data_2P2F
# 
_entry.id   2P2F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2P2F         
RCSB  RCSB041881   
WWPDB D_1000041881 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P20 . unspecified 
PDB 2P2B . unspecified 
PDB 2P2J . unspecified 
PDB 2P2M . unspecified 
PDB 2P2Q . unspecified 
# 
_pdbx_database_status.entry_id                        2P2F 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Reger, A.S.'  1 
primary 'Carney, J.M.' 2 
primary 'Gulick, A.M.' 3 
# 
_cell.entry_id           2P2F 
_cell.length_a           90.906 
_cell.length_b           94.933 
_cell.length_c           161.814 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P2F 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase' 72236.477 2   6.2.1.1 ? ? ? 
2 non-polymer syn 'ACETATE ION'                  59.044    2   ?       ? ? ? 
3 non-polymer syn 'COENZYME A'                   767.534   2   ?       ? ? ? 
4 non-polymer syn 'ADENOSINE MONOPHOSPHATE'      347.221   2   ?       ? ? ? 
5 water       nat water                          18.015    159 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'USB, 21608'    
3 1 sample ? ? ? ? ? 'Sigma, A-1752' 
4 1 sample ? ? ? ? ? 'Sigma, C-4780' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P2F A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P2F B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'             ? 'C2 H3 O2 -1'         59.044  
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'          89.093  
AMP non-polymer         . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P'     347.221 
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'              ? 'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                     ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'         117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P2F 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.07 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Acetate, 1 mM AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2003-03-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.95 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
# 
_reflns.entry_id                     2P2F 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.58 
_reflns.d_resolution_low             81.65 
_reflns.number_all                   ? 
_reflns.number_obs                   42079 
_reflns.percent_possible_obs         98.9 
_reflns.pdbx_Rmerge_I_obs            .072 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.8 
_reflns.B_iso_Wilson_estimate        38.3 
_reflns.pdbx_redundancy              5.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.58 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           .224 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P2F 
_refine.ls_d_res_high                            2.580 
_refine.ls_d_res_low                             81.650 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.970 
_refine.ls_number_reflns_obs                     42079 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_R_work                       0.183 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2261 
_refine.B_iso_mean                               18.048 
_refine.aniso_B[1][1]                            0.710 
_refine.aniso_B[2][2]                            -1.140 
_refine.aniso_B[3][3]                            0.430 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.887 
_refine.pdbx_overall_ESU_R                       1.238 
_refine.pdbx_overall_ESU_R_Free                  0.320 
_refine.overall_SU_ML                            0.211 
_refine.overall_SU_B                             20.041 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'pdb entry 1PG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9828 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         150 
_refine_hist.number_atoms_solvent             159 
_refine_hist.number_atoms_total               10137 
_refine_hist.d_res_high                       2.580 
_refine_hist.d_res_low                        81.650 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10247 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      14000 1.532  1.959  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1265  6.416  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   448   37.148 23.996 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1558  15.837 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   57    20.210 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1521  0.096  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7857  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4633  0.211  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6918  0.310  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    468   0.142  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   20    0.179  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 5     0.148  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6445  0.611  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10159 1.019  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4421  1.672  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3841  2.681  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.580 
_refine_ls_shell.d_res_low                        2.647 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               93.420 
_refine_ls_shell.number_reflns_R_work             2892 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.226 
_refine_ls_shell.R_factor_R_free                  0.341 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             144 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3036 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P2F 
_struct.title                     'Acetyl-CoA Synthetase, wild-type with acetate, AMP, and CoA bound' 
_struct.pdbx_descriptor           'Acetyl-coenzyme A synthetase (E.C.6.2.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P2F 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? LEU A 127 ? TYR A 110 LEU A 127 1 ? 18 
HELX_P HELX_P8  8  VAL A 142 ? GLY A 156 ? VAL A 142 GLY A 156 1 ? 15 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 PRO A 197 ? LEU A 206 ? PRO A 197 LEU A 206 1 ? 10 
HELX_P HELX_P11 11 TRP A 237 ? LYS A 243 ? TRP A 237 LYS A 243 1 ? 7  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? TYR A 315 ? TRP A 309 TYR A 315 1 ? 7  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? HIS A 349 ? ALA A 340 HIS A 349 1 ? 10 
HELX_P HELX_P16 16 ALA A 357 ? GLU A 367 ? ALA A 357 GLU A 367 1 ? 11 
HELX_P HELX_P17 17 GLY A 368 ? ILE A 372 ? GLY A 368 ILE A 372 5 ? 5  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? ALA A 538 ? THR A 529 ALA A 538 1 ? 10 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? ALA A 620 ? MET A 611 ALA A 620 1 ? 10 
HELX_P HELX_P25 25 GLY A 636 ? LYS A 645 ? GLY A 636 LYS A 645 1 ? 10 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 PRO B 197 ? LYS B 207 ? PRO B 197 LYS B 207 1 ? 11 
HELX_P HELX_P36 36 TRP B 237 ? ALA B 244 ? TRP B 237 ALA B 244 1 ? 8  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? LEU B 316 ? TRP B 309 LEU B 316 1 ? 8  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? ALA B 538 ? THR B 529 ALA B 538 1 ? 10 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 GLY B 636 ? ALA B 647 ? GLY B 636 ALA B 647 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           C 
_struct_conn.ptnr1_label_comp_id           ACT 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           O 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           E 
_struct_conn.ptnr2_label_comp_id           AMP 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           O3P 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            ACT 
_struct_conn.ptnr1_auth_seq_id             653 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            AMP 
_struct_conn.ptnr2_auth_seq_id             999 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.916 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 0.61 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 7.65 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 7 ? 
M ? 5 ? 
N ? 2 ? 
O ? 3 ? 
P ? 5 ? 
Q ? 2 ? 
R ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? parallel      
M 1 2 ? parallel      
M 2 3 ? parallel      
M 3 4 ? parallel      
M 4 5 ? parallel      
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLY A 189 ? ARG A 191 ? GLY A 189 ARG A 191 
E 2 ARG A 194 ? ILE A 196 ? ARG A 194 ILE A 196 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 6   ? HIS B 7   ? LYS B 6   HIS B 7   
I 2 LEU B 432 ? LYS B 433 ? LEU B 432 LYS B 433 
J 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
J 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
K 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
K 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
L 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
L 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
L 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
L 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
L 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
L 6 ILE B 382 ? VAL B 386 ? ILE B 382 VAL B 386 
L 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
M 1 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
M 2 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
M 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
M 4 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
M 5 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
N 1 GLY B 189 ? VAL B 190 ? GLY B 189 VAL B 190 
N 2 SER B 195 ? ILE B 196 ? SER B 195 ILE B 196 
O 1 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
O 2 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
O 3 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
P 1 PRO B 455 ? GLN B 456 ? PRO B 455 GLN B 456 
P 2 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
P 3 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
P 4 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
P 5 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
Q 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
Q 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
R 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
R 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
R 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 61  ? N ALA A 61  O ASN A 64  ? O ASN A 64  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O ILE A 108 ? O ILE A 108 N ALA A 94  ? N ALA A 94  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O LEU A 328 ? O LEU A 328 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O ILE A 353 ? O ILE A 353 
C 5 6 N THR A 356 ? N THR A 356 O GLY A 384 ? O GLY A 384 
C 6 7 N LEU A 383 ? N LEU A 383 O VAL A 410 ? O VAL A 410 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N VAL A 183 ? N VAL A 183 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 259 ? N LEU A 259 O HIS A 276 ? O HIS A 276 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N GLY A 189 ? N GLY A 189 O ILE A 196 ? O ILE A 196 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
F 3 4 N ARG A 503 ? N ARG A 503 O TRP A 511 ? O TRP A 511 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N ALA A 543 ? N ALA A 543 O THR A 564 ? O THR A 564 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N HIS B 7   ? N HIS B 7   O LEU B 432 ? O LEU B 432 
J 1 2 N ASN B 57  ? N ASN B 57  O LYS B 68  ? O LYS B 68  
K 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
L 1 2 O ILE B 108 ? O ILE B 108 N ILE B 95  ? N ILE B 95  
L 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
L 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
L 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
L 5 6 N LEU B 354 ? N LEU B 354 O GLY B 384 ? O GLY B 384 
L 6 7 N SER B 385 ? N SER B 385 O VAL B 410 ? O VAL B 410 
M 1 2 O SER B 160 ? O SER B 160 N VAL B 135 ? N VAL B 135 
M 2 3 N TYR B 138 ? N TYR B 138 O ILE B 184 ? O ILE B 184 
M 3 4 N THR B 185 ? N THR B 185 O ILE B 218 ? O ILE B 218 
M 4 5 N VAL B 219 ? N VAL B 219 O LEU B 235 ? O LEU B 235 
N 1 2 N GLY B 189 ? N GLY B 189 O ILE B 196 ? O ILE B 196 
O 1 2 N LEU B 259 ? N LEU B 259 O HIS B 276 ? O HIS B 276 
O 2 3 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
P 1 2 O GLN B 456 ? O GLN B 456 N LEU B 448 ? N LEU B 448 
P 2 3 N ALA B 447 ? N ALA B 447 O VAL B 465 ? O VAL B 465 
P 3 4 N THR B 460 ? N THR B 460 O ARG B 504 ? O ARG B 504 
P 4 5 N GLY B 501 ? N GLY B 501 O GLY B 514 ? O GLY B 514 
Q 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
R 1 2 N ALA B 546 ? N ALA B 546 O TYR B 562 ? O TYR B 562 
R 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT A 653' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ACT B 653' 
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE COA A 990' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE COA B 991' 
AC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE AMP A 999' 
AC6 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE AMP B 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  THR A 311 ? THR A 311  . ? 1_555 ? 
