
ATOM   5144  O OG1   . THR B 1 37  ? 78.872  141.929 55.566  1.00 29.85 ? 37   THR B OG1   1 
ATOM   5145  C CG2   . THR B 1 37  ? 80.006  139.921 54.868  1.00 29.48 ? 37   THR B CG2   1 
ATOM   5146  N N     . PHE B 1 38  ? 78.769  138.219 57.982  1.00 28.87 ? 38   PHE B N     1 
ATOM   5147  C CA    . PHE B 1 38  ? 79.266  136.898 58.407  1.00 28.13 ? 38   PHE B CA    1 
ATOM   5148  C C     . PHE B 1 38  ? 78.160  135.841 58.385  1.00 27.18 ? 38   PHE B C     1 
ATOM   5149  O O     . PHE B 1 38  ? 78.292  134.798 57.743  1.00 26.58 ? 38   PHE B O     1 
ATOM   5150  C CB    . PHE B 1 38  ? 79.947  136.925 59.780  1.00 28.29 ? 38   PHE B CB    1 
ATOM   5151  C CG    . PHE B 1 38  ? 80.417  135.566 60.221  1.00 29.55 ? 38   PHE B CG    1 
ATOM   5152  C CD1   . PHE B 1 38  ? 81.625  135.051 59.754  1.00 30.38 ? 38   PHE B CD1   1 
ATOM   5153  C CD2   . PHE B 1 38  ? 79.611  134.761 61.040  1.00 29.91 ? 38   PHE B CD2   1 
ATOM   5154  C CE1   . PHE B 1 38  ? 82.050  133.755 60.127  1.00 31.80 ? 38   PHE B CE1   1 
ATOM   5155  C CE2   . PHE B 1 38  ? 80.022  133.478 61.411  1.00 30.94 ? 38   PHE B CE2   1 
ATOM   5156  C CZ    . PHE B 1 38  ? 81.249  132.976 60.953  1.00 30.34 ? 38   PHE B CZ    1 
ATOM   5157  N N     . TRP B 1 39  ? 77.066  136.144 59.074  1.00 26.47 ? 39   TRP B N     1 
ATOM   5158  C CA    . TRP B 1 39  ? 75.937  135.228 59.178  1.00 26.07 ? 39   TRP B CA    1 
ATOM   5159  C C     . TRP B 1 39  ? 75.082  135.171 57.907  1.00 26.39 ? 39   TRP B C     1 
ATOM   5160  O O     . TRP B 1 39  ? 74.442  134.144 57.633  1.00 26.21 ? 39   TRP B O     1 
ATOM   5161  C CB    . TRP B 1 39  ? 75.117  135.552 60.429  1.00 25.67 ? 39   TRP B CB    1 
ATOM   5162  C CG    . TRP B 1 39  ? 75.850  135.201 61.714  1.00 24.54 ? 39   TRP B CG    1 
ATOM   5163  C CD1   . TRP B 1 39  ? 76.252  136.065 62.695  1.00 24.39 ? 39   TRP B CD1   1 
ATOM   5164  C CD2   . TRP B 1 39  ? 76.268  133.894 62.137  1.00 24.35 ? 39   TRP B CD2   1 
ATOM   5165  N NE1   . TRP B 1 39  ? 76.885  135.377 63.710  1.00 23.80 ? 39   TRP B NE1   1 
ATOM   5166  C CE2   . TRP B 1 39  ? 76.903  134.042 63.393  1.00 25.23 ? 39   TRP B CE2   1 
ATOM   5167  C CE3   . TRP B 1 39  ? 76.155  132.608 61.585  1.00 25.47 ? 39   TRP B CE3   1 
ATOM   5168  C CZ2   . TRP B 1 39  ? 77.430  132.949 64.101  1.00 24.43 ? 39   TRP B CZ2   1 
ATOM   5169  C CZ3   . TRP B 1 39  ? 76.672  131.516 62.300  1.00 24.81 ? 39   TRP B CZ3   1 
ATOM   5170  C CH2   . TRP B 1 39  ? 77.309  131.700 63.538  1.00 24.76 ? 39   TRP B CH2   1 
ATOM   5171  N N     . GLY B 1 40  ? 75.094  136.266 57.140  1.00 26.56 ? 40   GLY B N     1 
ATOM   5172  C CA    . GLY B 1 40  ? 74.568  136.302 55.774  1.00 26.95 ? 40   GLY B CA    1 
ATOM   5173  C C     . GLY B 1 40  ? 75.165  135.212 54.894  1.00 27.42 ? 40   GLY B C     1 
ATOM   5174  O O     . GLY B 1 40  ? 74.446  134.519 54.170  1.00 27.39 ? 40   GLY B O     1 
ATOM   5175  N N     . GLU B 1 41  ? 76.479  135.047 54.975  1.00 27.55 ? 41   GLU B N     1 
ATOM   5176  C CA    . GLU B 1 41  ? 77.169  134.010 54.225  1.00 28.45 ? 41   GLU B CA    1 
ATOM   5177  C C     . GLU B 1 41  ? 77.091  132.650 54.918  1.00 27.70 ? 41   GLU B C     1 
ATOM   5178  O O     . GLU B 1 41  ? 76.910  131.638 54.261  1.00 28.29 ? 41   GLU B O     1 
ATOM   5179  C CB    . GLU B 1 41  ? 78.634  134.411 53.976  1.00 29.06 ? 41   GLU B CB    1 
ATOM   5180  C CG    . GLU B 1 41  ? 78.823  135.239 52.692  1.00 33.45 ? 41   GLU B CG    1 
ATOM   5181  C CD    . GLU B 1 41  ? 79.962  136.263 52.780  1.00 38.75 ? 41   GLU B CD    1 
ATOM   5182  O OE1   . GLU B 1 41  ? 80.137  137.057 51.819  1.00 41.74 ? 41   GLU B OE1   1 
ATOM   5183  O OE2   . GLU B 1 41  ? 80.681  136.287 53.800  1.00 39.72 ? 41   GLU B OE2   1 
ATOM   5184  N N     . GLN B 1 42  ? 77.236  132.626 56.238  1.00 26.75 ? 42   GLN B N     1 
ATOM   5185  C CA    . GLN B 1 42  ? 77.175  131.378 56.990  1.00 26.08 ? 42   GLN B CA    1 
ATOM   5186  C C     . GLN B 1 42  ? 75.786  130.712 57.000  1.00 25.55 ? 42   GLN B C     1 
ATOM   5187  O O     . GLN B 1 42  ? 75.687  129.494 57.138  1.00 24.50 ? 42   GLN B O     1 
ATOM   5188  C CB    . GLN B 1 42  ? 77.708  131.557 58.428  1.00 26.20 ? 42   GLN B CB    1 
ATOM   5189  C CG    . GLN B 1 42  ? 77.899  130.227 59.178  1.00 26.46 ? 42   GLN B CG    1 
ATOM   5190  C CD    . GLN B 1 42  ? 78.641  129.187 58.336  1.00 27.14 ? 42   GLN B CD    1 
ATOM   5191  O OE1   . GLN B 1 42  ? 78.232  128.024 58.249  1.00 29.37 ? 42   GLN B OE1   1 
ATOM   5192  N NE2   . GLN B 1 42  ? 79.720  129.608 57.700  1.00 24.41 ? 42   GLN B NE2   1 
ATOM   5193  N N     . GLY B 1 43  ? 74.731  131.510 56.845  1.00 25.05 ? 43   GLY B N     1 
ATOM   5194  C CA    . GLY B 1 43  ? 73.355  130.992 56.830  1.00 25.22 ? 43   GLY B CA    1 
ATOM   5195  C C     . GLY B 1 43  ? 73.076  130.120 55.616  1.00 25.04 ? 43   GLY B C     1 
ATOM   5196  O O     . GLY B 1 43  ? 72.093  129.392 55.577  1.00 25.15 ? 43   GLY B O     1 
ATOM   5197  N N     . LYS B 1 44  ? 73.972  130.187 54.637  1.00 25.03 ? 44   LYS B N     1 
ATOM   5198  C CA    . LYS B 1 44  ? 73.912  129.337 53.455  1.00 24.94 ? 44   LYS B CA    1 
ATOM   5199  C C     . LYS B 1 44  ? 74.357  127.879 53.709  1.00 24.83 ? 44   LYS B C     1 
ATOM   5200  O O     . LYS B 1 44  ? 74.393  127.078 52.778  1.00 25.05 ? 44   LYS B O     1 
ATOM   5201  C CB    . LYS B 1 44  ? 74.727  129.977 52.312  1.00 25.01 ? 44   LYS B CB    1 
ATOM   5202  N N     . ILE B 1 45  ? 74.696  127.539 54.955  1.00 24.34 ? 45   ILE B N     1 
ATOM   5203  C CA    . ILE B 1 45  ? 74.907  126.132 55.361  1.00 24.09 ? 45   ILE B CA    1 
ATOM   5204  C C     . ILE B 1 45  ? 73.599  125.343 55.212  1.00 23.93 ? 45   ILE B C     1 
ATOM   5205  O O     . ILE B 1 45  ? 73.622  124.131 55.022  1.00 23.84 ? 45   ILE B O     1 
ATOM   5206  C CB    . ILE B 1 45  ? 75.479  126.019 56.808  1.00 24.17 ? 45   ILE B CB    1 
ATOM   5207  C CG1   . ILE B 1 45  ? 76.037  124.615 57.096  1.00 24.62 ? 45   ILE B CG1   1 
ATOM   5208  C CG2   . ILE B 1 45  ? 74.440  126.459 57.856  1.00 24.65 ? 45   ILE B CG2   1 
ATOM   5209  C CD1   . ILE B 1 45  ? 77.031  124.574 58.233  1.00 23.20 ? 45   ILE B CD1   1 
ATOM   5210  N N     . LEU B 1 46  ? 72.472  126.055 55.257  1.00 23.54 ? 46   LEU B N     1 
ATOM   5211  C CA    . LEU B 1 46  ? 71.130  125.482 55.009  1.00 23.87 ? 46   LEU B CA    1 
ATOM   5212  C C     . LEU B 1 46  ? 70.548  125.834 53.634  1.00 24.40 ? 46   LEU B C     1 
ATOM   5213  O O     . LEU B 1 46  ? 70.916  126.853 53.043  1.00 24.23 ? 46   LEU B O     1 
ATOM   5214  C CB    . LEU B 1 46  ? 70.139  125.972 56.084  1.00 23.52 ? 46   LEU B CB    1 
ATOM   5215  C CG    . LEU B 1 46  ? 70.585  125.925 57.550  1.00 21.99 ? 46   LEU B CG    1 
ATOM   5216  C CD1   . LEU B 1 46  ? 69.454  126.398 58.434  1.00 20.76 ? 46   LEU B CD1   1 
ATOM   5217  C CD2   . LEU B 1 46  ? 71.083  124.526 57.964  1.00 21.28 ? 46   LEU B CD2   1 
ATOM   5218  N N     . ASP B 1 47  ? 69.654  124.968 53.143  1.00 24.93 ? 47   ASP B N     1 
ATOM   5219  C CA    . ASP B 1 47  ? 68.687  125.284 52.084  1.00 25.69 ? 47   ASP B CA    1 
ATOM   5220  C C     . ASP B 1 47  ? 67.544  126.173 52.618  1.00 25.73 ? 47   ASP B C     1 
ATOM   5221  O O     . ASP B 1 47  ? 66.864  125.830 53.585  1.00 26.11 ? 47   ASP B O     1 
ATOM   5222  C CB    . ASP B 1 47  ? 68.068  123.993 51.502  1.00 25.80 ? 47   ASP B CB    1 
ATOM   5223  C CG    . ASP B 1 47  ? 69.082  123.127 50.714  1.00 27.49 ? 47   ASP B CG    1 
ATOM   5224  O OD1   . ASP B 1 47  ? 68.643  122.212 49.978  1.00 27.17 ? 47   ASP B OD1   1 
ATOM   5225  O OD2   . ASP B 1 47  ? 70.309  123.340 50.828  1.00 27.23 ? 47   ASP B OD2   1 
ATOM   5226  N N     . TRP B 1 48  ? 67.333  127.320 51.977  1.00 26.10 ? 48   TRP B N     1 
ATOM   5227  C CA    . TRP B 1 48  ? 66.208  128.204 52.285  1.00 25.11 ? 48   TRP B CA    1 
ATOM   5228  C C     . TRP B 1 48  ? 65.219  128.084 51.141  1.00 25.59 ? 48   TRP B C     1 
ATOM   5229  O O     . TRP B 1 48  ? 65.619  127.984 49.986  1.00 26.17 ? 48   TRP B O     1 
ATOM   5230  C CB    . TRP B 1 48  ? 66.686  129.658 52.486  1.00 24.49 ? 48   TRP B CB    1 
ATOM   5231  C CG    . TRP B 1 48  ? 67.553  129.777 53.719  1.00 23.36 ? 48   TRP B CG    1 
ATOM   5232  C CD1   . TRP B 1 48  ? 68.862  129.411 53.837  1.00 21.99 ? 48   TRP B CD1   1 
ATOM   5233  C CD2   . TRP B 1 48  ? 67.151  130.262 55.008  1.00 22.02 ? 48   TRP B CD2   1 
ATOM   5234  N NE1   . TRP B 1 48  ? 69.306  129.644 55.124  1.00 23.56 ? 48   TRP B NE1   1 
ATOM   5235  C CE2   . TRP B 1 48  ? 68.269  130.153 55.864  1.00 23.17 ? 48   TRP B CE2   1 
ATOM   5236  C CE3   . TRP B 1 48  ? 65.954  130.768 55.523  1.00 20.71 ? 48   TRP B CE3   1 
ATOM   5237  C CZ2   . TRP B 1 48  ? 68.226  130.546 57.214  1.00 23.45 ? 48   TRP B CZ2   1 
ATOM   5238  C CZ3   . TRP B 1 48  ? 65.909  131.159 56.865  1.00 21.95 ? 48   TRP B CZ3   1 
ATOM   5239  C CH2   . TRP B 1 48  ? 67.036  131.043 57.692  1.00 22.19 ? 48   TRP B CH2   1 
ATOM   5240  N N     . ILE B 1 49  ? 63.937  128.042 51.479  1.00 25.32 ? 49   ILE B N     1 
ATOM   5241  C CA    . ILE B 1 49  ? 62.860  127.983 50.503  1.00 24.98 ? 49   ILE B CA    1 
ATOM   5242  C C     . ILE B 1 49  ? 62.666  129.376 49.880  1.00 25.26 ? 49   ILE B C     1 
ATOM   5243  O O     . ILE B 1 49  ? 62.751  129.535 48.661  1.00 24.86 ? 49   ILE B O     1 
ATOM   5244  C CB    . ILE B 1 49  ? 61.576  127.424 51.154  1.00 24.72 ? 49   ILE B CB    1 
ATOM   5245  C CG1   . ILE B 1 49  ? 61.817  125.947 51.564  1.00 25.53 ? 49   ILE B CG1   1 
ATOM   5246  C CG2   . ILE B 1 49  ? 60.391  127.554 50.203  1.00 25.14 ? 49   ILE B CG2   1 
ATOM   5247  C CD1   . ILE B 1 49  ? 60.841  125.377 52.590  1.00 24.38 ? 49   ILE B CD1   1 
ATOM   5248  N N     . THR B 1 50  ? 62.441  130.378 50.721  1.00 25.15 ? 50   THR B N     1 
ATOM   5249  C CA    . THR B 1 50  ? 62.689  131.755 50.311  1.00 25.92 ? 50   THR B CA    1 
ATOM   5250  C C     . THR B 1 50  ? 63.917  132.312 51.041  1.00 26.31 ? 50   THR B C     1 
ATOM   5251  O O     . THR B 1 50  ? 64.030  132.210 52.261  1.00 26.11 ? 50   THR B O     1 
ATOM   5252  C CB    . THR B 1 50  ? 61.421  132.683 50.433  1.00 26.11 ? 50   THR B CB    1 
ATOM   5253  O OG1   . THR B 1 50  ? 61.130  132.933 51.807  1.00 28.91 ? 50   THR B OG1   1 
ATOM   5254  C CG2   . THR B 1 50  ? 60.214  132.031 49.797  1.00 23.45 ? 50   THR B CG2   1 
ATOM   5255  N N     . PRO B 1 51  ? 64.855  132.889 50.280  1.00 27.43 ? 51   PRO B N     1 
ATOM   5256  C CA    . PRO B 1 51  ? 66.091  133.453 50.828  1.00 27.82 ? 51   PRO B CA    1 
ATOM   5257  C C     . PRO B 1 51  ? 65.777  134.606 51.753  1.00 27.89 ? 51   PRO B C     1 
ATOM   5258  O O     . PRO B 1 51  ? 64.912  135.418 51.436  1.00 28.27 ? 51   PRO B O     1 
ATOM   5259  C CB    . PRO B 1 51  ? 66.799  134.007 49.589  1.00 27.68 ? 51   PRO B CB    1 
ATOM   5260  C CG    . PRO B 1 51  ? 65.602  134.281 48.584  1.00 29.17 ? 51   PRO B CG    1 
ATOM   5261  C CD    . PRO B 1 51  ? 64.760  133.071 48.813  1.00 27.66 ? 51   PRO B CD    1 
ATOM   5262  N N     . TYR B 1 52  ? 66.466  134.678 52.888  1.00 27.59 ? 52   TYR B N     1 
ATOM   5263  C CA    . TYR B 1 52  ? 66.408  135.867 53.720  1.00 27.44 ? 52   TYR B CA    1 
ATOM   5264  C C     . TYR B 1 52  ? 67.099  137.014 53.016  1.00 27.44 ? 52   TYR B C     1 
ATOM   5265  O O     . TYR B 1 52  ? 67.961  136.795 52.162  1.00 27.21 ? 52   TYR B O     1 
ATOM   5266  C CB    . TYR B 1 52  ? 67.087  135.649 55.077  1.00 27.50 ? 52   TYR B CB    1 
ATOM   5267  C CG    . TYR B 1 52  ? 68.452  135.005 55.003  1.00 27.59 ? 52   TYR B CG    1 
ATOM   5268  C CD1   . TYR B 1 52  ? 69.609  135.774 54.861  1.00 28.49 ? 52   TYR B CD1   1 
ATOM   5269  C CD2   . TYR B 1 52  ? 68.585  133.622 55.093  1.00 26.57 ? 52   TYR B CD2   1 
ATOM   5270  C CE1   . TYR B 1 52  ? 70.867  135.181 54.793  1.00 29.07 ? 52   TYR B CE1   1 
ATOM   5271  C CE2   . TYR B 1 52  ? 69.828  133.018 55.027  1.00 28.51 ? 52   TYR B CE2   1 
ATOM   5272  C CZ    . TYR B 1 52  ? 70.968  133.796 54.883  1.00 29.17 ? 52   TYR B CZ    1 
ATOM   5273  O OH    . TYR B 1 52  ? 72.200  133.175 54.826  1.00 27.98 ? 52   TYR B OH    1 
ATOM   5274  N N     . GLN B 1 53  ? 66.727  138.228 53.399  1.00 27.28 ? 53   GLN B N     1 
ATOM   5275  C CA    . GLN B 1 53  ? 67.491  139.409 53.039  1.00 28.21 ? 53   GLN B CA    1 
ATOM   5276  C C     . GLN B 1 53  ? 68.100  140.040 54.304  1.00 28.49 ? 53   GLN B C     1 
ATOM   5277  O O     . GLN B 1 53  ? 69.313  140.276 54.358  1.00 29.23 ? 53   GLN B O     1 
ATOM   5278  C CB    . GLN B 1 53  ? 66.618  140.408 52.255  1.00 27.70 ? 53   GLN B CB    1 
ATOM   5279  N N     . LYS B 1 54  ? 67.263  140.306 55.310  1.00 28.50 ? 54   LYS B N     1 
ATOM   5280  C CA    . LYS B 1 54  ? 67.721  140.811 56.620  1.00 28.41 ? 54   LYS B CA    1 
ATOM   5281  C C     . LYS B 1 54  ? 68.366  139.680 57.426  1.00 28.23 ? 54   LYS B C     1 
ATOM   5282  O O     . LYS B 1 54  ? 67.889  138.535 57.401  1.00 27.95 ? 54   LYS B O     1 
ATOM   5283  C CB    . LYS B 1 54  ? 66.550  141.415 57.415  1.00 28.67 ? 54   LYS B CB    1 
ATOM   5284  N N     . VAL B 1 55  ? 69.448  140.003 58.133  1.00 27.90 ? 55   VAL B N     1 
ATOM   5285  C CA    . VAL B 1 55  ? 70.171  139.011 58.928  1.00 28.07 ? 55   VAL B CA    1 
ATOM   5286  C C     . VAL B 1 55  ? 69.903  139.182 60.438  1.00 27.92 ? 55   VAL B C     1 
ATOM   5287  O O     . VAL B 1 55  ? 69.034  138.510 60.965  1.00 28.16 ? 55   VAL B O     1 
ATOM   5288  C CB    . VAL B 1 55  ? 71.686  138.997 58.600  1.00 28.31 ? 55   VAL B CB    1 
ATOM   5289  C CG1   . VAL B 1 55  ? 72.406  137.910 59.427  1.00 27.91 ? 55   VAL B CG1   1 
ATOM   5290  C CG2   . VAL B 1 55  ? 71.909  138.776 57.092  1.00 27.15 ? 55   VAL B CG2   1 
ATOM   5291  N N     . LYS B 1 56  ? 70.619  140.098 61.099  1.00 27.40 ? 56   LYS B N     1 
ATOM   5292  C CA    . LYS B 1 56  ? 70.489  140.348 62.541  1.00 27.16 ? 56   LYS B CA    1 
ATOM   5293  C C     . LYS B 1 56  ? 69.501  141.462 62.905  1.00 27.43 ? 56   LYS B C     1 
ATOM   5294  O O     . LYS B 1 56  ? 69.641  142.591 62.461  1.00 26.82 ? 56   LYS B O     1 
ATOM   5295  C CB    . LYS B 1 56  ? 71.862  140.687 63.111  1.00 26.92 ? 56   LYS B CB    1 
ATOM   5296  C CG    . LYS B 1 56  ? 71.907  141.042 64.593  1.00 26.78 ? 56   LYS B CG    1 
ATOM   5297  C CD    . LYS B 1 56  ? 73.365  141.066 65.054  1.00 26.28 ? 56   LYS B CD    1 
ATOM   5298  C CE    . LYS B 1 56  ? 73.510  141.173 66.549  1.00 27.34 ? 56   LYS B CE    1 
ATOM   5299  N NZ    . LYS B 1 56  ? 73.096  142.505 67.026  1.00 28.81 ? 56   LYS B NZ    1 
ATOM   5300  N N     . ASN B 1 57  ? 68.516  141.149 63.743  1.00 27.36 ? 57   ASN B N     1 
ATOM   5301  C CA    . ASN B 1 57  ? 67.553  142.167 64.183  1.00 27.55 ? 57   ASN B CA    1 
ATOM   5302  C C     . ASN B 1 57  ? 67.224  141.968 65.674  1.00 27.53 ? 57   ASN B C     1 
ATOM   5303  O O     . ASN B 1 57  ? 66.156  141.465 66.045  1.00 27.30 ? 57   ASN B O     1 
ATOM   5304  C CB    . ASN B 1 57  ? 66.312  142.171 63.263  1.00 26.83 ? 57   ASN B CB    1 
ATOM   5305  C CG    . ASN B 1 57  ? 65.343  143.308 63.557  1.00 27.49 ? 57   ASN B CG    1 
ATOM   5306  O OD1   . ASN B 1 57  ? 65.641  144.216 64.313  1.00 28.99 ? 57   ASN B OD1   1 
ATOM   5307  N ND2   . ASN B 1 57  ? 64.171  143.266 62.926  1.00 27.36 ? 57   ASN B ND2   1 
ATOM   5308  N N     . THR B 1 58  ? 68.165  142.383 66.523  1.00 27.74 ? 58   THR B N     1 
ATOM   5309  C CA    . THR B 1 58  ? 68.137  142.026 67.944  1.00 27.57 ? 58   THR B CA    1 
ATOM   5310  C C     . THR B 1 58  ? 68.243  143.236 68.877  1.00 28.11 ? 58   THR B C     1 
ATOM   5311  O O     . THR B 1 58  ? 68.812  144.275 68.515  1.00 27.95 ? 58   THR B O     1 
ATOM   5312  C CB    . THR B 1 58  ? 69.224  140.945 68.302  1.00 27.82 ? 58   THR B CB    1 
ATOM   5313  O OG1   . THR B 1 58  ? 70.537  141.511 68.221  1.00 27.62 ? 58   THR B OG1   1 
ATOM   5314  C CG2   . THR B 1 58  ? 69.139  139.723 67.365  1.00 26.33 ? 58   THR B CG2   1 
ATOM   5315  N N     . SER B 1 59  ? 67.658  143.093 70.068  1.00 28.62 ? 59   SER B N     1 
ATOM   5316  C CA    . SER B 1 59  ? 67.700  144.113 71.126  1.00 29.20 ? 59   SER B CA    1 
ATOM   5317  C C     . SER B 1 59  ? 67.716  143.400 72.472  1.00 29.19 ? 59   SER B C     1 
ATOM   5318  O O     . SER B 1 59  ? 66.957  142.460 72.673  1.00 29.10 ? 59   SER B O     1 
ATOM   5319  C CB    . SER B 1 59  ? 66.484  145.053 71.032  1.00 29.38 ? 59   SER B CB    1 
ATOM   5320  O OG    . SER B 1 59  ? 66.463  146.017 72.079  1.00 28.57 ? 59   SER B OG    1 
ATOM   5321  N N     . PHE B 1 60  ? 68.594  143.841 73.370  1.00 29.57 ? 60   PHE B N     1 
ATOM   5322  C CA    . PHE B 1 60  ? 68.652  143.331 74.745  1.00 30.07 ? 60   PHE B CA    1 
ATOM   5323  C C     . PHE B 1 60  ? 68.153  144.395 75.738  1.00 31.35 ? 60   PHE B C     1 
ATOM   5324  O O     . PHE B 1 60  ? 68.308  144.231 76.967  1.00 30.96 ? 60   PHE B O     1 
ATOM   5325  C CB    . PHE B 1 60  ? 70.088  142.900 75.129  1.00 29.34 ? 60   PHE B CB    1 
ATOM   5326  C CG    . PHE B 1 60  ? 70.543  141.583 74.515  1.00 28.28 ? 60   PHE B CG    1 
ATOM   5327  C CD1   . PHE B 1 60  ? 71.848  141.157 74.682  1.00 28.25 ? 60   PHE B CD1   1 
ATOM   5328  C CD2   . PHE B 1 60  ? 69.689  140.786 73.761  1.00 27.05 ? 60   PHE B CD2   1 
ATOM   5329  C CE1   . PHE B 1 60  ? 72.284  139.941 74.137  1.00 27.24 ? 60   PHE B CE1   1 
ATOM   5330  C CE2   . PHE B 1 60  ? 70.129  139.580 73.199  1.00 25.68 ? 60   PHE B CE2   1 
ATOM   5331  C CZ    . PHE B 1 60  ? 71.415  139.166 73.385  1.00 26.30 ? 60   PHE B CZ    1 
ATOM   5332  N N     . ALA B 1 61  ? 67.569  145.479 75.204  1.00 32.29 ? 61   ALA B N     1 
ATOM   5333  C CA    . ALA B 1 61  ? 67.175  146.636 76.010  1.00 33.45 ? 61   ALA B CA    1 
ATOM   5334  C C     . ALA B 1 61  ? 66.075  146.304 77.040  1.00 34.05 ? 61   ALA B C     1 
ATOM   5335  O O     . ALA B 1 61  ? 65.222  145.461 76.764  1.00 34.19 ? 61   ALA B O     1 
ATOM   5336  C CB    . ALA B 1 61  ? 66.768  147.787 75.120  1.00 33.65 ? 61   ALA B CB    1 
ATOM   5337  N N     . PRO B 1 62  ? 66.128  146.939 78.241  1.00 34.48 ? 62   PRO B N     1 
ATOM   5338  C CA    . PRO B 1 62  ? 65.369  146.558 79.458  1.00 35.24 ? 62   PRO B CA    1 
ATOM   5339  C C     . PRO B 1 62  ? 63.876  146.215 79.315  1.00 35.91 ? 62   PRO B C     1 
ATOM   5340  O O     . PRO B 1 62  ? 63.107  147.011 78.760  1.00 35.65 ? 62   PRO B O     1 
ATOM   5341  C CB    . PRO B 1 62  ? 65.595  147.750 80.385  1.00 35.27 ? 62   PRO B CB    1 
ATOM   5342  C CG    . PRO B 1 62  ? 66.972  148.174 80.029  1.00 34.58 ? 62   PRO B CG    1 
ATOM   5343  C CD    . PRO B 1 62  ? 67.027  148.070 78.531  1.00 34.09 ? 62   PRO B CD    1 
ATOM   5344  N N     . GLY B 1 63  ? 63.515  145.015 79.814  1.00 36.55 ? 63   GLY B N     1 
ATOM   5345  C CA    . GLY B 1 63  ? 62.170  144.416 79.690  1.00 37.19 ? 63   GLY B CA    1 
ATOM   5346  C C     . GLY B 1 63  ? 61.506  144.700 78.346  1.00 37.85 ? 63   GLY B C     1 
ATOM   5347  O O     . GLY B 1 63  ? 60.271  144.888 78.259  1.00 38.13 ? 63   GLY B O     1 
ATOM   5348  N N     . ASN B 1 64  ? 62.350  144.759 77.308  1.00 37.49 ? 64   ASN B N     1 
ATOM   5349  C CA    . ASN B 1 64  ? 61.964  145.027 75.913  1.00 36.20 ? 64   ASN B CA    1 
ATOM   5350  C C     . ASN B 1 64  ? 62.978  144.333 74.966  1.00 35.10 ? 64   ASN B C     1 
ATOM   5351  O O     . ASN B 1 64  ? 63.682  144.963 74.162  1.00 34.92 ? 64   ASN B O     1 
ATOM   5352  C CB    . ASN B 1 64  ? 61.846  146.522 75.678  1.00 35.96 ? 64   ASN B CB    1 
ATOM   5353  C CG    . ASN B 1 64  ? 60.559  147.112 76.273  1.00 36.57 ? 64   ASN B CG    1 
ATOM   5354  O OD1   . ASN B 1 64  ? 59.447  146.662 75.967  1.00 35.89 ? 64   ASN B OD1   1 
ATOM   5355  N ND2   . ASN B 1 64  ? 60.709  148.134 77.115  1.00 36.36 ? 64   ASN B ND2   1 
ATOM   5356  N N     . VAL B 1 65  ? 63.038  143.011 75.118  1.00 33.01 ? 65   VAL B N     1 
ATOM   5357  C CA    . VAL B 1 65  ? 63.993  142.156 74.435  1.00 31.12 ? 65   VAL B CA    1 
ATOM   5358  C C     . VAL B 1 65  ? 63.333  141.551 73.190  1.00 30.17 ? 65   VAL B C     1 
ATOM   5359  O O     . VAL B 1 65  ? 62.219  141.007 73.264  1.00 29.84 ? 65   VAL B O     1 
ATOM   5360  C CB    . VAL B 1 65  ? 64.468  141.022 75.390  1.00 31.47 ? 65   VAL B CB    1 
ATOM   5361  C CG1   . VAL B 1 65  ? 65.449  140.090 74.692  1.00 30.42 ? 65   VAL B CG1   1 
ATOM   5362  C CG2   . VAL B 1 65  ? 65.054  141.616 76.688  1.00 30.69 ? 65   VAL B CG2   1 
ATOM   5363  N N     . SER B 1 66  ? 64.013  141.661 72.049  1.00 28.84 ? 66   SER B N     1 
ATOM   5364  C CA    . SER B 1 66  ? 63.509  141.121 70.780  1.00 27.61 ? 66   SER B CA    1 
ATOM   5365  C C     . SER B 1 66  ? 64.672  140.553 69.985  1.00 26.77 ? 66   SER B C     1 
ATOM   5366  O O     . SER B 1 66  ? 65.605  141.269 69.622  1.00 26.29 ? 66   SER B O     1 
ATOM   5367  C CB    . SER B 1 66  ? 62.803  142.216 69.965  1.00 28.16 ? 66   SER B CB    1 
ATOM   5368  O OG    . SER B 1 66  ? 62.054  141.649 68.900  1.00 28.54 ? 66   SER B OG    1 
ATOM   5369  N N     . ILE B 1 67  ? 64.607  139.258 69.708  1.00 25.85 ? 67   ILE B N     1 
ATOM   5370  C CA    . ILE B 1 67  ? 65.696  138.550 69.037  1.00 25.20 ? 67   ILE B CA    1 
ATOM   5371  C C     . ILE B 1 67  ? 65.173  137.947 67.746  1.00 24.53 ? 67   ILE B C     1 
ATOM   5372  O O     . ILE B 1 67  ? 64.314  137.048 67.752  1.00 24.53 ? 67   ILE B O     1 
ATOM   5373  C CB    . ILE B 1 67  ? 66.307  137.445 69.966  1.00 25.33 ? 67   ILE B CB    1 
ATOM   5374  C CG1   . ILE B 1 67  ? 66.910  138.076 71.223  1.00 25.06 ? 67   ILE B CG1   1 
ATOM   5375  C CG2   . ILE B 1 67  ? 67.365  136.609 69.252  1.00 24.75 ? 67   ILE B CG2   1 
ATOM   5376  C CD1   . ILE B 1 67  ? 66.635  137.270 72.491  1.00 23.96 ? 67   ILE B CD1   1 
ATOM   5377  N N     . LYS B 1 68  ? 65.678  138.462 66.635  1.00 23.56 ? 68   LYS B N     1 
ATOM   5378  C CA    . LYS B 1 68  ? 65.278  137.981 65.331  1.00 22.95 ? 68   LYS B CA    1 
ATOM   5379  C C     . LYS B 1 68  ? 66.473  137.814 64.417  1.00 22.38 ? 68   LYS B C     1 
ATOM   5380  O O     . LYS B 1 68  ? 67.319  138.692 64.319  1.00 22.64 ? 68   LYS B O     1 
ATOM   5381  C CB    . LYS B 1 68  ? 64.263  138.935 64.697  1.00 22.98 ? 68   LYS B CB    1 
ATOM   5382  C CG    . LYS B 1 68  ? 62.904  138.889 65.315  1.00 23.96 ? 68   LYS B CG    1 
ATOM   5383  C CD    . LYS B 1 68  ? 62.080  140.096 64.884  1.00 26.81 ? 68   LYS B CD    1 
ATOM   5384  C CE    . LYS B 1 68  ? 60.669  139.967 65.413  1.00 28.94 ? 68   LYS B CE    1 
ATOM   5385  N NZ    . LYS B 1 68  ? 59.799  141.082 64.958  1.00 32.54 ? 68   LYS B NZ    1 
ATOM   5386  N N     . TRP B 1 69  ? 66.511  136.682 63.737  1.00 21.86 ? 69   TRP B N     1 
ATOM   5387  C CA    . TRP B 1 69  ? 67.574  136.339 62.818  1.00 21.91 ? 69   TRP B CA    1 
ATOM   5388  C C     . TRP B 1 69  ? 66.971  135.764 61.550  1.00 22.47 ? 69   TRP B C     1 
ATOM   5389  O O     . TRP B 1 69  ? 66.058  134.902 61.612  1.00 22.41 ? 69   TRP B O     1 
ATOM   5390  C CB    . TRP B 1 69  ? 68.491  135.280 63.450  1.00 21.39 ? 69   TRP B CB    1 
ATOM   5391  C CG    . TRP B 1 69  ? 69.415  135.832 64.493  1.00 20.89 ? 69   TRP B CG    1 
ATOM   5392  C CD1   . TRP B 1 69  ? 69.177  135.925 65.840  1.00 20.81 ? 69   TRP B CD1   1 
ATOM   5393  C CD2   . TRP B 1 69  ? 70.718  136.384 64.274  1.00 19.84 ? 69   TRP B CD2   1 
ATOM   5394  N NE1   . TRP B 1 69  ? 70.250  136.509 66.467  1.00 21.84 ? 69   TRP B NE1   1 
ATOM   5395  C CE2   . TRP B 1 69  ? 71.216  136.789 65.534  1.00 21.10 ? 69   TRP B CE2   1 
ATOM   5396  C CE3   . TRP B 1 69  ? 71.505  136.598 63.130  1.00 20.47 ? 69   TRP B CE3   1 
ATOM   5397  C CZ2   . TRP B 1 69  ? 72.486  137.384 65.690  1.00 21.77 ? 69   TRP B CZ2   1 
ATOM   5398  C CZ3   . TRP B 1 69  ? 72.755  137.170 63.274  1.00 20.46 ? 69   TRP B CZ3   1 
ATOM   5399  C CH2   . TRP B 1 69  ? 73.246  137.555 64.557  1.00 20.68 ? 69   TRP B CH2   1 
ATOM   5400  N N     . TYR B 1 70  ? 67.500  136.216 60.409  1.00 22.37 ? 70   TYR B N     1 
ATOM   5401  C CA    . TYR B 1 70  ? 67.073  135.747 59.080  1.00 22.69 ? 70   TYR B CA    1 
ATOM   5402  C C     . TYR B 1 70  ? 65.556  135.886 58.868  1.00 22.99 ? 70   TYR B C     1 
ATOM   5403  O O     . TYR B 1 70  ? 64.941  135.105 58.135  1.00 22.42 ? 70   TYR B O     1 
ATOM   5404  C CB    . TYR B 1 70  ? 67.481  134.276 58.880  1.00 22.94 ? 70   TYR B CB    1 
ATOM   5405  C CG    . TYR B 1 70  ? 68.955  133.972 59.081  1.00 23.18 ? 70   TYR B CG    1 
ATOM   5406  C CD1   . TYR B 1 70  ? 69.377  133.087 60.090  1.00 23.80 ? 70   TYR B CD1   1 
ATOM   5407  C CD2   . TYR B 1 70  ? 69.927  134.567 58.276  1.00 22.61 ? 70   TYR B CD2   1 
ATOM   5408  C CE1   . TYR B 1 70  ? 70.749  132.796 60.276  1.00 24.73 ? 70   TYR B CE1   1 
ATOM   5409  C CE2   . TYR B 1 70  ? 71.304  134.277 58.455  1.00 24.07 ? 70   TYR B CE2   1 
ATOM   5410  C CZ    . TYR B 1 70  ? 71.697  133.394 59.444  1.00 23.30 ? 70   TYR B CZ    1 
ATOM   5411  O OH    . TYR B 1 70  ? 73.035  133.113 59.611  1.00 23.99 ? 70   TYR B OH    1 
ATOM   5412  N N     . GLU B 1 71  ? 64.959  136.891 59.502  1.00 23.30 ? 71   GLU B N     1 
ATOM   5413  C CA    . GLU B 1 71  ? 63.509  136.880 59.749  1.00 23.99 ? 71   GLU B CA    1 
ATOM   5414  C C     . GLU B 1 71  ? 62.604  136.805 58.513  1.00 24.40 ? 71   GLU B C     1 
ATOM   5415  O O     . GLU B 1 71  ? 61.471  136.350 58.637  1.00 24.25 ? 71   GLU B O     1 
ATOM   5416  C CB    . GLU B 1 71  ? 63.094  138.058 60.626  1.00 24.09 ? 71   GLU B CB    1 
ATOM   5417  C CG    . GLU B 1 71  ? 63.009  139.388 59.842  1.00 25.43 ? 71   GLU B CG    1 
ATOM   5418  C CD    . GLU B 1 71  ? 62.997  140.576 60.740  1.00 26.44 ? 71   GLU B CD    1 
ATOM   5419  O OE1   . GLU B 1 71  ? 64.032  140.858 61.383  1.00 27.63 ? 71   GLU B OE1   1 
ATOM   5420  O OE2   . GLU B 1 71  ? 61.956  141.241 60.795  1.00 28.59 ? 71   GLU B OE2   1 
ATOM   5421  N N     . ASP B 1 72  ? 63.080  137.263 57.348  1.00 24.99 ? 72   ASP B N     1 
ATOM   5422  C CA    . ASP B 1 72  ? 62.264  137.188 56.131  1.00 25.80 ? 72   ASP B CA    1 
ATOM   5423  C C     . ASP B 1 72  ? 62.492  135.915 55.291  1.00 25.39 ? 72   ASP B C     1 
ATOM   5424  O O     . ASP B 1 72  ? 61.881  135.730 54.251  1.00 26.20 ? 72   ASP B O     1 
ATOM   5425  C CB    . ASP B 1 72  ? 62.344  138.492 55.285  1.00 26.45 ? 72   ASP B CB    1 
ATOM   5426  C CG    . ASP B 1 72  ? 63.782  138.931 54.971  1.00 28.54 ? 72   ASP B CG    1 
ATOM   5427  O OD1   . ASP B 1 72  ? 64.757  138.215 55.293  1.00 32.93 ? 72   ASP B OD1   1 
ATOM   5428  O OD2   . ASP B 1 72  ? 63.939  140.022 54.391  1.00 31.35 ? 72   ASP B OD2   1 
ATOM   5429  N N     . GLY B 1 73  ? 63.361  135.034 55.750  1.00 25.33 ? 73   GLY B N     1 
ATOM   5430  C CA    . GLY B 1 73  ? 63.569  133.772 55.070  1.00 24.49 ? 73   GLY B CA    1 
ATOM   5431  C C     . GLY B 1 73  ? 62.561  132.737 55.503  1.00 24.07 ? 73   GLY B C     1 
ATOM   5432  O O     . GLY B 1 73  ? 61.939  132.862 56.555  1.00 24.29 ? 73   GLY B O     1 
ATOM   5433  N N     . THR B 1 74  ? 62.374  131.727 54.666  1.00 23.47 ? 74   THR B N     1 
ATOM   5434  C CA    . THR B 1 74  ? 61.533  130.596 55.001  1.00 22.99 ? 74   THR B CA    1 
ATOM   5435  C C     . THR B 1 74  ? 62.347  129.352 54.683  1.00 23.40 ? 74   THR B C     1 
ATOM   5436  O O     . THR B 1 74  ? 63.241  129.392 53.819  1.00 23.45 ? 74   THR B O     1 
ATOM   5437  C CB    . THR B 1 74  ? 60.160  130.563 54.224  1.00 22.91 ? 74   THR B CB    1 
ATOM   5438  O OG1   . THR B 1 74  ? 60.396  130.396 52.829  1.00 23.18 ? 74   THR B OG1   1 
ATOM   5439  C CG2   . THR B 1 74  ? 59.325  131.827 54.443  1.00 21.71 ? 74   THR B CG2   1 
ATOM   5440  N N     . LEU B 1 75  ? 62.045  128.255 55.391  1.00 22.92 ? 75   LEU B N     1 
ATOM   5441  C CA    . LEU B 1 75  ? 62.811  127.027 55.301  1.00 21.89 ? 75   LEU B CA    1 
ATOM   5442  C C     . LEU B 1 75  ? 62.049  125.895 55.981  1.00 22.47 ? 75   LEU B C     1 
ATOM   5443  O O     . LEU B 1 75  ? 61.030  126.121 56.644  1.00 22.61 ? 75   LEU B O     1 
ATOM   5444  C CB    . LEU B 1 75  ? 64.177  127.203 55.991  1.00 21.91 ? 75   LEU B CB    1 
ATOM   5445  C CG    . LEU B 1 75  ? 64.293  127.152 57.534  1.00 20.00 ? 75   LEU B CG    1 
ATOM   5446  C CD1   . LEU B 1 75  ? 65.755  126.891 57.958  1.00 20.30 ? 75   LEU B CD1   1 
ATOM   5447  C CD2   . LEU B 1 75  ? 63.749  128.407 58.230  1.00 17.84 ? 75   LEU B CD2   1 
ATOM   5448  N N     . ASN B 1 76  ? 62.568  124.680 55.848  1.00 22.08 ? 76   ASN B N     1 
ATOM   5449  C CA    . ASN B 1 76  ? 62.016  123.547 56.572  1.00 21.60 ? 76   ASN B CA    1 
ATOM   5450  C C     . ASN B 1 76  ? 63.170  122.780 57.226  1.00 21.45 ? 76   ASN B C     1 
ATOM   5451  O O     . ASN B 1 76  ? 64.153  122.465 56.563  1.00 21.06 ? 76   ASN B O     1 
ATOM   5452  C CB    . ASN B 1 76  ? 61.175  122.674 55.635  1.00 21.14 ? 76   ASN B CB    1 
ATOM   5453  C CG    . ASN B 1 76  ? 60.358  121.640 56.383  1.00 21.60 ? 76   ASN B CG    1 
ATOM   5454  O OD1   . ASN B 1 76  ? 59.142  121.790 56.555  1.00 22.95 ? 76   ASN B OD1   1 
ATOM   5455  N ND2   . ASN B 1 76  ? 61.019  120.595 56.849  1.00 17.82 ? 76   ASN B ND2   1 
ATOM   5456  N N     . LEU B 1 77  ? 63.076  122.534 58.536  1.00 21.56 ? 77   LEU B N     1 
ATOM   5457  C CA    . LEU B 1 77  ? 64.148  121.820 59.249  1.00 20.83 ? 77   LEU B CA    1 
ATOM   5458  C C     . LEU B 1 77  ? 64.323  120.398 58.741  1.00 21.26 ? 77   LEU B C     1 
ATOM   5459  O O     . LEU B 1 77  ? 65.461  119.927 58.589  1.00 21.26 ? 77   LEU B O     1 
ATOM   5460  C CB    . LEU B 1 77  ? 63.917  121.806 60.766  1.00 20.86 ? 77   LEU B CB    1 
ATOM   5461  C CG    . LEU B 1 77  ? 64.949  120.955 61.551  1.00 20.03 ? 77   LEU B CG    1 
ATOM   5462  C CD1   . LEU B 1 77  ? 65.312  121.574 62.894  1.00 19.75 ? 77   LEU B CD1   1 
ATOM   5463  C CD2   . LEU B 1 77  ? 64.490  119.495 61.706  1.00 18.26 ? 77   LEU B CD2   1 
ATOM   5464  N N     . ALA B 1 78  ? 63.199  119.710 58.499  1.00 21.15 ? 78   ALA B N     1 
ATOM   5465  C CA    . ALA B 1 78  ? 63.227  118.315 58.059  1.00 21.20 ? 78   ALA B CA    1 
ATOM   5466  C C     . ALA B 1 78  ? 63.812  118.192 56.651  1.00 21.58 ? 78   ALA B C     1 
ATOM   5467  O O     . ALA B 1 78  ? 64.575  117.270 56.377  1.00 22.63 ? 78   ALA B O     1 
ATOM   5468  C CB    . ALA B 1 78  ? 61.849  117.694 58.139  1.00 21.00 ? 78   ALA B CB    1 
ATOM   5469  N N     . ALA B 1 79  ? 63.502  119.139 55.767  1.00 21.90 ? 79   ALA B N     1 
ATOM   5470  C CA    . ALA B 1 79  ? 64.120  119.174 54.430  1.00 22.20 ? 79   ALA B CA    1 
ATOM   5471  C C     . ALA B 1 79  ? 65.645  119.335 54.496  1.00 22.08 ? 79   ALA B C     1 
ATOM   5472  O O     . ALA B 1 79  ? 66.357  118.769 53.685  1.00 22.96 ? 79   ALA B O     1 
ATOM   5473  C CB    . ALA B 1 79  ? 63.468  120.280 53.529  1.00 21.89 ? 79   ALA B CB    1 
ATOM   5474  N N     . ASN B 1 80  ? 66.129  120.099 55.468  1.00 21.90 ? 80   ASN B N     1 
ATOM   5475  C CA    . ASN B 1 80  ? 67.565  120.281 55.692  1.00 22.06 ? 80   ASN B CA    1 
ATOM   5476  C C     . ASN B 1 80  ? 68.243  119.048 56.324  1.00 22.03 ? 80   ASN B C     1 
ATOM   5477  O O     . ASN B 1 80  ? 69.419  118.749 56.053  1.00 22.14 ? 80   ASN B O     1 
ATOM   5478  C CB    . ASN B 1 80  ? 67.814  121.545 56.539  1.00 22.08 ? 80   ASN B CB    1 
ATOM   5479  C CG    . ASN B 1 80  ? 67.908  122.790 55.688  1.00 23.24 ? 80   ASN B CG    1 
ATOM   5480  O OD1   . ASN B 1 80  ? 68.955  123.051 55.086  1.00 22.44 ? 80   ASN B OD1   1 
ATOM   5481  N ND2   . ASN B 1 80  ? 66.806  123.555 55.598  1.00 21.30 ? 80   ASN B ND2   1 
ATOM   5482  N N     . CYS B 1 81  ? 67.477  118.315 57.127  1.00 21.70 ? 81   CYS B N     1 
ATOM   5483  C CA    . CYS B 1 81  ? 67.993  117.148 57.845  1.00 21.33 ? 81   CYS B CA    1 
ATOM   5484  C C     . CYS B 1 81  ? 67.830  115.852 57.055  1.00 21.04 ? 81   CYS B C     1 
ATOM   5485  O O     . CYS B 1 81  ? 68.513  114.880 57.330  1.00 20.44 ? 81   CYS B O     1 
ATOM   5486  C CB    . CYS B 1 81  ? 67.338  117.050 59.242  1.00 21.34 ? 81   CYS B CB    1 
ATOM   5487  S SG    . CYS B 1 81  ? 67.834  118.406 60.320  1.00 21.17 ? 81   CYS B SG    1 
ATOM   5488  N N     . LEU B 1 82  ? 66.966  115.859 56.042  1.00 21.41 ? 82   LEU B N     1 
ATOM   5489  C CA    . LEU B 1 82  ? 66.590  114.620 55.333  1.00 21.44 ? 82   LEU B CA    1 
ATOM   5490  C C     . LEU B 1 82  ? 66.556  114.754 53.802  1.00 21.88 ? 82   LEU B C     1 
ATOM   5491  O O     . LEU B 1 82  ? 67.446  114.237 53.103  1.00 21.29 ? 82   LEU B O     1 
ATOM   5492  C CB    . LEU B 1 82  ? 65.239  114.086 55.868  1.00 20.96 ? 82   LEU B CB    1 
ATOM   5493  C CG    . LEU B 1 82  ? 65.094  113.942 57.403  1.00 20.77 ? 82   LEU B CG    1 
ATOM   5494  C CD1   . LEU B 1 82  ? 63.650  113.747 57.887  1.00 18.72 ? 82   LEU B CD1   1 
ATOM   5495  C CD2   . LEU B 1 82  ? 65.982  112.806 57.927  1.00 18.56 ? 82   LEU B CD2   1 
ATOM   5496  N N     . ASP B 1 83  ? 65.512  115.425 53.290  1.00 22.48 ? 83   ASP B N     1 
ATOM   5497  C CA    . ASP B 1 83  ? 65.256  115.543 51.843  1.00 22.81 ? 83   ASP B CA    1 
ATOM   5498  C C     . ASP B 1 83  ? 66.485  115.949 51.039  1.00 23.30 ? 83   ASP B C     1 
ATOM   5499  O O     . ASP B 1 83  ? 66.776  115.336 50.024  1.00 23.41 ? 83   ASP B O     1 
ATOM   5500  C CB    . ASP B 1 83  ? 64.104  116.532 51.540  1.00 22.69 ? 83   ASP B CB    1 
ATOM   5501  C CG    . ASP B 1 83  ? 62.840  116.216 52.310  1.00 22.32 ? 83   ASP B CG    1 
ATOM   5502  O OD1   . ASP B 1 83  ? 61.792  116.042 51.673  1.00 21.81 ? 83   ASP B OD1   1 
ATOM   5503  O OD2   . ASP B 1 83  ? 62.886  116.122 53.558  1.00 23.79 ? 83   ASP B OD2   1 
ATOM   5504  N N     . ARG B 1 84  ? 67.198  116.978 51.497  1.00 23.92 ? 84   ARG B N     1 
ATOM   5505  C CA    . ARG B 1 84  ? 68.316  117.527 50.730  1.00 25.00 ? 84   ARG B CA    1 
ATOM   5506  C C     . ARG B 1 84  ? 69.505  116.567 50.584  1.00 25.77 ? 84   ARG B C     1 
ATOM   5507  O O     . ARG B 1 84  ? 70.366  116.768 49.706  1.00 25.62 ? 84   ARG B O     1 
ATOM   5508  C CB    . ARG B 1 84  ? 68.761  118.899 51.267  1.00 24.98 ? 84   ARG B CB    1 
ATOM   5509  C CG    . ARG B 1 84  ? 69.523  118.879 52.576  1.00 23.91 ? 84   ARG B CG    1 
ATOM   5510  C CD    . ARG B 1 84  ? 70.111  120.255 52.808  1.00 22.13 ? 84   ARG B CD    1 
ATOM   5511  N NE    . ARG B 1 84  ? 70.834  120.391 54.072  1.00 19.49 ? 84   ARG B NE    1 
ATOM   5512  C CZ    . ARG B 1 84  ? 71.679  121.387 54.320  1.00 19.59 ? 84   ARG B CZ    1 
ATOM   5513  N NH1   . ARG B 1 84  ? 71.901  122.307 53.381  1.00 15.49 ? 84   ARG B NH1   1 
ATOM   5514  N NH2   . ARG B 1 84  ? 72.310  121.471 55.497  1.00 16.65 ? 84   ARG B NH2   1 
ATOM   5515  N N     . HIS B 1 85  ? 69.538  115.527 51.428  1.00 26.52 ? 85   HIS B N     1 
ATOM   5516  C CA    . HIS B 1 85  ? 70.621  114.527 51.403  1.00 27.12 ? 85   HIS B CA    1 
ATOM   5517  C C     . HIS B 1 85  ? 70.307  113.274 50.553  1.00 28.33 ? 85   HIS B C     1 
ATOM   5518  O O     . HIS B 1 85  ? 71.185  112.442 50.333  1.00 28.68 ? 85   HIS B O     1 
ATOM   5519  C CB    . HIS B 1 85  ? 71.013  114.106 52.828  1.00 26.82 ? 85   HIS B CB    1 
ATOM   5520  C CG    . HIS B 1 85  ? 71.339  115.247 53.741  1.00 24.22 ? 85   HIS B CG    1 
ATOM   5521  N ND1   . HIS B 1 85  ? 72.431  116.069 53.551  1.00 23.43 ? 85   HIS B ND1   1 
ATOM   5522  C CD2   . HIS B 1 85  ? 70.727  115.690 54.863  1.00 23.15 ? 85   HIS B CD2   1 
ATOM   5523  C CE1   . HIS B 1 85  ? 72.471  116.976 54.511  1.00 23.27 ? 85   HIS B CE1   1 
ATOM   5524  N NE2   . HIS B 1 85  ? 71.451  116.763 55.325  1.00 24.81 ? 85   HIS B NE2   1 
ATOM   5525  N N     . LEU B 1 86  ? 69.077  113.168 50.052  1.00 29.59 ? 86   LEU B N     1 
ATOM   5526  C CA    . LEU B 1 86  ? 68.604  111.981 49.329  1.00 31.11 ? 86   LEU B CA    1 
ATOM   5527  C C     . LEU B 1 86  ? 69.285  111.719 47.985  1.00 32.42 ? 86   LEU B C     1 
ATOM   5528  O O     . LEU B 1 86  ? 69.637  110.580 47.685  1.00 32.46 ? 86   LEU B O     1 
ATOM   5529  C CB    . LEU B 1 86  ? 67.081  112.041 49.107  1.00 31.05 ? 86   LEU B CB    1 
ATOM   5530  C CG    . LEU B 1 86  ? 66.120  111.973 50.305  1.00 31.01 ? 86   LEU B CG    1 
ATOM   5531  C CD1   . LEU B 1 86  ? 64.693  111.772 49.810  1.00 30.11 ? 86   LEU B CD1   1 
ATOM   5532  C CD2   . LEU B 1 86  ? 66.513  110.854 51.264  1.00 30.14 ? 86   LEU B CD2   1 
ATOM   5533  N N     . GLN B 1 87  ? 69.454  112.770 47.179  1.00 33.84 ? 87   GLN B N     1 
ATOM   5534  C CA    . GLN B 1 87  ? 69.889  112.611 45.787  1.00 35.41 ? 87   GLN B CA    1 
ATOM   5535  C C     . GLN B 1 87  ? 71.308  112.047 45.699  1.00 35.27 ? 87   GLN B C     1 
ATOM   5536  O O     . GLN B 1 87  ? 71.602  111.242 44.821  1.00 35.54 ? 87   GLN B O     1 
ATOM   5537  C CB    . GLN B 1 87  ? 69.779  113.939 45.029  1.00 35.23 ? 87   GLN B CB    1 
ATOM   5538  C CG    . GLN B 1 87  ? 68.958  113.848 43.740  1.00 37.39 ? 87   GLN B CG    1 
ATOM   5539  C CD    . GLN B 1 87  ? 68.708  115.217 43.104  1.00 36.85 ? 87   GLN B CD    1 
ATOM   5540  O OE1   . GLN B 1 87  ? 67.598  115.763 43.184  1.00 38.01 ? 87   GLN B OE1   1 
ATOM   5541  N NE2   . GLN B 1 87  ? 69.748  115.784 42.482  1.00 38.53 ? 87   GLN B NE2   1 
ATOM   5542  N N     . GLU B 1 88  ? 72.164  112.471 46.629  1.00 35.41 ? 88   GLU B N     1 
ATOM   5543  C CA    . GLU B 1 88  ? 73.540  112.017 46.702  1.00 35.41 ? 88   GLU B CA    1 
ATOM   5544  C C     . GLU B 1 88  ? 73.773  110.967 47.795  1.00 35.29 ? 88   GLU B C     1 
ATOM   5545  O O     . GLU B 1 88  ? 74.393  109.936 47.538  1.00 35.52 ? 88   GLU B O     1 
ATOM   5546  C CB    . GLU B 1 88  ? 74.482  113.214 46.906  1.00 35.64 ? 88   GLU B CB    1 
ATOM   5547  N N     . ASN B 1 89  ? 73.277  111.230 49.003  1.00 35.21 ? 89   ASN B N     1 
ATOM   5548  C CA    . ASN B 1 89  ? 73.607  110.410 50.186  1.00 35.01 ? 89   ASN B CA    1 
ATOM   5549  C C     . ASN B 1 89  ? 72.416  109.650 50.808  1.00 34.41 ? 89   ASN B C     1 
ATOM   5550  O O     . ASN B 1 89  ? 72.429  109.327 52.002  1.00 34.26 ? 89   ASN B O     1 
ATOM   5551  C CB    . ASN B 1 89  ? 74.325  111.274 51.246  1.00 34.80 ? 89   ASN B CB    1 
ATOM   5552  C CG    . ASN B 1 89  ? 75.631  111.882 50.730  1.00 36.48 ? 89   ASN B CG    1 
ATOM   5553  O OD1   . ASN B 1 89  ? 75.783  113.108 50.671  1.00 37.91 ? 89   ASN B OD1   1 
ATOM   5554  N ND2   . ASN B 1 89  ? 76.574  111.028 50.345  1.00 35.90 ? 89   ASN B ND2   1 
ATOM   5555  N N     . GLY B 1 90  ? 71.403  109.352 49.995  1.00 33.80 ? 90   GLY B N     1 
ATOM   5556  C CA    . GLY B 1 90  ? 70.224  108.602 50.459  1.00 33.11 ? 90   GLY B CA    1 
ATOM   5557  C C     . GLY B 1 90  ? 70.560  107.228 51.028  1.00 32.91 ? 90   GLY B C     1 
ATOM   5558  O O     . GLY B 1 90  ? 69.884  106.732 51.941  1.00 32.37 ? 90   GLY B O     1 
ATOM   5559  N N     . ASP B 1 91  ? 71.607  106.615 50.482  1.00 32.51 ? 91   ASP B N     1 
ATOM   5560  C CA    . ASP B 1 91  ? 72.085  105.318 50.957  1.00 32.50 ? 91   ASP B CA    1 
ATOM   5561  C C     . ASP B 1 91  ? 73.017  105.402 52.182  1.00 31.29 ? 91   ASP B C     1 
ATOM   5562  O O     . ASP B 1 91  ? 73.180  104.420 52.894  1.00 31.13 ? 91   ASP B O     1 
ATOM   5563  C CB    . ASP B 1 91  ? 72.748  104.551 49.813  1.00 33.21 ? 91   ASP B CB    1 
ATOM   5564  C CG    . ASP B 1 91  ? 71.751  103.734 48.999  1.00 36.78 ? 91   ASP B CG    1 
ATOM   5565  O OD1   . ASP B 1 91  ? 71.004  102.911 49.591  1.00 39.18 ? 91   ASP B OD1   1 
ATOM   5566  O OD2   . ASP B 1 91  ? 71.729  103.894 47.754  1.00 40.66 ? 91   ASP B OD2   1 
ATOM   5567  N N     . ARG B 1 92  ? 73.616  106.570 52.429  1.00 30.27 ? 92   ARG B N     1 
ATOM   5568  C CA    . ARG B 1 92  ? 74.417  106.787 53.636  1.00 29.63 ? 92   ARG B CA    1 
ATOM   5569  C C     . ARG B 1 92  ? 73.573  106.547 54.899  1.00 27.95 ? 92   ARG B C     1 
ATOM   5570  O O     . ARG B 1 92  ? 72.391  106.863 54.918  1.00 27.17 ? 92   ARG B O     1 
ATOM   5571  C CB    . ARG B 1 92  ? 75.004  108.207 53.650  1.00 30.02 ? 92   ARG B CB    1 
ATOM   5572  C CG    . ARG B 1 92  ? 75.861  108.534 54.903  1.00 32.24 ? 92   ARG B CG    1 
ATOM   5573  C CD    . ARG B 1 92  ? 76.317  109.997 54.965  1.00 31.50 ? 92   ARG B CD    1 
ATOM   5574  N NE    . ARG B 1 92  ? 77.358  110.283 53.977  1.00 37.16 ? 92   ARG B NE    1 
ATOM   5575  C CZ    . ARG B 1 92  ? 77.540  111.472 53.393  1.00 40.20 ? 92   ARG B CZ    1 
ATOM   5576  N NH1   . ARG B 1 92  ? 76.745  112.512 53.683  1.00 39.97 ? 92   ARG B NH1   1 
ATOM   5577  N NH2   . ARG B 1 92  ? 78.514  111.627 52.503  1.00 40.31 ? 92   ARG B NH2   1 
ATOM   5578  N N     . THR B 1 93  ? 74.183  105.969 55.934  1.00 26.27 ? 93   THR B N     1 
ATOM   5579  C CA    . THR B 1 93  ? 73.524  105.807 57.217  1.00 24.81 ? 93   THR B CA    1 
ATOM   5580  C C     . THR B 1 93  ? 73.300  107.169 57.866  1.00 24.15 ? 93   THR B C     1 
ATOM   5581  O O     . THR B 1 93  ? 74.245  107.935 58.065  1.00 23.17 ? 93   THR B O     1 
ATOM   5582  C CB    . THR B 1 93  ? 74.311  104.870 58.168  1.00 25.15 ? 93   THR B CB    1 
ATOM   5583  O OG1   . THR B 1 93  ? 74.472  103.598 57.529  1.00 26.12 ? 93   THR B OG1   1 
ATOM   5584  C CG2   . THR B 1 93  ? 73.559  104.650 59.487  1.00 23.06 ? 93   THR B CG2   1 
ATOM   5585  N N     . ALA B 1 94  ? 72.033  107.462 58.154  1.00 22.87 ? 94   ALA B N     1 
ATOM   5586  C CA    . ALA B 1 94  ? 71.672  108.654 58.906  1.00 22.43 ? 94   ALA B CA    1 
ATOM   5587  C C     . ALA B 1 94  ? 71.885  108.423 60.382  1.00 22.04 ? 94   ALA B C     1 
ATOM   5588  O O     . ALA B 1 94  ? 72.488  109.260 61.067  1.00 22.61 ? 94   ALA B O     1 
ATOM   5589  C CB    . ALA B 1 94  ? 70.209  109.074 58.621  1.00 21.25 ? 94   ALA B CB    1 
ATOM   5590  N N     . ILE B 1 95  ? 71.374  107.299 60.880  1.00 22.00 ? 95   ILE B N     1 
ATOM   5591  C CA    . ILE B 1 95  ? 71.408  107.014 62.311  1.00 21.66 ? 95   ILE B CA    1 
ATOM   5592  C C     . ILE B 1 95  ? 71.873  105.583 62.536  1.00 21.66 ? 95   ILE B C     1 
ATOM   5593  O O     . ILE B 1 95  ? 71.328  104.660 61.942  1.00 21.63 ? 95   ILE B O     1 
ATOM   5594  C CB    . ILE B 1 95  ? 70.008  107.149 63.000  1.00 21.70 ? 95   ILE B CB    1 
ATOM   5595  C CG1   . ILE B 1 95  ? 69.533  108.599 63.035  1.00 20.97 ? 95   ILE B CG1   1 
ATOM   5596  C CG2   . ILE B 1 95  ? 70.038  106.557 64.468  1.00 22.04 ? 95   ILE B CG2   1 
ATOM   5597  C CD1   . ILE B 1 95  ? 68.084  108.767 63.532  1.00 20.92 ? 95   ILE B CD1   1 
ATOM   5598  N N     . ILE B 1 96  ? 72.862  105.415 63.407  1.00 20.91 ? 96   ILE B N     1 
ATOM   5599  C CA    . ILE B 1 96  ? 73.200  104.093 63.907  1.00 21.27 ? 96   ILE B CA    1 
ATOM   5600  C C     . ILE B 1 96  ? 72.526  103.987 65.266  1.00 21.14 ? 96   ILE B C     1 
ATOM   5601  O O     . ILE B 1 96  ? 72.720  104.823 66.144  1.00 20.66 ? 96   ILE B O     1 
ATOM   5602  C CB    . ILE B 1 96  ? 74.739  103.855 63.997  1.00 21.22 ? 96   ILE B CB    1 
ATOM   5603  C CG1   . ILE B 1 96  ? 75.359  103.839 62.596  1.00 20.92 ? 96   ILE B CG1   1 
ATOM   5604  C CG2   . ILE B 1 96  ? 75.055  102.549 64.779  1.00 21.22 ? 96   ILE B CG2   1 
ATOM   5605  C CD1   . ILE B 1 96  ? 76.850  103.932 62.580  1.00 22.14 ? 96   ILE B CD1   1 
ATOM   5606  N N     . TRP B 1 97  ? 71.668  102.996 65.415  1.00 21.58 ? 97   TRP B N     1 
ATOM   5607  C CA    . TRP B 1 97  ? 71.034  102.802 66.698  1.00 21.94 ? 97   TRP B CA    1 
ATOM   5608  C C     . TRP B 1 97  ? 71.707  101.599 67.339  1.00 22.42 ? 97   TRP B C     1 
ATOM   5609  O O     . TRP B 1 97  ? 71.852  100.562 66.717  1.00 22.07 ? 97   TRP B O     1 
ATOM   5610  C CB    . TRP B 1 97  ? 69.518  102.632 66.562  1.00 21.95 ? 97   TRP B CB    1 
ATOM   5611  C CG    . TRP B 1 97  ? 68.833  102.354 67.859  1.00 21.83 ? 97   TRP B CG    1 
ATOM   5612  C CD1   . TRP B 1 97  ? 68.602  103.238 68.878  1.00 22.79 ? 97   TRP B CD1   1 
ATOM   5613  C CD2   . TRP B 1 97  ? 68.294  101.094 68.289  1.00 23.11 ? 97   TRP B CD2   1 
ATOM   5614  N NE1   . TRP B 1 97  ? 67.943  102.611 69.914  1.00 22.21 ? 97   TRP B NE1   1 
ATOM   5615  C CE2   . TRP B 1 97  ? 67.741  101.294 69.574  1.00 23.21 ? 97   TRP B CE2   1 
ATOM   5616  C CE3   . TRP B 1 97  ? 68.240  99.810  67.715  1.00 22.83 ? 97   TRP B CE3   1 
ATOM   5617  C CZ2   . TRP B 1 97  ? 67.139  100.253 70.298  1.00 23.88 ? 97   TRP B CZ2   1 
ATOM   5618  C CZ3   . TRP B 1 97  ? 67.632  98.786  68.418  1.00 22.50 ? 97   TRP B CZ3   1 
ATOM   5619  C CH2   . TRP B 1 97  ? 67.094  99.007  69.705  1.00 23.19 ? 97   TRP B CH2   1 
ATOM   5620  N N     . GLU B 1 98  ? 72.157  101.767 68.574  1.00 22.80 ? 98   GLU B N     1 
ATOM   5621  C CA    . GLU B 1 98  ? 72.794  100.688 69.312  1.00 23.11 ? 98   GLU B CA    1 
ATOM   5622  C C     . GLU B 1 98  ? 71.902  100.420 70.517  1.00 23.34 ? 98   GLU B C     1 
ATOM   5623  O O     . GLU B 1 98  ? 71.697  101.319 71.346  1.00 23.76 ? 98   GLU B O     1 
ATOM   5624  C CB    . GLU B 1 98  ? 74.209  101.127 69.732  1.00 22.61 ? 98   GLU B CB    1 
ATOM   5625  C CG    . GLU B 1 98  ? 74.889  100.230 70.753  1.00 22.68 ? 98   GLU B CG    1 
ATOM   5626  C CD    . GLU B 1 98  ? 75.339  98.896  70.184  1.00 20.92 ? 98   GLU B CD    1 
ATOM   5627  O OE1   . GLU B 1 98  ? 75.300  98.721  68.952  1.00 23.77 ? 98   GLU B OE1   1 
ATOM   5628  O OE2   . GLU B 1 98  ? 75.754  98.033  70.978  1.00 20.80 ? 98   GLU B OE2   1 
ATOM   5629  N N     . GLY B 1 99  ? 71.355  99.204  70.598  1.00 23.20 ? 99   GLY B N     1 
ATOM   5630  C CA    . GLY B 1 99  ? 70.449  98.833  71.675  1.00 23.15 ? 99   GLY B CA    1 
ATOM   5631  C C     . GLY B 1 99  ? 71.179  98.756  73.009  1.00 24.01 ? 99   GLY B C     1 
ATOM   5632  O O     . GLY B 1 99  ? 72.421  98.614  73.052  1.00 24.28 ? 99   GLY B O     1 
ATOM   5633  N N     . ASP B 1 100 ? 70.415  98.870  74.094  1.00 24.51 ? 100  ASP B N     1 
ATOM   5634  C CA    . ASP B 1 100 ? 70.903  98.570  75.441  1.00 25.69 ? 100  ASP B CA    1 
ATOM   5635  C C     . ASP B 1 100 ? 71.616  97.187  75.479  1.00 27.04 ? 100  ASP B C     1 
ATOM   5636  O O     . ASP B 1 100 ? 72.692  97.008  76.109  1.00 26.56 ? 100  ASP B O     1 
ATOM   5637  C CB    . ASP B 1 100 ? 69.735  98.605  76.420  1.00 25.12 ? 100  ASP B CB    1 
ATOM   5638  C CG    . ASP B 1 100 ? 70.180  98.470  77.857  1.00 24.39 ? 100  ASP B CG    1 
ATOM   5639  O OD1   . ASP B 1 100 ? 71.027  99.282  78.307  1.00 24.93 ? 100  ASP B OD1   1 
ATOM   5640  O OD2   . ASP B 1 100 ? 69.683  97.554  78.538  1.00 19.83 ? 100  ASP B OD2   1 
ATOM   5641  N N     . ASP B 1 101 ? 71.019  96.227  74.778  1.00 28.26 ? 101  ASP B N     1 
ATOM   5642  C CA    . ASP B 1 101 ? 71.670  94.950  74.530  1.00 30.41 ? 101  ASP B CA    1 
ATOM   5643  C C     . ASP B 1 101 ? 72.354  94.994  73.180  1.00 31.03 ? 101  ASP B C     1 
ATOM   5644  O O     . ASP B 1 101 ? 71.728  95.371  72.173  1.00 31.32 ? 101  ASP B O     1 
ATOM   5645  C CB    . ASP B 1 101 ? 70.670  93.809  74.544  1.00 30.19 ? 101  ASP B CB    1 
ATOM   5646  C CG    . ASP B 1 101 ? 71.343  92.491  74.826  1.00 34.60 ? 101  ASP B CG    1 
ATOM   5647  O OD1   . ASP B 1 101 ? 71.883  91.886  73.853  1.00 35.80 ? 101  ASP B OD1   1 
ATOM   5648  O OD2   . ASP B 1 101 ? 71.367  92.099  76.035  1.00 37.18 ? 101  ASP B OD2   1 
ATOM   5649  N N     . THR B 1 102 ? 73.620  94.584  73.143  1.00 31.94 ? 102  THR B N     1 
ATOM   5650  C CA    . THR B 1 102 ? 74.419  94.747  71.926  1.00 33.04 ? 102  THR B CA    1 
ATOM   5651  C C     . THR B 1 102 ? 74.056  93.847  70.720  1.00 33.40 ? 102  THR B C     1 
ATOM   5652  O O     . THR B 1 102 ? 74.462  94.121  69.578  1.00 34.03 ? 102  THR B O     1 
ATOM   5653  C CB    . THR B 1 102 ? 75.917  94.691  72.210  1.00 33.19 ? 102  THR B CB    1 
ATOM   5654  O OG1   . THR B 1 102 ? 76.620  95.109  71.033  1.00 33.99 ? 102  THR B OG1   1 
ATOM   5655  C CG2   . THR B 1 102 ? 76.349  93.277  72.637  1.00 34.13 ? 102  THR B CG2   1 
ATOM   5656  N N     . SER B 1 103 ? 73.294  92.787  70.961  1.00 33.29 ? 103  SER B N     1 
ATOM   5657  C CA    . SER B 1 103 ? 72.742  92.009  69.857  1.00 33.18 ? 103  SER B CA    1 
ATOM   5658  C C     . SER B 1 103 ? 71.727  92.826  69.064  1.00 33.56 ? 103  SER B C     1 
ATOM   5659  O O     . SER B 1 103 ? 71.355  92.438  67.955  1.00 33.78 ? 103  SER B O     1 
ATOM   5660  C CB    . SER B 1 103 ? 72.092  90.703  70.357  1.00 33.34 ? 103  SER B CB    1 
ATOM   5661  O OG    . SER B 1 103 ? 70.970  90.945  71.203  1.00 32.50 ? 103  SER B OG    1 
ATOM   5662  N N     . GLN B 1 104 ? 71.258  93.942  69.642  1.00 33.54 ? 104  GLN B N     1 
ATOM   5663  C CA    . GLN B 1 104 ? 70.260  94.768  68.985  1.00 33.39 ? 104  GLN B CA    1 
ATOM   5664  C C     . GLN B 1 104 ? 70.907  96.028  68.449  1.00 32.90 ? 104  GLN B C     1 
ATOM   5665  O O     . GLN B 1 104 ? 71.588  96.749  69.183  1.00 32.77 ? 104  GLN B O     1 
ATOM   5666  C CB    . GLN B 1 104 ? 69.099  95.105  69.926  1.00 33.76 ? 104  GLN B CB    1 
ATOM   5667  C CG    . GLN B 1 104 ? 68.524  93.915  70.689  1.00 35.50 ? 104  GLN B CG    1 
ATOM   5668  C CD    . GLN B 1 104 ? 68.039  92.802  69.775  1.00 38.34 ? 104  GLN B CD    1 
ATOM   5669  O OE1   . GLN B 1 104 ? 67.364  93.052  68.777  1.00 40.20 ? 104  GLN B OE1   1 
ATOM   5670  N NE2   . GLN B 1 104 ? 68.383  91.562  70.114  1.00 40.09 ? 104  GLN B NE2   1 
ATOM   5671  N N     . SER B 1 105 ? 70.702  96.282  67.158  1.00 32.40 ? 105  SER B N     1 
ATOM   5672  C CA    . SER B 1 105 ? 71.212  97.494  66.520  1.00 31.73 ? 105  SER B CA    1 
ATOM   5673  C C     . SER B 1 105 ? 70.564  97.680  65.158  1.00 31.47 ? 105  SER B C     1 
ATOM   5674  O O     . SER B 1 105 ? 69.952  96.752  64.628  1.00 30.88 ? 105  SER B O     1 
ATOM   5675  C CB    . SER B 1 105 ? 72.740  97.439  66.376  1.00 31.63 ? 105  SER B CB    1 
ATOM   5676  O OG    . SER B 1 105 ? 73.109  96.555  65.335  1.00 32.54 ? 105  SER B OG    1 
ATOM   5677  N N     . LYS B 1 106 ? 70.755  98.862  64.579  1.00 30.70 ? 106  LYS B N     1 
ATOM   5678  C CA    . LYS B 1 106 ? 70.043  99.282  63.378  1.00 30.96 ? 106  LYS B CA    1 
ATOM   5679  C C     . LYS B 1 106 ? 70.912  100.284 62.659  1.00 30.72 ? 106  LYS B C     1 
ATOM   5680  O O     . LYS B 1 106 ? 71.547  101.126 63.301  1.00 31.03 ? 106  LYS B O     1 
ATOM   5681  C CB    . LYS B 1 106 ? 68.787  100.050 63.785  1.00 31.18 ? 106  LYS B CB    1 
ATOM   5682  C CG    . LYS B 1 106 ? 67.511  99.630  63.140  1.00 32.71 ? 106  LYS B CG    1 
ATOM   5683  C CD    . LYS B 1 106 ? 66.658  98.896  64.138  1.00 34.23 ? 106  LYS B CD    1 
ATOM   5684  C CE    . LYS B 1 106 ? 65.209  99.355  64.040  1.00 36.76 ? 106  LYS B CE    1 
ATOM   5685  N NZ    . LYS B 1 106 ? 64.308  98.305  64.606  1.00 37.80 ? 106  LYS B NZ    1 
ATOM   5686  N N     . HIS B 1 107 ? 70.932  100.202 61.334  1.00 30.41 ? 107  HIS B N     1 
ATOM   5687  C CA    . HIS B 1 107 ? 71.532  101.235 60.502  1.00 30.19 ? 107  HIS B CA    1 
ATOM   5688  C C     . HIS B 1 107 ? 70.423  101.820 59.641  1.00 29.78 ? 107  HIS B C     1 
ATOM   5689  O O     . HIS B 1 107 ? 69.924  101.169 58.727  1.00 29.57 ? 107  HIS B O     1 
ATOM   5690  C CB    . HIS B 1 107 ? 72.640  100.652 59.629  1.00 30.56 ? 107  HIS B CB    1 
ATOM   5691  C CG    . HIS B 1 107 ? 73.855  100.233 60.394  1.00 32.07 ? 107  HIS B CG    1 
ATOM   5692  N ND1   . HIS B 1 107 ? 73.829  99.236  61.348  1.00 33.82 ? 107  HIS B ND1   1 
ATOM   5693  C CD2   . HIS B 1 107 ? 75.136  100.670 60.340  1.00 33.39 ? 107  HIS B CD2   1 
ATOM   5694  C CE1   . HIS B 1 107 ? 75.039  99.085  61.857  1.00 34.53 ? 107  HIS B CE1   1 
ATOM   5695  N NE2   . HIS B 1 107 ? 75.852  99.942  61.260  1.00 34.81 ? 107  HIS B NE2   1 
ATOM   5696  N N     . ILE B 1 108 ? 70.025  103.049 59.945  1.00 28.97 ? 108  ILE B N     1 
ATOM   5697  C CA    . ILE B 1 108 ? 68.914  103.688 59.234  1.00 28.21 ? 108  ILE B CA    1 
ATOM   5698  C C     . ILE B 1 108 ? 69.470  104.710 58.240  1.00 27.53 ? 108  ILE B C     1 
ATOM   5699  O O     . ILE B 1 108 ? 70.071  105.700 58.638  1.00 27.48 ? 108  ILE B O     1 
ATOM   5700  C CB    . ILE B 1 108 ? 67.920  104.318 60.245  1.00 28.46 ? 108  ILE B CB    1 
ATOM   5701  C CG1   . ILE B 1 108 ? 67.487  103.263 61.283  1.00 28.08 ? 108  ILE B CG1   1 
ATOM   5702  C CG2   . ILE B 1 108 ? 66.697  104.925 59.529  1.00 28.43 ? 108  ILE B CG2   1 
ATOM   5703  C CD1   . ILE B 1 108 ? 67.440  103.804 62.709  1.00 25.54 ? 108  ILE B CD1   1 
ATOM   5704  N N     . SER B 1 109 ? 69.304  104.436 56.947  1.00 27.27 ? 109  SER B N     1 
ATOM   5705  C CA    . SER B 1 109 ? 69.809  105.320 55.880  1.00 27.09 ? 109  SER B CA    1 
ATOM   5706  C C     . SER B 1 109 ? 68.996  106.588 55.801  1.00 26.01 ? 109  SER B C     1 
ATOM   5707  O O     . SER B 1 109 ? 67.869  106.609 56.287  1.00 26.13 ? 109  SER B O     1 
ATOM   5708  C CB    . SER B 1 109 ? 69.800  104.609 54.521  1.00 27.32 ? 109  SER B CB    1 
ATOM   5709  O OG    . SER B 1 109 ? 68.480  104.464 54.032  1.00 28.58 ? 109  SER B OG    1 
ATOM   5710  N N     . TYR B 1 110 ? 69.555  107.654 55.215  1.00 25.54 ? 110  TYR B N     1 
ATOM   5711  C CA    . TYR B 1 110 ? 68.790  108.911 55.058  1.00 24.93 ? 110  TYR B CA    1 
ATOM   5712  C C     . TYR B 1 110 ? 67.442  108.696 54.374  1.00 25.74 ? 110  TYR B C     1 
ATOM   5713  O O     . TYR B 1 110 ? 66.436  109.283 54.788  1.00 25.91 ? 110  TYR B O     1 
ATOM   5714  C CB    . TYR B 1 110 ? 69.598  110.016 54.356  1.00 23.88 ? 110  TYR B CB    1 
ATOM   5715  C CG    . TYR B 1 110 ? 70.428  110.810 55.341  1.00 23.34 ? 110  TYR B CG    1 
ATOM   5716  C CD1   . TYR B 1 110 ? 71.743  110.435 55.631  1.00 20.57 ? 110  TYR B CD1   1 
ATOM   5717  C CD2   . TYR B 1 110 ? 69.878  111.893 56.043  1.00 22.16 ? 110  TYR B CD2   1 
ATOM   5718  C CE1   . TYR B 1 110 ? 72.493  111.132 56.542  1.00 20.46 ? 110  TYR B CE1   1 
ATOM   5719  C CE2   . TYR B 1 110 ? 70.642  112.605 56.977  1.00 20.99 ? 110  TYR B CE2   1 
ATOM   5720  C CZ    . TYR B 1 110 ? 71.942  112.208 57.213  1.00 21.47 ? 110  TYR B CZ    1 
ATOM   5721  O OH    . TYR B 1 110 ? 72.698  112.873 58.125  1.00 21.90 ? 110  TYR B OH    1 
ATOM   5722  N N     . ARG B 1 111 ? 67.443  107.852 53.338  1.00 26.71 ? 111  ARG B N     1 
ATOM   5723  C CA    . ARG B 1 111 ? 66.239  107.451 52.594  1.00 28.67 ? 111  ARG B CA    1 
ATOM   5724  C C     . ARG B 1 111 ? 65.195  106.794 53.497  1.00 28.06 ? 111  ARG B C     1 
ATOM   5725  O O     . ARG B 1 111 ? 64.018  107.151 53.451  1.00 28.55 ? 111  ARG B O     1 
ATOM   5726  C CB    . ARG B 1 111 ? 66.602  106.506 51.432  1.00 28.01 ? 111  ARG B CB    1 
ATOM   5727  C CG    . ARG B 1 111 ? 65.615  106.584 50.268  1.00 31.49 ? 111  ARG B CG    1 
ATOM   5728  C CD    . ARG B 1 111 ? 65.903  105.575 49.112  1.00 32.27 ? 111  ARG B CD    1 
ATOM   5729  N NE    . ARG B 1 111 ? 67.308  105.549 48.663  1.00 37.81 ? 111  ARG B NE    1 
ATOM   5730  C CZ    . ARG B 1 111 ? 67.905  106.491 47.929  1.00 39.37 ? 111  ARG B CZ    1 
ATOM   5731  N NH1   . ARG B 1 111 ? 67.247  107.580 47.533  1.00 39.85 ? 111  ARG B NH1   1 
ATOM   5732  N NH2   . ARG B 1 111 ? 69.182  106.346 47.582  1.00 40.71 ? 111  ARG B NH2   1 
ATOM   5733  N N     . GLU B 1 112 ? 65.632  105.820 54.296  1.00 27.67 ? 112  GLU B N     1 
ATOM   5734  C CA    . GLU B 1 112 ? 64.766  105.133 55.236  1.00 27.88 ? 112  GLU B CA    1 
ATOM   5735  C C     . GLU B 1 112 ? 64.188  106.152 56.243  1.00 26.02 ? 112  GLU B C     1 
ATOM   5736  O O     . GLU B 1 112 ? 62.980  106.277 56.387  1.00 25.67 ? 112  GLU B O     1 
ATOM   5737  C CB    . GLU B 1 112 ? 65.532  103.975 55.934  1.00 27.31 ? 112  GLU B CB    1 
ATOM   5738  C CG    . GLU B 1 112 ? 66.021  102.888 54.945  1.00 30.43 ? 112  GLU B CG    1 
ATOM   5739  C CD    . GLU B 1 112 ? 66.910  101.741 55.531  1.00 31.22 ? 112  GLU B CD    1 
ATOM   5740  O OE1   . GLU B 1 112 ? 67.643  101.918 56.551  1.00 33.99 ? 112  GLU B OE1   1 
ATOM   5741  O OE2   . GLU B 1 112 ? 66.889  100.645 54.907  1.00 34.58 ? 112  GLU B OE2   1 
ATOM   5742  N N     . LEU B 1 113 ? 65.058  106.893 56.917  1.00 24.73 ? 113  LEU B N     1 
ATOM   5743  C CA    . LEU B 1 113 ? 64.613  107.904 57.882  1.00 23.61 ? 113  LEU B CA    1 
ATOM   5744  C C     . LEU B 1 113 ? 63.657  108.906 57.223  1.00 23.09 ? 113  LEU B C     1 
ATOM   5745  O O     . LEU B 1 113 ? 62.658  109.299 57.812  1.00 22.82 ? 113  LEU B O     1 
ATOM   5746  C CB    . LEU B 1 113 ? 65.829  108.601 58.515  1.00 23.15 ? 113  LEU B CB    1 
ATOM   5747  C CG    . LEU B 1 113 ? 65.641  109.602 59.667  1.00 23.67 ? 113  LEU B CG    1 
ATOM   5748  C CD1   . LEU B 1 113 ? 64.948  108.980 60.879  1.00 20.53 ? 113  LEU B CD1   1 
ATOM   5749  C CD2   . LEU B 1 113 ? 66.996  110.190 60.054  1.00 23.36 ? 113  LEU B CD2   1 
ATOM   5750  N N     . HIS B 1 114 ? 63.939  109.292 55.984  1.00 23.14 ? 114  HIS B N     1 
ATOM   5751  C CA    . HIS B 1 114 ? 63.070  110.251 55.290  1.00 23.53 ? 114  HIS B CA    1 
ATOM   5752  C C     . HIS B 1 114 ? 61.679  109.666 55.049  1.00 23.49 ? 114  HIS B C     1 
ATOM   5753  O O     . HIS B 1 114 ? 60.673  110.353 55.224  1.00 23.67 ? 114  HIS B O     1 
ATOM   5754  C CB    . HIS B 1 114 ? 63.703  110.735 53.989  1.00 22.99 ? 114  HIS B CB    1 
ATOM   5755  C CG    . HIS B 1 114 ? 62.758  111.488 53.097  1.00 23.77 ? 114  HIS B CG    1 
ATOM   5756  N ND1   . HIS B 1 114 ? 62.044  110.878 52.087  1.00 25.16 ? 114  HIS B ND1   1 
ATOM   5757  C CD2   . HIS B 1 114 ? 62.408  112.796 53.066  1.00 23.32 ? 114  HIS B CD2   1 
ATOM   5758  C CE1   . HIS B 1 114 ? 61.291  111.775 51.473  1.00 25.21 ? 114  HIS B CE1   1 
ATOM   5759  N NE2   . HIS B 1 114 ? 61.501  112.948 52.043  1.00 26.12 ? 114  HIS B NE2   1 
ATOM   5760  N N     . ARG B 1 115 ? 61.628  108.396 54.670  1.00 24.29 ? 115  ARG B N     1 
ATOM   5761  C CA    . ARG B 1 115 ? 60.362  107.744 54.341  1.00 26.32 ? 115  ARG B CA    1 
ATOM   5762  C C     . ARG B 1 115 ? 59.453  107.676 55.561  1.00 25.18 ? 115  ARG B C     1 
ATOM   5763  O O     . ARG B 1 115 ? 58.278  107.993 55.462  1.00 25.08 ? 115  ARG B O     1 
ATOM   5764  C CB    . ARG B 1 115 ? 60.570  106.331 53.778  1.00 26.12 ? 115  ARG B CB    1 
ATOM   5765  C CG    . ARG B 1 115 ? 59.238  105.694 53.379  1.00 29.07 ? 115  ARG B CG    1 
ATOM   5766  C CD    . ARG B 1 115 ? 59.342  104.322 52.683  1.00 30.52 ? 115  ARG B CD    1 
ATOM   5767  N NE    . ARG B 1 115 ? 57.996  103.847 52.288  1.00 37.59 ? 115  ARG B NE    1 
ATOM   5768  C CZ    . ARG B 1 115 ? 57.155  103.192 53.097  1.00 38.51 ? 115  ARG B CZ    1 
ATOM   5769  N NH1   . ARG B 1 115 ? 57.515  102.902 54.340  1.00 39.33 ? 115  ARG B NH1   1 
ATOM   5770  N NH2   . ARG B 1 115 ? 55.956  102.809 52.665  1.00 39.10 ? 115  ARG B NH2   1 
ATOM   5771  N N     . ASP B 1 116 ? 60.016  107.241 56.689  1.00 25.17 ? 116  ASP B N     1 
ATOM   5772  C CA    . ASP B 1 116 ? 59.315  107.201 57.984  1.00 24.80 ? 116  ASP B CA    1 
ATOM   5773  C C     . ASP B 1 116 ? 58.915  108.567 58.544  1.00 23.60 ? 116  ASP B C     1 
ATOM   5774  O O     . ASP B 1 116 ? 57.828  108.713 59.129  1.00 23.12 ? 116  ASP B O     1 
ATOM   5775  C CB    . ASP B 1 116 ? 60.126  106.408 59.009  1.00 25.67 ? 116  ASP B CB    1 
ATOM   5776  C CG    . ASP B 1 116 ? 60.016  104.885 58.792  1.00 28.85 ? 116  ASP B CG    1 
ATOM   5777  O OD1   . ASP B 1 116 ? 59.079  104.436 58.088  1.00 30.88 ? 116  ASP B OD1   1 
ATOM   5778  O OD2   . ASP B 1 116 ? 60.883  104.141 59.312  1.00 32.52 ? 116  ASP B OD2   1 
ATOM   5779  N N     . VAL B 1 117 ? 59.770  109.571 58.363  1.00 22.25 ? 117  VAL B N     1 
ATOM   5780  C CA    . VAL B 1 117 ? 59.368  110.917 58.753  1.00 21.41 ? 117  VAL B CA    1 
ATOM   5781  C C     . VAL B 1 117 ? 58.166  111.417 57.917  1.00 21.25 ? 117  VAL B C     1 
ATOM   5782  O O     . VAL B 1 117 ? 57.277  112.050 58.468  1.00 21.27 ? 117  VAL B O     1 
ATOM   5783  C CB    . VAL B 1 117 ? 60.564  111.903 58.788  1.00 20.74 ? 117  VAL B CB    1 
ATOM   5784  C CG1   . VAL B 1 117 ? 60.102  113.348 58.933  1.00 19.61 ? 117  VAL B CG1   1 
ATOM   5785  C CG2   . VAL B 1 117 ? 61.454  111.550 59.959  1.00 20.24 ? 117  VAL B CG2   1 
ATOM   5786  N N     . CYS B 1 118 ? 58.131  111.117 56.618  1.00 20.98 ? 118  CYS B N     1 
ATOM   5787  C CA    . CYS B 1 118 ? 56.990  111.495 55.768  1.00 21.75 ? 118  CYS B CA    1 
ATOM   5788  C C     . CYS B 1 118 ? 55.711  110.754 56.160  1.00 21.38 ? 118  CYS B C     1 
ATOM   5789  O O     . CYS B 1 118 ? 54.636  111.349 56.193  1.00 21.02 ? 118  CYS B O     1 
ATOM   5790  C CB    . CYS B 1 118 ? 57.283  111.249 54.274  1.00 22.26 ? 118  CYS B CB    1 
ATOM   5791  S SG    . CYS B 1 118 ? 58.570  112.320 53.578  1.00 26.45 ? 118  CYS B SG    1 
ATOM   5792  N N     . ARG B 1 119 ? 55.835  109.457 56.461  1.00 21.18 ? 119  ARG B N     1 
ATOM   5793  C CA    . ARG B 1 119 ? 54.691  108.676 56.930  1.00 21.22 ? 119  ARG B CA    1 
ATOM   5794  C C     . ARG B 1 119 ? 54.212  109.216 58.258  1.00 20.71 ? 119  ARG B C     1 
ATOM   5795  O O     . ARG B 1 119 ? 53.013  109.350 58.475  1.00 20.63 ? 119  ARG B O     1 
ATOM   5796  C CB    . ARG B 1 119 ? 55.027  107.179 57.049  1.00 21.55 ? 119  ARG B CB    1 
ATOM   5797  C CG    . ARG B 1 119 ? 55.339  106.487 55.729  1.00 22.72 ? 119  ARG B CG    1 
ATOM   5798  C CD    . ARG B 1 119 ? 55.087  104.988 55.830  1.00 27.62 ? 119  ARG B CD    1 
ATOM   5799  N NE    . ARG B 1 119 ? 56.077  104.295 56.654  1.00 32.19 ? 119  ARG B NE    1 
ATOM   5800  C CZ    . ARG B 1 119 ? 55.969  103.035 57.077  1.00 35.07 ? 119  ARG B CZ    1 
ATOM   5801  N NH1   . ARG B 1 119 ? 54.909  102.304 56.752  1.00 36.60 ? 119  ARG B NH1   1 
ATOM   5802  N NH2   . ARG B 1 119 ? 56.929  102.499 57.821  1.00 35.44 ? 119  ARG B NH2   1 
ATOM   5803  N N     . PHE B 1 120 ? 55.151  109.549 59.144  1.00 21.16 ? 120  PHE B N     1 
ATOM   5804  C CA    . PHE B 1 120 ? 54.771  110.042 60.462  1.00 21.20 ? 120  PHE B CA    1 
ATOM   5805  C C     . PHE B 1 120 ? 54.206  111.467 60.420  1.00 21.05 ? 120  PHE B C     1 
ATOM   5806  O O     . PHE B 1 120 ? 53.285  111.791 61.140  1.00 21.30 ? 120  PHE B O     1 
ATOM   5807  C CB    . PHE B 1 120 ? 55.874  109.859 61.533  1.00 20.60 ? 120  PHE B CB    1 
ATOM   5808  C CG    . PHE B 1 120 ? 55.326  109.891 62.935  1.00 20.85 ? 120  PHE B CG    1 
ATOM   5809  C CD1   . PHE B 1 120 ? 54.599  108.809 63.425  1.00 21.09 ? 120  PHE B CD1   1 
ATOM   5810  C CD2   . PHE B 1 120 ? 55.454  111.024 63.725  1.00 19.96 ? 120  PHE B CD2   1 
ATOM   5811  C CE1   . PHE B 1 120 ? 54.035  108.837 64.708  1.00 22.28 ? 120  PHE B CE1   1 
ATOM   5812  C CE2   . PHE B 1 120 ? 54.905  111.071 65.007  1.00 19.55 ? 120  PHE B CE2   1 
ATOM   5813  C CZ    . PHE B 1 120 ? 54.185  109.981 65.499  1.00 21.70 ? 120  PHE B CZ    1 
ATOM   5814  N N     . ALA B 1 121 ? 54.754  112.310 59.555  1.00 21.65 ? 121  ALA B N     1 
ATOM   5815  C CA    . ALA B 1 121 ? 54.180  113.625 59.294  1.00 21.10 ? 121  ALA B CA    1 
ATOM   5816  C C     . ALA B 1 121 ? 52.721  113.498 58.804  1.00 21.42 ? 121  ALA B C     1 
ATOM   5817  O O     . ALA B 1 121 ? 51.823  114.196 59.310  1.00 21.92 ? 121  ALA B O     1 
ATOM   5818  C CB    . ALA B 1 121 ? 55.023  114.346 58.293  1.00 20.70 ? 121  ALA B CB    1 
ATOM   5819  N N     . ASN B 1 122 ? 52.477  112.588 57.852  1.00 21.15 ? 122  ASN B N     1 
ATOM   5820  C CA    . ASN B 1 122 ? 51.117  112.353 57.335  1.00 21.45 ? 122  ASN B CA    1 
ATOM   5821  C C     . ASN B 1 122 ? 50.180  111.884 58.426  1.00 21.35 ? 122  ASN B C     1 
ATOM   5822  O O     . ASN B 1 122 ? 49.017  112.276 58.439  1.00 21.77 ? 122  ASN B O     1 
ATOM   5823  C CB    . ASN B 1 122 ? 51.090  111.378 56.139  1.00 21.08 ? 122  ASN B CB    1 
ATOM   5824  C CG    . ASN B 1 122 ? 51.413  112.065 54.812  1.00 22.26 ? 122  ASN B CG    1 
ATOM   5825  O OD1   . ASN B 1 122 ? 50.954  113.175 54.541  1.00 23.43 ? 122  ASN B OD1   1 
ATOM   5826  N ND2   . ASN B 1 122 ? 52.211  111.407 53.988  1.00 23.15 ? 122  ASN B ND2   1 
ATOM   5827  N N     . THR B 1 123 ? 50.706  111.039 59.322  1.00 21.80 ? 123  THR B N     1 
ATOM   5828  C CA    . THR B 1 123 ? 50.004  110.527 60.505  1.00 22.16 ? 123  THR B CA    1 
ATOM   5829  C C     . THR B 1 123 ? 49.576  111.668 61.441  1.00 22.54 ? 123  THR B C     1 
ATOM   5830  O O     . THR B 1 123 ? 48.404  111.758 61.832  1.00 22.57 ? 123  THR B O     1 
ATOM   5831  C CB    . THR B 1 123 ? 50.891  109.519 61.292  1.00 22.25 ? 123  THR B CB    1 
ATOM   5832  O OG1   . THR B 1 123 ? 51.240  108.406 60.456  1.00 23.19 ? 123  THR B OG1   1 
ATOM   5833  C CG2   . THR B 1 123 ? 50.198  109.024 62.525  1.00 21.68 ? 123  THR B CG2   1 
ATOM   5834  N N     . LEU B 1 124 ? 50.515  112.549 61.779  1.00 22.66 ? 124  LEU B N     1 
ATOM   5835  C CA    . LEU B 1 124 ? 50.191  113.694 62.623  1.00 23.32 ? 124  LEU B CA    1 
ATOM   5836  C C     . LEU B 1 124 ? 49.087  114.564 62.010  1.00 23.89 ? 124  LEU B C     1 
ATOM   5837  O O     . LEU B 1 124 ? 48.171  114.996 62.719  1.00 23.63 ? 124  LEU B O     1 
ATOM   5838  C CB    . LEU B 1 124 ? 51.430  114.552 62.895  1.00 23.02 ? 124  LEU B CB    1 
ATOM   5839  C CG    . LEU B 1 124 ? 52.548  113.946 63.730  1.00 22.91 ? 124  LEU B CG    1 
ATOM   5840  C CD1   . LEU B 1 124 ? 53.736  114.923 63.869  1.00 22.26 ? 124  LEU B CD1   1 
ATOM   5841  C CD2   . LEU B 1 124 ? 52.003  113.536 65.068  1.00 24.10 ? 124  LEU B CD2   1 
ATOM   5842  N N     . LEU B 1 125 ? 49.192  114.818 60.704  1.00 24.36 ? 125  LEU B N     1 
ATOM   5843  C CA    . LEU B 1 125 ? 48.245  115.659 59.983  1.00 25.29 ? 125  LEU B CA    1 
ATOM   5844  C C     . LEU B 1 125 ? 46.876  114.987 59.885  1.00 26.01 ? 125  LEU B C     1 
ATOM   5845  O O     . LEU B 1 125 ? 45.835  115.646 60.018  1.00 26.43 ? 125  LEU B O     1 
ATOM   5846  C CB    . LEU B 1 125 ? 48.779  116.001 58.582  1.00 25.16 ? 125  LEU B CB    1 
ATOM   5847  C CG    . LEU B 1 125 ? 49.928  117.027 58.497  1.00 25.95 ? 125  LEU B CG    1 
ATOM   5848  C CD1   . LEU B 1 125 ? 50.710  116.877 57.193  1.00 25.81 ? 125  LEU B CD1   1 
ATOM   5849  C CD2   . LEU B 1 125 ? 49.442  118.459 58.668  1.00 24.71 ? 125  LEU B CD2   1 
ATOM   5850  N N     . ASP B 1 126 ? 46.872  113.680 59.640  1.00 26.47 ? 126  ASP B N     1 
ATOM   5851  C CA    . ASP B 1 126 ? 45.623  112.925 59.585  1.00 27.04 ? 126  ASP B CA    1 
ATOM   5852  C C     . ASP B 1 126 ? 44.941  112.869 60.962  1.00 26.63 ? 126  ASP B C     1 
ATOM   5853  O O     . ASP B 1 126 ? 43.725  112.711 61.051  1.00 26.52 ? 126  ASP B O     1 
ATOM   5854  C CB    . ASP B 1 126 ? 45.869  111.505 59.029  1.00 27.48 ? 126  ASP B CB    1 
ATOM   5855  C CG    . ASP B 1 126 ? 46.067  111.484 57.501  1.00 30.24 ? 126  ASP B CG    1 
ATOM   5856  O OD1   . ASP B 1 126 ? 45.752  112.483 56.812  1.00 34.31 ? 126  ASP B OD1   1 
ATOM   5857  O OD2   . ASP B 1 126 ? 46.548  110.458 56.972  1.00 34.61 ? 126  ASP B OD2   1 
ATOM   5858  N N     . LEU B 1 127 ? 45.735  113.021 62.021  1.00 26.33 ? 127  LEU B N     1 
ATOM   5859  C CA    . LEU B 1 127 ? 45.244  113.037 63.400  1.00 26.67 ? 127  LEU B CA    1 
ATOM   5860  C C     . LEU B 1 127 ? 44.775  114.433 63.814  1.00 26.72 ? 127  LEU B C     1 
ATOM   5861  O O     . LEU B 1 127 ? 44.250  114.621 64.908  1.00 27.13 ? 127  LEU B O     1 
ATOM   5862  C CB    . LEU B 1 127 ? 46.352  112.546 64.339  1.00 26.40 ? 127  LEU B CB    1 
ATOM   5863  C CG    . LEU B 1 127 ? 46.153  111.420 65.362  1.00 27.32 ? 127  LEU B CG    1 
ATOM   5864  C CD1   . LEU B 1 127 ? 45.022  110.436 65.019  1.00 25.18 ? 127  LEU B CD1   1 
ATOM   5865  C CD2   . LEU B 1 127 ? 47.476  110.667 65.574  1.00 26.80 ? 127  LEU B CD2   1 
ATOM   5866  N N     . GLY B 1 128 ? 44.964  115.417 62.940  1.00 27.13 ? 128  GLY B N     1 
ATOM   5867  C CA    . GLY B 1 128 ? 44.513  116.788 63.209  1.00 27.19 ? 128  GLY B CA    1 
ATOM   5868  C C     . GLY B 1 128 ? 45.542  117.719 63.821  1.00 27.10 ? 128  GLY B C     1 
ATOM   5869  O O     . GLY B 1 128 ? 45.206  118.833 64.248  1.00 27.85 ? 128  GLY B O     1 
ATOM   5870  N N     . ILE B 1 129 ? 46.793  117.274 63.891  1.00 26.73 ? 129  ILE B N     1 
ATOM   5871  C CA    . ILE B 1 129 ? 47.858  118.142 64.393  1.00 26.03 ? 129  ILE B CA    1 
ATOM   5872  C C     . ILE B 1 129 ? 48.177  119.181 63.313  1.00 26.34 ? 129  ILE B C     1 
ATOM   5873  O O     . ILE B 1 129 ? 48.324  118.835 62.144  1.00 25.93 ? 129  ILE B O     1 
ATOM   5874  C CB    . ILE B 1 129 ? 49.126  117.338 64.811  1.00 26.02 ? 129  ILE B CB    1 
ATOM   5875  C CG1   . ILE B 1 129 ? 48.783  116.307 65.905  1.00 24.82 ? 129  ILE B CG1   1 
ATOM   5876  C CG2   . ILE B 1 129 ? 50.265  118.282 65.273  1.00 24.53 ? 129  ILE B CG2   1 
ATOM   5877  C CD1   . ILE B 1 129 ? 48.388  116.914 67.237  1.00 24.93 ? 129  ILE B CD1   1 
ATOM   5878  N N     . LYS B 1 130 ? 48.266  120.446 63.710  1.00 26.40 ? 130  LYS B N     1 
ATOM   5879  C CA    . LYS B 1 130 ? 48.533  121.536 62.773  1.00 26.81 ? 130  LYS B CA    1 
ATOM   5880  C C     . LYS B 1 130 ? 49.769  122.331 63.169  1.00 25.84 ? 130  LYS B C     1 
ATOM   5881  O O     . LYS B 1 130 ? 50.231  122.265 64.305  1.00 25.42 ? 130  LYS B O     1 
ATOM   5882  C CB    . LYS B 1 130 ? 47.325  122.474 62.672  1.00 26.87 ? 130  LYS B CB    1 
ATOM   5883  C CG    . LYS B 1 130 ? 46.211  121.879 61.831  1.00 31.57 ? 130  LYS B CG    1 
ATOM   5884  C CD    . LYS B 1 130 ? 44.856  122.509 62.093  1.00 35.41 ? 130  LYS B CD    1 
ATOM   5885  C CE    . LYS B 1 130 ? 43.768  121.465 61.843  1.00 37.95 ? 130  LYS B CE    1 
ATOM   5886  N NZ    . LYS B 1 130 ? 43.874  120.865 60.470  1.00 37.73 ? 130  LYS B NZ    1 
ATOM   5887  N N     . LYS B 1 131 ? 50.287  123.078 62.206  1.00 24.76 ? 131  LYS B N     1 
ATOM   5888  C CA    . LYS B 1 131 ? 51.369  124.006 62.440  1.00 24.85 ? 131  LYS B CA    1 
ATOM   5889  C C     . LYS B 1 131 ? 51.052  124.833 63.686  1.00 24.46 ? 131  LYS B C     1 
ATOM   5890  O O     . LYS B 1 131 ? 49.969  125.421 63.792  1.00 24.94 ? 131  LYS B O     1 
ATOM   5891  C CB    . LYS B 1 131 ? 51.577  124.908 61.200  1.00 24.34 ? 131  LYS B CB    1 
ATOM   5892  C CG    . LYS B 1 131 ? 52.566  126.047 61.427  1.00 23.39 ? 131  LYS B CG    1 
ATOM   5893  C CD    . LYS B 1 131 ? 52.719  126.951 60.200  1.00 24.97 ? 131  LYS B CD    1 
ATOM   5894  C CE    . LYS B 1 131 ? 53.800  127.987 60.469  1.00 25.72 ? 131  LYS B CE    1 
ATOM   5895  N NZ    . LYS B 1 131 ? 54.054  128.867 59.302  1.00 27.93 ? 131  LYS B NZ    1 
ATOM   5896  N N     . GLY B 1 132 ? 51.997  124.862 64.618  1.00 24.54 ? 132  GLY B N     1 
ATOM   5897  C CA    . GLY B 1 132 ? 51.869  125.631 65.854  1.00 24.32 ? 132  GLY B CA    1 
ATOM   5898  C C     . GLY B 1 132 ? 51.376  124.826 67.044  1.00 23.91 ? 132  GLY B C     1 
ATOM   5899  O O     . GLY B 1 132 ? 51.516  125.263 68.188  1.00 24.33 ? 132  GLY B O     1 
ATOM   5900  N N     . ASP B 1 133 ? 50.760  123.671 66.788  1.00 23.44 ? 133  ASP B N     1 
ATOM   5901  C CA    . ASP B 1 133 ? 50.316  122.803 67.872  1.00 22.81 ? 133  ASP B CA    1 
ATOM   5902  C C     . ASP B 1 133 ? 51.528  122.245 68.601  1.00 22.41 ? 133  ASP B C     1 
ATOM   5903  O O     . ASP B 1 133 ? 52.533  121.916 67.971  1.00 21.79 ? 133  ASP B O     1 
ATOM   5904  C CB    . ASP B 1 133 ? 49.465  121.635 67.365  1.00 23.01 ? 133  ASP B CB    1 
ATOM   5905  C CG    . ASP B 1 133 ? 48.092  122.067 66.873  1.00 23.08 ? 133  ASP B CG    1 
ATOM   5906  O OD1   . ASP B 1 133 ? 47.639  123.181 67.217  1.00 23.07 ? 133  ASP B OD1   1 
ATOM   5907  O OD2   . ASP B 1 133 ? 47.472  121.277 66.127  1.00 23.82 ? 133  ASP B OD2   1 
ATOM   5908  N N     . VAL B 1 134 ? 51.420  122.143 69.929  1.00 22.10 ? 134  VAL B N     1 
ATOM   5909  C CA    . VAL B 1 134 ? 52.463  121.514 70.741  1.00 20.78 ? 134  VAL B CA    1 
ATOM   5910  C C     . VAL B 1 134 ? 52.216  120.009 70.850  1.00 20.57 ? 134  VAL B C     1 
ATOM   5911  O O     . VAL B 1 134 ? 51.098  119.552 71.128  1.00 19.65 ? 134  VAL B O     1 
ATOM   5912  C CB    . VAL B 1 134 ? 52.619  122.153 72.129  1.00 21.15 ? 134  VAL B CB    1 
ATOM   5913  C CG1   . VAL B 1 134 ? 53.710  121.408 72.965  1.00 20.17 ? 134  VAL B CG1   1 
ATOM   5914  C CG2   . VAL B 1 134 ? 52.973  123.652 72.009  1.00 20.85 ? 134  VAL B CG2   1 
ATOM   5915  N N     . VAL B 1 135 ? 53.277  119.248 70.610  1.00 19.89 ? 135  VAL B N     1 
ATOM   5916  C CA    . VAL B 1 135 ? 53.230  117.803 70.684  1.00 19.36 ? 135  VAL B CA    1 
ATOM   5917  C C     . VAL B 1 135 ? 54.243  117.385 71.735  1.00 19.68 ? 135  VAL B C     1 
ATOM   5918  O O     . VAL B 1 135 ? 55.441  117.642 71.569  1.00 19.89 ? 135  VAL B O     1 
ATOM   5919  C CB    . VAL B 1 135 ? 53.597  117.160 69.312  1.00 19.06 ? 135  VAL B CB    1 
ATOM   5920  C CG1   . VAL B 1 135 ? 53.752  115.637 69.432  1.00 18.64 ? 135  VAL B CG1   1 
ATOM   5921  C CG2   . VAL B 1 135 ? 52.524  117.469 68.277  1.00 17.69 ? 135  VAL B CG2   1 
ATOM   5922  N N     . ALA B 1 136 ? 53.775  116.753 72.815  1.00 19.38 ? 136  ALA B N     1 
ATOM   5923  C CA    . ALA B 1 136 ? 54.701  116.258 73.856  1.00 19.45 ? 136  ALA B CA    1 
ATOM   5924  C C     . ALA B 1 136 ? 55.288  114.916 73.446  1.00 19.11 ? 136  ALA B C     1 
ATOM   5925  O O     . ALA B 1 136 ? 54.573  113.998 73.012  1.00 19.37 ? 136  ALA B O     1 
ATOM   5926  C CB    . ALA B 1 136 ? 54.020  116.155 75.216  1.00 19.17 ? 136  ALA B CB    1 
ATOM   5927  N N     . ILE B 1 137 ? 56.602  114.816 73.581  1.00 18.85 ? 137  ILE B N     1 
ATOM   5928  C CA    . ILE B 1 137 ? 57.329  113.600 73.242  1.00 18.46 ? 137  ILE B CA    1 
ATOM   5929  C C     . ILE B 1 137 ? 57.981  113.068 74.512  1.00 17.79 ? 137  ILE B C     1 
ATOM   5930  O O     . ILE B 1 137 ? 58.839  113.722 75.082  1.00 16.96 ? 137  ILE B O     1 
ATOM   5931  C CB    . ILE B 1 137 ? 58.360  113.848 72.102  1.00 18.48 ? 137  ILE B CB    1 
ATOM   5932  C CG1   . ILE B 1 137 ? 57.638  114.334 70.820  1.00 19.94 ? 137  ILE B CG1   1 
ATOM   5933  C CG2   . ILE B 1 137 ? 59.209  112.582 71.815  1.00 18.13 ? 137  ILE B CG2   1 
ATOM   5934  C CD1   . ILE B 1 137 ? 58.584  114.605 69.591  1.00 17.28 ? 137  ILE B CD1   1 
ATOM   5935  N N     . TYR B 1 138 ? 57.540  111.882 74.943  1.00 17.64 ? 138  TYR B N     1 
ATOM   5936  C CA    . TYR B 1 138 ? 58.017  111.242 76.172  1.00 17.41 ? 138  TYR B CA    1 
ATOM   5937  C C     . TYR B 1 138 ? 58.538  109.831 75.831  1.00 17.66 ? 138  TYR B C     1 
ATOM   5938  O O     . TYR B 1 138 ? 57.883  108.809 76.071  1.00 16.20 ? 138  TYR B O     1 
ATOM   5939  C CB    . TYR B 1 138 ? 56.884  111.256 77.201  1.00 16.90 ? 138  TYR B CB    1 
ATOM   5940  C CG    . TYR B 1 138 ? 57.206  110.751 78.596  1.00 17.45 ? 138  TYR B CG    1 
ATOM   5941  C CD1   . TYR B 1 138 ? 58.137  111.409 79.418  1.00 16.42 ? 138  TYR B CD1   1 
ATOM   5942  C CD2   . TYR B 1 138 ? 56.526  109.648 79.126  1.00 18.94 ? 138  TYR B CD2   1 
ATOM   5943  C CE1   . TYR B 1 138 ? 58.396  110.972 80.736  1.00 15.70 ? 138  TYR B CE1   1 
ATOM   5944  C CE2   . TYR B 1 138 ? 56.778  109.194 80.455  1.00 17.53 ? 138  TYR B CE2   1 
ATOM   5945  C CZ    . TYR B 1 138 ? 57.724  109.870 81.232  1.00 17.33 ? 138  TYR B CZ    1 
ATOM   5946  O OH    . TYR B 1 138 ? 57.970  109.447 82.500  1.00 18.14 ? 138  TYR B OH    1 
ATOM   5947  N N     . MET B 1 139 ? 59.735  109.813 75.232  1.00 18.79 ? 139  MET B N     1 
ATOM   5948  C CA    . MET B 1 139 ? 60.253  108.653 74.507  1.00 19.48 ? 139  MET B CA    1 
ATOM   5949  C C     . MET B 1 139 ? 61.612  108.218 75.055  1.00 19.84 ? 139  MET B C     1 
ATOM   5950  O O     . MET B 1 139 ? 62.374  109.055 75.536  1.00 19.37 ? 139  MET B O     1 
ATOM   5951  C CB    . MET B 1 139 ? 60.431  108.998 73.014  1.00 19.55 ? 139  MET B CB    1 
ATOM   5952  C CG    . MET B 1 139 ? 59.126  109.113 72.180  1.00 21.86 ? 139  MET B CG    1 
ATOM   5953  S SD    . MET B 1 139 ? 58.338  107.505 72.039  1.00 26.36 ? 139  MET B SD    1 
ATOM   5954  C CE    . MET B 1 139 ? 59.171  106.833 70.604  1.00 18.07 ? 139  MET B CE    1 
ATOM   5955  N N     . PRO B 1 140 ? 61.953  106.916 74.891  1.00 20.27 ? 140  PRO B N     1 
ATOM   5956  C CA    . PRO B 1 140 ? 63.313  106.472 75.200  1.00 20.41 ? 140  PRO B CA    1 
ATOM   5957  C C     . PRO B 1 140 ? 64.270  106.791 74.041  1.00 20.58 ? 140  PRO B C     1 
ATOM   5958  O O     . PRO B 1 140 ? 63.881  107.430 73.042  1.00 20.38 ? 140  PRO B O     1 
ATOM   5959  C CB    . PRO B 1 140 ? 63.157  104.946 75.371  1.00 19.78 ? 140  PRO B CB    1 
ATOM   5960  C CG    . PRO B 1 140 ? 61.849  104.587 74.753  1.00 18.80 ? 140  PRO B CG    1 
ATOM   5961  C CD    . PRO B 1 140 ? 61.128  105.822 74.331  1.00 19.68 ? 140  PRO B CD    1 
ATOM   5962  N N     . MET B 1 141 ? 65.517  106.339 74.184  1.00 21.01 ? 141  MET B N     1 
ATOM   5963  C CA    . MET B 1 141 ? 66.539  106.472 73.139  1.00 20.62 ? 141  MET B CA    1 
ATOM   5964  C C     . MET B 1 141 ? 66.379  105.391 72.058  1.00 20.38 ? 141  MET B C     1 
ATOM   5965  O O     . MET B 1 141 ? 67.184  104.465 71.954  1.00 19.25 ? 141  MET B O     1 
ATOM   5966  C CB    . MET B 1 141 ? 67.931  106.456 73.769  1.00 21.20 ? 141  MET B CB    1 
ATOM   5967  C CG    . MET B 1 141 ? 68.282  107.766 74.484  1.00 22.15 ? 141  MET B CG    1 
ATOM   5968  S SD    . MET B 1 141 ? 68.594  109.096 73.311  1.00 23.85 ? 141  MET B SD    1 
ATOM   5969  C CE    . MET B 1 141 ? 70.341  108.872 72.997  1.00 23.38 ? 141  MET B CE    1 
ATOM   5970  N N     . VAL B 1 142 ? 65.295  105.533 71.285  1.00 20.31 ? 142  VAL B N     1 
ATOM   5971  C CA    . VAL B 1 142 ? 64.958  104.691 70.153  1.00 20.41 ? 142  VAL B CA    1 
ATOM   5972  C C     . VAL B 1 142 ? 64.785  105.583 68.924  1.00 21.40 ? 142  VAL B C     1 
ATOM   5973  O O     . VAL B 1 142 ? 64.467  106.769 69.075  1.00 21.44 ? 142  VAL B O     1 
ATOM   5974  C CB    . VAL B 1 142 ? 63.678  103.841 70.413  1.00 20.98 ? 142  VAL B CB    1 
ATOM   5975  C CG1   . VAL B 1 142 ? 63.948  102.800 71.505  1.00 19.02 ? 142  VAL B CG1   1 
ATOM   5976  C CG2   . VAL B 1 142 ? 62.436  104.724 70.754  1.00 20.16 ? 142  VAL B CG2   1 
ATOM   5977  N N     . PRO B 1 143 ? 65.005  105.035 67.697  1.00 21.37 ? 143  PRO B N     1 
ATOM   5978  C CA    . PRO B 1 143 ? 64.978  105.863 66.485  1.00 21.34 ? 143  PRO B CA    1 
ATOM   5979  C C     . PRO B 1 143 ? 63.603  106.511 66.241  1.00 21.37 ? 143  PRO B C     1 
ATOM   5980  O O     . PRO B 1 143 ? 63.527  107.604 65.675  1.00 20.86 ? 143  PRO B O     1 
ATOM   5981  C CB    . PRO B 1 143 ? 65.276  104.860 65.356  1.00 21.73 ? 143  PRO B CB    1 
ATOM   5982  C CG    . PRO B 1 143 ? 65.913  103.686 66.020  1.00 21.70 ? 143  PRO B CG    1 
ATOM   5983  C CD    . PRO B 1 143 ? 65.271  103.621 67.380  1.00 22.04 ? 143  PRO B CD    1 
ATOM   5984  N N     . GLU B 1 144 ? 62.528  105.842 66.662  1.00 21.18 ? 144  GLU B N     1 
ATOM   5985  C CA    . GLU B 1 144 ? 61.180  106.437 66.592  1.00 21.06 ? 144  GLU B CA    1 
ATOM   5986  C C     . GLU B 1 144 ? 61.095  107.798 67.305  1.00 20.65 ? 144  GLU B C     1 
ATOM   5987  O O     . GLU B 1 144 ? 60.338  108.659 66.878  1.00 20.97 ? 144  GLU B O     1 
ATOM   5988  C CB    . GLU B 1 144 ? 60.127  105.477 67.149  1.00 21.53 ? 144  GLU B CB    1 
ATOM   5989  C CG    . GLU B 1 144 ? 59.969  104.175 66.319  1.00 22.71 ? 144  GLU B CG    1 
ATOM   5990  C CD    . GLU B 1 144 ? 60.989  103.106 66.685  1.00 24.62 ? 144  GLU B CD    1 
ATOM   5991  O OE1   . GLU B 1 144 ? 61.825  103.331 67.566  1.00 24.49 ? 144  GLU B OE1   1 
ATOM   5992  O OE2   . GLU B 1 144 ? 60.963  102.022 66.090  1.00 28.38 ? 144  GLU B OE2   1 
ATOM   5993  N N     . ALA B 1 145 ? 61.867  108.003 68.372  1.00 20.04 ? 145  ALA B N     1 
ATOM   5994  C CA    . ALA B 1 145 ? 61.899  109.327 69.029  1.00 20.46 ? 145  ALA B CA    1 
ATOM   5995  C C     . ALA B 1 145 ? 62.349  110.410 68.053  1.00 20.44 ? 145  ALA B C     1 
ATOM   5996  O O     . ALA B 1 145 ? 61.791  111.515 68.058  1.00 20.40 ? 145  ALA B O     1 
ATOM   5997  C CB    . ALA B 1 145 ? 62.804  109.317 70.238  1.00 20.29 ? 145  ALA B CB    1 
ATOM   5998  N N     . ALA B 1 146 ? 63.367  110.082 67.238  1.00 20.48 ? 146  ALA B N     1 
ATOM   5999  C CA    . ALA B 1 146 ? 63.904  110.984 66.212  1.00 20.19 ? 146  ALA B CA    1 
ATOM   6000  C C     . ALA B 1 146 ? 62.890  111.208 65.093  1.00 20.16 ? 146  ALA B C     1 
ATOM   6001  O O     . ALA B 1 146 ? 62.704  112.333 64.643  1.00 20.71 ? 146  ALA B O     1 
ATOM   6002  C CB    . ALA B 1 146 ? 65.219  110.450 65.646  1.00 19.64 ? 146  ALA B CB    1 
ATOM   6003  N N     . VAL B 1 147 ? 62.239  110.136 64.644  1.00 19.91 ? 147  VAL B N     1 
ATOM   6004  C CA    . VAL B 1 147 ? 61.190  110.249 63.647  1.00 20.36 ? 147  VAL B CA    1 
ATOM   6005  C C     . VAL B 1 147 ? 60.120  111.225 64.149  1.00 19.95 ? 147  VAL B C     1 
ATOM   6006  O O     . VAL B 1 147 ? 59.659  112.086 63.410  1.00 20.03 ? 147  VAL B O     1 
ATOM   6007  C CB    . VAL B 1 147 ? 60.542  108.860 63.337  1.00 20.62 ? 147  VAL B CB    1 
ATOM   6008  C CG1   . VAL B 1 147 ? 59.306  109.019 62.415  1.00 20.53 ? 147  VAL B CG1   1 
ATOM   6009  C CG2   . VAL B 1 147 ? 61.569  107.914 62.712  1.00 21.11 ? 147  VAL B CG2   1 
ATOM   6010  N N     . ALA B 1 148 ? 59.732  111.071 65.410  1.00 19.90 ? 148  ALA B N     1 
ATOM   6011  C CA    . ALA B 1 148 ? 58.682  111.894 66.014  1.00 20.24 ? 148  ALA B CA    1 
ATOM   6012  C C     . ALA B 1 148 ? 59.080  113.375 66.032  1.00 20.07 ? 148  ALA B C     1 
ATOM   6013  O O     . ALA B 1 148 ? 58.300  114.234 65.648  1.00 20.00 ? 148  ALA B O     1 
ATOM   6014  C CB    . ALA B 1 148 ? 58.360  111.382 67.429  1.00 19.47 ? 148  ALA B CB    1 
ATOM   6015  N N     . MET B 1 149 ? 60.299  113.671 66.476  1.00 20.86 ? 149  MET B N     1 
ATOM   6016  C CA    . MET B 1 149 ? 60.822  115.034 66.483  1.00 21.21 ? 149  MET B CA    1 
ATOM   6017  C C     . MET B 1 149 ? 60.846  115.655 65.078  1.00 21.46 ? 149  MET B C     1 
ATOM   6018  O O     . MET B 1 149 ? 60.209  116.674 64.822  1.00 21.64 ? 149  MET B O     1 
ATOM   6019  C CB    . MET B 1 149 ? 62.221  115.027 67.103  1.00 21.49 ? 149  MET B CB    1 
ATOM   6020  C CG    . MET B 1 149 ? 62.167  114.767 68.602  1.00 21.62 ? 149  MET B CG    1 
ATOM   6021  S SD    . MET B 1 149 ? 63.751  114.550 69.367  1.00 22.38 ? 149  MET B SD    1 
ATOM   6022  C CE    . MET B 1 149 ? 64.417  116.232 69.333  1.00 18.98 ? 149  MET B CE    1 
ATOM   6023  N N     . LEU B 1 150 ? 61.555  115.003 64.161  1.00 21.53 ? 150  LEU B N     1 
ATOM   6024  C CA    . LEU B 1 150 ? 61.648  115.442 62.770  1.00 20.79 ? 150  LEU B CA    1 
ATOM   6025  C C     . LEU B 1 150 ? 60.291  115.587 62.052  1.00 20.95 ? 150  LEU B C     1 
ATOM   6026  O O     . LEU B 1 150 ? 60.119  116.489 61.220  1.00 21.35 ? 150  LEU B O     1 
ATOM   6027  C CB    . LEU B 1 150 ? 62.535  114.463 62.004  1.00 20.48 ? 150  LEU B CB    1 
ATOM   6028  C CG    . LEU B 1 150 ? 64.049  114.534 62.218  1.00 19.44 ? 150  LEU B CG    1 
ATOM   6029  C CD1   . LEU B 1 150 ? 64.684  113.179 61.909  1.00 15.31 ? 150  LEU B CD1   1 
ATOM   6030  C CD2   . LEU B 1 150 ? 64.638  115.614 61.335  1.00 17.47 ? 150  LEU B CD2   1 
ATOM   6031  N N     . ALA B 1 151 ? 59.337  114.701 62.351  1.00 20.60 ? 151  ALA B N     1 
ATOM   6032  C CA    . ALA B 1 151 ? 58.013  114.787 61.748  1.00 20.34 ? 151  ALA B CA    1 
ATOM   6033  C C     . ALA B 1 151 ? 57.285  116.034 62.209  1.00 20.09 ? 151  ALA B C     1 
ATOM   6034  O O     . ALA B 1 151 ? 56.602  116.673 61.416  1.00 20.99 ? 151  ALA B O     1 
ATOM   6035  C CB    . ALA B 1 151 ? 57.200  113.573 62.067  1.00 21.12 ? 151  ALA B CB    1 
ATOM   6036  N N     . CYS B 1 152 ? 57.435  116.378 63.486  1.00 19.68 ? 152  CYS B N     1 
ATOM   6037  C CA    . CYS B 1 152 ? 56.821  117.572 64.072  1.00 19.31 ? 152  CYS B CA    1 
ATOM   6038  C C     . CYS B 1 152 ? 57.364  118.825 63.406  1.00 19.87 ? 152  CYS B C     1 
ATOM   6039  O O     . CYS B 1 152 ? 56.590  119.662 62.939  1.00 20.75 ? 152  CYS B O     1 
ATOM   6040  C CB    . CYS B 1 152 ? 57.124  117.621 65.563  1.00 19.37 ? 152  CYS B CB    1 
ATOM   6041  S SG    . CYS B 1 152 ? 56.021  116.622 66.587  1.00 20.95 ? 152  CYS B SG    1 
ATOM   6042  N N     . ALA B 1 153 ? 58.699  118.913 63.326  1.00 19.03 ? 153  ALA B N     1 
ATOM   6043  C CA    . ALA B 1 153 ? 59.399  119.979 62.627  1.00 18.56 ? 153  ALA B CA    1 
ATOM   6044  C C     . ALA B 1 153 ? 58.992  120.113 61.156  1.00 18.73 ? 153  ALA B C     1 
ATOM   6045  O O     . ALA B 1 153 ? 58.916  121.223 60.639  1.00 19.19 ? 153  ALA B O     1 
ATOM   6046  C CB    . ALA B 1 153 ? 60.912  119.785 62.740  1.00 17.24 ? 153  ALA B CB    1 
ATOM   6047  N N     . ARG B 1 154 ? 58.781  118.990 60.481  1.00 18.70 ? 154  ARG B N     1 
ATOM   6048  C CA    . ARG B 1 154 ? 58.399  119.014 59.070  1.00 19.48 ? 154  ARG B CA    1 
ATOM   6049  C C     . ARG B 1 154 ? 57.035  119.689 58.819  1.00 19.16 ? 154  ARG B C     1 
ATOM   6050  O O     . ARG B 1 154 ? 56.859  120.340 57.813  1.00 19.71 ? 154  ARG B O     1 
ATOM   6051  C CB    . ARG B 1 154 ? 58.414  117.596 58.483  1.00 19.78 ? 154  ARG B CB    1 
ATOM   6052  C CG    . ARG B 1 154 ? 58.258  117.543 56.939  1.00 20.30 ? 154  ARG B CG    1 
ATOM   6053  C CD    . ARG B 1 154 ? 58.154  116.081 56.477  1.00 19.95 ? 154  ARG B CD    1 
ATOM   6054  N NE    . ARG B 1 154 ? 58.229  115.926 55.019  1.00 19.12 ? 154  ARG B NE    1 
ATOM   6055  C CZ    . ARG B 1 154 ? 59.365  115.873 54.321  1.00 20.53 ? 154  ARG B CZ    1 
ATOM   6056  N NH1   . ARG B 1 154 ? 60.542  115.996 54.930  1.00 19.96 ? 154  ARG B NH1   1 
ATOM   6057  N NH2   . ARG B 1 154 ? 59.328  115.710 53.004  1.00 21.18 ? 154  ARG B NH2   1 
ATOM   6058  N N     . ILE B 1 155 ? 56.088  119.545 59.745  1.00 19.02 ? 155  ILE B N     1 
ATOM   6059  C CA    . ILE B 1 155 ? 54.766  120.160 59.591  1.00 18.40 ? 155  ILE B CA    1 
ATOM   6060  C C     . ILE B 1 155 ? 54.607  121.454 60.369  1.00 18.42 ? 155  ILE B C     1 
ATOM   6061  O O     . ILE B 1 155 ? 53.560  122.083 60.305  1.00 18.95 ? 155  ILE B O     1 
ATOM   6062  C CB    . ILE B 1 155 ? 53.627  119.151 59.888  1.00 18.25 ? 155  ILE B CB    1 
ATOM   6063  C CG1   . ILE B 1 155 ? 53.585  118.771 61.385  1.00 18.92 ? 155  ILE B CG1   1 
ATOM   6064  C CG2   . ILE B 1 155 ? 53.819  117.890 58.999  1.00 17.55 ? 155  ILE B CG2   1 
ATOM   6065  C CD1   . ILE B 1 155 ? 52.230  118.144 61.850  1.00 18.93 ? 155  ILE B CD1   1 
ATOM   6066  N N     . GLY B 1 156 ? 55.666  121.885 61.061  1.00 18.59 ? 156  GLY B N     1 
ATOM   6067  C CA    . GLY B 1 156 ? 55.622  123.122 61.810  1.00 18.93 ? 156  GLY B CA    1 
ATOM   6068  C C     . GLY B 1 156 ? 54.949  122.975 63.168  1.00 20.53 ? 156  GLY B C     1 
ATOM   6069  O O     . GLY B 1 156 ? 54.657  123.991 63.818  1.00 20.30 ? 156  GLY B O     1 
ATOM   6070  N N     . ALA B 1 157 ? 54.709  121.727 63.604  1.00 20.48 ? 157  ALA B N     1 
ATOM   6071  C CA    . ALA B 1 157 ? 54.212  121.468 64.951  1.00 21.52 ? 157  ALA B CA    1 
ATOM   6072  C C     . ALA B 1 157 ? 55.367  121.785 65.865  1.00 22.08 ? 157  ALA B C     1 
ATOM   6073  O O     . ALA B 1 157 ? 56.515  121.794 65.434  1.00 23.25 ? 157  ALA B O     1 
ATOM   6074  C CB    . ALA B 1 157 ? 53.758  119.995 65.134  1.00 20.90 ? 157  ALA B CB    1 
ATOM   6075  N N     . VAL B 1 158 ? 55.075  122.054 67.127  1.00 22.30 ? 158  VAL B N     1 
ATOM   6076  C CA    . VAL B 1 158 ? 56.110  122.473 68.044  1.00 21.59 ? 158  VAL B CA    1 
ATOM   6077  C C     . VAL B 1 158 ? 56.348  121.342 69.058  1.00 21.67 ? 158  VAL B C     1 
ATOM   6078  O O     . VAL B 1 158 ? 55.520  121.098 69.922  1.00 21.97 ? 158  VAL B O     1 
ATOM   6079  C CB    . VAL B 1 158 ? 55.732  123.795 68.734  1.00 21.54 ? 158  VAL B CB    1 
ATOM   6080  C CG1   . VAL B 1 158 ? 56.846  124.226 69.698  1.00 21.38 ? 158  VAL B CG1   1 
ATOM   6081  C CG2   . VAL B 1 158 ? 55.471  124.895 67.684  1.00 19.79 ? 158  VAL B CG2   1 
ATOM   6082  N N     . HIS B 1 159 ? 57.454  120.625 68.935  1.00 20.98 ? 159  HIS B N     1 
ATOM   6083  C CA    . HIS B 1 159 ? 57.657  119.526 69.868  1.00 20.80 ? 159  HIS B CA    1 
ATOM   6084  C C     . HIS B 1 159 ? 58.168  120.004 71.224  1.00 20.46 ? 159  HIS B C     1 
ATOM   6085  O O     . HIS B 1 159 ? 58.923  120.984 71.335  1.00 19.65 ? 159  HIS B O     1 
ATOM   6086  C CB    . HIS B 1 159 ? 58.491  118.359 69.292  1.00 20.36 ? 159  HIS B CB    1 
ATOM   6087  C CG    . HIS B 1 159 ? 59.933  118.683 69.004  1.00 20.78 ? 159  HIS B CG    1 
ATOM   6088  N ND1   . HIS B 1 159 ? 60.862  118.950 69.995  1.00 19.75 ? 159  HIS B ND1   1 
ATOM   6089  C CD2   . HIS B 1 159 ? 60.614  118.718 67.831  1.00 20.30 ? 159  HIS B CD2   1 
ATOM   6090  C CE1   . HIS B 1 159 ? 62.047  119.141 69.443  1.00 20.75 ? 159  HIS B CE1   1 
ATOM   6091  N NE2   . HIS B 1 159 ? 61.924  119.005 68.131  1.00 22.47 ? 159  HIS B NE2   1 
ATOM   6092  N N     . SER B 1 160 ? 57.705  119.319 72.257  1.00 20.12 ? 160  SER B N     1 
ATOM   6093  C CA    . SER B 1 160 ? 58.237  119.525 73.567  1.00 20.21 ? 160  SER B CA    1 
ATOM   6094  C C     . SER B 1 160 ? 58.662  118.165 74.045  1.00 20.03 ? 160  SER B C     1 
ATOM   6095  O O     . SER B 1 160 ? 57.837  117.378 74.516  1.00 19.61 ? 160  SER B O     1 
ATOM   6096  C CB    . SER B 1 160 ? 57.209  120.133 74.521  1.00 20.29 ? 160  SER B CB    1 
ATOM   6097  O OG    . SER B 1 160 ? 57.839  120.365 75.767  1.00 21.79 ? 160  SER B OG    1 
ATOM   6098  N N     . VAL B 1 161 ? 59.960  117.896 73.918  1.00 19.24 ? 161  VAL B N     1 
ATOM   6099  C CA    . VAL B 1 161 ? 60.492  116.619 74.324  1.00 19.48 ? 161  VAL B CA    1 
ATOM   6100  C C     . VAL B 1 161 ? 60.680  116.597 75.842  1.00 19.65 ? 161  VAL B C     1 
ATOM   6101  O O     . VAL B 1 161 ? 61.324  117.484 76.420  1.00 19.79 ? 161  VAL B O     1 
ATOM   6102  C CB    . VAL B 1 161 ? 61.817  116.263 73.588  1.00 19.11 ? 161  VAL B CB    1 
ATOM   6103  C CG1   . VAL B 1 161 ? 62.293  114.884 73.992  1.00 18.25 ? 161  VAL B CG1   1 
ATOM   6104  C CG2   . VAL B 1 161 ? 61.597  116.302 72.104  1.00 18.87 ? 161  VAL B CG2   1 
ATOM   6105  N N     . ILE B 1 162 ? 60.093  115.580 76.471  1.00 19.31 ? 162  ILE B N     1 
ATOM   6106  C CA    . ILE B 1 162 ? 60.173  115.409 77.911  1.00 19.74 ? 162  ILE B CA    1 
ATOM   6107  C C     . ILE B 1 162 ? 61.070  114.210 78.281  1.00 19.84 ? 162  ILE B C     1 
ATOM   6108  O O     . ILE B 1 162 ? 60.784  113.073 77.935  1.00 20.09 ? 162  ILE B O     1 
ATOM   6109  C CB    . ILE B 1 162 ? 58.764  115.269 78.532  1.00 20.09 ? 162  ILE B CB    1 
ATOM   6110  C CG1   . ILE B 1 162 ? 57.877  116.468 78.161  1.00 19.05 ? 162  ILE B CG1   1 
ATOM   6111  C CG2   . ILE B 1 162 ? 58.849  115.051 80.050  1.00 19.27 ? 162  ILE B CG2   1 
ATOM   6112  C CD1   . ILE B 1 162 ? 56.357  116.246 78.528  1.00 18.85 ? 162  ILE B CD1   1 
ATOM   6113  N N     . PHE B 1 163 ? 62.156  114.475 78.979  1.00 20.02 ? 163  PHE B N     1 
ATOM   6114  C CA    . PHE B 1 163 ? 63.041  113.413 79.399  1.00 21.13 ? 163  PHE B CA    1 
ATOM   6115  C C     . PHE B 1 163 ? 62.268  112.296 80.119  1.00 20.64 ? 163  PHE B C     1 
ATOM   6116  O O     . PHE B 1 163 ? 61.457  112.575 81.000  1.00 21.40 ? 163  PHE B O     1 
ATOM   6117  C CB    . PHE B 1 163 ? 64.167  113.991 80.286  1.00 20.96 ? 163  PHE B CB    1 
ATOM   6118  C CG    . PHE B 1 163 ? 65.139  112.951 80.834  1.00 20.36 ? 163  PHE B CG    1 
ATOM   6119  C CD1   . PHE B 1 163 ? 65.980  112.250 79.988  1.00 19.76 ? 163  PHE B CD1   1 
ATOM   6120  C CD2   . PHE B 1 163 ? 65.256  112.753 82.209  1.00 20.39 ? 163  PHE B CD2   1 
ATOM   6121  C CE1   . PHE B 1 163 ? 66.898  111.295 80.489  1.00 20.25 ? 163  PHE B CE1   1 
ATOM   6122  C CE2   . PHE B 1 163 ? 66.175  111.830 82.733  1.00 22.81 ? 163  PHE B CE2   1 
ATOM   6123  C CZ    . PHE B 1 163 ? 66.999  111.082 81.858  1.00 22.16 ? 163  PHE B CZ    1 
ATOM   6124  N N     . GLY B 1 164 ? 62.561  111.041 79.768  1.00 21.23 ? 164  GLY B N     1 
ATOM   6125  C CA    . GLY B 1 164 ? 61.907  109.850 80.345  1.00 20.72 ? 164  GLY B CA    1 
ATOM   6126  C C     . GLY B 1 164 ? 62.057  109.645 81.850  1.00 21.81 ? 164  GLY B C     1 
ATOM   6127  O O     . GLY B 1 164 ? 61.243  108.954 82.466  1.00 21.33 ? 164  GLY B O     1 
ATOM   6128  N N     . GLY B 1 165 ? 63.082  110.250 82.449  1.00 21.81 ? 165  GLY B N     1 
ATOM   6129  C CA    . GLY B 1 165 ? 63.276  110.209 83.908  1.00 22.83 ? 165  GLY B CA    1 
ATOM   6130  C C     . GLY B 1 165 ? 62.347  111.118 84.712  1.00 23.08 ? 165  GLY B C     1 
ATOM   6131  O O     . GLY B 1 165 ? 62.399  111.122 85.947  1.00 23.90 ? 165  GLY B O     1 
ATOM   6132  N N     . PHE B 1 166 ? 61.489  111.887 84.033  1.00 22.64 ? 166  PHE B N     1 
ATOM   6133  C CA    . PHE B 1 166 ? 60.498  112.704 84.748  1.00 21.39 ? 166  PHE B CA    1 
ATOM   6134  C C     . PHE B 1 166 ? 59.269  111.892 85.214  1.00 21.08 ? 166  PHE B C     1 
ATOM   6135  O O     . PHE B 1 166 ? 58.814  110.948 84.545  1.00 19.14 ? 166  PHE B O     1 
ATOM   6136  C CB    . PHE B 1 166 ? 60.082  113.944 83.927  1.00 22.19 ? 166  PHE B CB    1 
ATOM   6137  C CG    . PHE B 1 166 ? 61.109  115.064 83.948  1.00 22.53 ? 166  PHE B CG    1 
ATOM   6138  C CD1   . PHE B 1 166 ? 61.470  115.674 85.144  1.00 22.65 ? 166  PHE B CD1   1 
ATOM   6139  C CD2   . PHE B 1 166 ? 61.706  115.503 82.766  1.00 22.03 ? 166  PHE B CD2   1 
ATOM   6140  C CE1   . PHE B 1 166 ? 62.439  116.700 85.160  1.00 25.16 ? 166  PHE B CE1   1 
ATOM   6141  C CE2   . PHE B 1 166 ? 62.645  116.515 82.764  1.00 22.40 ? 166  PHE B CE2   1 
ATOM   6142  C CZ    . PHE B 1 166 ? 63.022  117.124 83.960  1.00 23.09 ? 166  PHE B CZ    1 
ATOM   6143  N N     . SER B 1 167 ? 58.753  112.263 86.384  1.00 20.56 ? 167  SER B N     1 
ATOM   6144  C CA    . SER B 1 167 ? 57.645  111.575 87.012  1.00 21.12 ? 167  SER B CA    1 
ATOM   6145  C C     . SER B 1 167 ? 56.369  112.010 86.338  1.00 21.51 ? 167  SER B C     1 
ATOM   6146  O O     . SER B 1 167 ? 56.393  113.018 85.630  1.00 22.44 ? 167  SER B O     1 
ATOM   6147  C CB    . SER B 1 167 ? 57.577  111.980 88.482  1.00 21.65 ? 167  SER B CB    1 
ATOM   6148  O OG    . SER B 1 167 ? 57.189  113.352 88.602  1.00 22.41 ? 167  SER B OG    1 
ATOM   6149  N N     . PRO B 1 168 ? 55.241  111.284 86.576  1.00 21.79 ? 168  PRO B N     1 
ATOM   6150  C CA    . PRO B 1 168 ? 53.917  111.694 86.089  1.00 21.54 ? 168  PRO B CA    1 
ATOM   6151  C C     . PRO B 1 168 ? 53.542  113.138 86.456  1.00 22.33 ? 168  PRO B C     1 
ATOM   6152  O O     . PRO B 1 168 ? 52.917  113.833 85.660  1.00 22.65 ? 168  PRO B O     1 
ATOM   6153  C CB    . PRO B 1 168 ? 52.959  110.720 86.804  1.00 21.30 ? 168  PRO B CB    1 
ATOM   6154  C CG    . PRO B 1 168 ? 53.763  109.496 87.089  1.00 21.46 ? 168  PRO B CG    1 
ATOM   6155  C CD    . PRO B 1 168 ? 55.190  109.992 87.313  1.00 21.65 ? 168  PRO B CD    1 
ATOM   6156  N N     . GLU B 1 169 ? 53.888  113.584 87.664  1.00 22.83 ? 169  GLU B N     1 
ATOM   6157  C CA    . GLU B 1 169 ? 53.600  114.962 88.068  1.00 23.65 ? 169  GLU B CA    1 
ATOM   6158  C C     . GLU B 1 169 ? 54.363  116.006 87.231  1.00 23.25 ? 169  GLU B C     1 
ATOM   6159  O O     . GLU B 1 169 ? 53.788  117.035 86.831  1.00 23.10 ? 169  GLU B O     1 
ATOM   6160  C CB    . GLU B 1 169 ? 53.794  115.147 89.586  1.00 23.92 ? 169  GLU B CB    1 
ATOM   6161  C CG    . GLU B 1 169 ? 53.925  116.579 90.041  1.00 28.53 ? 169  GLU B CG    1 
ATOM   6162  C CD    . GLU B 1 169 ? 52.603  117.315 90.276  1.00 32.16 ? 169  GLU B CD    1 
ATOM   6163  O OE1   . GLU B 1 169 ? 51.496  116.735 90.125  1.00 32.30 ? 169  GLU B OE1   1 
ATOM   6164  O OE2   . GLU B 1 169 ? 52.701  118.508 90.637  1.00 36.09 ? 169  GLU B OE2   1 
ATOM   6165  N N     . ALA B 1 170 ? 55.635  115.713 86.947  1.00 22.85 ? 170  ALA B N     1 
ATOM   6166  C CA    . ALA B 1 170 ? 56.482  116.574 86.122  1.00 22.41 ? 170  ALA B CA    1 
ATOM   6167  C C     . ALA B 1 170 ? 56.002  116.553 84.680  1.00 21.54 ? 170  ALA B C     1 
ATOM   6168  O O     . ALA B 1 170 ? 55.960  117.593 84.036  1.00 21.99 ? 170  ALA B O     1 
ATOM   6169  C CB    . ALA B 1 170 ? 57.955  116.146 86.215  1.00 22.02 ? 170  ALA B CB    1 
ATOM   6170  N N     . VAL B 1 171 ? 55.617  115.373 84.190  1.00 21.33 ? 171  VAL B N     1 
ATOM   6171  C CA    . VAL B 1 171 ? 55.022  115.242 82.854  1.00 20.54 ? 171  VAL B CA    1 
ATOM   6172  C C     . VAL B 1 171 ? 53.732  116.053 82.734  1.00 20.48 ? 171  VAL B C     1 
ATOM   6173  O O     . VAL B 1 171 ? 53.570  116.792 81.780  1.00 20.71 ? 171  VAL B O     1 
ATOM   6174  C CB    . VAL B 1 171 ? 54.775  113.755 82.449  1.00 21.28 ? 171  VAL B CB    1 
ATOM   6175  C CG1   . VAL B 1 171 ? 53.988  113.678 81.123  1.00 19.95 ? 171  VAL B CG1   1 
ATOM   6176  C CG2   . VAL B 1 171 ? 56.103  112.985 82.362  1.00 17.90 ? 171  VAL B CG2   1 
ATOM   6177  N N     . ALA B 1 172 ? 52.826  115.923 83.705  1.00 20.39 ? 172  ALA B N     1 
ATOM   6178  C CA    . ALA B 1 172 ? 51.563  116.675 83.703  1.00 20.75 ? 172  ALA B CA    1 
ATOM   6179  C C     . ALA B 1 172 ? 51.756  118.204 83.729  1.00 21.18 ? 172  ALA B C     1 
ATOM   6180  O O     . ALA B 1 172 ? 51.051  118.925 83.025  1.00 21.26 ? 172  ALA B O     1 
ATOM   6181  C CB    . ALA B 1 172 ? 50.670  116.237 84.846  1.00 20.22 ? 172  ALA B CB    1 
ATOM   6182  N N     . GLY B 1 173 ? 52.697  118.689 84.543  1.00 21.91 ? 173  GLY B N     1 
ATOM   6183  C CA    . GLY B 1 173 ? 53.027  120.135 84.602  1.00 21.51 ? 173  GLY B CA    1 
ATOM   6184  C C     . GLY B 1 173 ? 53.456  120.713 83.252  1.00 22.11 ? 173  GLY B C     1 
ATOM   6185  O O     . GLY B 1 173 ? 53.037  121.822 82.899  1.00 21.41 ? 173  GLY B O     1 
ATOM   6186  N N     . ARG B 1 174 ? 54.291  119.958 82.513  1.00 21.92 ? 174  ARG B N     1 
ATOM   6187  C CA    . ARG B 1 174 ? 54.766  120.312 81.161  1.00 21.39 ? 174  ARG B CA    1 
ATOM   6188  C C     . ARG B 1 174 ? 53.673  120.229 80.106  1.00 22.31 ? 174  ARG B C     1 
ATOM   6189  O O     . ARG B 1 174 ? 53.606  121.105 79.220  1.00 22.85 ? 174  ARG B O     1 
ATOM   6190  C CB    . ARG B 1 174 ? 55.935  119.422 80.730  1.00 21.09 ? 174  ARG B CB    1 
ATOM   6191  C CG    . ARG B 1 174 ? 57.252  119.760 81.410  1.00 21.05 ? 174  ARG B CG    1 
ATOM   6192  C CD    . ARG B 1 174 ? 58.281  118.624 81.291  1.00 21.38 ? 174  ARG B CD    1 
ATOM   6193  N NE    . ARG B 1 174 ? 59.562  119.028 81.870  1.00 22.73 ? 174  ARG B NE    1 
ATOM   6194  C CZ    . ARG B 1 174 ? 59.776  119.187 83.179  1.00 19.93 ? 174  ARG B CZ    1 
ATOM   6195  N NH1   . ARG B 1 174 ? 58.807  118.971 84.059  1.00 19.55 ? 174  ARG B NH1   1 
ATOM   6196  N NH2   . ARG B 1 174 ? 60.954  119.574 83.605  1.00 20.22 ? 174  ARG B NH2   1 
ATOM   6197  N N     . ILE B 1 175 ? 52.838  119.182 80.170  1.00 21.83 ? 175  ILE B N     1 
ATOM   6198  C CA    . ILE B 1 175 ? 51.632  119.107 79.332  1.00 22.11 ? 175  ILE B CA    1 
ATOM   6199  C C     . ILE B 1 175 ? 50.696  120.325 79.566  1.00 22.99 ? 175  ILE B C     1 
ATOM   6200  O O     . ILE B 1 175 ? 50.191  120.923 78.604  1.00 22.45 ? 175  ILE B O     1 
ATOM   6201  C CB    . ILE B 1 175 ? 50.870  117.765 79.494  1.00 21.64 ? 175  ILE B CB    1 
ATOM   6202  C CG1   . ILE B 1 175 ? 51.666  116.597 78.883  1.00 22.57 ? 175  ILE B CG1   1 
ATOM   6203  C CG2   . ILE B 1 175 ? 49.526  117.801 78.819  1.00 21.29 ? 175  ILE B CG2   1 
ATOM   6204  C CD1   . ILE B 1 175 ? 51.057  115.249 79.197  1.00 22.00 ? 175  ILE B CD1   1 
ATOM   6205  N N     . ILE B 1 176 ? 50.493  120.697 80.833  1.00 23.18 ? 176  ILE B N     1 
ATOM   6206  C CA    . ILE B 1 176 ? 49.564  121.788 81.180  1.00 23.57 ? 176  ILE B CA    1 
ATOM   6207  C C     . ILE B 1 176 ? 50.067  123.131 80.643  1.00 24.22 ? 176  ILE B C     1 
ATOM   6208  O O     . ILE B 1 176 ? 49.315  123.876 79.992  1.00 24.59 ? 176  ILE B O     1 
ATOM   6209  C CB    . ILE B 1 176 ? 49.280  121.851 82.722  1.00 23.58 ? 176  ILE B CB    1 
ATOM   6210  C CG1   . ILE B 1 176 ? 48.451  120.630 83.161  1.00 24.21 ? 176  ILE B CG1   1 
ATOM   6211  C CG2   . ILE B 1 176 ? 48.539  123.137 83.101  1.00 24.01 ? 176  ILE B CG2   1 
ATOM   6212  C CD1   . ILE B 1 176 ? 48.388  120.396 84.671  1.00 22.60 ? 176  ILE B CD1   1 
ATOM   6213  N N     . ASP B 1 177 ? 51.343  123.411 80.890  1.00 24.39 ? 177  ASP B N     1 
ATOM   6214  C CA    . ASP B 1 177 ? 51.946  124.688 80.547  1.00 24.99 ? 177  ASP B CA    1 
ATOM   6215  C C     . ASP B 1 177 ? 51.920  124.905 79.031  1.00 24.93 ? 177  ASP B C     1 
ATOM   6216  O O     . ASP B 1 177 ? 51.591  126.000 78.567  1.00 25.22 ? 177  ASP B O     1 
ATOM   6217  C CB    . ASP B 1 177 ? 53.389  124.790 81.099  1.00 24.67 ? 177  ASP B CB    1 
ATOM   6218  C CG    . ASP B 1 177 ? 54.002  126.194 80.897  1.00 24.71 ? 177  ASP B CG    1 
ATOM   6219  O OD1   . ASP B 1 177 ? 54.951  126.353 80.089  1.00 23.72 ? 177  ASP B OD1   1 
ATOM   6220  O OD2   . ASP B 1 177 ? 53.527  127.151 81.546  1.00 25.94 ? 177  ASP B OD2   1 
ATOM   6221  N N     . SER B 1 178 ? 52.219  123.841 78.281  1.00 24.62 ? 178  SER B N     1 
ATOM   6222  C CA    . SER B 1 178 ? 52.385  123.907 76.827  1.00 23.42 ? 178  SER B CA    1 
ATOM   6223  C C     . SER B 1 178 ? 51.089  123.717 76.067  1.00 23.79 ? 178  SER B C     1 
ATOM   6224  O O     . SER B 1 178 ? 51.048  123.954 74.861  1.00 23.97 ? 178  SER B O     1 
ATOM   6225  C CB    . SER B 1 178 ? 53.445  122.893 76.354  1.00 23.49 ? 178  SER B CB    1 
ATOM   6226  O OG    . SER B 1 178 ? 53.026  121.551 76.568  1.00 21.67 ? 178  SER B OG    1 
ATOM   6227  N N     . SER B 1 179 ? 50.029  123.306 76.766  1.00 23.54 ? 179  SER B N     1 
ATOM   6228  C CA    . SER B 1 179 ? 48.786  122.852 76.118  1.00 23.73 ? 179  SER B CA    1 
ATOM   6229  C C     . SER B 1 179 ? 49.051  121.813 75.038  1.00 23.44 ? 179  SER B C     1 
ATOM   6230  O O     . SER B 1 179 ? 48.504  121.920 73.947  1.00 23.24 ? 179  SER B O     1 
ATOM   6231  C CB    . SER B 1 179 ? 47.983  124.013 75.519  1.00 23.56 ? 179  SER B CB    1 
ATOM   6232  O OG    . SER B 1 179 ? 47.445  124.822 76.548  1.00 26.71 ? 179  SER B OG    1 
ATOM   6233  N N     . SER B 1 180 ? 49.890  120.822 75.352  1.00 23.31 ? 180  SER B N     1 
ATOM   6234  C CA    . SER B 1 180 ? 50.212  119.744 74.424  1.00 23.47 ? 180  SER B CA    1 
ATOM   6235  C C     . SER B 1 180 ? 48.927  119.070 73.948  1.00 23.31 ? 180  SER B C     1 
ATOM   6236  O O     . SER B 1 180 ? 48.061  118.743 74.749  1.00 23.07 ? 180  SER B O     1 
ATOM   6237  C CB    . SER B 1 180 ? 51.143  118.721 75.087  1.00 23.22 ? 180  SER B CB    1 
ATOM   6238  O OG    . SER B 1 180 ? 52.434  119.279 75.331  1.00 23.74 ? 180  SER B OG    1 
ATOM   6239  N N     . ARG B 1 181 ? 48.807  118.895 72.639  1.00 23.48 ? 181  ARG B N     1 
ATOM   6240  C CA    . ARG B 1 181 ? 47.606  118.351 72.016  1.00 24.25 ? 181  ARG B CA    1 
ATOM   6241  C C     . ARG B 1 181 ? 47.751  116.856 71.796  1.00 23.78 ? 181  ARG B C     1 
ATOM   6242  O O     . ARG B 1 181 ? 46.769  116.145 71.538  1.00 23.66 ? 181  ARG B O     1 
ATOM   6243  C CB    . ARG B 1 181 ? 47.373  119.023 70.666  1.00 24.88 ? 181  ARG B CB    1 
ATOM   6244  C CG    . ARG B 1 181 ? 46.903  120.474 70.775  1.00 29.83 ? 181  ARG B CG    1 
ATOM   6245  C CD    . ARG B 1 181 ? 46.078  120.850 69.538  1.00 37.90 ? 181  ARG B CD    1 
ATOM   6246  N NE    . ARG B 1 181 ? 45.295  119.722 69.017  1.00 39.93 ? 181  ARG B NE    1 
ATOM   6247  C CZ    . ARG B 1 181 ? 44.681  119.713 67.835  1.00 41.97 ? 181  ARG B CZ    1 
ATOM   6248  N NH1   . ARG B 1 181 ? 44.729  120.768 67.025  1.00 41.88 ? 181  ARG B NH1   1 
ATOM   6249  N NH2   . ARG B 1 181 ? 44.010  118.638 67.463  1.00 43.66 ? 181  ARG B NH2   1 
ATOM   6250  N N     . LEU B 1 182 ? 48.994  116.389 71.866  1.00 23.01 ? 182  LEU B N     1 
ATOM   6251  C CA    . LEU B 1 182 ? 49.306  114.998 71.610  1.00 21.56 ? 182  LEU B CA    1 
ATOM   6252  C C     . LEU B 1 182 ? 50.439  114.591 72.532  1.00 21.59 ? 182  LEU B C     1 
ATOM   6253  O O     . LEU B 1 182 ? 51.305  115.407 72.842  1.00 20.85 ? 182  LEU B O     1 
ATOM   6254  C CB    . LEU B 1 182 ? 49.735  114.857 70.153  1.00 21.57 ? 182  LEU B CB    1 
ATOM   6255  C CG    . LEU B 1 182 ? 50.167  113.515 69.573  1.00 20.84 ? 182  LEU B CG    1 
ATOM   6256  C CD1   . LEU B 1 182 ? 49.022  112.591 69.672  1.00 18.42 ? 182  LEU B CD1   1 
ATOM   6257  C CD2   . LEU B 1 182 ? 50.599  113.701 68.117  1.00 21.40 ? 182  LEU B CD2   1 
ATOM   6258  N N     . VAL B 1 183 ? 50.425  113.331 72.971  1.00 20.82 ? 183  VAL B N     1 
ATOM   6259  C CA    . VAL B 1 183 ? 51.607  112.730 73.604  1.00 20.20 ? 183  VAL B CA    1 
ATOM   6260  C C     . VAL B 1 183 ? 52.084  111.563 72.751  1.00 20.17 ? 183  VAL B C     1 
ATOM   6261  O O     . VAL B 1 183 ? 51.287  110.740 72.324  1.00 20.53 ? 183  VAL B O     1 
ATOM   6262  C CB    . VAL B 1 183 ? 51.338  112.297 75.076  1.00 20.08 ? 183  VAL B CB    1 
ATOM   6263  C CG1   . VAL B 1 183 ? 52.571  111.686 75.714  1.00 17.95 ? 183  VAL B CG1   1 
ATOM   6264  C CG2   . VAL B 1 183 ? 50.863  113.524 75.919  1.00 19.00 ? 183  VAL B CG2   1 
ATOM   6265  N N     . ILE B 1 184 ? 53.383  111.525 72.473  1.00 20.50 ? 184  ILE B N     1 
ATOM   6266  C CA    . ILE B 1 184 ? 54.019  110.364 71.830  1.00 19.62 ? 184  ILE B CA    1 
ATOM   6267  C C     . ILE B 1 184 ? 54.933  109.680 72.840  1.00 19.97 ? 184  ILE B C     1 
ATOM   6268  O O     . ILE B 1 184 ? 55.849  110.312 73.371  1.00 20.45 ? 184  ILE B O     1 
ATOM   6269  C CB    . ILE B 1 184 ? 54.800  110.758 70.564  1.00 19.40 ? 184  ILE B CB    1 
ATOM   6270  C CG1   . ILE B 1 184 ? 53.884  111.539 69.615  1.00 19.09 ? 184  ILE B CG1   1 
ATOM   6271  C CG2   . ILE B 1 184 ? 55.338  109.487 69.868  1.00 18.46 ? 184  ILE B CG2   1 
ATOM   6272  C CD1   . ILE B 1 184 ? 54.562  112.220 68.429  1.00 18.29 ? 184  ILE B CD1   1 
ATOM   6273  N N     . THR B 1 185 ? 54.668  108.403 73.119  1.00 19.47 ? 185  THR B N     1 
ATOM   6274  C CA    . THR B 1 185 ? 55.370  107.684 74.174  1.00 19.28 ? 185  THR B CA    1 
ATOM   6275  C C     . THR B 1 185 ? 55.602  106.222 73.782  1.00 19.75 ? 185  THR B C     1 
ATOM   6276  O O     . THR B 1 185 ? 55.320  105.833 72.651  1.00 20.90 ? 185  THR B O     1 
ATOM   6277  C CB    . THR B 1 185 ? 54.703  107.832 75.582  1.00 19.46 ? 185  THR B CB    1 
ATOM   6278  O OG1   . THR B 1 185 ? 55.617  107.378 76.594  1.00 20.74 ? 185  THR B OG1   1 
ATOM   6279  C CG2   . THR B 1 185 ? 53.381  107.035 75.712  1.00 17.59 ? 185  THR B CG2   1 
ATOM   6280  N N     . ALA B 1 186 ? 56.178  105.434 74.679  1.00 19.18 ? 186  ALA B N     1 
ATOM   6281  C CA    . ALA B 1 186 ? 56.327  104.005 74.439  1.00 19.64 ? 186  ALA B CA    1 
ATOM   6282  C C     . ALA B 1 186 ? 55.727  103.310 75.631  1.00 19.71 ? 186  ALA B C     1 
ATOM   6283  O O     . ALA B 1 186 ? 55.563  103.951 76.681  1.00 19.56 ? 186  ALA B O     1 
ATOM   6284  C CB    . ALA B 1 186 ? 57.819  103.613 74.293  1.00 17.70 ? 186  ALA B CB    1 
ATOM   6285  N N     . ASP B 1 187 ? 55.441  102.011 75.493  1.00 19.52 ? 187  ASP B N     1 
ATOM   6286  C CA    . ASP B 1 187 ? 54.996  101.237 76.642  1.00 20.41 ? 187  ASP B CA    1 
ATOM   6287  C C     . ASP B 1 187 ? 56.052  101.326 77.748  1.00 20.37 ? 187  ASP B C     1 
ATOM   6288  O O     . ASP B 1 187 ? 55.761  101.807 78.854  1.00 21.40 ? 187  ASP B O     1 
ATOM   6289  C CB    . ASP B 1 187 ? 54.585  99.787  76.291  1.00 19.92 ? 187  ASP B CB    1 
ATOM   6290  C CG    . ASP B 1 187 ? 55.598  99.050  75.384  1.00 21.17 ? 187  ASP B CG    1 
ATOM   6291  O OD1   . ASP B 1 187 ? 56.762  99.486  75.234  1.00 19.45 ? 187  ASP B OD1   1 
ATOM   6292  O OD2   . ASP B 1 187 ? 55.189  98.013  74.814  1.00 20.52 ? 187  ASP B OD2   1 
ATOM   6293  N N     . GLU B 1 188 ? 57.284  100.943 77.425  1.00 19.88 ? 188  GLU B N     1 
ATOM   6294  C CA    . GLU B 1 188 ? 58.419  101.065 78.350  1.00 19.50 ? 188  GLU B CA    1 
ATOM   6295  C C     . GLU B 1 188 ? 59.705  101.411 77.591  1.00 19.48 ? 188  GLU B C     1 
ATOM   6296  O O     . GLU B 1 188 ? 59.822  101.118 76.409  1.00 19.58 ? 188  GLU B O     1 
ATOM   6297  C CB    . GLU B 1 188 ? 58.630  99.735  79.080  1.00 19.89 ? 188  GLU B CB    1 
ATOM   6298  C CG    . GLU B 1 188 ? 57.427  99.242  79.829  1.00 19.65 ? 188  GLU B CG    1 
ATOM   6299  C CD    . GLU B 1 188 ? 57.715  97.999  80.635  1.00 21.52 ? 188  GLU B CD    1 
ATOM   6300  O OE1   . GLU B 1 188 ? 58.285  97.038  80.094  1.00 22.51 ? 188  GLU B OE1   1 
ATOM   6301  O OE2   . GLU B 1 188 ? 57.343  97.971  81.819  1.00 25.44 ? 188  GLU B OE2   1 
ATOM   6302  N N     . GLY B 1 189 ? 60.659  102.029 78.274  1.00 19.74 ? 189  GLY B N     1 
ATOM   6303  C CA    . GLY B 1 189 ? 62.004  102.218 77.755  1.00 20.92 ? 189  GLY B CA    1 
ATOM   6304  C C     . GLY B 1 189 ? 62.911  101.112 78.292  1.00 21.49 ? 189  GLY B C     1 
ATOM   6305  O O     . GLY B 1 189 ? 62.597  100.492 79.309  1.00 21.36 ? 189  GLY B O     1 
ATOM   6306  N N     . VAL B 1 190 ? 64.010  100.835 77.588  1.00 22.51 ? 190  VAL B N     1 
ATOM   6307  C CA    . VAL B 1 190 ? 64.967  99.806  78.000  1.00 22.90 ? 190  VAL B CA    1 
ATOM   6308  C C     . VAL B 1 190 ? 66.336  100.446 78.272  1.00 23.46 ? 190  VAL B C     1 
ATOM   6309  O O     . VAL B 1 190 ? 66.892  101.149 77.410  1.00 22.81 ? 190  VAL B O     1 
ATOM   6310  C CB    . VAL B 1 190 ? 65.080  98.649  76.963  1.00 23.42 ? 190  VAL B CB    1 
ATOM   6311  C CG1   . VAL B 1 190 ? 66.047  97.523  77.463  1.00 22.76 ? 190  VAL B CG1   1 
ATOM   6312  C CG2   . VAL B 1 190 ? 63.691  98.066  76.618  1.00 22.50 ? 190  VAL B CG2   1 
ATOM   6313  N N     . ARG B 1 191 ? 66.872  100.196 79.475  1.00 23.96 ? 191  ARG B N     1 
ATOM   6314  C CA    . ARG B 1 191 ? 68.086  100.879 79.961  1.00 25.13 ? 191  ARG B CA    1 
ATOM   6315  C C     . ARG B 1 191 ? 68.804  100.086 81.044  1.00 25.32 ? 191  ARG B C     1 
ATOM   6316  O O     . ARG B 1 191 ? 68.261  99.888  82.137  1.00 25.00 ? 191  ARG B O     1 
ATOM   6317  C CB    . ARG B 1 191 ? 67.724  102.267 80.529  1.00 24.71 ? 191  ARG B CB    1 
ATOM   6318  C CG    . ARG B 1 191 ? 68.918  103.146 80.903  1.00 26.22 ? 191  ARG B CG    1 
ATOM   6319  C CD    . ARG B 1 191 ? 68.447  104.504 81.465  1.00 26.76 ? 191  ARG B CD    1 
ATOM   6320  N NE    . ARG B 1 191 ? 69.547  105.431 81.769  1.00 29.78 ? 191  ARG B NE    1 
ATOM   6321  C CZ    . ARG B 1 191 ? 70.174  105.501 82.945  1.00 32.68 ? 191  ARG B CZ    1 
ATOM   6322  N NH1   . ARG B 1 191 ? 69.853  104.684 83.941  1.00 33.46 ? 191  ARG B NH1   1 
ATOM   6323  N NH2   . ARG B 1 191 ? 71.156  106.381 83.131  1.00 35.04 ? 191  ARG B NH2   1 
ATOM   6324  N N     . ALA B 1 192 ? 70.045  99.688  80.762  1.00 25.77 ? 192  ALA B N     1 
ATOM   6325  C CA    . ALA B 1 192 ? 70.868  98.974  81.736  1.00 26.04 ? 192  ALA B CA    1 
ATOM   6326  C C     . ALA B 1 192 ? 70.186  97.685  82.199  1.00 26.94 ? 192  ALA B C     1 
ATOM   6327  O O     . ALA B 1 192 ? 70.142  97.370  83.396  1.00 26.72 ? 192  ALA B O     1 
ATOM   6328  C CB    . ALA B 1 192 ? 71.225  99.892  82.927  1.00 26.20 ? 192  ALA B CB    1 
ATOM   6329  N N     . GLY B 1 193 ? 69.642  96.955  81.226  1.00 27.67 ? 193  GLY B N     1 
ATOM   6330  C CA    . GLY B 1 193 ? 68.949  95.700  81.468  1.00 28.70 ? 193  GLY B CA    1 
ATOM   6331  C C     . GLY B 1 193 ? 67.560  95.781  82.079  1.00 29.83 ? 193  GLY B C     1 
ATOM   6332  O O     . GLY B 1 193 ? 66.919  94.734  82.287  1.00 30.00 ? 193  GLY B O     1 
ATOM   6333  N N     . ARG B 1 194 ? 67.088  96.999  82.350  1.00 29.89 ? 194  ARG B N     1 
ATOM   6334  C CA    . ARG B 1 194 ? 65.824  97.214  83.060  1.00 31.03 ? 194  ARG B CA    1 
ATOM   6335  C C     . ARG B 1 194 ? 64.805  97.844  82.118  1.00 30.62 ? 194  ARG B C     1 
ATOM   6336  O O     . ARG B 1 194 ? 65.176  98.567  81.196  1.00 30.44 ? 194  ARG B O     1 
ATOM   6337  C CB    . ARG B 1 194 ? 66.031  98.152  84.263  1.00 30.45 ? 194  ARG B CB    1 
ATOM   6338  C CG    . ARG B 1 194 ? 67.056  97.649  85.292  1.00 33.36 ? 194  ARG B CG    1 
ATOM   6339  C CD    . ARG B 1 194 ? 67.353  98.639  86.400  1.00 33.72 ? 194  ARG B CD    1 
ATOM   6340  N NE    . ARG B 1 194 ? 66.141  99.278  86.922  1.00 40.62 ? 194  ARG B NE    1 
ATOM   6341  C CZ    . ARG B 1 194 ? 66.123  100.396 87.662  1.00 42.07 ? 194  ARG B CZ    1 
ATOM   6342  N NH1   . ARG B 1 194 ? 67.259  101.020 87.994  1.00 41.29 ? 194  ARG B NH1   1 
ATOM   6343  N NH2   . ARG B 1 194 ? 64.959  100.895 88.071  1.00 41.23 ? 194  ARG B NH2   1 
ATOM   6344  N N     . SER B 1 195 ? 63.531  97.553  82.354  1.00 30.36 ? 195  SER B N     1 
ATOM   6345  C CA    . SER B 1 195 ? 62.417  98.221  81.674  1.00 30.60 ? 195  SER B CA    1 
ATOM   6346  C C     . SER B 1 195 ? 61.916  99.353  82.559  1.00 30.56 ? 195  SER B C     1 
ATOM   6347  O O     . SER B 1 195 ? 61.695  99.163  83.756  1.00 31.31 ? 195  SER B O     1 
ATOM   6348  C CB    . SER B 1 195 ? 61.283  97.238  81.407  1.00 30.43 ? 195  SER B CB    1 
ATOM   6349  O OG    . SER B 1 195 ? 61.708  96.238  80.514  1.00 31.49 ? 195  SER B OG    1 
ATOM   6350  N N     . ILE B 1 196 ? 61.755  100.523 81.964  1.00 29.67 ? 196  ILE B N     1 
ATOM   6351  C CA    . ILE B 1 196 ? 61.347  101.720 82.663  1.00 29.69 ? 196  ILE B CA    1 
ATOM   6352  C C     . ILE B 1 196 ? 59.954  102.090 82.155  1.00 29.15 ? 196  ILE B C     1 
ATOM   6353  O O     . ILE B 1 196 ? 59.788  102.326 80.979  1.00 28.65 ? 196  ILE B O     1 
ATOM   6354  C CB    . ILE B 1 196 ? 62.393  102.869 82.406  1.00 30.04 ? 196  ILE B CB    1 
ATOM   6355  C CG1   . ILE B 1 196 ? 63.744  102.498 83.039  1.00 30.13 ? 196  ILE B CG1   1 
ATOM   6356  C CG2   . ILE B 1 196 ? 61.889  104.213 82.890  1.00 29.61 ? 196  ILE B CG2   1 
ATOM   6357  C CD1   . ILE B 1 196 ? 64.818  103.563 82.913  1.00 31.20 ? 196  ILE B CD1   1 
ATOM   6358  N N     . PRO B 1 197 ? 58.931  102.078 83.031  1.00 29.15 ? 197  PRO B N     1 
ATOM   6359  C CA    . PRO B 1 197 ? 57.594  102.480 82.570  1.00 28.62 ? 197  PRO B CA    1 
ATOM   6360  C C     . PRO B 1 197 ? 57.599  103.879 81.949  1.00 27.84 ? 197  PRO B C     1 
ATOM   6361  O O     . PRO B 1 197 ? 58.323  104.779 82.417  1.00 28.87 ? 197  PRO B O     1 
ATOM   6362  C CB    . PRO B 1 197 ? 56.727  102.435 83.846  1.00 28.92 ? 197  PRO B CB    1 
ATOM   6363  C CG    . PRO B 1 197 ? 57.698  102.410 84.994  1.00 31.11 ? 197  PRO B CG    1 
ATOM   6364  C CD    . PRO B 1 197 ? 58.918  101.661 84.445  1.00 29.79 ? 197  PRO B CD    1 
ATOM   6365  N N     . LEU B 1 198 ? 56.875  104.027 80.850  1.00 25.42 ? 198  LEU B N     1 
ATOM   6366  C CA    . LEU B 1 198 ? 56.703  105.325 80.234  1.00 23.54 ? 198  LEU B CA    1 
ATOM   6367  C C     . LEU B 1 198 ? 55.216  105.577 80.025  1.00 22.61 ? 198  LEU B C     1 
ATOM   6368  O O     . LEU B 1 198 ? 54.714  106.575 80.527  1.00 21.85 ? 198  LEU B O     1 
ATOM   6369  C CB    . LEU B 1 198 ? 57.513  105.475 78.943  1.00 22.63 ? 198  LEU B CB    1 
ATOM   6370  C CG    . LEU B 1 198 ? 59.046  105.552 79.003  1.00 22.27 ? 198  LEU B CG    1 
ATOM   6371  C CD1   . LEU B 1 198 ? 59.547  105.524 77.611  1.00 18.95 ? 198  LEU B CD1   1 
ATOM   6372  C CD2   . LEU B 1 198 ? 59.609  106.805 79.761  1.00 19.87 ? 198  LEU B CD2   1 
ATOM   6373  N N     . LYS B 1 199 ? 54.507  104.655 79.356  1.00 21.27 ? 199  LYS B N     1 
ATOM   6374  C CA    . LYS B 1 199 ? 53.049  104.849 79.104  1.00 21.42 ? 199  LYS B CA    1 
ATOM   6375  C C     . LYS B 1 199 ? 52.226  104.952 80.395  1.00 20.51 ? 199  LYS B C     1 
ATOM   6376  O O     . LYS B 1 199 ? 51.381  105.823 80.504  1.00 20.50 ? 199  LYS B O     1 
ATOM   6377  C CB    . LYS B 1 199 ? 52.476  103.823 78.108  1.00 20.70 ? 199  LYS B CB    1 
ATOM   6378  C CG    . LYS B 1 199 ? 50.969  103.503 78.238  1.00 22.66 ? 199  LYS B CG    1 
ATOM   6379  C CD    . LYS B 1 199 ? 50.018  104.575 77.737  1.00 22.27 ? 199  LYS B CD    1 
ATOM   6380  C CE    . LYS B 1 199 ? 48.734  103.945 77.155  1.00 21.15 ? 199  LYS B CE    1 
ATOM   6381  N NZ    . LYS B 1 199 ? 47.581  103.793 78.087  1.00 20.92 ? 199  LYS B NZ    1 
ATOM   6382  N N     . LYS B 1 200 ? 52.514  104.100 81.375  1.00 20.39 ? 200  LYS B N     1 
ATOM   6383  C CA    . LYS B 1 200 ? 51.890  104.199 82.715  1.00 21.09 ? 200  LYS B CA    1 
ATOM   6384  C C     . LYS B 1 200 ? 52.049  105.590 83.333  1.00 19.76 ? 200  LYS B C     1 
ATOM   6385  O O     . LYS B 1 200 ? 51.101  106.140 83.870  1.00 19.70 ? 200  LYS B O     1 
ATOM   6386  C CB    . LYS B 1 200 ? 52.452  103.139 83.677  1.00 21.39 ? 200  LYS B CB    1 
ATOM   6387  C CG    . LYS B 1 200 ? 51.738  103.086 85.040  1.00 22.84 ? 200  LYS B CG    1 
ATOM   6388  C CD    . LYS B 1 200 ? 52.296  101.937 85.913  1.00 23.54 ? 200  LYS B CD    1 
ATOM   6389  C CE    . LYS B 1 200 ? 51.728  101.967 87.363  1.00 25.98 ? 200  LYS B CE    1 
ATOM   6390  N NZ    . LYS B 1 200 ? 50.233  101.952 87.453  1.00 25.71 ? 200  LYS B NZ    1 
ATOM   6391  N N     . ASN B 1 201 ? 53.247  106.152 83.251  1.00 19.07 ? 201  ASN B N     1 
ATOM   6392  C CA    . ASN B 1 201 ? 53.475  107.525 83.706  1.00 19.39 ? 201  ASN B CA    1 
ATOM   6393  C C     . ASN B 1 201 ? 52.594  108.565 83.002  1.00 18.72 ? 201  ASN B C     1 
ATOM   6394  O O     . ASN B 1 201 ? 52.085  109.460 83.652  1.00 18.10 ? 201  ASN B O     1 
ATOM   6395  C CB    . ASN B 1 201 ? 54.965  107.912 83.623  1.00 18.56 ? 201  ASN B CB    1 
ATOM   6396  C CG    . ASN B 1 201 ? 55.805  107.222 84.688  1.00 19.26 ? 201  ASN B CG    1 
ATOM   6397  O OD1   . ASN B 1 201 ? 55.281  106.548 85.566  1.00 20.44 ? 201  ASN B OD1   1 
ATOM   6398  N ND2   . ASN B 1 201 ? 57.121  107.383 84.607  1.00 18.46 ? 201  ASN B ND2   1 
ATOM   6399  N N     . VAL B 1 202 ? 52.435  108.433 81.684  1.00 18.95 ? 202  VAL B N     1 
ATOM   6400  C CA    . VAL B 1 202 ? 51.526  109.273 80.894  1.00 19.58 ? 202  VAL B CA    1 
ATOM   6401  C C     . VAL B 1 202 ? 50.055  109.120 81.322  1.00 19.57 ? 202  VAL B C     1 
ATOM   6402  O O     . VAL B 1 202 ? 49.377  110.102 81.519  1.00 19.63 ? 202  VAL B O     1 
ATOM   6403  C CB    . VAL B 1 202 ? 51.679  109.031 79.374  1.00 19.60 ? 202  VAL B CB    1 
ATOM   6404  C CG1   . VAL B 1 202 ? 50.635  109.822 78.598  1.00 19.40 ? 202  VAL B CG1   1 
ATOM   6405  C CG2   . VAL B 1 202 ? 53.074  109.427 78.925  1.00 19.53 ? 202  VAL B CG2   1 
ATOM   6406  N N     . ASP B 1 203 ? 49.591  107.880 81.485  1.00 20.37 ? 203  ASP B N     1 
ATOM   6407  C CA    . ASP B 1 203 ? 48.279  107.595 82.060  1.00 19.84 ? 203  ASP B CA    1 
ATOM   6408  C C     . ASP B 1 203 ? 48.044  108.375 83.363  1.00 20.26 ? 203  ASP B C     1 
ATOM   6409  O O     . ASP B 1 203 ? 46.988  108.989 83.548  1.00 18.87 ? 203  ASP B O     1 
ATOM   6410  C CB    . ASP B 1 203 ? 48.126  106.101 82.351  1.00 18.94 ? 203  ASP B CB    1 
ATOM   6411  C CG    . ASP B 1 203 ? 47.916  105.245 81.085  1.00 18.98 ? 203  ASP B CG    1 
ATOM   6412  O OD1   . ASP B 1 203 ? 47.758  105.764 79.956  1.00 15.87 ? 203  ASP B OD1   1 
ATOM   6413  O OD2   . ASP B 1 203 ? 47.914  104.007 81.250  1.00 19.06 ? 203  ASP B OD2   1 
ATOM   6414  N N     . ASP B 1 204 ? 49.016  108.296 84.271  1.00 20.80 ? 204  ASP B N     1 
ATOM   6415  C CA    . ASP B 1 204 ? 48.918  108.947 85.576  1.00 22.03 ? 204  ASP B CA    1 
ATOM   6416  C C     . ASP B 1 204 ? 48.945  110.475 85.423  1.00 22.25 ? 204  ASP B C     1 
ATOM   6417  O O     . ASP B 1 204 ? 48.205  111.186 86.098  1.00 22.84 ? 204  ASP B O     1 
ATOM   6418  C CB    . ASP B 1 204 ? 50.033  108.449 86.515  1.00 21.91 ? 204  ASP B CB    1 
ATOM   6419  C CG    . ASP B 1 204 ? 49.830  106.988 86.944  1.00 23.38 ? 204  ASP B CG    1 
ATOM   6420  O OD1   . ASP B 1 204 ? 50.779  106.364 87.466  1.00 24.88 ? 204  ASP B OD1   1 
ATOM   6421  O OD2   . ASP B 1 204 ? 48.725  106.447 86.747  1.00 21.99 ? 204  ASP B OD2   1 
ATOM   6422  N N     . ALA B 1 205 ? 49.786  110.966 84.522  1.00 22.29 ? 205  ALA B N     1 
ATOM   6423  C CA    . ALA B 1 205 ? 49.828  112.391 84.202  1.00 23.11 ? 205  ALA B CA    1 
ATOM   6424  C C     . ALA B 1 205 ? 48.461  112.914 83.726  1.00 23.80 ? 205  ALA B C     1 
ATOM   6425  O O     . ALA B 1 205 ? 48.010  113.965 84.175  1.00 23.19 ? 205  ALA B O     1 
ATOM   6426  C CB    . ALA B 1 205 ? 50.909  112.673 83.175  1.00 22.75 ? 205  ALA B CB    1 
ATOM   6427  N N     . LEU B 1 206 ? 47.799  112.146 82.862  1.00 24.53 ? 206  LEU B N     1 
ATOM   6428  C CA    . LEU B 1 206 ? 46.553  112.567 82.222  1.00 25.90 ? 206  LEU B CA    1 
ATOM   6429  C C     . LEU B 1 206 ? 45.331  112.468 83.145  1.00 26.47 ? 206  LEU B C     1 
ATOM   6430  O O     . LEU B 1 206 ? 44.221  112.887 82.785  1.00 26.19 ? 206  LEU B O     1 
ATOM   6431  C CB    . LEU B 1 206 ? 46.327  111.804 80.898  1.00 26.06 ? 206  LEU B CB    1 
ATOM   6432  C CG    . LEU B 1 206 ? 47.342  111.968 79.749  1.00 27.34 ? 206  LEU B CG    1 
ATOM   6433  C CD1   . LEU B 1 206 ? 46.740  111.457 78.471  1.00 29.70 ? 206  LEU B CD1   1 
ATOM   6434  C CD2   . LEU B 1 206 ? 47.802  113.390 79.541  1.00 27.34 ? 206  LEU B CD2   1 
ATOM   6435  N N     . LYS B 1 207 ? 45.545  111.913 84.339  1.00 27.49 ? 207  LYS B N     1 
ATOM   6436  C CA    . LYS B 1 207 ? 44.511  111.881 85.370  1.00 28.31 ? 207  LYS B CA    1 
ATOM   6437  C C     . LYS B 1 207 ? 44.446  113.199 86.152  1.00 28.85 ? 207  LYS B C     1 
ATOM   6438  O O     . LYS B 1 207 ? 43.536  113.408 86.937  1.00 29.15 ? 207  LYS B O     1 
ATOM   6439  C CB    . LYS B 1 207 ? 44.732  110.700 86.306  1.00 28.45 ? 207  LYS B CB    1 
ATOM   6440  C CG    . LYS B 1 207 ? 44.448  109.366 85.660  1.00 28.42 ? 207  LYS B CG    1 
ATOM   6441  C CD    . LYS B 1 207 ? 44.882  108.248 86.568  1.00 30.01 ? 207  LYS B CD    1 
ATOM   6442  C CE    . LYS B 1 207 ? 44.775  106.919 85.845  1.00 30.81 ? 207  LYS B CE    1 
ATOM   6443  N NZ    . LYS B 1 207 ? 45.128  105.824 86.758  1.00 32.10 ? 207  LYS B NZ    1 
ATOM   6444  N N     . ASN B 1 208 ? 45.415  114.084 85.931  1.00 29.70 ? 208  ASN B N     1 
ATOM   6445  C CA    . ASN B 1 208 ? 45.393  115.423 86.511  1.00 30.32 ? 208  ASN B CA    1 
ATOM   6446  C C     . ASN B 1 208 ? 44.219  116.189 85.903  1.00 31.27 ? 208  ASN B C     1 
ATOM   6447  O O     . ASN B 1 208 ? 44.148  116.326 84.674  1.00 30.98 ? 208  ASN B O     1 
ATOM   6448  C CB    . ASN B 1 208 ? 46.735  116.128 86.270  1.00 30.24 ? 208  ASN B CB    1 
ATOM   6449  C CG    . ASN B 1 208 ? 46.853  117.462 87.003  1.00 30.06 ? 208  ASN B CG    1 
ATOM   6450  O OD1   . ASN B 1 208 ? 45.929  118.269 87.007  1.00 30.11 ? 208  ASN B OD1   1 
ATOM   6451  N ND2   . ASN B 1 208 ? 48.005  117.701 87.605  1.00 27.05 ? 208  ASN B ND2   1 
ATOM   6452  N N     . PRO B 1 209 ? 43.269  116.658 86.758  1.00 32.19 ? 209  PRO B N     1 