2  AC1 5  VAL A 386 ? VAL A 386  . ? 1_555 ? 
3  AC1 5  GLY A 387 ? GLY A 387  . ? 1_555 ? 
4  AC1 5  COA D .   ? COA A 990  . ? 1_555 ? 
5  AC1 5  AMP E .   ? AMP A 999  . ? 1_555 ? 
6  AC2 6  VAL B 310 ? VAL B 310  . ? 1_555 ? 
7  AC2 6  THR B 311 ? THR B 311  . ? 1_555 ? 
8  AC2 6  GLY B 387 ? GLY B 387  . ? 1_555 ? 
9  AC2 6  COA G .   ? COA B 991  . ? 1_555 ? 
10 AC2 6  AMP H .   ? AMP B 998  . ? 1_555 ? 
11 AC2 6  HOH J .   ? HOH B 1064 . ? 1_555 ? 
12 AC3 13 PHE A 163 ? PHE A 163  . ? 1_555 ? 
13 AC3 13 ARG A 191 ? ARG A 191  . ? 1_555 ? 
14 AC3 13 ASP A 306 ? ASP A 306  . ? 1_555 ? 
15 AC3 13 TRP A 309 ? TRP A 309  . ? 1_555 ? 
16 AC3 13 THR A 311 ? THR A 311  . ? 1_555 ? 
17 AC3 13 ALA A 357 ? ALA A 357  . ? 1_555 ? 
18 AC3 13 THR A 359 ? THR A 359  . ? 1_555 ? 
19 AC3 13 ALA A 360 ? ALA A 360  . ? 1_555 ? 
20 AC3 13 SER A 523 ? SER A 523  . ? 1_555 ? 
21 AC3 13 GLY A 524 ? GLY A 524  . ? 1_555 ? 
22 AC3 13 ARG A 584 ? ARG A 584  . ? 1_555 ? 
23 AC3 13 PRO A 589 ? PRO A 589  . ? 1_555 ? 
24 AC3 13 ACT C .   ? ACT A 653  . ? 1_555 ? 
25 AC4 13 PHE B 163 ? PHE B 163  . ? 1_555 ? 
26 AC4 13 GLY B 164 ? GLY B 164  . ? 1_555 ? 
27 AC4 13 GLY B 165 ? GLY B 165  . ? 1_555 ? 
28 AC4 13 ARG B 191 ? ARG B 191  . ? 1_555 ? 
29 AC4 13 ILE B 196 ? ILE B 196  . ? 1_555 ? 
30 AC4 13 ASP B 306 ? ASP B 306  . ? 1_555 ? 
31 AC4 13 PRO B 334 ? PRO B 334  . ? 1_555 ? 
32 AC4 13 ALA B 357 ? ALA B 357  . ? 1_555 ? 
33 AC4 13 SER B 523 ? SER B 523  . ? 1_555 ? 
34 AC4 13 HIS B 525 ? HIS B 525  . ? 1_555 ? 
35 AC4 13 ARG B 584 ? ARG B 584  . ? 1_555 ? 
36 AC4 13 PRO B 589 ? PRO B 589  . ? 1_555 ? 
37 AC4 13 ACT F .   ? ACT B 653  . ? 1_555 ? 
38 AC5 15 GLY A 387 ? GLY A 387  . ? 1_555 ? 
39 AC5 15 GLU A 388 ? GLU A 388  . ? 1_555 ? 
40 AC5 15 PRO A 389 ? PRO A 389  . ? 1_555 ? 
41 AC5 15 ASP A 411 ? ASP A 411  . ? 1_555 ? 
42 AC5 15 THR A 412 ? THR A 412  . ? 1_555 ? 
43 AC5 15 TRP A 413 ? TRP A 413  . ? 1_555 ? 
44 AC5 15 TRP A 414 ? TRP A 414  . ? 1_555 ? 
45 AC5 15 GLN A 415 ? GLN A 415  . ? 1_555 ? 
46 AC5 15 THR A 416 ? THR A 416  . ? 1_555 ? 
47 AC5 15 ASP A 500 ? ASP A 500  . ? 1_555 ? 
48 AC5 15 ILE A 512 ? ILE A 512  . ? 1_555 ? 
49 AC5 15 ARG A 515 ? ARG A 515  . ? 1_555 ? 
50 AC5 15 ASN A 521 ? ASN A 521  . ? 1_555 ? 
51 AC5 15 ARG A 526 ? ARG A 526  . ? 1_555 ? 
52 AC5 15 ACT C .   ? ACT A 653  . ? 1_555 ? 
53 AC6 16 VAL B 310 ? VAL B 310  . ? 1_555 ? 
54 AC6 16 GLY B 387 ? GLY B 387  . ? 1_555 ? 
55 AC6 16 GLU B 388 ? GLU B 388  . ? 1_555 ? 
56 AC6 16 PRO B 389 ? PRO B 389  . ? 1_555 ? 
57 AC6 16 ASP B 411 ? ASP B 411  . ? 1_555 ? 
58 AC6 16 THR B 412 ? THR B 412  . ? 1_555 ? 
59 AC6 16 TRP B 413 ? TRP B 413  . ? 1_555 ? 
60 AC6 16 TRP B 414 ? TRP B 414  . ? 1_555 ? 
61 AC6 16 GLN B 415 ? GLN B 415  . ? 1_555 ? 
62 AC6 16 THR B 416 ? THR B 416  . ? 1_555 ? 
63 AC6 16 ASP B 500 ? ASP B 500  . ? 1_555 ? 
64 AC6 16 ILE B 512 ? ILE B 512  . ? 1_555 ? 
65 AC6 16 ARG B 515 ? ARG B 515  . ? 1_555 ? 
66 AC6 16 ARG B 526 ? ARG B 526  . ? 1_555 ? 
67 AC6 16 ACT F .   ? ACT B 653  . ? 1_555 ? 
68 AC6 16 HOH J .   ? HOH B 1064 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P2F 
_atom_sites.fract_transf_matrix[1][1]   0.011000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010534 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006180 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 6   ? -21.795 16.771  7.474   1.00 15.95 ? 6    LYS A N     1 
ATOM   2     C CA    . LYS A 1 6   ? -20.526 16.462  6.713   1.00 17.73 ? 6    LYS A CA    1 
ATOM   3     C C     . LYS A 1 6   ? -20.367 17.214  5.373   1.00 17.80 ? 6    LYS A C     1 
ATOM   4     O O     . LYS A 1 6   ? -21.218 17.088  4.490   1.00 17.68 ? 6    LYS A O     1 
ATOM   5     C CB    . LYS A 1 6   ? -20.380 14.959  6.437   1.00 17.63 ? 6    LYS A CB    1 
ATOM   6     C CG    . LYS A 1 6   ? -19.632 14.153  7.525   1.00 18.89 ? 6    LYS A CG    1 
ATOM   7     C CD    . LYS A 1 6   ? -19.410 12.643  7.130   1.00 19.08 ? 6    LYS A CD    1 
ATOM   8     C CE    . LYS A 1 6   ? -18.533 11.898  8.188   1.00 20.41 ? 6    LYS A CE    1 
ATOM   9     N NZ    . LYS A 1 6   ? -17.516 10.907  7.625   1.00 20.55 ? 6    LYS A NZ    1 
ATOM   10    N N     . HIS A 1 7   ? -19.276 17.983  5.224   1.00 17.98 ? 7    HIS A N     1 
ATOM   11    C CA    . HIS A 1 7   ? -18.926 18.635  3.942   1.00 17.55 ? 7    HIS A CA    1 
ATOM   12    C C     . HIS A 1 7   ? -17.987 17.761  3.157   1.00 18.33 ? 7    HIS A C     1 
ATOM   13    O O     . HIS A 1 7   ? -16.981 17.305  3.691   1.00 19.16 ? 7    HIS A O     1 
ATOM   14    C CB    . HIS A 1 7   ? -18.251 19.976  4.160   1.00 16.27 ? 7    HIS A CB    1 
ATOM   15    C CG    . HIS A 1 7   ? -19.203 21.071  4.499   1.00 16.06 ? 7    HIS A CG    1 
ATOM   16    N ND1   . HIS A 1 7   ? -19.640 21.993  3.572   1.00 16.06 ? 7    HIS A ND1   1 
ATOM   17    C CD2   . HIS A 1 7   ? -19.831 21.377  5.658   1.00 15.44 ? 7    HIS A CD2   1 
ATOM   18    C CE1   . HIS A 1 7   ? -20.480 22.832  4.151   1.00 14.89 ? 7    HIS A CE1   1 
ATOM   19    N NE2   . HIS A 1 7   ? -20.615 22.479  5.417   1.00 14.18 ? 7    HIS A NE2   1 
ATOM   20    N N     . ALA A 1 8   ? -18.311 17.519  1.892   1.00 19.08 ? 8    ALA A N     1 
ATOM   21    C CA    . ALA A 1 8   ? -17.407 16.775  0.995   1.00 19.73 ? 8    ALA A CA    1 
ATOM   22    C C     . ALA A 1 8   ? -16.162 17.592  0.666   1.00 19.99 ? 8    ALA A C     1 
ATOM   23    O O     . ALA A 1 8   ? -16.212 18.841  0.628   1.00 20.14 ? 8    ALA A O     1 
ATOM   24    C CB    . ALA A 1 8   ? -18.122 16.381  -0.289  1.00 19.45 ? 8    ALA A CB    1 
ATOM   25    N N     . ILE A 1 9   ? -15.055 16.876  0.443   1.00 19.68 ? 9    ILE A N     1 
ATOM   26    C CA    . ILE A 1 9   ? -13.801 17.451  -0.041  1.00 18.74 ? 9    ILE A CA    1 
ATOM   27    C C     . ILE A 1 9   ? -14.062 17.874  -1.467  1.00 18.43 ? 9    ILE A C     1 
ATOM   28    O O     . ILE A 1 9   ? -14.536 17.067  -2.255  1.00 18.77 ? 9    ILE A O     1 
ATOM   29    C CB    . ILE A 1 9   ? -12.690 16.373  -0.010  1.00 19.05 ? 9    ILE A CB    1 
ATOM   30    C CG1   . ILE A 1 9   ? -12.242 16.109  1.424   1.00 19.08 ? 9    ILE A CG1   1 
ATOM   31    C CG2   . ILE A 1 9   ? -11.495 16.733  -0.928  1.00 18.62 ? 9    ILE A CG2   1 
ATOM   32    C CD1   . ILE A 1 9   ? -11.830 14.685  1.662   1.00 20.97 ? 9    ILE A CD1   1 
ATOM   33    N N     . PRO A 1 10  ? -13.799 19.148  -1.811  1.00 18.13 ? 10   PRO A N     1 
ATOM   34    C CA    . PRO A 1 10  ? -14.084 19.523  -3.202  1.00 17.44 ? 10   PRO A CA    1 
ATOM   35    C C     . PRO A 1 10  ? -13.004 18.964  -4.134  1.00 17.06 ? 10   PRO A C     1 
ATOM   36    O O     . PRO A 1 10  ? -11.875 18.712  -3.668  1.00 17.03 ? 10   PRO A O     1 
ATOM   37    C CB    . PRO A 1 10  ? -14.072 21.056  -3.189  1.00 16.63 ? 10   PRO A CB    1 
ATOM   38    C CG    . PRO A 1 10  ? -13.403 21.461  -1.925  1.00 17.93 ? 10   PRO A CG    1 
ATOM   39    C CD    . PRO A 1 10  ? -13.240 20.260  -1.020  1.00 18.27 ? 10   PRO A CD    1 
ATOM   40    N N     . ALA A 1 11  ? -13.338 18.799  -5.422  1.00 15.95 ? 11   ALA A N     1 
ATOM   41    C CA    . ALA A 1 11  ? -12.407 18.198  -6.391  1.00 15.55 ? 11   ALA A CA    1 
ATOM   42    C C     . ALA A 1 11  ? -11.084 18.958  -6.625  1.00 15.22 ? 11   ALA A C     1 
ATOM   43    O O     . ALA A 1 11  ? -10.067 18.335  -6.920  1.00 15.24 ? 11   ALA A O     1 
ATOM   44    C CB    . ALA A 1 11  ? -13.105 17.899  -7.712  1.00 14.80 ? 11   ALA A CB    1 
ATOM   45    N N     . ASN A 1 12  ? -11.094 20.283  -6.506  1.00 15.02 ? 12   ASN A N     1 
ATOM   46    C CA    . ASN A 1 12  ? -9.873  21.055  -6.699  1.00 15.21 ? 12   ASN A CA    1 
ATOM   47    C C     . ASN A 1 12  ? -8.848  20.738  -5.586  1.00 16.11 ? 12   ASN A C     1 
ATOM   48    O O     . ASN A 1 12  ? -7.639  20.700  -5.841  1.00 17.01 ? 12   ASN A O     1 
ATOM   49    C CB    . ASN A 1 12  ? -10.176 22.559  -6.812  1.00 14.66 ? 12   ASN A CB    1 
ATOM   50    C CG    . ASN A 1 12  ? -10.599 23.201  -5.451  1.00 14.85 ? 12   ASN A CG    1 
ATOM   51    O OD1   . ASN A 1 12  ? -11.596 22.810  -4.851  1.00 12.37 ? 12   ASN A OD1   1 
ATOM   52    N ND2   . ASN A 1 12  ? -9.820  24.178  -4.977  1.00 13.93 ? 12   ASN A ND2   1 
ATOM   53    N N     . ILE A 1 13  ? -9.321  20.469  -4.362  1.00 16.26 ? 13   ILE A N     1 
ATOM   54    C CA    . ILE A 1 13  ? -8.400  20.129  -3.282  1.00 16.01 ? 13   ILE A CA    1 
ATOM   55    C C     . ILE A 1 13  ? -7.911  18.692  -3.439  1.00 16.61 ? 13   ILE A C     1 
ATOM   56    O O     . ILE A 1 13  ? -6.706  18.400  -3.300  1.00 16.99 ? 13   ILE A O     1 
ATOM   57    C CB    . ILE A 1 13  ? -9.017  20.347  -1.868  1.00 16.01 ? 13   ILE A CB    1 
ATOM   58    C CG1   . ILE A 1 13  ? -9.642  21.740  -1.733  1.00 15.07 ? 13   ILE A CG1   1 
ATOM   59    C CG2   . ILE A 1 13  ? -7.946  20.216  -0.789  1.00 14.40 ? 13   ILE A CG2   1 
ATOM   60    C CD1   . ILE A 1 13  ? -8.608  22.861  -1.560  1.00 14.46 ? 13   ILE A CD1   1 
ATOM   61    N N     . ALA A 1 14  ? -8.842  17.791  -3.727  1.00 16.51 ? 14   ALA A N     1 
ATOM   62    C CA    . ALA A 1 14  ? -8.478  16.401  -4.002  1.00 16.79 ? 14   ALA A CA    1 
ATOM   63    C C     . ALA A 1 14  ? -7.377  16.322  -5.062  1.00 16.74 ? 14   ALA A C     1 
ATOM   64    O O     . ALA A 1 14  ? -6.485  15.487  -4.945  1.00 17.32 ? 14   ALA A O     1 
ATOM   65    C CB    . ALA A 1 14  ? -9.723  15.536  -4.394  1.00 16.20 ? 14   ALA A CB    1 
ATOM   66    N N     . ASP A 1 15  ? -7.419  17.208  -6.058  1.00 16.73 ? 15   ASP A N     1 
ATOM   67    C CA    . ASP A 1 15  ? -6.412  17.227  -7.123  1.00 17.17 ? 15   ASP A CA    1 
ATOM   68    C C     . ASP A 1 15  ? -4.992  17.670  -6.743  1.00 16.83 ? 15   ASP A C     1 
ATOM   69    O O     . ASP A 1 15  ? -4.050  17.290  -7.412  1.00 16.61 ? 15   ASP A O     1 
ATOM   70    C CB    . ASP A 1 15  ? -6.922  18.001  -8.341  1.00 17.50 ? 15   ASP A CB    1 
ATOM   71    C CG    . ASP A 1 15  ? -8.021  17.240  -9.099  1.00 19.40 ? 15   ASP A CG    1 
ATOM   72    O OD1   . ASP A 1 15  ? -8.562  16.242  -8.579  1.00 21.62 ? 15   ASP A OD1   1 
ATOM   73    O OD2   . ASP A 1 15  ? -8.374  17.654  -10.220 1.00 22.25 ? 15   ASP A OD2   1 
ATOM   74    N N     . ARG A 1 16  ? -4.831  18.457  -5.679  1.00 16.63 ? 16   ARG A N     1 
ATOM   75    C CA    . ARG A 1 16  ? -3.504  18.997  -5.333  1.00 16.62 ? 16   ARG A CA    1 
ATOM   76    C C     . ARG A 1 16  ? -2.988  18.625  -3.953  1.00 15.85 ? 16   ARG A C     1 
ATOM   77    O O     . ARG A 1 16  ? -1.819  18.891  -3.655  1.00 16.28 ? 16   ARG A O     1 
ATOM   78    C CB    . ARG A 1 16  ? -3.497  20.521  -5.440  1.00 16.83 ? 16   ARG A CB    1 
ATOM   79    C CG    . ARG A 1 16  ? -4.484  21.174  -4.472  1.00 19.62 ? 16   ARG A CG    1 
ATOM   80    C CD    . ARG A 1 16  ? -4.695  22.633  -4.806  1.00 23.15 ? 16   ARG A CD    1 
ATOM   81    N NE    . ARG A 1 16  ? -3.848  23.482  -3.973  1.00 25.65 ? 16   ARG A NE    1 
ATOM   82    C CZ    . ARG A 1 16  ? -2.861  24.260  -4.413  1.00 27.04 ? 16   ARG A CZ    1 
ATOM   83    N NH1   . ARG A 1 16  ? -2.561  24.326  -5.720  1.00 25.56 ? 16   ARG A NH1   1 
ATOM   84    N NH2   . ARG A 1 16  ? -2.178  24.986  -3.523  1.00 26.49 ? 16   ARG A NH2   1 
ATOM   85    N N     . CYS A 1 17  ? -3.844  18.029  -3.123  1.00 14.54 ? 17   CYS A N     1 
ATOM   86    C CA    . CYS A 1 17  ? -3.579  17.932  -1.682  1.00 13.25 ? 17   CYS A CA    1 
ATOM   87    C C     . CYS A 1 17  ? -2.357  17.090  -1.401  1.00 12.92 ? 17   CYS A C     1 
ATOM   88    O O     . CYS A 1 17  ? -2.089  16.146  -2.110  1.00 12.50 ? 17   CYS A O     1 
ATOM   89    C CB    . CYS A 1 17  ? -4.790  17.375  -0.926  1.00 13.06 ? 17   CYS A CB    1 
ATOM   90    S SG    . CYS A 1 17  ? -5.285  15.718  -1.494  1.00 10.06 ? 17   CYS A SG    1 
ATOM   91    N N     . LEU A 1 18  ? -1.613  17.446  -0.364  1.00 12.78 ? 18   LEU A N     1 
ATOM   92    C CA    . LEU A 1 18  ? -0.428  16.702  -0.026  1.00 12.61 ? 18   LEU A CA    1 
ATOM   93    C C     . LEU A 1 18  ? -0.765  15.457  0.753   1.00 13.21 ? 18   LEU A C     1 
ATOM   94    O O     . LEU A 1 18  ? -0.066  14.454  0.641   1.00 13.74 ? 18   LEU A O     1 
ATOM   95    C CB    . LEU A 1 18  ? 0.522   17.567  0.768   1.00 12.80 ? 18   LEU A CB    1 
ATOM   96    C CG    . LEU A 1 18  ? 0.993   18.849  0.091   1.00 11.38 ? 18   LEU A CG    1 
ATOM   97    C CD1   . LEU A 1 18  ? 1.614   19.724  1.143   1.00 9.48  ? 18   LEU A CD1   1 
ATOM   98    C CD2   . LEU A 1 18  ? 1.949   18.567  -1.074  1.00 6.61  ? 18   LEU A CD2   1 
ATOM   99    N N     . ILE A 1 19  ? -1.852  15.510  1.518   1.00 13.72 ? 19   ILE A N     1 
ATOM   100   C CA    . ILE A 1 19  ? -2.321  14.362  2.294   1.00 13.94 ? 19   ILE A CA    1 
ATOM   101   C C     . ILE A 1 19  ? -3.762  13.992  1.920   1.00 14.37 ? 19   ILE A C     1 
ATOM   102   O O     . ILE A 1 19  ? -4.711  14.746  2.235   1.00 14.85 ? 19   ILE A O     1 
ATOM   103   C CB    . ILE A 1 19  ? -2.248  14.651  3.821   1.00 13.96 ? 19   ILE A CB    1 
ATOM   104   C CG1   . ILE A 1 19  ? -0.831  15.097  4.245   1.00 14.41 ? 19   ILE A CG1   1 
ATOM   105   C CG2   . ILE A 1 19  ? -2.759  13.447  4.630   1.00 14.60 ? 19   ILE A CG2   1 
ATOM   106   C CD1   . ILE A 1 19  ? 0.265   14.025  4.097   1.00 14.77 ? 19   ILE A CD1   1 
ATOM   107   N N     . ASN A 1 20  ? -3.948  12.837  1.280   1.00 13.83 ? 20   ASN A N     1 
ATOM   108   C CA    . ASN A 1 20  ? -5.302  12.375  0.988   1.00 14.02 ? 20   ASN A CA    1 
ATOM   109   C C     . ASN A 1 20  ? -5.804  11.448  2.110   1.00 14.77 ? 20   ASN A C     1 
ATOM   110   O O     . ASN A 1 20  ? -5.049  11.162  3.044   1.00 15.00 ? 20   ASN A O     1 
ATOM   111   C CB    . ASN A 1 20  ? -5.412  11.737  -0.406  1.00 13.32 ? 20   ASN A CB    1 
ATOM   112   C CG    . ASN A 1 20  ? -4.619  10.437  -0.543  1.00 13.24 ? 20   ASN A CG    1 
ATOM   113   O OD1   . ASN A 1 20  ? -4.468  9.637   0.399   1.00 13.28 ? 20   ASN A OD1   1 
ATOM   114   N ND2   . ASN A 1 20  ? -4.123  10.214  -1.739  1.00 11.34 ? 20   ASN A ND2   1 
ATOM   115   N N     . PRO A 1 21  ? -7.072  10.990  2.036   1.00 15.56 ? 21   PRO A N     1 