ATOM   6453  C CA    . PRO B 1 209 ? 42.041  117.326 86.299  1.00 32.28 ? 209  PRO B CA    1 
ATOM   6454  C C     . PRO B 1 209 ? 42.327  118.593 85.493  1.00 32.25 ? 209  PRO B C     1 
ATOM   6455  O O     . PRO B 1 209 ? 41.445  119.099 84.793  1.00 32.37 ? 209  PRO B O     1 
ATOM   6456  C CB    . PRO B 1 209 ? 41.313  117.675 87.608  1.00 32.76 ? 209  PRO B CB    1 
ATOM   6457  C CG    . PRO B 1 209 ? 42.384  117.705 88.654  1.00 32.82 ? 209  PRO B CG    1 
ATOM   6458  C CD    . PRO B 1 209 ? 43.310  116.577 88.232  1.00 32.63 ? 209  PRO B CD    1 
ATOM   6459  N N     . ASN B 1 210 ? 43.562  119.078 85.575  1.00 32.05 ? 210  ASN B N     1 
ATOM   6460  C CA    . ASN B 1 210 ? 43.984  120.254 84.815  1.00 32.13 ? 210  ASN B CA    1 
ATOM   6461  C C     . ASN B 1 210 ? 44.478  119.975 83.384  1.00 31.70 ? 210  ASN B C     1 
ATOM   6462  O O     . ASN B 1 210 ? 44.574  120.905 82.582  1.00 31.88 ? 210  ASN B O     1 
ATOM   6463  C CB    . ASN B 1 210 ? 45.006  121.051 85.619  1.00 32.33 ? 210  ASN B CB    1 
ATOM   6464  C CG    . ASN B 1 210 ? 44.419  121.581 86.891  1.00 33.38 ? 210  ASN B CG    1 
ATOM   6465  O OD1   . ASN B 1 210 ? 43.272  122.017 86.901  1.00 33.94 ? 210  ASN B OD1   1 
ATOM   6466  N ND2   . ASN B 1 210 ? 45.173  121.518 87.977  1.00 34.29 ? 210  ASN B ND2   1 
ATOM   6467  N N     . VAL B 1 211 ? 44.761  118.708 83.071  1.00 30.47 ? 211  VAL B N     1 
ATOM   6468  C CA    . VAL B 1 211 ? 45.121  118.321 81.715  1.00 29.90 ? 211  VAL B CA    1 
ATOM   6469  C C     . VAL B 1 211 ? 43.865  118.207 80.876  1.00 29.78 ? 211  VAL B C     1 
ATOM   6470  O O     . VAL B 1 211 ? 43.080  117.275 81.036  1.00 29.80 ? 211  VAL B O     1 
ATOM   6471  C CB    . VAL B 1 211 ? 45.911  116.972 81.648  1.00 30.00 ? 211  VAL B CB    1 
ATOM   6472  C CG1   . VAL B 1 211 ? 46.136  116.560 80.192  1.00 29.03 ? 211  VAL B CG1   1 
ATOM   6473  C CG2   . VAL B 1 211 ? 47.230  117.081 82.385  1.00 28.98 ? 211  VAL B CG2   1 
ATOM   6474  N N     . THR B 1 212 ? 43.700  119.159 79.966  1.00 29.52 ? 212  THR B N     1 
ATOM   6475  C CA    . THR B 1 212 ? 42.492  119.278 79.172  1.00 29.51 ? 212  THR B CA    1 
ATOM   6476  C C     . THR B 1 212 ? 42.781  119.237 77.682  1.00 28.77 ? 212  THR B C     1 
ATOM   6477  O O     . THR B 1 212 ? 41.864  119.055 76.900  1.00 28.69 ? 212  THR B O     1 
ATOM   6478  C CB    . THR B 1 212 ? 41.742  120.615 79.450  1.00 29.80 ? 212  THR B CB    1 
ATOM   6479  O OG1   . THR B 1 212 ? 42.323  121.657 78.660  1.00 30.43 ? 212  THR B OG1   1 
ATOM   6480  C CG2   . THR B 1 212 ? 41.792  121.005 80.935  1.00 31.04 ? 212  THR B CG2   1 
ATOM   6481  N N     . SER B 1 213 ? 44.047  119.405 77.296  1.00 28.20 ? 213  SER B N     1 
ATOM   6482  C CA    . SER B 1 213 ? 44.409  119.610 75.888  1.00 27.34 ? 213  SER B CA    1 
ATOM   6483  C C     . SER B 1 213 ? 44.716  118.356 75.068  1.00 26.98 ? 213  SER B C     1 
ATOM   6484  O O     . SER B 1 213 ? 44.606  118.382 73.841  1.00 26.42 ? 213  SER B O     1 
ATOM   6485  C CB    . SER B 1 213 ? 45.590  120.587 75.788  1.00 27.20 ? 213  SER B CB    1 
ATOM   6486  O OG    . SER B 1 213 ? 46.673  120.147 76.594  1.00 27.15 ? 213  SER B OG    1 
ATOM   6487  N N     . VAL B 1 214 ? 45.128  117.281 75.740  1.00 26.72 ? 214  VAL B N     1 
ATOM   6488  C CA    . VAL B 1 214 ? 45.635  116.088 75.063  1.00 26.22 ? 214  VAL B CA    1 
ATOM   6489  C C     . VAL B 1 214 ? 44.529  115.337 74.327  1.00 26.61 ? 214  VAL B C     1 
ATOM   6490  O O     . VAL B 1 214 ? 43.560  114.903 74.943  1.00 27.04 ? 214  VAL B O     1 
ATOM   6491  C CB    . VAL B 1 214 ? 46.374  115.138 76.054  1.00 26.56 ? 214  VAL B CB    1 
ATOM   6492  C CG1   . VAL B 1 214 ? 46.811  113.846 75.365  1.00 24.99 ? 214  VAL B CG1   1 
ATOM   6493  C CG2   . VAL B 1 214 ? 47.569  115.830 76.664  1.00 24.95 ? 214  VAL B CG2   1 
ATOM   6494  N N     . GLU B 1 215 ? 44.666  115.181 73.010  1.00 26.22 ? 215  GLU B N     1 
ATOM   6495  C CA    . GLU B 1 215 ? 43.630  114.475 72.248  1.00 26.32 ? 215  GLU B CA    1 
ATOM   6496  C C     . GLU B 1 215 ? 43.953  112.990 72.019  1.00 25.50 ? 215  GLU B C     1 
ATOM   6497  O O     . GLU B 1 215 ? 43.054  112.156 71.983  1.00 25.30 ? 215  GLU B O     1 
ATOM   6498  C CB    . GLU B 1 215 ? 43.331  115.199 70.934  1.00 26.55 ? 215  GLU B CB    1 
ATOM   6499  C CG    . GLU B 1 215 ? 42.577  116.515 71.159  1.00 30.36 ? 215  GLU B CG    1 
ATOM   6500  C CD    . GLU B 1 215 ? 42.589  117.439 69.945  1.00 35.03 ? 215  GLU B CD    1 
ATOM   6501  O OE1   . GLU B 1 215 ? 42.935  118.640 70.123  1.00 36.39 ? 215  GLU B OE1   1 
ATOM   6502  O OE2   . GLU B 1 215 ? 42.251  116.968 68.824  1.00 37.51 ? 215  GLU B OE2   1 
ATOM   6503  N N     . HIS B 1 216 ? 45.232  112.671 71.875  1.00 24.37 ? 216  HIS B N     1 
ATOM   6504  C CA    . HIS B 1 216 ? 45.652  111.299 71.663  1.00 24.07 ? 216  HIS B CA    1 
ATOM   6505  C C     . HIS B 1 216 ? 46.995  111.045 72.303  1.00 22.95 ? 216  HIS B C     1 
ATOM   6506  O O     . HIS B 1 216 ? 47.749  111.973 72.568  1.00 23.05 ? 216  HIS B O     1 
ATOM   6507  C CB    . HIS B 1 216 ? 45.737  110.956 70.172  1.00 24.83 ? 216  HIS B CB    1 
ATOM   6508  C CG    . HIS B 1 216 ? 44.421  110.987 69.466  1.00 26.18 ? 216  HIS B CG    1 
ATOM   6509  N ND1   . HIS B 1 216 ? 43.492  109.970 69.573  1.00 26.28 ? 216  HIS B ND1   1 
ATOM   6510  C CD2   . HIS B 1 216 ? 43.877  111.912 68.636  1.00 29.08 ? 216  HIS B CD2   1 
ATOM   6511  C CE1   . HIS B 1 216 ? 42.437  110.266 68.832  1.00 27.31 ? 216  HIS B CE1   1 
ATOM   6512  N NE2   . HIS B 1 216 ? 42.638  111.446 68.266  1.00 27.87 ? 216  HIS B NE2   1 
ATOM   6513  N N     . VAL B 1 217 ? 47.254  109.773 72.577  1.00 21.13 ? 217  VAL B N     1 
ATOM   6514  C CA    . VAL B 1 217 ? 48.550  109.298 72.996  1.00 19.66 ? 217  VAL B CA    1 
ATOM   6515  C C     . VAL B 1 217 ? 48.942  108.281 71.921  1.00 19.31 ? 217  VAL B C     1 
ATOM   6516  O O     . VAL B 1 217 ? 48.224  107.324 71.690  1.00 18.90 ? 217  VAL B O     1 
ATOM   6517  C CB    . VAL B 1 217 ? 48.477  108.652 74.424  1.00 18.85 ? 217  VAL B CB    1 
ATOM   6518  C CG1   . VAL B 1 217 ? 49.815  108.090 74.843  1.00 17.77 ? 217  VAL B CG1   1 
ATOM   6519  C CG2   . VAL B 1 217 ? 48.038  109.717 75.461  1.00 18.88 ? 217  VAL B CG2   1 
ATOM   6520  N N     . ILE B 1 218 ? 50.050  108.516 71.222  1.00 19.30 ? 218  ILE B N     1 
ATOM   6521  C CA    . ILE B 1 218 ? 50.581  107.500 70.323  1.00 18.68 ? 218  ILE B CA    1 
ATOM   6522  C C     . ILE B 1 218 ? 51.550  106.685 71.163  1.00 19.09 ? 218  ILE B C     1 
ATOM   6523  O O     . ILE B 1 218 ? 52.397  107.260 71.852  1.00 19.95 ? 218  ILE B O     1 
ATOM   6524  C CB    . ILE B 1 218 ? 51.261  108.115 69.080  1.00 19.18 ? 218  ILE B CB    1 
ATOM   6525  C CG1   . ILE B 1 218 ? 50.230  108.824 68.184  1.00 18.66 ? 218  ILE B CG1   1 
ATOM   6526  C CG2   . ILE B 1 218 ? 52.004  107.060 68.261  1.00 17.37 ? 218  ILE B CG2   1 
ATOM   6527  C CD1   . ILE B 1 218 ? 50.904  109.756 67.149  1.00 16.97 ? 218  ILE B CD1   1 
ATOM   6528  N N     . VAL B 1 219 ? 51.409  105.362 71.135  1.00 18.41 ? 219  VAL B N     1 
ATOM   6529  C CA    . VAL B 1 219 ? 52.231  104.485 71.952  1.00 18.37 ? 219  VAL B CA    1 
ATOM   6530  C C     . VAL B 1 219 ? 53.065  103.560 71.073  1.00 18.59 ? 219  VAL B C     1 
ATOM   6531  O O     . VAL B 1 219 ? 52.514  102.777 70.288  1.00 18.66 ? 219  VAL B O     1 
ATOM   6532  C CB    . VAL B 1 219 ? 51.345  103.624 72.914  1.00 17.93 ? 219  VAL B CB    1 
ATOM   6533  C CG1   . VAL B 1 219 ? 52.195  102.665 73.774  1.00 16.80 ? 219  VAL B CG1   1 
ATOM   6534  C CG2   . VAL B 1 219 ? 50.438  104.524 73.762  1.00 18.25 ? 219  VAL B CG2   1 
ATOM   6535  N N     . LEU B 1 220 ? 54.386  103.653 71.199  1.00 18.53 ? 220  LEU B N     1 
ATOM   6536  C CA    . LEU B 1 220 ? 55.285  102.673 70.566  1.00 18.93 ? 220  LEU B CA    1 
ATOM   6537  C C     . LEU B 1 220 ? 55.396  101.392 71.418  1.00 19.16 ? 220  LEU B C     1 
ATOM   6538  O O     . LEU B 1 220 ? 55.717  101.465 72.592  1.00 18.56 ? 220  LEU B O     1 
ATOM   6539  C CB    . LEU B 1 220 ? 56.689  103.260 70.312  1.00 18.73 ? 220  LEU B CB    1 
ATOM   6540  C CG    . LEU B 1 220 ? 57.717  102.269 69.717  1.00 18.87 ? 220  LEU B CG    1 
ATOM   6541  C CD1   . LEU B 1 220 ? 57.451  101.999 68.216  1.00 17.21 ? 220  LEU B CD1   1 
ATOM   6542  C CD2   . LEU B 1 220 ? 59.157  102.745 69.962  1.00 17.45 ? 220  LEU B CD2   1 
ATOM   6543  N N     . LYS B 1 221 ? 55.131  100.227 70.821  1.00 19.38 ? 221  LYS B N     1 
ATOM   6544  C CA    . LYS B 1 221 ? 55.381  98.966  71.509  1.00 19.74 ? 221  LYS B CA    1 
ATOM   6545  C C     . LYS B 1 221 ? 56.866  98.656  71.443  1.00 19.72 ? 221  LYS B C     1 
ATOM   6546  O O     . LYS B 1 221 ? 57.360  98.174  70.418  1.00 19.65 ? 221  LYS B O     1 
ATOM   6547  C CB    . LYS B 1 221 ? 54.585  97.830  70.862  1.00 20.14 ? 221  LYS B CB    1 
ATOM   6548  C CG    . LYS B 1 221 ? 54.561  96.527  71.616  1.00 20.67 ? 221  LYS B CG    1 
ATOM   6549  C CD    . LYS B 1 221 ? 53.953  95.493  70.669  1.00 24.62 ? 221  LYS B CD    1 
ATOM   6550  C CE    . LYS B 1 221 ? 53.460  94.237  71.361  1.00 26.19 ? 221  LYS B CE    1 
ATOM   6551  N NZ    . LYS B 1 221 ? 52.874  93.227  70.394  1.00 25.84 ? 221  LYS B NZ    1 
ATOM   6552  N N     . ARG B 1 222 ? 57.561  98.905  72.551  1.00 19.85 ? 222  ARG B N     1 
ATOM   6553  C CA    . ARG B 1 222 ? 58.999  98.664  72.648  1.00 19.03 ? 222  ARG B CA    1 
ATOM   6554  C C     . ARG B 1 222 ? 59.299  97.411  73.437  1.00 19.02 ? 222  ARG B C     1 
ATOM   6555  O O     . ARG B 1 222 ? 60.272  96.728  73.144  1.00 19.35 ? 222  ARG B O     1 
ATOM   6556  C CB    . ARG B 1 222 ? 59.718  99.885  73.275  1.00 19.21 ? 222  ARG B CB    1 
ATOM   6557  C CG    . ARG B 1 222 ? 61.206  99.692  73.629  1.00 18.69 ? 222  ARG B CG    1 
ATOM   6558  C CD    . ARG B 1 222 ? 62.057  99.546  72.378  1.00 18.31 ? 222  ARG B CD    1 
ATOM   6559  N NE    . ARG B 1 222 ? 63.435  99.108  72.604  1.00 17.82 ? 222  ARG B NE    1 
ATOM   6560  C CZ    . ARG B 1 222 ? 63.819  97.829  72.747  1.00 21.93 ? 222  ARG B CZ    1 
ATOM   6561  N NH1   . ARG B 1 222 ? 62.925  96.835  72.759  1.00 18.51 ? 222  ARG B NH1   1 
ATOM   6562  N NH2   . ARG B 1 222 ? 65.111  97.533  72.906  1.00 20.58 ? 222  ARG B NH2   1 
ATOM   6563  N N     . THR B 1 223 ? 58.514  97.126  74.471  1.00 18.80 ? 223  THR B N     1 
ATOM   6564  C CA    . THR B 1 223 ? 58.736  95.903  75.264  1.00 19.18 ? 223  THR B CA    1 
ATOM   6565  C C     . THR B 1 223 ? 57.591  94.908  75.294  1.00 19.57 ? 223  THR B C     1 
ATOM   6566  O O     . THR B 1 223 ? 57.784  93.781  75.743  1.00 19.31 ? 223  THR B O     1 
ATOM   6567  C CB    . THR B 1 223 ? 59.109  96.209  76.740  1.00 19.07 ? 223  THR B CB    1 
ATOM   6568  O OG1   . THR B 1 223 ? 57.975  96.770  77.430  1.00 18.60 ? 223  THR B OG1   1 
ATOM   6569  C CG2   . THR B 1 223 ? 60.311  97.137  76.787  1.00 19.02 ? 223  THR B CG2   1 
ATOM   6570  N N     . GLY B 1 224 ? 56.400  95.333  74.868  1.00 19.45 ? 224  GLY B N     1 
ATOM   6571  C CA    . GLY B 1 224 ? 55.207  94.483  74.897  1.00 20.25 ? 224  GLY B CA    1 
ATOM   6572  C C     . GLY B 1 224 ? 54.656  94.214  76.283  1.00 20.76 ? 224  GLY B C     1 
ATOM   6573  O O     . GLY B 1 224 ? 53.877  93.260  76.478  1.00 20.02 ? 224  GLY B O     1 
ATOM   6574  N N     . SER B 1 225 ? 55.066  95.027  77.256  1.00 21.29 ? 225  SER B N     1 
ATOM   6575  C CA    . SER B 1 225 ? 54.551  94.855  78.610  1.00 23.13 ? 225  SER B CA    1 
ATOM   6576  C C     . SER B 1 225 ? 53.069  95.204  78.710  1.00 23.50 ? 225  SER B C     1 
ATOM   6577  O O     . SER B 1 225 ? 52.521  95.923  77.867  1.00 23.02 ? 225  SER B O     1 
ATOM   6578  C CB    . SER B 1 225 ? 55.372  95.638  79.631  1.00 23.29 ? 225  SER B CB    1 
ATOM   6579  O OG    . SER B 1 225 ? 56.551  94.895  79.973  1.00 26.30 ? 225  SER B OG    1 
ATOM   6580  N N     . ASP B 1 226 ? 52.422  94.671  79.736  1.00 24.58 ? 226  ASP B N     1 
ATOM   6581  C CA    . ASP B 1 226 ? 50.988  94.836  79.876  1.00 26.21 ? 226  ASP B CA    1 
ATOM   6582  C C     . ASP B 1 226 ? 50.718  96.255  80.331  1.00 25.98 ? 226  ASP B C     1 
ATOM   6583  O O     . ASP B 1 226 ? 51.130  96.647  81.427  1.00 26.72 ? 226  ASP B O     1 
ATOM   6584  C CB    . ASP B 1 226 ? 50.428  93.847  80.885  1.00 26.75 ? 226  ASP B CB    1 
ATOM   6585  C CG    . ASP B 1 226 ? 50.490  92.423  80.391  1.00 30.44 ? 226  ASP B CG    1 
ATOM   6586  O OD1   . ASP B 1 226 ? 50.275  92.167  79.170  1.00 33.64 ? 226  ASP B OD1   1 
ATOM   6587  O OD2   . ASP B 1 226 ? 50.760  91.555  81.237  1.00 34.58 ? 226  ASP B OD2   1 
ATOM   6588  N N     . ILE B 1 227 ? 50.069  97.027  79.469  1.00 24.93 ? 227  ILE B N     1 
ATOM   6589  C CA    . ILE B 1 227 ? 49.707  98.391  79.817  1.00 24.35 ? 227  ILE B CA    1 
ATOM   6590  C C     . ILE B 1 227 ? 48.180  98.487  79.847  1.00 24.78 ? 227  ILE B C     1 
ATOM   6591  O O     . ILE B 1 227 ? 47.491  97.613  79.326  1.00 24.51 ? 227  ILE B O     1 
ATOM   6592  C CB    . ILE B 1 227 ? 50.296  99.428  78.817  1.00 24.05 ? 227  ILE B CB    1 
ATOM   6593  C CG1   . ILE B 1 227 ? 49.889  99.090  77.374  1.00 23.79 ? 227  ILE B CG1   1 
ATOM   6594  C CG2   . ILE B 1 227 ? 51.827  99.559  78.971  1.00 22.60 ? 227  ILE B CG2   1 
ATOM   6595  C CD1   . ILE B 1 227 ? 50.255  100.190 76.370  1.00 23.51 ? 227  ILE B CD1   1 
ATOM   6596  N N     . ASP B 1 228 ? 47.674  99.545  80.471  1.00 24.67 ? 228  ASP B N     1 
ATOM   6597  C CA    . ASP B 1 228 ? 46.273  99.927  80.379  1.00 24.75 ? 228  ASP B CA    1 
ATOM   6598  C C     . ASP B 1 228 ? 46.059  100.719 79.105  1.00 25.01 ? 228  ASP B C     1 
ATOM   6599  O O     . ASP B 1 228 ? 46.989  101.390 78.609  1.00 25.04 ? 228  ASP B O     1 
ATOM   6600  C CB    . ASP B 1 228 ? 45.907  100.796 81.576  1.00 24.76 ? 228  ASP B CB    1 
ATOM   6601  C CG    . ASP B 1 228 ? 46.056  100.054 82.880  1.00 25.22 ? 228  ASP B CG    1 
ATOM   6602  O OD1   . ASP B 1 228 ? 46.882  100.459 83.712  1.00 25.25 ? 228  ASP B OD1   1 
ATOM   6603  O OD2   . ASP B 1 228 ? 45.356  99.046  83.055  1.00 25.05 ? 228  ASP B OD2   1 
ATOM   6604  N N     . TRP B 1 229 ? 44.831  100.665 78.598  1.00 24.42 ? 229  TRP B N     1 
ATOM   6605  C CA    . TRP B 1 229 ? 44.505  101.260 77.318  1.00 24.51 ? 229  TRP B CA    1 
ATOM   6606  C C     . TRP B 1 229 ? 43.195  102.045 77.399  1.00 24.28 ? 229  TRP B C     1 
ATOM   6607  O O     . TRP B 1 229 ? 42.177  101.515 77.863  1.00 24.45 ? 229  TRP B O     1 
ATOM   6608  C CB    . TRP B 1 229 ? 44.409  100.153 76.267  1.00 24.42 ? 229  TRP B CB    1 
ATOM   6609  C CG    . TRP B 1 229 ? 44.559  100.625 74.828  1.00 24.62 ? 229  TRP B CG    1 
ATOM   6610  C CD1   . TRP B 1 229 ? 43.557  100.785 73.902  1.00 24.65 ? 229  TRP B CD1   1 
ATOM   6611  C CD2   . TRP B 1 229 ? 45.785  100.949 74.148  1.00 24.97 ? 229  TRP B CD2   1 
ATOM   6612  N NE1   . TRP B 1 229 ? 44.087  101.192 72.691  1.00 24.75 ? 229  TRP B NE1   1 
ATOM   6613  C CE2   . TRP B 1 229 ? 45.449  101.300 72.817  1.00 24.73 ? 229  TRP B CE2   1 
ATOM   6614  C CE3   . TRP B 1 229 ? 47.134  100.977 74.533  1.00 23.83 ? 229  TRP B CE3   1 
ATOM   6615  C CZ2   . TRP B 1 229 ? 46.410  101.686 71.882  1.00 24.82 ? 229  TRP B CZ2   1 
ATOM   6616  C CZ3   . TRP B 1 229 ? 48.087  101.355 73.599  1.00 24.21 ? 229  TRP B CZ3   1 
ATOM   6617  C CH2   . TRP B 1 229 ? 47.719  101.705 72.289  1.00 24.79 ? 229  TRP B CH2   1 
ATOM   6618  N N     . GLN B 1 230 ? 43.238  103.309 76.989  1.00 23.56 ? 230  GLN B N     1 
ATOM   6619  C CA    . GLN B 1 230 ? 42.036  104.131 76.884  1.00 23.78 ? 230  GLN B CA    1 
ATOM   6620  C C     . GLN B 1 230 ? 41.616  104.154 75.414  1.00 23.63 ? 230  GLN B C     1 
ATOM   6621  O O     . GLN B 1 230 ? 42.269  104.810 74.583  1.00 22.94 ? 230  GLN B O     1 
ATOM   6622  C CB    . GLN B 1 230 ? 42.280  105.565 77.413  1.00 23.85 ? 230  GLN B CB    1 
ATOM   6623  C CG    . GLN B 1 230 ? 41.112  106.553 77.194  1.00 24.06 ? 230  GLN B CG    1 
ATOM   6624  C CD    . GLN B 1 230 ? 39.748  105.995 77.635  1.00 27.42 ? 230  GLN B CD    1 
ATOM   6625  O OE1   . GLN B 1 230 ? 39.559  105.655 78.812  1.00 27.82 ? 230  GLN B OE1   1 
ATOM   6626  N NE2   . GLN B 1 230 ? 38.789  105.902 76.689  1.00 25.01 ? 230  GLN B NE2   1 
ATOM   6627  N N     . GLU B 1 231 ? 40.553  103.412 75.104  1.00 22.86 ? 231  GLU B N     1 
ATOM   6628  C CA    . GLU B 1 231 ? 39.961  103.381 73.757  1.00 23.28 ? 231  GLU B CA    1 
ATOM   6629  C C     . GLU B 1 231 ? 39.751  104.792 73.203  1.00 22.69 ? 231  GLU B C     1 
ATOM   6630  O O     . GLU B 1 231 ? 39.387  105.717 73.951  1.00 22.25 ? 231  GLU B O     1 
ATOM   6631  C CB    . GLU B 1 231 ? 38.621  102.633 73.779  1.00 23.65 ? 231  GLU B CB    1 
ATOM   6632  C CG    . GLU B 1 231 ? 37.608  103.204 74.794  1.00 23.62 ? 231  GLU B CG    1 
ATOM   6633  C CD    . GLU B 1 231 ? 36.299  102.415 74.862  1.00 24.67 ? 231  GLU B CD    1 
ATOM   6634  O OE1   . GLU B 1 231 ? 36.143  101.466 74.056  1.00 24.80 ? 231  GLU B OE1   1 
ATOM   6635  O OE2   . GLU B 1 231 ? 35.438  102.756 75.727  1.00 24.23 ? 231  GLU B OE2   1 
ATOM   6636  N N     . GLY B 1 232 ? 40.003  104.963 71.906  1.00 21.84 ? 232  GLY B N     1 
ATOM   6637  C CA    . GLY B 1 232 ? 39.817  106.271 71.280  1.00 21.76 ? 232  GLY B CA    1 
ATOM   6638  C C     . GLY B 1 232 ? 41.001  107.199 71.513  1.00 21.97 ? 232  GLY B C     1 
ATOM   6639  O O     . GLY B 1 232 ? 41.583  107.693 70.552  1.00 22.84 ? 232  GLY B O     1 
ATOM   6640  N N     . ARG B 1 233 ? 41.386  107.440 72.767  1.00 21.30 ? 233  ARG B N     1 
ATOM   6641  C CA    . ARG B 1 233 ? 42.603  108.234 73.021  1.00 20.69 ? 233  ARG B CA    1 
ATOM   6642  C C     . ARG B 1 233 ? 43.886  107.546 72.534  1.00 20.80 ? 233  ARG B C     1 
ATOM   6643  O O     . ARG B 1 233 ? 44.676  108.137 71.782  1.00 20.99 ? 233  ARG B O     1 
ATOM   6644  C CB    . ARG B 1 233 ? 42.743  108.582 74.497  1.00 20.28 ? 233  ARG B CB    1 
ATOM   6645  C CG    . ARG B 1 233 ? 43.753  109.699 74.781  1.00 20.22 ? 233  ARG B CG    1 
ATOM   6646  C CD    . ARG B 1 233 ? 44.123  109.756 76.263  1.00 21.73 ? 233  ARG B CD    1 
ATOM   6647  N NE    . ARG B 1 233 ? 44.808  108.539 76.731  1.00 22.53 ? 233  ARG B NE    1 
ATOM   6648  C CZ    . ARG B 1 233 ? 44.947  108.171 78.005  1.00 21.08 ? 233  ARG B CZ    1 
ATOM   6649  N NH1   . ARG B 1 233 ? 44.436  108.897 78.997  1.00 21.58 ? 233  ARG B NH1   1 
ATOM   6650  N NH2   . ARG B 1 233 ? 45.576  107.044 78.287  1.00 21.09 ? 233  ARG B NH2   1 
ATOM   6651  N N     . ASP B 1 234 ? 44.100  106.306 72.971  1.00 20.09 ? 234  ASP B N     1 
ATOM   6652  C CA    . ASP B 1 234 ? 45.375  105.640 72.745  1.00 20.03 ? 234  ASP B CA    1 
ATOM   6653  C C     . ASP B 1 234 ? 45.431  104.985 71.370  1.00 20.06 ? 234  ASP B C     1 
ATOM   6654  O O     . ASP B 1 234 ? 44.463  104.325 70.946  1.00 19.68 ? 234  ASP B O     1 
ATOM   6655  C CB    . ASP B 1 234 ? 45.658  104.616 73.867  1.00 19.26 ? 234  ASP B CB    1 
ATOM   6656  C CG    . ASP B 1 234 ? 45.832  105.274 75.211  1.00 18.91 ? 234  ASP B CG    1 
ATOM   6657  O OD1   . ASP B 1 234 ? 46.190  106.453 75.220  1.00 19.43 ? 234  ASP B OD1   1 
ATOM   6658  O OD2   . ASP B 1 234 ? 45.612  104.643 76.264  1.00 18.68 ? 234  ASP B OD2   1 
ATOM   6659  N N     . LEU B 1 235 ? 46.565  105.153 70.689  1.00 19.91 ? 235  LEU B N     1 
ATOM   6660  C CA    . LEU B 1 235 ? 46.791  104.526 69.387  1.00 20.25 ? 235  LEU B CA    1 
ATOM   6661  C C     . LEU B 1 235 ? 48.181  103.917 69.328  1.00 21.12 ? 235  LEU B C     1 
ATOM   6662  O O     . LEU B 1 235 ? 49.139  104.523 69.849  1.00 20.93 ? 235  LEU B O     1 
ATOM   6663  C CB    . LEU B 1 235 ? 46.632  105.555 68.264  1.00 20.25 ? 235  LEU B CB    1 
ATOM   6664  C CG    . LEU B 1 235 ? 45.368  106.415 68.270  1.00 20.88 ? 235  LEU B CG    1 
ATOM   6665  C CD1   . LEU B 1 235 ? 45.608  107.680 67.467  1.00 22.28 ? 235  LEU B CD1   1 
ATOM   6666  C CD2   . LEU B 1 235 ? 44.160  105.650 67.752  1.00 21.46 ? 235  LEU B CD2   1 
ATOM   6667  N N     . TRP B 1 236 ? 48.298  102.736 68.702  1.00 21.12 ? 236  TRP B N     1 
ATOM   6668  C CA    . TRP B 1 236 ? 49.612  102.108 68.490  1.00 21.73 ? 236  TRP B CA    1 
ATOM   6669  C C     . TRP B 1 236 ? 50.383  102.796 67.364  1.00 22.10 ? 236  TRP B C     1 
ATOM   6670  O O     . TRP B 1 236 ? 49.822  103.105 66.305  1.00 22.05 ? 236  TRP B O     1 
ATOM   6671  C CB    . TRP B 1 236 ? 49.506  100.605 68.190  1.00 21.05 ? 236  TRP B CB    1 
ATOM   6672  C CG    . TRP B 1 236 ? 49.094  99.769  69.374  1.00 21.40 ? 236  TRP B CG    1 
ATOM   6673  C CD1   . TRP B 1 236 ? 47.882  99.127  69.553  1.00 20.52 ? 236  TRP B CD1   1 
ATOM   6674  C CD2   . TRP B 1 236 ? 49.863  99.505  70.557  1.00 20.35 ? 236  TRP B CD2   1 
ATOM   6675  N NE1   . TRP B 1 236 ? 47.868  98.482  70.756  1.00 20.40 ? 236  TRP B NE1   1 
ATOM   6676  C CE2   . TRP B 1 236 ? 49.064  98.695  71.398  1.00 21.79 ? 236  TRP B CE2   1 
ATOM   6677  C CE3   . TRP B 1 236 ? 51.152  99.864  70.980  1.00 21.14 ? 236  TRP B CE3   1 
ATOM   6678  C CZ2   . TRP B 1 236 ? 49.511  98.236  72.644  1.00 21.24 ? 236  TRP B CZ2   1 
ATOM   6679  C CZ3   . TRP B 1 236 ? 51.601  99.411  72.214  1.00 21.36 ? 236  TRP B CZ3   1 
ATOM   6680  C CH2   . TRP B 1 236 ? 50.779  98.597  73.035  1.00 21.47 ? 236  TRP B CH2   1 
ATOM   6681  N N     . TRP B 1 237 ? 51.672  103.022 67.604  1.00 22.81 ? 237  TRP B N     1 
ATOM   6682  C CA    . TRP B 1 237 ? 52.564  103.614 66.615  1.00 24.34 ? 237  TRP B CA    1 
ATOM   6683  C C     . TRP B 1 237 ? 52.483  102.859 65.281  1.00 25.15 ? 237  TRP B C     1 
ATOM   6684  O O     . TRP B 1 237 ? 52.252  103.462 64.238  1.00 25.38 ? 237  TRP B O     1 
ATOM   6685  C CB    . TRP B 1 237 ? 54.011  103.630 67.147  1.00 24.14 ? 237  TRP B CB    1 
ATOM   6686  C CG    . TRP B 1 237 ? 55.046  104.111 66.168  1.00 24.29 ? 237  TRP B CG    1 
ATOM   6687  C CD1   . TRP B 1 237 ? 55.564  103.413 65.119  1.00 25.76 ? 237  TRP B CD1   1 
ATOM   6688  C CD2   . TRP B 1 237 ? 55.711  105.393 66.162  1.00 23.82 ? 237  TRP B CD2   1 
ATOM   6689  N NE1   . TRP B 1 237 ? 56.499  104.177 64.456  1.00 25.67 ? 237  TRP B NE1   1 
ATOM   6690  C CE2   . TRP B 1 237 ? 56.600  105.397 65.068  1.00 22.27 ? 237  TRP B CE2   1 
ATOM   6691  C CE3   . TRP B 1 237 ? 55.644  106.529 66.984  1.00 25.76 ? 237  TRP B CE3   1 
ATOM   6692  C CZ2   . TRP B 1 237 ? 57.412  106.487 64.762  1.00 23.03 ? 237  TRP B CZ2   1 
ATOM   6693  C CZ3   . TRP B 1 237 ? 56.462  107.631 66.675  1.00 25.43 ? 237  TRP B CZ3   1 
ATOM   6694  C CH2   . TRP B 1 237 ? 57.332  107.590 65.572  1.00 24.20 ? 237  TRP B CH2   1 
ATOM   6695  N N     . ARG B 1 238 ? 52.651  101.540 65.338  1.00 26.49 ? 238  ARG B N     1 
ATOM   6696  C CA    . ARG B 1 238 ? 52.780  100.700 64.151  1.00 28.05 ? 238  ARG B CA    1 
ATOM   6697  C C     . ARG B 1 238 ? 51.507  100.723 63.308  1.00 27.89 ? 238  ARG B C     1 
ATOM   6698  O O     . ARG B 1 238 ? 51.597  100.779 62.087  1.00 28.02 ? 238  ARG B O     1 
ATOM   6699  C CB    . ARG B 1 238 ? 53.162  99.262  64.534  1.00 27.62 ? 238  ARG B CB    1 
ATOM   6700  C CG    . ARG B 1 238 ? 53.692  98.443  63.358  1.00 30.50 ? 238  ARG B CG    1 
ATOM   6701  C CD    . ARG B 1 238 ? 54.116  97.010  63.712  1.00 31.59 ? 238  ARG B CD    1 
ATOM   6702  N NE    . ARG B 1 238 ? 54.801  96.391  62.562  1.00 39.95 ? 238  ARG B NE    1 
ATOM   6703  C CZ    . ARG B 1 238 ? 55.408  95.202  62.567  1.00 42.88 ? 238  ARG B CZ    1 
ATOM   6704  N NH1   . ARG B 1 238 ? 55.438  94.452  63.669  1.00 42.92 ? 238  ARG B NH1   1 
ATOM   6705  N NH2   . ARG B 1 238 ? 55.996  94.757  61.455  1.00 43.98 ? 238  ARG B NH2   1 
ATOM   6706  N N     . ASP B 1 239 ? 50.337  100.688 63.954  1.00 27.96 ? 239  ASP B N     1 
ATOM   6707  C CA    . ASP B 1 239 ? 49.049  100.723 63.252  1.00 28.52 ? 239  ASP B CA    1 
ATOM   6708  C C     . ASP B 1 239 ? 48.858  102.023 62.471  1.00 28.82 ? 239  ASP B C     1 
ATOM   6709  O O     . ASP B 1 239 ? 48.255  102.035 61.398  1.00 28.35 ? 239  ASP B O     1 
ATOM   6710  C CB    . ASP B 1 239 ? 47.874  100.565 64.222  1.00 28.89 ? 239  ASP B CB    1 
ATOM   6711  C CG    . ASP B 1 239 ? 47.814  99.189  64.862  1.00 30.98 ? 239  ASP B CG    1 
ATOM   6712  O OD1   . ASP B 1 239 ? 48.627  98.302  64.511  1.00 32.58 ? 239  ASP B OD1   1 
ATOM   6713  O OD2   . ASP B 1 239 ? 46.939  98.997  65.729  1.00 33.85 ? 239  ASP B OD2   1 
ATOM   6714  N N     . LEU B 1 240 ? 49.366  103.116 63.028  1.00 29.06 ? 240  LEU B N     1 
ATOM   6715  C CA    . LEU B 1 240 ? 49.188  104.426 62.444  1.00 29.36 ? 240  LEU B CA    1 
ATOM   6716  C C     . LEU B 1 240 ? 50.101  104.621 61.260  1.00 30.13 ? 240  LEU B C     1 
ATOM   6717  O O     . LEU B 1 240 ? 49.636  104.997 60.191  1.00 29.79 ? 240  LEU B O     1 
ATOM   6718  C CB    . LEU B 1 240 ? 49.467  105.510 63.481  1.00 29.42 ? 240  LEU B CB    1 
ATOM   6719  C CG    . LEU B 1 240 ? 48.399  105.709 64.540  1.00 28.21 ? 240  LEU B CG    1 
ATOM   6720  C CD1   . LEU B 1 240 ? 48.840  106.821 65.483  1.00 28.47 ? 240  LEU B CD1   1 
ATOM   6721  C CD2   . LEU B 1 240 ? 47.102  106.058 63.859  1.00 27.98 ? 240  LEU B CD2   1 
ATOM   6722  N N     . ILE B 1 241 ? 51.394  104.346 61.458  1.00 31.13 ? 241  ILE B N     1 
ATOM   6723  C CA    . ILE B 1 241 ? 52.417  104.684 60.476  1.00 32.16 ? 241  ILE B CA    1 
ATOM   6724  C C     . ILE B 1 241 ? 52.375  103.772 59.251  1.00 33.31 ? 241  ILE B C     1 
ATOM   6725  O O     . ILE B 1 241 ? 52.731  104.197 58.147  1.00 33.53 ? 241  ILE B O     1 
ATOM   6726  C CB    . ILE B 1 241 ? 53.862  104.756 61.101  1.00 32.07 ? 241  ILE B CB    1 
ATOM   6727  C CG1   . ILE B 1 241 ? 54.746  105.702 60.271  1.00 31.65 ? 241  ILE B CG1   1 
ATOM   6728  C CG2   . ILE B 1 241 ? 54.491  103.362 61.263  1.00 30.94 ? 241  ILE B CG2   1 
ATOM   6729  C CD1   . ILE B 1 241 ? 56.181  105.879 60.761  1.00 32.13 ? 241  ILE B CD1   1 
ATOM   6730  N N     . GLU B 1 242 ? 51.937  102.526 59.451  1.00 34.33 ? 242  GLU B N     1 
ATOM   6731  C CA    . GLU B 1 242 ? 51.898  101.536 58.373  1.00 35.61 ? 242  GLU B CA    1 
ATOM   6732  C C     . GLU B 1 242 ? 50.807  101.838 57.347  1.00 35.58 ? 242  GLU B C     1 
ATOM   6733  O O     . GLU B 1 242 ? 50.854  101.349 56.210  1.00 35.81 ? 242  GLU B O     1 
ATOM   6734  C CB    . GLU B 1 242 ? 51.742  100.114 58.928  1.00 35.54 ? 242  GLU B CB    1 
ATOM   6735  C CG    . GLU B 1 242 ? 53.044  99.495  59.465  1.00 36.45 ? 242  GLU B CG    1 
ATOM   6736  C CD    . GLU B 1 242 ? 52.925  97.986  59.740  1.00 37.70 ? 242  GLU B CD    1 
ATOM   6737  O OE1   . GLU B 1 242 ? 51.804  97.420  59.596  1.00 39.44 ? 242  GLU B OE1   1 
ATOM   6738  O OE2   . GLU B 1 242 ? 53.961  97.365  60.105  1.00 39.76 ? 242  GLU B OE2   1 
ATOM   6739  N N     . LYS B 1 243 ? 49.829  102.644 57.743  1.00 35.75 ? 243  LYS B N     1 
ATOM   6740  C CA    . LYS B 1 243 ? 48.729  102.986 56.850  1.00 36.00 ? 243  LYS B CA    1 
ATOM   6741  C C     . LYS B 1 243 ? 48.925  104.353 56.178  1.00 35.61 ? 243  LYS B C     1 
ATOM   6742  O O     . LYS B 1 243 ? 48.301  104.653 55.153  1.00 35.71 ? 243  LYS B O     1 
ATOM   6743  C CB    . LYS B 1 243 ? 47.391  102.892 57.592  1.00 36.48 ? 243  LYS B CB    1 
ATOM   6744  C CG    . LYS B 1 243 ? 47.025  104.092 58.444  1.00 37.86 ? 243  LYS B CG    1 
ATOM   6745  C CD    . LYS B 1 243 ? 45.793  103.788 59.290  1.00 41.66 ? 243  LYS B CD    1 
ATOM   6746  C CE    . LYS B 1 243 ? 45.216  105.067 59.893  1.00 43.66 ? 243  LYS B CE    1 
ATOM   6747  N NZ    . LYS B 1 243 ? 44.392  104.788 61.112  1.00 44.70 ? 243  LYS B NZ    1 
ATOM   6748  N N     . ALA B 1 244 ? 49.802  105.172 56.750  1.00 34.91 ? 244  ALA B N     1 
ATOM   6749  C CA    . ALA B 1 244 ? 50.058  106.510 56.222  1.00 34.09 ? 244  ALA B CA    1 
ATOM   6750  C C     . ALA B 1 244 ? 50.923  106.464 54.951  1.00 33.56 ? 244  ALA B C     1 
ATOM   6751  O O     . ALA B 1 244 ? 51.691  105.513 54.720  1.00 33.02 ? 244  ALA B O     1 
ATOM   6752  C CB    . ALA B 1 244 ? 50.700  107.395 57.294  1.00 34.09 ? 244  ALA B CB    1 
ATOM   6753  N N     . SER B 1 245 ? 50.772  107.500 54.130  1.00 32.86 ? 245  SER B N     1 
ATOM   6754  C CA    . SER B 1 245 ? 51.501  107.630 52.883  1.00 32.23 ? 245  SER B CA    1 
ATOM   6755  C C     . SER B 1 245 ? 52.906  108.131 53.153  1.00 32.01 ? 245  SER B C     1 
ATOM   6756  O O     . SER B 1 245 ? 53.082  109.029 53.991  1.00 31.73 ? 245  SER B O     1 
ATOM   6757  C CB    . SER B 1 245 ? 50.788  108.619 51.954  1.00 32.55 ? 245  SER B CB    1 
ATOM   6758  O OG    . SER B 1 245 ? 51.687  109.099 50.974  1.00 32.33 ? 245  SER B OG    1 
ATOM   6759  N N     . PRO B 1 246 ? 53.909  107.559 52.440  1.00 31.78 ? 246  PRO B N     1 
ATOM   6760  C CA    . PRO B 1 246 ? 55.297  108.012 52.491  1.00 31.59 ? 246  PRO B CA    1 
ATOM   6761  C C     . PRO B 1 246 ? 55.591  109.261 51.648  1.00 31.21 ? 246  PRO B C     1 
ATOM   6762  O O     . PRO B 1 246 ? 56.753  109.656 51.514  1.00 30.99 ? 246  PRO B O     1 
ATOM   6763  C CB    . PRO B 1 246 ? 56.074  106.806 51.958  1.00 31.65 ? 246  PRO B CB    1 
ATOM   6764  C CG    . PRO B 1 246 ? 55.117  106.103 51.040  1.00 31.87 ? 246  PRO B CG    1 
ATOM   6765  C CD    . PRO B 1 246 ? 53.741  106.382 51.551  1.00 32.10 ? 246  PRO B CD    1 
ATOM   6766  N N     . GLU B 1 247 ? 54.553  109.860 51.081  1.00 30.87 ? 247  GLU B N     1 
ATOM   6767  C CA    . GLU B 1 247 ? 54.703  111.081 50.283  1.00 31.32 ? 247  GLU B CA    1 
ATOM   6768  C C     . GLU B 1 247 ? 54.227  112.258 51.104  1.00 30.09 ? 247  GLU B C     1 
ATOM   6769  O O     . GLU B 1 247 ? 53.045  112.326 51.478  1.00 29.91 ? 247  GLU B O     1 
ATOM   6770  C CB    . GLU B 1 247 ? 53.878  111.031 48.996  1.00 31.20 ? 247  GLU B CB    1 
ATOM   6771  C CG    . GLU B 1 247 ? 54.057  109.790 48.143  1.00 32.90 ? 247  GLU B CG    1 
ATOM   6772  C CD    . GLU B 1 247 ? 53.248  109.880 46.867  1.00 33.86 ? 247  GLU B CD    1 
ATOM   6773  O OE1   . GLU B 1 247 ? 53.028  111.019 46.377  1.00 38.76 ? 247  GLU B OE1   1 
ATOM   6774  O OE2   . GLU B 1 247 ? 52.826  108.824 46.352  1.00 35.89 ? 247  GLU B OE2   1 
ATOM   6775  N N     . HIS B 1 248 ? 55.152  113.163 51.409  1.00 28.76 ? 248  HIS B N     1 
ATOM   6776  C CA    . HIS B 1 248 ? 54.810  114.397 52.112  1.00 27.96 ? 248  HIS B CA    1 
ATOM   6777  C C     . HIS B 1 248 ? 55.719  115.521 51.630  1.00 27.66 ? 248  HIS B C     1 
ATOM   6778  O O     . HIS B 1 248 ? 56.947  115.422 51.723  1.00 26.89 ? 248  HIS B O     1 
ATOM   6779  C CB    . HIS B 1 248 ? 54.907  114.251 53.650  1.00 27.17 ? 248  HIS B CB    1 
ATOM   6780  C CG    . HIS B 1 248 ? 54.622  115.530 54.374  1.00 25.51 ? 248  HIS B CG    1 
ATOM   6781  N ND1   . HIS B 1 248 ? 53.338  115.975 54.625  1.00 23.17 ? 248  HIS B ND1   1 
ATOM   6782  C CD2   . HIS B 1 248 ? 55.451  116.498 54.828  1.00 23.59 ? 248  HIS B CD2   1 
ATOM   6783  C CE1   . HIS B 1 248 ? 53.394  117.153 55.220  1.00 23.36 ? 248  HIS B CE1   1 
ATOM   6784  N NE2   . HIS B 1 248 ? 54.663  117.493 55.354  1.00 25.31 ? 248  HIS B NE2   1 
ATOM   6785  N N     . GLN B 1 249 ? 55.100  116.574 51.111  1.00 28.09 ? 249  GLN B N     1 
ATOM   6786  C CA    . GLN B 1 249 ? 55.818  117.790 50.687  1.00 28.87 ? 249  GLN B CA    1 
ATOM   6787  C C     . GLN B 1 249 ? 56.101  118.686 51.883  1.00 28.45 ? 249  GLN B C     1 
ATOM   6788  O O     . GLN B 1 249 ? 55.182  118.999 52.635  1.00 28.26 ? 249  GLN B O     1 
ATOM   6789  C CB    . GLN B 1 249 ? 55.003  118.577 49.645  1.00 29.15 ? 249  GLN B CB    1 
ATOM   6790  C CG    . GLN B 1 249 ? 54.781  117.824 48.334  1.00 31.06 ? 249  GLN B CG    1 
ATOM   6791  C CD    . GLN B 1 249 ? 56.079  117.251 47.776  1.00 34.49 ? 249  GLN B CD    1 
ATOM   6792  O OE1   . GLN B 1 249 ? 56.197  116.027 47.582  1.00 33.79 ? 249  GLN B OE1   1 
ATOM   6793  N NE2   . GLN B 1 249 ? 57.080  118.131 47.550  1.00 33.52 ? 249  GLN B NE2   1 
ATOM   6794  N N     . PRO B 1 250 ? 57.367  119.101 52.069  1.00 28.42 ? 250  PRO B N     1 
ATOM   6795  C CA    . PRO B 1 250 ? 57.566  120.008 53.190  1.00 28.95 ? 250  PRO B CA    1 
ATOM   6796  C C     . PRO B 1 250 ? 57.060  121.411 52.829  1.00 29.46 ? 250  PRO B C     1 
ATOM   6797  O O     . PRO B 1 250 ? 57.308  121.905 51.714  1.00 29.85 ? 250  PRO B O     1 
ATOM   6798  C CB    . PRO B 1 250 ? 59.091  120.011 53.413  1.00 28.76 ? 250  PRO B CB    1 
ATOM   6799  C CG    . PRO B 1 250 ? 59.689  119.164 52.329  1.00 29.06 ? 250  PRO B CG    1 
ATOM   6800  C CD    . PRO B 1 250 ? 58.613  118.850 51.321  1.00 28.72 ? 250  PRO B CD    1 
ATOM   6801  N N     . GLU B 1 251 ? 56.320  122.013 53.753  1.00 29.47 ? 251  GLU B N     1 
ATOM   6802  C CA    . GLU B 1 251 ? 55.907  123.392 53.605  1.00 29.71 ? 251  GLU B CA    1 
ATOM   6803  C C     . GLU B 1 251 ? 56.973  124.302 54.221  1.00 29.15 ? 251  GLU B C     1 
ATOM   6804  O O     . GLU B 1 251 ? 57.708  123.909 55.136  1.00 28.44 ? 251  GLU B O     1 
ATOM   6805  C CB    . GLU B 1 251 ? 54.536  123.654 54.247  1.00 29.93 ? 251  GLU B CB    1 
ATOM   6806  C CG    . GLU B 1 251 ? 53.396  122.750 53.783  1.00 31.52 ? 251  GLU B CG    1 
ATOM   6807  C CD    . GLU B 1 251 ? 52.784  123.141 52.435  1.00 33.31 ? 251  GLU B CD    1 
ATOM   6808  O OE1   . GLU B 1 251 ? 52.877  124.339 52.017  1.00 33.75 ? 251  GLU B OE1   1 
ATOM   6809  O OE2   . GLU B 1 251 ? 52.184  122.233 51.800  1.00 31.85 ? 251  GLU B OE2   1 
ATOM   6810  N N     . ALA B 1 252 ? 57.023  125.521 53.696  1.00 28.31 ? 252  ALA B N     1 
ATOM   6811  C CA    . ALA B 1 252 ? 57.936  126.541 54.129  1.00 27.53 ? 252  ALA B CA    1 
ATOM   6812  C C     . ALA B 1 252 ? 57.529  127.060 55.488  1.00 26.97 ? 252  ALA B C     1 
ATOM   6813  O O     . ALA B 1 252 ? 56.387  127.465 55.694  1.00 27.98 ? 252  ALA B O     1 
ATOM   6814  C CB    . ALA B 1 252 ? 57.957  127.687 53.097  1.00 27.47 ? 252  ALA B CB    1 
ATOM   6815  N N     . MET B 1 253 ? 58.475  127.057 56.412  1.00 25.72 ? 253  MET B N     1 
ATOM   6816  C CA    . MET B 1 253 ? 58.287  127.661 57.712  1.00 24.83 ? 253  MET B CA    1 
ATOM   6817  C C     . MET B 1 253 ? 59.062  129.002 57.726  1.00 24.90 ? 253  MET B C     1 
ATOM   6818  O O     . MET B 1 253 ? 60.159  129.079 57.173  1.00 24.57 ? 253  MET B O     1 
ATOM   6819  C CB    . MET B 1 253 ? 58.822  126.711 58.795  1.00 24.84 ? 253  MET B CB    1 
ATOM   6820  C CG    . MET B 1 253 ? 58.117  125.333 58.848  1.00 23.64 ? 253  MET B CG    1 
ATOM   6821  S SD    . MET B 1 253 ? 56.336  125.453 59.108  1.00 25.11 ? 253  MET B SD    1 
ATOM   6822  C CE    . MET B 1 253 ? 55.701  124.129 58.099  1.00 26.56 ? 253  MET B CE    1 
ATOM   6823  N N     . ASN B 1 254 ? 58.503  130.043 58.340  1.00 24.26 ? 254  ASN B N     1 
ATOM   6824  C CA    . ASN B 1 254 ? 59.270  131.272 58.582  1.00 24.52 ? 254  ASN B CA    1 
ATOM   6825  C C     . ASN B 1 254 ? 60.449  131.006 59.516  1.00 24.16 ? 254  ASN B C     1 
ATOM   6826  O O     . ASN B 1 254 ? 60.360  130.160 60.431  1.00 23.63 ? 254  ASN B O     1 
ATOM   6827  C CB    . ASN B 1 254 ? 58.414  132.356 59.236  1.00 24.98 ? 254  ASN B CB    1 
ATOM   6828  C CG    . ASN B 1 254 ? 57.244  132.793 58.378  1.00 27.81 ? 254  ASN B CG    1 
ATOM   6829  O OD1   . ASN B 1 254 ? 56.095  132.799 58.842  1.00 31.37 ? 254  ASN B OD1   1 
ATOM   6830  N ND2   . ASN B 1 254 ? 57.517  133.161 57.132  1.00 28.91 ? 254  ASN B ND2   1 
ATOM   6831  N N     . ALA B 1 255 ? 61.532  131.757 59.312  1.00 23.11 ? 255  ALA B N     1 
ATOM   6832  C CA    . ALA B 1 255 ? 62.715  131.674 60.185  1.00 22.39 ? 255  ALA B CA    1 
ATOM   6833  C C     . ALA B 1 255 ? 62.347  131.782 61.673  1.00 21.79 ? 255  ALA B C     1 
ATOM   6834  O O     . ALA B 1 255 ? 62.937  131.109 62.524  1.00 21.33 ? 255  ALA B O     1 
ATOM   6835  C CB    . ALA B 1 255 ? 63.730  132.756 59.798  1.00 21.63 ? 255  ALA B CB    1 
ATOM   6836  N N     . GLU B 1 256 ? 61.357  132.619 61.970  1.00 21.60 ? 256  GLU B N     1 
ATOM   6837  C CA    . GLU B 1 256 ? 60.949  132.873 63.347  1.00 22.04 ? 256  GLU B CA    1 
ATOM   6838  C C     . GLU B 1 256 ? 59.725  132.068 63.831  1.00 21.87 ? 256  GLU B C     1 
ATOM   6839  O O     . GLU B 1 256 ? 59.165  132.365 64.891  1.00 22.44 ? 256  GLU B O     1 
ATOM   6840  C CB    . GLU B 1 256 ? 60.799  134.382 63.606  1.00 21.85 ? 256  GLU B CB    1 
ATOM   6841  C CG    . GLU B 1 256 ? 62.145  135.155 63.601  1.00 22.07 ? 256  GLU B CG    1 
ATOM   6842  C CD    . GLU B 1 256 ? 63.192  134.631 64.601  1.00 22.57 ? 256  GLU B CD    1 
ATOM   6843  O OE1   . GLU B 1 256 ? 62.825  134.111 65.674  1.00 22.89 ? 256  GLU B OE1   1 
ATOM   6844  O OE2   . GLU B 1 256 ? 64.402  134.740 64.322  1.00 21.85 ? 256  GLU B OE2   1 
ATOM   6845  N N     . ASP B 1 257 ? 59.324  131.053 63.054  1.00 21.63 ? 257  ASP B N     1 
ATOM   6846  C CA    . ASP B 1 257 ? 58.289  130.110 63.484  1.00 21.07 ? 257  ASP B CA    1 
ATOM   6847  C C     . ASP B 1 257 ? 58.875  129.269 64.594  1.00 21.10 ? 257  ASP B C     1 
ATOM   6848  O O     . ASP B 1 257 ? 60.026  128.847 64.498  1.00 21.24 ? 257  ASP B O     1 
ATOM   6849  C CB    . ASP B 1 257 ? 57.791  129.208 62.342  1.00 20.31 ? 257  ASP B CB    1 
ATOM   6850  C CG    . ASP B 1 257 ? 56.793  129.908 61.436  1.00 19.98 ? 257  ASP B CG    1 
ATOM   6851  O OD1   . ASP B 1 257 ? 56.201  130.921 61.865  1.00 20.84 ? 257  ASP B OD1   1 
ATOM   6852  O OD2   . ASP B 1 257 ? 56.604  129.460 60.292  1.00 18.95 ? 257  ASP B OD2   1 
ATOM   6853  N N     . PRO B 1 258 ? 58.091  129.051 65.667  1.00 21.28 ? 258  PRO B N     1 
ATOM   6854  C CA    . PRO B 1 258 ? 58.527  128.178 66.772  1.00 20.80 ? 258  PRO B CA    1 
ATOM   6855  C C     . PRO B 1 258 ? 58.836  126.771 66.278  1.00 19.99 ? 258  PRO B C     1 
ATOM   6856  O O     . PRO B 1 258 ? 58.076  126.199 65.487  1.00 20.61 ? 258  PRO B O     1 
ATOM   6857  C CB    . PRO B 1 258 ? 57.335  128.186 67.731  1.00 20.25 ? 258  PRO B CB    1 
ATOM   6858  C CG    . PRO B 1 258 ? 56.489  129.370 67.324  1.00 21.21 ? 258  PRO B CG    1 
ATOM   6859  C CD    . PRO B 1 258 ? 56.751  129.643 65.898  1.00 20.99 ? 258  PRO B CD    1 
ATOM   6860  N N     . LEU B 1 259 ? 59.981  126.254 66.704  1.00 19.78 ? 259  LEU B N     1 
ATOM   6861  C CA    . LEU B 1 259 ? 60.437  124.902 66.332  1.00 19.55 ? 259  LEU B CA    1 
ATOM   6862  C C     . LEU B 1 259 ? 60.217  123.948 67.502  1.00 19.20 ? 259  LEU B C     1 
ATOM   6863  O O     . LEU B 1 259 ? 59.666  122.863 67.321  1.00 19.35 ? 259  LEU B O     1 
ATOM   6864  C CB    . LEU B 1 259 ? 61.931  124.907 65.916  1.00 19.36 ? 259  LEU B CB    1 
ATOM   6865  C CG    . LEU B 1 259 ? 62.655  123.566 65.774  1.00 19.45 ? 259  LEU B CG    1 
ATOM   6866  C CD1   . LEU B 1 259 ? 62.059  122.667 64.680  1.00 21.13 ? 259  LEU B CD1   1 
ATOM   6867  C CD2   . LEU B 1 259 ? 64.140  123.759 65.577  1.00 19.40 ? 259  LEU B CD2   1 
ATOM   6868  N N     . PHE B 1 260 ? 60.687  124.340 68.690  1.00 18.65 ? 260  PHE B N     1 
ATOM   6869  C CA    . PHE B 1 260 ? 60.536  123.491 69.872  1.00 18.95 ? 260  PHE B CA    1 
ATOM   6870  C C     . PHE B 1 260 ? 60.583  124.276 71.164  1.00 19.59 ? 260  PHE B C     1 
ATOM   6871  O O     . PHE B 1 260 ? 61.142  125.390 71.203  1.00 19.09 ? 260  PHE B O     1 
ATOM   6872  C CB    . PHE B 1 260 ? 61.545  122.315 69.900  1.00 17.75 ? 260  PHE B CB    1 
ATOM   6873  C CG    . PHE B 1 260 ? 62.976  122.704 70.215  1.00 18.08 ? 260  PHE B CG    1 
ATOM   6874  C CD1   . PHE B 1 260 ? 63.388  122.947 71.531  1.00 17.58 ? 260  PHE B CD1   1 
ATOM   6875  C CD2   . PHE B 1 260 ? 63.929  122.766 69.207  1.00 17.68 ? 260  PHE B CD2   1 
ATOM   6876  C CE1   . PHE B 1 260 ? 64.723  123.264 71.834  1.00 16.32 ? 260  PHE B CE1   1 
ATOM   6877  C CE2   . PHE B 1 260 ? 65.260  123.094 69.492  1.00 17.37 ? 260  PHE B CE2   1 
ATOM   6878  C CZ    . PHE B 1 260 ? 65.660  123.337 70.825  1.00 16.46 ? 260  PHE B CZ    1 
ATOM   6879  N N     . ILE B 1 261 ? 60.016  123.664 72.212  1.00 20.64 ? 261  ILE B N     1 
ATOM   6880  C CA    . ILE B 1 261 ? 60.087  124.164 73.585  1.00 21.97 ? 261  ILE B CA    1 
ATOM   6881  C C     . ILE B 1 261 ? 60.766  123.096 74.406  1.00 22.12 ? 261  ILE B C     1 
ATOM   6882  O O     . ILE B 1 261 ? 60.533  121.909 74.199  1.00 22.37 ? 261  ILE B O     1 
ATOM   6883  C CB    . ILE B 1 261 ? 58.681  124.409 74.192  1.00 22.82 ? 261  ILE B CB    1 
ATOM   6884  C CG1   . ILE B 1 261 ? 57.958  125.542 73.477  1.00 21.75 ? 261  ILE B CG1   1 
ATOM   6885  C CG2   . ILE B 1 261 ? 58.774  124.704 75.679  1.00 24.42 ? 261  ILE B CG2   1 
ATOM   6886  C CD1   . ILE B 1 261 ? 56.495  125.250 73.399  1.00 27.12 ? 261  ILE B CD1   1 
ATOM   6887  N N     . LEU B 1 262 ? 61.630  123.510 75.331  1.00 22.41 ? 262  LEU B N     1 
ATOM   6888  C CA    . LEU B 1 262 ? 62.348  122.557 76.147  1.00 21.57 ? 262  LEU B CA    1 
ATOM   6889  C C     . LEU B 1 262 ? 62.337  123.067 77.562  1.00 21.45 ? 262  LEU B C     1 
ATOM   6890  O O     . LEU B 1 262 ? 62.945  124.102 77.859  1.00 21.15 ? 262  LEU B O     1 
ATOM   6891  C CB    . LEU B 1 262 ? 63.793  122.378 75.660  1.00 22.08 ? 262  LEU B CB    1 
ATOM   6892  C CG    . LEU B 1 262 ? 64.320  120.969 75.331  1.00 22.57 ? 262  LEU B CG    1 
ATOM   6893  C CD1   . LEU B 1 262 ? 65.831  120.994 75.234  1.00 20.90 ? 262  LEU B CD1   1 
ATOM   6894  C CD2   . LEU B 1 262 ? 63.825  119.853 76.286  1.00 19.64 ? 262  LEU B CD2   1 
ATOM   6895  N N     . TYR B 1 263 ? 61.654  122.335 78.436  1.00 21.60 ? 263  TYR B N     1 
ATOM   6896  C CA    . TYR B 1 263 ? 61.592  122.725 79.840  1.00 22.54 ? 263  TYR B CA    1 
ATOM   6897  C C     . TYR B 1 263 ? 62.965  122.647 80.498  1.00 22.91 ? 263  TYR B C     1 
ATOM   6898  O O     . TYR B 1 263 ? 63.725  121.682 80.320  1.00 23.28 ? 263  TYR B O     1 
ATOM   6899  C CB    . TYR B 1 263 ? 60.439  122.014 80.601  1.00 21.86 ? 263  TYR B CB    1 
ATOM   6900  C CG    . TYR B 1 263 ? 59.102  122.566 80.132  1.00 21.29 ? 263  TYR B CG    1 
ATOM   6901  C CD1   . TYR B 1 263 ? 58.456  122.039 79.016  1.00 22.25 ? 263  TYR B CD1   1 
ATOM   6902  C CD2   . TYR B 1 263 ? 58.519  123.656 80.767  1.00 18.36 ? 263  TYR B CD2   1 
ATOM   6903  C CE1   . TYR B 1 263 ? 57.246  122.583 78.550  1.00 20.93 ? 263  TYR B CE1   1 
ATOM   6904  C CE2   . TYR B 1 263 ? 57.328  124.194 80.322  1.00 18.58 ? 263  TYR B CE2   1 
ATOM   6905  C CZ    . TYR B 1 263 ? 56.692  123.658 79.220  1.00 21.20 ? 263  TYR B CZ    1 
ATOM   6906  O OH    . TYR B 1 263 ? 55.509  124.219 78.779  1.00 21.14 ? 263  TYR B OH    1 
ATOM   6907  N N     . THR B 1 264 ? 63.272  123.715 81.221  1.00 23.62 ? 264  THR B N     1 
ATOM   6908  C CA    . THR B 1 264 ? 64.590  123.989 81.757  1.00 24.25 ? 264  THR B CA    1 
ATOM   6909  C C     . THR B 1 264 ? 64.421  124.591 83.156  1.00 25.02 ? 264  THR B C     1 
ATOM   6910  O O     . THR B 1 264 ? 63.651  125.544 83.332  1.00 24.91 ? 264  THR B O     1 
ATOM   6911  C CB    . THR B 1 264 ? 65.272  125.038 80.866  1.00 24.11 ? 264  THR B CB    1 
ATOM   6912  O OG1   . THR B 1 264 ? 65.298  124.550 79.521  1.00 25.49 ? 264  THR B OG1   1 
ATOM   6913  C CG2   . THR B 1 264 ? 66.665  125.316 81.322  1.00 24.11 ? 264  THR B CG2   1 
ATOM   6914  N N     . SER B 1 265 ? 65.149  124.048 84.132  1.00 25.78 ? 265  SER B N     1 
ATOM   6915  C CA    . SER B 1 265 ? 65.095  124.528 85.515  1.00 26.32 ? 265  SER B CA    1 
ATOM   6916  C C     . SER B 1 265 ? 65.816  125.869 85.698  1.00 26.94 ? 265  SER B C     1 
ATOM   6917  O O     . SER B 1 265 ? 66.855  126.123 85.091  1.00 26.83 ? 265  SER B O     1 
ATOM   6918  C CB    . SER B 1 265 ? 65.733  123.495 86.457  1.00 26.27 ? 265  SER B CB    1 
ATOM   6919  O OG    . SER B 1 265 ? 65.027  122.253 86.488  1.00 25.50 ? 265  SER B OG    1 
ATOM   6920  N N     . GLY B 1 266 ? 65.274  126.710 86.572  1.00 28.03 ? 266  GLY B N     1 
ATOM   6921  C CA    . GLY B 1 266 ? 65.884  127.988 86.866  1.00 28.84 ? 266  GLY B CA    1 
ATOM   6922  C C     . GLY B 1 266 ? 66.141  128.146 88.343  1.00 29.91 ? 266  GLY B C     1 
ATOM   6923  O O     . GLY B 1 266 ? 65.778  127.274 89.148  1.00 29.69 ? 266  GLY B O     1 
ATOM   6924  N N     . SER B 1 267 ? 66.769  129.268 88.689  1.00 30.55 ? 267  SER B N     1 
ATOM   6925  C CA    . SER B 1 267 ? 67.086  129.619 90.072  1.00 31.60 ? 267  SER B CA    1 
ATOM   6926  C C     . SER B 1 267 ? 65.862  129.664 90.985  1.00 31.59 ? 267  SER B C     1 
ATOM   6927  O O     . SER B 1 267 ? 65.941  129.256 92.152  1.00 32.19 ? 267  SER B O     1 
ATOM   6928  C CB    . SER B 1 267 ? 67.796  130.974 90.119  1.00 31.73 ? 267  SER B CB    1 
ATOM   6929  O OG    . SER B 1 267 ? 68.313  131.203 91.419  1.00 34.47 ? 267  SER B OG    1 
ATOM   6930  N N     . THR B 1 268 ? 64.743  130.161 90.448  1.00 31.67 ? 268  THR B N     1 
ATOM   6931  C CA    . THR B 1 268 ? 63.479  130.246 91.178  1.00 31.70 ? 268  THR B CA    1 
ATOM   6932  C C     . THR B 1 268 ? 62.356  129.669 90.327  1.00 31.56 ? 268  THR B C     1 
ATOM   6933  O O     . THR B 1 268 ? 62.423  129.692 89.089  1.00 31.79 ? 268  THR B O     1 
ATOM   6934  C CB    . THR B 1 268 ? 63.093  131.720 91.521  1.00 32.14 ? 268  THR B CB    1 
ATOM   6935  O OG1   . THR B 1 268 ? 62.766  132.427 90.315  1.00 31.33 ? 268  THR B OG1   1 
ATOM   6936  C CG2   . THR B 1 268 ? 64.231  132.437 92.261  1.00 33.28 ? 268  THR B CG2   1 
ATOM   6937  N N     . GLY B 1 269 ? 61.320  129.169 90.995  1.00 30.94 ? 269  GLY B N     1 
ATOM   6938  C CA    . GLY B 1 269 ? 60.128  128.703 90.318  1.00 30.54 ? 269  GLY B CA    1 
ATOM   6939  C C     . GLY B 1 269 ? 60.296  127.328 89.687  1.00 30.11 ? 269  GLY B C     1 
ATOM   6940  O O     . GLY B 1 269 ? 61.346  126.685 89.827  1.00 30.29 ? 269  GLY B O     1 
ATOM   6941  N N     . LYS B 1 270 ? 59.243  126.878 89.000  1.00 29.45 ? 270  LYS B N     1 
ATOM   6942  C CA    . LYS B 1 270 ? 59.245  125.592 88.306  1.00 28.90 ? 270  LYS B CA    1 
ATOM   6943  C C     . LYS B 1 270 ? 59.911  125.769 86.923  1.00 27.87 ? 270  LYS B C     1 
ATOM   6944  O O     . LYS B 1 270 ? 60.141  126.900 86.491  1.00 27.29 ? 270  LYS B O     1 
ATOM   6945  C CB    . LYS B 1 270 ? 57.813  125.066 88.188  1.00 29.47 ? 270  LYS B CB    1 
ATOM   6946  N N     . PRO B 1 271 ? 60.278  124.657 86.252  1.00 27.01 ? 271  PRO B N     1 
ATOM   6947  C CA    . PRO B 1 271 ? 60.877  124.809 84.911  1.00 25.82 ? 271  PRO B CA    1 
ATOM   6948  C C     . PRO B 1 271 ? 59.957  125.528 83.932  1.00 25.15 ? 271  PRO B C     1 
ATOM   6949  O O     . PRO B 1 271 ? 58.738  125.353 83.982  1.00 24.26 ? 271  PRO B O     1 
ATOM   6950  C CB    . PRO B 1 271 ? 61.110  123.355 84.468  1.00 25.59 ? 271  PRO B CB    1 
ATOM   6951  C CG    . PRO B 1 271 ? 61.302  122.632 85.756  1.00 25.91 ? 271  PRO B CG    1 
ATOM   6952  C CD    . PRO B 1 271 ? 60.261  123.240 86.667  1.00 26.31 ? 271  PRO B CD    1 
ATOM   6953  N N     . LYS B 1 272 ? 60.563  126.351 83.072  1.00 24.89 ? 272  LYS B N     1 
ATOM   6954  C CA    . LYS B 1 272 ? 59.846  127.093 82.051  1.00 24.74 ? 272  LYS B CA    1 
ATOM   6955  C C     . LYS B 1 272 ? 60.286  126.586 80.692  1.00 23.93 ? 272  LYS B C     1 
ATOM   6956  O O     . LYS B 1 272 ? 61.398  126.087 80.552  1.00 23.92 ? 272  LYS B O     1 
ATOM   6957  C CB    . LYS B 1 272 ? 60.104  128.615 82.156  1.00 25.38 ? 272  LYS B CB    1 
ATOM   6958  C CG    . LYS B 1 272 ? 59.858  129.277 83.530  1.00 25.91 ? 272  LYS B CG    1 
ATOM   6959  C CD    . LYS B 1 272 ? 58.364  129.510 83.873  1.00 28.16 ? 272  LYS B CD    1 
ATOM   6960  C CE    . LYS B 1 272 ? 58.248  129.797 85.400  1.00 30.87 ? 272  LYS B CE    1 
ATOM   6961  N NZ    . LYS B 1 272 ? 56.892  130.185 85.947  1.00 31.21 ? 272  LYS B NZ    1 
ATOM   6962  N N     . GLY B 1 273 ? 59.406  126.729 79.699  1.00 23.43 ? 273  GLY B N     1 
ATOM   6963  C CA    . GLY B 1 273 ? 59.669  126.260 78.348  1.00 22.94 ? 273  GLY B CA    1 
ATOM   6964  C C     . GLY B 1 273 ? 60.523  127.205 77.526  1.00 22.09 ? 273  GLY B C     1 
ATOM   6965  O O     . GLY B 1 273 ? 60.016  128.216 77.025  1.00 21.83 ? 273  GLY B O     1 
ATOM   6966  N N     . VAL B 1 274 ? 61.814  126.869 77.388  1.00 21.74 ? 274  VAL B N     1 
ATOM   6967  C CA    . VAL B 1 274 ? 62.738  127.663 76.590  1.00 20.89 ? 274  VAL B CA    1 
ATOM   6968  C C     . VAL B 1 274 ? 62.365  127.401 75.133  1.00 21.78 ? 274  VAL B C     1 
ATOM   6969  O O     . VAL B 1 274 ? 62.318  126.237 74.683  1.00 20.84 ? 274  VAL B O     1 
ATOM   6970  C CB    . VAL B 1 274 ? 64.258  127.324 76.844  1.00 21.12 ? 274  VAL B CB    1 
ATOM   6971  C CG1   . VAL B 1 274 ? 65.159  128.048 75.837  1.00 18.03 ? 274  VAL B CG1   1 
ATOM   6972  C CG2   . VAL B 1 274 ? 64.694  127.623 78.279  1.00 18.90 ? 274  VAL B CG2   1 
ATOM   6973  N N     . LEU B 1 275 ? 62.108  128.495 74.410  1.00 21.91 ? 275  LEU B N     1 
ATOM   6974  C CA    . LEU B 1 275 ? 61.610  128.424 73.042  1.00 22.06 ? 275  LEU B CA    1 
ATOM   6975  C C     . LEU B 1 275 ? 62.681  128.777 72.024  1.00 21.99 ? 275  LEU B C     1 
ATOM   6976  O O     . LEU B 1 275 ? 63.244  129.879 72.036  1.00 22.07 ? 275  LEU B O     1 
ATOM   6977  C CB    . LEU B 1 275 ? 60.351  129.306 72.851  1.00 21.80 ? 275  LEU B CB    1 
ATOM   6978  C CG    . LEU B 1 275 ? 59.532  129.188 71.529  1.00 22.87 ? 275  LEU B CG    1 
ATOM   6979  C CD1   . LEU B 1 275 ? 58.004  129.294 71.714  1.00 18.35 ? 275  LEU B CD1   1 
ATOM   6980  C CD2   . LEU B 1 275 ? 59.989  130.180 70.436  1.00 21.93 ? 275  LEU B CD2   1 
ATOM   6981  N N     . HIS B 1 276 ? 62.937  127.830 71.126  1.00 21.81 ? 276  HIS B N     1 
ATOM   6982  C CA    . HIS B 1 276 ? 63.750  128.091 69.952  1.00 21.35 ? 276  HIS B CA    1 
ATOM   6983  C C     . HIS B 1 276 ? 62.890  128.198 68.706  1.00 21.16 ? 276  HIS B C     1 
ATOM   6984  O O     . HIS B 1 276 ? 61.945  127.432 68.517  1.00 21.40 ? 276  HIS B O     1 
ATOM   6985  C CB    . HIS B 1 276 ? 64.804  127.009 69.780  1.00 20.93 ? 276  HIS B CB    1 
ATOM   6986  C CG    . HIS B 1 276 ? 65.904  127.112 70.779  1.00 21.85 ? 276  HIS B CG    1 
ATOM   6987  N ND1   . HIS B 1 276 ? 67.010  127.913 70.583  1.00 20.92 ? 276  HIS B ND1   1 
ATOM   6988  C CD2   . HIS B 1 276 ? 66.052  126.551 72.000  1.00 20.89 ? 276  HIS B CD2   1 
ATOM   6989  C CE1   . HIS B 1 276 ? 67.792  127.832 71.642  1.00 21.83 ? 276  HIS B CE1   1 
ATOM   6990  N NE2   . HIS B 1 276 ? 67.240  127.007 72.510  1.00 20.79 ? 276  HIS B NE2   1 
ATOM   6991  N N     . THR B 1 277 ? 63.231  129.160 67.856  1.00 20.65 ? 277  THR B N     1 
ATOM   6992  C CA    . THR B 1 277 ? 62.617  129.257 66.550  1.00 20.12 ? 277  THR B CA    1 
ATOM   6993  C C     . THR B 1 277 ? 63.420  128.408 65.542  1.00 20.20 ? 277  THR B C     1 
ATOM   6994  O O     . THR B 1 277 ? 64.214  127.549 65.942  1.00 19.32 ? 277  THR B O     1 
ATOM   6995  C CB    . THR B 1 277 ? 62.387  130.731 66.139  1.00 20.10 ? 277  THR B CB    1 
ATOM   6996  O OG1   . THR B 1 277 ? 63.621  131.465 66.240  1.00 21.33 ? 277  THR B OG1   1 
ATOM   6997  C CG2   . THR B 1 277 ? 61.340  131.369 67.054  1.00 18.08 ? 277  THR B CG2   1 
ATOM   6998  N N     . THR B 1 278 ? 63.200  128.626 64.246  1.00 20.94 ? 278  THR B N     1 
ATOM   6999  C CA    . THR B 1 278 ? 63.629  127.661 63.221  1.00 20.97 ? 278  THR B CA    1 
ATOM   7000  C C     . THR B 1 278 ? 64.973  127.962 62.529  1.00 20.93 ? 278  THR B C     1 
ATOM   7001  O O     . THR B 1 278 ? 65.860  127.120 62.537  1.00 21.13 ? 278  THR B O     1 
ATOM   7002  C CB    . THR B 1 278 ? 62.474  127.389 62.195  1.00 20.92 ? 278  THR B CB    1 
ATOM   7003  O OG1   . THR B 1 278 ? 61.312  126.903 62.896  1.00 21.18 ? 278  THR B OG1   1 
ATOM   7004  C CG2   . THR B 1 278 ? 62.888  126.344 61.146  1.00 19.56 ? 278  THR B CG2   1 
ATOM   7005  N N     . GLY B 1 279 ? 65.126  129.166 61.968  1.00 21.16 ? 279  GLY B N     1 
ATOM   7006  C CA    . GLY B 1 279 ? 66.245  129.500 61.065  1.00 20.60 ? 279  GLY B CA    1 
ATOM   7007  C C     . GLY B 1 279 ? 67.590  129.665 61.730  1.00 20.52 ? 279  GLY B C     1 
ATOM   7008  O O     . GLY B 1 279 ? 68.509  128.904 61.465  1.00 20.71 ? 279  GLY B O     1 
ATOM   7009  N N     . GLY B 1 280 ? 67.697  130.669 62.595  1.00 21.09 ? 280  GLY B N     1 
ATOM   7010  C CA    . GLY B 1 280 ? 68.910  130.927 63.370  1.00 21.51 ? 280  GLY B CA    1 
ATOM   7011  C C     . GLY B 1 280 ? 69.334  129.749 64.214  1.00 21.96 ? 280  GLY B C     1 
ATOM   7012  O O     . GLY B 1 280 ? 70.529  129.443 64.293  1.00 23.20 ? 280  GLY B O     1 
ATOM   7013  N N     . TYR B 1 281 ? 68.379  129.077 64.857  1.00 21.78 ? 281  TYR B N     1 
ATOM   7014  C CA    . TYR B 1 281 ? 68.723  127.900 65.669  1.00 21.37 ? 281  TYR B CA    1 
ATOM   7015  C C     . TYR B 1 281 ? 69.415  126.832 64.814  1.00 21.21 ? 281  TYR B C     1 
ATOM   7016  O O     . TYR B 1 281 ? 70.416  126.260 65.234  1.00 21.31 ? 281  TYR B O     1 
ATOM   7017  C CB    . TYR B 1 281 ? 67.482  127.273 66.352  1.00 21.52 ? 281  TYR B CB    1 
ATOM   7018  C CG    . TYR B 1 281 ? 67.783  125.888 66.902  1.00 21.12 ? 281  TYR B CG    1 
ATOM   7019  C CD1   . TYR B 1 281 ? 68.396  125.731 68.152  1.00 20.04 ? 281  TYR B CD1   1 
ATOM   7020  C CD2   . TYR B 1 281 ? 67.506  124.742 66.149  1.00 21.52 ? 281  TYR B CD2   1 
ATOM   7021  C CE1   . TYR B 1 281 ? 68.699  124.478 68.648  1.00 21.03 ? 281  TYR B CE1   1 
ATOM   7022  C CE2   . TYR B 1 281 ? 67.826  123.480 66.621  1.00 20.19 ? 281  TYR B CE2   1 
ATOM   7023  C CZ    . TYR B 1 281 ? 68.399  123.345 67.893  1.00 22.02 ? 281  TYR B CZ    1 
ATOM   7024  O OH    . TYR B 1 281 ? 68.722  122.082 68.388  1.00 19.96 ? 281  TYR B OH    1 
ATOM   7025  N N     . LEU B 1 282 ? 68.854  126.543 63.637  1.00 20.86 ? 282  LEU B N     1 
ATOM   7026  C CA    . LEU B 1 282 ? 69.383  125.464 62.811  1.00 20.75 ? 282  LEU B CA    1 
ATOM   7027  C C     . LEU B 1 282 ? 70.707  125.850 62.171  1.00 20.78 ? 282  LEU B C     1 
ATOM   7028  O O     . LEU B 1 282 ? 71.618  125.031 62.135  1.00 21.47 ? 282  LEU B O     1 
ATOM   7029  C CB    . LEU B 1 282 ? 68.368  124.956 61.769  1.00 20.41 ? 282  LEU B CB    1 
ATOM   7030  C CG    . LEU B 1 282 ? 68.714  123.631 61.039  1.00 20.27 ? 282  LEU B CG    1 
ATOM   7031  C CD1   . LEU B 1 282 ? 68.935  122.436 61.992  1.00 20.50 ? 282  LEU B CD1   1 
ATOM   7032  C CD2   . LEU B 1 282 ? 67.648  123.290 60.050  1.00 20.34 ? 282  LEU B CD2   1 
ATOM   7033  N N     . VAL B 1 283 ? 70.824  127.094 61.687  1.00 21.26 ? 283  VAL B N     1 
ATOM   7034  C CA    . VAL B 1 283 ? 72.105  127.569 61.137  1.00 20.87 ? 283  VAL B CA    1 
ATOM   7035  C C     . VAL B 1 283 ? 73.203  127.366 62.183  1.00 21.25 ? 283  VAL B C     1 
ATOM   7036  O O     . VAL B 1 283 ? 74.270  126.808 61.879  1.00 21.88 ? 283  VAL B O     1 
ATOM   7037  C CB    . VAL B 1 283 ? 72.075  129.060 60.681  1.00 20.99 ? 283  VAL B CB    1 
ATOM   7038  C CG1   . VAL B 1 283 ? 73.496  129.596 60.427  1.00 18.63 ? 283  VAL B CG1   1 
ATOM   7039  C CG2   . VAL B 1 283 ? 71.220  129.242 59.415  1.00 20.31 ? 283  VAL B CG2   1 
ATOM   7040  N N     . TYR B 1 284 ? 72.930  127.817 63.406  1.00 20.63 ? 284  TYR B N     1 
ATOM   7041  C CA    . TYR B 1 284 ? 73.905  127.784 64.480  1.00 20.66 ? 284  TYR B CA    1 
ATOM   7042  C C     . TYR B 1 284 ? 74.265  126.365 64.954  1.00 20.37 ? 284  TYR B C     1 
ATOM   7043  O O     . TYR B 1 284 ? 75.433  126.088 65.229  1.00 19.67 ? 284  TYR B O     1 
ATOM   7044  C CB    . TYR B 1 284 ? 73.419  128.642 65.652  1.00 20.91 ? 284  TYR B CB    1 
ATOM   7045  C CG    . TYR B 1 284 ? 74.519  129.093 66.584  1.00 21.68 ? 284  TYR B CG    1 
ATOM   7046  C CD1   . TYR B 1 284 ? 74.630  128.552 67.857  1.00 20.75 ? 284  TYR B CD1   1 
ATOM   7047  C CD2   . TYR B 1 284 ? 75.455  130.058 66.181  1.00 21.36 ? 284  TYR B CD2   1 
ATOM   7048  C CE1   . TYR B 1 284 ? 75.635  128.936 68.710  1.00 20.99 ? 284  TYR B CE1   1 
ATOM   7049  C CE2   . TYR B 1 284 ? 76.470  130.474 67.035  1.00 21.25 ? 284  TYR B CE2   1 
ATOM   7050  C CZ    . TYR B 1 284 ? 76.557  129.897 68.300  1.00 23.10 ? 284  TYR B CZ    1 
ATOM   7051  O OH    . TYR B 1 284 ? 77.546  130.277 69.176  1.00 22.09 ? 284  TYR B OH    1 
ATOM   7052  N N     . ALA B 1 285 ? 73.264  125.489 65.060  1.00 20.39 ? 285  ALA B N     1 
ATOM   7053  C CA    . ALA B 1 285 ? 73.475  124.087 65.437  1.00 20.79 ? 285  ALA B CA    1 
ATOM   7054  C C     . ALA B 1 285 ? 74.351  123.430 64.402  1.00 20.89 ? 285  ALA B C     1 
ATOM   7055  O O     . ALA B 1 285 ? 75.289  122.723 64.745  1.00 20.95 ? 285  ALA B O     1 
ATOM   7056  C CB    . ALA B 1 285 ? 72.150  123.319 65.564  1.00 20.73 ? 285  ALA B CB    1 
ATOM   7057  N N     . ALA B 1 286 ? 74.048  123.684 63.132  1.00 21.30 ? 286  ALA B N     1 
ATOM   7058  C CA    . ALA B 1 286 ? 74.785  123.062 62.016  1.00 21.10 ? 286  ALA B CA    1 
ATOM   7059  C C     . ALA B 1 286 ? 76.215  123.600 61.948  1.00 20.79 ? 286  ALA B C     1 
ATOM   7060  O O     . ALA B 1 286 ? 77.158  122.846 61.719  1.00 21.14 ? 286  ALA B O     1 
ATOM   7061  C CB    . ALA B 1 286 ? 74.056  123.299 60.702  1.00 20.55 ? 286  ALA B CB    1 
ATOM   7062  N N     . THR B 1 287 ? 76.362  124.902 62.179  1.00 20.49 ? 287  THR B N     1 
ATOM   7063  C CA    . THR B 1 287 ? 77.650  125.581 62.067  1.00 20.43 ? 287  THR B CA    1 
ATOM   7064  C C     . THR B 1 287 ? 78.594  125.178 63.198  1.00 20.69 ? 287  THR B C     1 
ATOM   7065  O O     . THR B 1 287 ? 79.782  124.864 62.967  1.00 20.59 ? 287  THR B O     1 
ATOM   7066  C CB    . THR B 1 287 ? 77.446  127.130 62.067  1.00 20.84 ? 287  THR B CB    1 
ATOM   7067  O OG1   . THR B 1 287 ? 76.572  127.505 60.989  1.00 19.13 ? 287  THR B OG1   1 
ATOM   7068  C CG2   . THR B 1 287 ? 78.756  127.901 62.014  1.00 19.68 ? 287  THR B CG2   1 
ATOM   7069  N N     . THR B 1 288 ? 78.072  125.200 64.420  1.00 20.76 ? 288  THR B N     1 
ATOM   7070  C CA    . THR B 1 288 ? 78.863  124.842 65.581  1.00 21.02 ? 288  THR B CA    1 
ATOM   7071  C C     . THR B 1 288 ? 79.286  123.376 65.484  1.00 21.72 ? 288  THR B C     1 
ATOM   7072  O O     . THR B 1 288 ? 80.457  123.044 65.729  1.00 21.82 ? 288  THR B O     1 
ATOM   7073  C CB    . THR B 1 288 ? 78.111  125.079 66.898  1.00 21.07 ? 288  THR B CB    1 
ATOM   7074  O OG1   . THR B 1 288 ? 76.777  124.564 66.788  1.00 22.19 ? 288  THR B OG1   1 
ATOM   7075  C CG2   . THR B 1 288 ? 78.065  126.548 67.235  1.00 19.03 ? 288  THR B CG2   1 
ATOM   7076  N N     . PHE B 1 289 ? 78.346  122.509 65.104  1.00 21.74 ? 289  PHE B N     1 
ATOM   7077  C CA    . PHE B 1 289 ? 78.625  121.084 64.953  1.00 22.38 ? 289  PHE B CA    1 
ATOM   7078  C C     . PHE B 1 289 ? 79.786  120.852 64.006  1.00 23.39 ? 289  PHE B C     1 
ATOM   7079  O O     . PHE B 1 289 ? 80.748  120.172 64.357  1.00 23.80 ? 289  PHE B O     1 
ATOM   7080  C CB    . PHE B 1 289 ? 77.397  120.311 64.445  1.00 21.69 ? 289  PHE B CB    1 
ATOM   7081  C CG    . PHE B 1 289 ? 77.712  118.897 63.991  1.00 22.37 ? 289  PHE B CG    1 
ATOM   7082  C CD1   . PHE B 1 289 ? 77.888  117.872 64.923  1.00 22.87 ? 289  PHE B CD1   1 
ATOM   7083  C CD2   . PHE B 1 289 ? 77.828  118.589 62.646  1.00 21.39 ? 289  PHE B CD2   1 
ATOM   7084  C CE1   . PHE B 1 289 ? 78.190  116.580 64.506  1.00 22.71 ? 289  PHE B CE1   1 
ATOM   7085  C CE2   . PHE B 1 289 ? 78.116  117.295 62.238  1.00 22.76 ? 289  PHE B CE2   1 
ATOM   7086  C CZ    . PHE B 1 289 ? 78.303  116.296 63.167  1.00 21.40 ? 289  PHE B CZ    1 
ATOM   7087  N N     . LYS B 1 290 ? 79.670  121.415 62.807  1.00 24.25 ? 290  LYS B N     1 
ATOM   7088  C CA    . LYS B 1 290 ? 80.630  121.219 61.730  1.00 25.68 ? 290  LYS B CA    1 
ATOM   7089  C C     . LYS B 1 290 ? 82.049  121.697 62.082  1.00 26.36 ? 290  LYS B C     1 
ATOM   7090  O O     . LYS B 1 290 ? 83.023  121.026 61.747  1.00 26.93 ? 290  LYS B O     1 
ATOM   7091  C CB    . LYS B 1 290 ? 80.137  121.935 60.471  1.00 25.11 ? 290  LYS B CB    1 
ATOM   7092  C CG    . LYS B 1 290 ? 81.045  121.793 59.245  1.00 27.04 ? 290  LYS B CG    1 
ATOM   7093  C CD    . LYS B 1 290 ? 80.397  122.506 58.066  1.00 30.25 ? 290  LYS B CD    1 
ATOM   7094  C CE    . LYS B 1 290 ? 81.083  122.193 56.761  1.00 32.04 ? 290  LYS B CE    1 
ATOM   7095  N NZ    . LYS B 1 290 ? 80.346  122.867 55.662  1.00 33.95 ? 290  LYS B NZ    1 
ATOM   7096  N N     . TYR B 1 291 ? 82.166  122.838 62.756  1.00 26.89 ? 291  TYR B N     1 
ATOM   7097  C CA    . TYR B 1 291 ? 83.479  123.415 63.026  1.00 27.44 ? 291  TYR B CA    1 
ATOM   7098  C C     . TYR B 1 291 ? 84.112  122.969 64.336  1.00 27.11 ? 291  TYR B C     1 
ATOM   7099  O O     . TYR B 1 291 ? 85.330  122.810 64.421  1.00 27.07 ? 291  TYR B O     1 
ATOM   7100  C CB    . TYR B 1 291 ? 83.468  124.948 62.865  1.00 28.10 ? 291  TYR B CB    1 
ATOM   7101  C CG    . TYR B 1 291 ? 83.181  125.373 61.429  1.00 30.06 ? 291  TYR B CG    1 
ATOM   7102  C CD1   . TYR B 1 291 ? 82.152  126.258 61.135  1.00 31.14 ? 291  TYR B CD1   1 
ATOM   7103  C CD2   . TYR B 1 291 ? 83.923  124.850 60.359  1.00 31.74 ? 291  TYR B CD2   1 
ATOM   7104  C CE1   . TYR B 1 291 ? 81.879  126.633 59.819  1.00 32.46 ? 291  TYR B CE1   1 
ATOM   7105  C CE2   . TYR B 1 291 ? 83.660  125.222 59.043  1.00 31.49 ? 291  TYR B CE2   1 
ATOM   7106  C CZ    . TYR B 1 291 ? 82.636  126.108 58.783  1.00 31.70 ? 291  TYR B CZ    1 
ATOM   7107  O OH    . TYR B 1 291 ? 82.363  126.477 57.484  1.00 31.84 ? 291  TYR B OH    1 