ATOM   116   C CA    . PRO A 1 21  ? -7.605  10.158  3.127   1.00 16.72 ? 21   PRO A CA    1 
ATOM   117   C C     . PRO A 1 21  ? -6.743  8.951   3.464   1.00 18.43 ? 21   PRO A C     1 
ATOM   118   O O     . PRO A 1 21  ? -6.503  8.681   4.643   1.00 18.57 ? 21   PRO A O     1 
ATOM   119   C CB    . PRO A 1 21  ? -8.969  9.719   2.602   1.00 16.71 ? 21   PRO A CB    1 
ATOM   120   C CG    . PRO A 1 21  ? -9.367  10.845  1.637   1.00 15.96 ? 21   PRO A CG    1 
ATOM   121   C CD    . PRO A 1 21  ? -8.083  11.256  0.991   1.00 15.01 ? 21   PRO A CD    1 
ATOM   122   N N     . GLU A 1 22  ? -6.262  8.234   2.449   1.00 20.07 ? 22   GLU A N     1 
ATOM   123   C CA    . GLU A 1 22  ? -5.489  7.007   2.704   1.00 21.45 ? 22   GLU A CA    1 
ATOM   124   C C     . GLU A 1 22  ? -4.127  7.361   3.307   1.00 20.62 ? 22   GLU A C     1 
ATOM   125   O O     . GLU A 1 22  ? -3.655  6.702   4.236   1.00 20.47 ? 22   GLU A O     1 
ATOM   126   C CB    . GLU A 1 22  ? -5.374  6.123   1.440   1.00 22.36 ? 22   GLU A CB    1 
ATOM   127   C CG    . GLU A 1 22  ? -6.763  5.581   0.880   1.00 27.98 ? 22   GLU A CG    1 
ATOM   128   C CD    . GLU A 1 22  ? -7.837  6.703   0.505   1.00 33.93 ? 22   GLU A CD    1 
ATOM   129   O OE1   . GLU A 1 22  ? -9.065  6.487   0.761   1.00 33.67 ? 22   GLU A OE1   1 
ATOM   130   O OE2   . GLU A 1 22  ? -7.455  7.785   -0.050  1.00 35.32 ? 22   GLU A OE2   1 
ATOM   131   N N     . GLN A 1 23  ? -3.516  8.423   2.794   1.00 20.08 ? 23   GLN A N     1 
ATOM   132   C CA    . GLN A 1 23  ? -2.282  8.924   3.361   1.00 19.56 ? 23   GLN A CA    1 
ATOM   133   C C     . GLN A 1 23  ? -2.468  9.322   4.823   1.00 19.37 ? 23   GLN A C     1 
ATOM   134   O O     . GLN A 1 23  ? -1.628  8.982   5.651   1.00 19.52 ? 23   GLN A O     1 
ATOM   135   C CB    . GLN A 1 23  ? -1.740  10.079  2.535   1.00 19.66 ? 23   GLN A CB    1 
ATOM   136   C CG    . GLN A 1 23  ? -0.937  9.615   1.348   1.00 20.77 ? 23   GLN A CG    1 
ATOM   137   C CD    . GLN A 1 23  ? -0.830  10.659  0.276   1.00 22.52 ? 23   GLN A CD    1 
ATOM   138   O OE1   . GLN A 1 23  ? -1.792  11.361  -0.020  1.00 22.36 ? 23   GLN A OE1   1 
ATOM   139   N NE2   . GLN A 1 23  ? 0.348   10.767  -0.324  1.00 24.57 ? 23   GLN A NE2   1 
ATOM   140   N N     . TYR A 1 24  ? -3.566  10.009  5.152   1.00 18.31 ? 24   TYR A N     1 
ATOM   141   C CA    . TYR A 1 24  ? -3.812  10.354  6.550   1.00 17.61 ? 24   TYR A CA    1 
ATOM   142   C C     . TYR A 1 24  ? -3.856  9.120   7.447   1.00 17.63 ? 24   TYR A C     1 
ATOM   143   O O     . TYR A 1 24  ? -3.240  9.126   8.532   1.00 17.98 ? 24   TYR A O     1 
ATOM   144   C CB    . TYR A 1 24  ? -5.090  11.200  6.772   1.00 16.89 ? 24   TYR A CB    1 
ATOM   145   C CG    . TYR A 1 24  ? -5.423  11.296  8.252   1.00 15.51 ? 24   TYR A CG    1 
ATOM   146   C CD1   . TYR A 1 24  ? -4.758  12.203  9.086   1.00 16.29 ? 24   TYR A CD1   1 
ATOM   147   C CD2   . TYR A 1 24  ? -6.346  10.430  8.833   1.00 14.97 ? 24   TYR A CD2   1 
ATOM   148   C CE1   . TYR A 1 24  ? -5.035  12.252  10.466  1.00 15.33 ? 24   TYR A CE1   1 
ATOM   149   C CE2   . TYR A 1 24  ? -6.624  10.470  10.194  1.00 12.87 ? 24   TYR A CE2   1 
ATOM   150   C CZ    . TYR A 1 24  ? -5.967  11.368  10.996  1.00 14.00 ? 24   TYR A CZ    1 
ATOM   151   O OH    . TYR A 1 24  ? -6.262  11.391  12.325  1.00 14.65 ? 24   TYR A OH    1 
ATOM   152   N N     . GLU A 1 25  ? -4.605  8.096   7.015   1.00 17.05 ? 25   GLU A N     1 
ATOM   153   C CA    . GLU A 1 25  ? -4.739  6.837   7.768   1.00 17.00 ? 25   GLU A CA    1 
ATOM   154   C C     . GLU A 1 25  ? -3.389  6.156   7.978   1.00 16.22 ? 25   GLU A C     1 
ATOM   155   O O     . GLU A 1 25  ? -3.064  5.721   9.087   1.00 16.18 ? 25   GLU A O     1 
ATOM   156   C CB    . GLU A 1 25  ? -5.716  5.846   7.093   1.00 17.00 ? 25   GLU A CB    1 
ATOM   157   C CG    . GLU A 1 25  ? -7.222  6.054   7.364   1.00 19.24 ? 25   GLU A CG    1 
ATOM   158   C CD    . GLU A 1 25  ? -7.540  6.473   8.803   1.00 23.14 ? 25   GLU A CD    1 
ATOM   159   O OE1   . GLU A 1 25  ? -7.050  5.812   9.745   1.00 25.33 ? 25   GLU A OE1   1 
ATOM   160   O OE2   . GLU A 1 25  ? -8.280  7.474   8.993   1.00 24.00 ? 25   GLU A OE2   1 
ATOM   161   N N     . THR A 1 26  ? -2.619  6.073   6.901   1.00 15.41 ? 26   THR A N     1 
ATOM   162   C CA    . THR A 1 26  ? -1.360  5.346   6.897   1.00 14.99 ? 26   THR A CA    1 
ATOM   163   C C     . THR A 1 26  ? -0.324  6.083   7.743   1.00 14.96 ? 26   THR A C     1 
ATOM   164   O O     . THR A 1 26  ? 0.218   5.527   8.676   1.00 14.72 ? 26   THR A O     1 
ATOM   165   C CB    . THR A 1 26  ? -0.868  5.061   5.424   1.00 15.12 ? 26   THR A CB    1 
ATOM   166   O OG1   . THR A 1 26  ? -1.850  4.265   4.749   1.00 14.56 ? 26   THR A OG1   1 
ATOM   167   C CG2   . THR A 1 26  ? 0.501   4.341   5.377   1.00 12.69 ? 26   THR A CG2   1 
ATOM   168   N N     . LYS A 1 27  ? -0.070  7.343   7.426   1.00 15.22 ? 27   LYS A N     1 
ATOM   169   C CA    . LYS A 1 27  ? 0.810   8.157   8.237   1.00 15.91 ? 27   LYS A CA    1 
ATOM   170   C C     . LYS A 1 27  ? 0.374   8.213   9.723   1.00 16.15 ? 27   LYS A C     1 
ATOM   171   O O     . LYS A 1 27  ? 1.222   8.161   10.620  1.00 16.62 ? 27   LYS A O     1 
ATOM   172   C CB    . LYS A 1 27  ? 0.940   9.564   7.646   1.00 16.01 ? 27   LYS A CB    1 
ATOM   173   C CG    . LYS A 1 27  ? 1.629   9.633   6.295   1.00 17.43 ? 27   LYS A CG    1 
ATOM   174   C CD    . LYS A 1 27  ? 2.053   11.069  6.013   1.00 20.78 ? 27   LYS A CD    1 
ATOM   175   C CE    . LYS A 1 27  ? 2.935   11.181  4.755   1.00 21.32 ? 27   LYS A CE    1 
ATOM   176   N NZ    . LYS A 1 27  ? 4.368   10.953  5.093   1.00 24.45 ? 27   LYS A NZ    1 
ATOM   177   N N     . TYR A 1 28  ? -0.927  8.301   9.995   1.00 15.92 ? 28   TYR A N     1 
ATOM   178   C CA    . TYR A 1 28  ? -1.364  8.368   11.391  1.00 15.99 ? 28   TYR A CA    1 
ATOM   179   C C     . TYR A 1 28  ? -1.094  7.090   12.151  1.00 16.31 ? 28   TYR A C     1 
ATOM   180   O O     . TYR A 1 28  ? -0.554  7.143   13.267  1.00 16.85 ? 28   TYR A O     1 
ATOM   181   C CB    . TYR A 1 28  ? -2.841  8.727   11.554  1.00 15.99 ? 28   TYR A CB    1 
ATOM   182   C CG    . TYR A 1 28  ? -3.204  8.806   13.013  1.00 15.37 ? 28   TYR A CG    1 
ATOM   183   C CD1   . TYR A 1 28  ? -2.969  9.986   13.732  1.00 13.89 ? 28   TYR A CD1   1 
ATOM   184   C CD2   . TYR A 1 28  ? -3.736  7.694   13.696  1.00 15.23 ? 28   TYR A CD2   1 
ATOM   185   C CE1   . TYR A 1 28  ? -3.262  10.088  15.068  1.00 13.99 ? 28   TYR A CE1   1 
ATOM   186   C CE2   . TYR A 1 28  ? -4.040  7.777   15.061  1.00 15.33 ? 28   TYR A CE2   1 
ATOM   187   C CZ    . TYR A 1 28  ? -3.790  8.992   15.735  1.00 16.53 ? 28   TYR A CZ    1 
ATOM   188   O OH    . TYR A 1 28  ? -4.057  9.136   17.081  1.00 18.32 ? 28   TYR A OH    1 
ATOM   189   N N     . LYS A 1 29  ? -1.504  5.958   11.576  1.00 16.12 ? 29   LYS A N     1 
ATOM   190   C CA    . LYS A 1 29  ? -1.243  4.658   12.172  1.00 16.17 ? 29   LYS A CA    1 
ATOM   191   C C     . LYS A 1 29  ? 0.261   4.522   12.498  1.00 16.50 ? 29   LYS A C     1 
ATOM   192   O O     . LYS A 1 29  ? 0.629   4.155   13.613  1.00 16.89 ? 29   LYS A O     1 
ATOM   193   C CB    . LYS A 1 29  ? -1.773  3.513   11.292  1.00 15.81 ? 29   LYS A CB    1 
ATOM   194   N N     . GLN A 1 30  ? 1.134   4.868   11.559  1.00 16.83 ? 30   GLN A N     1 
ATOM   195   C CA    . GLN A 1 30  ? 2.569   4.696   11.781  1.00 16.99 ? 30   GLN A CA    1 
ATOM   196   C C     . GLN A 1 30  ? 3.119   5.643   12.882  1.00 18.18 ? 30   GLN A C     1 
ATOM   197   O O     . GLN A 1 30  ? 3.982   5.253   13.677  1.00 18.19 ? 30   GLN A O     1 
ATOM   198   C CB    . GLN A 1 30  ? 3.342   4.834   10.469  1.00 16.05 ? 30   GLN A CB    1 
ATOM   199   C CG    . GLN A 1 30  ? 4.757   4.342   10.607  1.00 15.67 ? 30   GLN A CG    1 
ATOM   200   C CD    . GLN A 1 30  ? 5.706   4.835   9.546   1.00 13.01 ? 30   GLN A CD    1 
ATOM   201   O OE1   . GLN A 1 30  ? 5.626   5.981   9.107   1.00 14.42 ? 30   GLN A OE1   1 
ATOM   202   N NE2   . GLN A 1 30  ? 6.637   3.974   9.145   1.00 11.05 ? 30   GLN A NE2   1 
ATOM   203   N N     . SER A 1 31  ? 2.598   6.872   12.938  1.00 19.13 ? 31   SER A N     1 
ATOM   204   C CA    . SER A 1 31  ? 3.003   7.849   13.961  1.00 20.16 ? 31   SER A CA    1 
ATOM   205   C C     . SER A 1 31  ? 2.713   7.383   15.393  1.00 20.59 ? 31   SER A C     1 
ATOM   206   O O     . SER A 1 31  ? 3.426   7.745   16.315  1.00 21.08 ? 31   SER A O     1 
ATOM   207   C CB    . SER A 1 31  ? 2.368   9.237   13.695  1.00 20.31 ? 31   SER A CB    1 
ATOM   208   O OG    . SER A 1 31  ? 0.950   9.220   13.799  1.00 20.53 ? 31   SER A OG    1 
ATOM   209   N N     . ILE A 1 32  ? 1.665   6.584   15.554  1.00 21.61 ? 32   ILE A N     1 
ATOM   210   C CA    . ILE A 1 32  ? 1.299   5.951   16.820  1.00 22.48 ? 32   ILE A CA    1 
ATOM   211   C C     . ILE A 1 32  ? 2.146   4.710   17.107  1.00 22.69 ? 32   ILE A C     1 
ATOM   212   O O     . ILE A 1 32  ? 2.755   4.602   18.176  1.00 22.85 ? 32   ILE A O     1 
ATOM   213   C CB    . ILE A 1 32  ? -0.203  5.523   16.822  1.00 22.71 ? 32   ILE A CB    1 
ATOM   214   C CG1   . ILE A 1 32  ? -1.116  6.730   16.625  1.00 23.32 ? 32   ILE A CG1   1 
ATOM   215   C CG2   . ILE A 1 32  ? -0.566  4.734   18.099  1.00 23.76 ? 32   ILE A CG2   1 
ATOM   216   C CD1   . ILE A 1 32  ? -0.640  8.003   17.309  1.00 24.71 ? 32   ILE A CD1   1 
ATOM   217   N N     . ASN A 1 33  ? 2.174   3.786   16.145  1.00 23.01 ? 33   ASN A N     1 
ATOM   218   C CA    . ASN A 1 33  ? 2.819   2.483   16.306  1.00 23.32 ? 33   ASN A CA    1 
ATOM   219   C C     . ASN A 1 33  ? 4.332   2.564   16.319  1.00 23.22 ? 33   ASN A C     1 
ATOM   220   O O     . ASN A 1 33  ? 4.991   1.764   16.976  1.00 23.05 ? 33   ASN A O     1 
ATOM   221   C CB    . ASN A 1 33  ? 2.426   1.528   15.168  1.00 23.77 ? 33   ASN A CB    1 
ATOM   222   C CG    . ASN A 1 33  ? 0.936   1.140   15.172  1.00 25.55 ? 33   ASN A CG    1 
ATOM   223   O OD1   . ASN A 1 33  ? 0.224   1.247   16.184  1.00 26.88 ? 33   ASN A OD1   1 
ATOM   224   N ND2   . ASN A 1 33  ? 0.468   0.665   14.021  1.00 27.19 ? 33   ASN A ND2   1 
ATOM   225   N N     . ASP A 1 34  ? 4.887   3.500   15.555  1.00 22.92 ? 34   ASP A N     1 
ATOM   226   C CA    . ASP A 1 34  ? 6.327   3.573   15.397  1.00 22.72 ? 34   ASP A CA    1 
ATOM   227   C C     . ASP A 1 34  ? 6.798   5.046   15.281  1.00 22.83 ? 34   ASP A C     1 
ATOM   228   O O     . ASP A 1 34  ? 7.189   5.517   14.188  1.00 22.57 ? 34   ASP A O     1 
ATOM   229   C CB    . ASP A 1 34  ? 6.762   2.691   14.215  1.00 22.49 ? 34   ASP A CB    1 
ATOM   230   C CG    . ASP A 1 34  ? 8.273   2.592   14.072  1.00 22.57 ? 34   ASP A CG    1 
ATOM   231   O OD1   . ASP A 1 34  ? 8.997   3.119   14.950  1.00 22.15 ? 34   ASP A OD1   1 
ATOM   232   O OD2   . ASP A 1 34  ? 8.734   1.991   13.073  1.00 21.43 ? 34   ASP A OD2   1 
ATOM   233   N N     . PRO A 1 35  ? 6.796   5.773   16.424  1.00 22.65 ? 35   PRO A N     1 
ATOM   234   C CA    . PRO A 1 35  ? 7.075   7.197   16.382  1.00 22.31 ? 35   PRO A CA    1 
ATOM   235   C C     . PRO A 1 35  ? 8.494   7.446   15.904  1.00 22.15 ? 35   PRO A C     1 
ATOM   236   O O     . PRO A 1 35  ? 8.723   8.406   15.181  1.00 22.07 ? 35   PRO A O     1 
ATOM   237   C CB    . PRO A 1 35  ? 6.918   7.640   17.834  1.00 22.58 ? 35   PRO A CB    1 
ATOM   238   C CG    . PRO A 1 35  ? 6.178   6.538   18.524  1.00 22.95 ? 35   PRO A CG    1 
ATOM   239   C CD    . PRO A 1 35  ? 6.599   5.300   17.806  1.00 22.93 ? 35   PRO A CD    1 
ATOM   240   N N     . ASP A 1 36  ? 9.431   6.572   16.269  1.00 22.12 ? 36   ASP A N     1 
ATOM   241   C CA    . ASP A 1 36  ? 10.841  6.789   15.931  1.00 22.25 ? 36   ASP A CA    1 
ATOM   242   C C     . ASP A 1 36  ? 11.131  6.778   14.428  1.00 22.16 ? 36   ASP A C     1 
ATOM   243   O O     . ASP A 1 36  ? 11.887  7.622   13.940  1.00 22.66 ? 36   ASP A O     1 
ATOM   244   C CB    . ASP A 1 36  ? 11.762  5.822   16.687  1.00 22.78 ? 36   ASP A CB    1 
ATOM   245   C CG    . ASP A 1 36  ? 11.957  6.216   18.168  1.00 23.65 ? 36   ASP A CG    1 
ATOM   246   O OD1   . ASP A 1 36  ? 12.050  5.302   19.009  1.00 25.43 ? 36   ASP A OD1   1 
ATOM   247   O OD2   . ASP A 1 36  ? 12.008  7.427   18.503  1.00 23.47 ? 36   ASP A OD2   1 
ATOM   248   N N     . THR A 1 37  ? 10.527  5.839   13.697  1.00 21.68 ? 37   THR A N     1 
ATOM   249   C CA    . THR A 1 37  ? 10.617  5.820   12.239  1.00 20.75 ? 37   THR A CA    1 
ATOM   250   C C     . THR A 1 37  ? 9.831   6.980   11.650  1.00 20.40 ? 37   THR A C     1 
ATOM   251   O O     . THR A 1 37  ? 10.330  7.692   10.791  1.00 21.30 ? 37   THR A O     1 
ATOM   252   C CB    . THR A 1 37  ? 10.080  4.523   11.627  1.00 20.75 ? 37   THR A CB    1 
ATOM   253   O OG1   . THR A 1 37  ? 10.614  3.396   12.335  1.00 20.04 ? 37   THR A OG1   1 
ATOM   254   C CG2   . THR A 1 37  ? 10.460  4.441   10.129  1.00 20.06 ? 37   THR A CG2   1 
ATOM   255   N N     . PHE A 1 38  ? 8.606   7.176   12.111  1.00 19.68 ? 38   PHE A N     1 
ATOM   256   C CA    . PHE A 1 38  ? 7.790   8.255   11.591  1.00 18.70 ? 38   PHE A CA    1 
ATOM   257   C C     . PHE A 1 38  ? 8.463   9.630   11.761  1.00 18.45 ? 38   PHE A C     1 
ATOM   258   O O     . PHE A 1 38  ? 8.597   10.382  10.798  1.00 19.05 ? 38   PHE A O     1 
ATOM   259   C CB    . PHE A 1 38  ? 6.386   8.265   12.198  1.00 18.04 ? 38   PHE A CB    1 
ATOM   260   C CG    . PHE A 1 38  ? 5.549   9.363   11.657  1.00 18.09 ? 38   PHE A CG    1 
ATOM   261   C CD1   . PHE A 1 38  ? 4.964   9.252   10.407  1.00 17.28 ? 38   PHE A CD1   1 
ATOM   262   C CD2   . PHE A 1 38  ? 5.416   10.562  12.345  1.00 17.75 ? 38   PHE A CD2   1 
ATOM   263   C CE1   . PHE A 1 38  ? 4.224   10.303  9.877   1.00 16.50 ? 38   PHE A CE1   1 
ATOM   264   C CE2   . PHE A 1 38  ? 4.678   11.609  11.813  1.00 15.37 ? 38   PHE A CE2   1 
ATOM   265   C CZ    . PHE A 1 38  ? 4.085   11.480  10.586  1.00 15.57 ? 38   PHE A CZ    1 
ATOM   266   N N     . TRP A 1 39  ? 8.906   9.947   12.969  1.00 18.02 ? 39   TRP A N     1 