ATOM   7108  N N     . VAL B 1 292 ? 83.292  122.751 65.352  1.00 27.01 ? 292  VAL B N     1 
ATOM   7109  C CA    . VAL B 1 292 ? 83.804  122.282 66.643  1.00 26.05 ? 292  VAL B CA    1 
ATOM   7110  C C     . VAL B 1 292 ? 84.170  120.806 66.593  1.00 26.16 ? 292  VAL B C     1 
ATOM   7111  O O     . VAL B 1 292 ? 85.172  120.389 67.190  1.00 26.50 ? 292  VAL B O     1 
ATOM   7112  C CB    . VAL B 1 292 ? 82.837  122.616 67.791  1.00 26.09 ? 292  VAL B CB    1 
ATOM   7113  C CG1   . VAL B 1 292 ? 83.370  122.121 69.140  1.00 25.75 ? 292  VAL B CG1   1 
ATOM   7114  C CG2   . VAL B 1 292 ? 82.624  124.134 67.841  1.00 25.82 ? 292  VAL B CG2   1 
ATOM   7115  N N     . PHE B 1 293 ? 83.393  120.012 65.866  1.00 25.88 ? 293  PHE B N     1 
ATOM   7116  C CA    . PHE B 1 293 ? 83.741  118.604 65.722  1.00 26.43 ? 293  PHE B CA    1 
ATOM   7117  C C     . PHE B 1 293 ? 84.527  118.311 64.465  1.00 26.81 ? 293  PHE B C     1 
ATOM   7118  O O     . PHE B 1 293 ? 84.768  117.147 64.152  1.00 26.91 ? 293  PHE B O     1 
ATOM   7119  C CB    . PHE B 1 293 ? 82.518  117.694 65.822  1.00 25.82 ? 293  PHE B CB    1 
ATOM   7120  C CG    . PHE B 1 293 ? 81.842  117.766 67.145  1.00 25.91 ? 293  PHE B CG    1 
ATOM   7121  C CD1   . PHE B 1 293 ? 80.551  118.272 67.251  1.00 24.70 ? 293  PHE B CD1   1 
ATOM   7122  C CD2   . PHE B 1 293 ? 82.519  117.366 68.308  1.00 24.83 ? 293  PHE B CD2   1 
ATOM   7123  C CE1   . PHE B 1 293 ? 79.928  118.343 68.486  1.00 24.95 ? 293  PHE B CE1   1 
ATOM   7124  C CE2   . PHE B 1 293 ? 81.908  117.438 69.539  1.00 24.28 ? 293  PHE B CE2   1 
ATOM   7125  C CZ    . PHE B 1 293 ? 80.608  117.930 69.632  1.00 25.28 ? 293  PHE B CZ    1 
ATOM   7126  N N     . ASP B 1 294 ? 84.938  119.370 63.766  1.00 27.95 ? 294  ASP B N     1 
ATOM   7127  C CA    . ASP B 1 294 ? 85.734  119.257 62.541  1.00 28.49 ? 294  ASP B CA    1 
ATOM   7128  C C     . ASP B 1 294 ? 85.174  118.168 61.627  1.00 28.88 ? 294  ASP B C     1 
ATOM   7129  O O     . ASP B 1 294 ? 85.917  117.316 61.150  1.00 28.72 ? 294  ASP B O     1 
ATOM   7130  C CB    . ASP B 1 294 ? 87.206  118.982 62.879  1.00 28.57 ? 294  ASP B CB    1 
ATOM   7131  C CG    . ASP B 1 294 ? 88.147  119.424 61.771  1.00 28.63 ? 294  ASP B CG    1 
ATOM   7132  O OD1   . ASP B 1 294 ? 88.988  118.610 61.320  1.00 28.34 ? 294  ASP B OD1   1 
ATOM   7133  O OD2   . ASP B 1 294 ? 88.034  120.593 61.353  1.00 30.31 ? 294  ASP B OD2   1 
ATOM   7134  N N     . TYR B 1 295 ? 83.859  118.203 61.398  1.00 30.06 ? 295  TYR B N     1 
ATOM   7135  C CA    . TYR B 1 295 ? 83.182  117.139 60.661  1.00 31.21 ? 295  TYR B CA    1 
ATOM   7136  C C     . TYR B 1 295 ? 83.540  117.060 59.168  1.00 31.22 ? 295  TYR B C     1 
ATOM   7137  O O     . TYR B 1 295 ? 83.547  118.068 58.455  1.00 31.40 ? 295  TYR B O     1 
ATOM   7138  C CB    . TYR B 1 295 ? 81.654  117.175 60.857  1.00 32.14 ? 295  TYR B CB    1 
ATOM   7139  C CG    . TYR B 1 295 ? 80.954  116.165 59.986  1.00 33.31 ? 295  TYR B CG    1 
ATOM   7140  C CD1   . TYR B 1 295 ? 80.835  114.829 60.383  1.00 34.20 ? 295  TYR B CD1   1 
ATOM   7141  C CD2   . TYR B 1 295 ? 80.452  116.534 58.736  1.00 35.21 ? 295  TYR B CD2   1 
ATOM   7142  C CE1   . TYR B 1 295 ? 80.216  113.891 59.564  1.00 35.34 ? 295  TYR B CE1   1 
ATOM   7143  C CE2   . TYR B 1 295 ? 79.840  115.605 57.907  1.00 35.57 ? 295  TYR B CE2   1 
ATOM   7144  C CZ    . TYR B 1 295 ? 79.720  114.291 58.331  1.00 34.79 ? 295  TYR B CZ    1 
ATOM   7145  O OH    . TYR B 1 295 ? 79.110  113.383 57.497  1.00 36.53 ? 295  TYR B OH    1 
ATOM   7146  N N     . HIS B 1 296 ? 83.809  115.839 58.713  1.00 31.36 ? 296  HIS B N     1 
ATOM   7147  C CA    . HIS B 1 296 ? 84.097  115.547 57.308  1.00 31.46 ? 296  HIS B CA    1 
ATOM   7148  C C     . HIS B 1 296 ? 83.165  114.442 56.839  1.00 31.32 ? 296  HIS B C     1 
ATOM   7149  O O     . HIS B 1 296 ? 82.869  113.535 57.609  1.00 31.06 ? 296  HIS B O     1 
ATOM   7150  C CB    . HIS B 1 296 ? 85.531  115.023 57.159  1.00 31.40 ? 296  HIS B CB    1 
ATOM   7151  C CG    . HIS B 1 296 ? 86.583  116.056 57.389  1.00 31.54 ? 296  HIS B CG    1 
ATOM   7152  N ND1   . HIS B 1 296 ? 86.817  116.615 58.626  1.00 31.58 ? 296  HIS B ND1   1 
ATOM   7153  C CD2   . HIS B 1 296 ? 87.468  116.629 56.540  1.00 31.55 ? 296  HIS B CD2   1 
ATOM   7154  C CE1   . HIS B 1 296 ? 87.803  117.490 58.530  1.00 31.76 ? 296  HIS B CE1   1 
ATOM   7155  N NE2   . HIS B 1 296 ? 88.212  117.520 57.274  1.00 31.85 ? 296  HIS B NE2   1 
ATOM   7156  N N     . PRO B 1 297 ? 82.723  114.500 55.569  1.00 31.51 ? 297  PRO B N     1 
ATOM   7157  C CA    . PRO B 1 297 ? 81.889  113.437 55.015  1.00 31.53 ? 297  PRO B CA    1 
ATOM   7158  C C     . PRO B 1 297 ? 82.391  112.041 55.386  1.00 31.43 ? 297  PRO B C     1 
ATOM   7159  O O     . PRO B 1 297 ? 83.558  111.722 55.158  1.00 31.00 ? 297  PRO B O     1 
ATOM   7160  C CB    . PRO B 1 297 ? 82.011  113.665 53.505  1.00 31.78 ? 297  PRO B CB    1 
ATOM   7161  C CG    . PRO B 1 297 ? 82.105  115.160 53.387  1.00 32.03 ? 297  PRO B CG    1 
ATOM   7162  C CD    . PRO B 1 297 ? 82.974  115.569 54.577  1.00 31.84 ? 297  PRO B CD    1 
ATOM   7163  N N     . GLY B 1 298 ? 81.513  111.232 55.977  1.00 31.05 ? 298  GLY B N     1 
ATOM   7164  C CA    . GLY B 1 298 ? 81.895  109.890 56.411  1.00 30.66 ? 298  GLY B CA    1 
ATOM   7165  C C     . GLY B 1 298 ? 82.390  109.703 57.846  1.00 30.20 ? 298  GLY B C     1 
ATOM   7166  O O     . GLY B 1 298 ? 82.599  108.555 58.266  1.00 30.84 ? 298  GLY B O     1 
ATOM   7167  N N     . ASP B 1 299 ? 82.609  110.798 58.590  1.00 28.98 ? 299  ASP B N     1 
ATOM   7168  C CA    . ASP B 1 299 ? 82.952  110.696 60.024  1.00 28.45 ? 299  ASP B CA    1 
ATOM   7169  C C     . ASP B 1 299 ? 81.785  110.070 60.778  1.00 27.88 ? 299  ASP B C     1 
ATOM   7170  O O     . ASP B 1 299 ? 80.629  110.480 60.588  1.00 27.72 ? 299  ASP B O     1 
ATOM   7171  C CB    . ASP B 1 299 ? 83.261  112.066 60.652  1.00 28.41 ? 299  ASP B CB    1 
ATOM   7172  C CG    . ASP B 1 299 ? 84.627  112.634 60.244  1.00 28.28 ? 299  ASP B CG    1 
ATOM   7173  O OD1   . ASP B 1 299 ? 85.405  111.957 59.529  1.00 24.98 ? 299  ASP B OD1   1 
ATOM   7174  O OD2   . ASP B 1 299 ? 84.918  113.780 60.662  1.00 27.71 ? 299  ASP B OD2   1 
ATOM   7175  N N     . ILE B 1 300 ? 82.083  109.064 61.606  1.00 27.18 ? 300  ILE B N     1 
ATOM   7176  C CA    . ILE B 1 300 ? 81.070  108.447 62.446  1.00 26.01 ? 300  ILE B CA    1 
ATOM   7177  C C     . ILE B 1 300 ? 81.030  109.206 63.763  1.00 25.40 ? 300  ILE B C     1 
ATOM   7178  O O     . ILE B 1 300 ? 82.021  109.245 64.501  1.00 25.86 ? 300  ILE B O     1 
ATOM   7179  C CB    . ILE B 1 300 ? 81.333  106.956 62.701  1.00 26.46 ? 300  ILE B CB    1 
ATOM   7180  C CG1   . ILE B 1 300 ? 81.651  106.202 61.388  1.00 27.10 ? 300  ILE B CG1   1 
ATOM   7181  C CG2   . ILE B 1 300 ? 80.140  106.331 63.465  1.00 26.74 ? 300  ILE B CG2   1 
ATOM   7182  C CD1   . ILE B 1 300 ? 80.502  106.167 60.372  1.00 26.38 ? 300  ILE B CD1   1 
ATOM   7183  N N     . TYR B 1 301 ? 79.873  109.788 64.066  1.00 24.33 ? 301  TYR B N     1 
ATOM   7184  C CA    . TYR B 1 301 ? 79.745  110.748 65.154  1.00 23.28 ? 301  TYR B CA    1 
ATOM   7185  C C     . TYR B 1 301 ? 78.853  110.189 66.260  1.00 22.78 ? 301  TYR B C     1 
ATOM   7186  O O     . TYR B 1 301 ? 77.773  109.660 65.993  1.00 22.67 ? 301  TYR B O     1 
ATOM   7187  C CB    . TYR B 1 301 ? 79.196  112.084 64.613  1.00 23.36 ? 301  TYR B CB    1 
ATOM   7188  C CG    . TYR B 1 301 ? 78.784  113.035 65.694  1.00 23.08 ? 301  TYR B CG    1 
ATOM   7189  C CD1   . TYR B 1 301 ? 77.460  113.124 66.086  1.00 22.28 ? 301  TYR B CD1   1 
ATOM   7190  C CD2   . TYR B 1 301 ? 79.730  113.828 66.350  1.00 22.94 ? 301  TYR B CD2   1 
ATOM   7191  C CE1   . TYR B 1 301 ? 77.074  113.975 67.107  1.00 23.72 ? 301  TYR B CE1   1 
ATOM   7192  C CE2   . TYR B 1 301 ? 79.359  114.682 67.371  1.00 23.74 ? 301  TYR B CE2   1 
ATOM   7193  C CZ    . TYR B 1 301 ? 78.023  114.756 67.734  1.00 24.40 ? 301  TYR B CZ    1 
ATOM   7194  O OH    . TYR B 1 301 ? 77.641  115.590 68.741  1.00 24.68 ? 301  TYR B OH    1 
ATOM   7195  N N     . TRP B 1 302 ? 79.306  110.306 67.502  1.00 22.05 ? 302  TRP B N     1 
ATOM   7196  C CA    . TRP B 1 302 ? 78.519  109.805 68.622  1.00 22.36 ? 302  TRP B CA    1 
ATOM   7197  C C     . TRP B 1 302 ? 78.417  110.766 69.779  1.00 22.39 ? 302  TRP B C     1 
ATOM   7198  O O     . TRP B 1 302 ? 79.410  111.014 70.477  1.00 22.57 ? 302  TRP B O     1 
ATOM   7199  C CB    . TRP B 1 302 ? 79.021  108.433 69.099  1.00 21.49 ? 302  TRP B CB    1 
ATOM   7200  C CG    . TRP B 1 302 ? 78.196  107.840 70.213  1.00 21.83 ? 302  TRP B CG    1 
ATOM   7201  C CD1   . TRP B 1 302 ? 76.894  108.142 70.528  1.00 22.04 ? 302  TRP B CD1   1 
ATOM   7202  C CD2   . TRP B 1 302 ? 78.596  106.807 71.134  1.00 20.38 ? 302  TRP B CD2   1 
ATOM   7203  N NE1   . TRP B 1 302 ? 76.479  107.387 71.587  1.00 22.00 ? 302  TRP B NE1   1 
ATOM   7204  C CE2   . TRP B 1 302 ? 77.494  106.556 71.980  1.00 19.87 ? 302  TRP B CE2   1 
ATOM   7205  C CE3   . TRP B 1 302 ? 79.784  106.083 71.327  1.00 19.95 ? 302  TRP B CE3   1 
ATOM   7206  C CZ2   . TRP B 1 302 ? 77.535  105.617 73.011  1.00 21.32 ? 302  TRP B CZ2   1 
ATOM   7207  C CZ3   . TRP B 1 302 ? 79.832  105.149 72.342  1.00 21.35 ? 302  TRP B CZ3   1 
ATOM   7208  C CH2   . TRP B 1 302 ? 78.704  104.918 73.180  1.00 21.68 ? 302  TRP B CH2   1 
ATOM   7209  N N     . CYS B 1 303 ? 77.207  111.302 69.959  1.00 22.43 ? 303  CYS B N     1 
ATOM   7210  C CA    . CYS B 1 303 ? 76.856  112.105 71.115  1.00 22.25 ? 303  CYS B CA    1 
ATOM   7211  C C     . CYS B 1 303 ? 76.047  111.223 72.051  1.00 22.05 ? 303  CYS B C     1 
ATOM   7212  O O     . CYS B 1 303 ? 75.036  110.640 71.641  1.00 21.72 ? 303  CYS B O     1 
ATOM   7213  C CB    . CYS B 1 303 ? 76.007  113.315 70.688  1.00 22.89 ? 303  CYS B CB    1 
ATOM   7214  S SG    . CYS B 1 303 ? 75.276  114.279 72.049  1.00 24.75 ? 303  CYS B SG    1 
ATOM   7215  N N     . THR B 1 304 ? 76.475  111.143 73.310  1.00 21.60 ? 304  THR B N     1 
ATOM   7216  C CA    . THR B 1 304 ? 75.848  110.247 74.269  1.00 21.36 ? 304  THR B CA    1 
ATOM   7217  C C     . THR B 1 304 ? 74.648  110.856 75.006  1.00 21.97 ? 304  THR B C     1 
ATOM   7218  O O     . THR B 1 304 ? 73.993  110.162 75.791  1.00 22.86 ? 304  THR B O     1 
ATOM   7219  C CB    . THR B 1 304 ? 76.872  109.741 75.325  1.00 21.58 ? 304  THR B CB    1 
ATOM   7220  O OG1   . THR B 1 304 ? 77.379  110.861 76.048  1.00 19.01 ? 304  THR B OG1   1 
ATOM   7221  C CG2   . THR B 1 304 ? 78.017  108.965 74.679  1.00 20.52 ? 304  THR B CG2   1 
ATOM   7222  N N     . ALA B 1 305 ? 74.375  112.139 74.783  1.00 22.05 ? 305  ALA B N     1 
ATOM   7223  C CA    . ALA B 1 305 ? 73.284  112.833 75.480  1.00 22.83 ? 305  ALA B CA    1 
ATOM   7224  C C     . ALA B 1 305 ? 71.907  112.368 75.067  1.00 23.12 ? 305  ALA B C     1 
ATOM   7225  O O     . ALA B 1 305 ? 71.655  112.104 73.898  1.00 22.67 ? 305  ALA B O     1 
ATOM   7226  C CB    . ALA B 1 305 ? 73.369  114.326 75.293  1.00 22.20 ? 305  ALA B CB    1 
ATOM   7227  N N     . ASP B 1 306 ? 71.017  112.322 76.050  1.00 23.27 ? 306  ASP B N     1 
ATOM   7228  C CA    . ASP B 1 306 ? 69.645  111.931 75.813  1.00 23.53 ? 306  ASP B CA    1 
ATOM   7229  C C     . ASP B 1 306 ? 68.916  112.940 74.945  1.00 23.37 ? 306  ASP B C     1 
ATOM   7230  O O     . ASP B 1 306 ? 69.118  114.142 75.059  1.00 22.35 ? 306  ASP B O     1 
ATOM   7231  C CB    . ASP B 1 306 ? 68.881  111.788 77.123  1.00 23.28 ? 306  ASP B CB    1 
ATOM   7232  C CG    . ASP B 1 306 ? 67.673  110.876 76.987  1.00 25.57 ? 306  ASP B CG    1 
ATOM   7233  O OD1   . ASP B 1 306 ? 66.527  111.368 76.927  1.00 23.06 ? 306  ASP B OD1   1 
ATOM   7234  O OD2   . ASP B 1 306 ? 67.888  109.652 76.964  1.00 27.89 ? 306  ASP B OD2   1 
ATOM   7235  N N     . VAL B 1 307 ? 68.033  112.397 74.111  1.00 23.27 ? 307  VAL B N     1 
ATOM   7236  C CA    . VAL B 1 307 ? 67.145  113.141 73.260  1.00 23.78 ? 307  VAL B CA    1 
ATOM   7237  C C     . VAL B 1 307 ? 66.322  114.174 74.046  1.00 23.56 ? 307  VAL B C     1 
ATOM   7238  O O     . VAL B 1 307 ? 65.985  115.215 73.512  1.00 23.85 ? 307  VAL B O     1 
ATOM   7239  C CB    . VAL B 1 307 ? 66.287  112.138 72.431  1.00 23.95 ? 307  VAL B CB    1 
ATOM   7240  C CG1   . VAL B 1 307 ? 65.092  111.568 73.218  1.00 24.16 ? 307  VAL B CG1   1 
ATOM   7241  C CG2   . VAL B 1 307 ? 65.885  112.727 71.137  1.00 24.45 ? 307  VAL B CG2   1 
ATOM   7242  N N     . GLY B 1 308 ? 66.057  113.881 75.329  1.00 23.82 ? 308  GLY B N     1 
ATOM   7243  C CA    . GLY B 1 308 ? 65.272  114.736 76.218  1.00 22.56 ? 308  GLY B CA    1 
ATOM   7244  C C     . GLY B 1 308 ? 66.009  115.976 76.708  1.00 22.91 ? 308  GLY B C     1 
ATOM   7245  O O     . GLY B 1 308 ? 65.409  116.837 77.386  1.00 22.50 ? 308  GLY B O     1 
ATOM   7246  N N     . TRP B 1 309 ? 67.298  116.077 76.372  1.00 21.69 ? 309  TRP B N     1 
ATOM   7247  C CA    . TRP B 1 309 ? 68.098  117.238 76.754  1.00 21.61 ? 309  TRP B CA    1 
ATOM   7248  C C     . TRP B 1 309 ? 68.472  118.055 75.515  1.00 21.36 ? 309  TRP B C     1 
ATOM   7249  O O     . TRP B 1 309 ? 68.389  117.544 74.382  1.00 21.32 ? 309  TRP B O     1 
ATOM   7250  C CB    . TRP B 1 309 ? 69.351  116.805 77.521  1.00 21.56 ? 309  TRP B CB    1 
ATOM   7251  C CG    . TRP B 1 309 ? 69.043  115.957 78.713  1.00 22.33 ? 309  TRP B CG    1 
ATOM   7252  C CD1   . TRP B 1 309 ? 69.548  114.713 78.993  1.00 22.66 ? 309  TRP B CD1   1 
ATOM   7253  C CD2   . TRP B 1 309 ? 68.144  116.279 79.790  1.00 23.64 ? 309  TRP B CD2   1 
ATOM   7254  N NE1   . TRP B 1 309 ? 69.020  114.256 80.169  1.00 24.06 ? 309  TRP B NE1   1 
ATOM   7255  C CE2   . TRP B 1 309 ? 68.157  115.198 80.675  1.00 23.83 ? 309  TRP B CE2   1 
ATOM   7256  C CE3   . TRP B 1 309 ? 67.313  117.383 80.074  1.00 26.03 ? 309  TRP B CE3   1 
ATOM   7257  C CZ2   . TRP B 1 309 ? 67.396  115.187 81.844  1.00 25.34 ? 309  TRP B CZ2   1 
ATOM   7258  C CZ3   . TRP B 1 309 ? 66.554  117.372 81.219  1.00 23.79 ? 309  TRP B CZ3   1 
ATOM   7259  C CH2   . TRP B 1 309 ? 66.598  116.272 82.096  1.00 24.27 ? 309  TRP B CH2   1 
ATOM   7260  N N     . VAL B 1 310 ? 68.885  119.307 75.727  1.00 20.26 ? 310  VAL B N     1 
ATOM   7261  C CA    . VAL B 1 310 ? 69.216  120.197 74.611  1.00 20.13 ? 310  VAL B CA    1 
ATOM   7262  C C     . VAL B 1 310 ? 70.400  119.652 73.812  1.00 19.67 ? 310  VAL B C     1 
ATOM   7263  O O     . VAL B 1 310 ? 70.451  119.792 72.591  1.00 19.63 ? 310  VAL B O     1 
ATOM   7264  C CB    . VAL B 1 310 ? 69.455  121.692 75.065  1.00 19.76 ? 310  VAL B CB    1 
ATOM   7265  C CG1   . VAL B 1 310 ? 70.725  121.822 75.968  1.00 19.54 ? 310  VAL B CG1   1 
ATOM   7266  C CG2   . VAL B 1 310 ? 69.511  122.628 73.857  1.00 20.28 ? 310  VAL B CG2   1 
ATOM   7267  N N     . THR B 1 311 ? 71.348  119.016 74.495  1.00 19.97 ? 311  THR B N     1 
ATOM   7268  C CA    . THR B 1 311 ? 72.473  118.384 73.796  1.00 19.72 ? 311  THR B CA    1 
ATOM   7269  C C     . THR B 1 311 ? 71.953  117.336 72.824  1.00 20.00 ? 311  THR B C     1 
ATOM   7270  O O     . THR B 1 311 ? 72.454  117.230 71.715  1.00 20.19 ? 311  THR B O     1 
ATOM   7271  C CB    . THR B 1 311 ? 73.478  117.814 74.771  1.00 19.96 ? 311  THR B CB    1 
ATOM   7272  O OG1   . THR B 1 311 ? 73.849  118.860 75.661  1.00 21.08 ? 311  THR B OG1   1 
ATOM   7273  C CG2   . THR B 1 311 ? 74.749  117.306 74.054  1.00 18.87 ? 311  THR B CG2   1 
ATOM   7274  N N     . GLY B 1 312 ? 70.921  116.597 73.224  1.00 19.73 ? 312  GLY B N     1 
ATOM   7275  C CA    . GLY B 1 312 ? 70.294  115.627 72.336  1.00 20.27 ? 312  GLY B CA    1 
ATOM   7276  C C     . GLY B 1 312 ? 69.559  116.255 71.152  1.00 20.31 ? 312  GLY B C     1 
ATOM   7277  O O     . GLY B 1 312 ? 69.586  115.706 70.068  1.00 20.92 ? 312  GLY B O     1 
ATOM   7278  N N     . HIS B 1 313 ? 68.892  117.393 71.357  1.00 20.04 ? 313  HIS B N     1 
ATOM   7279  C CA    . HIS B 1 313 ? 68.262  118.141 70.255  1.00 20.42 ? 313  HIS B CA    1 
ATOM   7280  C C     . HIS B 1 313 ? 69.327  118.618 69.247  1.00 20.67 ? 313  HIS B C     1 
ATOM   7281  O O     . HIS B 1 313 ? 69.281  118.285 68.056  1.00 21.03 ? 313  HIS B O     1 
ATOM   7282  C CB    . HIS B 1 313 ? 67.496  119.375 70.791  1.00 20.28 ? 313  HIS B CB    1 
ATOM   7283  C CG    . HIS B 1 313 ? 66.218  119.058 71.518  1.00 19.36 ? 313  HIS B CG    1 
ATOM   7284  N ND1   . HIS B 1 313 ? 66.116  118.067 72.477  1.00 20.91 ? 313  HIS B ND1   1 
ATOM   7285  C CD2   . HIS B 1 313 ? 64.995  119.641 71.452  1.00 17.80 ? 313  HIS B CD2   1 
ATOM   7286  C CE1   . HIS B 1 313 ? 64.881  118.036 72.949  1.00 18.65 ? 313  HIS B CE1   1 
ATOM   7287  N NE2   . HIS B 1 313 ? 64.179  118.980 72.340  1.00 17.65 ? 313  HIS B NE2   1 
ATOM   7288  N N     . SER B 1 314 ? 70.303  119.376 69.749  1.00 20.69 ? 314  SER B N     1 
ATOM   7289  C CA    . SER B 1 314 ? 71.247  120.112 68.913  1.00 21.24 ? 314  SER B CA    1 
ATOM   7290  C C     . SER B 1 314 ? 72.382  119.263 68.354  1.00 22.06 ? 314  SER B C     1 
ATOM   7291  O O     . SER B 1 314 ? 72.811  119.503 67.231  1.00 22.21 ? 314  SER B O     1 
ATOM   7292  C CB    . SER B 1 314 ? 71.854  121.286 69.695  1.00 20.93 ? 314  SER B CB    1 
ATOM   7293  O OG    . SER B 1 314 ? 70.934  122.336 69.857  1.00 21.74 ? 314  SER B OG    1 
ATOM   7294  N N     . TYR B 1 315 ? 72.875  118.295 69.133  1.00 21.74 ? 315  TYR B N     1 
ATOM   7295  C CA    . TYR B 1 315 ? 74.096  117.588 68.771  1.00 23.04 ? 315  TYR B CA    1 
ATOM   7296  C C     . TYR B 1 315 ? 73.978  116.062 68.593  1.00 24.03 ? 315  TYR B C     1 
ATOM   7297  O O     . TYR B 1 315 ? 74.895  115.432 68.056  1.00 25.12 ? 315  TYR B O     1 
ATOM   7298  C CB    . TYR B 1 315 ? 75.280  118.044 69.651  1.00 22.29 ? 315  TYR B CB    1 
ATOM   7299  C CG    . TYR B 1 315 ? 75.483  119.540 69.481  1.00 22.58 ? 315  TYR B CG    1 
ATOM   7300  C CD1   . TYR B 1 315 ? 75.043  120.441 70.454  1.00 22.04 ? 315  TYR B CD1   1 
ATOM   7301  C CD2   . TYR B 1 315 ? 76.041  120.065 68.299  1.00 22.92 ? 315  TYR B CD2   1 
ATOM   7302  C CE1   . TYR B 1 315 ? 75.188  121.831 70.280  1.00 20.61 ? 315  TYR B CE1   1 
ATOM   7303  C CE2   . TYR B 1 315 ? 76.174  121.468 68.106  1.00 20.86 ? 315  TYR B CE2   1 
ATOM   7304  C CZ    . TYR B 1 315 ? 75.739  122.327 69.107  1.00 21.40 ? 315  TYR B CZ    1 
ATOM   7305  O OH    . TYR B 1 315 ? 75.888  123.679 68.971  1.00 21.65 ? 315  TYR B OH    1 
ATOM   7306  N N     . LEU B 1 316 ? 72.843  115.486 68.984  1.00 24.52 ? 316  LEU B N     1 
ATOM   7307  C CA    . LEU B 1 316 ? 72.522  114.105 68.607  1.00 24.30 ? 316  LEU B CA    1 
ATOM   7308  C C     . LEU B 1 316 ? 71.819  114.117 67.251  1.00 23.77 ? 316  LEU B C     1 
ATOM   7309  O O     . LEU B 1 316 ? 72.102  113.304 66.380  1.00 23.84 ? 316  LEU B O     1 
ATOM   7310  C CB    . LEU B 1 316 ? 71.598  113.455 69.642  1.00 24.59 ? 316  LEU B CB    1 
ATOM   7311  C CG    . LEU B 1 316 ? 71.401  111.933 69.846  1.00 26.56 ? 316  LEU B CG    1 
ATOM   7312  C CD1   . LEU B 1 316 ? 70.013  111.712 70.536  1.00 28.37 ? 316  LEU B CD1   1 
ATOM   7313  C CD2   . LEU B 1 316 ? 71.459  111.120 68.586  1.00 27.49 ? 316  LEU B CD2   1 
ATOM   7314  N N     . LEU B 1 317 ? 70.893  115.044 67.076  1.00 23.16 ? 317  LEU B N     1 
ATOM   7315  C CA    . LEU B 1 317 ? 70.023  114.999 65.909  1.00 23.29 ? 317  LEU B CA    1 
ATOM   7316  C C     . LEU B 1 317 ? 70.211  116.177 64.955  1.00 22.53 ? 317  LEU B C     1 
ATOM   7317  O O     . LEU B 1 317 ? 70.626  115.988 63.827  1.00 22.29 ? 317  LEU B O     1 
ATOM   7318  C CB    . LEU B 1 317 ? 68.546  114.877 66.334  1.00 23.39 ? 317  LEU B CB    1 
ATOM   7319  C CG    . LEU B 1 317 ? 68.112  113.631 67.114  1.00 25.90 ? 317  LEU B CG    1 
ATOM   7320  C CD1   . LEU B 1 317 ? 66.573  113.639 67.322  1.00 27.77 ? 317  LEU B CD1   1 
ATOM   7321  C CD2   . LEU B 1 317 ? 68.567  112.321 66.431  1.00 25.74 ? 317  LEU B CD2   1 
ATOM   7322  N N     . TYR B 1 318 ? 69.896  117.390 65.396  1.00 21.91 ? 318  TYR B N     1 
ATOM   7323  C CA    . TYR B 1 318 ? 69.689  118.479 64.406  1.00 22.29 ? 318  TYR B CA    1 
ATOM   7324  C C     . TYR B 1 318 ? 70.950  118.968 63.680  1.00 22.31 ? 318  TYR B C     1 
ATOM   7325  O O     . TYR B 1 318 ? 70.979  119.017 62.441  1.00 21.89 ? 318  TYR B O     1 
ATOM   7326  C CB    . TYR B 1 318 ? 68.861  119.621 65.004  1.00 21.76 ? 318  TYR B CB    1 
ATOM   7327  C CG    . TYR B 1 318 ? 67.415  119.213 65.297  1.00 22.47 ? 318  TYR B CG    1 
ATOM   7328  C CD1   . TYR B 1 318 ? 66.744  118.292 64.469  1.00 22.85 ? 318  TYR B CD1   1 
ATOM   7329  C CD2   . TYR B 1 318 ? 66.710  119.756 66.382  1.00 22.15 ? 318  TYR B CD2   1 
ATOM   7330  C CE1   . TYR B 1 318 ? 65.404  117.922 64.718  1.00 21.55 ? 318  TYR B CE1   1 
ATOM   7331  C CE2   . TYR B 1 318 ? 65.365  119.402 66.621  1.00 22.02 ? 318  TYR B CE2   1 
ATOM   7332  C CZ    . TYR B 1 318 ? 64.733  118.487 65.776  1.00 21.66 ? 318  TYR B CZ    1 
ATOM   7333  O OH    . TYR B 1 318 ? 63.432  118.121 65.989  1.00 23.33 ? 318  TYR B OH    1 
ATOM   7334  N N     . GLY B 1 319 ? 71.980  119.322 64.447  1.00 21.82 ? 319  GLY B N     1 
ATOM   7335  C CA    . GLY B 1 319 ? 73.273  119.718 63.883  1.00 21.92 ? 319  GLY B CA    1 
ATOM   7336  C C     . GLY B 1 319 ? 73.840  118.656 62.957  1.00 22.33 ? 319  GLY B C     1 
ATOM   7337  O O     . GLY B 1 319 ? 74.125  118.937 61.798  1.00 21.87 ? 319  GLY B O     1 
ATOM   7338  N N     . PRO B 1 320 ? 74.036  117.421 63.474  1.00 22.50 ? 320  PRO B N     1 
ATOM   7339  C CA    . PRO B 1 320 ? 74.556  116.311 62.651  1.00 22.71 ? 320  PRO B CA    1 
ATOM   7340  C C     . PRO B 1 320 ? 73.737  115.983 61.390  1.00 23.02 ? 320  PRO B C     1 
ATOM   7341  O O     . PRO B 1 320 ? 74.322  115.815 60.319  1.00 24.05 ? 320  PRO B O     1 
ATOM   7342  C CB    . PRO B 1 320 ? 74.572  115.124 63.626  1.00 22.47 ? 320  PRO B CB    1 
ATOM   7343  C CG    . PRO B 1 320 ? 74.624  115.751 64.985  1.00 22.63 ? 320  PRO B CG    1 
ATOM   7344  C CD    . PRO B 1 320 ? 73.857  117.030 64.885  1.00 22.38 ? 320  PRO B CD    1 
ATOM   7345  N N     . LEU B 1 321 ? 72.413  115.859 61.502  1.00 23.24 ? 321  LEU B N     1 
ATOM   7346  C CA    . LEU B 1 321 ? 71.596  115.518 60.325  1.00 23.14 ? 321  LEU B CA    1 
ATOM   7347  C C     . LEU B 1 321 ? 71.593  116.638 59.303  1.00 23.20 ? 321  LEU B C     1 
ATOM   7348  O O     . LEU B 1 321 ? 71.733  116.384 58.113  1.00 23.43 ? 321  LEU B O     1 
ATOM   7349  C CB    . LEU B 1 321 ? 70.186  115.082 60.705  1.00 22.46 ? 321  LEU B CB    1 
ATOM   7350  C CG    . LEU B 1 321 ? 70.026  113.754 61.455  1.00 23.23 ? 321  LEU B CG    1 
ATOM   7351  C CD1   . LEU B 1 321 ? 68.561  113.474 61.831  1.00 20.95 ? 321  LEU B CD1   1 
ATOM   7352  C CD2   . LEU B 1 321 ? 70.585  112.585 60.655  1.00 24.41 ? 321  LEU B CD2   1 
ATOM   7353  N N     . ALA B 1 322 ? 71.492  117.885 59.762  1.00 23.58 ? 322  ALA B N     1 
ATOM   7354  C CA    . ALA B 1 322 ? 71.583  119.030 58.845  1.00 24.28 ? 322  ALA B CA    1 
ATOM   7355  C C     . ALA B 1 322 ? 72.885  119.017 58.035  1.00 24.70 ? 322  ALA B C     1 
ATOM   7356  O O     . ALA B 1 322 ? 72.887  119.420 56.868  1.00 24.70 ? 322  ALA B O     1 
ATOM   7357  C CB    . ALA B 1 322 ? 71.415  120.363 59.588  1.00 24.21 ? 322  ALA B CB    1 
ATOM   7358  N N     . CYS B 1 323 ? 73.982  118.555 58.650  1.00 24.40 ? 323  CYS B N     1 
ATOM   7359  C CA    . CYS B 1 323 ? 75.271  118.420 57.949  1.00 24.04 ? 323  CYS B CA    1 
ATOM   7360  C C     . CYS B 1 323 ? 75.443  117.098 57.190  1.00 23.99 ? 323  CYS B C     1 
ATOM   7361  O O     . CYS B 1 323 ? 76.487  116.876 56.612  1.00 23.18 ? 323  CYS B O     1 
ATOM   7362  C CB    . CYS B 1 323 ? 76.441  118.593 58.914  1.00 23.84 ? 323  CYS B CB    1 
ATOM   7363  S SG    . CYS B 1 323 ? 76.598  120.244 59.576  1.00 24.43 ? 323  CYS B SG    1 
ATOM   7364  N N     . GLY B 1 324 ? 74.443  116.214 57.218  1.00 24.46 ? 324  GLY B N     1 
ATOM   7365  C CA    . GLY B 1 324 ? 74.526  114.943 56.484  1.00 24.63 ? 324  GLY B CA    1 
ATOM   7366  C C     . GLY B 1 324 ? 75.394  113.888 57.148  1.00 25.69 ? 324  GLY B C     1 
ATOM   7367  O O     . GLY B 1 324 ? 75.870  112.954 56.487  1.00 25.91 ? 324  GLY B O     1 
ATOM   7368  N N     . ALA B 1 325 ? 75.591  114.024 58.464  1.00 25.66 ? 325  ALA B N     1 
ATOM   7369  C CA    . ALA B 1 325 ? 76.436  113.114 59.229  1.00 24.94 ? 325  ALA B CA    1 
ATOM   7370  C C     . ALA B 1 325 ? 75.770  111.759 59.545  1.00 24.63 ? 325  ALA B C     1 
ATOM   7371  O O     . ALA B 1 325 ? 74.554  111.599 59.470  1.00 24.40 ? 325  ALA B O     1 
ATOM   7372  C CB    . ALA B 1 325 ? 76.904  113.793 60.534  1.00 25.21 ? 325  ALA B CB    1 
ATOM   7373  N N     . THR B 1 326 ? 76.599  110.779 59.877  1.00 23.57 ? 326  THR B N     1 
ATOM   7374  C CA    . THR B 1 326 ? 76.124  109.555 60.486  1.00 23.04 ? 326  THR B CA    1 
ATOM   7375  C C     . THR B 1 326 ? 76.246  109.809 61.971  1.00 21.98 ? 326  THR B C     1 
ATOM   7376  O O     . THR B 1 326 ? 77.342  110.058 62.485  1.00 21.51 ? 326  THR B O     1 
ATOM   7377  C CB    . THR B 1 326 ? 76.969  108.361 60.052  1.00 22.79 ? 326  THR B CB    1 
ATOM   7378  O OG1   . THR B 1 326 ? 76.745  108.131 58.662  1.00 23.35 ? 326  THR B OG1   1 
ATOM   7379  C CG2   . THR B 1 326 ? 76.581  107.124 60.825  1.00 23.93 ? 326  THR B CG2   1 
ATOM   7380  N N     . THR B 1 327 ? 75.099  109.792 62.638  1.00 21.82 ? 327  THR B N     1 
ATOM   7381  C CA    . THR B 1 327 ? 75.008  110.065 64.068  1.00 21.35 ? 327  THR B CA    1 
ATOM   7382  C C     . THR B 1 327 ? 74.547  108.789 64.794  1.00 21.80 ? 327  THR B C     1 
ATOM   7383  O O     . THR B 1 327 ? 73.692  108.042 64.278  1.00 21.71 ? 327  THR B O     1 
ATOM   7384  C CB    . THR B 1 327 ? 74.118  111.335 64.352  1.00 21.30 ? 327  THR B CB    1 
ATOM   7385  O OG1   . THR B 1 327 ? 74.209  111.711 65.729  1.00 21.37 ? 327  THR B OG1   1 
ATOM   7386  C CG2   . THR B 1 327 ? 72.630  111.148 63.941  1.00 20.63 ? 327  THR B CG2   1 
ATOM   7387  N N     . LEU B 1 328 ? 75.146  108.520 65.963  1.00 21.60 ? 328  LEU B N     1 
ATOM   7388  C CA    . LEU B 1 328 ? 74.825  107.304 66.728  1.00 21.68 ? 328  LEU B CA    1 
ATOM   7389  C C     . LEU B 1 328 ? 73.906  107.607 67.915  1.00 22.04 ? 328  LEU B C     1 
ATOM   7390  O O     . LEU B 1 328 ? 74.189  108.501 68.746  1.00 21.68 ? 328  LEU B O     1 
ATOM   7391  C CB    . LEU B 1 328 ? 76.108  106.623 67.232  1.00 21.30 ? 328  LEU B CB    1 
ATOM   7392  C CG    . LEU B 1 328 ? 76.137  105.148 67.625  1.00 21.12 ? 328  LEU B CG    1 
ATOM   7393  C CD1   . LEU B 1 328 ? 77.563  104.569 67.401  1.00 19.98 ? 328  LEU B CD1   1 
ATOM   7394  C CD2   . LEU B 1 328 ? 75.704  104.907 69.057  1.00 20.59 ? 328  LEU B CD2   1 
ATOM   7395  N N     . MET B 1 329 ? 72.823  106.843 67.984  1.00 22.14 ? 329  MET B N     1 
ATOM   7396  C CA    . MET B 1 329 ? 71.888  106.907 69.085  1.00 23.59 ? 329  MET B CA    1 
ATOM   7397  C C     . MET B 1 329 ? 71.992  105.619 69.854  1.00 22.77 ? 329  MET B C     1 
ATOM   7398  O O     . MET B 1 329 ? 71.592  104.560 69.358  1.00 22.09 ? 329  MET B O     1 
ATOM   7399  C CB    . MET B 1 329 ? 70.440  107.114 68.601  1.00 23.01 ? 329  MET B CB    1 
ATOM   7400  C CG    . MET B 1 329 ? 69.448  107.046 69.744  1.00 24.44 ? 329  MET B CG    1 
ATOM   7401  S SD    . MET B 1 329 ? 67.742  107.099 69.200  1.00 27.16 ? 329  MET B SD    1 
ATOM   7402  C CE    . MET B 1 329 ? 67.488  108.864 69.002  1.00 27.93 ? 329  MET B CE    1 
ATOM   7403  N N     . PHE B 1 330 ? 72.543  105.725 71.063  1.00 22.57 ? 330  PHE B N     1 
ATOM   7404  C CA    . PHE B 1 330 ? 72.753  104.587 71.932  1.00 22.07 ? 330  PHE B CA    1 
ATOM   7405  C C     . PHE B 1 330 ? 71.611  104.577 72.934  1.00 22.60 ? 330  PHE B C     1 
ATOM   7406  O O     . PHE B 1 330 ? 71.311  105.610 73.579  1.00 21.98 ? 330  PHE B O     1 
ATOM   7407  C CB    . PHE B 1 330 ? 74.123  104.703 72.632  1.00 21.96 ? 330  PHE B CB    1 
ATOM   7408  C CG    . PHE B 1 330 ? 74.381  103.654 73.678  1.00 21.43 ? 330  PHE B CG    1 
ATOM   7409  C CD1   . PHE B 1 330 ? 74.186  102.291 73.405  1.00 19.75 ? 330  PHE B CD1   1 
ATOM   7410  C CD2   . PHE B 1 330 ? 74.838  104.024 74.942  1.00 20.09 ? 330  PHE B CD2   1 
ATOM   7411  C CE1   . PHE B 1 330 ? 74.445  101.305 74.383  1.00 17.44 ? 330  PHE B CE1   1 
ATOM   7412  C CE2   . PHE B 1 330 ? 75.090  103.052 75.916  1.00 19.20 ? 330  PHE B CE2   1 
ATOM   7413  C CZ    . PHE B 1 330 ? 74.889  101.695 75.637  1.00 18.98 ? 330  PHE B CZ    1 
ATOM   7414  N N     . GLU B 1 331 ? 70.992  103.401 73.078  1.00 23.07 ? 331  GLU B N     1 
ATOM   7415  C CA    . GLU B 1 331 ? 69.789  103.225 73.925  1.00 23.20 ? 331  GLU B CA    1 
ATOM   7416  C C     . GLU B 1 331 ? 70.108  103.176 75.425  1.00 23.38 ? 331  GLU B C     1 
ATOM   7417  O O     . GLU B 1 331 ? 69.261  103.514 76.271  1.00 23.37 ? 331  GLU B O     1 
ATOM   7418  C CB    . GLU B 1 331 ? 69.026  101.965 73.497  1.00 22.66 ? 331  GLU B CB    1 
ATOM   7419  C CG    . GLU B 1 331 ? 67.657  101.797 74.173  1.00 23.59 ? 331  GLU B CG    1 
ATOM   7420  C CD    . GLU B 1 331 ? 66.921  100.513 73.791  1.00 23.25 ? 331  GLU B CD    1 
ATOM   7421  O OE1   . GLU B 1 331 ? 67.583  99.465  73.691  1.00 23.51 ? 331  GLU B OE1   1 
ATOM   7422  O OE2   . GLU B 1 331 ? 65.677  100.549 73.622  1.00 22.22 ? 331  GLU B OE2   1 
ATOM   7423  N N     . GLY B 1 332 ? 71.326  102.756 75.757  1.00 23.81 ? 332  GLY B N     1 
ATOM   7424  C CA    . GLY B 1 332 ? 71.634  102.381 77.137  1.00 24.20 ? 332  GLY B CA    1 
ATOM   7425  C C     . GLY B 1 332 ? 72.475  103.371 77.892  1.00 24.92 ? 332  GLY B C     1 
ATOM   7426  O O     . GLY B 1 332 ? 72.325  104.587 77.734  1.00 24.84 ? 332  GLY B O     1 
ATOM   7427  N N     . VAL B 1 333 ? 73.354  102.831 78.738  1.00 25.71 ? 333  VAL B N     1 
ATOM   7428  C CA    . VAL B 1 333 ? 74.294  103.617 79.560  1.00 25.77 ? 333  VAL B CA    1 
ATOM   7429  C C     . VAL B 1 333 ? 75.730  103.130 79.301  1.00 25.72 ? 333  VAL B C     1 
ATOM   7430  O O     . VAL B 1 333 ? 75.939  101.935 79.056  1.00 26.19 ? 333  VAL B O     1 
ATOM   7431  C CB    . VAL B 1 333 ? 73.972  103.550 81.120  1.00 25.97 ? 333  VAL B CB    1 
ATOM   7432  C CG1   . VAL B 1 333 ? 72.626  104.135 81.418  1.00 25.68 ? 333  VAL B CG1   1 
ATOM   7433  C CG2   . VAL B 1 333 ? 74.053  102.161 81.670  1.00 25.14 ? 333  VAL B CG2   1 
ATOM   7434  N N     . PRO B 1 334 ? 76.721  104.039 79.374  1.00 25.38 ? 334  PRO B N     1 
ATOM   7435  C CA    . PRO B 1 334 ? 78.107  103.725 78.958  1.00 25.22 ? 334  PRO B CA    1 
ATOM   7436  C C     . PRO B 1 334 ? 78.830  102.636 79.749  1.00 25.12 ? 334  PRO B C     1 
ATOM   7437  O O     . PRO B 1 334 ? 79.879  102.192 79.329  1.00 25.07 ? 334  PRO B O     1 
ATOM   7438  C CB    . PRO B 1 334 ? 78.850  105.061 79.152  1.00 25.06 ? 334  PRO B CB    1 
ATOM   7439  C CG    . PRO B 1 334 ? 78.039  105.821 80.134  1.00 25.88 ? 334  PRO B CG    1 
ATOM   7440  C CD    . PRO B 1 334 ? 76.595  105.430 79.858  1.00 24.93 ? 334  PRO B CD    1 
ATOM   7441  N N     . ASN B 1 335 ? 78.284  102.235 80.892  1.00 25.34 ? 335  ASN B N     1 
ATOM   7442  C CA    . ASN B 1 335 ? 78.928  101.248 81.760  1.00 25.32 ? 335  ASN B CA    1 
ATOM   7443  C C     . ASN B 1 335 ? 78.042  100.015 82.055  1.00 24.93 ? 335  ASN B C     1 
ATOM   7444  O O     . ASN B 1 335 ? 78.173  99.391  83.101  1.00 24.35 ? 335  ASN B O     1 
ATOM   7445  C CB    . ASN B 1 335 ? 79.425  101.907 83.062  1.00 25.10 ? 335  ASN B CB    1 
ATOM   7446  C CG    . ASN B 1 335 ? 78.309  102.620 83.837  1.00 26.41 ? 335  ASN B CG    1 
ATOM   7447  O OD1   . ASN B 1 335 ? 78.560  103.263 84.856  1.00 30.22 ? 335  ASN B OD1   1 
ATOM   7448  N ND2   . ASN B 1 335 ? 77.090  102.530 83.347  1.00 24.50 ? 335  ASN B ND2   1 
ATOM   7449  N N     . TRP B 1 336 ? 77.160  99.668  81.122  1.00 24.39 ? 336  TRP B N     1 
ATOM   7450  C CA    . TRP B 1 336 ? 76.357  98.456  81.261  1.00 25.63 ? 336  TRP B CA    1 
ATOM   7451  C C     . TRP B 1 336 ? 76.305  97.742  79.939  1.00 25.57 ? 336  TRP B C     1 
ATOM   7452  O O     . TRP B 1 336 ? 75.944  98.357  78.945  1.00 25.92 ? 336  TRP B O     1 
ATOM   7453  C CB    . TRP B 1 336 ? 74.924  98.768  81.739  1.00 25.74 ? 336  TRP B CB    1 
ATOM   7454  C CG    . TRP B 1 336 ? 74.177  97.512  82.138  1.00 26.87 ? 336  TRP B CG    1 
ATOM   7455  C CD1   . TRP B 1 336 ? 74.031  97.012  83.404  1.00 27.02 ? 336  TRP B CD1   1 
ATOM   7456  C CD2   . TRP B 1 336 ? 73.513  96.582  81.262  1.00 26.00 ? 336  TRP B CD2   1 
ATOM   7457  N NE1   . TRP B 1 336 ? 73.305  95.840  83.369  1.00 27.50 ? 336  TRP B NE1   1 
ATOM   7458  C CE2   . TRP B 1 336 ? 72.978  95.556  82.068  1.00 26.67 ? 336  TRP B CE2   1 
ATOM   7459  C CE3   . TRP B 1 336 ? 73.314  96.524  79.879  1.00 27.01 ? 336  TRP B CE3   1 
ATOM   7460  C CZ2   . TRP B 1 336 ? 72.260  94.472  81.535  1.00 27.25 ? 336  TRP B CZ2   1 
ATOM   7461  C CZ3   . TRP B 1 336 ? 72.583  95.444  79.346  1.00 27.97 ? 336  TRP B CZ3   1 
ATOM   7462  C CH2   . TRP B 1 336 ? 72.068  94.436  80.185  1.00 27.04 ? 336  TRP B CH2   1 
ATOM   7463  N N     . PRO B 1 337 ? 76.576  96.421  79.926  1.00 26.31 ? 337  PRO B N     1 
ATOM   7464  C CA    . PRO B 1 337 ? 76.755  95.478  81.059  1.00 26.59 ? 337  PRO B CA    1 
ATOM   7465  C C     . PRO B 1 337 ? 78.003  95.672  81.938  1.00 26.38 ? 337  PRO B C     1 
ATOM   7466  O O     . PRO B 1 337 ? 77.962  95.346  83.136  1.00 26.32 ? 337  PRO B O     1 
ATOM   7467  C CB    . PRO B 1 337 ? 76.781  94.098  80.376  1.00 26.86 ? 337  PRO B CB    1 
ATOM   7468  C CG    . PRO B 1 337 ? 76.236  94.327  78.995  1.00 26.42 ? 337  PRO B CG    1 
ATOM   7469  C CD    . PRO B 1 337 ? 76.683  95.717  78.640  1.00 26.26 ? 337  PRO B CD    1 
ATOM   7470  N N     . THR B 1 338 ? 79.077  96.218  81.355  1.00 25.92 ? 338  THR B N     1 
ATOM   7471  C CA    . THR B 1 338 ? 80.365  96.378  82.048  1.00 24.71 ? 338  THR B CA    1 
ATOM   7472  C C     . THR B 1 338 ? 80.927  97.783  81.762  1.00 25.04 ? 338  THR B C     1 
ATOM   7473  O O     . THR B 1 338 ? 80.466  98.451  80.827  1.00 24.27 ? 338  THR B O     1 
ATOM   7474  C CB    . THR B 1 338 ? 81.385  95.312  81.595  1.00 24.58 ? 338  THR B CB    1 
ATOM   7475  O OG1   . THR B 1 338 ? 81.861  95.658  80.300  1.00 24.85 ? 338  THR B OG1   1 
ATOM   7476  C CG2   . THR B 1 338 ? 80.747  93.885  81.537  1.00 23.36 ? 338  THR B CG2   1 
ATOM   7477  N N     . PRO B 1 339 ? 81.893  98.256  82.595  1.00 24.54 ? 339  PRO B N     1 
ATOM   7478  C CA    . PRO B 1 339 ? 82.541  99.547  82.365  1.00 24.06 ? 339  PRO B CA    1 
ATOM   7479  C C     . PRO B 1 339 ? 83.158  99.749  80.972  1.00 23.97 ? 339  PRO B C     1 
ATOM   7480  O O     . PRO B 1 339 ? 83.334  100.895 80.553  1.00 23.63 ? 339  PRO B O     1 
ATOM   7481  C CB    . PRO B 1 339 ? 83.617  99.600  83.465  1.00 24.60 ? 339  PRO B CB    1 
ATOM   7482  C CG    . PRO B 1 339 ? 83.027  98.782  84.570  1.00 24.69 ? 339  PRO B CG    1 
ATOM   7483  C CD    . PRO B 1 339 ? 82.368  97.627  83.850  1.00 24.47 ? 339  PRO B CD    1 
ATOM   7484  N N     . ALA B 1 340 ? 83.447  98.664  80.251  1.00 23.33 ? 340  ALA B N     1 
ATOM   7485  C CA    . ALA B 1 340 ? 84.001  98.781  78.898  1.00 22.96 ? 340  ALA B CA    1 
ATOM   7486  C C     . ALA B 1 340 ? 82.962  99.079  77.812  1.00 23.07 ? 340  ALA B C     1 
ATOM   7487  O O     . ALA B 1 340 ? 83.330  99.241  76.661  1.00 22.74 ? 340  ALA B O     1 
ATOM   7488  C CB    . ALA B 1 340 ? 84.825  97.532  78.529  1.00 22.82 ? 340  ALA B CB    1 
ATOM   7489  N N     . ARG B 1 341 ? 81.675  99.141  78.169  1.00 22.70 ? 341  ARG B N     1 
ATOM   7490  C CA    . ARG B 1 341 ? 80.622  99.267  77.167  1.00 23.02 ? 341  ARG B CA    1 
ATOM   7491  C C     . ARG B 1 341 ? 80.842  100.402 76.161  1.00 23.04 ? 341  ARG B C     1 
ATOM   7492  O O     . ARG B 1 341 ? 80.870  100.150 74.951  1.00 22.71 ? 341  ARG B O     1 
ATOM   7493  C CB    . ARG B 1 341 ? 79.221  99.383  77.809  1.00 23.13 ? 341  ARG B CB    1 
ATOM   7494  C CG    . ARG B 1 341 ? 78.103  99.433  76.770  1.00 21.48 ? 341  ARG B CG    1 
ATOM   7495  C CD    . ARG B 1 341 ? 78.066  98.116  76.013  1.00 19.74 ? 341  ARG B CD    1 
ATOM   7496  N NE    . ARG B 1 341 ? 77.213  98.088  74.824  1.00 17.81 ? 341  ARG B NE    1 
ATOM   7497  C CZ    . ARG B 1 341 ? 75.890  97.934  74.822  1.00 17.61 ? 341  ARG B CZ    1 
ATOM   7498  N NH1   . ARG B 1 341 ? 75.203  97.866  75.959  1.00 16.11 ? 341  ARG B NH1   1 
ATOM   7499  N NH2   . ARG B 1 341 ? 75.240  97.864  73.660  1.00 16.78 ? 341  ARG B NH2   1 
ATOM   7500  N N     . MET B 1 342 ? 80.997  101.643 76.651  1.00 23.59 ? 342  MET B N     1 
ATOM   7501  C CA    . MET B 1 342 ? 81.206  102.804 75.768  1.00 23.64 ? 342  MET B CA    1 
ATOM   7502  C C     . MET B 1 342 ? 82.308  102.587 74.743  1.00 23.91 ? 342  MET B C     1 
ATOM   7503  O O     . MET B 1 342 ? 82.128  102.908 73.567  1.00 24.76 ? 342  MET B O     1 
ATOM   7504  C CB    . MET B 1 342 ? 81.493  104.083 76.558  1.00 23.81 ? 342  MET B CB    1 
ATOM   7505  C CG    . MET B 1 342 ? 81.673  105.335 75.683  1.00 22.84 ? 342  MET B CG    1 
ATOM   7506  S SD    . MET B 1 342 ? 81.971  106.844 76.632  1.00 25.95 ? 342  MET B SD    1 
ATOM   7507  C CE    . MET B 1 342 ? 83.743  106.737 76.961  1.00 24.42 ? 342  MET B CE    1 
ATOM   7508  N N     . CYS B 1 343 ? 83.458  102.073 75.174  1.00 23.72 ? 343  CYS B N     1 
ATOM   7509  C CA    . CYS B 1 343 ? 84.561  101.855 74.226  1.00 24.02 ? 343  CYS B CA    1 
ATOM   7510  C C     . CYS B 1 343 ? 84.296  100.672 73.304  1.00 23.51 ? 343  CYS B C     1 
ATOM   7511  O O     . CYS B 1 343 ? 84.800  100.646 72.184  1.00 23.65 ? 343  CYS B O     1 
ATOM   7512  C CB    . CYS B 1 343 ? 85.920  101.720 74.937  1.00 23.96 ? 343  CYS B CB    1 
ATOM   7513  S SG    . CYS B 1 343 ? 86.495  103.294 75.613  1.00 22.94 ? 343  CYS B SG    1 
ATOM   7514  N N     . GLN B 1 344 ? 83.496  99.716  73.765  1.00 23.08 ? 344  GLN B N     1 
ATOM   7515  C CA    . GLN B 1 344 ? 83.060  98.602  72.913  1.00 23.73 ? 344  GLN B CA    1 
ATOM   7516  C C     . GLN B 1 344 ? 82.179  99.106  71.768  1.00 23.87 ? 344  GLN B C     1 
ATOM   7517  O O     . GLN B 1 344 ? 82.345  98.662  70.624  1.00 24.62 ? 344  GLN B O     1 
ATOM   7518  C CB    . GLN B 1 344 ? 82.348  97.503  73.715  1.00 23.35 ? 344  GLN B CB    1 
ATOM   7519  C CG    . GLN B 1 344 ? 83.295  96.662  74.571  1.00 23.89 ? 344  GLN B CG    1 
ATOM   7520  C CD    . GLN B 1 344 ? 82.586  95.774  75.601  1.00 24.33 ? 344  GLN B CD    1 
ATOM   7521  O OE1   . GLN B 1 344 ? 83.199  94.865  76.186  1.00 26.12 ? 344  GLN B OE1   1 
ATOM   7522  N NE2   . GLN B 1 344 ? 81.311  96.035  75.835  1.00 22.79 ? 344  GLN B NE2   1 
ATOM   7523  N N     . VAL B 1 345 ? 81.269  100.036 72.073  1.00 23.69 ? 345  VAL B N     1 
ATOM   7524  C CA    . VAL B 1 345 ? 80.455  100.707 71.035  1.00 23.68 ? 345  VAL B CA    1 
ATOM   7525  C C     . VAL B 1 345 ? 81.338  101.501 70.057  1.00 24.41 ? 345  VAL B C     1 
ATOM   7526  O O     . VAL B 1 345 ? 81.099  101.478 68.839  1.00 24.17 ? 345  VAL B O     1 
ATOM   7527  C CB    . VAL B 1 345 ? 79.380  101.659 71.643  1.00 23.24 ? 345  VAL B CB    1 
ATOM   7528  C CG1   . VAL B 1 345 ? 78.537  102.330 70.535  1.00 22.44 ? 345  VAL B CG1   1 
ATOM   7529  C CG2   . VAL B 1 345 ? 78.485  100.918 72.604  1.00 22.15 ? 345  VAL B CG2   1 
ATOM   7530  N N     . VAL B 1 346 ? 82.348  102.200 70.593  1.00 24.44 ? 346  VAL B N     1 
ATOM   7531  C CA    . VAL B 1 346 ? 83.291  102.948 69.765  1.00 24.35 ? 346  VAL B CA    1 
ATOM   7532  C C     . VAL B 1 346 ? 83.944  101.996 68.760  1.00 24.83 ? 346  VAL B C     1 
ATOM   7533  O O     . VAL B 1 346 ? 83.996  102.300 67.558  1.00 25.18 ? 346  VAL B O     1 
ATOM   7534  C CB    . VAL B 1 346 ? 84.358  103.696 70.607  1.00 24.15 ? 346  VAL B CB    1 
ATOM   7535  C CG1   . VAL B 1 346 ? 85.554  104.064 69.760  1.00 24.10 ? 346  VAL B CG1   1 
ATOM   7536  C CG2   . VAL B 1 346 ? 83.757  104.934 71.273  1.00 23.32 ? 346  VAL B CG2   1 
ATOM   7537  N N     . ASP B 1 347 ? 84.425  100.851 69.258  1.00 24.40 ? 347  ASP B N     1 
ATOM   7538  C CA    . ASP B 1 347 ? 84.996  99.795  68.420  1.00 24.20 ? 347  ASP B CA    1 
ATOM   7539  C C     . ASP B 1 347 ? 83.983  99.216  67.424  1.00 24.31 ? 347  ASP B C     1 
ATOM   7540  O O     . ASP B 1 347 ? 84.262  99.154  66.241  1.00 23.59 ? 347  ASP B O     1 
ATOM   7541  C CB    . ASP B 1 347 ? 85.570  98.662  69.284  1.00 23.97 ? 347  ASP B CB    1 
ATOM   7542  C CG    . ASP B 1 347 ? 86.917  99.003  69.905  1.00 23.74 ? 347  ASP B CG    1 
ATOM   7543  O OD1   . ASP B 1 347 ? 87.485  100.082 69.646  1.00 23.02 ? 347  ASP B OD1   1 
ATOM   7544  O OD2   . ASP B 1 347 ? 87.433  98.155  70.652  1.00 25.44 ? 347  ASP B OD2   1 
ATOM   7545  N N     . LYS B 1 348 ? 82.813  98.790  67.910  1.00 24.86 ? 348  LYS B N     1 
ATOM   7546  C CA    . LYS B 1 348 ? 81.817  98.120  67.060  1.00 25.21 ? 348  LYS B CA    1 
ATOM   7547  C C     . LYS B 1 348 ? 81.351  98.974  65.864  1.00 25.46 ? 348  LYS B C     1 
ATOM   7548  O O     . LYS B 1 348 ? 81.091  98.455  64.774  1.00 25.86 ? 348  LYS B O     1 
ATOM   7549  C CB    . LYS B 1 348 ? 80.624  97.675  67.908  1.00 25.65 ? 348  LYS B CB    1 
ATOM   7550  C CG    . LYS B 1 348 ? 79.518  96.963  67.112  1.00 27.10 ? 348  LYS B CG    1 
ATOM   7551  C CD    . LYS B 1 348 ? 78.393  96.548  68.030  1.00 27.13 ? 348  LYS B CD    1 
ATOM   7552  C CE    . LYS B 1 348 ? 77.145  96.171  67.247  1.00 26.53 ? 348  LYS B CE    1 
ATOM   7553  N NZ    . LYS B 1 348 ? 75.951  96.138  68.154  1.00 26.02 ? 348  LYS B NZ    1 
ATOM   7554  N N     . HIS B 1 349 ? 81.243  100.284 66.060  1.00 25.20 ? 349  HIS B N     1 
ATOM   7555  C CA    . HIS B 1 349 ? 80.741  101.135 64.991  1.00 25.09 ? 349  HIS B CA    1 
ATOM   7556  C C     . HIS B 1 349 ? 81.792  102.069 64.419  1.00 25.20 ? 349  HIS B C     1 
ATOM   7557  O O     . HIS B 1 349 ? 81.485  102.880 63.527  1.00 26.09 ? 349  HIS B O     1 
ATOM   7558  C CB    . HIS B 1 349 ? 79.490  101.893 65.436  1.00 24.51 ? 349  HIS B CB    1 
ATOM   7559  C CG    . HIS B 1 349 ? 78.341  100.992 65.778  1.00 23.60 ? 349  HIS B CG    1 
ATOM   7560  N ND1   . HIS B 1 349 ? 77.695  100.223 64.836  1.00 22.44 ? 349  HIS B ND1   1 
ATOM   7561  C CD2   . HIS B 1 349 ? 77.745  100.715 66.962  1.00 21.62 ? 349  HIS B CD2   1 
ATOM   7562  C CE1   . HIS B 1 349 ? 76.737  99.528  65.420  1.00 21.48 ? 349  HIS B CE1   1 
ATOM   7563  N NE2   . HIS B 1 349 ? 76.748  99.804  66.710  1.00 21.04 ? 349  HIS B NE2   1 
ATOM   7564  N N     . GLN B 1 350 ? 83.017  101.955 64.932  1.00 24.90 ? 350  GLN B N     1 
ATOM   7565  C CA    . GLN B 1 350 ? 84.178  102.710 64.416  1.00 25.29 ? 350  GLN B CA    1 
ATOM   7566  C C     . GLN B 1 350 ? 83.949  104.226 64.539  1.00 25.14 ? 350  GLN B C     1 
ATOM   7567  O O     . GLN B 1 350 ? 84.199  104.993 63.609  1.00 25.00 ? 350  GLN B O     1 
ATOM   7568  C CB    . GLN B 1 350 ? 84.527  102.295 62.971  1.00 25.19 ? 350  GLN B CB    1 
ATOM   7569  C CG    . GLN B 1 350 ? 84.967  100.828 62.835  1.00 25.49 ? 350  GLN B CG    1 
ATOM   7570  C CD    . GLN B 1 350 ? 86.314  100.526 63.497  1.00 26.83 ? 350  GLN B CD    1 
ATOM   7571  O OE1   . GLN B 1 350 ? 86.383  99.808  64.506  1.00 27.96 ? 350  GLN B OE1   1 
ATOM   7572  N NE2   . GLN B 1 350 ? 87.380  101.077 62.946  1.00 24.60 ? 350  GLN B NE2   1 
ATOM   7573  N N     . VAL B 1 351 ? 83.457  104.619 65.715  1.00 24.70 ? 351  VAL B N     1 
ATOM   7574  C CA    . VAL B 1 351 ? 83.198  105.999 66.065  1.00 24.39 ? 351  VAL B CA    1 
ATOM   7575  C C     . VAL B 1 351 ? 84.491  106.813 65.912  1.00 24.72 ? 351  VAL B C     1 
ATOM   7576  O O     . VAL B 1 351 ? 85.563  106.399 66.399  1.00 24.71 ? 351  VAL B O     1 
ATOM   7577  C CB    . VAL B 1 351 ? 82.618  106.092 67.500  1.00 24.44 ? 351  VAL B CB    1 
ATOM   7578  C CG1   . VAL B 1 351 ? 82.474  107.529 67.949  1.00 23.94 ? 351  VAL B CG1   1 
ATOM   7579  C CG2   . VAL B 1 351 ? 81.257  105.352 67.598  1.00 23.14 ? 351  VAL B CG2   1 
ATOM   7580  N N     . ASN B 1 352 ? 84.391  107.934 65.194  1.00 23.92 ? 352  ASN B N     1 
ATOM   7581  C CA    . ASN B 1 352 ? 85.513  108.857 65.021  1.00 24.55 ? 352  ASN B CA    1 
ATOM   7582  C C     . ASN B 1 352 ? 85.411  110.066 65.942  1.00 24.91 ? 352  ASN B C     1 
ATOM   7583  O O     . ASN B 1 352 ? 86.425  110.667 66.299  1.00 25.23 ? 352  ASN B O     1 
ATOM   7584  C CB    . ASN B 1 352 ? 85.612  109.341 63.573  1.00 24.20 ? 352  ASN B CB    1 
ATOM   7585  C CG    . ASN B 1 352 ? 85.689  108.198 62.580  1.00 24.59 ? 352  ASN B CG    1 
ATOM   7586  O OD1   . ASN B 1 352 ? 84.801  108.027 61.756  1.00 25.04 ? 352  ASN B OD1   1 
ATOM   7587  N ND2   . ASN B 1 352 ? 86.752  107.409 62.661  1.00 23.45 ? 352  ASN B ND2   1 
ATOM   7588  N N     . ILE B 1 353 ? 84.177  110.430 66.301  1.00 25.27 ? 353  ILE B N     1 
ATOM   7589  C CA    . ILE B 1 353 ? 83.933  111.578 67.154  1.00 25.06 ? 353  ILE B CA    1 
ATOM   7590  C C     . ILE B 1 353 ? 83.039  111.157 68.302  1.00 24.92 ? 353  ILE B C     1 
ATOM   7591  O O     . ILE B 1 353 ? 81.923  110.713 68.091  1.00 25.00 ? 353  ILE B O     1 
ATOM   7592  C CB    . ILE B 1 353 ? 83.352  112.811 66.378  1.00 24.96 ? 353  ILE B CB    1 
ATOM   7593  C CG1   . ILE B 1 353 ? 84.074  113.000 65.025  1.00 25.74 ? 353  ILE B CG1   1 
ATOM   7594  C CG2   . ILE B 1 353 ? 83.524  114.087 67.220  1.00 24.00 ? 353  ILE B CG2   1 
ATOM   7595  C CD1   . ILE B 1 353 ? 83.353  113.945 64.021  1.00 25.77 ? 353  ILE B CD1   1 
ATOM   7596  N N     . LEU B 1 354 ? 83.559  111.285 69.520  1.00 24.55 ? 354  LEU B N     1 
ATOM   7597  C CA    . LEU B 1 354 ? 82.802  110.956 70.711  1.00 24.74 ? 354  LEU B CA    1 
ATOM   7598  C C     . LEU B 1 354 ? 82.562  112.183 71.587  1.00 24.35 ? 354  LEU B C     1 
ATOM   7599  O O     . LEU B 1 354 ? 83.506  112.816 72.056  1.00 25.01 ? 354  LEU B O     1 
ATOM   7600  C CB    . LEU B 1 354 ? 83.517  109.870 71.523  1.00 24.29 ? 354  LEU B CB    1 
ATOM   7601  C CG    . LEU B 1 354 ? 82.892  109.543 72.880  1.00 24.40 ? 354  LEU B CG    1 
ATOM   7602  C CD1   . LEU B 1 354 ? 81.535  108.825 72.707  1.00 23.00 ? 354  LEU B CD1   1 
ATOM   7603  C CD2   . LEU B 1 354 ? 83.860  108.701 73.713  1.00 25.09 ? 354  LEU B CD2   1 
ATOM   7604  N N     . TYR B 1 355 ? 81.298  112.463 71.862  1.00 23.93 ? 355  TYR B N     1 
ATOM   7605  C CA    . TYR B 1 355 ? 80.920  113.640 72.616  1.00 24.05 ? 355  TYR B CA    1 
ATOM   7606  C C     . TYR B 1 355 ? 80.101  113.250 73.840  1.00 24.55 ? 355  TYR B C     1 
ATOM   7607  O O     . TYR B 1 355 ? 78.955  112.792 73.717  1.00 25.12 ? 355  TYR B O     1 
ATOM   7608  C CB    . TYR B 1 355 ? 80.149  114.581 71.697  1.00 24.11 ? 355  TYR B CB    1 
ATOM   7609  C CG    . TYR B 1 355 ? 79.679  115.893 72.300  1.00 24.35 ? 355  TYR B CG    1 
ATOM   7610  C CD1   . TYR B 1 355 ? 80.494  116.639 73.163  1.00 24.64 ? 355  TYR B CD1   1 
ATOM   7611  C CD2   . TYR B 1 355 ? 78.440  116.422 71.935  1.00 23.44 ? 355  TYR B CD2   1 
ATOM   7612  C CE1   . TYR B 1 355 ? 80.059  117.854 73.685  1.00 25.43 ? 355  TYR B CE1   1 
ATOM   7613  C CE2   . TYR B 1 355 ? 77.996  117.626 72.449  1.00 24.15 ? 355  TYR B CE2   1 
ATOM   7614  C CZ    . TYR B 1 355 ? 78.788  118.332 73.321  1.00 24.57 ? 355  TYR B CZ    1 
ATOM   7615  O OH    . TYR B 1 355 ? 78.325  119.530 73.782  1.00 24.34 ? 355  TYR B OH    1 
ATOM   7616  N N     . THR B 1 356 ? 80.678  113.434 75.027  1.00 24.27 ? 356  THR B N     1 
ATOM   7617  C CA    . THR B 1 356 ? 80.039  112.897 76.230  1.00 24.77 ? 356  THR B CA    1 
ATOM   7618  C C     . THR B 1 356 ? 80.078  113.848 77.437  1.00 25.01 ? 356  THR B C     1 
ATOM   7619  O O     . THR B 1 356 ? 80.342  115.019 77.279  1.00 25.47 ? 356  THR B O     1 
ATOM   7620  C CB    . THR B 1 356 ? 80.567  111.457 76.554  1.00 24.33 ? 356  THR B CB    1 
ATOM   7621  O OG1   . THR B 1 356 ? 79.634  110.788 77.414  1.00 24.38 ? 356  THR B OG1   1 
ATOM   7622  C CG2   . THR B 1 356 ? 81.974  111.490 77.194  1.00 23.30 ? 356  THR B CG2   1 
ATOM   7623  N N     . ALA B 1 357 ? 79.772  113.340 78.624  1.00 25.76 ? 357  ALA B N     1 
ATOM   7624  C CA    . ALA B 1 357 ? 79.640  114.165 79.822  1.00 25.31 ? 357  ALA B CA    1 
ATOM   7625  C C     . ALA B 1 357 ? 80.677  113.777 80.874  1.00 24.82 ? 357  ALA B C     1 
ATOM   7626  O O     . ALA B 1 357 ? 81.025  112.610 80.988  1.00 24.03 ? 357  ALA B O     1 
ATOM   7627  C CB    . ALA B 1 357 ? 78.230  114.003 80.405  1.00 25.60 ? 357  ALA B CB    1 
ATOM   7628  N N     . PRO B 1 358 ? 81.179  114.766 81.640  1.00 24.47 ? 358  PRO B N     1 
ATOM   7629  C CA    . PRO B 1 358 ? 82.067  114.505 82.758  1.00 24.06 ? 358  PRO B CA    1 
ATOM   7630  C C     . PRO B 1 358 ? 81.533  113.498 83.782  1.00 24.21 ? 358  PRO B C     1 
ATOM   7631  O O     . PRO B 1 358 ? 82.327  112.745 84.344  1.00 23.60 ? 358  PRO B O     1 
ATOM   7632  C CB    . PRO B 1 358 ? 82.255  115.892 83.373  1.00 23.41 ? 358  PRO B CB    1 
ATOM   7633  C CG    . PRO B 1 358 ? 82.168  116.788 82.185  1.00 24.47 ? 358  PRO B CG    1 
ATOM   7634  C CD    . PRO B 1 358 ? 81.013  116.218 81.429  1.00 24.52 ? 358  PRO B CD    1 
ATOM   7635  N N     . THR B 1 359 ? 80.217  113.465 84.023  1.00 24.16 ? 359  THR B N     1 
ATOM   7636  C CA    . THR B 1 359 ? 79.651  112.426 84.895  1.00 24.28 ? 359  THR B CA    1 
ATOM   7637  C C     . THR B 1 359 ? 79.969  111.015 84.353  1.00 23.66 ? 359  THR B C     1 
ATOM   7638  O O     . THR B 1 359 ? 80.493  110.178 85.078  1.00 23.80 ? 359  THR B O     1 
ATOM   7639  C CB    . THR B 1 359 ? 78.119  112.632 85.132  1.00 24.32 ? 359  THR B CB    1 
ATOM   7640  O OG1   . THR B 1 359 ? 77.936  113.787 85.952  1.00 26.17 ? 359  THR B OG1   1 
ATOM   7641  C CG2   . THR B 1 359 ? 77.487  111.416 85.853  1.00 23.97 ? 359  THR B CG2   1 
ATOM   7642  N N     . ALA B 1 360 ? 79.664  110.776 83.077  1.00 23.09 ? 360  ALA B N     1 
ATOM   7643  C CA    . ALA B 1 360 ? 79.997  109.509 82.411  1.00 22.63 ? 360  ALA B CA    1 
ATOM   7644  C C     . ALA B 1 360 ? 81.501  109.225 82.533  1.00 22.86 ? 360  ALA B C     1 
ATOM   7645  O O     . ALA B 1 360 ? 81.912  108.103 82.845  1.00 21.68 ? 360  ALA B O     1 
ATOM   7646  C CB    . ALA B 1 360 ? 79.579  109.554 80.939  1.00 21.86 ? 360  ALA B CB    1 
ATOM   7647  N N     . ILE B 1 361 ? 82.320  110.263 82.325  1.00 23.17 ? 361  ILE B N     1 
ATOM   7648  C CA    . ILE B 1 361 ? 83.783  110.094 82.324  1.00 22.93 ? 361  ILE B CA    1 
ATOM   7649  C C     . ILE B 1 361 ? 84.293  109.658 83.692  1.00 23.05 ? 361  ILE B C     1 
ATOM   7650  O O     . ILE B 1 361 ? 85.112  108.736 83.778  1.00 22.47 ? 361  ILE B O     1 
ATOM   7651  C CB    . ILE B 1 361 ? 84.515  111.356 81.776  1.00 22.94 ? 361  ILE B CB    1 
ATOM   7652  C CG1   . ILE B 1 361 ? 84.294  111.454 80.258  1.00 22.48 ? 361  ILE B CG1   1 
ATOM   7653  C CG2   . ILE B 1 361 ? 86.029  111.327 82.120  1.00 23.70 ? 361  ILE B CG2   1 
ATOM   7654  C CD1   . ILE B 1 361 ? 84.197  112.862 79.729  1.00 24.56 ? 361  ILE B CD1   1 
ATOM   7655  N N     . ARG B 1 362 ? 83.790  110.311 84.740  1.00 23.54 ? 362  ARG B N     1 
ATOM   7656  C CA    . ARG B 1 362 ? 84.149  110.016 86.137  1.00 24.60 ? 362  ARG B CA    1 
ATOM   7657  C C     . ARG B 1 362 ? 83.628  108.657 86.611  1.00 24.59 ? 362  ARG B C     1 
ATOM   7658  O O     . ARG B 1 362 ? 84.309  107.981 87.349  1.00 25.50 ? 362  ARG B O     1 
ATOM   7659  C CB    . ARG B 1 362 ? 83.671  111.134 87.078  1.00 24.61 ? 362  ARG B CB    1 
ATOM   7660  C CG    . ARG B 1 362 ? 84.388  112.501 86.856  1.00 25.41 ? 362  ARG B CG    1 
ATOM   7661  C CD    . ARG B 1 362 ? 83.966  113.557 87.898  1.00 25.20 ? 362  ARG B CD    1 
ATOM   7662  N NE    . ARG B 1 362 ? 82.553  113.914 87.775  1.00 28.27 ? 362  ARG B NE    1 
ATOM   7663  C CZ    . ARG B 1 362 ? 82.093  115.049 87.246  1.00 30.87 ? 362  ARG B CZ    1 
ATOM   7664  N NH1   . ARG B 1 362 ? 82.913  116.001 86.774  1.00 31.63 ? 362  ARG B NH1   1 
ATOM   7665  N NH2   . ARG B 1 362 ? 80.786  115.240 87.189  1.00 34.19 ? 362  ARG B NH2   1 
ATOM   7666  N N     . ALA B 1 363 ? 82.422  108.266 86.186  1.00 24.55 ? 363  ALA B N     1 
ATOM   7667  C CA    . ALA B 1 363 ? 81.885  106.920 86.461  1.00 24.21 ? 363  ALA B CA    1 
ATOM   7668  C C     . ALA B 1 363 ? 82.778  105.847 85.836  1.00 24.10 ? 363  ALA B C     1 
ATOM   7669  O O     . ALA B 1 363 ? 83.053  104.821 86.462  1.00 23.54 ? 363  ALA B O     1 
ATOM   7670  C CB    . ALA B 1 363 ? 80.442  106.777 85.942  1.00 23.72 ? 363  ALA B CB    1 
ATOM   7671  N N     . LEU B 1 364 ? 83.235  106.088 84.607  1.00 23.75 ? 364  LEU B N     1 
ATOM   7672  C CA    . LEU B 1 364 ? 84.158  105.155 83.968  1.00 24.79 ? 364  LEU B CA    1 
ATOM   7673  C C     . LEU B 1 364 ? 85.539  105.163 84.629  1.00 25.13 ? 364  LEU B C     1 
ATOM   7674  O O     . LEU B 1 364 ? 86.066  104.101 84.956  1.00 25.47 ? 364  LEU B O     1 
ATOM   7675  C CB    . LEU B 1 364 ? 84.252  105.385 82.453  1.00 24.29 ? 364  LEU B CB    1 
ATOM   7676  C CG    . LEU B 1 364 ? 82.963  105.133 81.648  1.00 25.15 ? 364  LEU B CG    1 
ATOM   7677  C CD1   . LEU B 1 364 ? 83.144  105.522 80.189  1.00 23.61 ? 364  LEU B CD1   1 
ATOM   7678  C CD2   . LEU B 1 364 ? 82.502  103.706 81.757  1.00 23.58 ? 364  LEU B CD2   1 
ATOM   7679  N N     . MET B 1 365 ? 86.094  106.357 84.832  1.00 25.77 ? 365  MET B N     1 
ATOM   7680  C CA    . MET B 1 365 ? 87.397  106.550 85.478  1.00 27.23 ? 365  MET B CA    1 
ATOM   7681  C C     . MET B 1 365 ? 87.490  105.868 86.847  1.00 27.41 ? 365  MET B C     1 
ATOM   7682  O O     . MET B 1 365 ? 88.537  105.294 87.209  1.00 27.75 ? 365  MET B O     1 
ATOM   7683  C CB    . MET B 1 365 ? 87.714  108.054 85.564  1.00 26.74 ? 365  MET B CB    1 
ATOM   7684  C CG    . MET B 1 365 ? 88.932  108.439 86.400  1.00 28.73 ? 365  MET B CG    1 
ATOM   7685  S SD    . MET B 1 365 ? 89.192  110.240 86.331  1.00 28.62 ? 365  MET B SD    1 
ATOM   7686  C CE    . MET B 1 365 ? 87.791  110.841 87.260  1.00 29.30 ? 365  MET B CE    1 
ATOM   7687  N N     . ALA B 1 366 ? 86.389  105.892 87.595  1.00 27.78 ? 366  ALA B N     1 
ATOM   7688  C CA    . ALA B 1 366 ? 86.314  105.171 88.875  1.00 28.27 ? 366  ALA B CA    1 
ATOM   7689  C C     . ALA B 1 366 ? 86.638  103.673 88.731  1.00 28.64 ? 366  ALA B C     1 
ATOM   7690  O O     . ALA B 1 366 ? 87.043  103.022 89.695  1.00 27.85 ? 366  ALA B O     1 
ATOM   7691  C CB    . ALA B 1 366 ? 84.948  105.355 89.492  1.00 28.34 ? 366  ALA B CB    1 
ATOM   7692  N N     . GLU B 1 367 ? 86.467  103.145 87.519  1.00 29.33 ? 367  GLU B N     1 
ATOM   7693  C CA    . GLU B 1 367 ? 86.736  101.730 87.230  1.00 29.80 ? 367  GLU B CA    1 
ATOM   7694  C C     . GLU B 1 367 ? 88.115  101.521 86.632  1.00 29.73 ? 367  GLU B C     1 
ATOM   7695  O O     . GLU B 1 367 ? 88.499  100.393 86.312  1.00 29.74 ? 367  GLU B O     1 
ATOM   7696  C CB    . GLU B 1 367 ? 85.675  101.158 86.280  1.00 29.79 ? 367  GLU B CB    1 
ATOM   7697  C CG    . GLU B 1 367 ? 84.268  101.228 86.817  1.00 30.48 ? 367  GLU B CG    1 
ATOM   7698  C CD    . GLU B 1 367 ? 84.105  100.561 88.181  1.00 33.64 ? 367  GLU B CD    1 
ATOM   7699  O OE1   . GLU B 1 367 ? 84.724  99.503  88.437  1.00 34.24 ? 367  GLU B OE1   1 
ATOM   7700  O OE2   . GLU B 1 367 ? 83.334  101.099 89.003  1.00 35.32 ? 367  GLU B OE2   1 
ATOM   7701  N N     . GLY B 1 368 ? 88.854  102.612 86.472  1.00 29.82 ? 368  GLY B N     1 
ATOM   7702  C CA    . GLY B 1 368 ? 90.212  102.539 85.953  1.00 29.46 ? 368  GLY B CA    1 
ATOM   7703  C C     . GLY B 1 368 ? 90.206  101.934 84.568  1.00 29.41 ? 368  GLY B C     1 
ATOM   7704  O O     . GLY B 1 368 ? 89.389  102.318 83.721  1.00 29.39 ? 368  GLY B O     1 
ATOM   7705  N N     . ASP B 1 369 ? 91.080  100.950 84.366  1.00 29.04 ? 369  ASP B N     1 
ATOM   7706  C CA    . ASP B 1 369 ? 91.365  100.392 83.040  1.00 29.27 ? 369  ASP B CA    1 
ATOM   7707  C C     . ASP B 1 369 ? 90.295  99.399  82.581  1.00 29.00 ? 369  ASP B C     1 
ATOM   7708  O O     . ASP B 1 369 ? 90.332  98.915  81.449  1.00 28.92 ? 369  ASP B O     1 
ATOM   7709  C CB    . ASP B 1 369 ? 92.773  99.745  82.998  1.00 29.37 ? 369  ASP B CB    1 
ATOM   7710  C CG    . ASP B 1 369 ? 93.912  100.777 82.839  1.00 30.15 ? 369  ASP B CG    1 
ATOM   7711  O OD1   . ASP B 1 369 ? 93.667  101.993 82.738  1.00 32.07 ? 369  ASP B OD1   1 
ATOM   7712  O OD2   . ASP B 1 369 ? 95.083  100.367 82.818  1.00 33.72 ? 369  ASP B OD2   1 
ATOM   7713  N N     . LYS B 1 370 ? 89.354  99.087  83.467  1.00 28.62 ? 370  LYS B N     1 
ATOM   7714  C CA    . LYS B 1 370 ? 88.209  98.269  83.093  1.00 28.94 ? 370  LYS B CA    1 
ATOM   7715  C C     . LYS B 1 370 ? 87.308  98.963  82.074  1.00 28.33 ? 370  LYS B C     1 
ATOM   7716  O O     . LYS B 1 370 ? 86.607  98.291  81.335  1.00 28.58 ? 370  LYS B O     1 
ATOM   7717  C CB    . LYS B 1 370 ? 87.416  97.852  84.325  1.00 29.34 ? 370  LYS B CB    1 
ATOM   7718  C CG    . LYS B 1 370 ? 88.123  96.778  85.129  1.00 31.29 ? 370  LYS B CG    1 
ATOM   7719  C CD    . LYS B 1 370 ? 87.880  96.933  86.611  1.00 35.33 ? 370  LYS B CD    1 
ATOM   7720  C CE    . LYS B 1 370 ? 86.432  96.703  86.982  1.00 37.87 ? 370  LYS B CE    1 
ATOM   7721  N NZ    . LYS B 1 370 ? 86.176  97.322  88.301  1.00 39.77 ? 370  LYS B NZ    1 
ATOM   7722  N N     . ALA B 1 371 ? 87.360  100.296 82.037  1.00 27.57 ? 371  ALA B N     1 
ATOM   7723  C CA    . ALA B 1 371 ? 86.685  101.119 81.027  1.00 27.94 ? 371  ALA B CA    1 
ATOM   7724  C C     . ALA B 1 371 ? 87.179  100.864 79.600  1.00 27.83 ? 371  ALA B C     1 
ATOM   7725  O O     . ALA B 1 371 ? 86.477  101.168 78.633  1.00 27.42 ? 371  ALA B O     1 
ATOM   7726  C CB    . ALA B 1 371 ? 86.833  102.614 81.363  1.00 27.38 ? 371  ALA B CB    1 
ATOM   7727  N N     . ILE B 1 372 ? 88.390  100.328 79.473  1.00 28.22 ? 372  ILE B N     1 
ATOM   7728  C CA    . ILE B 1 372 ? 89.053  100.225 78.164  1.00 28.83 ? 372  ILE B CA    1 
ATOM   7729  C C     . ILE B 1 372 ? 89.553  98.814  77.871  1.00 29.67 ? 372  ILE B C     1 
ATOM   7730  O O     . ILE B 1 372 ? 90.055  98.537  76.785  1.00 29.90 ? 372  ILE B O     1 
ATOM   7731  C CB    . ILE B 1 372 ? 90.220  101.258 78.016  1.00 28.46 ? 372  ILE B CB    1 
ATOM   7732  C CG1   . ILE B 1 372 ? 91.358  100.948 79.009  1.00 27.80 ? 372  ILE B CG1   1 
ATOM   7733  C CG2   . ILE B 1 372 ? 89.685  102.706 78.114  1.00 27.65 ? 372  ILE B CG2   1 
ATOM   7734  C CD1   . ILE B 1 372 ? 92.681  101.558 78.653  1.00 27.68 ? 372  ILE B CD1   1 
ATOM   7735  N N     . GLU B 1 373 ? 89.416  97.942  78.863  1.00 30.82 ? 373  GLU B N     1 
ATOM   7736  C CA    . GLU B 1 373 ? 89.840  96.543  78.792  1.00 32.36 ? 373  GLU B CA    1 
ATOM   7737  C C     . GLU B 1 373 ? 89.240  95.800  77.595  1.00 31.09 ? 373  GLU B C     1 
ATOM   7738  O O     . GLU B 1 373 ? 88.022  95.742  77.429  1.00 31.25 ? 373  GLU B O     1 
ATOM   7739  C CB    . GLU B 1 373 ? 89.462  95.826  80.104  1.00 32.64 ? 373  GLU B CB    1 
ATOM   7740  C CG    . GLU B 1 373 ? 90.157  94.487  80.345  1.00 35.06 ? 373  GLU B CG    1 
ATOM   7741  C CD    . GLU B 1 373 ? 89.774  93.895  81.684  1.00 36.08 ? 373  GLU B CD    1 
ATOM   7742  O OE1   . GLU B 1 373 ? 90.360  94.337  82.703  1.00 40.45 ? 373  GLU B OE1   1 
ATOM   7743  O OE2   . GLU B 1 373 ? 88.884  93.003  81.717  1.00 38.78 ? 373  GLU B OE2   1 
ATOM   7744  N N     . GLY B 1 374 ? 90.117  95.238  76.768  1.00 30.60 ? 374  GLY B N     1 
ATOM   7745  C CA    . GLY B 1 374 ? 89.716  94.439  75.614  1.00 29.02 ? 374  GLY B CA    1 
ATOM   7746  C C     . GLY B 1 374 ? 89.261  95.276  74.427  1.00 28.43 ? 374  GLY B C     1 
ATOM   7747  O O     . GLY B 1 374 ? 88.805  94.732  73.420  1.00 28.23 ? 374  GLY B O     1 
ATOM   7748  N N     . THR B 1 375 ? 89.393  96.597  74.529  1.00 27.29 ? 375  THR B N     1 
ATOM   7749  C CA    . THR B 1 375 ? 88.960  97.493  73.452  1.00 26.29 ? 375  THR B CA    1 
ATOM   7750  C C     . THR B 1 375 ? 90.131  98.158  72.740  1.00 26.21 ? 375  THR B C     1 
ATOM   7751  O O     . THR B 1 375 ? 91.241  98.257  73.267  1.00 26.38 ? 375  THR B O     1 
ATOM   7752  C CB    . THR B 1 375 ? 87.955  98.588  73.934  1.00 25.78 ? 375  THR B CB    1 
ATOM   7753  O OG1   . THR B 1 375 ? 88.641  99.574  74.717  1.00 24.65 ? 375  THR B OG1   1 
ATOM   7754  C CG2   . THR B 1 375 ? 86.842  97.985  74.753  1.00 25.59 ? 375  THR B CG2   1 
ATOM   7755  N N     . ASP B 1 376 ? 89.871  98.648  71.541  1.00 26.13 ? 376  ASP B N     1 
ATOM   7756  C CA    . ASP B 1 376 ? 90.946  99.151  70.693  1.00 26.72 ? 376  ASP B CA    1 
ATOM   7757  C C     . ASP B 1 376 ? 90.983  100.696 70.648  1.00 26.15 ? 376  ASP B C     1 
ATOM   7758  O O     . ASP B 1 376 ? 92.056  101.283 70.855  1.00 25.84 ? 376  ASP B O     1 
ATOM   7759  C CB    . ASP B 1 376 ? 90.835  98.492  69.313  1.00 27.10 ? 376  ASP B CB    1 
ATOM   7760  C CG    . ASP B 1 376 ? 91.847  98.999  68.334  1.00 29.95 ? 376  ASP B CG    1 
ATOM   7761  O OD1   . ASP B 1 376 ? 92.926  98.359  68.187  1.00 34.19 ? 376  ASP B OD1   1 