ATOM   267   C CA    . TRP A 1 39  ? 9.402   11.284  13.259  1.00 17.59 ? 39   TRP A CA    1 
ATOM   268   C C     . TRP A 1 39  ? 10.869  11.453  12.922  1.00 17.64 ? 39   TRP A C     1 
ATOM   269   O O     . TRP A 1 39  ? 11.354  12.579  12.737  1.00 17.70 ? 39   TRP A O     1 
ATOM   270   C CB    . TRP A 1 39  ? 9.123   11.656  14.720  1.00 17.47 ? 39   TRP A CB    1 
ATOM   271   C CG    . TRP A 1 39  ? 7.703   11.945  14.959  1.00 16.64 ? 39   TRP A CG    1 
ATOM   272   C CD1   . TRP A 1 39  ? 6.826   11.198  15.673  1.00 16.54 ? 39   TRP A CD1   1 
ATOM   273   C CD2   . TRP A 1 39  ? 6.969   13.072  14.462  1.00 16.65 ? 39   TRP A CD2   1 
ATOM   274   N NE1   . TRP A 1 39  ? 5.584   11.798  15.676  1.00 16.57 ? 39   TRP A NE1   1 
ATOM   275   C CE2   . TRP A 1 39  ? 5.647   12.946  14.930  1.00 15.79 ? 39   TRP A CE2   1 
ATOM   276   C CE3   . TRP A 1 39  ? 7.307   14.178  13.665  1.00 16.48 ? 39   TRP A CE3   1 
ATOM   277   C CZ2   . TRP A 1 39  ? 4.657   13.883  14.632  1.00 17.08 ? 39   TRP A CZ2   1 
ATOM   278   C CZ3   . TRP A 1 39  ? 6.316   15.101  13.345  1.00 17.40 ? 39   TRP A CZ3   1 
ATOM   279   C CH2   . TRP A 1 39  ? 5.007   14.953  13.840  1.00 17.43 ? 39   TRP A CH2   1 
ATOM   280   N N     . GLY A 1 40  ? 11.576  10.328  12.851  1.00 17.65 ? 40   GLY A N     1 
ATOM   281   C CA    . GLY A 1 40  ? 12.940  10.318  12.348  1.00 17.42 ? 40   GLY A CA    1 
ATOM   282   C C     . GLY A 1 40  ? 12.954  10.681  10.874  1.00 17.54 ? 40   GLY A C     1 
ATOM   283   O O     . GLY A 1 40  ? 13.825  11.408  10.428  1.00 17.55 ? 40   GLY A O     1 
ATOM   284   N N     . GLU A 1 41  ? 11.984  10.183  10.112  1.00 17.67 ? 41   GLU A N     1 
ATOM   285   C CA    . GLU A 1 41  ? 11.875  10.575  8.716   1.00 18.37 ? 41   GLU A CA    1 
ATOM   286   C C     . GLU A 1 41  ? 11.339  12.009  8.634   1.00 17.85 ? 41   GLU A C     1 
ATOM   287   O O     . GLU A 1 41  ? 11.933  12.876  7.983   1.00 17.81 ? 41   GLU A O     1 
ATOM   288   C CB    . GLU A 1 41  ? 11.027  9.573   7.916   1.00 17.95 ? 41   GLU A CB    1 
ATOM   289   C CG    . GLU A 1 41  ? 11.793  8.273   7.490   1.00 19.68 ? 41   GLU A CG    1 
ATOM   290   C CD    . GLU A 1 41  ? 10.843  7.118   7.087   1.00 20.86 ? 41   GLU A CD    1 
ATOM   291   O OE1   . GLU A 1 41  ? 11.233  5.929   7.212   1.00 24.35 ? 41   GLU A OE1   1 
ATOM   292   O OE2   . GLU A 1 41  ? 9.693   7.395   6.658   1.00 23.65 ? 41   GLU A OE2   1 
ATOM   293   N N     . GLN A 1 42  ? 10.253  12.275  9.348   1.00 17.41 ? 42   GLN A N     1 
ATOM   294   C CA    . GLN A 1 42  ? 9.589   13.552  9.232   1.00 17.01 ? 42   GLN A CA    1 
ATOM   295   C C     . GLN A 1 42  ? 10.460  14.722  9.696   1.00 17.28 ? 42   GLN A C     1 
ATOM   296   O O     . GLN A 1 42  ? 10.297  15.832  9.201   1.00 17.54 ? 42   GLN A O     1 
ATOM   297   C CB    . GLN A 1 42  ? 8.252   13.536  9.966   1.00 16.74 ? 42   GLN A CB    1 
ATOM   298   C CG    . GLN A 1 42  ? 7.395   14.767  9.703   1.00 16.19 ? 42   GLN A CG    1 
ATOM   299   C CD    . GLN A 1 42  ? 7.296   15.146  8.235   1.00 15.58 ? 42   GLN A CD    1 
ATOM   300   O OE1   . GLN A 1 42  ? 7.428   16.321  7.897   1.00 17.98 ? 42   GLN A OE1   1 
ATOM   301   N NE2   . GLN A 1 42  ? 7.038   14.167  7.357   1.00 12.67 ? 42   GLN A NE2   1 
ATOM   302   N N     . GLY A 1 43  ? 11.396  14.470  10.616  1.00 16.84 ? 43   GLY A N     1 
ATOM   303   C CA    . GLY A 1 43  ? 12.313  15.501  11.075  1.00 16.17 ? 43   GLY A CA    1 
ATOM   304   C C     . GLY A 1 43  ? 13.216  16.080  9.991   1.00 16.00 ? 43   GLY A C     1 
ATOM   305   O O     . GLY A 1 43  ? 13.843  17.114  10.198  1.00 15.64 ? 43   GLY A O     1 
ATOM   306   N N     . LYS A 1 44  ? 13.289  15.421  8.832   1.00 16.00 ? 44   LYS A N     1 
ATOM   307   C CA    . LYS A 1 44  ? 14.149  15.895  7.723   1.00 15.92 ? 44   LYS A CA    1 
ATOM   308   C C     . LYS A 1 44  ? 13.575  17.097  6.948   1.00 15.32 ? 44   LYS A C     1 
ATOM   309   O O     . LYS A 1 44  ? 14.223  17.626  6.077   1.00 15.42 ? 44   LYS A O     1 
ATOM   310   C CB    . LYS A 1 44  ? 14.509  14.732  6.791   1.00 16.54 ? 44   LYS A CB    1 
ATOM   311   C CG    . LYS A 1 44  ? 15.310  13.609  7.500   1.00 16.61 ? 44   LYS A CG    1 
ATOM   312   C CD    . LYS A 1 44  ? 16.775  14.035  7.762   1.00 18.68 ? 44   LYS A CD    1 
ATOM   313   C CE    . LYS A 1 44  ? 17.638  12.948  8.448   1.00 19.75 ? 44   LYS A CE    1 
ATOM   314   N NZ    . LYS A 1 44  ? 17.274  11.510  8.106   1.00 20.43 ? 44   LYS A NZ    1 
ATOM   315   N N     . ILE A 1 45  ? 12.353  17.516  7.281   1.00 14.62 ? 45   ILE A N     1 
ATOM   316   C CA    . ILE A 1 45  ? 11.798  18.806  6.843   1.00 13.84 ? 45   ILE A CA    1 
ATOM   317   C C     . ILE A 1 45  ? 12.728  19.992  7.207   1.00 14.13 ? 45   ILE A C     1 
ATOM   318   O O     . ILE A 1 45  ? 12.617  21.082  6.642   1.00 13.43 ? 45   ILE A O     1 
ATOM   319   C CB    . ILE A 1 45  ? 10.355  19.028  7.441   1.00 13.68 ? 45   ILE A CB    1 
ATOM   320   C CG1   . ILE A 1 45  ? 9.672   20.232  6.793   1.00 12.22 ? 45   ILE A CG1   1 
ATOM   321   C CG2   . ILE A 1 45  ? 10.399  19.163  8.970   1.00 12.28 ? 45   ILE A CG2   1 
ATOM   322   C CD1   . ILE A 1 45  ? 8.148   20.210  6.876   1.00 13.36 ? 45   ILE A CD1   1 
ATOM   323   N N     . LEU A 1 46  ? 13.623  19.751  8.168   1.00 14.25 ? 46   LEU A N     1 
ATOM   324   C CA    . LEU A 1 46  ? 14.604  20.723  8.595   1.00 14.66 ? 46   LEU A CA    1 
ATOM   325   C C     . LEU A 1 46  ? 16.046  20.278  8.252   1.00 15.07 ? 46   LEU A C     1 
ATOM   326   O O     . LEU A 1 46  ? 16.329  19.085  8.099   1.00 14.89 ? 46   LEU A O     1 
ATOM   327   C CB    . LEU A 1 46  ? 14.498  20.967  10.107  1.00 14.22 ? 46   LEU A CB    1 
ATOM   328   C CG    . LEU A 1 46  ? 13.178  21.318  10.794  1.00 13.60 ? 46   LEU A CG    1 
ATOM   329   C CD1   . LEU A 1 46  ? 13.449  21.538  12.297  1.00 11.89 ? 46   LEU A CD1   1 
ATOM   330   C CD2   . LEU A 1 46  ? 12.420  22.505  10.179  1.00 8.17  ? 46   LEU A CD2   1 
ATOM   331   N N     . ASP A 1 47  ? 16.938  21.260  8.127   1.00 15.06 ? 47   ASP A N     1 
ATOM   332   C CA    . ASP A 1 47  ? 18.354  20.996  8.027   1.00 15.42 ? 47   ASP A CA    1 
ATOM   333   C C     . ASP A 1 47  ? 18.850  20.898  9.454   1.00 15.82 ? 47   ASP A C     1 
ATOM   334   O O     . ASP A 1 47  ? 18.490  21.711  10.303  1.00 15.89 ? 47   ASP A O     1 
ATOM   335   C CB    . ASP A 1 47  ? 19.134  22.157  7.380   1.00 15.53 ? 47   ASP A CB    1 
ATOM   336   C CG    . ASP A 1 47  ? 18.765  22.435  5.927   1.00 15.58 ? 47   ASP A CG    1 
ATOM   337   O OD1   . ASP A 1 47  ? 19.416  23.355  5.399   1.00 18.04 ? 47   ASP A OD1   1 
ATOM   338   O OD2   . ASP A 1 47  ? 17.855  21.816  5.318   1.00 13.49 ? 47   ASP A OD2   1 
ATOM   339   N N     . TRP A 1 48  ? 19.717  19.922  9.683   1.00 16.09 ? 48   TRP A N     1 
ATOM   340   C CA    . TRP A 1 48  ? 20.382  19.727  10.943  1.00 16.56 ? 48   TRP A CA    1 
ATOM   341   C C     . TRP A 1 48  ? 21.890  19.990  10.752  1.00 17.13 ? 48   TRP A C     1 
ATOM   342   O O     . TRP A 1 48  ? 22.427  19.757  9.675   1.00 17.05 ? 48   TRP A O     1 