ATOM   7762  O OD2   . ASP B 1 376 ? 91.561  100.030 67.699  1.00 30.68 ? 376  ASP B OD2   1 
ATOM   7763  N N     . ARG B 1 377 ? 89.826  101.332 70.390  1.00 25.06 ? 377  ARG B N     1 
ATOM   7764  C CA    . ARG B 1 377 ? 89.685  102.807 70.390  1.00 24.96 ? 377  ARG B CA    1 
ATOM   7765  C C     . ARG B 1 377 ? 90.495  103.554 69.291  1.00 25.42 ? 377  ARG B C     1 
ATOM   7766  O O     . ARG B 1 377 ? 90.642  104.783 69.353  1.00 25.55 ? 377  ARG B O     1 
ATOM   7767  C CB    . ARG B 1 377 ? 89.998  103.405 71.784  1.00 24.65 ? 377  ARG B CB    1 
ATOM   7768  C CG    . ARG B 1 377 ? 89.078  102.939 72.922  1.00 24.04 ? 377  ARG B CG    1 
ATOM   7769  C CD    . ARG B 1 377 ? 89.820  102.825 74.270  1.00 22.71 ? 377  ARG B CD    1 
ATOM   7770  N NE    . ARG B 1 377 ? 90.750  101.684 74.287  1.00 21.57 ? 377  ARG B NE    1 
ATOM   7771  C CZ    . ARG B 1 377 ? 92.062  101.772 74.512  1.00 21.95 ? 377  ARG B CZ    1 
ATOM   7772  N NH1   . ARG B 1 377 ? 92.622  102.945 74.781  1.00 19.57 ? 377  ARG B NH1   1 
ATOM   7773  N NH2   . ARG B 1 377 ? 92.820  100.676 74.493  1.00 22.92 ? 377  ARG B NH2   1 
ATOM   7774  N N     . SER B 1 378 ? 91.004  102.832 68.291  1.00 25.62 ? 378  SER B N     1 
ATOM   7775  C CA    . SER B 1 378 ? 91.846  103.449 67.249  1.00 25.89 ? 378  SER B CA    1 
ATOM   7776  C C     . SER B 1 378 ? 91.077  104.285 66.219  1.00 26.15 ? 378  SER B C     1 
ATOM   7777  O O     . SER B 1 378 ? 91.678  105.087 65.495  1.00 26.22 ? 378  SER B O     1 
ATOM   7778  C CB    . SER B 1 378 ? 92.718  102.395 66.543  1.00 26.23 ? 378  SER B CB    1 
ATOM   7779  O OG    . SER B 1 378 ? 93.576  101.722 67.467  1.00 25.58 ? 378  SER B OG    1 
ATOM   7780  N N     . SER B 1 379 ? 89.755  104.112 66.157  1.00 26.40 ? 379  SER B N     1 
ATOM   7781  C CA    . SER B 1 379 ? 88.922  104.902 65.231  1.00 26.03 ? 379  SER B CA    1 
ATOM   7782  C C     . SER B 1 379 ? 88.708  106.361 65.656  1.00 25.81 ? 379  SER B C     1 
ATOM   7783  O O     . SER B 1 379 ? 88.375  107.198 64.822  1.00 26.17 ? 379  SER B O     1 
ATOM   7784  C CB    . SER B 1 379 ? 87.579  104.206 64.943  1.00 26.06 ? 379  SER B CB    1 
ATOM   7785  O OG    . SER B 1 379 ? 86.805  104.008 66.130  1.00 27.29 ? 379  SER B OG    1 
ATOM   7786  N N     . LEU B 1 380 ? 88.921  106.669 66.933  1.00 25.32 ? 380  LEU B N     1 
ATOM   7787  C CA    . LEU B 1 380 ? 88.687  108.021 67.454  1.00 25.33 ? 380  LEU B CA    1 
ATOM   7788  C C     . LEU B 1 380 ? 89.722  109.060 66.990  1.00 25.63 ? 380  LEU B C     1 
ATOM   7789  O O     . LEU B 1 380 ? 90.921  108.851 67.131  1.00 24.43 ? 380  LEU B O     1 
ATOM   7790  C CB    . LEU B 1 380 ? 88.653  108.000 68.981  1.00 24.75 ? 380  LEU B CB    1 
ATOM   7791  C CG    . LEU B 1 380 ? 87.462  107.325 69.656  1.00 25.13 ? 380  LEU B CG    1 
ATOM   7792  C CD1   . LEU B 1 380 ? 87.726  107.201 71.157  1.00 21.86 ? 380  LEU B CD1   1 
ATOM   7793  C CD2   . LEU B 1 380 ? 86.145  108.068 69.348  1.00 21.75 ? 380  LEU B CD2   1 
ATOM   7794  N N     . ARG B 1 381 ? 89.239  110.177 66.442  1.00 26.42 ? 381  ARG B N     1 
ATOM   7795  C CA    . ARG B 1 381 ? 90.098  111.325 66.137  1.00 27.07 ? 381  ARG B CA    1 
ATOM   7796  C C     . ARG B 1 381 ? 89.761  112.530 67.035  1.00 26.73 ? 381  ARG B C     1 
ATOM   7797  O O     . ARG B 1 381 ? 90.629  113.354 67.325  1.00 26.92 ? 381  ARG B O     1 
ATOM   7798  C CB    . ARG B 1 381 ? 89.999  111.741 64.661  1.00 27.59 ? 381  ARG B CB    1 
ATOM   7799  C CG    . ARG B 1 381 ? 90.148  110.625 63.623  1.00 31.34 ? 381  ARG B CG    1 
ATOM   7800  C CD    . ARG B 1 381 ? 89.456  111.041 62.313  1.00 36.03 ? 381  ARG B CD    1 
ATOM   7801  N NE    . ARG B 1 381 ? 89.233  109.935 61.370  1.00 38.34 ? 381  ARG B NE    1 
ATOM   7802  C CZ    . ARG B 1 381 ? 88.171  109.843 60.568  1.00 39.50 ? 381  ARG B CZ    1 
ATOM   7803  N NH1   . ARG B 1 381 ? 87.230  110.763 60.620  1.00 39.09 ? 381  ARG B NH1   1 
ATOM   7804  N NH2   . ARG B 1 381 ? 88.027  108.819 59.731  1.00 41.21 ? 381  ARG B NH2   1 
ATOM   7805  N N     . ILE B 1 382 ? 88.505  112.634 67.465  1.00 26.32 ? 382  ILE B N     1 
ATOM   7806  C CA    . ILE B 1 382 ? 88.040  113.806 68.223  1.00 25.84 ? 382  ILE B CA    1 
ATOM   7807  C C     . ILE B 1 382 ? 87.250  113.363 69.431  1.00 25.24 ? 382  ILE B C     1 
ATOM   7808  O O     . ILE B 1 382 ? 86.475  112.426 69.345  1.00 25.79 ? 382  ILE B O     1 
ATOM   7809  C CB    . ILE B 1 382 ? 87.158  114.756 67.358  1.00 25.84 ? 382  ILE B CB    1 
ATOM   7810  C CG1   . ILE B 1 382 ? 87.878  115.162 66.061  1.00 26.63 ? 382  ILE B CG1   1 
ATOM   7811  C CG2   . ILE B 1 382 ? 86.706  115.995 68.159  1.00 25.11 ? 382  ILE B CG2   1 
ATOM   7812  C CD1   . ILE B 1 382 ? 88.814  116.366 66.201  1.00 25.15 ? 382  ILE B CD1   1 
ATOM   7813  N N     . LEU B 1 383 ? 87.487  114.030 70.560  1.00 24.66 ? 383  LEU B N     1 
ATOM   7814  C CA    . LEU B 1 383 ? 86.746  113.819 71.790  1.00 24.02 ? 383  LEU B CA    1 
ATOM   7815  C C     . LEU B 1 383 ? 86.076  115.128 72.224  1.00 24.12 ? 383  LEU B C     1 
ATOM   7816  O O     . LEU B 1 383 ? 86.624  116.223 71.997  1.00 24.10 ? 383  LEU B O     1 
ATOM   7817  C CB    . LEU B 1 383 ? 87.674  113.322 72.913  1.00 23.92 ? 383  LEU B CB    1 
ATOM   7818  C CG    . LEU B 1 383 ? 88.336  111.942 72.845  1.00 23.88 ? 383  LEU B CG    1 
ATOM   7819  C CD1   . LEU B 1 383 ? 89.278  111.726 74.059  1.00 22.15 ? 383  LEU B CD1   1 
ATOM   7820  C CD2   . LEU B 1 383 ? 87.288  110.827 72.742  1.00 24.72 ? 383  LEU B CD2   1 
ATOM   7821  N N     . GLY B 1 384 ? 84.902  115.008 72.847  1.00 23.84 ? 384  GLY B N     1 
ATOM   7822  C CA    . GLY B 1 384 ? 84.148  116.155 73.352  1.00 24.03 ? 384  GLY B CA    1 
ATOM   7823  C C     . GLY B 1 384 ? 83.559  115.956 74.732  1.00 24.42 ? 384  GLY B C     1 
ATOM   7824  O O     . GLY B 1 384 ? 83.293  114.836 75.151  1.00 23.65 ? 384  GLY B O     1 
ATOM   7825  N N     . SER B 1 385 ? 83.359  117.063 75.440  1.00 25.34 ? 385  SER B N     1 
ATOM   7826  C CA    . SER B 1 385 ? 82.779  117.038 76.774  1.00 26.61 ? 385  SER B CA    1 
ATOM   7827  C C     . SER B 1 385 ? 81.888  118.266 76.924  1.00 27.38 ? 385  SER B C     1 
ATOM   7828  O O     . SER B 1 385 ? 82.234  119.329 76.406  1.00 27.29 ? 385  SER B O     1 
ATOM   7829  C CB    . SER B 1 385 ? 83.896  117.036 77.830  1.00 26.53 ? 385  SER B CB    1 
ATOM   7830  O OG    . SER B 1 385 ? 83.370  117.062 79.142  1.00 26.28 ? 385  SER B OG    1 
ATOM   7831  N N     . ALA B 1 386 ? 80.738  118.117 77.594  1.00 28.43 ? 386  ALA B N     1 
ATOM   7832  C CA    . ALA B 1 386 ? 79.875  119.272 77.910  1.00 29.52 ? 386  ALA B CA    1 
ATOM   7833  C C     . ALA B 1 386 ? 78.965  119.030 79.111  1.00 30.32 ? 386  ALA B C     1 
ATOM   7834  O O     . ALA B 1 386 ? 78.867  117.900 79.607  1.00 30.56 ? 386  ALA B O     1 
ATOM   7835  C CB    . ALA B 1 386 ? 79.030  119.665 76.708  1.00 29.53 ? 386  ALA B CB    1 
ATOM   7836  N N     . GLY B 1 387 ? 78.311  120.102 79.576  1.00 30.53 ? 387  GLY B N     1 
ATOM   7837  C CA    . GLY B 1 387 ? 77.237  119.994 80.565  1.00 31.51 ? 387  GLY B CA    1 
ATOM   7838  C C     . GLY B 1 387 ? 77.646  120.358 81.979  1.00 32.00 ? 387  GLY B C     1 
ATOM   7839  O O     . GLY B 1 387 ? 76.809  120.674 82.832  1.00 32.15 ? 387  GLY B O     1 
ATOM   7840  N N     . GLU B 1 388 ? 78.943  120.304 82.229  1.00 32.14 ? 388  GLU B N     1 
ATOM   7841  C CA    . GLU B 1 388 ? 79.470  120.528 83.555  1.00 32.82 ? 388  GLU B CA    1 
ATOM   7842  C C     . GLU B 1 388 ? 80.974  120.729 83.466  1.00 32.60 ? 388  GLU B C     1 
ATOM   7843  O O     . GLU B 1 388 ? 81.605  120.353 82.464  1.00 32.28 ? 388  GLU B O     1 
ATOM   7844  C CB    . GLU B 1 388 ? 79.119  119.360 84.506  1.00 32.52 ? 388  GLU B CB    1 
ATOM   7845  C CG    . GLU B 1 388 ? 79.449  118.006 83.936  1.00 32.85 ? 388  GLU B CG    1 
ATOM   7846  C CD    . GLU B 1 388 ? 79.022  116.848 84.815  1.00 33.73 ? 388  GLU B CD    1 
ATOM   7847  O OE1   . GLU B 1 388 ? 79.270  116.902 86.037  1.00 35.22 ? 388  GLU B OE1   1 
ATOM   7848  O OE2   . GLU B 1 388 ? 78.464  115.869 84.268  1.00 33.70 ? 388  GLU B OE2   1 
ATOM   7849  N N     . PRO B 1 389 ? 81.548  121.353 84.502  1.00 32.76 ? 389  PRO B N     1 
ATOM   7850  C CA    . PRO B 1 389 ? 82.997  121.444 84.583  1.00 33.38 ? 389  PRO B CA    1 
ATOM   7851  C C     . PRO B 1 389 ? 83.651  120.058 84.520  1.00 33.56 ? 389  PRO B C     1 
ATOM   7852  O O     . PRO B 1 389 ? 83.068  119.049 84.967  1.00 32.95 ? 389  PRO B O     1 
ATOM   7853  C CB    . PRO B 1 389 ? 83.231  122.089 85.964  1.00 33.69 ? 389  PRO B CB    1 
ATOM   7854  C CG    . PRO B 1 389 ? 81.945  122.873 86.233  1.00 32.59 ? 389  PRO B CG    1 
ATOM   7855  C CD    . PRO B 1 389 ? 80.874  122.011 85.640  1.00 32.93 ? 389  PRO B CD    1 
ATOM   7856  N N     . ILE B 1 390 ? 84.834  120.027 83.921  1.00 33.82 ? 390  ILE B N     1 
ATOM   7857  C CA    . ILE B 1 390 ? 85.671  118.847 83.899  1.00 34.29 ? 390  ILE B CA    1 
ATOM   7858  C C     . ILE B 1 390 ? 87.005  119.225 84.556  1.00 35.42 ? 390  ILE B C     1 
ATOM   7859  O O     . ILE B 1 390 ? 87.684  120.159 84.116  1.00 35.34 ? 390  ILE B O     1 
ATOM   7860  C CB    . ILE B 1 390 ? 85.816  118.269 82.458  1.00 34.38 ? 390  ILE B CB    1 
ATOM   7861  C CG1   . ILE B 1 390 ? 86.540  116.909 82.477  1.00 33.40 ? 390  ILE B CG1   1 
ATOM   7862  C CG2   . ILE B 1 390 ? 86.455  119.285 81.487  1.00 33.48 ? 390  ILE B CG2   1 
ATOM   7863  C CD1   . ILE B 1 390 ? 86.457  116.170 81.152  1.00 33.15 ? 390  ILE B CD1   1 
ATOM   7864  N N     . ASN B 1 391 ? 87.338  118.541 85.644  1.00 36.16 ? 391  ASN B N     1 
ATOM   7865  C CA    . ASN B 1 391 ? 88.574  118.807 86.361  1.00 37.62 ? 391  ASN B CA    1 
ATOM   7866  C C     . ASN B 1 391 ? 89.774  118.265 85.561  1.00 37.75 ? 391  ASN B C     1 
ATOM   7867  O O     . ASN B 1 391 ? 89.602  117.358 84.740  1.00 37.82 ? 391  ASN B O     1 
ATOM   7868  C CB    . ASN B 1 391 ? 88.495  118.251 87.802  1.00 38.12 ? 391  ASN B CB    1 
ATOM   7869  C CG    . ASN B 1 391 ? 88.867  116.786 87.893  1.00 39.62 ? 391  ASN B CG    1 
ATOM   7870  O OD1   . ASN B 1 391 ? 90.045  116.447 87.915  1.00 42.41 ? 391  ASN B OD1   1 
ATOM   7871  N ND2   . ASN B 1 391 ? 87.866  115.910 87.968  1.00 41.18 ? 391  ASN B ND2   1 
ATOM   7872  N N     . PRO B 1 392 ? 90.982  118.842 85.764  1.00 37.97 ? 392  PRO B N     1 
ATOM   7873  C CA    . PRO B 1 392 ? 92.166  118.398 85.007  1.00 37.66 ? 392  PRO B CA    1 
ATOM   7874  C C     . PRO B 1 392 ? 92.486  116.896 85.080  1.00 36.98 ? 392  PRO B C     1 
ATOM   7875  O O     . PRO B 1 392 ? 92.975  116.335 84.100  1.00 37.31 ? 392  PRO B O     1 
ATOM   7876  C CB    . PRO B 1 392 ? 93.301  119.240 85.610  1.00 38.20 ? 392  PRO B CB    1 
ATOM   7877  C CG    . PRO B 1 392 ? 92.605  120.516 86.058  1.00 38.26 ? 392  PRO B CG    1 
ATOM   7878  C CD    . PRO B 1 392 ? 91.314  119.975 86.658  1.00 38.49 ? 392  PRO B CD    1 
ATOM   7879  N N     . GLU B 1 393 ? 92.208  116.256 86.211  1.00 35.85 ? 393  GLU B N     1 
ATOM   7880  C CA    . GLU B 1 393 ? 92.401  114.820 86.346  1.00 34.86 ? 393  GLU B CA    1 
ATOM   7881  C C     . GLU B 1 393 ? 91.457  113.995 85.461  1.00 33.21 ? 393  GLU B C     1 
ATOM   7882  O O     . GLU B 1 393 ? 91.890  113.050 84.809  1.00 32.87 ? 393  GLU B O     1 
ATOM   7883  C CB    . GLU B 1 393 ? 92.227  114.398 87.800  1.00 35.33 ? 393  GLU B CB    1 
ATOM   7884  C CG    . GLU B 1 393 ? 92.856  113.071 88.116  1.00 38.55 ? 393  GLU B CG    1 
ATOM   7885  C CD    . GLU B 1 393 ? 92.224  112.381 89.322  1.00 42.65 ? 393  GLU B CD    1 
ATOM   7886  O OE1   . GLU B 1 393 ? 91.064  112.705 89.678  1.00 44.60 ? 393  GLU B OE1   1 
ATOM   7887  O OE2   . GLU B 1 393 ? 92.891  111.497 89.901  1.00 43.91 ? 393  GLU B OE2   1 
ATOM   7888  N N     . ALA B 1 394 ? 90.169  114.329 85.474  1.00 31.53 ? 394  ALA B N     1 
ATOM   7889  C CA    . ALA B 1 394 ? 89.197  113.671 84.610  1.00 30.01 ? 394  ALA B CA    1 
ATOM   7890  C C     . ALA B 1 394 ? 89.529  113.988 83.146  1.00 29.15 ? 394  ALA B C     1 
ATOM   7891  O O     . ALA B 1 394 ? 89.425  113.116 82.287  1.00 28.59 ? 394  ALA B O     1 
ATOM   7892  C CB    . ALA B 1 394 ? 87.777  114.102 84.951  1.00 29.35 ? 394  ALA B CB    1 
ATOM   7893  N N     . TRP B 1 395 ? 89.926  115.235 82.880  1.00 28.77 ? 395  TRP B N     1 
ATOM   7894  C CA    . TRP B 1 395 ? 90.331  115.669 81.535  1.00 28.47 ? 395  TRP B CA    1 
ATOM   7895  C C     . TRP B 1 395 ? 91.474  114.806 81.014  1.00 27.82 ? 395  TRP B C     1 
ATOM   7896  O O     . TRP B 1 395 ? 91.395  114.279 79.914  1.00 28.10 ? 395  TRP B O     1 
ATOM   7897  C CB    . TRP B 1 395 ? 90.741  117.137 81.531  1.00 28.44 ? 395  TRP B CB    1 
ATOM   7898  C CG    . TRP B 1 395 ? 90.892  117.735 80.141  1.00 29.29 ? 395  TRP B CG    1 
ATOM   7899  C CD1   . TRP B 1 395 ? 89.979  118.506 79.477  1.00 28.87 ? 395  TRP B CD1   1 
ATOM   7900  C CD2   . TRP B 1 395 ? 92.029  117.617 79.260  1.00 28.70 ? 395  TRP B CD2   1 
ATOM   7901  N NE1   . TRP B 1 395 ? 90.474  118.878 78.247  1.00 28.66 ? 395  TRP B NE1   1 
ATOM   7902  C CE2   . TRP B 1 395 ? 91.722  118.338 78.083  1.00 27.72 ? 395  TRP B CE2   1 
ATOM   7903  C CE3   . TRP B 1 395 ? 93.273  116.968 79.354  1.00 29.24 ? 395  TRP B CE3   1 
ATOM   7904  C CZ2   . TRP B 1 395 ? 92.609  118.433 77.003  1.00 27.98 ? 395  TRP B CZ2   1 
ATOM   7905  C CZ3   . TRP B 1 395 ? 94.159  117.055 78.263  1.00 28.91 ? 395  TRP B CZ3   1 
ATOM   7906  C CH2   . TRP B 1 395 ? 93.813  117.784 77.109  1.00 29.07 ? 395  TRP B CH2   1 
ATOM   7907  N N     . GLU B 1 396 ? 92.518  114.655 81.814  1.00 27.27 ? 396  GLU B N     1 
ATOM   7908  C CA    . GLU B 1 396 ? 93.702  113.881 81.437  1.00 26.73 ? 396  GLU B CA    1 
ATOM   7909  C C     . GLU B 1 396 ? 93.354  112.407 81.244  1.00 26.00 ? 396  GLU B C     1 
ATOM   7910  O O     . GLU B 1 396 ? 93.784  111.783 80.268  1.00 26.62 ? 396  GLU B O     1 
ATOM   7911  C CB    . GLU B 1 396 ? 94.801  114.007 82.510  1.00 26.57 ? 396  GLU B CB    1 
ATOM   7912  N N     . TRP B 1 397 ? 92.577  111.851 82.167  1.00 24.92 ? 397  TRP B N     1 
ATOM   7913  C CA    . TRP B 1 397 ? 92.209  110.443 82.084  1.00 23.92 ? 397  TRP B CA    1 
ATOM   7914  C C     . TRP B 1 397 ? 91.414  110.181 80.801  1.00 23.67 ? 397  TRP B C     1 
ATOM   7915  O O     . TRP B 1 397 ? 91.652  109.191 80.113  1.00 23.17 ? 397  TRP B O     1 
ATOM   7916  C CB    . TRP B 1 397 ? 91.444  110.019 83.328  1.00 23.67 ? 397  TRP B CB    1 
ATOM   7917  C CG    . TRP B 1 397 ? 91.098  108.551 83.350  1.00 24.09 ? 397  TRP B CG    1 
ATOM   7918  C CD1   . TRP B 1 397 ? 91.797  107.544 83.984  1.00 22.87 ? 397  TRP B CD1   1 
ATOM   7919  C CD2   . TRP B 1 397 ? 89.990  107.918 82.688  1.00 23.42 ? 397  TRP B CD2   1 
ATOM   7920  N NE1   . TRP B 1 397 ? 91.183  106.332 83.759  1.00 22.12 ? 397  TRP B NE1   1 
ATOM   7921  C CE2   . TRP B 1 397 ? 90.071  106.529 82.975  1.00 23.52 ? 397  TRP B CE2   1 
ATOM   7922  C CE3   . TRP B 1 397 ? 88.931  108.388 81.881  1.00 24.03 ? 397  TRP B CE3   1 
ATOM   7923  C CZ2   . TRP B 1 397 ? 89.136  105.602 82.477  1.00 22.54 ? 397  TRP B CZ2   1 
ATOM   7924  C CZ3   . TRP B 1 397 ? 88.000  107.460 81.380  1.00 22.15 ? 397  TRP B CZ3   1 
ATOM   7925  C CH2   . TRP B 1 397 ? 88.108  106.088 81.689  1.00 23.09 ? 397  TRP B CH2   1 
ATOM   7926  N N     . TYR B 1 398 ? 90.469  111.072 80.496  1.00 23.27 ? 398  TYR B N     1 
ATOM   7927  C CA    . TYR B 1 398 ? 89.670  111.009 79.272  1.00 23.33 ? 398  TYR B CA    1 
ATOM   7928  C C     . TYR B 1 398 ? 90.596  111.114 78.045  1.00 23.43 ? 398  TYR B C     1 
ATOM   7929  O O     . TYR B 1 398 ? 90.556  110.276 77.136  1.00 23.12 ? 398  TYR B O     1 
ATOM   7930  C CB    . TYR B 1 398 ? 88.645  112.151 79.301  1.00 22.43 ? 398  TYR B CB    1 
ATOM   7931  C CG    . TYR B 1 398 ? 87.643  112.207 78.177  1.00 22.06 ? 398  TYR B CG    1 
ATOM   7932  C CD1   . TYR B 1 398 ? 86.977  111.055 77.728  1.00 21.67 ? 398  TYR B CD1   1 
ATOM   7933  C CD2   . TYR B 1 398 ? 87.312  113.427 77.592  1.00 21.25 ? 398  TYR B CD2   1 
ATOM   7934  C CE1   . TYR B 1 398 ? 86.022  111.131 76.700  1.00 20.65 ? 398  TYR B CE1   1 
ATOM   7935  C CE2   . TYR B 1 398 ? 86.377  113.514 76.574  1.00 20.29 ? 398  TYR B CE2   1 
ATOM   7936  C CZ    . TYR B 1 398 ? 85.731  112.366 76.129  1.00 21.58 ? 398  TYR B CZ    1 
ATOM   7937  O OH    . TYR B 1 398 ? 84.804  112.468 75.109  1.00 20.66 ? 398  TYR B OH    1 
ATOM   7938  N N     . TRP B 1 399 ? 91.453  112.131 78.054  1.00 24.18 ? 399  TRP B N     1 
ATOM   7939  C CA    . TRP B 1 399 ? 92.437  112.373 76.991  1.00 24.76 ? 399  TRP B CA    1 
ATOM   7940  C C     . TRP B 1 399 ? 93.366  111.170 76.808  1.00 24.73 ? 399  TRP B C     1 
ATOM   7941  O O     . TRP B 1 399 ? 93.660  110.762 75.668  1.00 24.09 ? 399  TRP B O     1 
ATOM   7942  C CB    . TRP B 1 399 ? 93.224  113.632 77.341  1.00 25.70 ? 399  TRP B CB    1 
ATOM   7943  C CG    . TRP B 1 399 ? 94.438  113.964 76.504  1.00 26.34 ? 399  TRP B CG    1 
ATOM   7944  C CD1   . TRP B 1 399 ? 94.456  114.547 75.261  1.00 27.86 ? 399  TRP B CD1   1 
ATOM   7945  C CD2   . TRP B 1 399 ? 95.810  113.800 76.890  1.00 27.28 ? 399  TRP B CD2   1 
ATOM   7946  N NE1   . TRP B 1 399 ? 95.762  114.727 74.841  1.00 28.80 ? 399  TRP B NE1   1 
ATOM   7947  C CE2   . TRP B 1 399 ? 96.610  114.283 75.823  1.00 28.09 ? 399  TRP B CE2   1 
ATOM   7948  C CE3   . TRP B 1 399 ? 96.442  113.301 78.036  1.00 27.52 ? 399  TRP B CE3   1 
ATOM   7949  C CZ2   . TRP B 1 399 ? 98.011  114.269 75.868  1.00 27.80 ? 399  TRP B CZ2   1 
ATOM   7950  C CZ3   . TRP B 1 399 ? 97.846  113.276 78.077  1.00 27.97 ? 399  TRP B CZ3   1 
ATOM   7951  C CH2   . TRP B 1 399 ? 98.608  113.760 76.996  1.00 27.35 ? 399  TRP B CH2   1 
ATOM   7952  N N     . LYS B 1 400 ? 93.794  110.593 77.930  1.00 24.34 ? 400  LYS B N     1 
ATOM   7953  C CA    . LYS B 1 400 ? 94.742  109.483 77.905  1.00 25.12 ? 400  LYS B CA    1 
ATOM   7954  C C     . LYS B 1 400 ? 94.121  108.090 77.653  1.00 24.98 ? 400  LYS B C     1 
ATOM   7955  O O     . LYS B 1 400 ? 94.544  107.382 76.740  1.00 25.29 ? 400  LYS B O     1 
ATOM   7956  C CB    . LYS B 1 400 ? 95.622  109.493 79.167  1.00 25.16 ? 400  LYS B CB    1 
ATOM   7957  C CG    . LYS B 1 400 ? 96.600  108.344 79.259  1.00 26.32 ? 400  LYS B CG    1 
ATOM   7958  C CD    . LYS B 1 400 ? 97.029  108.069 80.698  1.00 27.97 ? 400  LYS B CD    1 
ATOM   7959  C CE    . LYS B 1 400 ? 98.220  108.921 81.124  1.00 30.36 ? 400  LYS B CE    1 
ATOM   7960  N NZ    . LYS B 1 400 ? 98.767  108.434 82.432  1.00 29.90 ? 400  LYS B NZ    1 
ATOM   7961  N N     . LYS B 1 401 ? 93.143  107.691 78.461  1.00 24.72 ? 401  LYS B N     1 
ATOM   7962  C CA    . LYS B 1 401 ? 92.568  106.353 78.342  1.00 24.75 ? 401  LYS B CA    1 
ATOM   7963  C C     . LYS B 1 401 ? 91.635  106.179 77.133  1.00 24.84 ? 401  LYS B C     1 
ATOM   7964  O O     . LYS B 1 401 ? 91.690  105.162 76.451  1.00 24.83 ? 401  LYS B O     1 
ATOM   7965  C CB    . LYS B 1 401 ? 91.852  105.952 79.636  1.00 24.93 ? 401  LYS B CB    1 
ATOM   7966  C CG    . LYS B 1 401 ? 92.741  106.028 80.868  1.00 25.44 ? 401  LYS B CG    1 
ATOM   7967  C CD    . LYS B 1 401 ? 93.715  104.862 80.942  1.00 26.78 ? 401  LYS B CD    1 
ATOM   7968  C CE    . LYS B 1 401 ? 94.912  105.205 81.787  1.00 24.93 ? 401  LYS B CE    1 
ATOM   7969  N NZ    . LYS B 1 401 ? 95.541  103.940 82.252  1.00 29.23 ? 401  LYS B NZ    1 
ATOM   7970  N N     . ILE B 1 402 ? 90.786  107.170 76.859  1.00 24.92 ? 402  ILE B N     1 
ATOM   7971  C CA    . ILE B 1 402 ? 89.826  107.036 75.753  1.00 24.52 ? 402  ILE B CA    1 
ATOM   7972  C C     . ILE B 1 402 ? 90.456  107.435 74.409  1.00 24.59 ? 402  ILE B C     1 
ATOM   7973  O O     . ILE B 1 402 ? 90.298  106.733 73.416  1.00 24.58 ? 402  ILE B O     1 
ATOM   7974  C CB    . ILE B 1 402 ? 88.470  107.783 76.047  1.00 23.98 ? 402  ILE B CB    1 
ATOM   7975  C CG1   . ILE B 1 402 ? 87.991  107.508 77.490  1.00 22.97 ? 402  ILE B CG1   1 
ATOM   7976  C CG2   . ILE B 1 402 ? 87.396  107.447 75.005  1.00 21.86 ? 402  ILE B CG2   1 
ATOM   7977  C CD1   . ILE B 1 402 ? 87.627  106.050 77.846  1.00 18.56 ? 402  ILE B CD1   1 
ATOM   7978  N N     . GLY B 1 403 ? 91.186  108.549 74.409  1.00 24.81 ? 403  GLY B N     1 
ATOM   7979  C CA    . GLY B 1 403 ? 91.778  109.123 73.207  1.00 24.67 ? 403  GLY B CA    1 
ATOM   7980  C C     . GLY B 1 403 ? 93.234  108.765 72.963  1.00 24.95 ? 403  GLY B C     1 
ATOM   7981  O O     . GLY B 1 403 ? 93.818  109.233 72.004  1.00 24.67 ? 403  GLY B O     1 
ATOM   7982  N N     . LYS B 1 404 ? 93.820  107.927 73.821  1.00 25.53 ? 404  LYS B N     1 
ATOM   7983  C CA    . LYS B 1 404 ? 95.198  107.446 73.637  1.00 26.39 ? 404  LYS B CA    1 
ATOM   7984  C C     . LYS B 1 404 ? 96.232  108.581 73.419  1.00 26.74 ? 404  LYS B C     1 
ATOM   7985  O O     . LYS B 1 404 ? 97.301  108.384 72.828  1.00 26.68 ? 404  LYS B O     1 
ATOM   7986  C CB    . LYS B 1 404 ? 95.239  106.383 72.526  1.00 26.50 ? 404  LYS B CB    1 
ATOM   7987  C CG    . LYS B 1 404 ? 94.439  105.131 72.869  1.00 27.51 ? 404  LYS B CG    1 
ATOM   7988  C CD    . LYS B 1 404 ? 94.015  104.341 71.631  1.00 30.13 ? 404  LYS B CD    1 
ATOM   7989  C CE    . LYS B 1 404 ? 95.156  103.515 71.063  1.00 30.47 ? 404  LYS B CE    1 
ATOM   7990  N NZ    . LYS B 1 404 ? 94.663  102.546 70.031  1.00 31.24 ? 404  LYS B NZ    1 
ATOM   7991  N N     . GLU B 1 405 ? 95.897  109.756 73.951  1.00 27.46 ? 405  GLU B N     1 
ATOM   7992  C CA    . GLU B 1 405 ? 96.706  110.976 73.885  1.00 27.96 ? 405  GLU B CA    1 
ATOM   7993  C C     . GLU B 1 405 ? 96.798  111.556 72.474  1.00 28.61 ? 405  GLU B C     1 
ATOM   7994  O O     . GLU B 1 405 ? 97.591  112.463 72.237  1.00 28.77 ? 405  GLU B O     1 
ATOM   7995  C CB    . GLU B 1 405 ? 98.092  110.773 74.520  1.00 28.03 ? 405  GLU B CB    1 
ATOM   7996  C CG    . GLU B 1 405 ? 98.042  110.273 75.976  1.00 27.00 ? 405  GLU B CG    1 
ATOM   7997  C CD    . GLU B 1 405 ? 99.408  110.253 76.669  1.00 27.39 ? 405  GLU B CD    1 
ATOM   7998  O OE1   . GLU B 1 405 ? 99.514  109.624 77.745  1.00 27.71 ? 405  GLU B OE1   1 
ATOM   7999  O OE2   . GLU B 1 405 ? 100.376 110.861 76.152  1.00 25.83 ? 405  GLU B OE2   1 
ATOM   8000  N N     . LYS B 1 406 ? 95.942  111.053 71.576  1.00 28.97 ? 406  LYS B N     1 
ATOM   8001  C CA    . LYS B 1 406 ? 95.904  111.421 70.155  1.00 29.88 ? 406  LYS B CA    1 
ATOM   8002  C C     . LYS B 1 406 ? 94.817  112.441 69.791  1.00 29.82 ? 406  LYS B C     1 
ATOM   8003  O O     . LYS B 1 406 ? 94.905  113.123 68.765  1.00 30.47 ? 406  LYS B O     1 
ATOM   8004  C CB    . LYS B 1 406 ? 95.697  110.159 69.312  1.00 29.72 ? 406  LYS B CB    1 
ATOM   8005  C CG    . LYS B 1 406 ? 96.830  109.137 69.468  1.00 31.54 ? 406  LYS B CG    1 
ATOM   8006  C CD    . LYS B 1 406 ? 96.630  107.896 68.607  1.00 31.14 ? 406  LYS B CD    1 
ATOM   8007  C CE    . LYS B 1 406 ? 97.133  108.123 67.183  1.00 34.45 ? 406  LYS B CE    1 
ATOM   8008  N NZ    . LYS B 1 406 ? 97.000  106.899 66.322  1.00 35.47 ? 406  LYS B NZ    1 
ATOM   8009  N N     . CYS B 1 407 ? 93.781  112.544 70.622  1.00 29.73 ? 407  CYS B N     1 
ATOM   8010  C CA    . CYS B 1 407 ? 92.615  113.365 70.275  1.00 28.51 ? 407  CYS B CA    1 
ATOM   8011  C C     . CYS B 1 407 ? 92.555  114.645 71.078  1.00 29.03 ? 407  CYS B C     1 
ATOM   8012  O O     . CYS B 1 407 ? 92.818  114.636 72.301  1.00 29.66 ? 407  CYS B O     1 
ATOM   8013  C CB    . CYS B 1 407 ? 91.316  112.593 70.476  1.00 28.12 ? 407  CYS B CB    1 
ATOM   8014  S SG    . CYS B 1 407 ? 91.345  110.932 69.777  1.00 25.08 ? 407  CYS B SG    1 
ATOM   8015  N N     . PRO B 1 408 ? 92.218  115.757 70.394  1.00 28.55 ? 408  PRO B N     1 
ATOM   8016  C CA    . PRO B 1 408 ? 91.789  116.972 71.084  1.00 28.38 ? 408  PRO B CA    1 
ATOM   8017  C C     . PRO B 1 408 ? 90.481  116.691 71.857  1.00 28.03 ? 408  PRO B C     1 
ATOM   8018  O O     . PRO B 1 408 ? 89.644  115.917 71.380  1.00 27.58 ? 408  PRO B O     1 
ATOM   8019  C CB    . PRO B 1 408 ? 91.511  117.946 69.932  1.00 28.28 ? 408  PRO B CB    1 
ATOM   8020  C CG    . PRO B 1 408 ? 92.237  117.372 68.750  1.00 28.49 ? 408  PRO B CG    1 
ATOM   8021  C CD    . PRO B 1 408 ? 92.193  115.908 68.927  1.00 27.99 ? 408  PRO B CD    1 
ATOM   8022  N N     . VAL B 1 409 ? 90.351  117.273 73.053  1.00 27.48 ? 409  VAL B N     1 
ATOM   8023  C CA    . VAL B 1 409 ? 89.099  117.276 73.821  1.00 26.78 ? 409  VAL B CA    1 
ATOM   8024  C C     . VAL B 1 409 ? 88.434  118.647 73.682  1.00 26.52 ? 409  VAL B C     1 
ATOM   8025  O O     . VAL B 1 409 ? 88.924  119.644 74.252  1.00 25.62 ? 409  VAL B O     1 
ATOM   8026  C CB    . VAL B 1 409 ? 89.309  116.964 75.340  1.00 26.91 ? 409  VAL B CB    1 
ATOM   8027  C CG1   . VAL B 1 409 ? 87.973  117.061 76.084  1.00 27.09 ? 409  VAL B CG1   1 
ATOM   8028  C CG2   . VAL B 1 409 ? 89.948  115.582 75.559  1.00 26.08 ? 409  VAL B CG2   1 
ATOM   8029  N N     . VAL B 1 410 ? 87.327  118.703 72.924  1.00 26.37 ? 410  VAL B N     1 
ATOM   8030  C CA    . VAL B 1 410 ? 86.525  119.928 72.863  1.00 25.98 ? 410  VAL B CA    1 
ATOM   8031  C C     . VAL B 1 410 ? 85.585  120.026 74.056  1.00 26.04 ? 410  VAL B C     1 
ATOM   8032  O O     . VAL B 1 410 ? 84.593  119.295 74.158  1.00 27.13 ? 410  VAL B O     1 
ATOM   8033  C CB    . VAL B 1 410 ? 85.800  120.150 71.489  1.00 25.96 ? 410  VAL B CB    1 
ATOM   8034  C CG1   . VAL B 1 410 ? 86.830  120.153 70.352  1.00 25.73 ? 410  VAL B CG1   1 
ATOM   8035  C CG2   . VAL B 1 410 ? 84.725  119.100 71.223  1.00 24.97 ? 410  VAL B CG2   1 
ATOM   8036  N N     . ASP B 1 411 ? 85.926  120.926 74.969  1.00 25.76 ? 411  ASP B N     1 
ATOM   8037  C CA    . ASP B 1 411 ? 85.120  121.213 76.156  1.00 25.04 ? 411  ASP B CA    1 
ATOM   8038  C C     . ASP B 1 411 ? 84.227  122.403 75.782  1.00 24.41 ? 411  ASP B C     1 
ATOM   8039  O O     . ASP B 1 411 ? 84.699  123.537 75.695  1.00 24.24 ? 411  ASP B O     1 
ATOM   8040  C CB    . ASP B 1 411 ? 86.037  121.534 77.354  1.00 24.90 ? 411  ASP B CB    1 
ATOM   8041  C CG    . ASP B 1 411 ? 85.270  121.934 78.627  1.00 25.25 ? 411  ASP B CG    1 
ATOM   8042  O OD1   . ASP B 1 411 ? 84.029  121.779 78.695  1.00 24.27 ? 411  ASP B OD1   1 
ATOM   8043  O OD2   . ASP B 1 411 ? 85.932  122.394 79.584  1.00 26.17 ? 411  ASP B OD2   1 
ATOM   8044  N N     . THR B 1 412 ? 82.947  122.118 75.533  1.00 23.78 ? 412  THR B N     1 
ATOM   8045  C CA    . THR B 1 412 ? 81.994  123.117 75.024  1.00 22.98 ? 412  THR B CA    1 
ATOM   8046  C C     . THR B 1 412 ? 81.101  123.654 76.144  1.00 22.13 ? 412  THR B C     1 
ATOM   8047  O O     . THR B 1 412 ? 80.321  122.896 76.723  1.00 21.23 ? 412  THR B O     1 
ATOM   8048  C CB    . THR B 1 412 ? 81.057  122.512 73.954  1.00 22.81 ? 412  THR B CB    1 
ATOM   8049  O OG1   . THR B 1 412 ? 80.269  121.483 74.570  1.00 24.91 ? 412  THR B OG1   1 
ATOM   8050  C CG2   . THR B 1 412 ? 81.832  121.914 72.793  1.00 20.85 ? 412  THR B CG2   1 
ATOM   8051  N N     . TRP B 1 413 ? 81.221  124.950 76.436  1.00 20.99 ? 413  TRP B N     1 
ATOM   8052  C CA    . TRP B 1 413 ? 80.297  125.606 77.338  1.00 20.89 ? 413  TRP B CA    1 
ATOM   8053  C C     . TRP B 1 413 ? 79.125  126.185 76.533  1.00 21.01 ? 413  TRP B C     1 
ATOM   8054  O O     . TRP B 1 413 ? 79.330  126.857 75.508  1.00 20.75 ? 413  TRP B O     1 
ATOM   8055  C CB    . TRP B 1 413 ? 80.955  126.718 78.187  1.00 20.89 ? 413  TRP B CB    1 
ATOM   8056  C CG    . TRP B 1 413 ? 79.886  127.491 78.959  1.00 20.96 ? 413  TRP B CG    1 
ATOM   8057  C CD1   . TRP B 1 413 ? 79.296  127.120 80.140  1.00 20.65 ? 413  TRP B CD1   1 
ATOM   8058  C CD2   . TRP B 1 413 ? 79.234  128.700 78.552  1.00 19.99 ? 413  TRP B CD2   1 
ATOM   8059  N NE1   . TRP B 1 413 ? 78.349  128.044 80.507  1.00 22.11 ? 413  TRP B NE1   1 
ATOM   8060  C CE2   . TRP B 1 413 ? 78.285  129.021 79.549  1.00 20.66 ? 413  TRP B CE2   1 
ATOM   8061  C CE3   . TRP B 1 413 ? 79.372  129.561 77.448  1.00 22.65 ? 413  TRP B CE3   1 
ATOM   8062  C CZ2   . TRP B 1 413 ? 77.473  130.168 79.478  1.00 21.23 ? 413  TRP B CZ2   1 
ATOM   8063  C CZ3   . TRP B 1 413 ? 78.564  130.723 77.382  1.00 21.28 ? 413  TRP B CZ3   1 
ATOM   8064  C CH2   . TRP B 1 413 ? 77.628  131.005 78.392  1.00 20.54 ? 413  TRP B CH2   1 
ATOM   8065  N N     . TRP B 1 414 ? 77.908  125.914 77.016  1.00 20.25 ? 414  TRP B N     1 
ATOM   8066  C CA    . TRP B 1 414 ? 76.670  126.497 76.487  1.00 19.94 ? 414  TRP B CA    1 
ATOM   8067  C C     . TRP B 1 414 ? 75.506  126.072 77.383  1.00 20.73 ? 414  TRP B C     1 
ATOM   8068  O O     . TRP B 1 414 ? 75.722  125.410 78.417  1.00 20.61 ? 414  TRP B O     1 
ATOM   8069  C CB    . TRP B 1 414 ? 76.416  126.081 75.032  1.00 19.74 ? 414  TRP B CB    1 
ATOM   8070  C CG    . TRP B 1 414 ? 76.275  124.590 74.797  1.00 18.80 ? 414  TRP B CG    1 
ATOM   8071  C CD1   . TRP B 1 414 ? 77.220  123.610 75.033  1.00 18.88 ? 414  TRP B CD1   1 
ATOM   8072  C CD2   . TRP B 1 414 ? 75.138  123.922 74.237  1.00 18.81 ? 414  TRP B CD2   1 
ATOM   8073  N NE1   . TRP B 1 414 ? 76.728  122.374 74.660  1.00 20.01 ? 414  TRP B NE1   1 
ATOM   8074  C CE2   . TRP B 1 414 ? 75.450  122.537 74.177  1.00 20.31 ? 414  TRP B CE2   1 
ATOM   8075  C CE3   . TRP B 1 414 ? 73.877  124.351 73.798  1.00 18.37 ? 414  TRP B CE3   1 
ATOM   8076  C CZ2   . TRP B 1 414 ? 74.540  121.589 73.699  1.00 19.05 ? 414  TRP B CZ2   1 
ATOM   8077  C CZ3   . TRP B 1 414 ? 72.975  123.397 73.304  1.00 18.85 ? 414  TRP B CZ3   1 
ATOM   8078  C CH2   . TRP B 1 414 ? 73.318  122.044 73.253  1.00 19.06 ? 414  TRP B CH2   1 
ATOM   8079  N N     . GLN B 1 415 ? 74.290  126.424 76.963  1.00 20.46 ? 415  GLN B N     1 
ATOM   8080  C CA    . GLN B 1 415 ? 73.082  126.240 77.756  1.00 20.79 ? 415  GLN B CA    1 
ATOM   8081  C C     . GLN B 1 415 ? 71.894  126.054 76.825  1.00 21.04 ? 415  GLN B C     1 
ATOM   8082  O O     . GLN B 1 415 ? 71.991  126.347 75.613  1.00 21.04 ? 415  GLN B O     1 
ATOM   8083  C CB    . GLN B 1 415 ? 72.804  127.496 78.575  1.00 21.93 ? 415  GLN B CB    1 
ATOM   8084  C CG    . GLN B 1 415 ? 74.029  128.192 79.127  1.00 21.80 ? 415  GLN B CG    1 
ATOM   8085  C CD    . GLN B 1 415 ? 73.653  129.378 79.923  1.00 21.51 ? 415  GLN B CD    1 
ATOM   8086  O OE1   . GLN B 1 415 ? 73.260  130.411 79.372  1.00 22.81 ? 415  GLN B OE1   1 
ATOM   8087  N NE2   . GLN B 1 415 ? 73.761  129.258 81.239  1.00 21.83 ? 415  GLN B NE2   1 
ATOM   8088  N N     . THR B 1 416 ? 70.764  125.619 77.393  1.00 20.61 ? 416  THR B N     1 
ATOM   8089  C CA    . THR B 1 416 ? 69.544  125.412 76.617  1.00 20.72 ? 416  THR B CA    1 
ATOM   8090  C C     . THR B 1 416 ? 69.203  126.736 75.919  1.00 20.57 ? 416  THR B C     1 
ATOM   8091  O O     . THR B 1 416 ? 68.791  126.761 74.757  1.00 20.38 ? 416  THR B O     1 
ATOM   8092  C CB    . THR B 1 416 ? 68.354  124.980 77.517  1.00 20.69 ? 416  THR B CB    1 
ATOM   8093  O OG1   . THR B 1 416 ? 68.731  123.860 78.330  1.00 21.68 ? 416  THR B OG1   1 
ATOM   8094  C CG2   . THR B 1 416 ? 67.149  124.602 76.658  1.00 19.99 ? 416  THR B CG2   1 
ATOM   8095  N N     . GLU B 1 417 ? 69.411  127.834 76.649  1.00 20.22 ? 417  GLU B N     1 
ATOM   8096  C CA    . GLU B 1 417 ? 69.075  129.187 76.182  1.00 20.35 ? 417  GLU B CA    1 
ATOM   8097  C C     . GLU B 1 417 ? 69.937  129.683 75.030  1.00 19.97 ? 417  GLU B C     1 
ATOM   8098  O O     . GLU B 1 417 ? 69.669  130.729 74.476  1.00 19.95 ? 417  GLU B O     1 
ATOM   8099  C CB    . GLU B 1 417 ? 69.161  130.188 77.339  1.00 19.90 ? 417  GLU B CB    1 
ATOM   8100  C CG    . GLU B 1 417 ? 68.183  129.899 78.482  1.00 21.30 ? 417  GLU B CG    1 
ATOM   8101  C CD    . GLU B 1 417 ? 68.759  129.027 79.598  1.00 24.78 ? 417  GLU B CD    1 
ATOM   8102  O OE1   . GLU B 1 417 ? 69.758  128.294 79.362  1.00 25.76 ? 417  GLU B OE1   1 
ATOM   8103  O OE2   . GLU B 1 417 ? 68.200  129.075 80.724  1.00 22.54 ? 417  GLU B OE2   1 
ATOM   8104  N N     . THR B 1 418 ? 70.986  128.947 74.678  1.00 20.12 ? 418  THR B N     1 
ATOM   8105  C CA    . THR B 1 418 ? 71.913  129.451 73.676  1.00 20.24 ? 418  THR B CA    1 
ATOM   8106  C C     . THR B 1 418 ? 71.886  128.627 72.394  1.00 20.07 ? 418  THR B C     1 
ATOM   8107  O O     . THR B 1 418 ? 72.532  128.983 71.415  1.00 20.78 ? 418  THR B O     1 
ATOM   8108  C CB    . THR B 1 418 ? 73.363  129.542 74.218  1.00 20.34 ? 418  THR B CB    1 
ATOM   8109  O OG1   . THR B 1 418 ? 73.957  128.240 74.244  1.00 21.04 ? 418  THR B OG1   1 
ATOM   8110  C CG2   . THR B 1 418 ? 73.426  130.213 75.620  1.00 18.66 ? 418  THR B CG2   1 
ATOM   8111  N N     . GLY B 1 419 ? 71.146  127.522 72.421  1.00 19.87 ? 419  GLY B N     1 
ATOM   8112  C CA    . GLY B 1 419 ? 70.860  126.733 71.236  1.00 19.14 ? 419  GLY B CA    1 
ATOM   8113  C C     . GLY B 1 419 ? 72.010  125.893 70.749  1.00 19.46 ? 419  GLY B C     1 
ATOM   8114  O O     . GLY B 1 419 ? 71.799  124.764 70.316  1.00 19.07 ? 419  GLY B O     1 
ATOM   8115  N N     . GLY B 1 420 ? 73.217  126.455 70.793  1.00 19.26 ? 420  GLY B N     1 
ATOM   8116  C CA    . GLY B 1 420 ? 74.429  125.734 70.424  1.00 19.59 ? 420  GLY B CA    1 
ATOM   8117  C C     . GLY B 1 420 ? 75.645  126.211 71.205  1.00 19.43 ? 420  GLY B C     1 
ATOM   8118  O O     . GLY B 1 420 ? 75.524  127.084 72.058  1.00 19.71 ? 420  GLY B O     1 
ATOM   8119  N N     . PHE B 1 421 ? 76.798  125.614 70.915  1.00 19.44 ? 421  PHE B N     1 
ATOM   8120  C CA    . PHE B 1 421 ? 78.107  125.941 71.539  1.00 20.10 ? 421  PHE B CA    1 
ATOM   8121  C C     . PHE B 1 421 ? 78.431  127.433 71.594  1.00 20.17 ? 421  PHE B C     1 
ATOM   8122  O O     . PHE B 1 421 ? 78.249  128.130 70.602  1.00 20.11 ? 421  PHE B O     1 
ATOM   8123  C CB    . PHE B 1 421 ? 79.248  125.241 70.781  1.00 19.62 ? 421  PHE B CB    1 
ATOM   8124  C CG    . PHE B 1 421 ? 79.087  123.751 70.644  1.00 19.81 ? 421  PHE B CG    1 
ATOM   8125  C CD1   . PHE B 1 421 ? 79.696  123.081 69.588  1.00 19.56 ? 421  PHE B CD1   1 
ATOM   8126  C CD2   . PHE B 1 421 ? 78.331  123.010 71.557  1.00 20.35 ? 421  PHE B CD2   1 
ATOM   8127  C CE1   . PHE B 1 421 ? 79.559  121.706 69.453  1.00 17.99 ? 421  PHE B CE1   1 
ATOM   8128  C CE2   . PHE B 1 421 ? 78.197  121.625 71.418  1.00 19.76 ? 421  PHE B CE2   1 
ATOM   8129  C CZ    . PHE B 1 421 ? 78.812  120.980 70.375  1.00 18.17 ? 421  PHE B CZ    1 
ATOM   8130  N N     . MET B 1 422 ? 78.941  127.902 72.739  1.00 20.70 ? 422  MET B N     1 
ATOM   8131  C CA    . MET B 1 422 ? 79.194  129.333 72.972  1.00 21.32 ? 422  MET B CA    1 
ATOM   8132  C C     . MET B 1 422 ? 80.668  129.680 73.196  1.00 22.22 ? 422  MET B C     1 
ATOM   8133  O O     . MET B 1 422 ? 81.206  130.582 72.553  1.00 22.15 ? 422  MET B O     1 
ATOM   8134  C CB    . MET B 1 422 ? 78.365  129.855 74.154  1.00 21.46 ? 422  MET B CB    1 
ATOM   8135  C CG    . MET B 1 422 ? 76.847  129.800 73.963  1.00 20.67 ? 422  MET B CG    1 
ATOM   8136  S SD    . MET B 1 422 ? 76.284  130.912 72.658  1.00 19.55 ? 422  MET B SD    1 
ATOM   8137  C CE    . MET B 1 422 ? 76.467  132.489 73.463  1.00 20.03 ? 422  MET B CE    1 
ATOM   8138  N N     . ILE B 1 423 ? 81.307  128.990 74.139  1.00 23.05 ? 423  ILE B N     1 
ATOM   8139  C CA    . ILE B 1 423 ? 82.744  129.107 74.355  1.00 23.24 ? 423  ILE B CA    1 
ATOM   8140  C C     . ILE B 1 423 ? 83.288  127.692 74.226  1.00 23.76 ? 423  ILE B C     1 
ATOM   8141  O O     . ILE B 1 423 ? 82.854  126.793 74.942  1.00 24.49 ? 423  ILE B O     1 
ATOM   8142  C CB    . ILE B 1 423 ? 83.075  129.734 75.753  1.00 23.42 ? 423  ILE B CB    1 
ATOM   8143  C CG1   . ILE B 1 423 ? 82.483  131.146 75.862  1.00 23.08 ? 423  ILE B CG1   1 
ATOM   8144  C CG2   . ILE B 1 423 ? 84.585  129.788 75.998  1.00 22.96 ? 423  ILE B CG2   1 
ATOM   8145  C CD1   . ILE B 1 423 ? 82.607  131.769 77.242  1.00 23.12 ? 423  ILE B CD1   1 
ATOM   8146  N N     . THR B 1 424 ? 84.218  127.490 73.305  1.00 24.15 ? 424  THR B N     1 
ATOM   8147  C CA    . THR B 1 424 ? 84.652  126.148 72.899  1.00 25.18 ? 424  THR B CA    1 
ATOM   8148  C C     . THR B 1 424 ? 85.932  126.255 72.087  1.00 26.33 ? 424  THR B C     1 
ATOM   8149  O O     . THR B 1 424 ? 86.133  127.255 71.389  1.00 25.86 ? 424  THR B O     1 
ATOM   8150  C CB    . THR B 1 424 ? 83.589  125.419 71.992  1.00 25.37 ? 424  THR B CB    1 
ATOM   8151  O OG1   . THR B 1 424 ? 84.073  124.129 71.601  1.00 25.99 ? 424  THR B OG1   1 
ATOM   8152  C CG2   . THR B 1 424 ? 83.277  126.215 70.727  1.00 24.40 ? 424  THR B CG2   1 
ATOM   8153  N N     . PRO B 1 425 ? 86.813  125.236 72.178  1.00 27.54 ? 425  PRO B N     1 
ATOM   8154  C CA    . PRO B 1 425 ? 87.863  125.167 71.145  1.00 28.39 ? 425  PRO B CA    1 
ATOM   8155  C C     . PRO B 1 425 ? 87.322  124.659 69.812  1.00 29.37 ? 425  PRO B C     1 
ATOM   8156  O O     . PRO B 1 425 ? 86.222  124.098 69.747  1.00 29.40 ? 425  PRO B O     1 
ATOM   8157  C CB    . PRO B 1 425 ? 88.867  124.152 71.705  1.00 28.29 ? 425  PRO B CB    1 
ATOM   8158  C CG    . PRO B 1 425 ? 88.114  123.352 72.734  1.00 28.18 ? 425  PRO B CG    1 
ATOM   8159  C CD    . PRO B 1 425 ? 86.938  124.177 73.203  1.00 27.38 ? 425  PRO B CD    1 
ATOM   8160  N N     . LEU B 1 426 ? 88.090  124.909 68.763  1.00 30.28 ? 426  LEU B N     1 
ATOM   8161  C CA    . LEU B 1 426 ? 87.951  124.232 67.490  1.00 31.57 ? 426  LEU B CA    1 
ATOM   8162  C C     . LEU B 1 426 ? 89.231  123.418 67.457  1.00 32.27 ? 426  LEU B C     1 
ATOM   8163  O O     . LEU B 1 426 ? 90.271  123.923 67.879  1.00 32.74 ? 426  LEU B O     1 
ATOM   8164  C CB    . LEU B 1 426 ? 87.886  125.254 66.340  1.00 31.30 ? 426  LEU B CB    1 
ATOM   8165  C CG    . LEU B 1 426 ? 86.546  125.970 66.037  1.00 31.98 ? 426  LEU B CG    1 
ATOM   8166  C CD1   . LEU B 1 426 ? 85.883  126.658 67.244  1.00 31.53 ? 426  LEU B CD1   1 
ATOM   8167  C CD2   . LEU B 1 426 ? 86.695  126.965 64.884  1.00 31.42 ? 426  LEU B CD2   1 
ATOM   8168  N N     . PRO B 1 427 ? 89.161  122.143 67.011  1.00 33.01 ? 427  PRO B N     1 
ATOM   8169  C CA    . PRO B 1 427 ? 90.267  121.201 67.234  1.00 33.33 ? 427  PRO B CA    1 
ATOM   8170  C C     . PRO B 1 427 ? 91.560  121.581 66.514  1.00 33.59 ? 427  PRO B C     1 
ATOM   8171  O O     . PRO B 1 427 ? 92.655  121.288 67.010  1.00 33.55 ? 427  PRO B O     1 
ATOM   8172  C CB    . PRO B 1 427 ? 89.725  119.871 66.670  1.00 33.32 ? 427  PRO B CB    1 
ATOM   8173  C CG    . PRO B 1 427 ? 88.271  120.049 66.555  1.00 32.98 ? 427  PRO B CG    1 
ATOM   8174  C CD    . PRO B 1 427 ? 88.056  121.504 66.275  1.00 33.10 ? 427  PRO B CD    1 
ATOM   8175  N N     . GLY B 1 428 ? 91.430  122.214 65.350  1.00 33.90 ? 428  GLY B N     1 
ATOM   8176  C CA    . GLY B 1 428 ? 92.599  122.595 64.569  1.00 33.97 ? 428  GLY B CA    1 
ATOM   8177  C C     . GLY B 1 428 ? 92.907  124.077 64.610  1.00 34.03 ? 428  GLY B C     1 
ATOM   8178  O O     . GLY B 1 428 ? 93.576  124.591 63.718  1.00 34.30 ? 428  GLY B O     1 
ATOM   8179  N N     . ALA B 1 429 ? 92.421  124.771 65.638  1.00 33.92 ? 429  ALA B N     1 
ATOM   8180  C CA    . ALA B 1 429 ? 92.550  126.228 65.696  1.00 33.83 ? 429  ALA B CA    1 
ATOM   8181  C C     . ALA B 1 429 ? 92.994  126.721 67.074  1.00 33.90 ? 429  ALA B C     1 
ATOM   8182  O O     . ALA B 1 429 ? 93.788  127.666 67.187  1.00 33.96 ? 429  ALA B O     1 
ATOM   8183  C CB    . ALA B 1 429 ? 91.235  126.898 65.285  1.00 33.26 ? 429  ALA B CB    1 
ATOM   8184  N N     . ILE B 1 430 ? 92.475  126.082 68.117  1.00 33.79 ? 430  ILE B N     1 
ATOM   8185  C CA    . ILE B 1 430 ? 92.711  126.537 69.481  1.00 33.61 ? 430  ILE B CA    1 
ATOM   8186  C C     . ILE B 1 430 ? 93.391  125.445 70.310  1.00 33.81 ? 430  ILE B C     1 
ATOM   8187  O O     . ILE B 1 430 ? 92.880  124.318 70.414  1.00 33.66 ? 430  ILE B O     1 
ATOM   8188  C CB    . ILE B 1 430 ? 91.389  127.019 70.149  1.00 33.32 ? 430  ILE B CB    1 
ATOM   8189  C CG1   . ILE B 1 430 ? 90.767  128.169 69.336  1.00 32.53 ? 430  ILE B CG1   1 
ATOM   8190  C CG2   . ILE B 1 430 ? 91.639  127.475 71.577  1.00 33.19 ? 430  ILE B CG2   1 
ATOM   8191  C CD1   . ILE B 1 430 ? 89.308  128.414 69.636  1.00 32.53 ? 430  ILE B CD1   1 
ATOM   8192  N N     . GLU B 1 431 ? 94.546  125.788 70.882  1.00 33.34 ? 431  GLU B N     1 
ATOM   8193  C CA    . GLU B 1 431 ? 95.266  124.894 71.787  1.00 33.42 ? 431  GLU B CA    1 
ATOM   8194  C C     . GLU B 1 431 ? 94.536  124.748 73.109  1.00 32.74 ? 431  GLU B C     1 
ATOM   8195  O O     . GLU B 1 431 ? 93.935  125.713 73.619  1.00 32.46 ? 431  GLU B O     1 
ATOM   8196  C CB    . GLU B 1 431 ? 96.690  125.397 72.029  1.00 33.57 ? 431  GLU B CB    1 
ATOM   8197  C CG    . GLU B 1 431 ? 97.573  125.381 70.777  1.00 34.27 ? 431  GLU B CG    1 
ATOM   8198  C CD    . GLU B 1 431 ? 99.027  125.734 71.070  1.00 34.89 ? 431  GLU B CD    1 
ATOM   8199  O OE1   . GLU B 1 431 ? 99.341  126.081 72.234  1.00 35.42 ? 431  GLU B OE1   1 
ATOM   8200  O OE2   . GLU B 1 431 ? 99.853  125.655 70.129  1.00 36.96 ? 431  GLU B OE2   1 
ATOM   8201  N N     . LEU B 1 432 ? 94.594  123.531 73.652  1.00 32.14 ? 432  LEU B N     1 
ATOM   8202  C CA    . LEU B 1 432 ? 93.796  123.135 74.816  1.00 31.58 ? 432  LEU B CA    1 
ATOM   8203  C C     . LEU B 1 432 ? 94.435  123.400 76.170  1.00 30.97 ? 432  LEU B C     1 
ATOM   8204  O O     . LEU B 1 432 ? 95.628  123.191 76.356  1.00 31.71 ? 432  LEU B O     1 
ATOM   8205  C CB    . LEU B 1 432 ? 93.443  121.644 74.725  1.00 31.48 ? 432  LEU B CB    1 
ATOM   8206  C CG    . LEU B 1 432 ? 92.812  121.191 73.400  1.00 32.05 ? 432  LEU B CG    1 
ATOM   8207  C CD1   . LEU B 1 432 ? 92.530  119.697 73.427  1.00 31.31 ? 432  LEU B CD1   1 
ATOM   8208  C CD2   . LEU B 1 432 ? 91.549  121.984 73.057  1.00 30.41 ? 432  LEU B CD2   1 
ATOM   8209  N N     . LYS B 1 433 ? 93.626  123.854 77.118  1.00 29.97 ? 433  LYS B N     1 
ATOM   8210  C CA    . LYS B 1 433 ? 94.015  123.837 78.520  1.00 28.98 ? 433  LYS B CA    1 
ATOM   8211  C C     . LYS B 1 433 ? 93.049  122.895 79.227  1.00 29.01 ? 433  LYS B C     1 
ATOM   8212  O O     . LYS B 1 433 ? 91.827  123.037 79.088  1.00 28.74 ? 433  LYS B O     1 
ATOM   8213  C CB    . LYS B 1 433 ? 93.992  125.246 79.137  1.00 29.18 ? 433  LYS B CB    1 
ATOM   8214  C CG    . LYS B 1 433 ? 95.014  126.210 78.503  1.00 28.82 ? 433  LYS B CG    1 
ATOM   8215  C CD    . LYS B 1 433 ? 95.048  127.547 79.208  1.00 28.26 ? 433  LYS B CD    1 
ATOM   8216  C CE    . LYS B 1 433 ? 95.838  128.549 78.406  1.00 26.00 ? 433  LYS B CE    1 
ATOM   8217  N NZ    . LYS B 1 433 ? 95.927  129.833 79.135  1.00 28.30 ? 433  LYS B NZ    1 
ATOM   8218  N N     . ALA B 1 434 ? 93.599  121.917 79.950  1.00 28.18 ? 434  ALA B N     1 
ATOM   8219  C CA    . ALA B 1 434 ? 92.782  120.960 80.689  1.00 27.79 ? 434  ALA B CA    1 
ATOM   8220  C C     . ALA B 1 434 ? 91.822  121.727 81.590  1.00 27.83 ? 434  ALA B C     1 
ATOM   8221  O O     . ALA B 1 434 ? 92.253  122.440 82.505  1.00 27.91 ? 434  ALA B O     1 
ATOM   8222  C CB    . ALA B 1 434 ? 93.660  120.006 81.509  1.00 26.81 ? 434  ALA B CB    1 
ATOM   8223  N N     . GLY B 1 435 ? 90.523  121.601 81.308  1.00 27.73 ? 435  GLY B N     1 
ATOM   8224  C CA    . GLY B 1 435 ? 89.474  122.214 82.140  1.00 26.85 ? 435  GLY B CA    1 
ATOM   8225  C C     . GLY B 1 435 ? 88.931  123.550 81.648  1.00 26.42 ? 435  GLY B C     1 
ATOM   8226  O O     . GLY B 1 435 ? 88.021  124.113 82.264  1.00 26.36 ? 435  GLY B O     1 
ATOM   8227  N N     . SER B 1 436 ? 89.479  124.064 80.547  1.00 26.16 ? 436  SER B N     1 
ATOM   8228  C CA    . SER B 1 436 ? 89.036  125.350 79.971  1.00 26.07 ? 436  SER B CA    1 
ATOM   8229  C C     . SER B 1 436 ? 88.135  125.184 78.735  1.00 26.32 ? 436  SER B C     1 
ATOM   8230  O O     . SER B 1 436 ? 88.445  124.414 77.826  1.00 26.70 ? 436  SER B O     1 
ATOM   8231  C CB    . SER B 1 436 ? 90.241  126.232 79.614  1.00 26.17 ? 436  SER B CB    1 
ATOM   8232  O OG    . SER B 1 436 ? 89.837  127.425 78.975  1.00 24.06 ? 436  SER B OG    1 
ATOM   8233  N N     . ALA B 1 437 ? 87.025  125.919 78.703  1.00 26.32 ? 437  ALA B N     1 
ATOM   8234  C CA    . ALA B 1 437 ? 86.193  125.987 77.502  1.00 26.41 ? 437  ALA B CA    1 
ATOM   8235  C C     . ALA B 1 437 ? 86.906  126.802 76.412  1.00 26.37 ? 437  ALA B C     1 
ATOM   8236  O O     . ALA B 1 437 ? 86.543  126.728 75.244  1.00 26.49 ? 437  ALA B O     1 
ATOM   8237  C CB    . ALA B 1 437 ? 84.812  126.565 77.817  1.00 26.26 ? 437  ALA B CB    1 
ATOM   8238  N N     . THR B 1 438 ? 87.952  127.535 76.809  1.00 26.43 ? 438  THR B N     1 
ATOM   8239  C CA    . THR B 1 438 ? 88.845  128.302 75.902  1.00 26.11 ? 438  THR B CA    1 
ATOM   8240  C C     . THR B 1 438 ? 88.206  129.593 75.361  1.00 26.02 ? 438  THR B C     1 
ATOM   8241  O O     . THR B 1 438 ? 87.906  130.485 76.150  1.00 26.27 ? 438  THR B O     1 
ATOM   8242  C CB    . THR B 1 438 ? 89.531  127.428 74.784  1.00 26.16 ? 438  THR B CB    1 
ATOM   8243  O OG1   . THR B 1 438 ? 88.606  127.159 73.721  1.00 26.24 ? 438  THR B OG1   1 
ATOM   8244  C CG2   . THR B 1 438 ? 90.083  126.122 75.360  1.00 24.93 ? 438  THR B CG2   1 
ATOM   8245  N N     . ARG B 1 439 ? 87.976  129.682 74.046  1.00 26.21 ? 439  ARG B N     1 
ATOM   8246  C CA    . ARG B 1 439 ? 87.597  130.960 73.389  1.00 26.49 ? 439  ARG B CA    1 
ATOM   8247  C C     . ARG B 1 439 ? 86.146  131.010 72.843  1.00 26.10 ? 439  ARG B C     1 
ATOM   8248  O O     . ARG B 1 439 ? 85.591  129.975 72.474  1.00 25.94 ? 439  ARG B O     1 
ATOM   8249  C CB    . ARG B 1 439 ? 88.581  131.289 72.261  1.00 26.87 ? 439  ARG B CB    1 
ATOM   8250  C CG    . ARG B 1 439 ? 90.002  131.577 72.749  1.00 28.68 ? 439  ARG B CG    1 
ATOM   8251  C CD    . ARG B 1 439 ? 90.828  132.249 71.668  1.00 32.80 ? 439  ARG B CD    1 
ATOM   8252  N NE    . ARG B 1 439 ? 92.245  132.271 72.025  1.00 37.47 ? 439  ARG B NE    1 
ATOM   8253  C CZ    . ARG B 1 439 ? 92.814  133.175 72.820  1.00 40.21 ? 439  ARG B CZ    1 
ATOM   8254  N NH1   . ARG B 1 439 ? 92.090  134.162 73.337  1.00 41.97 ? 439  ARG B NH1   1 
ATOM   8255  N NH2   . ARG B 1 439 ? 94.116  133.104 73.091  1.00 42.13 ? 439  ARG B NH2   1 
ATOM   8256  N N     . PRO B 1 440 ? 85.541  132.217 72.773  1.00 25.37 ? 440  PRO B N     1 
ATOM   8257  C CA    . PRO B 1 440 ? 84.193  132.316 72.212  1.00 25.20 ? 440  PRO B CA    1 
ATOM   8258  C C     . PRO B 1 440 ? 84.092  131.844 70.767  1.00 24.82 ? 440  PRO B C     1 
ATOM   8259  O O     . PRO B 1 440 ? 85.045  131.942 69.997  1.00 24.46 ? 440  PRO B O     1 
ATOM   8260  C CB    . PRO B 1 440 ? 83.869  133.801 72.319  1.00 24.95 ? 440  PRO B CB    1 
ATOM   8261  C CG    . PRO B 1 440 ? 85.195  134.479 72.424  1.00 25.06 ? 440  PRO B CG    1 
ATOM   8262  C CD    . PRO B 1 440 ? 86.032  133.530 73.217  1.00 25.41 ? 440  PRO B CD    1 
ATOM   8263  N N     . PHE B 1 441 ? 82.947  131.272 70.434  1.00 24.77 ? 441  PHE B N     1 
ATOM   8264  C CA    . PHE B 1 441 ? 82.660  130.861 69.063  1.00 24.72 ? 441  PHE B CA    1 
ATOM   8265  C C     . PHE B 1 441 ? 82.346  132.113 68.215  1.00 24.63 ? 441  PHE B C     1 
ATOM   8266  O O     . PHE B 1 441 ? 82.110  133.199 68.766  1.00 24.72 ? 441  PHE B O     1 
ATOM   8267  C CB    . PHE B 1 441 ? 81.492  129.862 69.060  1.00 23.89 ? 441  PHE B CB    1 
ATOM   8268  C CG    . PHE B 1 441 ? 81.296  129.174 67.747  1.00 24.49 ? 441  PHE B CG    1 
ATOM   8269  C CD1   . PHE B 1 441 ? 82.131  128.138 67.362  1.00 23.95 ? 441  PHE B CD1   1 
ATOM   8270  C CD2   . PHE B 1 441 ? 80.297  129.583 66.879  1.00 22.61 ? 441  PHE B CD2   1 
ATOM   8271  C CE1   . PHE B 1 441 ? 81.957  127.520 66.149  1.00 24.27 ? 441  PHE B CE1   1 
ATOM   8272  C CE2   . PHE B 1 441 ? 80.127  128.963 65.653  1.00 21.23 ? 441  PHE B CE2   1 
ATOM   8273  C CZ    . PHE B 1 441 ? 80.942  127.943 65.290  1.00 22.43 ? 441  PHE B CZ    1 
ATOM   8274  N N     . PHE B 1 442 ? 82.364  131.970 66.890  1.00 25.03 ? 442  PHE B N     1 
ATOM   8275  C CA    . PHE B 1 442 ? 81.938  133.046 65.993  1.00 25.75 ? 442  PHE B CA    1 
ATOM   8276  C C     . PHE B 1 442 ? 80.596  133.616 66.454  1.00 25.81 ? 442  PHE B C     1 
ATOM   8277  O O     . PHE B 1 442 ? 79.653  132.861 66.735  1.00 25.61 ? 442  PHE B O     1 
ATOM   8278  C CB    . PHE B 1 442 ? 81.783  132.541 64.561  1.00 26.01 ? 442  PHE B CB    1 
ATOM   8279  C CG    . PHE B 1 442 ? 82.981  131.811 64.042  1.00 28.16 ? 442  PHE B CG    1 
ATOM   8280  C CD1   . PHE B 1 442 ? 82.835  130.588 63.401  1.00 29.48 ? 442  PHE B CD1   1 
ATOM   8281  C CD2   . PHE B 1 442 ? 84.267  132.341 64.199  1.00 29.82 ? 442  PHE B CD2   1 
ATOM   8282  C CE1   . PHE B 1 442 ? 83.955  129.901 62.915  1.00 30.15 ? 442  PHE B CE1   1 
ATOM   8283  C CE2   . PHE B 1 442 ? 85.382  131.663 63.734  1.00 30.64 ? 442  PHE B CE2   1 
ATOM   8284  C CZ    . PHE B 1 442 ? 85.225  130.439 63.083  1.00 29.37 ? 442  PHE B CZ    1 
ATOM   8285  N N     . GLY B 1 443 ? 80.530  134.943 66.546  1.00 25.56 ? 443  GLY B N     1 
ATOM   8286  C CA    . GLY B 1 443 ? 79.274  135.645 66.808  1.00 24.74 ? 443  GLY B CA    1 
ATOM   8287  C C     . GLY B 1 443 ? 78.994  135.789 68.276  1.00 24.48 ? 443  GLY B C     1 
ATOM   8288  O O     . GLY B 1 443 ? 77.983  136.371 68.655  1.00 24.59 ? 443  GLY B O     1 
ATOM   8289  N N     . VAL B 1 444 ? 79.889  135.240 69.100  1.00 24.40 ? 444  VAL B N     1 
ATOM   8290  C CA    . VAL B 1 444 ? 79.733  135.212 70.567  1.00 24.32 ? 444  VAL B CA    1 
ATOM   8291  C C     . VAL B 1 444 ? 80.672  136.226 71.247  1.00 24.53 ? 444  VAL B C     1 
ATOM   8292  O O     . VAL B 1 444 ? 81.905  136.134 71.112  1.00 24.39 ? 444  VAL B O     1 
ATOM   8293  C CB    . VAL B 1 444 ? 79.967  133.782 71.154  1.00 24.07 ? 444  VAL B CB    1 
ATOM   8294  C CG1   . VAL B 1 444 ? 79.765  133.771 72.672  1.00 23.28 ? 444  VAL B CG1   1 
ATOM   8295  C CG2   . VAL B 1 444 ? 79.024  132.771 70.492  1.00 24.78 ? 444  VAL B CG2   1 
ATOM   8296  N N     . GLN B 1 445 ? 80.081  137.182 71.964  1.00 24.16 ? 445  GLN B N     1 
ATOM   8297  C CA    . GLN B 1 445 ? 80.844  138.221 72.641  1.00 24.50 ? 445  GLN B CA    1 
ATOM   8298  C C     . GLN B 1 445 ? 80.683  138.081 74.148  1.00 23.89 ? 445  GLN B C     1 
ATOM   8299  O O     . GLN B 1 445 ? 79.808  138.726 74.741  1.00 23.88 ? 445  GLN B O     1 
ATOM   8300  C CB    . GLN B 1 445 ? 80.362  139.610 72.230  1.00 24.22 ? 445  GLN B CB    1 
ATOM   8301  C CG    . GLN B 1 445 ? 80.395  139.919 70.759  1.00 25.82 ? 445  GLN B CG    1 
ATOM   8302  C CD    . GLN B 1 445 ? 80.201  141.418 70.462  1.00 26.60 ? 445  GLN B CD    1 
ATOM   8303  O OE1   . GLN B 1 445 ? 80.974  142.257 70.924  1.00 30.65 ? 445  GLN B OE1   1 
ATOM   8304  N NE2   . GLN B 1 445 ? 79.190  141.741 69.676  1.00 27.88 ? 445  GLN B NE2   1 
ATOM   8305  N N     . PRO B 1 446 ? 81.507  137.240 74.784  1.00 23.56 ? 446  PRO B N     1 
ATOM   8306  C CA    . PRO B 1 446 ? 81.344  137.126 76.240  1.00 23.88 ? 446  PRO B CA    1 
ATOM   8307  C C     . PRO B 1 446 ? 81.926  138.340 76.967  1.00 24.11 ? 446  PRO B C     1 
ATOM   8308  O O     . PRO B 1 446 ? 82.646  139.142 76.356  1.00 24.30 ? 446  PRO B O     1 
ATOM   8309  C CB    . PRO B 1 446 ? 82.119  135.854 76.591  1.00 23.17 ? 446  PRO B CB    1 
ATOM   8310  C CG    . PRO B 1 446 ? 83.145  135.719 75.519  1.00 23.26 ? 446  PRO B CG    1 
ATOM   8311  C CD    . PRO B 1 446 ? 82.597  136.399 74.271  1.00 23.79 ? 446  PRO B CD    1 
ATOM   8312  N N     . ALA B 1 447 ? 81.574  138.487 78.242  1.00 24.17 ? 447  ALA B N     1 
ATOM   8313  C CA    . ALA B 1 447 ? 82.220  139.444 79.154  1.00 24.76 ? 447  ALA B CA    1 
ATOM   8314  C C     . ALA B 1 447 ? 82.041  138.919 80.568  1.00 25.16 ? 447  ALA B C     1 
ATOM   8315  O O     . ALA B 1 447 ? 81.231  138.014 80.800  1.00 25.22 ? 447  ALA B O     1 
ATOM   8316  C CB    . ALA B 1 447 ? 81.635  140.871 79.021  1.00 24.35 ? 447  ALA B CB    1 
ATOM   8317  N N     . LEU B 1 448 ? 82.838  139.462 81.489  1.00 25.37 ? 448  LEU B N     1 
ATOM   8318  C CA    . LEU B 1 448 ? 82.718  139.189 82.911  1.00 25.12 ? 448  LEU B CA    1 
ATOM   8319  C C     . LEU B 1 448 ? 82.432  140.512 83.630  1.00 25.54 ? 448  LEU B C     1 
ATOM   8320  O O     . LEU B 1 448 ? 83.143  141.494 83.438  1.00 25.63 ? 448  LEU B O     1 
ATOM   8321  C CB    . LEU B 1 448 ? 83.997  138.519 83.430  1.00 25.21 ? 448  LEU B CB    1 
ATOM   8322  C CG    . LEU B 1 448 ? 84.434  137.231 82.725  1.00 24.60 ? 448  LEU B CG    1 
ATOM   8323  C CD1   . LEU B 1 448 ? 85.851  136.877 83.033  1.00 24.98 ? 448  LEU B CD1   1 
ATOM   8324  C CD2   . LEU B 1 448 ? 83.528  136.102 83.096  1.00 24.47 ? 448  LEU B CD2   1 
ATOM   8325  N N     . VAL B 1 449 ? 81.363  140.539 84.415  1.00 26.08 ? 449  VAL B N     1 
ATOM   8326  C CA    . VAL B 1 449 ? 80.931  141.745 85.127  1.00 26.77 ? 449  VAL B CA    1 
ATOM   8327  C C     . VAL B 1 449 ? 80.819  141.475 86.627  1.00 27.20 ? 449  VAL B C     1 
ATOM   8328  O O     . VAL B 1 449 ? 80.510  140.364 87.037  1.00 26.82 ? 449  VAL B O     1 
ATOM   8329  C CB    . VAL B 1 449 ? 79.551  142.275 84.624  1.00 26.42 ? 449  VAL B CB    1 
ATOM   8330  C CG1   . VAL B 1 449 ? 79.636  142.812 83.195  1.00 27.75 ? 449  VAL B CG1   1 
ATOM   8331  C CG2   . VAL B 1 449 ? 78.468  141.206 84.745  1.00 26.01 ? 449  VAL B CG2   1 
ATOM   8332  N N     . ASP B 1 450 ? 81.034  142.501 87.445  1.00 28.31 ? 450  ASP B N     1 
ATOM   8333  C CA    . ASP B 1 450 ? 80.825  142.365 88.883  1.00 29.49 ? 450  ASP B CA    1 
ATOM   8334  C C     . ASP B 1 450 ? 79.323  142.381 89.205  1.00 30.64 ? 450  ASP B C     1 
ATOM   8335  O O     . ASP B 1 450 ? 78.481  142.419 88.290  1.00 30.77 ? 450  ASP B O     1 
ATOM   8336  C CB    . ASP B 1 450 ? 81.606  143.433 89.663  1.00 29.24 ? 450  ASP B CB    1 
ATOM   8337  C CG    . ASP B 1 450 ? 81.152  144.861 89.359  1.00 29.30 ? 450  ASP B CG    1 
ATOM   8338  O OD1   . ASP B 1 450 ? 80.010  145.085 88.901  1.00 29.92 ? 450  ASP B OD1   1 
ATOM   8339  O OD2   . ASP B 1 450 ? 81.952  145.785 89.612  1.00 29.51 ? 450  ASP B OD2   1 
ATOM   8340  N N     . ASN B 1 451 ? 78.976  142.336 90.488  1.00 31.71 ? 451  ASN B N     1 
ATOM   8341  C CA    . ASN B 1 451 ? 77.560  142.303 90.879  1.00 32.35 ? 451  ASN B CA    1 
ATOM   8342  C C     . ASN B 1 451 ? 76.774  143.574 90.595  1.00 32.74 ? 451  ASN B C     1 
ATOM   8343  O O     . ASN B 1 451 ? 75.557  143.579 90.755  1.00 33.37 ? 451  ASN B O     1 
ATOM   8344  C CB    . ASN B 1 451 ? 77.389  141.861 92.336  1.00 32.43 ? 451  ASN B CB    1 
ATOM   8345  C CG    . ASN B 1 451 ? 77.628  140.385 92.513  1.00 32.38 ? 451  ASN B CG    1 
ATOM   8346  O OD1   . ASN B 1 451 ? 77.841  139.669 91.538  1.00 31.01 ? 451  ASN B OD1   1 
ATOM   8347  N ND2   . ASN B 1 451 ? 77.613  139.918 93.762  1.00 32.81 ? 451  ASN B ND2   1 
ATOM   8348  N N     . GLU B 1 452 ? 77.459  144.629 90.150  1.00 33.05 ? 452  GLU B N     1 
ATOM   8349  C CA    . GLU B 1 452 ? 76.797  145.864 89.722  1.00 33.56 ? 452  GLU B CA    1 
ATOM   8350  C C     . GLU B 1 452 ? 76.831  146.082 88.220  1.00 33.38 ? 452  GLU B C     1 
ATOM   8351  O O     . GLU B 1 452 ? 76.366  147.121 87.739  1.00 32.78 ? 452  GLU B O     1 
ATOM   8352  C CB    . GLU B 1 452 ? 77.408  147.095 90.378  1.00 34.27 ? 452  GLU B CB    1 
ATOM   8353  C CG    . GLU B 1 452 ? 77.036  147.289 91.814  1.00 36.88 ? 452  GLU B CG    1 
ATOM   8354  C CD    . GLU B 1 452 ? 78.250  147.268 92.673  1.00 41.02 ? 452  GLU B CD    1 
ATOM   8355  O OE1   . GLU B 1 452 ? 79.204  147.996 92.319  1.00 42.96 ? 452  GLU B OE1   1 
ATOM   8356  O OE2   . GLU B 1 452 ? 78.256  146.529 93.684  1.00 43.35 ? 452  GLU B OE2   1 
ATOM   8357  N N     . GLY B 1 453 ? 77.399  145.122 87.490  1.00 32.81 ? 453  GLY B N     1 
ATOM   8358  C CA    . GLY B 1 453 ? 77.385  145.157 86.036  1.00 32.47 ? 453  GLY B CA    1 
ATOM   8359  C C     . GLY B 1 453 ? 78.542  145.858 85.347  1.00 32.16 ? 453  GLY B C     1 
ATOM   8360  O O     . GLY B 1 453 ? 78.507  146.046 84.134  1.00 31.35 ? 453  GLY B O     1 
ATOM   8361  N N     . HIS B 1 454 ? 79.565  146.241 86.107  1.00 32.47 ? 454  HIS B N     1 
ATOM   8362  C CA    . HIS B 1 454 ? 80.769  146.839 85.507  1.00 33.10 ? 454  HIS B CA    1 
ATOM   8363  C C     . HIS B 1 454 ? 81.661  145.752 84.915  1.00 32.80 ? 454  HIS B C     1 
ATOM   8364  O O     . HIS B 1 454 ? 82.044  144.826 85.622  1.00 32.65 ? 454  HIS B O     1 
ATOM   8365  C CB    . HIS B 1 454 ? 81.571  147.667 86.526  1.00 33.32 ? 454  HIS B CB    1 
ATOM   8366  C CG    . HIS B 1 454 ? 80.757  148.706 87.226  1.00 34.78 ? 454  HIS B CG    1 
ATOM   8367  N ND1   . HIS B 1 454 ? 80.036  149.662 86.547  1.00 36.49 ? 454  HIS B ND1   1 
ATOM   8368  C CD2   . HIS B 1 454 ? 80.527  148.922 88.541  1.00 35.65 ? 454  HIS B CD2   1 
ATOM   8369  C CE1   . HIS B 1 454 ? 79.400  150.427 87.415  1.00 37.30 ? 454  HIS B CE1   1 
ATOM   8370  N NE2   . HIS B 1 454 ? 79.690  150.006 88.632  1.00 35.33 ? 454  HIS B NE2   1 
ATOM   8371  N N     . PRO B 1 455 ? 81.991  145.866 83.618  1.00 33.20 ? 455  PRO B N     1 
ATOM   8372  C CA    . PRO B 1 455 ? 82.865  144.900 82.967  1.00 33.42 ? 455  PRO B CA    1 
ATOM   8373  C C     . PRO B 1 455 ? 84.185  144.812 83.694  1.00 33.76 ? 455  PRO B C     1 
ATOM   8374  O O     . PRO B 1 455 ? 84.745  145.847 84.079  1.00 34.01 ? 455  PRO B O     1 
ATOM   8375  C CB    . PRO B 1 455 ? 83.084  145.501 81.572  1.00 33.11 ? 455  PRO B CB    1 
ATOM   8376  C CG    . PRO B 1 455 ? 81.877  146.322 81.335  1.00 33.54 ? 455  PRO B CG    1 
ATOM   8377  C CD    . PRO B 1 455 ? 81.547  146.917 82.676  1.00 33.49 ? 455  PRO B CD    1 
ATOM   8378  N N     . GLN B 1 456 ? 84.666  143.588 83.889  1.00 33.66 ? 456  GLN B N     1 
ATOM   8379  C CA    . GLN B 1 456 ? 85.980  143.344 84.480  1.00 33.85 ? 456  GLN B CA    1 
ATOM   8380  C C     . GLN B 1 456 ? 86.932  143.009 83.339  1.00 34.14 ? 456  GLN B C     1 
ATOM   8381  O O     . GLN B 1 456 ? 86.649  142.138 82.515  1.00 34.59 ? 456  GLN B O     1 
ATOM   8382  C CB    . GLN B 1 456 ? 85.912  142.205 85.505  1.00 33.72 ? 456  GLN B CB    1 
ATOM   8383  C CG    . GLN B 1 456 ? 84.876  142.403 86.640  1.00 33.66 ? 456  GLN B CG    1 
ATOM   8384  C CD    . GLN B 1 456 ? 85.111  143.681 87.468  1.00 35.59 ? 456  GLN B CD    1 
ATOM   8385  O OE1   . GLN B 1 456 ? 84.214  144.533 87.606  1.00 35.11 ? 456  GLN B OE1   1 
ATOM   8386  N NE2   . GLN B 1 456 ? 86.324  143.826 88.000  1.00 33.57 ? 456  GLN B NE2   1 
ATOM   8387  N N     . GLU B 1 457 ? 88.045  143.721 83.266  1.00 34.38 ? 457  GLU B N     1 
ATOM   8388  C CA    . GLU B 1 457 ? 88.962  143.582 82.136  1.00 34.69 ? 457  GLU B CA    1 
ATOM   8389  C C     . GLU B 1 457 ? 90.222  142.810 82.534  1.00 34.30 ? 457  GLU B C     1 
ATOM   8390  O O     . GLU B 1 457 ? 90.525  142.674 83.722  1.00 33.80 ? 457  GLU B O     1 
ATOM   8391  C CB    . GLU B 1 457 ? 89.328  144.960 81.552  1.00 35.35 ? 457  GLU B CB    1 
ATOM   8392  C CG    . GLU B 1 457 ? 88.150  145.935 81.327  1.00 37.49 ? 457  GLU B CG    1 
ATOM   8393  C CD    . GLU B 1 457 ? 87.203  145.537 80.182  1.00 40.32 ? 457  GLU B CD    1 
ATOM   8394  O OE1   . GLU B 1 457 ? 87.346  144.424 79.606  1.00 39.47 ? 457  GLU B OE1   1 
ATOM   8395  O OE2   . GLU B 1 457 ? 86.306  146.359 79.858  1.00 42.43 ? 457  GLU B OE2   1 
ATOM   8396  N N     . GLY B 1 458 ? 90.940  142.306 81.533  1.00 33.85 ? 458  GLY B N     1 
ATOM   8397  C CA    . GLY B 1 458 ? 92.130  141.503 81.751  1.00 33.75 ? 458  GLY B CA    1 
ATOM   8398  C C     . GLY B 1 458 ? 91.840  140.139 82.350  1.00 33.99 ? 458  GLY B C     1 
ATOM   8399  O O     . GLY B 1 458 ? 90.731  139.619 82.232  1.00 34.17 ? 458  GLY B O     1 
ATOM   8400  N N     . ALA B 1 459 ? 92.856  139.565 82.994  1.00 33.75 ? 459  ALA B N     1 
ATOM   8401  C CA    . ALA B 1 459 ? 92.777  138.266 83.613  1.00 33.42 ? 459  ALA B CA    1 
ATOM   8402  C C     . ALA B 1 459 ? 92.022  138.430 84.920  1.00 33.49 ? 459  ALA B C     1 
ATOM   8403  O O     . ALA B 1 459 ? 92.558  138.990 85.884  1.00 33.85 ? 459  ALA B O     1 
ATOM   8404  C CB    . ALA B 1 459 ? 94.176  137.724 83.866  1.00 33.69 ? 459  ALA B CB    1 
ATOM   8405  N N     . THR B 1 460 ? 90.788  137.930 84.958  1.00 32.44 ? 460  THR B N     1 
ATOM   8406  C CA    . THR B 1 460 ? 89.849  138.295 86.017  1.00 31.72 ? 460  THR B CA    1 
ATOM   8407  C C     . THR B 1 460 ? 88.731  137.251 86.189  1.00 31.62 ? 460  THR B C     1 
ATOM   8408  O O     . THR B 1 460 ? 88.777  136.172 85.607  1.00 31.35 ? 460  THR B O     1 
ATOM   8409  C CB    . THR B 1 460 ? 89.270  139.735 85.771  1.00 31.64 ? 460  THR B CB    1 
ATOM   8410  O OG1   . THR B 1 460 ? 88.528  140.174 86.914  1.00 32.05 ? 460  THR B OG1   1 
ATOM   8411  C CG2   . THR B 1 460 ? 88.382  139.786 84.528  1.00 30.92 ? 460  THR B CG2   1 
ATOM   8412  N N     . GLU B 1 461 ? 87.744  137.564 87.015  1.00 31.41 ? 461  GLU B N     1 
ATOM   8413  C CA    . GLU B 1 461 ? 86.661  136.638 87.285  1.00 31.97 ? 461  GLU B CA    1 
ATOM   8414  C C     . GLU B 1 461 ? 85.407  137.449 87.547  1.00 30.91 ? 461  GLU B C     1 
ATOM   8415  O O     . GLU B 1 461 ? 85.485  138.559 88.082  1.00 31.14 ? 461  GLU B O     1 
ATOM   8416  C CB    . GLU B 1 461 ? 86.999  135.691 88.456  1.00 32.56 ? 461  GLU B CB    1 
ATOM   8417  C CG    . GLU B 1 461 ? 87.445  136.370 89.782  1.00 37.17 ? 461  GLU B CG    1 
ATOM   8418  C CD    . GLU B 1 461 ? 88.981  136.445 89.999  1.00 41.48 ? 461  GLU B CD    1 
ATOM   8419  O OE1   . GLU B 1 461 ? 89.707  135.457 89.711  1.00 43.99 ? 461  GLU B OE1   1 
ATOM   8420  O OE2   . GLU B 1 461 ? 89.458  137.488 90.497  1.00 41.50 ? 461  GLU B OE2   1 
ATOM   8421  N N     . GLY B 1 462 ? 84.261  136.917 87.138  1.00 29.56 ? 462  GLY B N     1 
ATOM   8422  C CA    . GLY B 1 462 ? 83.008  137.579 87.414  1.00 28.48 ? 462  GLY B CA    1 
ATOM   8423  C C     . GLY B 1 462 ? 81.812  136.847 86.858  1.00 27.89 ? 462  GLY B C     1 
ATOM   8424  O O     . GLY B 1 462 ? 81.875  135.662 86.568  1.00 27.74 ? 462  GLY B O     1 
ATOM   8425  N N     . ASN B 1 463 ? 80.709  137.569 86.728  1.00 27.22 ? 463  ASN B N     1 
ATOM   8426  C CA    . ASN B 1 463 ? 79.501  136.995 86.205  1.00 27.01 ? 463  ASN B CA    1 
ATOM   8427  C C     . ASN B 1 463 ? 79.626  136.941 84.703  1.00 26.75 ? 463  ASN B C     1 
ATOM   8428  O O     . ASN B 1 463 ? 79.889  137.966 84.069  1.00 27.23 ? 463  ASN B O     1 
ATOM   8429  C CB    . ASN B 1 463 ? 78.295  137.831 86.620  1.00 26.81 ? 463  ASN B CB    1 
ATOM   8430  C CG    . ASN B 1 463 ? 78.122  137.888 88.129  1.00 27.47 ? 463  ASN B CG    1 
ATOM   8431  O OD1   . ASN B 1 463 ? 77.757  136.897 88.762  1.00 24.41 ? 463  ASN B OD1   1 
ATOM   8432  N ND2   . ASN B 1 463 ? 78.387  139.065 88.715  1.00 27.00 ? 463  ASN B ND2   1 
ATOM   8433  N N     . LEU B 1 464 ? 79.458  135.742 84.141  1.00 26.03 ? 464  LEU B N     1 
ATOM   8434  C CA    . LEU B 1 464 ? 79.540  135.546 82.694  1.00 25.24 ? 464  LEU B CA    1 
ATOM   8435  C C     . LEU B 1 464 ? 78.270  136.036 81.990  1.00 24.79 ? 464  LEU B C     1 
ATOM   8436  O O     . LEU B 1 464 ? 77.160  135.517 82.219  1.00 24.47 ? 464  LEU B O     1 
ATOM   8437  C CB    . LEU B 1 464 ? 79.845  134.078 82.366  1.00 25.31 ? 464  LEU B CB    1 
ATOM   8438  C CG    . LEU B 1 464 ? 79.909  133.612 80.908  1.00 25.75 ? 464  LEU B CG    1 
ATOM   8439  C CD1   . LEU B 1 464 ? 81.011  134.327 80.089  1.00 24.02 ? 464  LEU B CD1   1 
ATOM   8440  C CD2   . LEU B 1 464 ? 80.089  132.112 80.874  1.00 24.47 ? 464  LEU B CD2   1 
ATOM   8441  N N     . VAL B 1 465 ? 78.449  137.064 81.162  1.00 24.60 ? 465  VAL B N     1 
ATOM   8442  C CA    . VAL B 1 465 ? 77.385  137.622 80.325  1.00 24.00 ? 465  VAL B CA    1 
ATOM   8443  C C     . VAL B 1 465 ? 77.767  137.498 78.845  1.00 24.24 ? 465  VAL B C     1 
ATOM   8444  O O     . VAL B 1 465 ? 78.949  137.322 78.520  1.00 23.96 ? 465  VAL B O     1 
ATOM   8445  C CB    . VAL B 1 465 ? 77.080  139.128 80.679  1.00 24.26 ? 465  VAL B CB    1 
ATOM   8446  C CG1   . VAL B 1 465 ? 76.476  139.255 82.091  1.00 23.64 ? 465  VAL B CG1   1 
ATOM   8447  C CG2   . VAL B 1 465 ? 78.324  139.992 80.552  1.00 23.42 ? 465  VAL B CG2   1 
ATOM   8448  N N     . ILE B 1 466 ? 76.769  137.566 77.962  1.00 23.65 ? 466  ILE B N     1 
ATOM   8449  C CA    . ILE B 1 466 ? 77.002  137.699 76.527  1.00 23.85 ? 466  ILE B CA    1 
ATOM   8450  C C     . ILE B 1 466 ? 76.375  139.031 76.093  1.00 23.85 ? 466  ILE B C     1 
ATOM   8451  O O     . ILE B 1 466 ? 75.219  139.327 76.430  1.00 23.66 ? 466  ILE B O     1 
ATOM   8452  C CB    . ILE B 1 466 ? 76.422  136.499 75.699  1.00 24.27 ? 466  ILE B CB    1 
ATOM   8453  C CG1   . ILE B 1 466 ? 76.763  135.146 76.343  1.00 23.60 ? 466  ILE B CG1   1 
ATOM   8454  C CG2   . ILE B 1 466 ? 76.868  136.574 74.218  1.00 23.63 ? 466  ILE B CG2   1 
ATOM   8455  C CD1   . ILE B 1 466 ? 78.238  134.663 76.207  1.00 21.67 ? 466  ILE B CD1   1 
ATOM   8456  N N     . THR B 1 467 ? 77.149  139.849 75.383  1.00 24.15 ? 467  THR B N     1 
ATOM   8457  C CA    . THR B 1 467 ? 76.830  141.280 75.254  1.00 24.02 ? 467  THR B CA    1 
ATOM   8458  C C     . THR B 1 467 ? 76.058  141.623 73.984  1.00 24.36 ? 467  THR B C     1 
ATOM   8459  O O     . THR B 1 467 ? 75.583  142.757 73.821  1.00 24.07 ? 467  THR B O     1 
ATOM   8460  C CB    . THR B 1 467 ? 78.115  142.184 75.351  1.00 24.69 ? 467  THR B CB    1 
ATOM   8461  O OG1   . THR B 1 467 ? 78.967  141.941 74.231  1.00 24.29 ? 467  THR B OG1   1 
ATOM   8462  C CG2   . THR B 1 467 ? 78.917  141.884 76.649  1.00 23.79 ? 467  THR B CG2   1 
ATOM   8463  N N     . ASP B 1 468 ? 75.968  140.664 73.066  1.00 23.87 ? 468  ASP B N     1 
ATOM   8464  C CA    . ASP B 1 468 ? 75.117  140.827 71.876  1.00 23.90 ? 468  ASP B CA    1 
ATOM   8465  C C     . ASP B 1 468 ? 74.540  139.470 71.495  1.00 23.25 ? 468  ASP B C     1 
ATOM   8466  O O     . ASP B 1 468 ? 75.003  138.444 72.003  1.00 22.63 ? 468  ASP B O     1 
ATOM   8467  C CB    . ASP B 1 468 ? 75.895  141.439 70.710  1.00 24.06 ? 468  ASP B CB    1 
ATOM   8468  C CG    . ASP B 1 468 ? 74.992  142.211 69.745  1.00 25.11 ? 468  ASP B CG    1 
ATOM   8469  O OD1   . ASP B 1 468 ? 73.793  141.886 69.632  1.00 25.78 ? 468  ASP B OD1   1 
ATOM   8470  O OD2   . ASP B 1 468 ? 75.483  143.159 69.097  1.00 27.48 ? 468  ASP B OD2   1 
ATOM   8471  N N     . SER B 1 469 ? 73.526  139.464 70.626  1.00 22.57 ? 469  SER B N     1 
ATOM   8472  C CA    . SER B 1 469 ? 72.895  138.208 70.199  1.00 21.97 ? 469  SER B CA    1 
ATOM   8473  C C     . SER B 1 469 ? 73.779  137.342 69.275  1.00 21.88 ? 469  SER B C     1 
ATOM   8474  O O     . SER B 1 469 ? 74.855  137.758 68.862  1.00 21.20 ? 469  SER B O     1 
ATOM   8475  C CB    . SER B 1 469 ? 71.536  138.479 69.575  1.00 21.70 ? 469  SER B CB    1 
ATOM   8476  O OG    . SER B 1 469 ? 70.856  137.270 69.300  1.00 21.92 ? 469  SER B OG    1 
ATOM   8477  N N     . TRP B 1 470 ? 73.312  136.123 69.004  1.00 22.05 ? 470  TRP B N     1 
ATOM   8478  C CA    . TRP B 1 470 ? 73.932  135.148 68.100  1.00 22.17 ? 470  TRP B CA    1 
ATOM   8479  C C     . TRP B 1 470 ? 72.731  134.335 67.593  1.00 22.91 ? 470  TRP B C     1 
ATOM   8480  O O     . TRP B 1 470 ? 71.682  134.319 68.261  1.00 23.20 ? 470  TRP B O     1 
ATOM   8481  C CB    . TRP B 1 470 ? 74.959  134.253 68.836  1.00 21.60 ? 470  TRP B CB    1 
ATOM   8482  C CG    . TRP B 1 470 ? 74.330  133.446 69.960  1.00 22.46 ? 470  TRP B CG    1 
ATOM   8483  C CD1   . TRP B 1 470 ? 73.941  132.131 69.918  1.00 19.40 ? 470  TRP B CD1   1 
ATOM   8484  C CD2   . TRP B 1 470 ? 73.977  133.932 71.269  1.00 21.34 ? 470  TRP B CD2   1 
ATOM   8485  N NE1   . TRP B 1 470 ? 73.391  131.761 71.128  1.00 19.90 ? 470  TRP B NE1   1 
ATOM   8486  C CE2   . TRP B 1 470 ? 73.391  132.850 71.972  1.00 21.04 ? 470  TRP B CE2   1 
ATOM   8487  C CE3   . TRP B 1 470 ? 74.100  135.175 71.911  1.00 20.10 ? 470  TRP B CE3   1 
ATOM   8488  C CZ2   . TRP B 1 470 ? 72.927  132.975 73.294  1.00 19.59 ? 470  TRP B CZ2   1 
ATOM   8489  C CZ3   . TRP B 1 470 ? 73.645  135.295 73.224  1.00 21.12 ? 470  TRP B CZ3   1 
ATOM   8490  C CH2   . TRP B 1 470 ? 73.068  134.194 73.904  1.00 20.06 ? 470  TRP B CH2   1 
ATOM   8491  N N     . PRO B 1 471 ? 72.835  133.736 66.389  1.00 22.91 ? 471  PRO B N     1 
ATOM   8492  C CA    . PRO B 1 471 ? 71.668  133.150 65.709  1.00 22.91 ? 471  PRO B CA    1 
ATOM   8493  C C     . PRO B 1 471 ? 70.928  132.038 66.467  1.00 22.95 ? 471  PRO B C     1 
ATOM   8494  O O     . PRO B 1 471 ? 69.721  131.889 66.278  1.00 23.38 ? 471  PRO B O     1 
ATOM   8495  C CB    . PRO B 1 471 ? 72.254  132.604 64.393  1.00 22.66 ? 471  PRO B CB    1 
ATOM   8496  C CG    . PRO B 1 471 ? 73.495  133.421 64.167  1.00 23.09 ? 471  PRO B CG    1 
ATOM   8497  C CD    . PRO B 1 471 ? 74.047  133.641 65.556  1.00 23.63 ? 471  PRO B CD    1 
ATOM   8498  N N     . GLY B 1 472 ? 71.632  131.279 67.299  1.00 22.55 ? 472  GLY B N     1 
ATOM   8499  C CA    . GLY B 1 472 ? 71.025  130.159 68.010  1.00 22.35 ? 472  GLY B CA    1 
ATOM   8500  C C     . GLY B 1 472 ? 70.312  130.494 69.306  1.00 22.27 ? 472  GLY B C     1 
ATOM   8501  O O     . GLY B 1 472 ? 69.709  129.601 69.910  1.00 23.22 ? 472  GLY B O     1 
ATOM   8502  N N     . GLN B 1 473 ? 70.347  131.770 69.714  1.00 21.67 ? 473  GLN B N     1 
ATOM   8503  C CA    . GLN B 1 473 ? 69.786  132.235 70.998  1.00 21.99 ? 473  GLN B CA    1 
ATOM   8504  C C     . GLN B 1 473 ? 68.319  131.857 71.161  1.00 21.36 ? 473  GLN B C     1 
ATOM   8505  O O     . GLN B 1 473 ? 67.562  131.959 70.202  1.00 21.58 ? 473  GLN B O     1 
ATOM   8506  C CB    . GLN B 1 473 ? 69.921  133.775 71.118  1.00 21.81 ? 473  GLN B CB    1 
ATOM   8507  C CG    . GLN B 1 473 ? 69.545  134.304 72.511  1.00 21.79 ? 473  GLN B CG    1 
ATOM   8508  C CD    . GLN B 1 473 ? 70.009  135.712 72.795  1.00 22.81 ? 473  GLN B CD    1 
ATOM   8509  O OE1   . GLN B 1 473 ? 70.196  136.540 71.871  1.00 23.52 ? 473  GLN B OE1   1 
ATOM   8510  N NE2   . GLN B 1 473 ? 70.211  136.005 74.083  1.00 19.04 ? 473  GLN B NE2   1 
ATOM   8511  N N     . ALA B 1 474 ? 67.912  131.422 72.354  1.00 20.92 ? 474  ALA B N     1 
ATOM   8512  C CA    . ALA B 1 474 ? 66.475  131.197 72.617  1.00 20.97 ? 474  ALA B CA    1 
ATOM   8513  C C     . ALA B 1 474 ? 65.714  132.522 72.488  1.00 21.02 ? 474  ALA B C     1 
ATOM   8514  O O     . ALA B 1 474 ? 66.254  133.589 72.834  1.00 20.89 ? 474  ALA B O     1 
ATOM   8515  C CB    . ALA B 1 474 ? 66.238  130.596 74.002  1.00 20.43 ? 474  ALA B CB    1 
ATOM   8516  N N     . ARG B 1 475 ? 64.467  132.461 72.008  1.00 20.29 ? 475  ARG B N     1 
ATOM   8517  C CA    . ARG B 1 475 ? 63.745  133.698 71.679  1.00 20.30 ? 475  ARG B CA    1 
ATOM   8518  C C     . ARG B 1 475 ? 62.872  134.190 72.814  1.00 20.69 ? 475  ARG B C     1 
ATOM   8519  O O     . ARG B 1 475 ? 62.646  135.381 72.956  1.00 21.11 ? 475  ARG B O     1 
ATOM   8520  C CB    . ARG B 1 475 ? 62.913  133.540 70.403  1.00 19.53 ? 475  ARG B CB    1 
ATOM   8521  C CG    . ARG B 1 475 ? 63.705  133.085 69.174  1.00 19.26 ? 475  ARG B CG    1 
ATOM   8522  C CD    . ARG B 1 475 ? 64.811  134.073 68.818  1.00 20.38 ? 475  ARG B CD    1 
ATOM   8523  N NE    . ARG B 1 475 ? 65.174  133.988 67.406  1.00 20.29 ? 475  ARG B NE    1 
ATOM   8524  C CZ    . ARG B 1 475 ? 66.350  133.571 66.944  1.00 21.20 ? 475  ARG B CZ    1 
ATOM   8525  N NH1   . ARG B 1 475 ? 67.331  133.222 67.781  1.00 18.85 ? 475  ARG B NH1   1 
ATOM   8526  N NH2   . ARG B 1 475 ? 66.548  133.520 65.634  1.00 19.65 ? 475  ARG B NH2   1 
ATOM   8527  N N     . THR B 1 476 ? 62.392  133.261 73.624  1.00 21.46 ? 476  THR B N     1 
ATOM   8528  C CA    . THR B 1 476 ? 61.469  133.579 74.702  1.00 21.79 ? 476  THR B CA    1 
ATOM   8529  C C     . THR B 1 476 ? 61.308  132.367 75.621  1.00 21.75 ? 476  THR B C     1 
ATOM   8530  O O     . THR B 1 476 ? 61.934  131.319 75.385  1.00 21.34 ? 476  THR B O     1 
ATOM   8531  C CB    . THR B 1 476 ? 60.115  134.040 74.145  1.00 21.79 ? 476  THR B CB    1 
ATOM   8532  O OG1   . THR B 1 476 ? 59.335  134.591 75.209  1.00 23.26 ? 476  THR B OG1   1 
ATOM   8533  C CG2   . THR B 1 476 ? 59.355  132.888 73.444  1.00 21.27 ? 476  THR B CG2   1 
ATOM   8534  N N     . LEU B 1 477 ? 60.528  132.554 76.690  1.00 21.49 ? 477  LEU B N     1 
ATOM   8535  C CA    . LEU B 1 477 ? 60.021  131.458 77.522  1.00 21.67 ? 477  LEU B CA    1 
ATOM   8536  C C     . LEU B 1 477 ? 58.557  131.285 77.190  1.00 22.47 ? 477  LEU B C     1 
ATOM   8537  O O     . LEU B 1 477 ? 57.799  132.264 77.182  1.00 22.31 ? 477  LEU B O     1 
ATOM   8538  C CB    . LEU B 1 477 ? 60.205  131.729 79.009  1.00 21.02 ? 477  LEU B CB    1 
ATOM   8539  C CG    . LEU B 1 477 ? 61.647  131.818 79.555  1.00 20.62 ? 477  LEU B CG    1 
ATOM   8540  C CD1   . LEU B 1 477 ? 61.638  132.153 81.063  1.00 16.55 ? 477  LEU B CD1   1 
ATOM   8541  C CD2   . LEU B 1 477 ? 62.438  130.537 79.281  1.00 19.04 ? 477  LEU B CD2   1 
ATOM   8542  N N     . PHE B 1 478 ? 58.168  130.057 76.841  1.00 23.09 ? 478  PHE B N     1 
ATOM   8543  C CA    . PHE B 1 478 ? 56.823  129.837 76.342  1.00 23.30 ? 478  PHE B CA    1 
ATOM   8544  C C     . PHE B 1 478 ? 55.796  130.419 77.324  1.00 24.05 ? 478  PHE B C     1 
ATOM   8545  O O     . PHE B 1 478 ? 55.863  130.185 78.548  1.00 23.64 ? 478  PHE B O     1 
ATOM   8546  C CB    . PHE B 1 478 ? 56.554  128.352 76.099  1.00 23.39 ? 478  PHE B CB    1 
ATOM   8547  C CG    . PHE B 1 478 ? 55.210  128.075 75.509  1.00 21.92 ? 478  PHE B CG    1 
ATOM   8548  C CD1   . PHE B 1 478 ? 54.990  128.241 74.161  1.00 23.13 ? 478  PHE B CD1   1 
ATOM   8549  C CD2   . PHE B 1 478 ? 54.153  127.657 76.313  1.00 25.55 ? 478  PHE B CD2   1 
ATOM   8550  C CE1   . PHE B 1 478 ? 53.741  127.983 73.601  1.00 24.50 ? 478  PHE B CE1   1 
ATOM   8551  C CE2   . PHE B 1 478 ? 52.889  127.406 75.772  1.00 24.86 ? 478  PHE B CE2   1 
ATOM   8552  C CZ    . PHE B 1 478 ? 52.686  127.570 74.408  1.00 24.89 ? 478  PHE B CZ    1 
ATOM   8553  N N     . GLY B 1 479 ? 54.860  131.189 76.773  1.00 24.35 ? 479  GLY B N     1 
ATOM   8554  C CA    . GLY B 1 479 ? 53.806  131.817 77.561  1.00 25.00 ? 479  GLY B CA    1 
ATOM   8555  C C     . GLY B 1 479 ? 54.269  132.892 78.519  1.00 25.27 ? 479  GLY B C     1 
ATOM   8556  O O     . GLY B 1 479 ? 53.453  133.445 79.252  1.00 25.82 ? 479  GLY B O     1 
ATOM   8557  N N     . ASP B 1 480 ? 55.564  133.200 78.528  1.00 25.80 ? 480  ASP B N     1 
ATOM   8558  C CA    . ASP B 1 480 ? 56.103  134.113 79.554  1.00 26.26 ? 480  ASP B CA    1 
ATOM   8559  C C     . ASP B 1 480 ? 57.333  134.906 79.130  1.00 25.55 ? 480  ASP B C     1 
ATOM   8560  O O     . ASP B 1 480 ? 58.426  134.759 79.692  1.00 25.40 ? 480  ASP B O     1 
ATOM   8561  C CB    . ASP B 1 480 ? 56.375  133.358 80.869  1.00 26.27 ? 480  ASP B CB    1 
ATOM   8562  C CG    . ASP B 1 480 ? 56.302  134.271 82.094  1.00 28.69 ? 480  ASP B CG    1 
ATOM   8563  O OD1   . ASP B 1 480 ? 56.293  135.522 81.927  1.00 29.46 ? 480  ASP B OD1   1 
ATOM   8564  O OD2   . ASP B 1 480 ? 56.256  133.738 83.228  1.00 29.14 ? 480  ASP B OD2   1 
ATOM   8565  N N     . HIS B 1 481 ? 57.139  135.783 78.163  1.00 24.84 ? 481  HIS B N     1 
ATOM   8566  C CA    . HIS B 1 481 ? 58.213  136.649 77.723  1.00 24.88 ? 481  HIS B CA    1 
ATOM   8567  C C     . HIS B 1 481 ? 58.719  137.606 78.813  1.00 24.66 ? 481  HIS B C     1 
ATOM   8568  O O     . HIS B 1 481 ? 59.901  137.943 78.822  1.00 25.37 ? 481  HIS B O     1 
ATOM   8569  C CB    . HIS B 1 481 ? 57.793  137.427 76.469  1.00 24.99 ? 481  HIS B CB    1 
ATOM   8570  C CG    . HIS B 1 481 ? 58.914  138.177 75.825  1.00 24.56 ? 481  HIS B CG    1 
ATOM   8571  N ND1   . HIS B 1 481 ? 59.859  137.564 75.033  1.00 24.69 ? 481  HIS B ND1   1 
ATOM   8572  C CD2   . HIS B 1 481 ? 59.238  139.493 75.848  1.00 24.94 ? 481  HIS B CD2   1 
ATOM   8573  C CE1   . HIS B 1 481 ? 60.732  138.467 74.612  1.00 24.92 ? 481  HIS B CE1   1 
ATOM   8574  N NE2   . HIS B 1 481 ? 60.373  139.647 75.087  1.00 23.99 ? 481  HIS B NE2   1 
ATOM   8575  N N     . GLU B 1 482 ? 57.839  138.060 79.708  1.00 24.64 ? 482  GLU B N     1 
ATOM   8576  C CA    . GLU B 1 482 ? 58.234  138.987 80.791  1.00 24.64 ? 482  GLU B CA    1 
ATOM   8577  C C     . GLU B 1 482 ? 59.258  138.278 81.700  1.00 24.13 ? 482  GLU B C     1 
ATOM   8578  O O     . GLU B 1 482 ? 60.295  138.846 82.038  1.00 22.57 ? 482  GLU B O     1 
ATOM   8579  C CB    . GLU B 1 482 ? 57.020  139.474 81.604  1.00 24.63 ? 482  GLU B CB    1 
ATOM   8580  C CG    . GLU B 1 482 ? 56.107  140.528 80.935  1.00 29.10 ? 482  GLU B CG    1 
ATOM   8581  C CD    . GLU B 1 482 ? 55.522  140.074 79.588  1.00 34.97 ? 482  GLU B CD    1 
ATOM   8582  O OE1   . GLU B 1 482 ? 55.216  138.866 79.437  1.00 38.19 ? 482  GLU B OE1   1 
ATOM   8583  O OE2   . GLU B 1 482 ? 55.384  140.919 78.670  1.00 37.82 ? 482  GLU B OE2   1 
ATOM   8584  N N     . ARG B 1 483 ? 58.966  137.028 82.072  1.00 24.28 ? 483  ARG B N     1 
ATOM   8585  C CA    . ARG B 1 483 ? 59.905  136.228 82.859  1.00 24.56 ? 483  ARG B CA    1 
ATOM   8586  C C     . ARG B 1 483 ? 61.224  136.007 82.123  1.00 24.15 ? 483  ARG B C     1 
ATOM   8587  O O     . ARG B 1 483 ? 62.284  135.941 82.755  1.00 24.48 ? 483  ARG B O     1 
ATOM   8588  C CB    . ARG B 1 483 ? 59.285  134.899 83.292  1.00 24.99 ? 483  ARG B CB    1 
ATOM   8589  C CG    . ARG B 1 483 ? 60.143  134.105 84.279  1.00 28.33 ? 483  ARG B CG    1 
ATOM   8590  C CD    . ARG B 1 483 ? 59.346  133.055 85.031  1.00 34.18 ? 483  ARG B CD    1 
ATOM   8591  N NE    . ARG B 1 483 ? 58.989  133.517 86.373  1.00 38.29 ? 483  ARG B NE    1 
ATOM   8592  C CZ    . ARG B 1 483 ? 57.797  133.996 86.734  1.00 40.27 ? 483  ARG B CZ    1 
ATOM   8593  N NH1   . ARG B 1 483 ? 56.786  134.078 85.868  1.00 38.53 ? 483  ARG B NH1   1 
ATOM   8594  N NH2   . ARG B 1 483 ? 57.619  134.393 87.987  1.00 41.63 ? 483  ARG B NH2   1 
ATOM   8595  N N     . PHE B 1 484 ? 61.159  135.914 80.793  1.00 23.82 ? 484  PHE B N     1 
ATOM   8596  C CA    . PHE B 1 484 ? 62.353  135.782 79.937  1.00 23.26 ? 484  PHE B CA    1 
ATOM   8597  C C     . PHE B 1 484 ? 63.184  137.059 80.026  1.00 23.55 ? 484  PHE B C     1 
ATOM   8598  O O     . PHE B 1 484 ? 64.406  137.026 80.216  1.00 23.73 ? 484  PHE B O     1 
ATOM   8599  C CB    . PHE B 1 484 ? 61.917  135.508 78.489  1.00 22.81 ? 484  PHE B CB    1 
ATOM   8600  C CG    . PHE B 1 484 ? 63.054  135.442 77.487  1.00 23.13 ? 484  PHE B CG    1 
ATOM   8601  C CD1   . PHE B 1 484 ? 63.866  134.309 77.403  1.00 21.00 ? 484  PHE B CD1   1 
ATOM   8602  C CD2   . PHE B 1 484 ? 63.262  136.487 76.586  1.00 21.46 ? 484  PHE B CD2   1 
ATOM   8603  C CE1   . PHE B 1 484 ? 64.892  134.230 76.476  1.00 23.03 ? 484  PHE B CE1   1 
ATOM   8604  C CE2   . PHE B 1 484 ? 64.291  136.428 75.642  1.00 23.01 ? 484  PHE B CE2   1 
ATOM   8605  C CZ    . PHE B 1 484 ? 65.121  135.294 75.583  1.00 21.96 ? 484  PHE B CZ    1 
ATOM   8606  N N     . GLU B 1 485 ? 62.526  138.197 79.879  1.00 23.20 ? 485  GLU B N     1 
ATOM   8607  C CA    . GLU B 1 485 ? 63.235  139.469 80.037  1.00 24.25 ? 485  GLU B CA    1 
ATOM   8608  C C     . GLU B 1 485 ? 63.890  139.566 81.421  1.00 22.43 ? 485  GLU B C     1 
ATOM   8609  O O     . GLU B 1 485 ? 65.085  139.782 81.529  1.00 21.35 ? 485  GLU B O     1 
ATOM   8610  C CB    . GLU B 1 485 ? 62.282  140.643 79.766  1.00 23.58 ? 485  GLU B CB    1 
ATOM   8611  C CG    . GLU B 1 485 ? 61.634  140.547 78.369  1.00 25.44 ? 485  GLU B CG    1 
ATOM   8612  C CD    . GLU B 1 485 ? 60.629  141.652 78.086  1.00 28.04 ? 485  GLU B CD    1 
ATOM   8613  O OE1   . GLU B 1 485 ? 59.792  141.962 78.985  1.00 31.12 ? 485  GLU B OE1   1 
ATOM   8614  O OE2   . GLU B 1 485 ? 60.681  142.208 76.946  1.00 34.10 ? 485  GLU B OE2   1 
ATOM   8615  N N     . GLN B 1 486 ? 63.096  139.369 82.467  1.00 22.31 ? 486  GLN B N     1 
ATOM   8616  C CA    . GLN B 1 486 ? 63.586  139.484 83.841  1.00 23.24 ? 486  GLN B CA    1 
ATOM   8617  C C     . GLN B 1 486 ? 64.699  138.505 84.210  1.00 22.32 ? 486  GLN B C     1 
ATOM   8618  O O     . GLN B 1 486 ? 65.693  138.917 84.794  1.00 22.63 ? 486  GLN B O     1 
ATOM   8619  C CB    . GLN B 1 486 ? 62.445  139.418 84.866  1.00 22.83 ? 486  GLN B CB    1 
ATOM   8620  C CG    . GLN B 1 486 ? 62.951  139.334 86.303  1.00 25.45 ? 486  GLN B CG    1 
ATOM   8621  C CD    . GLN B 1 486 ? 61.839  139.391 87.339  1.00 25.39 ? 486  GLN B CD    1 
ATOM   8622  O OE1   . GLN B 1 486 ? 61.361  140.469 87.695  1.00 28.15 ? 486  GLN B OE1   1 
ATOM   8623  N NE2   . GLN B 1 486 ? 61.429  138.224 87.829  1.00 27.66 ? 486  GLN B NE2   1 
ATOM   8624  N N     . THR B 1 487 ? 64.542  137.230 83.865  1.00 22.06 ? 487  THR B N     1 
ATOM   8625  C CA    . THR B 1 487 ? 65.528  136.198 84.239  1.00 22.21 ? 487  THR B CA    1 
ATOM   8626  C C     . THR B 1 487 ? 66.924  136.401 83.615  1.00 22.41 ? 487  THR B C     1 
ATOM   8627  O O     . THR B 1 487 ? 67.955  136.243 84.295  1.00 21.63 ? 487  THR B O     1 
ATOM   8628  C CB    . THR B 1 487 ? 65.015  134.766 83.908  1.00 22.71 ? 487  THR B CB    1 
ATOM   8629  O OG1   . THR B 1 487 ? 63.729  134.557 84.516  1.00 22.27 ? 487  THR B OG1   1 
ATOM   8630  C CG2   . THR B 1 487 ? 66.018  133.671 84.403  1.00 22.46 ? 487  THR B CG2   1 
ATOM   8631  N N     . TYR B 1 488 ? 66.961  136.774 82.335  1.00 22.44 ? 488  TYR B N     1 
ATOM   8632  C CA    . TYR B 1 488 ? 68.231  136.793 81.607  1.00 23.01 ? 488  TYR B CA    1 
ATOM   8633  C C     . TYR B 1 488 ? 68.781  138.178 81.312  1.00 23.15 ? 488  TYR B C     1 
ATOM   8634  O O     . TYR B 1 488 ? 69.968  138.312 81.022  1.00 23.22 ? 488  TYR B O     1 
ATOM   8635  C CB    . TYR B 1 488 ? 68.126  135.975 80.309  1.00 23.08 ? 488  TYR B CB    1 
ATOM   8636  C CG    . TYR B 1 488 ? 67.634  134.562 80.527  1.00 23.40 ? 488  TYR B CG    1 
ATOM   8637  C CD1   . TYR B 1 488 ? 66.308  134.221 80.252  1.00 23.06 ? 488  TYR B CD1   1 
ATOM   8638  C CD2   . TYR B 1 488 ? 68.489  133.572 81.038  1.00 20.92 ? 488  TYR B CD2   1 
ATOM   8639  C CE1   . TYR B 1 488 ? 65.839  132.920 80.467  1.00 23.20 ? 488  TYR B CE1   1 
ATOM   8640  C CE2   . TYR B 1 488 ? 68.038  132.279 81.256  1.00 22.28 ? 488  TYR B CE2   1 
ATOM   8641  C CZ    . TYR B 1 488 ? 66.714  131.957 80.964  1.00 23.71 ? 488  TYR B CZ    1 
ATOM   8642  O OH    . TYR B 1 488 ? 66.258  130.679 81.182  1.00 24.02 ? 488  TYR B OH    1 
ATOM   8643  N N     . PHE B 1 489 ? 67.928  139.196 81.386  1.00 23.31 ? 489  PHE B N     1 
ATOM   8644  C CA    . PHE B 1 489 ? 68.299  140.528 80.899  1.00 23.67 ? 489  PHE B CA    1 
ATOM   8645  C C     . PHE B 1 489 ? 68.037  141.682 81.858  1.00 23.75 ? 489  PHE B C     1 
ATOM   8646  O O     . PHE B 1 489 ? 68.142  142.828 81.451  1.00 24.14 ? 489  PHE B O     1 
ATOM   8647  C CB    . PHE B 1 489 ? 67.551  140.843 79.590  1.00 23.37 ? 489  PHE B CB    1 
ATOM   8648  C CG    . PHE B 1 489 ? 67.796  139.858 78.491  1.00 22.92 ? 489  PHE B CG    1 
ATOM   8649  C CD1   . PHE B 1 489 ? 66.949  138.760 78.324  1.00 22.48 ? 489  PHE B CD1   1 
ATOM   8650  C CD2   . PHE B 1 489 ? 68.850  140.043 77.600  1.00 22.33 ? 489  PHE B CD2   1 
ATOM   8651  C CE1   . PHE B 1 489 ? 67.151  137.851 77.291  1.00 23.10 ? 489  PHE B CE1   1 
ATOM   8652  C CE2   . PHE B 1 489 ? 69.070  139.134 76.571  1.00 22.88 ? 489  PHE B CE2   1 
ATOM   8653  C CZ    . PHE B 1 489 ? 68.212  138.032 76.408  1.00 23.61 ? 489  PHE B CZ    1 
ATOM   8654  N N     . SER B 1 490 ? 67.689  141.408 83.110  1.00 24.41 ? 490  SER B N     1 
ATOM   8655  C CA    . SER B 1 490 ? 67.425  142.497 84.066  1.00 25.02 ? 490  SER B CA    1 
ATOM   8656  C C     . SER B 1 490 ? 68.489  142.650 85.169  1.00 25.63 ? 490  SER B C     1 
ATOM   8657  O O     . SER B 1 490 ? 68.520  143.661 85.875  1.00 25.63 ? 490  SER B O     1 
ATOM   8658  C CB    . SER B 1 490 ? 66.040  142.354 84.691  1.00 24.43 ? 490  SER B CB    1 
ATOM   8659  O OG    . SER B 1 490 ? 66.023  141.261 85.594  1.00 26.08 ? 490  SER B OG    1 
ATOM   8660  N N     . THR B 1 491 ? 69.337  141.642 85.340  1.00 26.67 ? 491  THR B N     1 
ATOM   8661  C CA    . THR B 1 491 ? 70.417  141.718 86.338  1.00 27.39 ? 491  THR B CA    1 
ATOM   8662  C C     . THR B 1 491 ? 71.448  142.706 85.823  1.00 27.35 ? 491  THR B C     1 
ATOM   8663  O O     . THR B 1 491 ? 71.807  143.661 86.513  1.00 27.32 ? 491  THR B O     1 
ATOM   8664  C CB    . THR B 1 491 ? 71.082  140.366 86.581  1.00 27.18 ? 491  THR B CB    1 
ATOM   8665  O OG1   . THR B 1 491 ? 70.069  139.395 86.830  1.00 29.67 ? 491  THR B OG1   1 
ATOM   8666  C CG2   . THR B 1 491 ? 72.005  140.417 87.799  1.00 28.59 ? 491  THR B CG2   1 
ATOM   8667  N N     . PHE B 1 492 ? 71.895  142.484 84.589  1.00 26.82 ? 492  PHE B N     1 
ATOM   8668  C CA    . PHE B 1 492 ? 72.869  143.371 83.968  1.00 26.19 ? 492  PHE B CA    1 
ATOM   8669  C C     . PHE B 1 492 ? 72.238  143.996 82.718  1.00 26.29 ? 492  PHE B C     1 
ATOM   8670  O O     . PHE B 1 492 ? 71.990  143.294 81.721  1.00 25.56 ? 492  PHE B O     1 
ATOM   8671  C CB    . PHE B 1 492 ? 74.164  142.590 83.716  1.00 25.74 ? 492  PHE B CB    1 
ATOM   8672  C CG    . PHE B 1 492 ? 74.675  141.884 84.962  1.00 25.95 ? 492  PHE B CG    1 
ATOM   8673  C CD1   . PHE B 1 492 ? 74.703  140.495 85.041  1.00 22.84 ? 492  PHE B CD1   1 
ATOM   8674  C CD2   . PHE B 1 492 ? 75.082  142.626 86.076  1.00 24.18 ? 492  PHE B CD2   1 
ATOM   8675  C CE1   . PHE B 1 492 ? 75.135  139.857 86.186  1.00 23.97 ? 492  PHE B CE1   1 
ATOM   8676  C CE2   . PHE B 1 492 ? 75.515  141.997 87.235  1.00 23.38 ? 492  PHE B CE2   1 
ATOM   8677  C CZ    . PHE B 1 492 ? 75.539  140.605 87.294  1.00 24.34 ? 492  PHE B CZ    1 
ATOM   8678  N N     . LYS B 1 493 ? 71.930  145.299 82.793  1.00 26.05 ? 493  LYS B N     1 
ATOM   8679  C CA    . LYS B 1 493 ? 71.143  145.958 81.732  1.00 27.13 ? 493  LYS B CA    1 
ATOM   8680  C C     . LYS B 1 493 ? 71.798  145.782 80.362  1.00 26.89 ? 493  LYS B C     1 
ATOM   8681  O O     . LYS B 1 493 ? 73.009  145.973 80.227  1.00 26.22 ? 493  LYS B O     1 
ATOM   8682  C CB    . LYS B 1 493 ? 70.934  147.455 82.009  1.00 27.48 ? 493  LYS B CB    1 
ATOM   8683  C CG    . LYS B 1 493 ? 70.297  147.800 83.357  1.00 30.07 ? 493  LYS B CG    1 
ATOM   8684  C CD    . LYS B 1 493 ? 68.781  147.921 83.300  1.00 32.83 ? 493  LYS B CD    1 
ATOM   8685  C CE    . LYS B 1 493 ? 68.096  146.572 83.442  1.00 32.70 ? 493  LYS B CE    1 
ATOM   8686  N NZ    . LYS B 1 493 ? 67.810  146.228 84.861  1.00 34.39 ? 493  LYS B NZ    1 
ATOM   8687  N N     . ASN B 1 494 ? 70.987  145.405 79.365  1.00 27.14 ? 494  ASN B N     1 
ATOM   8688  C CA    . ASN B 1 494 ? 71.416  145.331 77.957  1.00 27.29 ? 494  ASN B CA    1 
ATOM   8689  C C     . ASN B 1 494 ? 72.324  144.157 77.624  1.00 26.74 ? 494  ASN B C     1 
ATOM   8690  O O     . ASN B 1 494 ? 72.999  144.165 76.593  1.00 25.99 ? 494  ASN B O     1 
ATOM   8691  C CB    . ASN B 1 494 ? 72.068  146.653 77.511  1.00 27.60 ? 494  ASN B CB    1 
ATOM   8692  C CG    . ASN B 1 494 ? 71.091  147.797 77.493  1.00 30.70 ? 494  ASN B CG    1 
ATOM   8693  O OD1   . ASN B 1 494 ? 69.964  147.644 77.025  1.00 35.59 ? 494  ASN B OD1   1 
ATOM   8694  N ND2   . ASN B 1 494 ? 71.508  148.956 78.006  1.00 32.25 ? 494  ASN B ND2   1 
ATOM   8695  N N     . MET B 1 495 ? 72.316  143.142 78.497  1.00 27.14 ? 495  MET B N     1 
ATOM   8696  C CA    . MET B 1 495 ? 73.206  141.993 78.411  1.00 27.16 ? 495  MET B CA    1 
ATOM   8697  C C     . MET B 1 495 ? 72.483  140.701 78.781  1.00 26.22 ? 495  MET B C     1 
ATOM   8698  O O     . MET B 1 495 ? 71.608  140.693 79.654  1.00 25.80 ? 495  MET B O     1 
ATOM   8699  C CB    . MET B 1 495 ? 74.373  142.166 79.383  1.00 27.64 ? 495  MET B CB    1 
ATOM   8700  C CG    . MET B 1 495 ? 75.450  143.205 79.001  1.00 28.31 ? 495  MET B CG    1 
ATOM   8701  S SD    . MET B 1 495 ? 76.499  143.413 80.478  1.00 31.20 ? 495  MET B SD    1 
ATOM   8702  C CE    . MET B 1 495 ? 78.130  143.458 79.750  1.00 32.77 ? 495  MET B CE    1 
ATOM   8703  N N     . TYR B 1 496 ? 72.876  139.607 78.124  1.00 24.75 ? 496  TYR B N     1 
ATOM   8704  C CA    . TYR B 1 496 ? 72.415  138.283 78.471  1.00 23.21 ? 496  TYR B CA    1 
ATOM   8705  C C     . TYR B 1 496 ? 73.223  137.742 79.643  1.00 23.21 ? 496  TYR B C     1 
ATOM   8706  O O     . TYR B 1 496 ? 74.433  137.517 79.525  1.00 22.87 ? 496  TYR B O     1 
ATOM   8707  C CB    . TYR B 1 496 ? 72.541  137.331 77.278  1.00 22.74 ? 496  TYR B CB    1 
ATOM   8708  C CG    . TYR B 1 496 ? 72.199  135.911 77.657  1.00 22.29 ? 496  TYR B CG    1 
ATOM   8709  C CD1   . TYR B 1 496 ? 70.861  135.513 77.824  1.00 21.13 ? 496  TYR B CD1   1 
ATOM   8710  C CD2   . TYR B 1 496 ? 73.213  134.973 77.893  1.00 19.82 ? 496  TYR B CD2   1 
ATOM   8711  C CE1   . TYR B 1 496 ? 70.542  134.210 78.190  1.00 22.32 ? 496  TYR B CE1   1 
ATOM   8712  C CE2   . TYR B 1 496 ? 72.912  133.659 78.255  1.00 21.78 ? 496  TYR B CE2   1 
ATOM   8713  C CZ    . TYR B 1 496 ? 71.576  133.282 78.406  1.00 22.38 ? 496  TYR B CZ    1 
ATOM   8714  O OH    . TYR B 1 496 ? 71.301  131.995 78.779  1.00 21.10 ? 496  TYR B OH    1 
ATOM   8715  N N     . PHE B 1 497 ? 72.559  137.537 80.775  1.00 22.67 ? 497  PHE B N     1 
ATOM   8716  C CA    . PHE B 1 497 ? 73.213  136.893 81.902  1.00 22.84 ? 497  PHE B CA    1 
ATOM   8717  C C     . PHE B 1 497 ? 72.971  135.385 81.861  1.00 23.07 ? 497  PHE B C     1 
ATOM   8718  O O     . PHE B 1 497 ? 71.833  134.922 81.939  1.00 23.04 ? 497  PHE B O     1 
ATOM   8719  C CB    . PHE B 1 497 ? 72.764  137.510 83.237  1.00 22.26 ? 497  PHE B CB    1 
ATOM   8720  C CG    . PHE B 1 497 ? 73.468  136.943 84.432  1.00 22.42 ? 497  PHE B CG    1 
ATOM   8721  C CD1   . PHE B 1 497 ? 74.805  136.550 84.355  1.00 21.42 ? 497  PHE B CD1   1 
ATOM   8722  C CD2   . PHE B 1 497 ? 72.801  136.797 85.647  1.00 23.16 ? 497  PHE B CD2   1 
ATOM   8723  C CE1   . PHE B 1 497 ? 75.451  136.016 85.461  1.00 20.42 ? 497  PHE B CE1   1 
ATOM   8724  C CE2   . PHE B 1 497 ? 73.459  136.256 86.761  1.00 22.49 ? 497  PHE B CE2   1 
ATOM   8725  C CZ    . PHE B 1 497 ? 74.772  135.871 86.661  1.00 20.70 ? 497  PHE B CZ    1 
ATOM   8726  N N     . SER B 1 498 ? 74.062  134.637 81.731  1.00 23.69 ? 498  SER B N     1 
ATOM   8727  C CA    . SER B 1 498 ? 74.047  133.175 81.697  1.00 24.18 ? 498  SER B CA    1 
ATOM   8728  C C     . SER B 1 498 ? 73.665  132.502 83.023  1.00 24.72 ? 498  SER B C     1 
ATOM   8729  O O     . SER B 1 498 ? 73.210  131.359 83.028  1.00 25.37 ? 498  SER B O     1 
ATOM   8730  C CB    . SER B 1 498 ? 75.432  132.663 81.293  1.00 24.43 ? 498  SER B CB    1 
ATOM   8731  O OG    . SER B 1 498 ? 76.356  132.832 82.370  1.00 22.48 ? 498  SER B OG    1 
ATOM   8732  N N     . GLY B 1 499 ? 73.880  133.181 84.150  1.00 24.67 ? 499  GLY B N     1 
ATOM   8733  C CA    . GLY B 1 499 ? 73.717  132.533 85.465  1.00 23.68 ? 499  GLY B CA    1 
ATOM   8734  C C     . GLY B 1 499 ? 74.972  131.794 85.926  1.00 23.50 ? 499  GLY B C     1 
ATOM   8735  O O     . GLY B 1 499 ? 75.020  131.287 87.037  1.00 23.51 ? 499  GLY B O     1 
ATOM   8736  N N     . ASP B 1 500 ? 75.987  131.730 85.065  1.00 22.95 ? 500  ASP B N     1 
ATOM   8737  C CA    . ASP B 1 500 ? 77.284  131.148 85.400  1.00 22.38 ? 500  ASP B CA    1 
ATOM   8738  C C     . ASP B 1 500 ? 78.311  132.180 85.809  1.00 22.59 ? 500  ASP B C     1 
ATOM   8739  O O     . ASP B 1 500 ? 78.274  133.316 85.347  1.00 21.77 ? 500  ASP B O     1 
ATOM   8740  C CB    . ASP B 1 500 ? 77.870  130.422 84.196  1.00 21.64 ? 500  ASP B CB    1 
ATOM   8741  C CG    . ASP B 1 500 ? 77.264  129.083 83.998  1.00 23.29 ? 500  ASP B CG    1 
ATOM   8742  O OD1   . ASP B 1 500 ? 77.161  128.348 84.995  1.00 22.92 ? 500  ASP B OD1   1 
ATOM   8743  O OD2   . ASP B 1 500 ? 76.893  128.765 82.846  1.00 24.06 ? 500  ASP B OD2   1 
ATOM   8744  N N     . GLY B 1 501 ? 79.240  131.751 86.662  1.00 22.68 ? 501  GLY B N     1 
ATOM   8745  C CA    . GLY B 1 501 ? 80.456  132.493 86.910  1.00 24.04 ? 501  GLY B CA    1 
ATOM   8746  C C     . GLY B 1 501 ? 81.581  131.884 86.092  1.00 25.04 ? 501  GLY B C     1 
ATOM   8747  O O     . GLY B 1 501 ? 81.535  130.699 85.705  1.00 24.32 ? 501  GLY B O     1 
ATOM   8748  N N     . ALA B 1 502 ? 82.595  132.698 85.816  1.00 26.18 ? 502  ALA B N     1 
ATOM   8749  C CA    . ALA B 1 502 ? 83.769  132.246 85.078  1.00 27.39 ? 502  ALA B CA    1 
ATOM   8750  C C     . ALA B 1 502 ? 84.958  133.148 85.351  1.00 28.75 ? 502  ALA B C     1 
ATOM   8751  O O     . ALA B 1 502 ? 84.802  134.301 85.795  1.00 29.64 ? 502  ALA B O     1 
ATOM   8752  C CB    . ALA B 1 502 ? 83.482  132.215 83.576  1.00 27.13 ? 502  ALA B CB    1 
ATOM   8753  N N     . ARG B 1 503 ? 86.140  132.619 85.070  1.00 29.48 ? 503  ARG B N     1 
ATOM   8754  C CA    . ARG B 1 503 ? 87.339  133.422 85.019  1.00 30.84 ? 503  ARG B CA    1 
ATOM   8755  C C     . ARG B 1 503 ? 87.917  133.414 83.607  1.00 29.96 ? 503  ARG B C     1 
ATOM   8756  O O     . ARG B 1 503 ? 87.603  132.543 82.799  1.00 30.24 ? 503  ARG B O     1 
ATOM   8757  C CB    . ARG B 1 503 ? 88.372  132.986 86.086  1.00 30.81 ? 503  ARG B CB    1 
ATOM   8758  C CG    . ARG B 1 503 ? 88.922  131.582 85.960  1.00 33.03 ? 503  ARG B CG    1 
ATOM   8759  C CD    . ARG B 1 503 ? 89.897  131.250 87.128  1.00 33.50 ? 503  ARG B CD    1 
ATOM   8760  N NE    . ARG B 1 503 ? 90.492  129.912 86.999  1.00 38.21 ? 503  ARG B NE    1 
ATOM   8761  C CZ    . ARG B 1 503 ? 89.926  128.783 87.441  1.00 40.34 ? 503  ARG B CZ    1 
ATOM   8762  N NH1   . ARG B 1 503 ? 88.749  128.819 88.061  1.00 41.26 ? 503  ARG B NH1   1 
ATOM   8763  N NH2   . ARG B 1 503 ? 90.542  127.614 87.278  1.00 40.44 ? 503  ARG B NH2   1 
ATOM   8764  N N     . ARG B 1 504 ? 88.731  134.415 83.314  1.00 29.17 ? 504  ARG B N     1 
ATOM   8765  C CA    . ARG B 1 504 ? 89.396  134.518 82.037  1.00 28.91 ? 504  ARG B CA    1 
ATOM   8766  C C     . ARG B 1 504 ? 90.854  134.756 82.379  1.00 29.15 ? 504  ARG B C     1 
ATOM   8767  O O     . ARG B 1 504 ? 91.166  135.717 83.075  1.00 29.48 ? 504  ARG B O     1 
ATOM   8768  C CB    . ARG B 1 504 ? 88.808  135.688 81.230  1.00 29.02 ? 504  ARG B CB    1 
ATOM   8769  C CG    . ARG B 1 504 ? 89.524  136.023 79.900  1.00 28.63 ? 504  ARG B CG    1 
ATOM   8770  C CD    . ARG B 1 504 ? 88.864  137.214 79.190  1.00 27.92 ? 504  ARG B CD    1 
ATOM   8771  N NE    . ARG B 1 504 ? 88.970  138.426 80.001  1.00 27.75 ? 504  ARG B NE    1 
ATOM   8772  C CZ    . ARG B 1 504 ? 87.956  139.216 80.351  1.00 27.83 ? 504  ARG B CZ    1 
ATOM   8773  N NH1   . ARG B 1 504 ? 86.719  138.963 79.925  1.00 28.27 ? 504  ARG B NH1   1 
ATOM   8774  N NH2   . ARG B 1 504 ? 88.188  140.283 81.110  1.00 26.50 ? 504  ARG B NH2   1 
ATOM   8775  N N     . ASP B 1 505 ? 91.735  133.858 81.940  1.00 28.81 ? 505  ASP B N     1 
ATOM   8776  C CA    . ASP B 1 505 ? 93.157  133.998 82.225  1.00 28.99 ? 505  ASP B CA    1 
ATOM   8777  C C     . ASP B 1 505 ? 93.806  135.029 81.287  1.00 29.63 ? 505  ASP B C     1 
ATOM   8778  O O     . ASP B 1 505 ? 93.128  135.598 80.404  1.00 29.23 ? 505  ASP B O     1 
ATOM   8779  C CB    . ASP B 1 505 ? 93.893  132.635 82.211  1.00 28.62 ? 505  ASP B CB    1 
ATOM   8780  C CG    . ASP B 1 505 ? 93.839  131.929 80.858  1.00 28.42 ? 505  ASP B CG    1 
ATOM   8781  O OD1   . ASP B 1 505 ? 93.699  132.610 79.828  1.00 27.85 ? 505  ASP B OD1   1 
ATOM   8782  O OD2   . ASP B 1 505 ? 93.946  130.680 80.818  1.00 27.78 ? 505  ASP B OD2   1 
ATOM   8783  N N     . GLU B 1 506 ? 95.107  135.261 81.500  1.00 30.21 ? 506  GLU B N     1 
ATOM   8784  C CA    . GLU B 1 506 ? 95.912  136.203 80.719  1.00 30.68 ? 506  GLU B CA    1 
ATOM   8785  C C     . GLU B 1 506 ? 95.815  135.981 79.201  1.00 30.88 ? 506  GLU B C     1 
ATOM   8786  O O     . GLU B 1 506 ? 95.946  136.939 78.426  1.00 30.83 ? 506  GLU B O     1 
ATOM   8787  C CB    . GLU B 1 506 ? 97.384  136.140 81.169  1.00 30.88 ? 506  GLU B CB    1 
ATOM   8788  N N     . ASP B 1 507 ? 95.582  134.729 78.786  1.00 30.68 ? 507  ASP B N     1 
ATOM   8789  C CA    . ASP B 1 507 ? 95.486  134.390 77.350  1.00 30.59 ? 507  ASP B CA    1 
ATOM   8790  C C     . ASP B 1 507 ? 94.118  134.610 76.736  1.00 29.66 ? 507  ASP B C     1 
ATOM   8791  O O     . ASP B 1 507 ? 93.953  134.416 75.536  1.00 29.06 ? 507  ASP B O     1 
ATOM   8792  C CB    . ASP B 1 507 ? 95.883  132.931 77.098  1.00 31.24 ? 507  ASP B CB    1 
ATOM   8793  C CG    . ASP B 1 507 ? 97.374  132.710 77.163  1.00 32.51 ? 507  ASP B CG    1 
ATOM   8794  O OD1   . ASP B 1 507 ? 98.120  133.695 77.313  1.00 34.57 ? 507  ASP B OD1   1 
ATOM   8795  O OD2   . ASP B 1 507 ? 97.799  131.545 77.053  1.00 34.95 ? 507  ASP B OD2   1 
ATOM   8796  N N     . GLY B 1 508 ? 93.137  134.975 77.559  1.00 29.45 ? 508  GLY B N     1 
ATOM   8797  C CA    . GLY B 1 508 ? 91.748  135.155 77.090  1.00 28.64 ? 508  GLY B CA    1 
ATOM   8798  C C     . GLY B 1 508 ? 90.915  133.877 77.122  1.00 27.96 ? 508  GLY B C     1 
ATOM   8799  O O     . GLY B 1 508 ? 89.832  133.824 76.551  1.00 27.41 ? 508  GLY B O     1 
ATOM   8800  N N     . TYR B 1 509 ? 91.428  132.844 77.783  1.00 27.47 ? 509  TYR B N     1 
ATOM   8801  C CA    . TYR B 1 509 ? 90.723  131.578 77.911  1.00 27.28 ? 509  TYR B CA    1 
ATOM   8802  C C     . TYR B 1 509 ? 89.729  131.625 79.055  1.00 27.16 ? 509  TYR B C     1 
ATOM   8803  O O     . TYR B 1 509 ? 90.040  132.135 80.141  1.00 27.10 ? 509  TYR B O     1 
ATOM   8804  C CB    . TYR B 1 509 ? 91.707  130.454 78.179  1.00 27.35 ? 509  TYR B CB    1 
ATOM   8805  C CG    . TYR B 1 509 ? 92.398  129.913 76.950  1.00 28.41 ? 509  TYR B CG    1 
ATOM   8806  C CD1   . TYR B 1 509 ? 92.986  130.767 76.013  1.00 27.53 ? 509  TYR B CD1   1 
ATOM   8807  C CD2   . TYR B 1 509 ? 92.485  128.540 76.736  1.00 27.11 ? 509  TYR B CD2   1 
ATOM   8808  C CE1   . TYR B 1 509 ? 93.633  130.253 74.889  1.00 29.18 ? 509  TYR B CE1   1 
ATOM   8809  C CE2   . TYR B 1 509 ? 93.130  128.022 75.624  1.00 27.75 ? 509  TYR B CE2   1 
ATOM   8810  C CZ    . TYR B 1 509 ? 93.697  128.877 74.706  1.00 27.88 ? 509  TYR B CZ    1 
ATOM   8811  O OH    . TYR B 1 509 ? 94.331  128.350 73.602  1.00 29.26 ? 509  TYR B OH    1 
ATOM   8812  N N     . TYR B 1 510 ? 88.543  131.070 78.828  1.00 26.10 ? 510  TYR B N     1 
ATOM   8813  C CA    . TYR B 1 510 ? 87.525  131.097 79.860  1.00 25.83 ? 510  TYR B CA    1 
ATOM   8814  C C     . TYR B 1 510 ? 87.511  129.798 80.635  1.00 26.13 ? 510  TYR B C     1 
ATOM   8815  O O     . TYR B 1 510 ? 87.712  128.708 80.083  1.00 26.23 ? 510  TYR B O     1 
ATOM   8816  C CB    . TYR B 1 510 ? 86.134  131.438 79.294  1.00 25.38 ? 510  TYR B CB    1 
ATOM   8817  C CG    . TYR B 1 510 ? 85.988  132.884 78.862  1.00 24.03 ? 510  TYR B CG    1 
ATOM   8818  C CD1   . TYR B 1 510 ? 86.412  133.303 77.594  1.00 23.35 ? 510  TYR B CD1   1 
ATOM   8819  C CD2   . TYR B 1 510 ? 85.419  133.827 79.711  1.00 23.92 ? 510  TYR B CD2   1 
ATOM   8820  C CE1   . TYR B 1 510 ? 86.281  134.640 77.184  1.00 21.89 ? 510  TYR B CE1   1 
ATOM   8821  C CE2   . TYR B 1 510 ? 85.294  135.175 79.320  1.00 23.47 ? 510  TYR B CE2   1 
ATOM   8822  C CZ    . TYR B 1 510 ? 85.724  135.563 78.055  1.00 23.82 ? 510  TYR B CZ    1 
ATOM   8823  O OH    . TYR B 1 510 ? 85.590  136.877 77.668  1.00 25.34 ? 510  TYR B OH    1 
ATOM   8824  N N     . TRP B 1 511 ? 87.279  129.937 81.928  1.00 26.38 ? 511  TRP B N     1 
ATOM   8825  C CA    . TRP B 1 511 ? 87.192  128.806 82.823  1.00 27.32 ? 511  TRP B CA    1 
ATOM   8826  C C     . TRP B 1 511 ? 85.852  128.963 83.509  1.00 27.89 ? 511  TRP B C     1 
ATOM   8827  O O     . TRP B 1 511 ? 85.628  129.950 84.213  1.00 27.91 ? 511  TRP B O     1 
ATOM   8828  C CB    . TRP B 1 511 ? 88.332  128.866 83.835  1.00 27.18 ? 511  TRP B CB    1 
ATOM   8829  C CG    . TRP B 1 511 ? 89.704  128.792 83.223  1.00 26.98 ? 511  TRP B CG    1 
ATOM   8830  C CD1   . TRP B 1 511 ? 90.400  129.807 82.646  1.00 26.19 ? 511  TRP B CD1   1 
ATOM   8831  C CD2   . TRP B 1 511 ? 90.543  127.632 83.145  1.00 28.23 ? 511  TRP B CD2   1 
ATOM   8832  N NE1   . TRP B 1 511 ? 91.619  129.362 82.203  1.00 26.40 ? 511  TRP B NE1   1 
ATOM   8833  C CE2   . TRP B 1 511 ? 91.743  128.029 82.506  1.00 28.21 ? 511  TRP B CE2   1 
ATOM   8834  C CE3   . TRP B 1 511 ? 90.408  126.300 83.576  1.00 27.85 ? 511  TRP B CE3   1 
ATOM   8835  C CZ2   . TRP B 1 511 ? 92.808  127.137 82.278  1.00 26.82 ? 511  TRP B CZ2   1 
ATOM   8836  C CZ3   . TRP B 1 511 ? 91.459  125.403 83.334  1.00 26.19 ? 511  TRP B CZ3   1 
ATOM   8837  C CH2   . TRP B 1 511 ? 92.642  125.829 82.692  1.00 27.43 ? 511  TRP B CH2   1 
ATOM   8838  N N     . ILE B 1 512 ? 84.943  128.026 83.264  1.00 28.27 ? 512  ILE B N     1 
ATOM   8839  C CA    . ILE B 1 512 ? 83.595  128.142 83.793  1.00 29.10 ? 512  ILE B CA    1 
ATOM   8840  C C     . ILE B 1 512 ? 83.580  127.579 85.212  1.00 30.15 ? 512  ILE B C     1 
ATOM   8841  O O     . ILE B 1 512 ? 83.841  126.399 85.409  1.00 30.76 ? 512  ILE B O     1 
ATOM   8842  C CB    . ILE B 1 512 ? 82.545  127.423 82.861  1.00 29.38 ? 512  ILE B CB    1 
ATOM   8843  C CG1   . ILE B 1 512 ? 82.758  127.825 81.387  1.00 27.60 ? 512  ILE B CG1   1 
ATOM   8844  C CG2   . ILE B 1 512 ? 81.077  127.680 83.331  1.00 28.54 ? 512  ILE B CG2   1 
ATOM   8845  C CD1   . ILE B 1 512 ? 82.359  129.265 81.052  1.00 23.80 ? 512  ILE B CD1   1 
ATOM   8846  N N     . THR B 1 513 ? 83.296  128.423 86.201  1.00 31.26 ? 513  THR B N     1 
ATOM   8847  C CA    . THR B 1 513 ? 83.314  127.956 87.590  1.00 33.05 ? 513  THR B CA    1 
ATOM   8848  C C     . THR B 1 513 ? 81.940  127.467 88.097  1.00 32.93 ? 513  THR B C     1 
ATOM   8849  O O     . THR B 1 513 ? 81.845  126.865 89.173  1.00 34.21 ? 513  THR B O     1 
ATOM   8850  C CB    . THR B 1 513 ? 83.955  128.986 88.565  1.00 33.38 ? 513  THR B CB    1 
ATOM   8851  O OG1   . THR B 1 513 ? 83.139  130.153 88.629  1.00 35.36 ? 513  THR B OG1   1 
ATOM   8852  C CG2   . THR B 1 513 ? 85.373  129.381 88.109  1.00 33.80 ? 513  THR B CG2   1 
ATOM   8853  N N     . GLY B 1 514 ? 80.886  127.688 87.321  1.00 32.15 ? 514  GLY B N     1 
ATOM   8854  C CA    . GLY B 1 514 ? 79.594  127.119 87.667  1.00 31.04 ? 514  GLY B CA    1 
ATOM   8855  C C     . GLY B 1 514 ? 78.573  128.143 88.076  1.00 30.25 ? 514  GLY B C     1 
ATOM   8856  O O     . GLY B 1 514 ? 78.875  129.325 88.174  1.00 31.12 ? 514  GLY B O     1 
ATOM   8857  N N     . ARG B 1 515 ? 77.350  127.684 88.300  1.00 29.33 ? 515  ARG B N     1 
ATOM   8858  C CA    . ARG B 1 515 ? 76.233  128.564 88.553  1.00 28.04 ? 515  ARG B CA    1 
ATOM   8859  C C     . ARG B 1 515 ? 76.491  129.472 89.765  1.00 27.67 ? 515  ARG B C     1 
ATOM   8860  O O     . ARG B 1 515 ? 77.041  129.041 90.786  1.00 26.52 ? 515  ARG B O     1 
ATOM   8861  C CB    . ARG B 1 515 ? 74.938  127.763 88.738  1.00 27.99 ? 515  ARG B CB    1 
ATOM   8862  C CG    . ARG B 1 515 ? 74.582  126.800 87.600  1.00 28.03 ? 515  ARG B CG    1 
ATOM   8863  C CD    . ARG B 1 515 ? 74.209  127.493 86.283  1.00 25.93 ? 515  ARG B CD    1 
ATOM   8864  N NE    . ARG B 1 515 ? 73.023  128.340 86.375  1.00 24.20 ? 515  ARG B NE    1 
ATOM   8865  C CZ    . ARG B 1 515 ? 72.221  128.605 85.339  1.00 24.05 ? 515  ARG B CZ    1 
ATOM   8866  N NH1   . ARG B 1 515 ? 72.464  128.081 84.132  1.00 21.60 ? 515  ARG B NH1   1 
ATOM   8867  N NH2   . ARG B 1 515 ? 71.166  129.392 85.505  1.00 23.51 ? 515  ARG B NH2   1 
ATOM   8868  N N     . VAL B 1 516 ? 76.097  130.731 89.626  1.00 26.59 ? 516  VAL B N     1 
ATOM   8869  C CA    . VAL B 1 516 ? 76.151  131.679 90.731  1.00 26.62 ? 516  VAL B CA    1 
ATOM   8870  C C     . VAL B 1 516 ? 74.723  131.954 91.232  1.00 26.54 ? 516  VAL B C     1 
ATOM   8871  O O     . VAL B 1 516 ? 74.523  132.651 92.221  1.00 26.48 ? 516  VAL B O     1 
ATOM   8872  C CB    . VAL B 1 516 ? 76.891  132.997 90.341  1.00 26.33 ? 516  VAL B CB    1 
ATOM   8873  C CG1   . VAL B 1 516 ? 78.364  132.722 90.122  1.00 26.86 ? 516  VAL B CG1   1 
ATOM   8874  C CG2   . VAL B 1 516 ? 76.266  133.662 89.102  1.00 25.17 ? 516  VAL B CG2   1 
ATOM   8875  N N     . ASP B 1 517 ? 73.736  131.411 90.522  1.00 26.70 ? 517  ASP B N     1 
ATOM   8876  C CA    . ASP B 1 517 ? 72.358  131.451 90.989  1.00 27.31 ? 517  ASP B CA    1 
ATOM   8877  C C     . ASP B 1 517 ? 72.066  130.139 91.725  1.00 27.54 ? 517  ASP B C     1 
ATOM   8878  O O     . ASP B 1 517 ? 73.001  129.381 91.991  1.00 27.33 ? 517  ASP B O     1 
ATOM   8879  C CB    . ASP B 1 517 ? 71.365  131.773 89.860  1.00 26.68 ? 517  ASP B CB    1 
ATOM   8880  C CG    . ASP B 1 517 ? 71.446  130.809 88.686  1.00 28.24 ? 517  ASP B CG    1 
ATOM   8881  O OD1   . ASP B 1 517 ? 70.636  130.991 87.740  1.00 29.80 ? 517  ASP B OD1   1 
ATOM   8882  O OD2   . ASP B 1 517 ? 72.286  129.883 88.676  1.00 27.85 ? 517  ASP B OD2   1 
ATOM   8883  N N     . ASP B 1 518 ? 70.806  129.883 92.080  1.00 28.18 ? 518  ASP B N     1 
ATOM   8884  C CA    . ASP B 1 518 ? 70.473  128.715 92.905  1.00 29.06 ? 518  ASP B CA    1 
ATOM   8885  C C     . ASP B 1 518 ? 70.130  127.509 92.027  1.00 28.49 ? 518  ASP B C     1 
ATOM   8886  O O     . ASP B 1 518 ? 69.037  126.947 92.127  1.00 28.47 ? 518  ASP B O     1 
ATOM   8887  C CB    . ASP B 1 518 ? 69.302  129.041 93.824  1.00 30.19 ? 518  ASP B CB    1 
ATOM   8888  C CG    . ASP B 1 518 ? 69.594  130.194 94.766  1.00 33.52 ? 518  ASP B CG    1 
ATOM   8889  O OD1   . ASP B 1 518 ? 70.663  130.178 95.430  1.00 36.46 ? 518  ASP B OD1   1 
ATOM   8890  O OD2   . ASP B 1 518 ? 68.743  131.124 94.821  1.00 37.94 ? 518  ASP B OD2   1 
ATOM   8891  N N     . VAL B 1 519 ? 71.046  127.163 91.124  1.00 27.56 ? 519  VAL B N     1 
ATOM   8892  C CA    . VAL B 1 519 ? 70.808  126.109 90.143  1.00 26.40 ? 519  VAL B CA    1 
ATOM   8893  C C     . VAL B 1 519 ? 71.847  125.054 90.405  1.00 26.61 ? 519  VAL B C     1 
ATOM   8894  O O     . VAL B 1 519 ? 73.042  125.337 90.415  1.00 26.17 ? 519  VAL B O     1 
ATOM   8895  C CB    . VAL B 1 519 ? 70.901  126.624 88.685  1.00 25.86 ? 519  VAL B CB    1 
ATOM   8896  C CG1   . VAL B 1 519 ? 70.901  125.496 87.683  1.00 25.54 ? 519  VAL B CG1   1 
ATOM   8897  C CG2   . VAL B 1 519 ? 69.775  127.584 88.379  1.00 25.69 ? 519  VAL B CG2   1 
ATOM   8898  N N     . LEU B 1 520 ? 71.384  123.832 90.623  1.00 26.79 ? 520  LEU B N     1 
ATOM   8899  C CA    . LEU B 1 520 ? 72.285  122.709 90.871  1.00 27.61 ? 520  LEU B CA    1 
ATOM   8900  C C     . LEU B 1 520 ? 72.766  122.023 89.598  1.00 27.58 ? 520  LEU B C     1 
ATOM   8901  O O     . LEU B 1 520 ? 72.077  122.017 88.570  1.00 27.99 ? 520  LEU B O     1 
ATOM   8902  C CB    . LEU B 1 520 ? 71.610  121.677 91.790  1.00 28.05 ? 520  LEU B CB    1 
ATOM   8903  C CG    . LEU B 1 520 ? 71.268  122.154 93.199  1.00 30.17 ? 520  LEU B CG    1 
ATOM   8904  C CD1   . LEU B 1 520 ? 70.870  120.978 94.057  1.00 30.17 ? 520  LEU B CD1   1 
ATOM   8905  C CD2   . LEU B 1 520 ? 72.466  122.884 93.826  1.00 31.92 ? 520  LEU B CD2   1 
ATOM   8906  N N     . ASN B 1 521 ? 73.946  121.424 89.683  1.00 27.65 ? 521  ASN B N     1 
ATOM   8907  C CA    . ASN B 1 521 ? 74.418  120.534 88.639  1.00 27.90 ? 521  ASN B CA    1 
ATOM   8908  C C     . ASN B 1 521 ? 74.637  119.120 89.211  1.00 27.58 ? 521  ASN B C     1 
ATOM   8909  O O     . ASN B 1 521 ? 75.642  118.831 89.879  1.00 26.58 ? 521  ASN B O     1 
ATOM   8910  C CB    . ASN B 1 521 ? 75.682  121.104 87.975  1.00 28.75 ? 521  ASN B CB    1 
ATOM   8911  C CG    . ASN B 1 521 ? 75.870  120.598 86.556  1.00 30.57 ? 521  ASN B CG    1 
ATOM   8912  O OD1   . ASN B 1 521 ? 76.115  121.389 85.631  1.00 32.49 ? 521  ASN B OD1   1 
ATOM   8913  N ND2   . ASN B 1 521 ? 75.738  119.274 86.370  1.00 29.39 ? 521  ASN B ND2   1 
ATOM   8914  N N     . VAL B 1 522 ? 73.652  118.258 88.977  1.00 27.22 ? 522  VAL B N     1 
ATOM   8915  C CA    . VAL B 1 522 ? 73.644  116.921 89.544  1.00 27.63 ? 522  VAL B CA    1 
ATOM   8916  C C     . VAL B 1 522 ? 73.708  115.906 88.415  1.00 28.23 ? 522  VAL B C     1 
ATOM   8917  O O     . VAL B 1 522 ? 72.751  115.774 87.643  1.00 28.20 ? 522  VAL B O     1 
ATOM   8918  C CB    . VAL B 1 522 ? 72.358  116.672 90.367  1.00 27.18 ? 522  VAL B CB    1 
ATOM   8919  C CG1   . VAL B 1 522 ? 72.481  115.383 91.203  1.00 27.34 ? 522  VAL B CG1   1 
ATOM   8920  C CG2   . VAL B 1 522 ? 72.048  117.864 91.244  1.00 26.83 ? 522  VAL B CG2   1 
ATOM   8921  N N     . SER B 1 523 ? 74.842  115.206 88.326  1.00 28.64 ? 523  SER B N     1 
ATOM   8922  C CA    . SER B 1 523 ? 75.089  114.167 87.337  1.00 29.06 ? 523  SER B CA    1 
ATOM   8923  C C     . SER B 1 523 ? 74.889  114.682 85.929  1.00 29.33 ? 523  SER B C     1 
ATOM   8924  O O     . SER B 1 523 ? 74.386  113.962 85.053  1.00 30.11 ? 523  SER B O     1 
ATOM   8925  C CB    . SER B 1 523 ? 74.195  112.958 87.601  1.00 29.00 ? 523  SER B CB    1 
ATOM   8926  O OG    . SER B 1 523 ? 74.600  112.333 88.797  1.00 31.86 ? 523  SER B OG    1 
ATOM   8927  N N     . GLY B 1 524 ? 75.268  115.937 85.718  1.00 29.12 ? 524  GLY B N     1 
ATOM   8928  C CA    . GLY B 1 524 ? 75.060  116.601 84.441  1.00 28.95 ? 524  GLY B CA    1 
ATOM   8929  C C     . GLY B 1 524 ? 73.658  117.149 84.221  1.00 28.69 ? 524  GLY B C     1 
ATOM   8930  O O     . GLY B 1 524 ? 73.378  117.676 83.157  1.00 29.02 ? 524  GLY B O     1 
ATOM   8931  N N     . HIS B 1 525 ? 72.780  117.013 85.214  1.00 27.88 ? 525  HIS B N     1 
ATOM   8932  C CA    . HIS B 1 525 ? 71.407  117.556 85.146  1.00 27.15 ? 525  HIS B CA    1 
ATOM   8933  C C     . HIS B 1 525 ? 71.247  118.892 85.870  1.00 26.33 ? 525  HIS B C     1 
ATOM   8934  O O     . HIS B 1 525 ? 71.628  119.038 87.048  1.00 26.38 ? 525  HIS B O     1 
ATOM   8935  C CB    . HIS B 1 525 ? 70.403  116.568 85.724  1.00 27.19 ? 525  HIS B CB    1 
ATOM   8936  C CG    . HIS B 1 525 ? 70.490  115.206 85.114  1.00 28.24 ? 525  HIS B CG    1 
ATOM   8937  N ND1   . HIS B 1 525 ? 70.838  114.086 85.842  1.00 29.97 ? 525  HIS B ND1   1 
ATOM   8938  C CD2   . HIS B 1 525 ? 70.296  114.787 83.841  1.00 28.33 ? 525  HIS B CD2   1 
ATOM   8939  C CE1   . HIS B 1 525 ? 70.840  113.031 85.042  1.00 30.17 ? 525  HIS B CE1   1 
ATOM   8940  N NE2   . HIS B 1 525 ? 70.513  113.430 83.824  1.00 30.06 ? 525  HIS B NE2   1 
ATOM   8941  N N     . ARG B 1 526 ? 70.662  119.848 85.163  1.00 24.79 ? 526  ARG B N     1 
ATOM   8942  C CA    . ARG B 1 526 ? 70.421  121.168 85.680  1.00 23.45 ? 526  ARG B CA    1 
ATOM   8943  C C     . ARG B 1 526 ? 69.098  121.148 86.452  1.00 24.09 ? 526  ARG B C     1 
ATOM   8944  O O     . ARG B 1 526 ? 68.054  120.760 85.914  1.00 23.58 ? 526  ARG B O     1 
ATOM   8945  C CB    . ARG B 1 526 ? 70.370  122.128 84.495  1.00 23.72 ? 526  ARG B CB    1 
ATOM   8946  C CG    . ARG B 1 526 ? 69.948  123.548 84.799  1.00 22.14 ? 526  ARG B CG    1 
ATOM   8947  C CD    . ARG B 1 526 ? 69.976  124.389 83.518  1.00 20.57 ? 526  ARG B CD    1 
ATOM   8948  N NE    . ARG B 1 526 ? 69.223  125.610 83.712  1.00 15.61 ? 526  ARG B NE    1 
ATOM   8949  C CZ    . ARG B 1 526 ? 69.164  126.620 82.850  1.00 14.04 ? 526  ARG B CZ    1 
ATOM   8950  N NH1   . ARG B 1 526 ? 69.801  126.571 81.694  1.00 11.05 ? 526  ARG B NH1   1 
ATOM   8951  N NH2   . ARG B 1 526 ? 68.436  127.681 83.149  1.00 11.08 ? 526  ARG B NH2   1 
ATOM   8952  N N     . LEU B 1 527 ? 69.149  121.557 87.714  1.00 25.04 ? 527  LEU B N     1 
ATOM   8953  C CA    . LEU B 1 527 ? 67.979  121.505 88.611  1.00 26.69 ? 527  LEU B CA    1 
ATOM   8954  C C     . LEU B 1 527 ? 67.871  122.740 89.482  1.00 27.33 ? 527  LEU B C     1 
ATOM   8955  O O     . LEU B 1 527 ? 68.875  123.263 89.965  1.00 27.72 ? 527  LEU B O     1 
ATOM   8956  C CB    . LEU B 1 527 ? 68.032  120.266 89.526  1.00 27.21 ? 527  LEU B CB    1 
ATOM   8957  C CG    . LEU B 1 527 ? 67.975  118.908 88.834  1.00 28.32 ? 527  LEU B CG    1 
ATOM   8958  C CD1   . LEU B 1 527 ? 68.316  117.760 89.802  1.00 28.98 ? 527  LEU B CD1   1 
ATOM   8959  C CD2   . LEU B 1 527 ? 66.596  118.741 88.237  1.00 29.60 ? 527  LEU B CD2   1 
ATOM   8960  N N     . GLY B 1 528 ? 66.637  123.171 89.709  1.00 27.95 ? 528  GLY B N     1 
ATOM   8961  C CA    . GLY B 1 528 ? 66.361  124.288 90.579  1.00 28.12 ? 528  GLY B CA    1 
ATOM   8962  C C     . GLY B 1 528 ? 66.352  123.895 92.041  1.00 29.00 ? 528  GLY B C     1 
ATOM   8963  O O     . GLY B 1 528 ? 65.677  122.944 92.460  1.00 29.12 ? 528  GLY B O     1 
ATOM   8964  N N     . THR B 1 529 ? 67.130  124.632 92.820  1.00 28.77 ? 529  THR B N     1 
ATOM   8965  C CA    . THR B 1 529 ? 67.076  124.554 94.260  1.00 28.83 ? 529  THR B CA    1 
ATOM   8966  C C     . THR B 1 529 ? 65.634  124.764 94.773  1.00 28.21 ? 529  THR B C     1 
ATOM   8967  O O     . THR B 1 529 ? 65.108  123.929 95.518  1.00 27.24 ? 529  THR B O     1 
ATOM   8968  C CB    . THR B 1 529 ? 68.087  125.561 94.818  1.00 29.01 ? 529  THR B CB    1 
ATOM   8969  O OG1   . THR B 1 529 ? 69.329  124.872 95.001  1.00 32.27 ? 529  THR B OG1   1 
ATOM   8970  C CG2   . THR B 1 529 ? 67.656  126.173 96.113  1.00 29.44 ? 529  THR B CG2   1 
ATOM   8971  N N     . ALA B 1 530 ? 65.001  125.862 94.343  1.00 27.36 ? 530  ALA B N     1 
ATOM   8972  C CA    . ALA B 1 530 ? 63.654  126.214 94.778  1.00 26.88 ? 530  ALA B CA    1 
ATOM   8973  C C     . ALA B 1 530 ? 62.648  125.127 94.403  1.00 26.76 ? 530  ALA B C     1 
ATOM   8974  O O     . ALA B 1 530 ? 61.818  124.743 95.219  1.00 27.25 ? 530  ALA B O     1 
ATOM   8975  C CB    . ALA B 1 530 ? 63.232  127.560 94.199  1.00 26.44 ? 530  ALA B CB    1 
ATOM   8976  N N     . GLU B 1 531 ? 62.723  124.605 93.179  1.00 26.18 ? 531  GLU B N     1 
ATOM   8977  C CA    . GLU B 1 531 ? 61.785  123.556 92.787  1.00 25.41 ? 531  GLU B CA    1 
ATOM   8978  C C     . GLU B 1 531 ? 61.854  122.286 93.658  1.00 23.66 ? 531  GLU B C     1 
ATOM   8979  O O     . GLU B 1 531 ? 60.831  121.680 93.956  1.00 23.62 ? 531  GLU B O     1 
ATOM   8980  C CB    . GLU B 1 531 ? 61.902  123.237 91.299  1.00 26.06 ? 531  GLU B CB    1 
ATOM   8981  C CG    . GLU B 1 531 ? 63.061  122.356 90.939  1.00 29.46 ? 531  GLU B CG    1 
ATOM   8982  C CD    . GLU B 1 531 ? 63.094  122.031 89.458  1.00 32.70 ? 531  GLU B CD    1 
ATOM   8983  O OE1   . GLU B 1 531 ? 62.226  121.259 88.978  1.00 34.95 ? 531  GLU B OE1   1 
ATOM   8984  O OE2   . GLU B 1 531 ? 63.999  122.543 88.790  1.00 32.60 ? 531  GLU B OE2   1 
ATOM   8985  N N     . ILE B 1 532 ? 63.047  121.883 94.064  1.00 22.72 ? 532  ILE B N     1 
ATOM   8986  C CA    . ILE B 1 532 ? 63.189  120.729 94.967  1.00 22.11 ? 532  ILE B CA    1 
ATOM   8987  C C     . ILE B 1 532 ? 62.643  121.042 96.350  1.00 21.44 ? 532  ILE B C     1 
ATOM   8988  O O     . ILE B 1 532 ? 61.965  120.214 96.938  1.00 21.42 ? 532  ILE B O     1 
ATOM   8989  C CB    . ILE B 1 532 ? 64.630  120.195 95.045  1.00 21.61 ? 532  ILE B CB    1 
ATOM   8990  C CG1   . ILE B 1 532 ? 65.091  119.785 93.640  1.00 21.00 ? 532  ILE B CG1   1 
ATOM   8991  C CG2   . ILE B 1 532 ? 64.696  118.983 96.031  1.00 20.97 ? 532  ILE B CG2   1 
ATOM   8992  C CD1   . ILE B 1 532 ? 66.590  119.668 93.491  1.00 22.04 ? 532  ILE B CD1   1 
ATOM   8993  N N     . GLU B 1 533 ? 62.931  122.250 96.836  1.00 21.80 ? 533  GLU B N     1 
ATOM   8994  C CA    . GLU B 1 533 ? 62.327  122.792 98.049  1.00 22.17 ? 533  GLU B CA    1 
ATOM   8995  C C     . GLU B 1 533 ? 60.813  122.816 97.972  1.00 22.72 ? 533  GLU B C     1 
ATOM   8996  O O     . GLU B 1 533 ? 60.145  122.381 98.905  1.00 23.17 ? 533  GLU B O     1 
ATOM   8997  C CB    . GLU B 1 533 ? 62.852  124.199 98.334  1.00 22.15 ? 533  GLU B CB    1 
ATOM   8998  C CG    . GLU B 1 533 ? 64.295  124.186 98.738  1.00 21.94 ? 533  GLU B CG    1 
ATOM   8999  C CD    . GLU B 1 533 ? 64.932  125.556 98.804  1.00 22.73 ? 533  GLU B CD    1 
ATOM   9000  O OE1   . GLU B 1 533 ? 64.253  126.572 98.566  1.00 23.09 ? 533  GLU B OE1   1 
ATOM   9001  O OE2   . GLU B 1 533 ? 66.145  125.604 99.093  1.00 24.17 ? 533  GLU B OE2   1 
ATOM   9002  N N     . SER B 1 534 ? 60.268  123.284 96.856  1.00 22.77 ? 534  SER B N     1 
ATOM   9003  C CA    . SER B 1 534 ? 58.810  123.277 96.689  1.00 23.85 ? 534  SER B CA    1 
ATOM   9004  C C     . SER B 1 534 ? 58.197  121.880 96.728  1.00 22.60 ? 534  SER B C     1 
ATOM   9005  O O     . SER B 1 534 ? 57.142  121.680 97.350  1.00 22.79 ? 534  SER B O     1 
ATOM   9006  C CB    . SER B 1 534 ? 58.395  123.993 95.403  1.00 23.36 ? 534  SER B CB    1 
ATOM   9007  O OG    . SER B 1 534 ? 58.492  125.372 95.619  1.00 27.06 ? 534  SER B OG    1 
ATOM   9008  N N     . ALA B 1 535 ? 58.847  120.934 96.050  1.00 22.07 ? 535  ALA B N     1 
ATOM   9009  C CA    . ALA B 1 535 ? 58.428  119.522 96.084  1.00 21.77 ? 535  ALA B CA    1 
ATOM   9010  C C     . ALA B 1 535 ? 58.446  118.986 97.507  1.00 21.67 ? 535  ALA B C     1 
ATOM   9011  O O     . ALA B 1 535 ? 57.483  118.348 97.954  1.00 21.71 ? 535  ALA B O     1 
ATOM   9012  C CB    . ALA B 1 535 ? 59.307  118.679 95.198  1.00 21.24 ? 535  ALA B CB    1 
ATOM   9013  N N     . LEU B 1 536 ? 59.529  119.269 98.230  1.00 21.89 ? 536  LEU B N     1 
ATOM   9014  C CA    . LEU B 1 536 ? 59.652  118.845 99.636  1.00 21.74 ? 536  LEU B CA    1 
ATOM   9015  C C     . LEU B 1 536 ? 58.505  119.355 100.519 1.00 22.00 ? 536  LEU B C     1 
ATOM   9016  O O     . LEU B 1 536 ? 57.838  118.561 101.189 1.00 21.95 ? 536  LEU B O     1 
ATOM   9017  C CB    . LEU B 1 536 ? 61.022  119.246 100.220 1.00 21.33 ? 536  LEU B CB    1 
ATOM   9018  C CG    . LEU B 1 536 ? 62.202  118.412 99.698  1.00 20.50 ? 536  LEU B CG    1 
ATOM   9019  C CD1   . LEU B 1 536 ? 63.548  119.065 99.998  1.00 18.25 ? 536  LEU B CD1   1 
ATOM   9020  C CD2   . LEU B 1 536 ? 62.166  117.002 100.257 1.00 17.09 ? 536  LEU B CD2   1 
ATOM   9021  N N     . VAL B 1 537 ? 58.248  120.664 100.464 1.00 22.39 ? 537  VAL B N     1 
ATOM   9022  C CA    . VAL B 1 537 ? 57.337  121.337 101.394 1.00 22.52 ? 537  VAL B CA    1 
ATOM   9023  C C     . VAL B 1 537 ? 55.876  121.027 101.034 1.00 22.68 ? 537  VAL B C     1 
ATOM   9024  O O     . VAL B 1 537 ? 54.965  121.198 101.868 1.00 23.36 ? 537  VAL B O     1 
ATOM   9025  C CB    . VAL B 1 537 ? 57.603  122.884 101.451 1.00 23.37 ? 537  VAL B CB    1 
ATOM   9026  C CG1   . VAL B 1 537 ? 56.547  123.605 102.329 1.00 23.41 ? 537  VAL B CG1   1 
ATOM   9027  C CG2   . VAL B 1 537 ? 59.025  123.183 101.954 1.00 23.49 ? 537  VAL B CG2   1 
ATOM   9028  N N     . ALA B 1 538 ? 55.659  120.562 99.807  1.00 21.41 ? 538  ALA B N     1 
ATOM   9029  C CA    . ALA B 1 538 ? 54.374  119.984 99.422  1.00 21.38 ? 538  ALA B CA    1 
ATOM   9030  C C     . ALA B 1 538 ? 53.994  118.768 100.288 1.00 21.32 ? 538  ALA B C     1 
ATOM   9031  O O     . ALA B 1 538 ? 52.811  118.506 100.467 1.00 21.39 ? 538  ALA B O     1 
ATOM   9032  C CB    . ALA B 1 538 ? 54.363  119.607 97.925  1.00 20.63 ? 538  ALA B CB    1 
ATOM   9033  N N     . HIS B 1 539 ? 54.978  118.030 100.818 1.00 21.22 ? 539  HIS B N     1 
ATOM   9034  C CA    . HIS B 1 539 ? 54.691  116.859 101.650 1.00 21.37 ? 539  HIS B CA    1 
ATOM   9035  C C     . HIS B 1 539 ? 53.979  117.296 102.953 1.00 22.02 ? 539  HIS B C     1 
ATOM   9036  O O     . HIS B 1 539 ? 54.455  118.212 103.613 1.00 21.35 ? 539  HIS B O     1 
ATOM   9037  C CB    . HIS B 1 539 ? 55.977  116.115 102.014 1.00 21.26 ? 539  HIS B CB    1 
ATOM   9038  C CG    . HIS B 1 539 ? 55.728  114.753 102.576 1.00 21.42 ? 539  HIS B CG    1 
ATOM   9039  N ND1   . HIS B 1 539 ? 55.307  114.548 103.873 1.00 22.98 ? 539  HIS B ND1   1 
ATOM   9040  C CD2   . HIS B 1 539 ? 55.772  113.533 101.998 1.00 18.83 ? 539  HIS B CD2   1 
ATOM   9041  C CE1   . HIS B 1 539 ? 55.118  113.257 104.070 1.00 21.19 ? 539  HIS B CE1   1 
ATOM   9042  N NE2   . HIS B 1 539 ? 55.383  112.622 102.944 1.00 19.08 ? 539  HIS B NE2   1 
ATOM   9043  N N     . PRO B 1 540 ? 52.875  116.605 103.348 1.00 22.56 ? 540  PRO B N     1 
ATOM   9044  C CA    . PRO B 1 540 ? 52.074  117.079 104.485 1.00 23.08 ? 540  PRO B CA    1 
ATOM   9045  C C     . PRO B 1 540 ? 52.816  117.038 105.840 1.00 23.67 ? 540  PRO B C     1 
ATOM   9046  O O     . PRO B 1 540 ? 52.395  117.708 106.784 1.00 23.98 ? 540  PRO B O     1 
ATOM   9047  C CB    . PRO B 1 540 ? 50.846  116.140 104.496 1.00 23.50 ? 540  PRO B CB    1 
ATOM   9048  C CG    . PRO B 1 540 ? 50.912  115.358 103.189 1.00 24.20 ? 540  PRO B CG    1 
ATOM   9049  C CD    . PRO B 1 540 ? 52.355  115.342 102.789 1.00 22.16 ? 540  PRO B CD    1 
ATOM   9050  N N     . LYS B 1 541 ? 53.918  116.295 105.929 1.00 23.60 ? 541  LYS B N     1 
ATOM   9051  C CA    . LYS B 1 541 ? 54.703  116.239 107.175 1.00 24.20 ? 541  LYS B CA    1 
ATOM   9052  C C     . LYS B 1 541 ? 55.898  117.220 107.213 1.00 24.15 ? 541  LYS B C     1 
ATOM   9053  O O     . LYS B 1 541 ? 56.606  117.321 108.229 1.00 24.08 ? 541  LYS B O     1 
ATOM   9054  C CB    . LYS B 1 541 ? 55.174  114.805 107.443 1.00 23.90 ? 541  LYS B CB    1 
ATOM   9055  C CG    . LYS B 1 541 ? 54.026  113.800 107.661 1.00 24.71 ? 541  LYS B CG    1 
ATOM   9056  C CD    . LYS B 1 541 ? 54.591  112.397 107.856 1.00 25.58 ? 541  LYS B CD    1 
ATOM   9057  C CE    . LYS B 1 541 ? 53.487  111.329 107.942 1.00 29.74 ? 541  LYS B CE    1 
ATOM   9058  N NZ    . LYS B 1 541 ? 54.093  109.939 107.849 1.00 31.03 ? 541  LYS B NZ    1 
ATOM   9059  N N     . ILE B 1 542 ? 56.106  117.946 106.110 1.00 23.87 ? 542  ILE B N     1 
ATOM   9060  C CA    . ILE B 1 542 ? 57.253  118.841 105.992 1.00 23.61 ? 542  ILE B CA    1 
ATOM   9061  C C     . ILE B 1 542 ? 56.824  120.277 106.057 1.00 23.62 ? 542  ILE B C     1 
ATOM   9062  O O     . ILE B 1 542 ? 55.938  120.698 105.317 1.00 23.53 ? 542  ILE B O     1 
ATOM   9063  C CB    . ILE B 1 542 ? 58.119  118.562 104.722 1.00 23.54 ? 542  ILE B CB    1 
ATOM   9064  C CG1   . ILE B 1 542 ? 58.802  117.194 104.863 1.00 22.24 ? 542  ILE B CG1   1 
ATOM   9065  C CG2   . ILE B 1 542 ? 59.151  119.692 104.510 1.00 22.68 ? 542  ILE B CG2   1 
ATOM   9066  C CD1   . ILE B 1 542 ? 59.407  116.654 103.581 1.00 23.39 ? 542  ILE B CD1   1 
ATOM   9067  N N     . ALA B 1 543 ? 57.469  121.011 106.962 1.00 23.83 ? 543  ALA B N     1 
ATOM   9068  C CA    . ALA B 1 543 ? 57.186  122.419 107.192 1.00 24.11 ? 543  ALA B CA    1 
ATOM   9069  C C     . ALA B 1 543 ? 58.040  123.343 106.312 1.00 24.20 ? 543  ALA B C     1 
ATOM   9070  O O     . ALA B 1 543 ? 57.554  124.338 105.793 1.00 24.21 ? 543  ALA B O     1 