ATOM   343   C CB    . TRP A 1 48  ? 20.109  18.295  11.416  1.00 15.96 ? 48   TRP A CB    1 
ATOM   344   C CG    . TRP A 1 48  ? 18.693  18.136  11.737  1.00 15.30 ? 48   TRP A CG    1 
ATOM   345   C CD1   . TRP A 1 48  ? 17.666  17.915  10.863  1.00 15.08 ? 48   TRP A CD1   1 
ATOM   346   C CD2   . TRP A 1 48  ? 18.113  18.216  13.033  1.00 15.96 ? 48   TRP A CD2   1 
ATOM   347   N NE1   . TRP A 1 48  ? 16.478  17.858  11.541  1.00 14.96 ? 48   TRP A NE1   1 
ATOM   348   C CE2   . TRP A 1 48  ? 16.719  18.049  12.875  1.00 14.35 ? 48   TRP A CE2   1 
ATOM   349   C CE3   . TRP A 1 48  ? 18.636  18.434  14.322  1.00 16.36 ? 48   TRP A CE3   1 
ATOM   350   C CZ2   . TRP A 1 48  ? 15.836  18.079  13.950  1.00 14.70 ? 48   TRP A CZ2   1 
ATOM   351   C CZ3   . TRP A 1 48  ? 17.759  18.472  15.395  1.00 15.35 ? 48   TRP A CZ3   1 
ATOM   352   C CH2   . TRP A 1 48  ? 16.368  18.284  15.202  1.00 15.67 ? 48   TRP A CH2   1 
ATOM   353   N N     . ILE A 1 49  ? 22.567  20.477  11.782  1.00 17.38 ? 49   ILE A N     1 
ATOM   354   C CA    . ILE A 1 49  ? 23.997  20.646  11.679  1.00 18.22 ? 49   ILE A CA    1 
ATOM   355   C C     . ILE A 1 49  ? 24.701  19.310  12.019  1.00 19.26 ? 49   ILE A C     1 
ATOM   356   O O     . ILE A 1 49  ? 25.439  18.771  11.201  1.00 19.15 ? 49   ILE A O     1 
ATOM   357   C CB    . ILE A 1 49  ? 24.464  21.876  12.468  1.00 18.12 ? 49   ILE A CB    1 
ATOM   358   C CG1   . ILE A 1 49  ? 23.817  23.118  11.841  1.00 16.81 ? 49   ILE A CG1   1 
ATOM   359   C CG2   . ILE A 1 49  ? 26.003  21.990  12.471  1.00 17.08 ? 49   ILE A CG2   1 
ATOM   360   C CD1   . ILE A 1 49  ? 23.495  24.223  12.840  1.00 16.42 ? 49   ILE A CD1   1 
ATOM   361   N N     . THR A 1 50  ? 24.450  18.748  13.197  1.00 20.09 ? 50   THR A N     1 
ATOM   362   C CA    . THR A 1 50  ? 24.692  17.319  13.339  1.00 20.59 ? 50   THR A CA    1 
ATOM   363   C C     . THR A 1 50  ? 23.350  16.561  13.415  1.00 20.84 ? 50   THR A C     1 
ATOM   364   O O     . THR A 1 50  ? 22.476  16.895  14.209  1.00 21.22 ? 50   THR A O     1 
ATOM   365   C CB    . THR A 1 50  ? 25.722  16.909  14.462  1.00 20.74 ? 50   THR A CB    1 
ATOM   366   O OG1   . THR A 1 50  ? 25.049  16.334  15.580  1.00 21.23 ? 50   THR A OG1   1 
ATOM   367   C CG2   . THR A 1 50  ? 26.589  18.063  14.911  1.00 20.28 ? 50   THR A CG2   1 
ATOM   368   N N     . PRO A 1 51  ? 23.188  15.541  12.564  1.00 20.90 ? 51   PRO A N     1 
ATOM   369   C CA    . PRO A 1 51  ? 21.977  14.732  12.540  1.00 20.36 ? 51   PRO A CA    1 
ATOM   370   C C     . PRO A 1 51  ? 21.729  14.039  13.870  1.00 20.00 ? 51   PRO A C     1 
ATOM   371   O O     . PRO A 1 51  ? 22.668  13.570  14.535  1.00 20.23 ? 51   PRO A O     1 
ATOM   372   C CB    . PRO A 1 51  ? 22.280  13.666  11.465  1.00 20.16 ? 51   PRO A CB    1 
ATOM   373   C CG    . PRO A 1 51  ? 23.786  13.641  11.349  1.00 20.87 ? 51   PRO A CG    1 
ATOM   374   C CD    . PRO A 1 51  ? 24.200  15.064  11.593  1.00 21.17 ? 51   PRO A CD    1 
ATOM   375   N N     . TYR A 1 52  ? 20.461  13.972  14.243  1.00 19.38 ? 52   TYR A N     1 
ATOM   376   C CA    . TYR A 1 52  ? 20.043  13.229  15.416  1.00 19.06 ? 52   TYR A CA    1 
ATOM   377   C C     . TYR A 1 52  ? 20.148  11.729  15.185  1.00 19.35 ? 52   TYR A C     1 
ATOM   378   O O     . TYR A 1 52  ? 20.121  11.270  14.053  1.00 18.69 ? 52   TYR A O     1 
ATOM   379   C CB    . TYR A 1 52  ? 18.606  13.606  15.817  1.00 18.13 ? 52   TYR A CB    1 
ATOM   380   C CG    . TYR A 1 52  ? 17.615  13.551  14.674  1.00 17.34 ? 52   TYR A CG    1 
ATOM   381   C CD1   . TYR A 1 52  ? 17.028  12.341  14.290  1.00 14.63 ? 52   TYR A CD1   1 
ATOM   382   C CD2   . TYR A 1 52  ? 17.250  14.723  13.979  1.00 16.95 ? 52   TYR A CD2   1 
ATOM   383   C CE1   . TYR A 1 52  ? 16.143  12.284  13.259  1.00 13.26 ? 52   TYR A CE1   1 
ATOM   384   C CE2   . TYR A 1 52  ? 16.357  14.671  12.946  1.00 14.86 ? 52   TYR A CE2   1 
ATOM   385   C CZ    . TYR A 1 52  ? 15.812  13.453  12.599  1.00 15.19 ? 52   TYR A CZ    1 
ATOM   386   O OH    . TYR A 1 52  ? 14.930  13.405  11.573  1.00 17.27 ? 52   TYR A OH    1 
ATOM   387   N N     . GLN A 1 53  ? 20.264  10.973  16.272  1.00 20.42 ? 53   GLN A N     1 
ATOM   388   C CA    . GLN A 1 53  ? 20.160  9.511   16.218  1.00 21.64 ? 53   GLN A CA    1 
ATOM   389   C C     . GLN A 1 53  ? 18.931  9.097   17.038  1.00 20.71 ? 53   GLN A C     1 
ATOM   390   O O     . GLN A 1 53  ? 18.051  8.400   16.525  1.00 21.16 ? 53   GLN A O     1 
ATOM   391   C CB    . GLN A 1 53  ? 21.469  8.831   16.697  1.00 21.67 ? 53   GLN A CB    1 
ATOM   392   C CG    . GLN A 1 53  ? 22.730  9.136   15.800  1.00 23.50 ? 53   GLN A CG    1 
ATOM   393   C CD    . GLN A 1 53  ? 24.088  8.671   16.423  1.00 24.64 ? 53   GLN A CD    1 
ATOM   394   O OE1   . GLN A 1 53  ? 24.770  9.451   17.116  1.00 28.48 ? 53   GLN A OE1   1 
ATOM   395   N NE2   . GLN A 1 53  ? 24.480  7.409   16.161  1.00 25.56 ? 53   GLN A NE2   1 
ATOM   396   N N     . LYS A 1 54  ? 18.849  9.567   18.284  1.00 19.52 ? 54   LYS A N     1 
ATOM   397   C CA    . LYS A 1 54  ? 17.661  9.372   19.108  1.00 18.96 ? 54   LYS A CA    1 
ATOM   398   C C     . LYS A 1 54  ? 16.506  10.202  18.556  1.00 17.89 ? 54   LYS A C     1 
ATOM   399   O O     . LYS A 1 54  ? 16.721  11.282  18.040  1.00 18.07 ? 54   LYS A O     1 
ATOM   400   C CB    . LYS A 1 54  ? 17.945  9.803   20.545  1.00 19.37 ? 54   LYS A CB    1 
ATOM   401   C CG    . LYS A 1 54  ? 18.575  8.750   21.437  1.00 21.13 ? 54   LYS A CG    1 
ATOM   402   C CD    . LYS A 1 54  ? 19.367  9.434   22.570  1.00 23.46 ? 54   LYS A CD    1 
ATOM   403   C CE    . LYS A 1 54  ? 19.883  8.444   23.621  1.00 23.10 ? 54   LYS A CE    1 
ATOM   404   N NZ    . LYS A 1 54  ? 19.974  9.125   24.926  1.00 21.72 ? 54   LYS A NZ    1 
ATOM   405   N N     . VAL A 1 55  ? 15.281  9.708   18.638  1.00 16.99 ? 55   VAL A N     1 
ATOM   406   C CA    . VAL A 1 55  ? 14.140  10.518  18.200  1.00 16.13 ? 55   VAL A CA    1 
ATOM   407   C C     . VAL A 1 55  ? 13.214  10.764  19.401  1.00 16.20 ? 55   VAL A C     1 
ATOM   408   O O     . VAL A 1 55  ? 13.314  11.835  20.034  1.00 16.05 ? 55   VAL A O     1 
ATOM   409   C CB    . VAL A 1 55  ? 13.401  9.941   16.921  1.00 16.42 ? 55   VAL A CB    1 
ATOM   410   C CG1   . VAL A 1 55  ? 12.189  10.795  16.523  1.00 15.08 ? 55   VAL A CG1   1 
ATOM   411   C CG2   . VAL A 1 55  ? 14.352  9.808   15.717  1.00 14.82 ? 55   VAL A CG2   1 
ATOM   412   N N     . LYS A 1 56  ? 12.372  9.772   19.731  1.00 15.69 ? 56   LYS A N     1 
ATOM   413   C CA    . LYS A 1 56  ? 11.402  9.861   20.837  1.00 15.78 ? 56   LYS A CA    1 
ATOM   414   C C     . LYS A 1 56  ? 11.955  9.331   22.159  1.00 16.33 ? 56   LYS A C     1 
ATOM   415   O O     . LYS A 1 56  ? 12.291  8.165   22.265  1.00 16.91 ? 56   LYS A O     1 
ATOM   416   C CB    . LYS A 1 56  ? 10.108  9.104   20.507  1.00 15.39 ? 56   LYS A CB    1 
ATOM   417   C CG    . LYS A 1 56  ? 8.970   9.367   21.493  1.00 14.00 ? 56   LYS A CG    1 