ATOM   9071  C CB    . ALA B 1 543 ? 57.399  122.745 108.661 1.00 24.35 ? 543  ALA B CB    1 
ATOM   9072  N N     . GLU B 1 544 ? 59.311  122.999 106.135 1.00 24.32 ? 544  GLU B N     1 
ATOM   9073  C CA    . GLU B 1 544 ? 60.261  123.904 105.498 1.00 24.66 ? 544  GLU B CA    1 
ATOM   9074  C C     . GLU B 1 544 ? 61.453  123.106 104.999 1.00 24.09 ? 544  GLU B C     1 
ATOM   9075  O O     . GLU B 1 544 ? 61.794  122.075 105.573 1.00 23.08 ? 544  GLU B O     1 
ATOM   9076  C CB    . GLU B 1 544 ? 60.740  124.921 106.548 1.00 25.17 ? 544  GLU B CB    1 
ATOM   9077  C CG    . GLU B 1 544 ? 60.935  126.297 106.024 1.00 29.45 ? 544  GLU B CG    1 
ATOM   9078  C CD    . GLU B 1 544 ? 61.203  127.315 107.127 1.00 32.47 ? 544  GLU B CD    1 
ATOM   9079  O OE1   . GLU B 1 544 ? 61.573  126.921 108.258 1.00 33.55 ? 544  GLU B OE1   1 
ATOM   9080  O OE2   . GLU B 1 544 ? 61.029  128.515 106.840 1.00 34.43 ? 544  GLU B OE2   1 
ATOM   9081  N N     . ALA B 1 545 ? 62.091  123.580 103.930 1.00 23.63 ? 545  ALA B N     1 
ATOM   9082  C CA    . ALA B 1 545 ? 63.238  122.870 103.388 1.00 23.16 ? 545  ALA B CA    1 
ATOM   9083  C C     . ALA B 1 545 ? 64.182  123.841 102.719 1.00 23.11 ? 545  ALA B C     1 
ATOM   9084  O O     . ALA B 1 545 ? 63.749  124.820 102.130 1.00 22.66 ? 545  ALA B O     1 
ATOM   9085  C CB    . ALA B 1 545 ? 62.799  121.772 102.407 1.00 22.79 ? 545  ALA B CB    1 
ATOM   9086  N N     . ALA B 1 546 ? 65.474  123.543 102.831 1.00 22.33 ? 546  ALA B N     1 
ATOM   9087  C CA    . ALA B 1 546 ? 66.511  124.315 102.194 1.00 22.85 ? 546  ALA B CA    1 
ATOM   9088  C C     . ALA B 1 546 ? 67.452  123.333 101.491 1.00 22.55 ? 546  ALA B C     1 
ATOM   9089  O O     . ALA B 1 546 ? 68.033  122.471 102.128 1.00 23.20 ? 546  ALA B O     1 
ATOM   9090  C CB    . ALA B 1 546 ? 67.243  125.165 103.231 1.00 21.77 ? 546  ALA B CB    1 
ATOM   9091  N N     . VAL B 1 547 ? 67.574  123.475 100.174 1.00 23.16 ? 547  VAL B N     1 
ATOM   9092  C CA    . VAL B 1 547 ? 68.332  122.544 99.330  1.00 23.10 ? 547  VAL B CA    1 
ATOM   9093  C C     . VAL B 1 547 ? 69.636  123.168 98.834  1.00 23.66 ? 547  VAL B C     1 
ATOM   9094  O O     . VAL B 1 547 ? 69.647  124.283 98.303  1.00 24.02 ? 547  VAL B O     1 
ATOM   9095  C CB    . VAL B 1 547 ? 67.488  122.034 98.135  1.00 22.23 ? 547  VAL B CB    1 
ATOM   9096  C CG1   . VAL B 1 547 ? 68.326  121.163 97.214  1.00 22.91 ? 547  VAL B CG1   1 
ATOM   9097  C CG2   . VAL B 1 547 ? 66.293  121.220 98.636  1.00 22.12 ? 547  VAL B CG2   1 
ATOM   9098  N N     . VAL B 1 548 ? 70.732  122.435 99.018  1.00 24.39 ? 548  VAL B N     1 
ATOM   9099  C CA    . VAL B 1 548 ? 72.052  122.832 98.516  1.00 24.52 ? 548  VAL B CA    1 
ATOM   9100  C C     . VAL B 1 548 ? 72.719  121.681 97.760  1.00 24.98 ? 548  VAL B C     1 
ATOM   9101  O O     . VAL B 1 548 ? 72.351  120.500 97.910  1.00 25.16 ? 548  VAL B O     1 
ATOM   9102  C CB    . VAL B 1 548 ? 72.999  123.288 99.660  1.00 24.72 ? 548  VAL B CB    1 
ATOM   9103  C CG1   . VAL B 1 548 ? 72.471  124.546 100.339 1.00 25.16 ? 548  VAL B CG1   1 
ATOM   9104  C CG2   . VAL B 1 548 ? 73.213  122.178 100.671 1.00 23.56 ? 548  VAL B CG2   1 
ATOM   9105  N N     . GLY B 1 549 ? 73.699  122.028 96.941  1.00 24.99 ? 549  GLY B N     1 
ATOM   9106  C CA    . GLY B 1 549 ? 74.549  121.037 96.308  1.00 25.46 ? 549  GLY B CA    1 
ATOM   9107  C C     . GLY B 1 549 ? 75.843  120.963 97.092  1.00 26.07 ? 549  GLY B C     1 
ATOM   9108  O O     . GLY B 1 549 ? 76.331  121.979 97.601  1.00 26.24 ? 549  GLY B O     1 
ATOM   9109  N N     . ILE B 1 550 ? 76.369  119.750 97.228  1.00 26.20 ? 550  ILE B N     1 
ATOM   9110  C CA    . ILE B 1 550 ? 77.666  119.515 97.851  1.00 26.89 ? 550  ILE B CA    1 
ATOM   9111  C C     . ILE B 1 550 ? 78.525  118.747 96.859  1.00 26.71 ? 550  ILE B C     1 
ATOM   9112  O O     . ILE B 1 550 ? 77.982  118.035 96.021  1.00 26.57 ? 550  ILE B O     1 
ATOM   9113  C CB    . ILE B 1 550 ? 77.552  118.731 99.197  1.00 26.98 ? 550  ILE B CB    1 
ATOM   9114  C CG1   . ILE B 1 550 ? 76.772  117.422 99.033  1.00 27.94 ? 550  ILE B CG1   1 
ATOM   9115  C CG2   . ILE B 1 550 ? 76.875  119.601 100.247 1.00 28.78 ? 550  ILE B CG2   1 
ATOM   9116  C CD1   . ILE B 1 550 ? 77.113  116.366 100.063 1.00 31.12 ? 550  ILE B CD1   1 
ATOM   9117  N N     . PRO B 1 551 ? 79.862  118.907 96.938  1.00 27.00 ? 551  PRO B N     1 
ATOM   9118  C CA    . PRO B 1 551 ? 80.773  118.182 96.063  1.00 27.36 ? 551  PRO B CA    1 
ATOM   9119  C C     . PRO B 1 551 ? 80.566  116.674 96.152  1.00 27.70 ? 551  PRO B C     1 
ATOM   9120  O O     . PRO B 1 551 ? 80.347  116.136 97.249  1.00 28.47 ? 551  PRO B O     1 
ATOM   9121  C CB    . PRO B 1 551 ? 82.152  118.558 96.615  1.00 27.51 ? 551  PRO B CB    1 
ATOM   9122  C CG    . PRO B 1 551 ? 81.944  119.896 97.203  1.00 27.49 ? 551  PRO B CG    1 
ATOM   9123  C CD    . PRO B 1 551 ? 80.595  119.809 97.844  1.00 26.83 ? 551  PRO B CD    1 
ATOM   9124  N N     . HIS B 1 552 ? 80.602  116.015 94.996  1.00 27.31 ? 552  HIS B N     1 
ATOM   9125  C CA    . HIS B 1 552 ? 80.550  114.571 94.905  1.00 26.90 ? 552  HIS B CA    1 
ATOM   9126  C C     . HIS B 1 552 ? 81.508  114.163 93.801  1.00 26.95 ? 552  HIS B C     1 
ATOM   9127  O O     . HIS B 1 552 ? 81.459  114.711 92.705  1.00 26.79 ? 552  HIS B O     1 
ATOM   9128  C CB    . HIS B 1 552 ? 79.135  114.095 94.571  1.00 27.19 ? 552  HIS B CB    1 
ATOM   9129  C CG    . HIS B 1 552 ? 78.996  112.609 94.579  1.00 27.15 ? 552  HIS B CG    1 
ATOM   9130  N ND1   . HIS B 1 552 ? 78.469  111.913 95.649  1.00 29.36 ? 552  HIS B ND1   1 
ATOM   9131  C CD2   . HIS B 1 552 ? 79.374  111.678 93.672  1.00 26.63 ? 552  HIS B CD2   1 
ATOM   9132  C CE1   . HIS B 1 552 ? 78.506  110.617 95.387  1.00 28.64 ? 552  HIS B CE1   1 
ATOM   9133  N NE2   . HIS B 1 552 ? 79.053  110.449 94.193  1.00 27.09 ? 552  HIS B NE2   1 
ATOM   9134  N N     . ALA B 1 553 ? 82.377  113.194 94.082  1.00 27.07 ? 553  ALA B N     1 
ATOM   9135  C CA    . ALA B 1 553 ? 83.452  112.834 93.158  1.00 27.50 ? 553  ALA B CA    1 
ATOM   9136  C C     . ALA B 1 553 ? 82.971  112.293 91.813  1.00 27.27 ? 553  ALA B C     1 
ATOM   9137  O O     . ALA B 1 553 ? 83.674  112.428 90.820  1.00 27.75 ? 553  ALA B O     1 
ATOM   9138  C CB    . ALA B 1 553 ? 84.475  111.872 93.819  1.00 27.37 ? 553  ALA B CB    1 
ATOM   9139  N N     . ILE B 1 554 ? 81.785  111.694 91.779  1.00 27.28 ? 554  ILE B N     1 
ATOM   9140  C CA    . ILE B 1 554 ? 81.218  111.149 90.525  1.00 27.54 ? 554  ILE B CA    1 
ATOM   9141  C C     . ILE B 1 554 ? 80.131  112.058 89.921  1.00 26.88 ? 554  ILE B C     1 
ATOM   9142  O O     . ILE B 1 554 ? 80.204  112.420 88.741  1.00 26.56 ? 554  ILE B O     1 
ATOM   9143  C CB    . ILE B 1 554 ? 80.646  109.698 90.700  1.00 27.67 ? 554  ILE B CB    1 
ATOM   9144  C CG1   . ILE B 1 554 ? 81.710  108.697 91.195  1.00 28.64 ? 554  ILE B CG1   1 
ATOM   9145  C CG2   . ILE B 1 554 ? 80.008  109.190 89.412  1.00 29.35 ? 554  ILE B CG2   1 
ATOM   9146  C CD1   . ILE B 1 554 ? 83.056  108.808 90.529  1.00 31.05 ? 554  ILE B CD1   1 
ATOM   9147  N N     . LYS B 1 555 ? 79.139  112.401 90.749  1.00 25.83 ? 555  LYS B N     1 
ATOM   9148  C CA    . LYS B 1 555 ? 77.963  113.173 90.363  1.00 25.26 ? 555  LYS B CA    1 
ATOM   9149  C C     . LYS B 1 555 ? 78.267  114.671 90.111  1.00 24.15 ? 555  LYS B C     1 
ATOM   9150  O O     . LYS B 1 555 ? 77.460  115.381 89.510  1.00 23.53 ? 555  LYS B O     1 
ATOM   9151  C CB    . LYS B 1 555 ? 76.908  113.076 91.463  1.00 24.84 ? 555  LYS B CB    1 
ATOM   9152  C CG    . LYS B 1 555 ? 76.236  111.719 91.683  1.00 27.41 ? 555  LYS B CG    1 
ATOM   9153  C CD    . LYS B 1 555 ? 75.231  111.859 92.864  1.00 26.77 ? 555  LYS B CD    1 
ATOM   9154  C CE    . LYS B 1 555 ? 74.271  110.685 92.971  1.00 33.22 ? 555  LYS B CE    1 
ATOM   9155  N NZ    . LYS B 1 555 ? 74.807  109.541 93.802  1.00 35.06 ? 555  LYS B NZ    1 
ATOM   9156  N N     . GLY B 1 556 ? 79.412  115.141 90.595  1.00 23.64 ? 556  GLY B N     1 
ATOM   9157  C CA    . GLY B 1 556 ? 79.778  116.563 90.555  1.00 23.65 ? 556  GLY B CA    1 
ATOM   9158  C C     . GLY B 1 556 ? 79.197  117.272 91.755  1.00 23.45 ? 556  GLY B C     1 
ATOM   9159  O O     . GLY B 1 556 ? 79.932  117.738 92.618  1.00 23.88 ? 556  GLY B O     1 
ATOM   9160  N N     . GLN B 1 557 ? 77.872  117.355 91.806  1.00 23.46 ? 557  GLN B N     1 
ATOM   9161  C CA    . GLN B 1 557 ? 77.145  117.774 93.015  1.00 23.99 ? 557  GLN B CA    1 
ATOM   9162  C C     . GLN B 1 557 ? 76.132  116.687 93.382  1.00 24.12 ? 557  GLN B C     1 
ATOM   9163  O O     . GLN B 1 557 ? 75.472  116.116 92.492  1.00 23.55 ? 557  GLN B O     1 
ATOM   9164  C CB    . GLN B 1 557 ? 76.391  119.099 92.804  1.00 23.84 ? 557  GLN B CB    1 
ATOM   9165  C CG    . GLN B 1 557 ? 77.262  120.345 92.625  1.00 23.63 ? 557  GLN B CG    1 
ATOM   9166  C CD    . GLN B 1 557 ? 76.426  121.605 92.642  1.00 25.31 ? 557  GLN B CD    1 
ATOM   9167  O OE1   . GLN B 1 557 ? 75.541  121.774 91.808  1.00 28.41 ? 557  GLN B OE1   1 
ATOM   9168  N NE2   . GLN B 1 557 ? 76.669  122.479 93.613  1.00 25.12 ? 557  GLN B NE2   1 
ATOM   9169  N N     . ALA B 1 558 ? 76.027  116.408 94.683  1.00 24.07 ? 558  ALA B N     1 
ATOM   9170  C CA    . ALA B 1 558 ? 74.929  115.619 95.234  1.00 23.95 ? 558  ALA B CA    1 
ATOM   9171  C C     . ALA B 1 558 ? 73.945  116.576 95.894  1.00 24.27 ? 558  ALA B C     1 
ATOM   9172  O O     . ALA B 1 558 ? 74.315  117.686 96.258  1.00 24.04 ? 558  ALA B O     1 
ATOM   9173  C CB    . ALA B 1 558 ? 75.445  114.600 96.256  1.00 23.91 ? 558  ALA B CB    1 
ATOM   9174  N N     . ILE B 1 559 ? 72.701  116.125 96.058  1.00 24.70 ? 559  ILE B N     1 
ATOM   9175  C CA    . ILE B 1 559 ? 71.625  116.957 96.578  1.00 24.49 ? 559  ILE B CA    1 
ATOM   9176  C C     . ILE B 1 559 ? 71.534  116.791 98.084  1.00 24.33 ? 559  ILE B C     1 
ATOM   9177  O O     . ILE B 1 559 ? 71.359  115.678 98.571  1.00 24.59 ? 559  ILE B O     1 
ATOM   9178  C CB    . ILE B 1 559 ? 70.268  116.626 95.899  1.00 24.73 ? 559  ILE B CB    1 
ATOM   9179  C CG1   . ILE B 1 559 ? 70.339  116.972 94.405  1.00 25.21 ? 559  ILE B CG1   1 
ATOM   9180  C CG2   . ILE B 1 559 ? 69.118  117.419 96.563  1.00 23.78 ? 559  ILE B CG2   1 
ATOM   9181  C CD1   . ILE B 1 559 ? 69.320  116.267 93.506  1.00 24.18 ? 559  ILE B CD1   1 
ATOM   9182  N N     . TYR B 1 560 ? 71.674  117.899 98.809  1.00 23.47 ? 560  TYR B N     1 
ATOM   9183  C CA    . TYR B 1 560 ? 71.682  117.877 100.254 1.00 23.32 ? 560  TYR B CA    1 
ATOM   9184  C C     . TYR B 1 560 ? 70.516  118.743 100.724 1.00 22.98 ? 560  TYR B C     1 
ATOM   9185  O O     . TYR B 1 560 ? 70.508  119.950 100.503 1.00 23.14 ? 560  TYR B O     1 
ATOM   9186  C CB    . TYR B 1 560 ? 73.034  118.388 100.779 1.00 23.74 ? 560  TYR B CB    1 
ATOM   9187  C CG    . TYR B 1 560 ? 73.274  118.288 102.274 1.00 23.97 ? 560  TYR B CG    1 
ATOM   9188  C CD1   . TYR B 1 560 ? 72.538  119.057 103.179 1.00 24.98 ? 560  TYR B CD1   1 
ATOM   9189  C CD2   . TYR B 1 560 ? 74.274  117.453 102.783 1.00 25.28 ? 560  TYR B CD2   1 
ATOM   9190  C CE1   . TYR B 1 560 ? 72.778  118.983 104.570 1.00 24.23 ? 560  TYR B CE1   1 
ATOM   9191  C CE2   . TYR B 1 560 ? 74.516  117.356 104.167 1.00 24.19 ? 560  TYR B CE2   1 
ATOM   9192  C CZ    . TYR B 1 560 ? 73.766  118.136 105.052 1.00 25.08 ? 560  TYR B CZ    1 
ATOM   9193  O OH    . TYR B 1 560 ? 73.998  118.061 106.420 1.00 25.22 ? 560  TYR B OH    1 
ATOM   9194  N N     . ALA B 1 561 ? 69.536  118.103 101.359 1.00 22.20 ? 561  ALA B N     1 
ATOM   9195  C CA    . ALA B 1 561 ? 68.300  118.737 101.775 1.00 21.84 ? 561  ALA B CA    1 
ATOM   9196  C C     . ALA B 1 561 ? 68.186  118.854 103.306 1.00 22.40 ? 561  ALA B C     1 
ATOM   9197  O O     . ALA B 1 561 ? 68.111  117.846 104.017 1.00 21.88 ? 561  ALA B O     1 
ATOM   9198  C CB    . ALA B 1 561 ? 67.124  117.985 101.212 1.00 21.08 ? 561  ALA B CB    1 
ATOM   9199  N N     . TYR B 1 562 ? 68.184  120.097 103.798 1.00 22.77 ? 562  TYR B N     1 
ATOM   9200  C CA    . TYR B 1 562 ? 67.840  120.384 105.196 1.00 23.03 ? 562  TYR B CA    1 
ATOM   9201  C C     . TYR B 1 562 ? 66.322  120.434 105.283 1.00 22.78 ? 562  TYR B C     1 
ATOM   9202  O O     . TYR B 1 562 ? 65.693  121.183 104.559 1.00 23.27 ? 562  TYR B O     1 
ATOM   9203  C CB    . TYR B 1 562 ? 68.367  121.756 105.625 1.00 23.19 ? 562  TYR B CB    1 
ATOM   9204  C CG    . TYR B 1 562 ? 69.850  121.905 105.659 1.00 22.41 ? 562  TYR B CG    1 
ATOM   9205  C CD1   . TYR B 1 562 ? 70.569  122.193 104.503 1.00 22.63 ? 562  TYR B CD1   1 
ATOM   9206  C CD2   . TYR B 1 562 ? 70.538  121.794 106.853 1.00 21.74 ? 562  TYR B CD2   1 
ATOM   9207  C CE1   . TYR B 1 562 ? 71.938  122.355 104.540 1.00 23.41 ? 562  TYR B CE1   1 
ATOM   9208  C CE2   . TYR B 1 562 ? 71.907  121.955 106.898 1.00 22.23 ? 562  TYR B CE2   1 
ATOM   9209  C CZ    . TYR B 1 562 ? 72.600  122.239 105.749 1.00 23.48 ? 562  TYR B CZ    1 
ATOM   9210  O OH    . TYR B 1 562 ? 73.964  122.392 105.816 1.00 23.55 ? 562  TYR B OH    1 
ATOM   9211  N N     . VAL B 1 563 ? 65.738  119.658 106.177 1.00 23.07 ? 563  VAL B N     1 
ATOM   9212  C CA    . VAL B 1 563 ? 64.286  119.503 106.240 1.00 23.21 ? 563  VAL B CA    1 
ATOM   9213  C C     . VAL B 1 563 ? 63.810  119.731 107.664 1.00 23.65 ? 563  VAL B C     1 
ATOM   9214  O O     . VAL B 1 563 ? 64.358  119.164 108.607 1.00 23.90 ? 563  VAL B O     1 
ATOM   9215  C CB    . VAL B 1 563 ? 63.843  118.105 105.737 1.00 23.19 ? 563  VAL B CB    1 
ATOM   9216  C CG1   . VAL B 1 563 ? 62.341  117.897 105.937 1.00 22.87 ? 563  VAL B CG1   1 
ATOM   9217  C CG2   . VAL B 1 563 ? 64.183  117.942 104.272 1.00 22.93 ? 563  VAL B CG2   1 
ATOM   9218  N N     . THR B 1 564 ? 62.822  120.611 107.809 1.00 23.97 ? 564  THR B N     1 
ATOM   9219  C CA    . THR B 1 564 ? 62.177  120.863 109.078 1.00 24.25 ? 564  THR B CA    1 
ATOM   9220  C C     . THR B 1 564 ? 60.791  120.225 109.020 1.00 24.00 ? 564  THR B C     1 
ATOM   9221  O O     . THR B 1 564 ? 60.012  120.523 108.113 1.00 23.63 ? 564  THR B O     1 
ATOM   9222  C CB    . THR B 1 564 ? 62.055  122.362 109.347 1.00 24.43 ? 564  THR B CB    1 
ATOM   9223  O OG1   . THR B 1 564 ? 63.360  122.926 109.453 1.00 25.72 ? 564  THR B OG1   1 
ATOM   9224  C CG2   . THR B 1 564 ? 61.305  122.628 110.672 1.00 25.38 ? 564  THR B CG2   1 
ATOM   9225  N N     . LEU B 1 565 ? 60.514  119.341 109.977 1.00 23.79 ? 565  LEU B N     1 
ATOM   9226  C CA    . LEU B 1 565 ? 59.253  118.605 110.047 1.00 24.18 ? 565  LEU B CA    1 
ATOM   9227  C C     . LEU B 1 565 ? 58.199  119.332 110.882 1.00 25.02 ? 565  LEU B C     1 
ATOM   9228  O O     . LEU B 1 565 ? 58.526  120.030 111.843 1.00 24.88 ? 565  LEU B O     1 
ATOM   9229  C CB    . LEU B 1 565 ? 59.489  117.198 110.627 1.00 23.79 ? 565  LEU B CB    1 
ATOM   9230  C CG    . LEU B 1 565 ? 60.406  116.238 109.836 1.00 23.96 ? 565  LEU B CG    1 
ATOM   9231  C CD1   . LEU B 1 565 ? 60.898  115.069 110.696 1.00 22.15 ? 565  LEU B CD1   1 
ATOM   9232  C CD2   . LEU B 1 565 ? 59.721  115.733 108.549 1.00 22.33 ? 565  LEU B CD2   1 
ATOM   9233  N N     . ASN B 1 566 ? 56.928  119.148 110.523 1.00 25.64 ? 566  ASN B N     1 
ATOM   9234  C CA    . ASN B 1 566 ? 55.834  119.560 111.390 1.00 26.62 ? 566  ASN B CA    1 
ATOM   9235  C C     . ASN B 1 566 ? 55.914  118.803 112.723 1.00 27.94 ? 566  ASN B C     1 
ATOM   9236  O O     . ASN B 1 566 ? 56.534  117.758 112.800 1.00 28.37 ? 566  ASN B O     1 
ATOM   9237  C CB    . ASN B 1 566 ? 54.490  119.330 110.693 1.00 25.83 ? 566  ASN B CB    1 
ATOM   9238  C CG    . ASN B 1 566 ? 54.263  120.298 109.524 1.00 25.64 ? 566  ASN B CG    1 
ATOM   9239  O OD1   . ASN B 1 566 ? 54.545  121.494 109.629 1.00 24.44 ? 566  ASN B OD1   1 
ATOM   9240  N ND2   . ASN B 1 566 ? 53.772  119.778 108.409 1.00 23.64 ? 566  ASN B ND2   1 
ATOM   9241  N N     . HIS B 1 567 ? 55.298  119.340 113.767 1.00 29.90 ? 567  HIS B N     1 
ATOM   9242  C CA    . HIS B 1 567 ? 55.262  118.690 115.084 1.00 31.58 ? 567  HIS B CA    1 
ATOM   9243  C C     . HIS B 1 567 ? 54.446  117.401 115.048 1.00 33.03 ? 567  HIS B C     1 
ATOM   9244  O O     . HIS B 1 567 ? 53.435  117.302 114.347 1.00 33.15 ? 567  HIS B O     1 
ATOM   9245  C CB    . HIS B 1 567 ? 54.677  119.638 116.128 1.00 31.05 ? 567  HIS B CB    1 
ATOM   9246  C CG    . HIS B 1 567 ? 55.546  120.818 116.415 1.00 30.88 ? 567  HIS B CG    1 
ATOM   9247  N ND1   . HIS B 1 567 ? 55.240  121.747 117.383 1.00 29.83 ? 567  HIS B ND1   1 
ATOM   9248  C CD2   . HIS B 1 567 ? 56.722  121.213 115.869 1.00 29.36 ? 567  HIS B CD2   1 
ATOM   9249  C CE1   . HIS B 1 567 ? 56.190  122.666 117.419 1.00 30.96 ? 567  HIS B CE1   1 
ATOM   9250  N NE2   . HIS B 1 567 ? 57.100  122.364 116.510 1.00 30.04 ? 567  HIS B NE2   1 
ATOM   9251  N N     . GLY B 1 568 ? 54.906  116.409 115.799 1.00 34.41 ? 568  GLY B N     1 
ATOM   9252  C CA    . GLY B 1 568 ? 54.239  115.112 115.833 1.00 35.93 ? 568  GLY B CA    1 
ATOM   9253  C C     . GLY B 1 568 ? 54.892  114.210 114.823 1.00 36.92 ? 568  GLY B C     1 
ATOM   9254  O O     . GLY B 1 568 ? 54.651  112.988 114.800 1.00 37.47 ? 568  GLY B O     1 
ATOM   9255  N N     . GLU B 1 569 ? 55.718  114.824 113.980 1.00 37.52 ? 569  GLU B N     1 
ATOM   9256  C CA    . GLU B 1 569 ? 56.454  114.101 112.943 1.00 38.06 ? 569  GLU B CA    1 
ATOM   9257  C C     . GLU B 1 569 ? 57.857  113.915 113.459 1.00 38.00 ? 569  GLU B C     1 
ATOM   9258  O O     . GLU B 1 569 ? 58.611  114.901 113.587 1.00 38.40 ? 569  GLU B O     1 
ATOM   9259  C CB    . GLU B 1 569 ? 56.492  114.870 111.617 1.00 37.96 ? 569  GLU B CB    1 
ATOM   9260  C CG    . GLU B 1 569 ? 55.187  115.547 111.222 1.00 39.26 ? 569  GLU B CG    1 
ATOM   9261  C CD    . GLU B 1 569 ? 54.001  114.598 111.226 1.00 41.72 ? 569  GLU B CD    1 
ATOM   9262  O OE1   . GLU B 1 569 ? 54.202  113.362 111.322 1.00 42.03 ? 569  GLU B OE1   1 
ATOM   9263  O OE2   . GLU B 1 569 ? 52.860  115.100 111.136 1.00 44.42 ? 569  GLU B OE2   1 
ATOM   9264  N N     . GLU B 1 570 ? 58.180  112.663 113.790 1.00 37.01 ? 570  GLU B N     1 
ATOM   9265  C CA    . GLU B 1 570 ? 59.520  112.287 114.224 1.00 36.44 ? 570  GLU B CA    1 
ATOM   9266  C C     . GLU B 1 570 ? 60.275  111.542 113.091 1.00 35.48 ? 570  GLU B C     1 
ATOM   9267  O O     . GLU B 1 570 ? 59.678  110.727 112.362 1.00 36.22 ? 570  GLU B O     1 
ATOM   9268  C CB    . GLU B 1 570 ? 59.447  111.444 115.515 1.00 36.77 ? 570  GLU B CB    1 
ATOM   9269  N N     . PRO B 1 571 ? 61.576  111.840 112.914 1.00 33.75 ? 571  PRO B N     1 
ATOM   9270  C CA    . PRO B 1 571 ? 62.400  111.093 111.943 1.00 32.11 ? 571  PRO B CA    1 
ATOM   9271  C C     . PRO B 1 571 ? 62.484  109.582 112.224 1.00 30.64 ? 571  PRO B C     1 
ATOM   9272  O O     . PRO B 1 571 ? 62.768  109.160 113.353 1.00 30.80 ? 571  PRO B O     1 
ATOM   9273  C CB    . PRO B 1 571 ? 63.780  111.733 112.083 1.00 32.20 ? 571  PRO B CB    1 
ATOM   9274  C CG    . PRO B 1 571 ? 63.510  113.124 112.645 1.00 33.07 ? 571  PRO B CG    1 
ATOM   9275  C CD    . PRO B 1 571 ? 62.331  112.930 113.566 1.00 33.84 ? 571  PRO B CD    1 
ATOM   9276  N N     . SER B 1 572 ? 62.222  108.783 111.199 1.00 28.09 ? 572  SER B N     1 
ATOM   9277  C CA    . SER B 1 572 ? 62.331  107.338 111.292 1.00 26.05 ? 572  SER B CA    1 
ATOM   9278  C C     . SER B 1 572 ? 62.892  106.825 109.974 1.00 24.44 ? 572  SER B C     1 
ATOM   9279  O O     . SER B 1 572 ? 62.988  107.579 109.011 1.00 24.32 ? 572  SER B O     1 
ATOM   9280  C CB    . SER B 1 572 ? 60.952  106.712 111.571 1.00 26.08 ? 572  SER B CB    1 
ATOM   9281  O OG    . SER B 1 572 ? 60.074  106.977 110.490 1.00 25.71 ? 572  SER B OG    1 
ATOM   9282  N N     . PRO B 1 573 ? 63.294  105.539 109.925 1.00 23.30 ? 573  PRO B N     1 
ATOM   9283  C CA    . PRO B 1 573 ? 63.618  104.963 108.627 1.00 22.01 ? 573  PRO B CA    1 
ATOM   9284  C C     . PRO B 1 573 ? 62.486  105.147 107.606 1.00 21.15 ? 573  PRO B C     1 
ATOM   9285  O O     . PRO B 1 573 ? 62.760  105.440 106.452 1.00 20.64 ? 573  PRO B O     1 
ATOM   9286  C CB    . PRO B 1 573 ? 63.823  103.483 108.957 1.00 21.84 ? 573  PRO B CB    1 
ATOM   9287  C CG    . PRO B 1 573 ? 64.334  103.510 110.367 1.00 22.68 ? 573  PRO B CG    1 
ATOM   9288  C CD    . PRO B 1 573 ? 63.511  104.572 111.024 1.00 22.67 ? 573  PRO B CD    1 
ATOM   9289  N N     . GLU B 1 574 ? 61.238  104.968 108.043 1.00 21.02 ? 574  GLU B N     1 
ATOM   9290  C CA    . GLU B 1 574 ? 60.066  105.084 107.184 1.00 21.26 ? 574  GLU B CA    1 
ATOM   9291  C C     . GLU B 1 574 ? 59.923  106.491 106.582 1.00 21.66 ? 574  GLU B C     1 
ATOM   9292  O O     . GLU B 1 574 ? 59.715  106.634 105.381 1.00 20.72 ? 574  GLU B O     1 
ATOM   9293  C CB    . GLU B 1 574 ? 58.787  104.700 107.954 1.00 21.64 ? 574  GLU B CB    1 
ATOM   9294  C CG    . GLU B 1 574 ? 57.503  104.651 107.086 1.00 22.47 ? 574  GLU B CG    1 
ATOM   9295  C CD    . GLU B 1 574 ? 56.900  106.033 106.743 1.00 25.10 ? 574  GLU B CD    1 
ATOM   9296  O OE1   . GLU B 1 574 ? 57.118  107.021 107.479 1.00 23.54 ? 574  GLU B OE1   1 
ATOM   9297  O OE2   . GLU B 1 574 ? 56.191  106.130 105.716 1.00 25.57 ? 574  GLU B OE2   1 
ATOM   9298  N N     . LEU B 1 575 ? 60.014  107.514 107.430 1.00 21.43 ? 575  LEU B N     1 
ATOM   9299  C CA    . LEU B 1 575 ? 59.854  108.882 106.991 1.00 22.59 ? 575  LEU B CA    1 
ATOM   9300  C C     . LEU B 1 575 ? 60.982  109.271 106.050 1.00 22.41 ? 575  LEU B C     1 
ATOM   9301  O O     . LEU B 1 575 ? 60.754  109.994 105.075 1.00 22.45 ? 575  LEU B O     1 
ATOM   9302  C CB    . LEU B 1 575 ? 59.768  109.838 108.194 1.00 22.45 ? 575  LEU B CB    1 
ATOM   9303  C CG    . LEU B 1 575 ? 59.432  111.308 107.892 1.00 24.94 ? 575  LEU B CG    1 
ATOM   9304  C CD1   . LEU B 1 575 ? 58.122  111.460 107.097 1.00 23.10 ? 575  LEU B CD1   1 
ATOM   9305  C CD2   . LEU B 1 575 ? 59.376  112.123 109.203 1.00 23.74 ? 575  LEU B CD2   1 
ATOM   9306  N N     . TYR B 1 576 ? 62.184  108.767 106.331 1.00 22.04 ? 576  TYR B N     1 
ATOM   9307  C CA    . TYR B 1 576 ? 63.337  108.994 105.488 1.00 22.31 ? 576  TYR B CA    1 
ATOM   9308  C C     . TYR B 1 576 ? 63.043  108.501 104.052 1.00 21.47 ? 576  TYR B C     1 
ATOM   9309  O O     . TYR B 1 576 ? 63.248  109.233 103.064 1.00 20.68 ? 576  TYR B O     1 
ATOM   9310  C CB    . TYR B 1 576 ? 64.572  108.271 106.072 1.00 24.21 ? 576  TYR B CB    1 
ATOM   9311  C CG    . TYR B 1 576 ? 65.881  108.862 105.613 1.00 26.02 ? 576  TYR B CG    1 
ATOM   9312  C CD1   . TYR B 1 576 ? 66.533  109.827 106.376 1.00 28.62 ? 576  TYR B CD1   1 
ATOM   9313  C CD2   . TYR B 1 576 ? 66.450  108.486 104.402 1.00 29.72 ? 576  TYR B CD2   1 
ATOM   9314  C CE1   . TYR B 1 576 ? 67.737  110.410 105.951 1.00 28.56 ? 576  TYR B CE1   1 
ATOM   9315  C CE2   . TYR B 1 576 ? 67.664  109.061 103.958 1.00 30.63 ? 576  TYR B CE2   1 
ATOM   9316  C CZ    . TYR B 1 576 ? 68.289  110.020 104.734 1.00 28.52 ? 576  TYR B CZ    1 
ATOM   9317  O OH    . TYR B 1 576 ? 69.475  110.586 104.300 1.00 29.17 ? 576  TYR B OH    1 
ATOM   9318  N N     . ALA B 1 577 ? 62.561  107.257 103.946 1.00 20.45 ? 577  ALA B N     1 
ATOM   9319  C CA    . ALA B 1 577 ? 62.236  106.660 102.645 1.00 19.30 ? 577  ALA B CA    1 
ATOM   9320  C C     . ALA B 1 577 ? 61.050  107.391 102.008 1.00 18.75 ? 577  ALA B C     1 
ATOM   9321  O O     . ALA B 1 577 ? 61.052  107.671 100.821 1.00 18.66 ? 577  ALA B O     1 
ATOM   9322  C CB    . ALA B 1 577 ? 61.954  105.159 102.782 1.00 18.03 ? 577  ALA B CB    1 
ATOM   9323  N N     . GLU B 1 578 ? 60.048  107.719 102.816 1.00 18.65 ? 578  GLU B N     1 
ATOM   9324  C CA    . GLU B 1 578 ? 58.854  108.385 102.322 1.00 18.96 ? 578  GLU B CA    1 
ATOM   9325  C C     . GLU B 1 578 ? 59.142  109.747 101.663 1.00 18.80 ? 578  GLU B C     1 
ATOM   9326  O O     . GLU B 1 578 ? 58.567  110.089 100.621 1.00 18.84 ? 578  GLU B O     1 
ATOM   9327  C CB    . GLU B 1 578 ? 57.850  108.545 103.448 1.00 18.37 ? 578  GLU B CB    1 
ATOM   9328  C CG    . GLU B 1 578 ? 56.466  108.882 102.944 1.00 20.06 ? 578  GLU B CG    1 
ATOM   9329  C CD    . GLU B 1 578 ? 55.526  109.223 104.044 1.00 21.99 ? 578  GLU B CD    1 
ATOM   9330  O OE1   . GLU B 1 578 ? 55.439  108.448 105.002 1.00 23.41 ? 578  GLU B OE1   1 
ATOM   9331  O OE2   . GLU B 1 578 ? 54.862  110.278 103.958 1.00 25.24 ? 578  GLU B OE2   1 
ATOM   9332  N N     . VAL B 1 579 ? 60.028  110.501 102.301 1.00 18.84 ? 579  VAL B N     1 
ATOM   9333  C CA    . VAL B 1 579 ? 60.448  111.824 101.860 1.00 19.45 ? 579  VAL B CA    1 
ATOM   9334  C C     . VAL B 1 579 ? 61.288  111.763 100.584 1.00 20.20 ? 579  VAL B C     1 
ATOM   9335  O O     . VAL B 1 579 ? 61.064  112.561 99.671  1.00 19.92 ? 579  VAL B O     1 
ATOM   9336  C CB    . VAL B 1 579 ? 61.145  112.600 103.012 1.00 19.06 ? 579  VAL B CB    1 
ATOM   9337  C CG1   . VAL B 1 579 ? 61.858  113.866 102.512 1.00 19.32 ? 579  VAL B CG1   1 
ATOM   9338  C CG2   . VAL B 1 579 ? 60.118  112.969 104.046 1.00 19.39 ? 579  VAL B CG2   1 
ATOM   9339  N N     . ARG B 1 580 ? 62.202  110.791 100.478 1.00 21.36 ? 580  ARG B N     1 
ATOM   9340  C CA    . ARG B 1 580 ? 62.963  110.647 99.227  1.00 22.61 ? 580  ARG B CA    1 
ATOM   9341  C C     . ARG B 1 580 ? 62.028  110.254 98.090  1.00 22.51 ? 580  ARG B C     1 
ATOM   9342  O O     . ARG B 1 580 ? 62.071  110.846 97.017  1.00 21.96 ? 580  ARG B O     1 
ATOM   9343  C CB    . ARG B 1 580 ? 64.115  109.644 99.357  1.00 22.90 ? 580  ARG B CB    1 
ATOM   9344  C CG    . ARG B 1 580 ? 65.224  110.068 100.330 1.00 24.51 ? 580  ARG B CG    1 
ATOM   9345  C CD    . ARG B 1 580 ? 66.395  109.075 100.355 1.00 25.45 ? 580  ARG B CD    1 
ATOM   9346  N NE    . ARG B 1 580 ? 67.258  109.285 99.200  1.00 31.88 ? 580  ARG B NE    1 
ATOM   9347  C CZ    . ARG B 1 580 ? 67.488  108.394 98.232  1.00 33.21 ? 580  ARG B CZ    1 
ATOM   9348  N NH1   . ARG B 1 580 ? 66.948  107.178 98.268  1.00 31.67 ? 580  ARG B NH1   1 
ATOM   9349  N NH2   . ARG B 1 580 ? 68.267  108.738 97.212  1.00 33.83 ? 580  ARG B NH2   1 
ATOM   9350  N N     . ASN B 1 581 ? 61.165  109.270 98.347  1.00 23.08 ? 581  ASN B N     1 
ATOM   9351  C CA    . ASN B 1 581 ? 60.221  108.806 97.346  1.00 23.61 ? 581  ASN B CA    1 
ATOM   9352  C C     . ASN B 1 581 ? 59.216  109.882 96.952  1.00 23.43 ? 581  ASN B C     1 
ATOM   9353  O O     . ASN B 1 581 ? 58.718  109.868 95.831  1.00 23.83 ? 581  ASN B O     1 
ATOM   9354  C CB    . ASN B 1 581 ? 59.521  107.524 97.805  1.00 24.51 ? 581  ASN B CB    1 
ATOM   9355  C CG    . ASN B 1 581 ? 60.453  106.288 97.753  1.00 26.48 ? 581  ASN B CG    1 
ATOM   9356  O OD1   . ASN B 1 581 ? 61.575  106.348 97.227  1.00 27.85 ? 581  ASN B OD1   1 
ATOM   9357  N ND2   . ASN B 1 581 ? 59.995  105.185 98.323  1.00 27.30 ? 581  ASN B ND2   1 
ATOM   9358  N N     . TRP B 1 582 ? 58.929  110.809 97.869  1.00 23.10 ? 582  TRP B N     1 
ATOM   9359  C CA    . TRP B 1 582 ? 58.053  111.951 97.568  1.00 23.24 ? 582  TRP B CA    1 
ATOM   9360  C C     . TRP B 1 582 ? 58.637  112.847 96.495  1.00 22.97 ? 582  TRP B C     1 
ATOM   9361  O O     . TRP B 1 582 ? 57.916  113.295 95.614  1.00 22.74 ? 582  TRP B O     1 
ATOM   9362  C CB    . TRP B 1 582 ? 57.791  112.805 98.811  1.00 23.11 ? 582  TRP B CB    1 
ATOM   9363  C CG    . TRP B 1 582 ? 56.857  113.973 98.575  1.00 23.11 ? 582  TRP B CG    1 
ATOM   9364  C CD1   . TRP B 1 582 ? 57.205  115.281 98.408  1.00 22.98 ? 582  TRP B CD1   1 
ATOM   9365  C CD2   . TRP B 1 582 ? 55.425  113.923 98.482  1.00 23.26 ? 582  TRP B CD2   1 
ATOM   9366  N NE1   . TRP B 1 582 ? 56.080  116.057 98.225  1.00 22.31 ? 582  TRP B NE1   1 
ATOM   9367  C CE2   . TRP B 1 582 ? 54.974  115.245 98.267  1.00 23.24 ? 582  TRP B CE2   1 
ATOM   9368  C CE3   . TRP B 1 582 ? 54.480  112.886 98.562  1.00 24.71 ? 582  TRP B CE3   1 
ATOM   9369  C CZ2   . TRP B 1 582 ? 53.616  115.562 98.131  1.00 23.15 ? 582  TRP B CZ2   1 
ATOM   9370  C CZ3   . TRP B 1 582 ? 53.128  113.199 98.435  1.00 23.85 ? 582  TRP B CZ3   1 
ATOM   9371  C CH2   . TRP B 1 582 ? 52.708  114.529 98.224  1.00 23.72 ? 582  TRP B CH2   1 
ATOM   9372  N N     . VAL B 1 583 ? 59.929  113.144 96.593  1.00 23.25 ? 583  VAL B N     1 
ATOM   9373  C CA    . VAL B 1 583 ? 60.590  113.953 95.565  1.00 23.52 ? 583  VAL B CA    1 
ATOM   9374  C C     . VAL B 1 583 ? 60.670  113.196 94.247  1.00 23.98 ? 583  VAL B C     1 
ATOM   9375  O O     . VAL B 1 583 ? 60.482  113.785 93.173  1.00 23.89 ? 583  VAL B O     1 
ATOM   9376  C CB    . VAL B 1 583 ? 61.985  114.452 95.984  1.00 23.84 ? 583  VAL B CB    1 
ATOM   9377  C CG1   . VAL B 1 583 ? 62.625  115.239 94.844  1.00 23.41 ? 583  VAL B CG1   1 
ATOM   9378  C CG2   . VAL B 1 583 ? 61.879  115.337 97.223  1.00 22.42 ? 583  VAL B CG2   1 
ATOM   9379  N N     . ARG B 1 584 ? 60.916  111.891 94.335  1.00 23.88 ? 584  ARG B N     1 
ATOM   9380  C CA    . ARG B 1 584 ? 60.878  111.013 93.168  1.00 24.18 ? 584  ARG B CA    1 
ATOM   9381  C C     . ARG B 1 584 ? 59.521  111.108 92.438  1.00 23.98 ? 584  ARG B C     1 
ATOM   9382  O O     . ARG B 1 584 ? 59.485  111.184 91.207  1.00 23.91 ? 584  ARG B O     1 
ATOM   9383  C CB    . ARG B 1 584 ? 61.145  109.566 93.597  1.00 23.70 ? 584  ARG B CB    1 
ATOM   9384  C CG    . ARG B 1 584 ? 61.576  108.659 92.460  1.00 26.89 ? 584  ARG B CG    1 
ATOM   9385  C CD    . ARG B 1 584 ? 61.411  107.194 92.823  1.00 30.66 ? 584  ARG B CD    1 
ATOM   9386  N NE    . ARG B 1 584 ? 62.136  106.320 91.899  1.00 35.17 ? 584  ARG B NE    1 
ATOM   9387  C CZ    . ARG B 1 584 ? 61.692  105.960 90.697  1.00 36.32 ? 584  ARG B CZ    1 
ATOM   9388  N NH1   . ARG B 1 584 ? 60.522  106.407 90.255  1.00 38.59 ? 584  ARG B NH1   1 
ATOM   9389  N NH2   . ARG B 1 584 ? 62.419  105.159 89.934  1.00 35.47 ? 584  ARG B NH2   1 
ATOM   9390  N N     . LYS B 1 585 ? 58.431  111.123 93.210  1.00 23.63 ? 585  LYS B N     1 
ATOM   9391  C CA    . LYS B 1 585 ? 57.056  111.251 92.703  1.00 24.58 ? 585  LYS B CA    1 
ATOM   9392  C C     . LYS B 1 585 ? 56.791  112.651 92.111  1.00 24.06 ? 585  LYS B C     1 
ATOM   9393  O O     . LYS B 1 585 ? 56.184  112.788 91.030  1.00 22.95 ? 585  LYS B O     1 
ATOM   9394  C CB    . LYS B 1 585 ? 56.044  110.958 93.824  1.00 24.62 ? 585  LYS B CB    1 
ATOM   9395  C CG    . LYS B 1 585 ? 54.567  111.231 93.453  1.00 26.90 ? 585  LYS B CG    1 
ATOM   9396  C CD    . LYS B 1 585 ? 53.618  111.398 94.695  1.00 27.13 ? 585  LYS B CD    1 
ATOM   9397  C CE    . LYS B 1 585 ? 52.166  110.949 94.340  1.00 30.04 ? 585  LYS B CE    1 
ATOM   9398  N NZ    . LYS B 1 585 ? 51.106  111.542 95.243  1.00 30.89 ? 585  LYS B NZ    1 
ATOM   9399  N N     . GLU B 1 586 ? 57.248  113.673 92.834  1.00 23.47 ? 586  GLU B N     1 
ATOM   9400  C CA    . GLU B 1 586 ? 57.051  115.070 92.449  1.00 23.85 ? 586  GLU B CA    1 
ATOM   9401  C C     . GLU B 1 586 ? 57.794  115.485 91.186  1.00 23.15 ? 586  GLU B C     1 
ATOM   9402  O O     . GLU B 1 586 ? 57.235  116.160 90.334  1.00 23.40 ? 586  GLU B O     1 
ATOM   9403  C CB    . GLU B 1 586 ? 57.445  116.006 93.596  1.00 23.87 ? 586  GLU B CB    1 
ATOM   9404  C CG    . GLU B 1 586 ? 56.516  115.933 94.811  1.00 25.43 ? 586  GLU B CG    1 
ATOM   9405  C CD    . GLU B 1 586 ? 55.083  116.261 94.456  1.00 30.44 ? 586  GLU B CD    1 
ATOM   9406  O OE1   . GLU B 1 586 ? 54.682  117.421 94.672  1.00 31.57 ? 586  GLU B OE1   1 
ATOM   9407  O OE2   . GLU B 1 586 ? 54.360  115.363 93.958  1.00 32.94 ? 586  GLU B OE2   1 
ATOM   9408  N N     . ILE B 1 587 ? 59.046  115.071 91.065  1.00 22.38 ? 587  ILE B N     1 
ATOM   9409  C CA    . ILE B 1 587 ? 59.885  115.524 89.966  1.00 21.71 ? 587  ILE B CA    1 
ATOM   9410  C C     . ILE B 1 587 ? 60.535  114.348 89.230  1.00 21.48 ? 587  ILE B C     1 
ATOM   9411  O O     . ILE B 1 587 ? 60.478  114.265 88.004  1.00 21.36 ? 587  ILE B O     1 
ATOM   9412  C CB    . ILE B 1 587 ? 60.978  116.470 90.466  1.00 22.14 ? 587  ILE B CB    1 
ATOM   9413  C CG1   . ILE B 1 587 ? 60.361  117.759 91.044  1.00 21.57 ? 587  ILE B CG1   1 
ATOM   9414  C CG2   . ILE B 1 587 ? 61.980  116.747 89.329  1.00 20.83 ? 587  ILE B CG2   1 
ATOM   9415  C CD1   . ILE B 1 587 ? 61.300  118.548 91.926  1.00 24.02 ? 587  ILE B CD1   1 
ATOM   9416  N N     . GLY B 1 588 ? 61.167  113.455 89.981  1.00 20.60 ? 588  GLY B N     1 
ATOM   9417  C CA    . GLY B 1 588 ? 61.814  112.300 89.380  1.00 21.45 ? 588  GLY B CA    1 
ATOM   9418  C C     . GLY B 1 588 ? 63.030  111.851 90.167  1.00 20.84 ? 588  GLY B C     1 
ATOM   9419  O O     . GLY B 1 588 ? 63.512  112.600 91.015  1.00 21.03 ? 588  GLY B O     1 
ATOM   9420  N N     . PRO B 1 589 ? 63.540  110.635 89.882  1.00 21.46 ? 589  PRO B N     1 
ATOM   9421  C CA    . PRO B 1 589 ? 64.683  110.113 90.651  1.00 22.33 ? 589  PRO B CA    1 
ATOM   9422  C C     . PRO B 1 589 ? 65.904  111.029 90.601  1.00 22.96 ? 589  PRO B C     1 
ATOM   9423  O O     . PRO B 1 589 ? 66.635  111.137 91.588  1.00 23.22 ? 589  PRO B O     1 
ATOM   9424  C CB    . PRO B 1 589 ? 64.993  108.769 89.974  1.00 22.16 ? 589  PRO B CB    1 
ATOM   9425  C CG    . PRO B 1 589 ? 63.732  108.378 89.292  1.00 22.58 ? 589  PRO B CG    1 
ATOM   9426  C CD    . PRO B 1 589 ? 63.085  109.674 88.857  1.00 21.28 ? 589  PRO B CD    1 
ATOM   9427  N N     . LEU B 1 590 ? 66.098  111.723 89.492  1.00 22.81 ? 590  LEU B N     1 
ATOM   9428  C CA    . LEU B 1 590 ? 67.264  112.591 89.369  1.00 25.39 ? 590  LEU B CA    1 
ATOM   9429  C C     . LEU B 1 590 ? 67.316  113.814 90.307  1.00 25.19 ? 590  LEU B C     1 
ATOM   9430  O O     . LEU B 1 590 ? 68.386  114.409 90.476  1.00 25.94 ? 590  LEU B O     1 
ATOM   9431  C CB    . LEU B 1 590 ? 67.499  112.959 87.903  1.00 25.76 ? 590  LEU B CB    1 
ATOM   9432  C CG    . LEU B 1 590 ? 67.936  111.649 87.213  1.00 30.05 ? 590  LEU B CG    1 
ATOM   9433  C CD1   . LEU B 1 590 ? 67.574  111.629 85.727  1.00 34.46 ? 590  LEU B CD1   1 
ATOM   9434  C CD2   . LEU B 1 590 ? 69.434  111.300 87.458  1.00 32.45 ? 590  LEU B CD2   1 
ATOM   9435  N N     . ALA B 1 591 ? 66.185  114.154 90.928  1.00 24.74 ? 591  ALA B N     1 
ATOM   9436  C CA    . ALA B 1 591 ? 66.108  115.277 91.854  1.00 25.22 ? 591  ALA B CA    1 
ATOM   9437  C C     . ALA B 1 591 ? 66.018  114.825 93.319  1.00 25.61 ? 591  ALA B C     1 
ATOM   9438  O O     . ALA B 1 591 ? 65.875  115.650 94.215  1.00 25.10 ? 591  ALA B O     1 
ATOM   9439  C CB    . ALA B 1 591 ? 64.921  116.153 91.507  1.00 24.77 ? 591  ALA B CB    1 
ATOM   9440  N N     . THR B 1 592 ? 66.106  113.512 93.543  1.00 26.42 ? 592  THR B N     1 
ATOM   9441  C CA    . THR B 1 592 ? 65.989  112.910 94.869  1.00 27.31 ? 592  THR B CA    1 
ATOM   9442  C C     . THR B 1 592 ? 67.163  113.319 95.753  1.00 26.55 ? 592  THR B C     1 
ATOM   9443  O O     . THR B 1 592 ? 68.318  113.086 95.382  1.00 25.93 ? 592  THR B O     1 
ATOM   9444  C CB    . THR B 1 592 ? 65.949  111.357 94.779  1.00 27.41 ? 592  THR B CB    1 
ATOM   9445  O OG1   . THR B 1 592 ? 65.044  110.976 93.743  1.00 31.60 ? 592  THR B OG1   1 
ATOM   9446  C CG2   . THR B 1 592 ? 65.476  110.750 96.078  1.00 27.65 ? 592  THR B CG2   1 
ATOM   9447  N N     . PRO B 1 593 ? 66.877  113.931 96.921  1.00 26.49 ? 593  PRO B N     1 
ATOM   9448  C CA    . PRO B 1 593 ? 67.989  114.277 97.815  1.00 26.18 ? 593  PRO B CA    1 
ATOM   9449  C C     . PRO B 1 593 ? 68.834  113.068 98.158  1.00 26.06 ? 593  PRO B C     1 
ATOM   9450  O O     . PRO B 1 593 ? 68.310  112.020 98.494  1.00 26.65 ? 593  PRO B O     1 
ATOM   9451  C CB    . PRO B 1 593 ? 67.305  114.807 99.076  1.00 26.37 ? 593  PRO B CB    1 
ATOM   9452  C CG    . PRO B 1 593 ? 65.921  115.174 98.654  1.00 26.40 ? 593  PRO B CG    1 
ATOM   9453  C CD    . PRO B 1 593 ? 65.566  114.324 97.467  1.00 26.58 ? 593  PRO B CD    1 
ATOM   9454  N N     . ASP B 1 594 ? 70.143  113.225 98.055  1.00 26.30 ? 594  ASP B N     1 
ATOM   9455  C CA    . ASP B 1 594 ? 71.078  112.198 98.442  1.00 26.32 ? 594  ASP B CA    1 
ATOM   9456  C C     . ASP B 1 594 ? 71.196  112.205 99.965  1.00 25.70 ? 594  ASP B C     1 
ATOM   9457  O O     . ASP B 1 594 ? 71.311  111.156 100.577 1.00 25.39 ? 594  ASP B O     1 
ATOM   9458  C CB    . ASP B 1 594 ? 72.429  112.439 97.741  1.00 26.82 ? 594  ASP B CB    1 
ATOM   9459  C CG    . ASP B 1 594 ? 72.312  112.341 96.212  1.00 28.93 ? 594  ASP B CG    1 
ATOM   9460  O OD1   . ASP B 1 594 ? 72.129  111.210 95.706  1.00 30.63 ? 594  ASP B OD1   1 
ATOM   9461  O OD2   . ASP B 1 594 ? 72.360  113.385 95.509  1.00 29.10 ? 594  ASP B OD2   1 
ATOM   9462  N N     . VAL B 1 595 ? 71.145  113.389 100.577 1.00 24.52 ? 595  VAL B N     1 
ATOM   9463  C CA    . VAL B 1 595 ? 71.201  113.506 102.046 1.00 23.59 ? 595  VAL B CA    1 
ATOM   9464  C C     . VAL B 1 595 ? 69.932  114.229 102.550 1.00 23.05 ? 595  VAL B C     1 
ATOM   9465  O O     . VAL B 1 595 ? 69.521  115.231 101.968 1.00 22.55 ? 595  VAL B O     1 
ATOM   9466  C CB    . VAL B 1 595 ? 72.490  114.243 102.542 1.00 23.27 ? 595  VAL B CB    1 
ATOM   9467  C CG1   . VAL B 1 595 ? 72.600  114.219 104.093 1.00 23.19 ? 595  VAL B CG1   1 
ATOM   9468  C CG2   . VAL B 1 595 ? 73.731  113.633 101.924 1.00 23.73 ? 595  VAL B CG2   1 
ATOM   9469  N N     . LEU B 1 596 ? 69.303  113.689 103.595 1.00 22.55 ? 596  LEU B N     1 
ATOM   9470  C CA    . LEU B 1 596 ? 68.249  114.402 104.319 1.00 22.61 ? 596  LEU B CA    1 
ATOM   9471  C C     . LEU B 1 596 ? 68.780  114.768 105.692 1.00 23.00 ? 596  LEU B C     1 
ATOM   9472  O O     . LEU B 1 596 ? 69.165  113.901 106.473 1.00 22.56 ? 596  LEU B O     1 
ATOM   9473  C CB    . LEU B 1 596 ? 66.951  113.586 104.423 1.00 22.39 ? 596  LEU B CB    1 
ATOM   9474  C CG    . LEU B 1 596 ? 66.159  113.287 103.142 1.00 22.26 ? 596  LEU B CG    1 
ATOM   9475  C CD1   . LEU B 1 596 ? 65.074  112.264 103.397 1.00 20.95 ? 596  LEU B CD1   1 
ATOM   9476  C CD2   . LEU B 1 596 ? 65.563  114.568 102.563 1.00 22.98 ? 596  LEU B CD2   1 
ATOM   9477  N N     . HIS B 1 597 ? 68.835  116.067 105.964 1.00 23.34 ? 597  HIS B N     1 
ATOM   9478  C CA    . HIS B 1 597 ? 69.316  116.583 107.248 1.00 24.36 ? 597  HIS B CA    1 
ATOM   9479  C C     . HIS B 1 597 ? 68.127  117.181 108.010 1.00 24.27 ? 597  HIS B C     1 
ATOM   9480  O O     . HIS B 1 597 ? 67.671  118.281 107.690 1.00 23.28 ? 597  HIS B O     1 
ATOM   9481  C CB    . HIS B 1 597 ? 70.410  117.629 106.985 1.00 24.31 ? 597  HIS B CB    1 
ATOM   9482  C CG    . HIS B 1 597 ? 70.878  118.365 108.201 1.00 26.76 ? 597  HIS B CG    1 
ATOM   9483  N ND1   . HIS B 1 597 ? 72.131  118.934 108.279 1.00 29.34 ? 597  HIS B ND1   1 
ATOM   9484  C CD2   . HIS B 1 597 ? 70.266  118.650 109.378 1.00 28.18 ? 597  HIS B CD2   1 
ATOM   9485  C CE1   . HIS B 1 597 ? 72.270  119.541 109.444 1.00 28.26 ? 597  HIS B CE1   1 
ATOM   9486  N NE2   . HIS B 1 597 ? 71.150  119.388 110.127 1.00 27.53 ? 597  HIS B NE2   1 
ATOM   9487  N N     . TRP B 1 598 ? 67.623  116.442 108.998 1.00 25.04 ? 598  TRP B N     1 
ATOM   9488  C CA    . TRP B 1 598 ? 66.488  116.902 109.804 1.00 27.14 ? 598  TRP B CA    1 
ATOM   9489  C C     . TRP B 1 598 ? 66.942  118.005 110.773 1.00 27.67 ? 598  TRP B C     1 
ATOM   9490  O O     . TRP B 1 598 ? 67.900  117.844 111.506 1.00 28.45 ? 598  TRP B O     1 
ATOM   9491  C CB    . TRP B 1 598 ? 65.847  115.766 110.613 1.00 27.21 ? 598  TRP B CB    1 
ATOM   9492  C CG    . TRP B 1 598 ? 65.603  114.479 109.889 1.00 27.03 ? 598  TRP B CG    1 
ATOM   9493  C CD1   . TRP B 1 598 ? 66.210  113.275 110.143 1.00 27.07 ? 598  TRP B CD1   1 
ATOM   9494  C CD2   . TRP B 1 598 ? 64.650  114.241 108.845 1.00 26.36 ? 598  TRP B CD2   1 
ATOM   9495  N NE1   . TRP B 1 598 ? 65.714  112.307 109.301 1.00 28.29 ? 598  TRP B NE1   1 
ATOM   9496  C CE2   . TRP B 1 598 ? 64.760  112.871 108.486 1.00 28.73 ? 598  TRP B CE2   1 
ATOM   9497  C CE3   . TRP B 1 598 ? 63.732  115.056 108.158 1.00 26.71 ? 598  TRP B CE3   1 
ATOM   9498  C CZ2   . TRP B 1 598 ? 63.964  112.287 107.477 1.00 27.02 ? 598  TRP B CZ2   1 
ATOM   9499  C CZ3   . TRP B 1 598 ? 62.945  114.486 107.146 1.00 26.87 ? 598  TRP B CZ3   1 
ATOM   9500  C CH2   . TRP B 1 598 ? 63.069  113.105 106.818 1.00 27.93 ? 598  TRP B CH2   1 
ATOM   9501  N N     . THR B 1 599 ? 66.250  119.121 110.777 1.00 29.04 ? 599  THR B N     1 
ATOM   9502  C CA    . THR B 1 599 ? 66.692  120.247 111.591 1.00 30.48 ? 599  THR B CA    1 
ATOM   9503  C C     . THR B 1 599 ? 65.532  121.146 111.978 1.00 31.62 ? 599  THR B C     1 
ATOM   9504  O O     . THR B 1 599 ? 64.531  121.231 111.251 1.00 31.61 ? 599  THR B O     1 
ATOM   9505  C CB    . THR B 1 599 ? 67.819  121.060 110.867 1.00 30.45 ? 599  THR B CB    1 
ATOM   9506  O OG1   . THR B 1 599 ? 68.476  121.910 111.811 1.00 31.98 ? 599  THR B OG1   1 
ATOM   9507  C CG2   . THR B 1 599 ? 67.281  121.888 109.686 1.00 28.45 ? 599  THR B CG2   1 
ATOM   9508  N N     . ASP B 1 600 ? 65.666  121.806 113.126 1.00 32.83 ? 600  ASP B N     1 
ATOM   9509  C CA    . ASP B 1 600 ? 64.743  122.881 113.519 1.00 34.47 ? 600  ASP B CA    1 
ATOM   9510  C C     . ASP B 1 600 ? 65.469  124.224 113.559 1.00 34.43 ? 600  ASP B C     1 
ATOM   9511  O O     . ASP B 1 600 ? 64.903  125.239 113.953 1.00 35.21 ? 600  ASP B O     1 
ATOM   9512  C CB    . ASP B 1 600 ? 64.097  122.574 114.870 1.00 34.85 ? 600  ASP B CB    1 
ATOM   9513  C CG    . ASP B 1 600 ? 63.176  121.375 114.804 1.00 37.39 ? 600  ASP B CG    1 
ATOM   9514  O OD1   . ASP B 1 600 ? 62.514  121.200 113.751 1.00 39.83 ? 600  ASP B OD1   1 
ATOM   9515  O OD2   . ASP B 1 600 ? 63.129  120.597 115.789 1.00 38.51 ? 600  ASP B OD2   1 
ATOM   9516  N N     . SER B 1 601 ? 66.729  124.209 113.135 1.00 34.48 ? 601  SER B N     1 
ATOM   9517  C CA    . SER B 1 601 ? 67.574  125.397 113.108 1.00 34.24 ? 601  SER B CA    1 
ATOM   9518  C C     . SER B 1 601 ? 67.866  125.939 111.696 1.00 33.47 ? 601  SER B C     1 
ATOM   9519  O O     . SER B 1 601 ? 69.040  126.208 111.379 1.00 34.40 ? 601  SER B O     1 
ATOM   9520  C CB    . SER B 1 601 ? 68.903  125.084 113.804 1.00 34.18 ? 601  SER B CB    1 
ATOM   9521  O OG    . SER B 1 601 ? 68.696  124.614 115.121 1.00 36.12 ? 601  SER B OG    1 
ATOM   9522  N N     . LEU B 1 602 ? 66.845  126.106 110.850 1.00 31.78 ? 602  LEU B N     1 
ATOM   9523  C CA    . LEU B 1 602 ? 67.058  126.821 109.568 1.00 30.39 ? 602  LEU B CA    1 
ATOM   9524  C C     . LEU B 1 602 ? 67.450  128.286 109.791 1.00 29.38 ? 602  LEU B C     1 
ATOM   9525  O O     . LEU B 1 602 ? 66.770  128.997 110.514 1.00 29.13 ? 602  LEU B O     1 
ATOM   9526  C CB    . LEU B 1 602 ? 65.858  126.708 108.600 1.00 29.93 ? 602  LEU B CB    1 
ATOM   9527  C CG    . LEU B 1 602 ? 65.659  125.360 107.867 1.00 29.90 ? 602  LEU B CG    1 
ATOM   9528  C CD1   . LEU B 1 602 ? 64.559  125.446 106.795 1.00 27.71 ? 602  LEU B CD1   1 
ATOM   9529  C CD2   . LEU B 1 602 ? 66.959  124.815 107.254 1.00 26.10 ? 602  LEU B CD2   1 
ATOM   9530  N N     . PRO B 1 603 ? 68.566  128.727 109.178 1.00 28.87 ? 603  PRO B N     1 
ATOM   9531  C CA    . PRO B 1 603 ? 69.055  130.100 109.359 1.00 28.67 ? 603  PRO B CA    1 
ATOM   9532  C C     . PRO B 1 603 ? 68.307  131.107 108.488 1.00 28.63 ? 603  PRO B C     1 
ATOM   9533  O O     . PRO B 1 603 ? 68.177  130.911 107.264 1.00 28.59 ? 603  PRO B O     1 
ATOM   9534  C CB    . PRO B 1 603 ? 70.536  130.015 108.970 1.00 28.28 ? 603  PRO B CB    1 
ATOM   9535  C CG    . PRO B 1 603 ? 70.640  128.808 108.074 1.00 28.79 ? 603  PRO B CG    1 
ATOM   9536  C CD    . PRO B 1 603 ? 69.445  127.925 108.303 1.00 28.39 ? 603  PRO B CD    1 
ATOM   9537  N N     . LYS B 1 604 ? 67.806  132.159 109.139 1.00 28.01 ? 604  LYS B N     1 
ATOM   9538  C CA    . LYS B 1 604 ? 66.992  133.182 108.494 1.00 28.19 ? 604  LYS B CA    1 
ATOM   9539  C C     . LYS B 1 604 ? 67.527  134.548 108.873 1.00 27.89 ? 604  LYS B C     1 
ATOM   9540  O O     . LYS B 1 604 ? 67.954  134.736 110.006 1.00 27.29 ? 604  LYS B O     1 
ATOM   9541  C CB    . LYS B 1 604 ? 65.547  133.139 109.014 1.00 27.94 ? 604  LYS B CB    1 
ATOM   9542  C CG    . LYS B 1 604 ? 64.822  131.812 108.932 1.00 30.30 ? 604  LYS B CG    1 
ATOM   9543  C CD    . LYS B 1 604 ? 64.256  131.535 107.563 1.00 31.33 ? 604  LYS B CD    1 
ATOM   9544  C CE    . LYS B 1 604 ? 63.538  130.197 107.570 1.00 33.70 ? 604  LYS B CE    1 
ATOM   9545  N NZ    . LYS B 1 604 ? 62.368  130.200 108.519 1.00 33.44 ? 604  LYS B NZ    1 
ATOM   9546  N N     . THR B 1 605 ? 67.437  135.502 107.951 1.00 27.77 ? 605  THR B N     1 
ATOM   9547  C CA    . THR B 1 605 ? 67.621  136.913 108.277 1.00 28.50 ? 605  THR B CA    1 
ATOM   9548  C C     . THR B 1 605 ? 66.479  137.373 109.194 1.00 28.70 ? 605  THR B C     1 
ATOM   9549  O O     . THR B 1 605 ? 65.493  136.651 109.385 1.00 28.97 ? 605  THR B O     1 
ATOM   9550  C CB    . THR B 1 605 ? 67.622  137.794 107.018 1.00 28.39 ? 605  THR B CB    1 
ATOM   9551  O OG1   . THR B 1 605 ? 66.297  137.825 106.472 1.00 29.20 ? 605  THR B OG1   1 
ATOM   9552  C CG2   . THR B 1 605 ? 68.624  137.253 105.961 1.00 27.42 ? 605  THR B CG2   1 
ATOM   9553  N N     . ARG B 1 606 ? 66.603  138.575 109.739 1.00 29.13 ? 606  ARG B N     1 
ATOM   9554  C CA    . ARG B 1 606 ? 65.606  139.110 110.666 1.00 29.71 ? 606  ARG B CA    1 
ATOM   9555  C C     . ARG B 1 606 ? 64.260  139.362 109.998 1.00 30.06 ? 606  ARG B C     1 
ATOM   9556  O O     . ARG B 1 606 ? 63.214  139.233 110.630 1.00 29.38 ? 606  ARG B O     1 
ATOM   9557  C CB    . ARG B 1 606 ? 66.142  140.340 111.376 1.00 29.05 ? 606  ARG B CB    1 
ATOM   9558  C CG    . ARG B 1 606 ? 67.201  139.961 112.397 1.00 31.28 ? 606  ARG B CG    1 
ATOM   9559  C CD    . ARG B 1 606 ? 67.922  141.142 113.037 1.00 33.62 ? 606  ARG B CD    1 
ATOM   9560  N NE    . ARG B 1 606 ? 69.106  140.669 113.767 1.00 37.95 ? 606  ARG B NE    1 
ATOM   9561  C CZ    . ARG B 1 606 ? 70.326  140.535 113.234 1.00 40.67 ? 606  ARG B CZ    1 
ATOM   9562  N NH1   . ARG B 1 606 ? 70.550  140.860 111.958 1.00 40.73 ? 606  ARG B NH1   1 
ATOM   9563  N NH2   . ARG B 1 606 ? 71.336  140.085 113.979 1.00 40.96 ? 606  ARG B NH2   1 
ATOM   9564  N N     . SER B 1 607 ? 64.297  139.673 108.705 1.00 31.30 ? 607  SER B N     1 
ATOM   9565  C CA    . SER B 1 607 ? 63.081  139.847 107.904 1.00 32.52 ? 607  SER B CA    1 
ATOM   9566  C C     . SER B 1 607 ? 62.494  138.508 107.455 1.00 33.04 ? 607  SER B C     1 
ATOM   9567  O O     . SER B 1 607 ? 61.454  138.479 106.789 1.00 34.10 ? 607  SER B O     1 
ATOM   9568  C CB    . SER B 1 607 ? 63.360  140.755 106.699 1.00 32.50 ? 607  SER B CB    1 
ATOM   9569  O OG    . SER B 1 607 ? 64.135  140.054 105.732 1.00 34.66 ? 607  SER B OG    1 
ATOM   9570  N N     . GLY B 1 608 ? 63.166  137.406 107.805 1.00 33.49 ? 608  GLY B N     1 
ATOM   9571  C CA    . GLY B 1 608 ? 62.655  136.052 107.578 1.00 33.71 ? 608  GLY B CA    1 
ATOM   9572  C C     . GLY B 1 608 ? 63.150  135.290 106.358 1.00 34.53 ? 608  GLY B C     1 
ATOM   9573  O O     . GLY B 1 608 ? 62.645  134.202 106.065 1.00 35.02 ? 608  GLY B O     1 
ATOM   9574  N N     . LYS B 1 609 ? 64.128  135.835 105.636 1.00 34.95 ? 609  LYS B N     1 
ATOM   9575  C CA    . LYS B 1 609 ? 64.623  135.186 104.411 1.00 35.39 ? 609  LYS B CA    1 
ATOM   9576  C C     . LYS B 1 609 ? 65.622  134.074 104.725 1.00 35.87 ? 609  LYS B C     1 
ATOM   9577  O O     . LYS B 1 609 ? 66.561  134.285 105.500 1.00 35.45 ? 609  LYS B O     1 
ATOM   9578  C CB    . LYS B 1 609 ? 65.264  136.219 103.479 1.00 35.31 ? 609  LYS B CB    1 
ATOM   9579  N N     . ILE B 1 610 ? 65.425  132.892 104.129 1.00 36.47 ? 610  ILE B N     1 
ATOM   9580  C CA    . ILE B 1 610 ? 66.396  131.797 104.258 1.00 36.80 ? 610  ILE B CA    1 
ATOM   9581  C C     . ILE B 1 610 ? 67.785  132.235 103.788 1.00 37.16 ? 610  ILE B C     1 
ATOM   9582  O O     . ILE B 1 610 ? 67.914  132.948 102.794 1.00 36.43 ? 610  ILE B O     1 
ATOM   9583  C CB    . ILE B 1 610 ? 65.974  130.526 103.485 1.00 37.06 ? 610  ILE B CB    1 
ATOM   9584  N N     . MET B 1 611 ? 68.812  131.810 104.519 1.00 37.76 ? 611  MET B N     1 
ATOM   9585  C CA    . MET B 1 611 ? 70.202  132.108 104.158 1.00 39.00 ? 611  MET B CA    1 
ATOM   9586  C C     . MET B 1 611 ? 70.923  130.843 103.693 1.00 39.23 ? 611  MET B C     1 
ATOM   9587  O O     . MET B 1 611 ? 71.518  130.107 104.491 1.00 38.94 ? 611  MET B O     1 
ATOM   9588  C CB    . MET B 1 611 ? 70.954  132.785 105.312 1.00 39.30 ? 611  MET B CB    1 
ATOM   9589  C CG    . MET B 1 611 ? 70.635  134.253 105.482 1.00 42.41 ? 611  MET B CG    1 
ATOM   9590  S SD    . MET B 1 611 ? 71.241  135.289 104.117 1.00 50.66 ? 611  MET B SD    1 
ATOM   9591  C CE    . MET B 1 611 ? 72.935  135.601 104.651 1.00 49.31 ? 611  MET B CE    1 
ATOM   9592  N N     . ARG B 1 612 ? 70.865  130.618 102.383 1.00 39.83 ? 612  ARG B N     1 
ATOM   9593  C CA    . ARG B 1 612 ? 71.395  129.414 101.751 1.00 40.40 ? 612  ARG B CA    1 
ATOM   9594  C C     . ARG B 1 612 ? 72.925  129.315 101.817 1.00 39.65 ? 612  ARG B C     1 
ATOM   9595  O O     . ARG B 1 612 ? 73.451  128.211 101.905 1.00 39.87 ? 612  ARG B O     1 
ATOM   9596  C CB    . ARG B 1 612 ? 70.942  129.332 100.286 1.00 41.15 ? 612  ARG B CB    1 
ATOM   9597  C CG    . ARG B 1 612 ? 69.456  129.628 100.004 1.00 44.15 ? 612  ARG B CG    1 
ATOM   9598  C CD    . ARG B 1 612 ? 68.569  128.377 100.163 1.00 48.37 ? 612  ARG B CD    1 
ATOM   9599  N NE    . ARG B 1 612 ? 67.764  128.147 98.958  1.00 51.89 ? 612  ARG B NE    1 
ATOM   9600  C CZ    . ARG B 1 612 ? 66.598  128.736 98.688  1.00 53.89 ? 612  ARG B CZ    1 
ATOM   9601  N NH1   . ARG B 1 612 ? 66.048  129.593 99.536  1.00 54.44 ? 612  ARG B NH1   1 
ATOM   9602  N NH2   . ARG B 1 612 ? 65.967  128.456 97.558  1.00 55.59 ? 612  ARG B NH2   1 
ATOM   9603  N N     . ARG B 1 613 ? 73.622  130.458 101.764 1.00 39.05 ? 613  ARG B N     1 
ATOM   9604  C CA    . ARG B 1 613 ? 75.096  130.501 101.675 1.00 38.32 ? 613  ARG B CA    1 
ATOM   9605  C C     . ARG B 1 613 ? 75.807  129.681 102.742 1.00 37.77 ? 613  ARG B C     1 
ATOM   9606  O O     . ARG B 1 613 ? 76.667  128.873 102.407 1.00 37.56 ? 613  ARG B O     1 
ATOM   9607  C CB    . ARG B 1 613 ? 75.634  131.939 101.705 1.00 38.75 ? 613  ARG B CB    1 
ATOM   9608  N N     . ILE B 1 614 ? 75.455  129.893 104.013 1.00 37.00 ? 614  ILE B N     1 
ATOM   9609  C CA    . ILE B 1 614 ? 76.048  129.123 105.119 1.00 36.76 ? 614  ILE B CA    1 
ATOM   9610  C C     . ILE B 1 614 ? 75.676  127.659 105.072 1.00 35.85 ? 614  ILE B C     1 
ATOM   9611  O O     . ILE B 1 614 ? 76.503  126.813 105.402 1.00 35.60 ? 614  ILE B O     1 
ATOM   9612  C CB    . ILE B 1 614 ? 75.668  129.643 106.538 1.00 36.84 ? 614  ILE B CB    1 
ATOM   9613  C CG1   . ILE B 1 614 ? 74.379  130.428 106.485 1.00 37.15 ? 614  ILE B CG1   1 
ATOM   9614  C CG2   . ILE B 1 614 ? 76.801  130.450 107.166 1.00 37.28 ? 614  ILE B CG2   1 
ATOM   9615  C CD1   . ILE B 1 614 ? 73.435  129.945 107.491 1.00 37.65 ? 614  ILE B CD1   1 
ATOM   9616  N N     . LEU B 1 615 ? 74.424  127.377 104.695 1.00 35.48 ? 615  LEU B N     1 
ATOM   9617  C CA    . LEU B 1 615 ? 73.936  126.002 104.510 1.00 35.06 ? 615  LEU B CA    1 
ATOM   9618  C C     . LEU B 1 615 ? 74.765  125.255 103.475 1.00 35.66 ? 615  LEU B C     1 
ATOM   9619  O O     . LEU B 1 615 ? 75.033  124.060 103.626 1.00 35.90 ? 615  LEU B O     1 
ATOM   9620  C CB    . LEU B 1 615 ? 72.463  125.991 104.085 1.00 34.35 ? 615  LEU B CB    1 
ATOM   9621  C CG    . LEU B 1 615 ? 71.423  126.522 105.074 1.00 32.28 ? 615  LEU B CG    1 
ATOM   9622  C CD1   . LEU B 1 615 ? 70.030  126.408 104.483 1.00 29.43 ? 615  LEU B CD1   1 
ATOM   9623  C CD2   . LEU B 1 615 ? 71.502  125.778 106.385 1.00 28.17 ? 615  LEU B CD2   1 
ATOM   9624  N N     . ARG B 1 616 ? 75.161  125.969 102.425 1.00 36.30 ? 616  ARG B N     1 
ATOM   9625  C CA    . ARG B 1 616 ? 76.045  125.441 101.395 1.00 37.40 ? 616  ARG B CA    1 
ATOM   9626  C C     . ARG B 1 616 ? 77.429  125.146 101.987 1.00 37.23 ? 616  ARG B C     1 
ATOM   9627  O O     . ARG B 1 616 ? 78.024  124.092 101.706 1.00 37.09 ? 616  ARG B O     1 
ATOM   9628  C CB    . ARG B 1 616 ? 76.141  126.461 100.261 1.00 37.91 ? 616  ARG B CB    1 
ATOM   9629  C CG    . ARG B 1 616 ? 76.709  125.958 98.956  1.00 40.39 ? 616  ARG B CG    1 
ATOM   9630  C CD    . ARG B 1 616 ? 76.530  127.027 97.872  1.00 46.32 ? 616  ARG B CD    1 
ATOM   9631  N NE    . ARG B 1 616 ? 75.109  127.265 97.572  1.00 49.86 ? 616  ARG B NE    1 
ATOM   9632  C CZ    . ARG B 1 616 ? 74.480  128.434 97.699  1.00 51.94 ? 616  ARG B CZ    1 
ATOM   9633  N NH1   . ARG B 1 616 ? 75.144  129.512 98.114  1.00 52.93 ? 616  ARG B NH1   1 
ATOM   9634  N NH2   . ARG B 1 616 ? 73.183  128.527 97.393  1.00 52.45 ? 616  ARG B NH2   1 
ATOM   9635  N N     . LYS B 1 617 ? 77.918  126.071 102.817 1.00 37.10 ? 617  LYS B N     1 
ATOM   9636  C CA    . LYS B 1 617 ? 79.221  125.939 103.484 1.00 37.57 ? 617  LYS B CA    1 
ATOM   9637  C C     . LYS B 1 617 ? 79.239  124.802 104.514 1.00 37.67 ? 617  LYS B C     1 
ATOM   9638  O O     . LYS B 1 617 ? 80.117  123.929 104.470 1.00 37.68 ? 617  LYS B O     1 
ATOM   9639  C CB    . LYS B 1 617 ? 79.625  127.259 104.142 1.00 37.36 ? 617  LYS B CB    1 
ATOM   9640  C CG    . LYS B 1 617 ? 79.860  128.410 103.160 1.00 38.28 ? 617  LYS B CG    1 
ATOM   9641  N N     . ILE B 1 618 ? 78.271  124.821 105.434 1.00 37.34 ? 618  ILE B N     1 
ATOM   9642  C CA    . ILE B 1 618 ? 78.144  123.780 106.460 1.00 37.04 ? 618  ILE B CA    1 
ATOM   9643  C C     . ILE B 1 618 ? 78.052  122.393 105.816 1.00 37.20 ? 618  ILE B C     1 
ATOM   9644  O O     . ILE B 1 618 ? 78.727  121.458 106.250 1.00 36.99 ? 618  ILE B O     1 
ATOM   9645  C CB    . ILE B 1 618 ? 76.920  124.057 107.406 1.00 37.12 ? 618  ILE B CB    1 
ATOM   9646  C CG1   . ILE B 1 618 ? 77.214  125.246 108.325 1.00 36.15 ? 618  ILE B CG1   1 
ATOM   9647  C CG2   . ILE B 1 618 ? 76.541  122.827 108.239 1.00 36.15 ? 618  ILE B CG2   1 
ATOM   9648  C CD1   . ILE B 1 618 ? 75.986  125.870 108.922 1.00 37.55 ? 618  ILE B CD1   1 
ATOM   9649  N N     . ALA B 1 619 ? 77.238  122.278 104.765 1.00 37.22 ? 619  ALA B N     1 
ATOM   9650  C CA    . ALA B 1 619 ? 76.959  120.982 104.135 1.00 37.68 ? 619  ALA B CA    1 
ATOM   9651  C C     . ALA B 1 619 ? 78.161  120.390 103.374 1.00 38.13 ? 619  ALA B C     1 
ATOM   9652  O O     . ALA B 1 619 ? 78.345  119.164 103.340 1.00 38.02 ? 619  ALA B O     1 
ATOM   9653  C CB    . ALA B 1 619 ? 75.732  121.079 103.231 1.00 36.72 ? 619  ALA B CB    1 
ATOM   9654  N N     . ALA B 1 620 ? 78.959  121.262 102.765 1.00 39.04 ? 620  ALA B N     1 
ATOM   9655  C CA    . ALA B 1 620 ? 80.138  120.859 102.000 1.00 40.45 ? 620  ALA B CA    1 
ATOM   9656  C C     . ALA B 1 620 ? 81.297  120.497 102.927 1.00 41.87 ? 620  ALA B C     1 
ATOM   9657  O O     . ALA B 1 620 ? 82.061  119.559 102.659 1.00 42.22 ? 620  ALA B O     1 
ATOM   9658  C CB    . ALA B 1 620 ? 80.544  121.970 101.051 1.00 40.31 ? 620  ALA B CB    1 
ATOM   9659  N N     . GLY B 1 621 ? 81.413  121.248 104.024 1.00 42.98 ? 621  GLY B N     1 
ATOM   9660  C CA    . GLY B 1 621 ? 82.480  121.069 104.998 1.00 44.07 ? 621  GLY B CA    1 
ATOM   9661  C C     . GLY B 1 621 ? 83.154  122.382 105.346 1.00 44.63 ? 621  GLY B C     1 
ATOM   9662  O O     . GLY B 1 621 ? 83.642  122.542 106.460 1.00 45.32 ? 621  GLY B O     1 
ATOM   9663  N N     . ASP B 1 622 ? 83.175  123.315 104.391 1.00 45.11 ? 622  ASP B N     1 
ATOM   9664  C CA    . ASP B 1 622 ? 83.818  124.623 104.554 1.00 45.39 ? 622  ASP B CA    1 
ATOM   9665  C C     . ASP B 1 622 ? 83.212  125.432 105.695 1.00 45.58 ? 622  ASP B C     1 
ATOM   9666  O O     . ASP B 1 622 ? 83.711  125.397 106.821 1.00 45.69 ? 622  ASP B O     1 
ATOM   9667  C CB    . ASP B 1 622 ? 83.747  125.433 103.251 1.00 45.67 ? 622  ASP B CB    1 
ATOM   9668  N N     . GLY B 1 627 ? 80.884  132.773 107.129 1.00 46.64 ? 627  GLY B N     1 
ATOM   9669  C CA    . GLY B 1 627 ? 80.905  133.801 108.161 1.00 46.58 ? 627  GLY B CA    1 
ATOM   9670  C C     . GLY B 1 627 ? 80.187  135.093 107.820 1.00 46.93 ? 627  GLY B C     1 
ATOM   9671  O O     . GLY B 1 627 ? 80.798  136.163 107.769 1.00 47.56 ? 627  GLY B O     1 
ATOM   9672  N N     . ASP B 1 628 ? 78.882  134.995 107.581 1.00 47.21 ? 628  ASP B N     1 
ATOM   9673  C CA    . ASP B 1 628 ? 77.982  136.154 107.527 1.00 46.45 ? 628  ASP B CA    1 
ATOM   9674  C C     . ASP B 1 628 ? 76.948  135.983 108.645 1.00 45.76 ? 628  ASP B C     1 
ATOM   9675  O O     . ASP B 1 628 ? 75.844  136.526 108.583 1.00 46.06 ? 628  ASP B O     1 
ATOM   9676  C CB    . ASP B 1 628 ? 77.288  136.240 106.159 1.00 47.18 ? 628  ASP B CB    1 
ATOM   9677  N N     . THR B 1 629 ? 77.346  135.231 109.672 1.00 44.39 ? 629  THR B N     1 
ATOM   9678  C CA    . THR B 1 629 ? 76.497  134.773 110.775 1.00 42.59 ? 629  THR B CA    1 
ATOM   9679  C C     . THR B 1 629 ? 75.726  135.888 111.499 1.00 42.20 ? 629  THR B C     1 
ATOM   9680  O O     . THR B 1 629 ? 74.537  135.737 111.780 1.00 41.76 ? 629  THR B O     1 
ATOM   9681  C CB    . THR B 1 629 ? 77.339  133.929 111.778 1.00 42.61 ? 629  THR B CB    1 
ATOM   9682  O OG1   . THR B 1 629 ? 77.892  132.793 111.099 1.00 40.27 ? 629  THR B OG1   1 
ATOM   9683  C CG2   . THR B 1 629 ? 76.511  133.437 112.954 1.00 42.45 ? 629  THR B CG2   1 
ATOM   9684  N N     . SER B 1 630 ? 76.378  137.011 111.785 1.00 41.43 ? 630  SER B N     1 
ATOM   9685  C CA    . SER B 1 630 ? 75.704  138.098 112.524 1.00 40.63 ? 630  SER B CA    1 
ATOM   9686  C C     . SER B 1 630 ? 74.523  138.782 111.770 1.00 39.90 ? 630  SER B C     1 
ATOM   9687  O O     . SER B 1 630 ? 73.862  139.656 112.330 1.00 39.99 ? 630  SER B O     1 
ATOM   9688  C CB    . SER B 1 630 ? 76.725  139.118 113.049 1.00 40.68 ? 630  SER B CB    1 
ATOM   9689  O OG    . SER B 1 630 ? 77.342  139.796 111.977 1.00 40.54 ? 630  SER B OG    1 
ATOM   9690  N N     . THR B 1 631 ? 74.261  138.380 110.521 1.00 38.86 ? 631  THR B N     1 
ATOM   9691  C CA    . THR B 1 631 ? 73.058  138.823 109.789 1.00 38.11 ? 631  THR B CA    1 
ATOM   9692  C C     . THR B 1 631 ? 71.793  138.009 110.176 1.00 37.12 ? 631  THR B C     1 
ATOM   9693  O O     . THR B 1 631 ? 70.660  138.448 109.964 1.00 37.35 ? 631  THR B O     1 
ATOM   9694  C CB    . THR B 1 631 ? 73.236  138.748 108.242 1.00 38.13 ? 631  THR B CB    1 
ATOM   9695  O OG1   . THR B 1 631 ? 72.066  139.271 107.600 1.00 38.94 ? 631  THR B OG1   1 
ATOM   9696  C CG2   . THR B 1 631 ? 73.382  137.309 107.767 1.00 37.92 ? 631  THR B CG2   1 
ATOM   9697  N N     . LEU B 1 632 ? 72.005  136.822 110.728 1.00 35.45 ? 632  LEU B N     1 
ATOM   9698  C CA    . LEU B 1 632 ? 70.924  135.897 111.023 1.00 33.77 ? 632  LEU B CA    1 
ATOM   9699  C C     . LEU B 1 632 ? 70.115  136.341 112.230 1.00 33.02 ? 632  LEU B C     1 
ATOM   9700  O O     . LEU B 1 632 ? 70.669  136.862 113.194 1.00 32.41 ? 632  LEU B O     1 
ATOM   9701  C CB    . LEU B 1 632 ? 71.490  134.509 111.271 1.00 33.32 ? 632  LEU B CB    1 
ATOM   9702  C CG    . LEU B 1 632 ? 72.463  133.937 110.239 1.00 32.75 ? 632  LEU B CG    1 
ATOM   9703  C CD1   . LEU B 1 632 ? 73.095  132.698 110.826 1.00 31.52 ? 632  LEU B CD1   1 
ATOM   9704  C CD2   . LEU B 1 632 ? 71.788  133.634 108.895 1.00 31.64 ? 632  LEU B CD2   1 
ATOM   9705  N N     . ALA B 1 633 ? 68.802  136.144 112.158 1.00 31.89 ? 633  ALA B N     1 
ATOM   9706  C CA    . ALA B 1 633 ? 67.909  136.378 113.290 1.00 32.10 ? 633  ALA B CA    1 
ATOM   9707  C C     . ALA B 1 633 ? 68.331  135.601 114.552 1.00 32.60 ? 633  ALA B C     1 
ATOM   9708  O O     . ALA B 1 633 ? 68.179  136.100 115.664 1.00 32.13 ? 633  ALA B O     1 
ATOM   9709  C CB    . ALA B 1 633 ? 66.462  136.058 112.908 1.00 31.31 ? 633  ALA B CB    1 
ATOM   9710  N N     . ASP B 1 634 ? 68.872  134.392 114.371 1.00 33.56 ? 634  ASP B N     1 
ATOM   9711  C CA    . ASP B 1 634 ? 69.455  133.610 115.479 1.00 34.60 ? 634  ASP B CA    1 
ATOM   9712  C C     . ASP B 1 634 ? 70.758  132.933 115.026 1.00 35.04 ? 634  ASP B C     1 
ATOM   9713  O O     . ASP B 1 634 ? 70.728  131.843 114.449 1.00 34.65 ? 634  ASP B O     1 
ATOM   9714  C CB    . ASP B 1 634 ? 68.454  132.578 116.035 1.00 35.05 ? 634  ASP B CB    1 
ATOM   9715  C CG    . ASP B 1 634 ? 69.023  131.751 117.207 1.00 36.85 ? 634  ASP B CG    1 
ATOM   9716  O OD1   . ASP B 1 634 ? 70.049  132.141 117.812 1.00 37.43 ? 634  ASP B OD1   1 
ATOM   9717  O OD2   . ASP B 1 634 ? 68.430  130.693 117.524 1.00 38.89 ? 634  ASP B OD2   1 
ATOM   9718  N N     . PRO B 1 635 ? 71.910  133.591 115.281 1.00 35.42 ? 635  PRO B N     1 
ATOM   9719  C CA    . PRO B 1 635 ? 73.228  133.081 114.879 1.00 35.87 ? 635  PRO B CA    1 
ATOM   9720  C C     . PRO B 1 635 ? 73.629  131.780 115.611 1.00 36.38 ? 635  PRO B C     1 
ATOM   9721  O O     . PRO B 1 635 ? 74.612  131.121 115.223 1.00 36.56 ? 635  PRO B O     1 
ATOM   9722  C CB    . PRO B 1 635 ? 74.183  134.236 115.232 1.00 35.74 ? 635  PRO B CB    1 
ATOM   9723  C CG    . PRO B 1 635 ? 73.471  135.037 116.262 1.00 36.25 ? 635  PRO B CG    1 
ATOM   9724  C CD    . PRO B 1 635 ? 72.000  134.884 115.991 1.00 35.53 ? 635  PRO B CD    1 
ATOM   9725  N N     . GLY B 1 636 ? 72.876  131.428 116.657 1.00 36.39 ? 636  GLY B N     1 
ATOM   9726  C CA    . GLY B 1 636 ? 73.053  130.162 117.368 1.00 36.54 ? 636  GLY B CA    1 
ATOM   9727  C C     . GLY B 1 636 ? 72.551  128.937 116.608 1.00 36.43 ? 636  GLY B C     1 
ATOM   9728  O O     . GLY B 1 636 ? 72.722  127.803 117.072 1.00 36.94 ? 636  GLY B O     1 
ATOM   9729  N N     . VAL B 1 637 ? 71.929  129.136 115.447 1.00 35.84 ? 637  VAL B N     1 
ATOM   9730  C CA    . VAL B 1 637 ? 71.534  127.982 114.626 1.00 35.41 ? 637  VAL B CA    1 
ATOM   9731  C C     . VAL B 1 637 ? 72.733  127.336 113.940 1.00 35.53 ? 637  VAL B C     1 
ATOM   9732  O O     . VAL B 1 637 ? 72.681  126.165 113.592 1.00 35.63 ? 637  VAL B O     1 
ATOM   9733  C CB    . VAL B 1 637 ? 70.481  128.317 113.563 1.00 35.13 ? 637  VAL B CB    1 
ATOM   9734  C CG1   . VAL B 1 637 ? 69.211  128.860 114.208 1.00 34.33 ? 637  VAL B CG1   1 
ATOM   9735  C CG2   . VAL B 1 637 ? 71.057  129.247 112.505 1.00 33.93 ? 637  VAL B CG2   1 
ATOM   9736  N N     . VAL B 1 638 ? 73.806  128.105 113.761 1.00 35.98 ? 638  VAL B N     1 
ATOM   9737  C CA    . VAL B 1 638 ? 75.008  127.650 113.042 1.00 36.30 ? 638  VAL B CA    1 
ATOM   9738  C C     . VAL B 1 638 ? 75.743  126.536 113.800 1.00 36.64 ? 638  VAL B C     1 
ATOM   9739  O O     . VAL B 1 638 ? 76.039  125.482 113.232 1.00 36.78 ? 638  VAL B O     1 
ATOM   9740  C CB    . VAL B 1 638 ? 75.962  128.838 112.710 1.00 36.00 ? 638  VAL B CB    1 
ATOM   9741  C CG1   . VAL B 1 638 ? 77.316  128.353 112.196 1.00 36.00 ? 638  VAL B CG1   1 
ATOM   9742  C CG2   . VAL B 1 638 ? 75.322  129.764 111.692 1.00 35.97 ? 638  VAL B CG2   1 
ATOM   9743  N N     . GLU B 1 639 ? 76.018  126.778 115.078 1.00 37.01 ? 639  GLU B N     1 
ATOM   9744  C CA    . GLU B 1 639 ? 76.657  125.794 115.950 1.00 37.30 ? 639  GLU B CA    1 
ATOM   9745  C C     . GLU B 1 639 ? 75.850  124.500 116.009 1.00 37.40 ? 639  GLU B C     1 
ATOM   9746  O O     . GLU B 1 639 ? 76.432  123.414 115.968 1.00 38.06 ? 639  GLU B O     1 
ATOM   9747  C CB    . GLU B 1 639 ? 76.882  126.373 117.357 1.00 37.40 ? 639  GLU B CB    1 
ATOM   9748  N N     . LYS B 1 640 ? 74.519  124.613 116.081 1.00 37.50 ? 640  LYS B N     1 
ATOM   9749  C CA    . LYS B 1 640 ? 73.627  123.438 116.045 1.00 37.29 ? 640  LYS B CA    1 
ATOM   9750  C C     . LYS B 1 640 ? 73.702  122.683 114.714 1.00 37.44 ? 640  LYS B C     1 
ATOM   9751  O O     . LYS B 1 640 ? 73.814  121.452 114.708 1.00 37.52 ? 640  LYS B O     1 
ATOM   9752  C CB    . LYS B 1 640 ? 72.172  123.808 116.375 1.00 37.02 ? 640  LYS B CB    1 
ATOM   9753  N N     . LEU B 1 641 ? 73.654  123.419 113.602 1.00 37.34 ? 641  LEU B N     1 
ATOM   9754  C CA    . LEU B 1 641 ? 73.771  122.831 112.263 1.00 37.55 ? 641  LEU B CA    1 
ATOM   9755  C C     . LEU B 1 641 ? 75.096  122.102 112.054 1.00 38.16 ? 641  LEU B C     1 
ATOM   9756  O O     . LEU B 1 641 ? 75.128  121.004 111.476 1.00 38.02 ? 641  LEU B O     1 
ATOM   9757  C CB    . LEU B 1 641 ? 73.576  123.887 111.165 1.00 36.97 ? 641  LEU B CB    1 
ATOM   9758  C CG    . LEU B 1 641 ? 72.160  124.411 110.889 1.00 36.53 ? 641  LEU B CG    1 
ATOM   9759  C CD1   . LEU B 1 641 ? 72.238  125.452 109.797 1.00 36.70 ? 641  LEU B CD1   1 
ATOM   9760  C CD2   . LEU B 1 641 ? 71.171  123.298 110.507 1.00 34.16 ? 641  LEU B CD2   1 
ATOM   9761  N N     . LEU B 1 642 ? 76.178  122.727 112.518 1.00 39.29 ? 642  LEU B N     1 
ATOM   9762  C CA    . LEU B 1 642 ? 77.511  122.123 112.491 1.00 40.35 ? 642  LEU B CA    1 
ATOM   9763  C C     . LEU B 1 642 ? 77.510  120.794 113.230 1.00 41.02 ? 642  LEU B C     1 
ATOM   9764  O O     . LEU B 1 642 ? 77.970  119.781 112.687 1.00 41.18 ? 642  LEU B O     1 
ATOM   9765  C CB    . LEU B 1 642 ? 78.561  123.078 113.083 1.00 40.26 ? 642  LEU B CB    1 
ATOM   9766  C CG    . LEU B 1 642 ? 78.917  124.292 112.213 1.00 40.61 ? 642  LEU B CG    1 
ATOM   9767  C CD1   . LEU B 1 642 ? 79.796  125.270 112.980 1.00 40.93 ? 642  LEU B CD1   1 
ATOM   9768  C CD2   . LEU B 1 642 ? 79.584  123.868 110.899 1.00 41.24 ? 642  LEU B CD2   1 
ATOM   9769  N N     . GLU B 1 643 ? 76.967  120.798 114.451 1.00 42.03 ? 643  GLU B N     1 
ATOM   9770  C CA    . GLU B 1 643 ? 76.841  119.579 115.257 1.00 43.19 ? 643  GLU B CA    1 
ATOM   9771  C C     . GLU B 1 643 ? 76.027  118.495 114.537 1.00 43.93 ? 643  GLU B C     1 
ATOM   9772  O O     . GLU B 1 643 ? 76.503  117.363 114.373 1.00 44.11 ? 643  GLU B O     1 
ATOM   9773  C CB    . GLU B 1 643 ? 76.251  119.888 116.636 1.00 43.28 ? 643  GLU B CB    1 
ATOM   9774  N N     . GLU B 1 644 ? 74.821  118.853 114.089 1.00 44.77 ? 644  GLU B N     1 
ATOM   9775  C CA    . GLU B 1 644 ? 73.935  117.926 113.377 1.00 45.59 ? 644  GLU B CA    1 
ATOM   9776  C C     . GLU B 1 644 ? 74.612  117.273 112.158 1.00 46.34 ? 644  GLU B C     1 
ATOM   9777  O O     . GLU B 1 644 ? 74.474  116.069 111.946 1.00 46.13 ? 644  GLU B O     1 
ATOM   9778  C CB    . GLU B 1 644 ? 72.627  118.619 112.964 1.00 45.53 ? 644  GLU B CB    1 
ATOM   9779  C CG    . GLU B 1 644 ? 71.685  118.997 114.112 1.00 45.11 ? 644  GLU B CG    1 
ATOM   9780  C CD    . GLU B 1 644 ? 70.553  119.951 113.679 1.00 45.45 ? 644  GLU B CD    1 
ATOM   9781  O OE1   . GLU B 1 644 ? 70.641  120.550 112.582 1.00 44.28 ? 644  GLU B OE1   1 
ATOM   9782  O OE2   . GLU B 1 644 ? 69.571  120.109 114.442 1.00 45.12 ? 644  GLU B OE2   1 
ATOM   9783  N N     . LYS B 1 645 ? 75.343  118.072 111.373 1.00 47.63 ? 645  LYS B N     1 
ATOM   9784  C CA    . LYS B 1 645 ? 76.051  117.590 110.168 1.00 48.68 ? 645  LYS B CA    1 
ATOM   9785  C C     . LYS B 1 645 ? 77.182  116.612 110.502 1.00 49.43 ? 645  LYS B C     1 
ATOM   9786  O O     . LYS B 1 645 ? 77.422  115.666 109.749 1.00 49.48 ? 645  LYS B O     1 
ATOM   9787  C CB    . LYS B 1 645 ? 76.585  118.773 109.346 1.00 48.68 ? 645  LYS B CB    1 
ATOM   9788  C CG    . LYS B 1 645 ? 77.798  118.480 108.455 1.00 49.36 ? 645  LYS B CG    1 
ATOM   9789  C CD    . LYS B 1 645 ? 77.442  117.663 107.216 1.00 50.49 ? 645  LYS B CD    1 
ATOM   9790  C CE    . LYS B 1 645 ? 78.559  117.694 106.186 1.00 51.02 ? 645  LYS B CE    1 
ATOM   9791  N NZ    . LYS B 1 645 ? 79.784  116.948 106.583 1.00 51.64 ? 645  LYS B NZ    1 
ATOM   9792  N N     . GLN B 1 646 ? 77.854  116.855 111.630 1.00 50.27 ? 646  GLN B N     1 
ATOM   9793  C CA    . GLN B 1 646 ? 78.913  115.990 112.154 1.00 51.35 ? 646  GLN B CA    1 
ATOM   9794  C C     . GLN B 1 646 ? 78.424  114.566 112.463 1.00 51.42 ? 646  GLN B C     1 
ATOM   9795  O O     . GLN B 1 646 ? 79.178  113.604 112.300 1.00 51.44 ? 646  GLN B O     1 
ATOM   9796  C CB    . GLN B 1 646 ? 79.532  116.628 113.405 1.00 51.40 ? 646  GLN B CB    1 
ATOM   9797  C CG    . GLN B 1 646 ? 80.787  115.935 113.934 1.00 52.31 ? 646  GLN B CG    1 
ATOM   9798  C CD    . GLN B 1 646 ? 81.177  116.404 115.328 1.00 52.75 ? 646  GLN B CD    1 
ATOM   9799  O OE1   . GLN B 1 646 ? 80.783  117.488 115.774 1.00 54.90 ? 646  GLN B OE1   1 
ATOM   9800  N NE2   . GLN B 1 646 ? 81.957  115.584 116.026 1.00 54.22 ? 646  GLN B NE2   1 
ATOM   9801  N N     . ALA B 1 647 ? 77.166  114.441 112.892 1.00 51.59 ? 647  ALA B N     1 
ATOM   9802  C CA    . ALA B 1 647 ? 76.562  113.138 113.216 1.00 51.66 ? 647  ALA B CA    1 
ATOM   9803  C C     . ALA B 1 647 ? 76.268  112.277 111.980 1.00 51.66 ? 647  ALA B C     1 
ATOM   9804  O O     . ALA B 1 647 ? 75.994  112.792 110.890 1.00 51.43 ? 647  ALA B O     1 
ATOM   9805  C CB    . ALA B 1 647 ? 75.294  113.330 114.045 1.00 51.68 ? 647  ALA B CB    1 
HETATM 9806  N N1A   . COA C 2 .   ? 53.158  163.581 46.082  1.00 26.60 ? 990  COA A N1A   1 
HETATM 9807  C C2A   . COA C 2 .   ? 53.709  163.953 47.286  1.00 27.78 ? 990  COA A C2A   1 
HETATM 9808  N N3A   . COA C 2 .   ? 52.931  163.940 48.429  1.00 28.82 ? 990  COA A N3A   1 
HETATM 9809  C C4A   . COA C 2 .   ? 51.632  163.563 48.375  1.00 28.75 ? 990  COA A C4A   1 
HETATM 9810  C C5A   . COA C 2 .   ? 51.068  163.183 47.155  1.00 27.48 ? 990  COA A C5A   1 
HETATM 9811  C C6A   . COA C 2 .   ? 51.845  163.191 46.000  1.00 26.19 ? 990  COA A C6A   1 
HETATM 9812  N N6A   . COA C 2 .   ? 51.330  162.918 44.801  1.00 24.50 ? 990  COA A N6A   1 
HETATM 9813  N N7A   . COA C 2 .   ? 49.777  162.864 47.394  1.00 27.63 ? 990  COA A N7A   1 
HETATM 9814  C C8A   . COA C 2 .   ? 49.520  163.019 48.718  1.00 28.06 ? 990  COA A C8A   1 
HETATM 9815  N N9A   . COA C 2 .   ? 50.658  163.461 49.345  1.00 29.39 ? 990  COA A N9A   1 
HETATM 9816  C C1B   . COA C 2 .   ? 50.781  163.872 50.761  1.00 31.71 ? 990  COA A C1B   1 
HETATM 9817  C C2B   . COA C 2 .   ? 50.168  165.238 51.060  1.00 33.19 ? 990  COA A C2B   1 
HETATM 9818  O O2B   . COA C 2 .   ? 51.062  166.282 50.776  1.00 33.24 ? 990  COA A O2B   1 
HETATM 9819  C C3B   . COA C 2 .   ? 49.854  165.122 52.546  1.00 34.99 ? 990  COA A C3B   1 
HETATM 9820  O O3B   . COA C 2 .   ? 51.041  165.198 53.302  1.00 36.74 ? 990  COA A O3B   1 
HETATM 9821  P P3B   . COA C 2 .   ? 51.285  166.203 54.525  1.00 35.96 ? 990  COA A P3B   1 
HETATM 9822  O O7A   . COA C 2 .   ? 52.221  165.585 55.534  1.00 38.01 ? 990  COA A O7A   1 
HETATM 9823  O O8A   . COA C 2 .   ? 51.923  167.449 53.969  1.00 38.51 ? 990  COA A O8A   1 
HETATM 9824  O O9A   . COA C 2 .   ? 49.976  166.537 55.200  1.00 38.24 ? 990  COA A O9A   1 
HETATM 9825  C C4B   . COA C 2 .   ? 49.429  163.669 52.682  1.00 35.90 ? 990  COA A C4B   1 
HETATM 9826  O O4B   . COA C 2 .   ? 50.102  162.978 51.638  1.00 35.01 ? 990  COA A O4B   1 
HETATM 9827  C C5B   . COA C 2 .   ? 47.924  163.483 52.549  1.00 38.63 ? 990  COA A C5B   1 
HETATM 9828  O O5B   . COA C 2 .   ? 47.467  164.334 51.513  1.00 41.42 ? 990  COA A O5B   1 
HETATM 9829  P P1A   . COA C 2 .   ? 45.975  164.191 50.935  1.00 43.84 ? 990  COA A P1A   1 
HETATM 9830  O O1A   . COA C 2 .   ? 45.765  165.211 49.842  1.00 43.32 ? 990  COA A O1A   1 
HETATM 9831  O O2A   . COA C 2 .   ? 45.022  164.291 52.101  1.00 44.40 ? 990  COA A O2A   1 
HETATM 9832  O O3A   . COA C 2 .   ? 46.087  162.711 50.285  1.00 47.31 ? 990  COA A O3A   1 
HETATM 9833  P P2A   . COA C 2 .   ? 44.898  161.825 49.684  1.00 49.74 ? 990  COA A P2A   1 
HETATM 9834  O O4A   . COA C 2 .   ? 44.297  160.991 50.809  1.00 51.38 ? 990  COA A O4A   1 
HETATM 9835  O O5A   . COA C 2 .   ? 45.385  160.922 48.579  1.00 50.84 ? 990  COA A O5A   1 
HETATM 9836  O O6A   . COA C 2 .   ? 43.782  162.818 49.084  1.00 52.46 ? 990  COA A O6A   1 
HETATM 9837  C CBP   . COA C 2 .   ? 41.995  162.558 47.401  1.00 56.74 ? 990  COA A CBP   1 
HETATM 9838  C CCP   . COA C 2 .   ? 42.513  162.265 48.809  1.00 54.61 ? 990  COA A CCP   1 
HETATM 9839  C CDP   . COA C 2 .   ? 41.328  161.278 46.912  1.00 57.37 ? 990  COA A CDP   1 
HETATM 9840  C CEP   . COA C 2 .   ? 43.098  162.868 46.386  1.00 57.03 ? 990  COA A CEP   1 
HETATM 9841  C CAP   . COA C 2 .   ? 40.983  163.709 47.476  1.00 58.20 ? 990  COA A CAP   1 
HETATM 9842  O OAP   . COA C 2 .   ? 40.041  163.459 48.496  1.00 58.14 ? 990  COA A OAP   1 
HETATM 9843  C C9P   . COA C 2 .   ? 41.647  165.046 47.697  1.00 59.85 ? 990  COA A C9P   1 
HETATM 9844  O O9P   . COA C 2 .   ? 41.783  165.921 46.609  1.00 59.45 ? 990  COA A O9P   1 
HETATM 9845  N N8P   . COA C 2 .   ? 42.101  165.345 48.918  1.00 62.01 ? 990  COA A N8P   1 
HETATM 9846  C C7P   . COA C 2 .   ? 41.893  166.634 49.562  1.00 64.73 ? 990  COA A C7P   1 
HETATM 9847  C C6P   . COA C 2 .   ? 42.939  166.889 50.653  1.00 66.78 ? 990  COA A C6P   1 
HETATM 9848  C C5P   . COA C 2 .   ? 42.576  166.192 51.955  1.00 68.39 ? 990  COA A C5P   1 
HETATM 9849  O O5P   . COA C 2 .   ? 42.386  166.860 52.990  1.00 69.19 ? 990  COA A O5P   1 
HETATM 9850  N N4P   . COA C 2 .   ? 42.482  164.856 51.924  1.00 68.97 ? 990  COA A N4P   1 
HETATM 9851  C C3P   . COA C 2 .   ? 42.186  164.029 53.083  1.00 69.49 ? 990  COA A C3P   1 
HETATM 9852  C C2P   . COA C 2 .   ? 40.756  163.522 53.032  1.00 70.08 ? 990  COA A C2P   1 
HETATM 9853  S S1P   . COA C 2 .   ? 39.596  164.909 52.974  1.00 70.62 ? 990  COA A S1P   1 
HETATM 9854  O "O2'" . PRX D 3 .   ? 41.688  144.866 48.049  1.00 18.29 ? 999  PRX A "O2'" 1 
HETATM 9855  C "C2'" . PRX D 3 .   ? 41.572  145.034 46.622  1.00 18.80 ? 999  PRX A "C2'" 1 
HETATM 9856  C "C1'" . PRX D 3 .   ? 41.472  146.518 46.360  1.00 18.92 ? 999  PRX A "C1'" 1 
HETATM 9857  O "O4'" . PRX D 3 .   ? 42.810  146.962 46.068  1.00 18.95 ? 999  PRX A "O4'" 1 
HETATM 9858  C "C4'" . PRX D 3 .   ? 43.731  145.882 46.133  1.00 17.29 ? 999  PRX A "C4'" 1 
HETATM 9859  C "C5'" . PRX D 3 .   ? 44.778  146.024 45.056  1.00 17.80 ? 999  PRX A "C5'" 1 
HETATM 9860  O "O5'" . PRX D 3 .   ? 45.508  147.232 45.229  1.00 17.47 ? 999  PRX A "O5'" 1 
HETATM 9861  P P     . PRX D 3 .   ? 46.679  147.549 44.172  1.00 18.17 ? 999  PRX A P     1 
HETATM 9862  O O1P   . PRX D 3 .   ? 47.537  146.301 44.059  1.00 18.02 ? 999  PRX A O1P   1 
HETATM 9863  O O2P   . PRX D 3 .   ? 47.332  148.833 44.676  1.00 16.77 ? 999  PRX A O2P   1 
HETATM 9864  O O3P   . PRX D 3 .   ? 45.931  147.785 42.786  1.00 16.76 ? 999  PRX A O3P   1 
HETATM 9865  C C1P   . PRX D 3 .   ? 44.955  148.831 42.671  1.00 17.78 ? 999  PRX A C1P   1 
HETATM 9866  C C2P   . PRX D 3 .   ? 44.035  148.522 41.510  1.00 15.01 ? 999  PRX A C2P   1 
HETATM 9867  C C3P   . PRX D 3 .   ? 43.057  149.660 41.294  1.00 15.04 ? 999  PRX A C3P   1 
HETATM 9868  C "C3'" . PRX D 3 .   ? 42.852  144.668 45.898  1.00 17.65 ? 999  PRX A "C3'" 1 
HETATM 9869  O "O3'" . PRX D 3 .   ? 43.429  143.462 46.402  1.00 16.55 ? 999  PRX A "O3'" 1 
HETATM 9870  N N9    . PRX D 3 .   ? 40.579  146.849 45.206  1.00 19.59 ? 999  PRX A N9    1 
HETATM 9871  C C8    . PRX D 3 .   ? 40.978  147.265 43.996  1.00 19.85 ? 999  PRX A C8    1 
HETATM 9872  N N7    . PRX D 3 .   ? 39.906  147.506 43.213  1.00 21.05 ? 999  PRX A N7    1 
HETATM 9873  C C5    . PRX D 3 .   ? 38.813  147.234 43.946  1.00 20.23 ? 999  PRX A C5    1 
HETATM 9874  C C4    . PRX D 3 .   ? 39.250  146.824 45.205  1.00 19.82 ? 999  PRX A C4    1 
HETATM 9875  N N3    . PRX D 3 .   ? 38.333  146.492 46.152  1.00 20.39 ? 999  PRX A N3    1 
HETATM 9876  C C2    . PRX D 3 .   ? 37.018  146.556 45.863  1.00 19.28 ? 999  PRX A C2    1 
HETATM 9877  N N1    . PRX D 3 .   ? 36.578  146.959 44.662  1.00 18.45 ? 999  PRX A N1    1 
HETATM 9878  C C6    . PRX D 3 .   ? 37.437  147.313 43.685  1.00 19.42 ? 999  PRX A C6    1 
HETATM 9879  N N6    . PRX D 3 .   ? 36.976  147.697 42.460  1.00 19.10 ? 999  PRX A N6    1 
HETATM 9880  N N1A   . COA E 2 .   ? 64.734  107.401 81.617  1.00 29.57 ? 991  COA B N1A   1 
HETATM 9881  C C2A   . COA E 2 .   ? 64.088  107.012 82.757  1.00 30.25 ? 991  COA B C2A   1 
HETATM 9882  N N3A   . COA E 2 .   ? 64.778  106.948 83.945  1.00 32.46 ? 991  COA B N3A   1 
HETATM 9883  C C4A   . COA E 2 .   ? 66.087  107.285 83.996  1.00 31.96 ? 991  COA B C4A   1 
HETATM 9884  C C5A   . COA E 2 .   ? 66.755  107.688 82.854  1.00 30.00 ? 991  COA B C5A   1 
HETATM 9885  C C6A   . COA E 2 .   ? 66.063  107.750 81.650  1.00 29.69 ? 991  COA B C6A   1 
HETATM 9886  N N6A   . COA E 2 .   ? 66.695  107.965 80.493  1.00 28.44 ? 991  COA B N6A   1 
HETATM 9887  N N7A   . COA E 2 .   ? 68.036  107.937 83.201  1.00 30.78 ? 991  COA B N7A   1 
HETATM 9888  C C8A   . COA E 2 .   ? 68.189  107.724 84.527  1.00 31.18 ? 991  COA B C8A   1 
HETATM 9889  N N9A   . COA E 2 .   ? 66.977  107.317 85.034  1.00 32.95 ? 991  COA B N9A   1 
HETATM 9890  C C1B   . COA E 2 .   ? 66.672  106.892 86.404  1.00 34.97 ? 991  COA B C1B   1 
HETATM 9891  C C2B   . COA E 2 .   ? 67.189  105.482 86.651  1.00 37.97 ? 991  COA B C2B   1 
HETATM 9892  O O2B   . COA E 2 .   ? 66.248  104.498 86.295  1.00 38.64 ? 991  COA B O2B   1 
HETATM 9893  C C3B   . COA E 2 .   ? 67.429  105.508 88.143  1.00 39.17 ? 991  COA B C3B   1 
HETATM 9894  O O3B   . COA E 2 .   ? 66.188  105.250 88.743  1.00 41.98 ? 991  COA B O3B   1 
HETATM 9895  P P3B   . COA E 2 .   ? 65.976  104.194 89.933  1.00 43.59 ? 991  COA B P3B   1 
HETATM 9896  O O7A   . COA E 2 .   ? 66.999  103.084 89.825  1.00 43.91 ? 991  COA B O7A   1 
HETATM 9897  O O8A   . COA E 2 .   ? 64.594  103.603 89.775  1.00 44.05 ? 991  COA B O8A   1 
HETATM 9898  O O9A   . COA E 2 .   ? 66.127  104.950 91.228  1.00 43.39 ? 991  COA B O9A   1 
HETATM 9899  C C4B   . COA E 2 .   ? 67.795  106.953 88.456  1.00 38.17 ? 991  COA B C4B   1 
HETATM 9900  O O4B   . COA E 2 .   ? 67.320  107.716 87.358  1.00 35.81 ? 991  COA B O4B   1 
HETATM 9901  C C5B   . COA E 2 .   ? 69.300  107.117 88.578  1.00 41.08 ? 991  COA B C5B   1 
HETATM 9902  O O5B   . COA E 2 .   ? 69.885  106.585 87.396  1.00 44.40 ? 991  COA B O5B   1 
HETATM 9903  P P1A   . COA E 2 .   ? 71.477  106.407 87.195  1.00 46.34 ? 991  COA B P1A   1 
HETATM 9904  O O1A   . COA E 2 .   ? 71.735  105.700 85.879  1.00 45.71 ? 991  COA B O1A   1 
HETATM 9905  O O2A   . COA E 2 .   ? 72.067  105.652 88.365  1.00 46.68 ? 991  COA B O2A   1 
HETATM 9906  O O3A   . COA E 2 .   ? 71.986  107.954 87.208  1.00 47.38 ? 991  COA B O3A   1 
HETATM 9907  P P2A   . COA E 2 .   ? 72.554  108.749 85.924  1.00 48.01 ? 991  COA B P2A   1 
HETATM 9908  O O4A   . COA E 2 .   ? 72.876  110.163 86.342  1.00 48.64 ? 991  COA B O4A   1 
HETATM 9909  O O5A   . COA E 2 .   ? 71.621  108.765 84.747  1.00 47.38 ? 991  COA B O5A   1 
HETATM 9910  O O6A   . COA E 2 .   ? 73.901  107.917 85.595  1.00 50.07 ? 991  COA B O6A   1 
HETATM 9911  C CBP   . COA E 2 .   ? 75.860  107.109 84.417  1.00 56.22 ? 991  COA B CBP   1 
HETATM 9912  C CCP   . COA E 2 .   ? 74.596  107.978 84.366  1.00 53.75 ? 991  COA B CCP   1 
HETATM 9913  C CDP   . COA E 2 .   ? 76.774  107.526 85.575  1.00 56.34 ? 991  COA B CDP   1 
HETATM 9914  C CEP   . COA E 2 .   ? 76.636  107.403 83.140  1.00 56.25 ? 991  COA B CEP   1 
HETATM 9915  C CAP   . COA E 2 .   ? 75.425  105.629 84.456  1.00 57.76 ? 991  COA B CAP   1 
HETATM 9916  O OAP   . COA E 2 .   ? 76.057  104.859 83.462  1.00 57.76 ? 991  COA B OAP   1 
HETATM 9917  C C9P   . COA E 2 .   ? 75.324  104.874 85.772  1.00 60.05 ? 991  COA B C9P   1 
HETATM 9918  O O9P   . COA E 2 .   ? 75.016  105.487 87.003  1.00 59.29 ? 991  COA B O9P   1 
HETATM 9919  N N8P   . COA E 2 .   ? 75.518  103.554 85.722  1.00 63.40 ? 991  COA B N8P   1 
HETATM 9920  C C7P   . COA E 2 .   ? 74.467  102.612 85.355  1.00 65.48 ? 991  COA B C7P   1 
HETATM 9921  C C6P   . COA E 2 .   ? 74.250  101.561 86.433  1.00 67.75 ? 991  COA B C6P   1 
HETATM 9922  C C5P   . COA E 2 .   ? 74.979  100.272 86.110  1.00 69.54 ? 991  COA B C5P   1 
HETATM 9923  O O5P   . COA E 2 .   ? 76.221  100.194 86.159  1.00 69.89 ? 991  COA B O5P   1 
HETATM 9924  N N4P   . COA E 2 .   ? 74.207  99.232  85.801  1.00 70.32 ? 991  COA B N4P   1 
HETATM 9925  C C3P   . COA E 2 .   ? 73.963  98.158  86.753  1.00 70.56 ? 991  COA B C3P   1 
HETATM 9926  C C2P   . COA E 2 .   ? 72.623  98.320  87.465  1.00 70.55 ? 991  COA B C2P   1 
HETATM 9927  S S1P   . COA E 2 .   ? 71.225  98.323  86.315  1.00 70.81 ? 991  COA B S1P   1 
HETATM 9928  O "O2'" . PRX F 3 .   ? 76.522  125.816 84.347  1.00 18.49 ? 998  PRX B "O2'" 1 
HETATM 9929  C "C2'" . PRX F 3 .   ? 76.761  125.597 82.958  1.00 20.91 ? 998  PRX B "C2'" 1 
HETATM 9930  C "C1'" . PRX F 3 .   ? 76.796  124.105 82.745  1.00 20.65 ? 998  PRX B "C1'" 1 
HETATM 9931  O "O4'" . PRX F 3 .   ? 75.468  123.679 82.401  1.00 21.84 ? 998  PRX B "O4'" 1 
HETATM 9932  C "C4'" . PRX F 3 .   ? 74.601  124.814 82.333  1.00 22.55 ? 998  PRX B "C4'" 1 
HETATM 9933  C "C5'" . PRX F 3 .   ? 73.727  124.606 81.113  1.00 21.10 ? 998  PRX B "C5'" 1 
HETATM 9934  O "O5'" . PRX F 3 .   ? 72.742  123.632 81.417  1.00 19.54 ? 998  PRX B "O5'" 1 
HETATM 9935  P P     . PRX F 3 .   ? 71.685  123.199 80.287  1.00 22.15 ? 998  PRX B P     1 
HETATM 9936  O O1P   . PRX F 3 .   ? 70.791  124.390 80.001  1.00 18.54 ? 998  PRX B O1P   1 
HETATM 9937  O O2P   . PRX F 3 .   ? 71.075  121.914 80.772  1.00 19.61 ? 998  PRX B O2P   1 
HETATM 9938  O O3P   . PRX F 3 .   ? 72.591  122.986 78.974  1.00 22.95 ? 998  PRX B O3P   1 
HETATM 9939  C C1P   . PRX F 3 .   ? 73.373  121.804 78.754  1.00 23.29 ? 998  PRX B C1P   1 
HETATM 9940  C C2P   . PRX F 3 .   ? 74.289  122.062 77.565  1.00 24.05 ? 998  PRX B C2P   1 
HETATM 9941  C C3P   . PRX F 3 .   ? 75.430  121.059 77.463  1.00 23.85 ? 998  PRX B C3P   1 
HETATM 9942  C "C3'" . PRX F 3 .   ? 75.546  126.004 82.159  1.00 20.96 ? 998  PRX B "C3'" 1 
HETATM 9943  O "O3'" . PRX F 3 .   ? 74.988  127.237 82.627  1.00 20.80 ? 998  PRX B "O3'" 1 
HETATM 9944  N N9    . PRX F 3 .   ? 77.736  123.760 81.657  1.00 19.85 ? 998  PRX B N9    1 
HETATM 9945  C C8    . PRX F 3 .   ? 77.418  123.416 80.408  1.00 19.26 ? 998  PRX B C8    1 
HETATM 9946  N N7    . PRX F 3 .   ? 78.561  123.181 79.729  1.00 20.52 ? 998  PRX B N7    1 
HETATM 9947  C C5    . PRX F 3 .   ? 79.589  123.369 80.580  1.00 18.65 ? 998  PRX B C5    1 
HETATM 9948  C C4    . PRX F 3 .   ? 79.055  123.743 81.797  1.00 19.09 ? 998  PRX B C4    1 
HETATM 9949  N N3    . PRX F 3 .   ? 79.868  124.018 82.852  1.00 20.42 ? 998  PRX B N3    1 
HETATM 9950  C C2    . PRX F 3 .   ? 81.197  123.915 82.684  1.00 20.57 ? 998  PRX B C2    1 
HETATM 9951  N N1    . PRX F 3 .   ? 81.739  123.554 81.507  1.00 18.88 ? 998  PRX B N1    1 
HETATM 9952  C C6    . PRX F 3 .   ? 80.960  123.275 80.445  1.00 19.50 ? 998  PRX B C6    1 
HETATM 9953  N N6    . PRX F 3 .   ? 81.512  122.901 79.260  1.00 20.05 ? 998  PRX B N6    1 
HETATM 9954  O O     . HOH G 4 .   ? 17.364  150.080 35.465  1.00 37.09 ? 1000 HOH A O     1 
HETATM 9955  O O     . HOH G 4 .   ? 19.665  146.168 29.993  1.00 22.95 ? 1001 HOH A O     1 
HETATM 9956  O O     . HOH G 4 .   ? 22.279  157.354 28.683  1.00 21.29 ? 1002 HOH A O     1 
HETATM 9957  O O     . HOH G 4 .   ? 25.968  157.182 28.504  1.00 16.90 ? 1003 HOH A O     1 
HETATM 9958  O O     . HOH G 4 .   ? 28.362  144.926 19.843  1.00 28.78 ? 1004 HOH A O     1 
HETATM 9959  O O     . HOH G 4 .   ? 30.261  146.787 26.275  1.00 15.54 ? 1005 HOH A O     1 
HETATM 9960  O O     . HOH G 4 .   ? 37.623  128.014 19.890  1.00 36.92 ? 1006 HOH A O     1 
HETATM 9961  O O     . HOH G 4 .   ? 41.816  130.906 31.154  1.00 38.20 ? 1007 HOH A O     1 
HETATM 9962  O O     . HOH G 4 .   ? 47.411  145.762 15.631  1.00 23.30 ? 1008 HOH A O     1 
HETATM 9963  O O     . HOH G 4 .   ? 55.735  145.982 17.943  1.00 25.03 ? 1009 HOH A O     1 
HETATM 9964  O O     . HOH G 4 .   ? 51.242  142.754 13.645  1.00 27.49 ? 1010 HOH A O     1 
HETATM 9965  O O     . HOH G 4 .   ? 55.786  128.236 31.427  1.00 23.12 ? 1011 HOH A O     1 
HETATM 9966  O O     . HOH G 4 .   ? 55.117  123.994 36.944  1.00 28.55 ? 1012 HOH A O     1 
HETATM 9967  O O     . HOH G 4 .   ? 50.398  126.350 44.010  1.00 14.26 ? 1013 HOH A O     1 
HETATM 9968  O O     . HOH G 4 .   ? 54.075  127.980 45.917  1.00 23.03 ? 1014 HOH A O     1 
HETATM 9969  O O     . HOH G 4 .   ? 51.697  124.994 49.302  1.00 29.99 ? 1015 HOH A O     1 
HETATM 9970  O O     . HOH G 4 .   ? 53.486  125.827 47.709  1.00 26.12 ? 1016 HOH A O     1 
HETATM 9971  O O     . HOH G 4 .   ? 59.987  126.028 38.703  1.00 24.58 ? 1017 HOH A O     1 
HETATM 9972  O O     . HOH G 4 .   ? 56.467  133.142 35.826  1.00 20.12 ? 1018 HOH A O     1 
HETATM 9973  O O     . HOH G 4 .   ? 53.529  131.595 25.590  1.00 22.97 ? 1019 HOH A O     1 
HETATM 9974  O O     . HOH G 4 .   ? 59.031  147.817 24.755  1.00 16.12 ? 1020 HOH A O     1 
HETATM 9975  O O     . HOH G 4 .   ? 59.755  146.003 26.650  1.00 21.07 ? 1021 HOH A O     1 
HETATM 9976  O O     . HOH G 4 .   ? 61.428  146.816 28.512  1.00 16.55 ? 1022 HOH A O     1 
HETATM 9977  O O     . HOH G 4 .   ? 48.404  155.369 12.027  1.00 27.65 ? 1023 HOH A O     1 
HETATM 9978  O O     . HOH G 4 .   ? 42.584  165.405 19.122  1.00 29.50 ? 1024 HOH A O     1 
HETATM 9979  O O     . HOH G 4 .   ? 47.003  167.727 19.174  1.00 34.84 ? 1025 HOH A O     1 
HETATM 9980  O O     . HOH G 4 .   ? 40.835  170.338 25.828  1.00 23.91 ? 1026 HOH A O     1 
HETATM 9981  O O     . HOH G 4 .   ? 39.882  172.933 35.439  1.00 21.82 ? 1027 HOH A O     1 
HETATM 9982  O O     . HOH G 4 .   ? 49.149  175.848 41.682  1.00 22.04 ? 1028 HOH A O     1 
HETATM 9983  O O     . HOH G 4 .   ? 44.430  176.117 30.335  1.00 29.37 ? 1029 HOH A O     1 
HETATM 9984  O O     . HOH G 4 .   ? 46.453  173.085 25.846  1.00 40.56 ? 1030 HOH A O     1 
HETATM 9985  O O     . HOH G 4 .   ? 60.424  156.511 14.991  1.00 37.59 ? 1031 HOH A O     1 
HETATM 9986  O O     . HOH G 4 .   ? 73.319  152.768 26.095  1.00 20.20 ? 1032 HOH A O     1 
HETATM 9987  O O     . HOH G 4 .   ? 70.635  148.634 24.700  1.00 24.59 ? 1033 HOH A O     1 
HETATM 9988  O O     . HOH G 4 .   ? 71.315  145.512 31.274  1.00 33.38 ? 1034 HOH A O     1 
HETATM 9989  O O     . HOH G 4 .   ? 66.124  143.991 34.077  1.00 33.02 ? 1035 HOH A O     1 
HETATM 9990  O O     . HOH G 4 .   ? 69.898  148.187 36.857  1.00 20.80 ? 1036 HOH A O     1 
HETATM 9991  O O     . HOH G 4 .   ? 68.883  145.585 38.325  1.00 24.38 ? 1037 HOH A O     1 
HETATM 9992  O O     . HOH G 4 .   ? 60.277  150.211 30.738  1.00 20.64 ? 1038 HOH A O     1 
HETATM 9993  O O     . HOH G 4 .   ? 64.462  150.021 20.785  1.00 29.69 ? 1039 HOH A O     1 
HETATM 9994  O O     . HOH G 4 .   ? 64.040  144.523 29.328  1.00 17.27 ? 1040 HOH A O     1 
HETATM 9995  O O     . HOH G 4 .   ? 57.306  151.083 37.471  1.00 14.05 ? 1041 HOH A O     1 
HETATM 9996  O O     . HOH G 4 .   ? 58.264  150.963 41.798  1.00 15.94 ? 1042 HOH A O     1 
HETATM 9997  O O     . HOH G 4 .   ? 56.746  158.837 39.925  1.00 16.12 ? 1043 HOH A O     1 
HETATM 9998  O O     . HOH G 4 .   ? 55.270  153.692 43.124  1.00 13.76 ? 1044 HOH A O     1 
HETATM 9999  O O     . HOH G 4 .   ? 63.423  159.479 54.967  1.00 17.43 ? 1045 HOH A O     1 
HETATM 10000 O O     . HOH G 4 .   ? 67.871  156.542 53.702  1.00 29.08 ? 1046 HOH A O     1 
HETATM 10001 O O     . HOH G 4 .   ? 71.733  150.576 44.965  1.00 23.28 ? 1047 HOH A O     1 
HETATM 10002 O O     . HOH G 4 .   ? 69.440  144.410 43.007  1.00 28.86 ? 1048 HOH A O     1 
HETATM 10003 O O     . HOH G 4 .   ? 63.307  169.394 46.009  1.00 14.71 ? 1049 HOH A O     1 
HETATM 10004 O O     . HOH G 4 .   ? 69.096  167.432 51.511  1.00 27.11 ? 1050 HOH A O     1 
HETATM 10005 O O     . HOH G 4 .   ? 64.175  165.757 52.196  1.00 30.72 ? 1051 HOH A O     1 
HETATM 10006 O O     . HOH G 4 .   ? 72.840  163.158 47.606  1.00 19.92 ? 1052 HOH A O     1 
HETATM 10007 O O     . HOH G 4 .   ? 71.612  147.835 44.916  1.00 23.09 ? 1053 HOH A O     1 
HETATM 10008 O O     . HOH G 4 .   ? 74.817  155.560 44.001  1.00 27.81 ? 1054 HOH A O     1 
HETATM 10009 O O     . HOH G 4 .   ? 72.727  156.763 34.873  1.00 29.94 ? 1055 HOH A O     1 
HETATM 10010 O O     . HOH G 4 .   ? 64.723  171.003 32.780  1.00 7.74  ? 1056 HOH A O     1 
HETATM 10011 O O     . HOH G 4 .   ? 60.365  177.913 42.937  1.00 24.74 ? 1057 HOH A O     1 
HETATM 10012 O O     . HOH G 4 .   ? 72.757  169.630 32.883  1.00 21.27 ? 1058 HOH A O     1 
HETATM 10013 O O     . HOH G 4 .   ? 62.514  158.073 14.727  1.00 35.38 ? 1059 HOH A O     1 
HETATM 10014 O O     . HOH G 4 .   ? 54.051  138.210 27.210  1.00 18.69 ? 1060 HOH A O     1 
HETATM 10015 O O     . HOH G 4 .   ? 53.313  140.307 30.295  1.00 14.01 ? 1061 HOH A O     1 
HETATM 10016 O O     . HOH G 4 .   ? 53.004  140.804 33.083  1.00 10.42 ? 1062 HOH A O     1 
HETATM 10017 O O     . HOH G 4 .   ? 53.978  144.494 55.397  1.00 20.74 ? 1063 HOH A O     1 
HETATM 10018 O O     . HOH G 4 .   ? 55.025  145.776 52.356  1.00 20.15 ? 1064 HOH A O     1 
HETATM 10019 O O     . HOH G 4 .   ? 55.516  142.409 51.200  1.00 21.11 ? 1065 HOH A O     1 
HETATM 10020 O O     . HOH G 4 .   ? 58.568  144.611 57.575  1.00 29.32 ? 1066 HOH A O     1 
HETATM 10021 O O     . HOH G 4 .   ? 61.444  142.963 45.115  1.00 17.32 ? 1067 HOH A O     1 
HETATM 10022 O O     . HOH G 4 .   ? 47.698  144.289 31.730  1.00 17.36 ? 1068 HOH A O     1 
HETATM 10023 O O     . HOH G 4 .   ? 40.935  161.481 20.229  1.00 38.64 ? 1069 HOH A O     1 
HETATM 10024 O O     . HOH G 4 .   ? 34.046  159.444 19.760  1.00 32.02 ? 1070 HOH A O     1 
HETATM 10025 O O     . HOH G 4 .   ? 33.909  163.066 21.458  1.00 42.02 ? 1071 HOH A O     1 
HETATM 10026 O O     . HOH G 4 .   ? 34.331  165.172 23.835  1.00 25.85 ? 1072 HOH A O     1 
HETATM 10027 O O     . HOH G 4 .   ? 43.847  159.521 31.741  1.00 15.42 ? 1073 HOH A O     1 
HETATM 10028 O O     . HOH G 4 .   ? 44.888  162.428 36.010  1.00 14.69 ? 1074 HOH A O     1 
HETATM 10029 O O     . HOH G 4 .   ? 48.232  162.185 41.657  1.00 21.18 ? 1075 HOH A O     1 
HETATM 10030 O O     . HOH G 4 .   ? 44.373  170.718 42.105  1.00 18.20 ? 1076 HOH A O     1 
HETATM 10031 O O     . HOH G 4 .   ? 37.966  174.930 41.175  1.00 19.26 ? 1077 HOH A O     1 
HETATM 10032 O O     . HOH G 4 .   ? 33.891  167.976 41.065  1.00 15.12 ? 1078 HOH A O     1 
HETATM 10033 O O     . HOH G 4 .   ? 35.434  174.516 33.389  1.00 25.15 ? 1079 HOH A O     1 
HETATM 10034 O O     . HOH G 4 .   ? 30.784  168.315 30.003  1.00 20.23 ? 1080 HOH A O     1 
HETATM 10035 O O     . HOH G 4 .   ? 29.856  170.102 28.588  1.00 19.88 ? 1081 HOH A O     1 
HETATM 10036 O O     . HOH G 4 .   ? 35.647  150.791 43.271  1.00 10.82 ? 1082 HOH A O     1 
HETATM 10037 O O     . HOH G 4 .   ? 31.899  154.020 49.880  1.00 20.64 ? 1083 HOH A O     1 
HETATM 10038 O O     . HOH G 4 .   ? 32.154  175.774 39.149  1.00 26.58 ? 1084 HOH A O     1 
HETATM 10039 O O     . HOH G 4 .   ? 27.164  163.589 33.096  1.00 20.32 ? 1085 HOH A O     1 
HETATM 10040 O O     . HOH G 4 .   ? 26.031  162.331 30.979  1.00 19.39 ? 1086 HOH A O     1 
HETATM 10041 O O     . HOH G 4 .   ? 25.593  152.606 51.390  1.00 37.30 ? 1087 HOH A O     1 
HETATM 10042 O O     . HOH G 4 .   ? 25.466  158.066 35.392  1.00 18.88 ? 1088 HOH A O     1 
HETATM 10043 O O     . HOH G 4 .   ? 24.182  150.667 32.721  1.00 30.55 ? 1089 HOH A O     1 
HETATM 10044 O O     . HOH G 4 .   ? 25.686  148.892 32.038  1.00 19.97 ? 1090 HOH A O     1 
HETATM 10045 O O     . HOH G 4 .   ? 29.759  149.425 38.586  1.00 15.02 ? 1091 HOH A O     1 
HETATM 10046 O O     . HOH G 4 .   ? 28.016  147.145 39.177  1.00 14.67 ? 1092 HOH A O     1 
HETATM 10047 O O     . HOH G 4 .   ? 29.983  148.940 41.889  1.00 25.96 ? 1093 HOH A O     1 
HETATM 10048 O O     . HOH G 4 .   ? 40.932  154.779 38.981  1.00 30.90 ? 1094 HOH A O     1 
HETATM 10049 O O     . HOH G 4 .   ? 33.702  141.425 32.549  1.00 31.15 ? 1095 HOH A O     1 
HETATM 10050 O O     . HOH G 4 .   ? 32.394  144.610 44.576  1.00 14.04 ? 1096 HOH A O     1 
HETATM 10051 O O     . HOH G 4 .   ? 42.024  132.870 34.842  1.00 17.73 ? 1097 HOH A O     1 
HETATM 10052 O O     . HOH G 4 .   ? 45.724  124.018 49.511  1.00 22.51 ? 1098 HOH A O     1 
HETATM 10053 O O     . HOH G 4 .   ? 62.349  136.619 39.707  1.00 20.69 ? 1099 HOH A O     1 
HETATM 10054 O O     . HOH G 4 .   ? 51.616  132.828 52.599  1.00 35.16 ? 1100 HOH A O     1 
HETATM 10055 O O     . HOH G 4 .   ? 47.211  130.243 46.714  1.00 15.33 ? 1101 HOH A O     1 
HETATM 10056 O O     . HOH G 4 .   ? 49.284  132.086 48.799  1.00 23.89 ? 1102 HOH A O     1 
HETATM 10057 O O     . HOH G 4 .   ? 48.000  137.061 49.203  1.00 34.05 ? 1103 HOH A O     1 
HETATM 10058 O O     . HOH G 4 .   ? 34.011  137.973 52.770  1.00 43.07 ? 1104 HOH A O     1 
HETATM 10059 O O     . HOH G 4 .   ? 42.215  146.281 54.399  1.00 22.04 ? 1105 HOH A O     1 
HETATM 10060 O O     . HOH G 4 .   ? 63.203  150.383 68.742  1.00 10.20 ? 1106 HOH A O     1 
HETATM 10061 O O     . HOH G 4 .   ? 64.094  160.042 70.045  1.00 40.79 ? 1107 HOH A O     1 
HETATM 10062 O O     . HOH G 4 .   ? 46.672  144.639 61.073  1.00 45.25 ? 1108 HOH A O     1 
HETATM 10063 O O     . HOH G 4 .   ? 54.433  151.976 76.500  1.00 26.82 ? 1109 HOH A O     1 
HETATM 10064 O O     . HOH G 4 .   ? 51.722  166.254 69.431  1.00 19.88 ? 1110 HOH A O     1 
HETATM 10065 O O     . HOH G 4 .   ? 56.178  167.775 74.731  1.00 19.90 ? 1111 HOH A O     1 
HETATM 10066 O O     . HOH G 4 .   ? 48.202  138.742 76.375  1.00 34.85 ? 1112 HOH A O     1 
HETATM 10067 O O     . HOH G 4 .   ? 52.882  129.215 66.890  1.00 38.17 ? 1113 HOH A O     1 
HETATM 10068 O O     . HOH G 4 .   ? 61.703  134.528 38.166  1.00 62.84 ? 1114 HOH A O     1 
HETATM 10069 O O     . HOH G 4 .   ? 23.547  153.512 33.697  1.00 19.83 ? 1115 HOH A O     1 
HETATM 10070 O O     . HOH G 4 .   ? 25.906  158.695 23.695  1.00 26.64 ? 1116 HOH A O     1 
HETATM 10071 O O     . HOH G 4 .   ? 32.544  147.344 25.229  1.00 18.88 ? 1117 HOH A O     1 
HETATM 10072 O O     . HOH G 4 .   ? 23.925  146.602 21.758  1.00 20.24 ? 1118 HOH A O     1 
HETATM 10073 O O     . HOH G 4 .   ? 23.751  146.241 24.534  1.00 24.25 ? 1119 HOH A O     1 
HETATM 10074 O O     . HOH G 4 .   ? 21.436  145.835 25.417  1.00 20.90 ? 1120 HOH A O     1 
HETATM 10075 O O     . HOH G 4 .   ? 20.378  141.407 25.327  1.00 35.83 ? 1121 HOH A O     1 
HETATM 10076 O O     . HOH G 4 .   ? 32.042  130.421 22.620  1.00 30.41 ? 1122 HOH A O     1 
HETATM 10077 O O     . HOH G 4 .   ? 43.426  126.550 24.249  1.00 26.40 ? 1123 HOH A O     1 
HETATM 10078 O O     . HOH G 4 .   ? 44.202  125.921 28.522  1.00 39.21 ? 1124 HOH A O     1 
HETATM 10079 O O     . HOH G 4 .   ? 41.528  142.007 17.567  1.00 35.02 ? 1125 HOH A O     1 
HETATM 10080 O O     . HOH G 4 .   ? 51.370  137.830 16.100  1.00 37.31 ? 1126 HOH A O     1 
HETATM 10081 O O     . HOH G 4 .   ? 56.031  147.331 15.729  1.00 23.34 ? 1127 HOH A O     1 
HETATM 10082 O O     . HOH G 4 .   ? 48.086  128.101 34.696  1.00 31.46 ? 1128 HOH A O     1 
HETATM 10083 O O     . HOH G 4 .   ? 47.896  126.017 36.189  1.00 38.42 ? 1129 HOH A O     1 
HETATM 10084 O O     . HOH G 4 .   ? 60.676  127.383 43.176  1.00 33.57 ? 1130 HOH A O     1 
HETATM 10085 O O     . HOH G 4 .   ? 47.044  163.080 11.716  1.00 44.11 ? 1131 HOH A O     1 
HETATM 10086 O O     . HOH G 4 .   ? 52.376  176.072 37.690  1.00 22.77 ? 1132 HOH A O     1 
HETATM 10087 O O     . HOH G 4 .   ? 49.959  174.072 37.311  1.00 23.10 ? 1133 HOH A O     1 
HETATM 10088 O O     . HOH G 4 .   ? 57.396  162.226 15.440  1.00 24.86 ? 1134 HOH A O     1 
HETATM 10089 O O     . HOH G 4 .   ? 65.734  142.591 29.860  1.00 21.45 ? 1135 HOH A O     1 
HETATM 10090 O O     . HOH G 4 .   ? 54.125  160.383 41.617  1.00 15.70 ? 1136 HOH A O     1 
HETATM 10091 O O     . HOH G 4 .   ? 53.625  168.580 39.527  1.00 13.19 ? 1137 HOH A O     1 
HETATM 10092 O O     . HOH G 4 .   ? 51.729  166.577 40.470  1.00 14.62 ? 1138 HOH A O     1 
HETATM 10093 O O     . HOH G 4 .   ? 54.561  164.179 44.038  1.00 25.79 ? 1139 HOH A O     1 
HETATM 10094 O O     . HOH G 4 .   ? 52.568  162.665 42.472  1.00 22.75 ? 1140 HOH A O     1 
HETATM 10095 O O     . HOH G 4 .   ? 67.558  146.405 21.900  1.00 30.29 ? 1141 HOH A O     1 
HETATM 10096 O O     . HOH G 4 .   ? 56.479  151.734 44.990  1.00 27.80 ? 1142 HOH A O     1 
HETATM 10097 O O     . HOH G 4 .   ? 61.706  147.935 49.278  1.00 35.05 ? 1143 HOH A O     1 
HETATM 10098 O O     . HOH G 4 .   ? 65.297  174.017 40.302  1.00 20.09 ? 1144 HOH A O     1 
HETATM 10099 O O     . HOH G 4 .   ? 54.611  175.473 48.542  1.00 33.42 ? 1145 HOH A O     1 
HETATM 10100 O O     . HOH G 4 .   ? 69.991  168.035 49.374  1.00 26.28 ? 1146 HOH A O     1 
HETATM 10101 O O     . HOH G 4 .   ? 67.540  170.935 48.645  1.00 40.41 ? 1147 HOH A O     1 
HETATM 10102 O O     . HOH G 4 .   ? 68.134  169.610 46.553  1.00 28.78 ? 1148 HOH A O     1 
HETATM 10103 O O     . HOH G 4 .   ? 67.983  154.395 16.368  1.00 29.41 ? 1149 HOH A O     1 
HETATM 10104 O O     . HOH G 4 .   ? 51.385  149.091 47.675  1.00 14.21 ? 1150 HOH A O     1 
HETATM 10105 O O     . HOH G 4 .   ? 50.822  152.403 48.847  1.00 29.96 ? 1151 HOH A O     1 
HETATM 10106 O O     . HOH G 4 .   ? 50.758  140.135 49.939  1.00 30.62 ? 1152 HOH A O     1 
HETATM 10107 O O     . HOH G 4 .   ? 53.526  138.634 52.318  1.00 35.94 ? 1153 HOH A O     1 
HETATM 10108 O O     . HOH G 4 .   ? 44.905  162.865 38.739  1.00 8.99  ? 1154 HOH A O     1 
HETATM 10109 O O     . HOH G 4 .   ? 49.946  149.262 45.478  1.00 14.01 ? 1155 HOH A O     1 
HETATM 10110 O O     . HOH G 4 .   ? 50.448  150.008 42.346  1.00 24.18 ? 1156 HOH A O     1 
HETATM 10111 O O     . HOH G 4 .   ? 25.102  166.190 46.524  1.00 28.88 ? 1157 HOH A O     1 
HETATM 10112 O O     . HOH G 4 .   ? 24.919  175.156 39.302  1.00 33.23 ? 1158 HOH A O     1 
HETATM 10113 O O     . HOH G 4 .   ? 24.942  163.878 28.904  1.00 24.70 ? 1159 HOH A O     1 
HETATM 10114 O O     . HOH G 4 .   ? 23.533  158.336 47.307  1.00 29.76 ? 1160 HOH A O     1 
HETATM 10115 O O     . HOH G 4 .   ? 32.090  133.193 38.344  1.00 27.01 ? 1161 HOH A O     1 
HETATM 10116 O O     . HOH G 4 .   ? 62.279  147.704 62.587  1.00 25.56 ? 1162 HOH A O     1 
HETATM 10117 O O     . HOH G 4 .   ? 65.431  150.987 67.505  1.00 25.30 ? 1163 HOH A O     1 
HETATM 10118 O O     . HOH G 4 .   ? 60.515  162.139 63.965  1.00 19.41 ? 1164 HOH A O     1 
HETATM 10119 O O     . HOH G 4 .   ? 52.431  163.131 57.916  1.00 41.73 ? 1165 HOH A O     1 
HETATM 10120 O O     . HOH G 4 .   ? 49.019  149.152 78.956  1.00 37.58 ? 1166 HOH A O     1 
HETATM 10121 O O     . HOH G 4 .   ? 42.504  158.608 41.573  1.00 34.35 ? 1167 HOH A O     1 
HETATM 10122 O O     . HOH G 4 .   ? 46.095  157.910 42.768  1.00 27.97 ? 1168 HOH A O     1 
HETATM 10123 O O     . HOH G 4 .   ? 47.656  158.686 45.027  1.00 30.80 ? 1169 HOH A O     1 
HETATM 10124 O O     . HOH G 4 .   ? 45.347  161.157 54.494  1.00 44.88 ? 1170 HOH A O     1 
HETATM 10125 O O     . HOH G 4 .   ? 47.142  157.098 52.369  1.00 34.33 ? 1171 HOH A O     1 
HETATM 10126 O O     . HOH G 4 .   ? 57.361  162.994 51.110  1.00 31.87 ? 1172 HOH A O     1 
HETATM 10127 O O     . HOH G 4 .   ? 47.584  158.012 56.810  1.00 29.14 ? 1173 HOH A O     1 
HETATM 10128 O O     . HOH G 4 .   ? 44.442  147.534 49.879  1.00 27.94 ? 1174 HOH A O     1 
HETATM 10129 O O     . HOH G 4 .   ? 39.018  150.741 52.431  1.00 32.92 ? 1175 HOH A O     1 
HETATM 10130 O O     . HOH G 4 .   ? 42.255  154.876 41.372  1.00 34.11 ? 1176 HOH A O     1 
HETATM 10131 O O     . HOH G 4 .   ? 46.385  152.031 41.460  1.00 27.17 ? 1177 HOH A O     1 
HETATM 10132 O O     . HOH G 4 .   ? 43.887  150.246 46.056  1.00 27.97 ? 1178 HOH A O     1 
HETATM 10133 O O     . HOH G 4 .   ? 33.787  154.221 53.816  1.00 36.77 ? 1179 HOH A O     1 
HETATM 10134 O O     . HOH H 4 .   ? 51.743  120.558 113.061 1.00 34.77 ? 999  HOH B O     1 
HETATM 10135 O O     . HOH H 4 .   ? 63.398  147.082 72.569  1.00 34.37 ? 1000 HOH B O     1 
HETATM 10136 O O     . HOH H 4 .   ? 56.304  134.672 74.588  1.00 24.83 ? 1001 HOH B O     1 
HETATM 10137 O O     . HOH H 4 .   ? 89.371  123.468 63.873  1.00 28.79 ? 1002 HOH B O     1 
HETATM 10138 O O     . HOH H 4 .   ? 69.547  132.119 51.783  1.00 39.22 ? 1003 HOH B O     1 
HETATM 10139 O O     . HOH H 4 .   ? 66.016  139.113 61.182  1.00 26.43 ? 1004 HOH B O     1 
HETATM 10140 O O     . HOH H 4 .   ? 68.262  144.484 79.553  1.00 21.69 ? 1005 HOH B O     1 
HETATM 10141 O O     . HOH H 4 .   ? 62.549  137.583 71.290  1.00 26.88 ? 1006 HOH B O     1 
HETATM 10142 O O     . HOH H 4 .   ? 65.473  132.445 62.660  1.00 19.22 ? 1007 HOH B O     1 
HETATM 10143 O O     . HOH H 4 .   ? 60.313  134.847 60.305  1.00 29.22 ? 1008 HOH B O     1 
HETATM 10144 O O     . HOH H 4 .   ? 59.727  134.486 56.477  1.00 26.91 ? 1009 HOH B O     1 
HETATM 10145 O O     . HOH H 4 .   ? 64.355  124.554 53.584  1.00 30.20 ? 1010 HOH B O     1 
HETATM 10146 O O     . HOH H 4 .   ? 60.796  123.008 60.037  1.00 18.65 ? 1011 HOH B O     1 
HETATM 10147 O O     . HOH H 4 .   ? 59.778  124.833 61.986  1.00 22.12 ? 1012 HOH B O     1 
HETATM 10148 O O     . HOH H 4 .   ? 73.662  99.887  78.456  1.00 19.50 ? 1013 HOH B O     1 
HETATM 10149 O O     . HOH H 4 .   ? 68.655  95.012  77.932  1.00 33.36 ? 1014 HOH B O     1 
HETATM 10150 O O     . HOH H 4 .   ? 72.504  103.020 55.699  1.00 37.50 ? 1015 HOH B O     1 
HETATM 10151 O O     . HOH H 4 .   ? 48.231  126.189 61.938  1.00 28.79 ? 1016 HOH B O     1 
HETATM 10152 O O     . HOH H 4 .   ? 50.204  125.292 72.851  1.00 24.46 ? 1017 HOH B O     1 
HETATM 10153 O O     . HOH H 4 .   ? 61.587  111.986 75.548  1.00 25.68 ? 1018 HOH B O     1 
HETATM 10154 O O     . HOH H 4 .   ? 64.205  110.363 77.349  1.00 15.08 ? 1019 HOH B O     1 
HETATM 10155 O O     . HOH H 4 .   ? 66.414  104.272 76.282  1.00 28.64 ? 1020 HOH B O     1 
HETATM 10156 O O     . HOH H 4 .   ? 64.615  102.097 75.285  1.00 17.48 ? 1021 HOH B O     1 
HETATM 10157 O O     . HOH H 4 .   ? 55.503  120.787 55.835  1.00 33.93 ? 1022 HOH B O     1 
HETATM 10158 O O     . HOH H 4 .   ? 58.046  123.995 63.791  1.00 22.30 ? 1023 HOH B O     1 
HETATM 10159 O O     . HOH H 4 .   ? 55.631  126.430 64.227  1.00 14.08 ? 1024 HOH B O     1 
HETATM 10160 O O     . HOH H 4 .   ? 61.614  119.815 72.676  1.00 14.51 ? 1025 HOH B O     1 
HETATM 10161 O O     . HOH H 4 .   ? 60.280  119.891 77.158  1.00 14.77 ? 1026 HOH B O     1 
HETATM 10162 O O     . HOH H 4 .   ? 63.098  117.221 78.886  1.00 13.56 ? 1027 HOH B O     1 
HETATM 10163 O O     . HOH H 4 .   ? 54.156  111.601 89.956  1.00 17.75 ? 1028 HOH B O     1 
HETATM 10164 O O     . HOH H 4 .   ? 46.314  120.654 79.146  1.00 22.41 ? 1029 HOH B O     1 
HETATM 10165 O O     . HOH H 4 .   ? 46.555  123.251 78.919  1.00 28.11 ? 1030 HOH B O     1 
HETATM 10166 O O     . HOH H 4 .   ? 56.842  127.942 80.115  1.00 19.02 ? 1031 HOH B O     1 
HETATM 10167 O O     . HOH H 4 .   ? 54.436  101.755 80.970  1.00 11.68 ? 1032 HOH B O     1 
HETATM 10168 O O     . HOH H 4 .   ? 49.785  101.779 81.197  1.00 22.83 ? 1033 HOH B O     1 
HETATM 10169 O O     . HOH H 4 .   ? 47.518  103.075 83.613  1.00 33.29 ? 1034 HOH B O     1 
HETATM 10170 O O     . HOH H 4 .   ? 44.977  108.463 81.864  1.00 24.67 ? 1035 HOH B O     1 
HETATM 10171 O O     . HOH H 4 .   ? 53.811  99.946  67.912  1.00 4.56  ? 1036 HOH B O     1 
HETATM 10172 O O     . HOH H 4 .   ? 52.651  97.050  75.287  1.00 16.64 ? 1037 HOH B O     1 
HETATM 10173 O O     . HOH H 4 .   ? 57.575  93.163  78.349  1.00 22.48 ? 1038 HOH B O     1 
HETATM 10174 O O     . HOH H 4 .   ? 45.525  97.006  72.887  1.00 32.65 ? 1039 HOH B O     1 
HETATM 10175 O O     . HOH H 4 .   ? 36.075  105.116 77.086  1.00 41.88 ? 1040 HOH B O     1 
HETATM 10176 O O     . HOH H 4 .   ? 41.986  103.390 70.772  1.00 30.84 ? 1041 HOH B O     1 
HETATM 10177 O O     . HOH H 4 .   ? 45.798  101.484 67.608  1.00 21.05 ? 1042 HOH B O     1 
HETATM 10178 O O     . HOH H 4 .   ? 46.017  97.102  67.409  1.00 35.25 ? 1043 HOH B O     1 
HETATM 10179 O O     . HOH H 4 .   ? 55.424  99.859  56.768  1.00 43.62 ? 1044 HOH B O     1 
HETATM 10180 O O     . HOH H 4 .   ? 63.957  126.432 91.033  1.00 20.20 ? 1045 HOH B O     1 
HETATM 10181 O O     . HOH H 4 .   ? 62.987  125.296 88.065  1.00 32.74 ? 1046 HOH B O     1 
HETATM 10182 O O     . HOH H 4 .   ? 62.484  128.176 86.557  1.00 25.53 ? 1047 HOH B O     1 
HETATM 10183 O O     . HOH H 4 .   ? 64.771  132.038 87.817  1.00 33.88 ? 1048 HOH B O     1 
HETATM 10184 O O     . HOH H 4 .   ? 66.294  130.043 68.586  1.00 16.88 ? 1049 HOH B O     1 
HETATM 10185 O O     . HOH H 4 .   ? 66.220  130.567 65.887  1.00 18.15 ? 1050 HOH B O     1 
HETATM 10186 O O     . HOH H 4 .   ? 71.708  126.198 67.792  1.00 14.26 ? 1051 HOH B O     1 
HETATM 10187 O O     . HOH H 4 .   ? 80.286  102.254 61.231  1.00 30.91 ? 1052 HOH B O     1 
HETATM 10188 O O     . HOH H 4 .   ? 75.148  110.940 68.223  1.00 22.81 ? 1053 HOH B O     1 
HETATM 10189 O O     . HOH H 4 .   ? 73.412  108.109 72.293  1.00 21.14 ? 1054 HOH B O     1 
HETATM 10190 O O     . HOH H 4 .   ? 73.384  107.701 75.030  1.00 21.42 ? 1055 HOH B O     1 
HETATM 10191 O O     . HOH H 4 .   ? 71.979  112.548 79.042  1.00 33.73 ? 1056 HOH B O     1 
HETATM 10192 O O     . HOH H 4 .   ? 68.062  120.708 78.332  1.00 27.40 ? 1057 HOH B O     1 
HETATM 10193 O O     . HOH H 4 .   ? 81.331  102.733 85.587  1.00 31.87 ? 1058 HOH B O     1 
HETATM 10194 O O     . HOH H 4 .   ? 80.192  95.744  78.204  1.00 25.94 ? 1059 HOH B O     1 
HETATM 10195 O O     . HOH H 4 .   ? 84.115  102.095 78.230  1.00 18.01 ? 1060 HOH B O     1 
HETATM 10196 O O     . HOH H 4 .   ? 82.990  96.077  70.393  1.00 28.03 ? 1061 HOH B O     1 
HETATM 10197 O O     . HOH H 4 .   ? 78.517  97.489  72.246  1.00 28.85 ? 1062 HOH B O     1 
HETATM 10198 O O     . HOH H 4 .   ? 92.636  103.980 84.613  1.00 28.40 ? 1063 HOH B O     1 
HETATM 10199 O O     . HOH H 4 .   ? 94.447  106.050 67.216  1.00 31.38 ? 1064 HOH B O     1 
HETATM 10200 O O     . HOH H 4 .   ? 93.259  113.120 66.677  1.00 24.67 ? 1065 HOH B O     1 
HETATM 10201 O O     . HOH H 4 .   ? 82.785  119.592 79.956  1.00 17.87 ? 1066 HOH B O     1 
HETATM 10202 O O     . HOH H 4 .   ? 80.664  118.554 87.338  1.00 39.43 ? 1067 HOH B O     1 
HETATM 10203 O O     . HOH H 4 .   ? 85.713  116.424 86.995  1.00 27.37 ? 1068 HOH B O     1 
HETATM 10204 O O     . HOH H 4 .   ? 93.086  112.249 73.485  1.00 19.71 ? 1069 HOH B O     1 
HETATM 10205 O O     . HOH H 4 .   ? 84.672  123.420 81.439  1.00 40.23 ? 1070 HOH B O     1 
HETATM 10206 O O     . HOH H 4 .   ? 85.602  129.127 69.545  1.00 39.68 ? 1071 HOH B O     1 
HETATM 10207 O O     . HOH H 4 .   ? 85.824  125.984 81.668  1.00 22.43 ? 1072 HOH B O     1 
HETATM 10208 O O     . HOH H 4 .   ? 76.466  137.721 66.264  1.00 34.57 ? 1073 HOH B O     1 
HETATM 10209 O O     . HOH H 4 .   ? 77.402  137.541 71.000  1.00 23.95 ? 1074 HOH B O     1 
HETATM 10210 O O     . HOH H 4 .   ? 84.908  141.011 80.707  1.00 27.39 ? 1075 HOH B O     1 
HETATM 10211 O O     . HOH H 4 .   ? 83.594  140.176 89.996  1.00 29.60 ? 1076 HOH B O     1 
HETATM 10212 O O     . HOH H 4 .   ? 54.266  137.093 81.049  1.00 31.88 ? 1077 HOH B O     1 
HETATM 10213 O O     . HOH H 4 .   ? 71.201  140.689 82.787  1.00 18.63 ? 1078 HOH B O     1 
HETATM 10214 O O     . HOH H 4 .   ? 69.283  138.833 84.473  1.00 24.20 ? 1079 HOH B O     1 
HETATM 10215 O O     . HOH H 4 .   ? 70.806  129.828 82.432  1.00 19.91 ? 1080 HOH B O     1 
HETATM 10216 O O     . HOH H 4 .   ? 53.822  120.557 103.923 1.00 7.83  ? 1081 HOH B O     1 
HETATM 10217 O O     . HOH H 4 .   ? 52.379  121.246 106.138 1.00 27.88 ? 1082 HOH B O     1 
HETATM 10218 O O     . HOH H 4 .   ? 73.810  125.155 96.374  1.00 25.08 ? 1083 HOH B O     1 
HETATM 10219 O O     . HOH H 4 .   ? 69.601  110.487 95.245  1.00 27.66 ? 1084 HOH B O     1 
HETATM 10220 O O     . HOH H 4 .   ? 62.344  118.930 112.293 1.00 27.18 ? 1085 HOH B O     1 
HETATM 10221 O O     . HOH H 4 .   ? 59.421  121.329 114.154 1.00 39.12 ? 1086 HOH B O     1 
HETATM 10222 O O     . HOH H 4 .   ? 53.869  121.537 113.527 1.00 22.31 ? 1087 HOH B O     1 
HETATM 10223 O O     . HOH H 4 .   ? 51.959  118.730 112.954 1.00 44.83 ? 1088 HOH B O     1 
HETATM 10224 O O     . HOH H 4 .   ? 68.962  132.528 112.141 1.00 22.58 ? 1089 HOH B O     1 
HETATM 10225 O O     . HOH H 4 .   ? 58.468  136.922 105.757 1.00 24.86 ? 1090 HOH B O     1 
HETATM 10226 O O     . HOH H 4 .   ? 70.796  144.089 65.529  1.00 33.80 ? 1091 HOH B O     1 
HETATM 10227 O O     . HOH H 4 .   ? 52.717  103.166 54.708  1.00 34.48 ? 1092 HOH B O     1 
HETATM 10228 O O     . HOH H 4 .   ? 44.166  108.955 61.780  1.00 36.34 ? 1093 HOH B O     1 
HETATM 10229 O O     . HOH H 4 .   ? 53.245  127.312 69.049  1.00 36.04 ? 1094 HOH B O     1 
HETATM 10230 O O     . HOH H 4 .   ? 49.144  123.062 71.637  1.00 27.63 ? 1095 HOH B O     1 
HETATM 10231 O O     . HOH H 4 .   ? 63.116  100.223 68.588  1.00 28.17 ? 1096 HOH B O     1 
HETATM 10232 O O     . HOH H 4 .   ? 52.154  124.724 56.826  1.00 31.45 ? 1097 HOH B O     1 
HETATM 10233 O O     . HOH H 4 .   ? 60.431  107.609 85.966  1.00 37.44 ? 1098 HOH B O     1 
HETATM 10234 O O     . HOH H 4 .   ? 49.028  113.110 88.353  1.00 37.09 ? 1099 HOH B O     1 
HETATM 10235 O O     . HOH H 4 .   ? 56.156  123.445 84.273  1.00 32.46 ? 1100 HOH B O     1 
HETATM 10236 O O     . HOH H 4 .   ? 56.486  121.438 85.751  1.00 27.35 ? 1101 HOH B O     1 
HETATM 10237 O O     . HOH H 4 .   ? 44.690  122.857 71.642  1.00 39.68 ? 1102 HOH B O     1 
HETATM 10238 O O     . HOH H 4 .   ? 68.012  101.920 83.932  1.00 25.65 ? 1103 HOH B O     1 
HETATM 10239 O O     . HOH H 4 .   ? 64.405  94.499  79.195  1.00 32.28 ? 1104 HOH B O     1 
HETATM 10240 O O     . HOH H 4 .   ? 44.235  105.526 81.691  1.00 32.15 ? 1105 HOH B O     1 
HETATM 10241 O O     . HOH H 4 .   ? 51.624  97.146  67.806  1.00 37.76 ? 1106 HOH B O     1 
HETATM 10242 O O     . HOH H 4 .   ? 51.228  95.318  73.922  1.00 30.81 ? 1107 HOH B O     1 
HETATM 10243 O O     . HOH H 4 .   ? 62.492  119.479 86.909  1.00 25.35 ? 1108 HOH B O     1 
HETATM 10244 O O     . HOH H 4 .   ? 66.851  121.720 83.430  1.00 12.64 ? 1109 HOH B O     1 
HETATM 10245 O O     . HOH H 4 .   ? 68.459  121.565 81.405  1.00 15.21 ? 1110 HOH B O     1 
HETATM 10246 O O     . HOH H 4 .   ? 63.042  132.019 84.898  1.00 31.76 ? 1111 HOH B O     1 
HETATM 10247 O O     . HOH H 4 .   ? 85.031  105.114 60.995  1.00 28.98 ? 1112 HOH B O     1 
HETATM 10248 O O     . HOH H 4 .   ? 88.012  102.044 67.696  1.00 29.17 ? 1113 HOH B O     1 
HETATM 10249 O O     . HOH H 4 .   ? 92.606  130.666 85.650  1.00 42.73 ? 1114 HOH B O     1 
HETATM 10250 O O     . HOH H 4 .   ? 55.402  123.631 97.974  1.00 17.86 ? 1115 HOH B O     1 
HETATM 10251 O O     . HOH H 4 .   ? 60.445  103.348 110.302 1.00 22.02 ? 1116 HOH B O     1 
HETATM 10252 O O     . HOH H 4 .   ? 56.446  108.949 99.338  1.00 17.80 ? 1117 HOH B O     1 
HETATM 10253 O O     . HOH H 4 .   ? 69.643  114.524 110.489 1.00 37.51 ? 1118 HOH B O     1 
HETATM 10254 O O     . HOH H 4 .   ? 63.165  105.465 86.457  1.00 38.49 ? 1119 HOH B O     1 
HETATM 10255 O O     . HOH H 4 .   ? 65.143  104.956 78.692  1.00 21.58 ? 1120 HOH B O     1 
HETATM 10256 O O     . HOH H 4 .   ? 75.795  112.048 78.087  1.00 38.30 ? 1121 HOH B O     1 
HETATM 10257 O O     . HOH H 4 .   ? 70.146  108.383 77.397  1.00 29.18 ? 1122 HOH B O     1 
HETATM 10258 O O     . HOH H 4 .   ? 71.245  106.477 76.130  1.00 15.94 ? 1123 HOH B O     1 
HETATM 10259 O O     . HOH H 4 .   ? 76.067  115.917 77.659  1.00 39.90 ? 1124 HOH B O     1 
HETATM 10260 O O     . HOH H 4 .   ? 70.788  117.668 81.178  1.00 27.42 ? 1125 HOH B O     1 
HETATM 10261 O O     . HOH H 4 .   ? 62.903  95.481  84.335  1.00 34.18 ? 1126 HOH B O     1 
HETATM 10262 O O     . HOH H 4 .   ? 58.687  120.721 66.257  1.00 29.18 ? 1127 HOH B O     1 
HETATM 10263 O O     . HOH H 4 .   ? 67.168  118.326 84.557  1.00 28.07 ? 1128 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PRO 197 197 197 PRO PRO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ASP 294 294 294 ASP ASP A . n 
A 1 295 TYR 295 295 295 TYR TYR A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 PRO 297 297 297 PRO PRO A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 TRP 302 302 302 TRP TRP A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 HIS 313 313 313 HIS HIS A . n 
A 1 314 SER 314 314 314 SER SER A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 CYS 323 323 323 CYS CYS A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 MET 329 329 329 MET MET A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 TRP 336 336 336 TRP TRP A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 HIS 349 349 349 HIS HIS A . n 
A 1 350 GLN 350 350 350 GLN GLN A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 ASN 352 352 352 ASN ASN A . n 
A 1 353 ILE 353 353 353 ILE ILE A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 ARG 362 362 362 ARG ARG A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 MET 365 365 365 MET MET A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 THR 375 375 375 THR THR A . n 
A 1 376 ASP 376 376 376 ASP ASP A . n 
A 1 377 ARG 377 377 377 ARG ARG A . n 
A 1 378 SER 378 378 378 SER SER A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 LEU 383 383 383 LEU LEU A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ILE 390 390 390 ILE ILE A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 TRP 395 395 395 TRP TRP A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 TRP 397 397 397 TRP TRP A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 TRP 399 399 399 TRP TRP A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 LYS 404 404 404 LYS LYS A . n 
A 1 405 GLU 405 405 405 GLU GLU A . n 
A 1 406 LYS 406 406 406 LYS LYS A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 TRP 413 413 413 TRP TRP A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 THR 416 416 416 THR THR A . n 
A 1 417 GLU 417 417 417 GLU GLU A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 GLY 419 419 419 GLY GLY A . n 
A 1 420 GLY 420 420 420 GLY GLY A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 MET 422 422 422 MET MET A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 THR 424 424 424 THR THR A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 ALA 429 429 429 ALA ALA A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 LEU 432 432 432 LEU LEU A . n 
A 1 433 LYS 433 433 433 LYS LYS A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 SER 436 436 436 SER SER A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 ARG 439 439 439 ARG ARG A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 PHE 442 442 442 PHE PHE A . n 
A 1 443 GLY 443 443 443 GLY GLY A . n 
A 1 444 VAL 444 444 444 VAL VAL A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASN 451 451 451 ASN ASN A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 HIS 454 454 454 HIS HIS A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 GLN 456 456 456 GLN GLN A . n 
A 1 457 GLU 457 457 457 GLU GLU A . n 
A 1 458 GLY 458 458 458 GLY GLY A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ASN 463 463 463 ASN ASN A . n 
A 1 464 LEU 464 464 464 LEU LEU A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 SER 469 469 469 SER SER A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 PRO 471 471 471 PRO PRO A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 GLN 473 473 473 GLN GLN A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 GLY 479 479 479 GLY GLY A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 HIS 481 481 481 HIS HIS A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ARG 483 483 483 ARG ARG A . n 
A 1 484 PHE 484 484 484 PHE PHE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 THR 487 487 487 THR THR A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 PHE 489 489 489 PHE PHE A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 THR 491 491 491 THR THR A . n 
A 1 492 PHE 492 492 492 PHE PHE A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 MET 495 495 495 MET MET A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 PHE 497 497 497 PHE PHE A . n 
A 1 498 SER 498 498 498 SER SER A . n 
A 1 499 GLY 499 499 499 GLY GLY A . n 
A 1 500 ASP 500 500 500 ASP ASP A . n 
A 1 501 GLY 501 501 501 GLY GLY A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 ARG 504 504 504 ARG ARG A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 ASP 507 507 507 ASP ASP A . n 
A 1 508 GLY 508 508 508 GLY GLY A . n 
A 1 509 TYR 509 509 509 TYR TYR A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 TRP 511 511 511 TRP TRP A . n 
A 1 512 ILE 512 512 512 ILE ILE A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 VAL 519 519 519 VAL VAL A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 SER 523 523 523 SER SER A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 HIS 525 525 525 HIS HIS A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 THR 529 529 529 THR THR A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 ILE 532 532 532 ILE ILE A . n 
A 1 533 GLU 533 533 533 GLU GLU A . n 
A 1 534 SER 534 534 534 SER SER A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 VAL 537 537 537 VAL VAL A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 PRO 540 540 540 PRO PRO A . n 
A 1 541 LYS 541 541 541 LYS LYS A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 GLU 544 544 544 GLU GLU A . n 
A 1 545 ALA 545 545 545 ALA ALA A . n 
A 1 546 ALA 546 546 546 ALA ALA A . n 
A 1 547 VAL 547 547 547 VAL VAL A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 ILE 550 550 550 ILE ILE A . n 
A 1 551 PRO 551 551 551 PRO PRO A . n 
A 1 552 HIS 552 552 552 HIS HIS A . n 
A 1 553 ALA 553 553 553 ALA ALA A . n 
A 1 554 ILE 554 554 554 ILE ILE A . n 
A 1 555 LYS 555 555 555 LYS LYS A . n 
A 1 556 GLY 556 556 556 GLY GLY A . n 
A 1 557 GLN 557 557 557 GLN GLN A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 TYR 560 560 560 TYR TYR A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 TYR 562 562 562 TYR TYR A . n 
A 1 563 VAL 563 563 563 VAL VAL A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 ASN 566 566 566 ASN ASN A . n 
A 1 567 HIS 567 567 567 HIS HIS A . n 
A 1 568 GLY 568 568 568 GLY GLY A . n 
A 1 569 GLU 569 569 569 GLU GLU A . n 
A 1 570 GLU 570 570 570 GLU GLU A . n 
A 1 571 PRO 571 571 571 PRO PRO A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 PRO 573 573 573 PRO PRO A . n 
A 1 574 GLU 574 574 574 GLU GLU A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 TYR 576 576 576 TYR TYR A . n 
A 1 577 ALA 577 577 577 ALA ALA A . n 
A 1 578 GLU 578 578 578 GLU GLU A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ARG 580 580 580 ARG ARG A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 TRP 582 582 582 TRP TRP A . n 
A 1 583 VAL 583 583 583 VAL VAL A . n 
A 1 584 ARG 584 584 584 ARG ARG A . n 
A 1 585 LYS 585 585 585 LYS LYS A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 ILE 587 587 587 ILE ILE A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 ALA 591 591 591 ALA ALA A . n 
A 1 592 THR 592 592 592 THR THR A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 VAL 595 595 595 VAL VAL A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 HIS 597 597 597 HIS HIS A . n 
A 1 598 TRP 598 598 598 TRP TRP A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASP 600 600 600 ASP ASP A . n 
A 1 601 SER 601 601 601 SER SER A . n 
A 1 602 LEU 602 602 602 LEU LEU A . n 
A 1 603 PRO 603 603 603 PRO PRO A . n 
A 1 604 LYS 604 604 604 LYS LYS A . n 
A 1 605 THR 605 605 605 THR THR A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 SER 607 607 607 SER SER A . n 
A 1 608 GLY 608 608 608 GLY GLY A . n 
A 1 609 LYS 609 609 609 LYS LYS A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 MET 611 611 611 MET MET A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 ARG 613 613 613 ARG ARG A . n 
A 1 614 ILE 614 614 614 ILE ILE A . n 
A 1 615 LEU 615 615 615 LEU LEU A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LYS 617 617 617 LYS LYS A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 ALA 620 620 620 ALA ALA A . n 
A 1 621 GLY 621 621 621 GLY GLY A . n 
A 1 622 ASP 622 622 622 ASP ASP A . n 
A 1 623 THR 623 623 ?   ?   ?   A . n 
A 1 624 SER 624 624 ?   ?   ?   A . n 
A 1 625 ASN 625 625 ?   ?   ?   A . n 
A 1 626 LEU 626 626 ?   ?   ?   A . n 
A 1 627 GLY 627 627 ?   ?   ?   A . n 
A 1 628 ASP 628 628 ?   ?   ?   A . n 
A 1 629 THR 629 629 ?   ?   ?   A . n 
A 1 630 SER 630 630 ?   ?   ?   A . n 
A 1 631 THR 631 631 ?   ?   ?   A . n 
A 1 632 LEU 632 632 ?   ?   ?   A . n 
A 1 633 ALA 633 633 633 ALA ALA A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 PRO 635 635 635 PRO PRO A . n 
A 1 636 GLY 636 636 636 GLY GLY A . n 
A 1 637 VAL 637 637 637 VAL VAL A . n 
A 1 638 VAL 638 638 638 VAL VAL A . n 
A 1 639 GLU 639 639 639 GLU GLU A . n 
A 1 640 LYS 640 640 640 LYS LYS A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 LEU 642 642 642 LEU LEU A . n 
A 1 643 GLU 643 643 643 GLU GLU A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 LYS 645 645 645 LYS LYS A . n 
A 1 646 GLN 646 646 646 GLN GLN A . n 
A 1 647 ALA 647 647 647 ALA ALA A . n 
A 1 648 ILE 648 648 ?   ?   ?   A . n 
A 1 649 ALA 649 649 ?   ?   ?   A . n 
A 1 650 MET 650 650 ?   ?   ?   A . n 
A 1 651 PRO 651 651 ?   ?   ?   A . n 
A 1 652 SER 652 652 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   GLN 3   3   ?   ?   ?   B . n 
B 1 4   THR 4   4   ?   ?   ?   B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   HIS 7   7   7   HIS HIS B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  PRO 10  10  10  PRO PRO B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  ASP 15  15  15  ASP ASP B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  CYS 17  17  17  CYS CYS B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  TYR 24  24  24  TYR TYR B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  SER 31  31  31  SER SER B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ASP 47  47  47  ASP ASP B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  TRP 69  69  69  TRP TRP B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  ARG 84  84  84  ARG ARG B . n 
B 1 85  HIS 85  85  85  HIS HIS B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ILE 95  95  95  ILE ILE B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  TRP 97  97  97  TRP TRP B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 THR 102 102 102 THR THR B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 HIS 107 107 107 HIS HIS B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 HIS 114 114 114 HIS HIS B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 CYS 118 118 118 CYS CYS B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 TYR 138 138 138 TYR TYR B . n 
B 1 139 MET 139 139 139 MET MET B . n 
B 1 140 PRO 140 140 140 PRO PRO B . n 
B 1 141 MET 141 141 141 MET MET B . n 
B