ATOM   418   C CD    . LYS A 1 56  ? 7.858   8.375   21.304  1.00 14.83 ? 56   LYS A CD    1 
ATOM   419   C CE    . LYS A 1 56  ? 6.573   8.800   22.022  1.00 16.12 ? 56   LYS A CE    1 
ATOM   420   N NZ    . LYS A 1 56  ? 6.632   8.626   23.486  1.00 13.10 ? 56   LYS A NZ    1 
ATOM   421   N N     . ASN A 1 57  ? 12.026  10.184  23.169  1.00 16.84 ? 57   ASN A N     1 
ATOM   422   C CA    . ASN A 1 57  ? 12.556  9.782   24.468  1.00 17.66 ? 57   ASN A CA    1 
ATOM   423   C C     . ASN A 1 57  ? 11.810  10.530  25.585  1.00 17.62 ? 57   ASN A C     1 
ATOM   424   O O     . ASN A 1 57  ? 12.272  11.558  26.087  1.00 17.88 ? 57   ASN A O     1 
ATOM   425   C CB    . ASN A 1 57  ? 14.081  9.993   24.508  1.00 17.37 ? 57   ASN A CB    1 
ATOM   426   C CG    . ASN A 1 57  ? 14.701  9.552   25.807  1.00 17.43 ? 57   ASN A CG    1 
ATOM   427   O OD1   . ASN A 1 57  ? 14.098  8.801   26.560  1.00 18.63 ? 57   ASN A OD1   1 
ATOM   428   N ND2   . ASN A 1 57  ? 15.910  10.031  26.088  1.00 15.89 ? 57   ASN A ND2   1 
ATOM   429   N N     . THR A 1 58  ? 10.628  10.013  25.933  1.00 17.64 ? 58   THR A N     1 
ATOM   430   C CA    . THR A 1 58  ? 9.642   10.773  26.726  1.00 17.26 ? 58   THR A CA    1 
ATOM   431   C C     . THR A 1 58  ? 8.904   9.938   27.768  1.00 17.33 ? 58   THR A C     1 
ATOM   432   O O     . THR A 1 58  ? 8.803   8.712   27.685  1.00 16.69 ? 58   THR A O     1 
ATOM   433   C CB    . THR A 1 58  ? 8.549   11.434  25.853  1.00 16.79 ? 58   THR A CB    1 
ATOM   434   O OG1   . THR A 1 58  ? 7.546   10.467  25.561  1.00 16.97 ? 58   THR A OG1   1 
ATOM   435   C CG2   . THR A 1 58  ? 9.099   11.960  24.553  1.00 16.17 ? 58   THR A CG2   1 
ATOM   436   N N     . SER A 1 59  ? 8.357   10.645  28.744  1.00 17.60 ? 59   SER A N     1 
ATOM   437   C CA    . SER A 1 59  ? 7.708   10.011  29.877  1.00 17.20 ? 59   SER A CA    1 
ATOM   438   C C     . SER A 1 59  ? 6.780   11.031  30.556  1.00 17.07 ? 59   SER A C     1 
ATOM   439   O O     . SER A 1 59  ? 7.146   12.213  30.738  1.00 16.42 ? 59   SER A O     1 
ATOM   440   C CB    . SER A 1 59  ? 8.773   9.446   30.825  1.00 16.49 ? 59   SER A CB    1 
ATOM   441   O OG    . SER A 1 59  ? 8.229   9.065   32.063  1.00 16.10 ? 59   SER A OG    1 
ATOM   442   N N     . PHE A 1 60  ? 5.568   10.580  30.880  1.00 16.90 ? 60   PHE A N     1 
ATOM   443   C CA    . PHE A 1 60  ? 4.632   11.410  31.657  1.00 17.31 ? 60   PHE A CA    1 
ATOM   444   C C     . PHE A 1 60  ? 4.505   10.900  33.103  1.00 17.58 ? 60   PHE A C     1 
ATOM   445   O O     . PHE A 1 60  ? 3.559   11.239  33.799  1.00 17.46 ? 60   PHE A O     1 
ATOM   446   C CB    . PHE A 1 60  ? 3.242   11.438  31.003  1.00 16.94 ? 60   PHE A CB    1 
ATOM   447   C CG    . PHE A 1 60  ? 3.177   12.170  29.670  1.00 16.46 ? 60   PHE A CG    1 
ATOM   448   C CD1   . PHE A 1 60  ? 2.019   12.078  28.881  1.00 16.19 ? 60   PHE A CD1   1 
ATOM   449   C CD2   . PHE A 1 60  ? 4.245   12.943  29.201  1.00 13.48 ? 60   PHE A CD2   1 
ATOM   450   C CE1   . PHE A 1 60  ? 1.923   12.752  27.677  1.00 14.34 ? 60   PHE A CE1   1 
ATOM   451   C CE2   . PHE A 1 60  ? 4.167   13.609  28.002  1.00 12.39 ? 60   PHE A CE2   1 
ATOM   452   C CZ    . PHE A 1 60  ? 3.005   13.525  27.236  1.00 15.54 ? 60   PHE A CZ    1 
ATOM   453   N N     . ALA A 1 61  ? 5.466   10.087  33.535  1.00 18.20 ? 61   ALA A N     1 
ATOM   454   C CA    . ALA A 1 61  ? 5.374   9.361   34.797  1.00 19.37 ? 61   ALA A CA    1 
ATOM   455   C C     . ALA A 1 61  ? 5.405   10.314  35.977  1.00 19.88 ? 61   ALA A C     1 
ATOM   456   O O     . ALA A 1 61  ? 6.241   11.221  36.001  1.00 20.29 ? 61   ALA A O     1 
ATOM   457   C CB    . ALA A 1 61  ? 6.505   8.319   34.919  1.00 19.15 ? 61   ALA A CB    1 
ATOM   458   N N     . PRO A 1 62  ? 4.492   10.112  36.954  1.00 20.17 ? 62   PRO A N     1 
ATOM   459   C CA    . PRO A 1 62  ? 4.452   10.931  38.180  1.00 20.47 ? 62   PRO A CA    1 
ATOM   460   C C     . PRO A 1 62  ? 5.864   11.211  38.729  1.00 20.85 ? 62   PRO A C     1 
ATOM   461   O O     . PRO A 1 62  ? 6.645   10.274  38.928  1.00 20.53 ? 62   PRO A O     1 
ATOM   462   C CB    . PRO A 1 62  ? 3.665   10.046  39.160  1.00 20.03 ? 62   PRO A CB    1 
ATOM   463   C CG    . PRO A 1 62  ? 2.777   9.201   38.290  1.00 19.80 ? 62   PRO A CG    1 
ATOM   464   C CD    . PRO A 1 62  ? 3.445   9.063   36.943  1.00 19.88 ? 62   PRO A CD    1 
ATOM   465   N N     . GLY A 1 63  ? 6.202   12.486  38.924  1.00 21.58 ? 63   GLY A N     1 
ATOM   466   C CA    . GLY A 1 63  ? 7.517   12.848  39.489  1.00 21.73 ? 63   GLY A CA    1 
ATOM   467   C C     . GLY A 1 63  ? 8.735   12.620  38.602  1.00 22.12 ? 63   GLY A C     1 
ATOM   468   O O     . GLY A 1 63  ? 9.867   12.896  39.013  1.00 22.53 ? 63   GLY A O     1 
ATOM   469   N N     . ASN A 1 64  ? 8.527   12.127  37.385  1.00 22.54 ? 64   ASN A N     1 
ATOM   470   C CA    . ASN A 1 64  ? 9.595   12.061  36.379  1.00 23.16 ? 64   ASN A CA    1 
ATOM   471   C C     . ASN A 1 64  ? 9.092   12.374  34.997  1.00 22.51 ? 64   ASN A C     1 
ATOM   472   O O     . ASN A 1 64  ? 9.184   11.531  34.091  1.00 23.01 ? 64   ASN A O     1 
ATOM   473   C CB    . ASN A 1 64  ? 10.233  10.679  36.332  1.00 24.23 ? 64   ASN A CB    1 
ATOM   474   C CG    . ASN A 1 64  ? 10.989  10.359  37.579  1.00 27.20 ? 64   ASN A CG    1 
ATOM   475   O OD1   . ASN A 1 64  ? 11.935  11.070  37.939  1.00 31.42 ? 64   ASN A OD1   1 
ATOM   476   N ND2   . ASN A 1 64  ? 10.578  9.293   38.269  1.00 28.77 ? 64   ASN A ND2   1 
ATOM   477   N N     . VAL A 1 65  ? 8.549   13.573  34.833  1.00 21.51 ? 65   VAL A N     1 
ATOM   478   C CA    . VAL A 1 65  ? 8.104   14.045  33.525  1.00 20.13 ? 65   VAL A CA    1 
ATOM   479   C C     . VAL A 1 65  ? 9.322   14.576  32.775  1.00 19.17 ? 65   VAL A C     1 
ATOM   480   O O     . VAL A 1 65  ? 10.036  15.458  33.254  1.00 18.43 ? 65   VAL A O     1 
ATOM   481   C CB    . VAL A 1 65  ? 6.979   15.111  33.682  1.00 20.76 ? 65   VAL A CB    1 
ATOM   482   C CG1   . VAL A 1 65  ? 6.617   15.786  32.322  1.00 20.38 ? 65   VAL A CG1   1 
ATOM   483   C CG2   . VAL A 1 65  ? 5.758   14.471  34.342  1.00 19.57 ? 65   VAL A CG2   1 
ATOM   484   N N     . SER A 1 66  ? 9.571   14.000  31.608  1.00 18.69 ? 66   SER A N     1 
ATOM   485   C CA    . SER A 1 66  ? 10.789  14.268  30.860  1.00 18.11 ? 66   SER A CA    1 
ATOM   486   C C     . SER A 1 66  ? 10.532  14.084  29.362  1.00 18.00 ? 66   SER A C     1 
ATOM   487   O O     . SER A 1 66  ? 10.247  12.971  28.877  1.00 18.29 ? 66   SER A O     1 
ATOM   488   C CB    . SER A 1 66  ? 11.891  13.334  31.353  1.00 17.93 ? 66   SER A CB    1 
ATOM   489   O OG    . SER A 1 66  ? 13.045  13.411  30.544  1.00 18.86 ? 66   SER A OG    1 
ATOM   490   N N     . ILE A 1 67  ? 10.647  15.180  28.632  1.00 17.20 ? 67   ILE A N     1 
ATOM   491   C CA    . ILE A 1 67  ? 10.281  15.200  27.233  1.00 16.83 ? 67   ILE A CA    1 
ATOM   492   C C     . ILE A 1 67  ? 11.496  15.568  26.361  1.00 17.02 ? 67   ILE A C     1 
ATOM   493   O O     . ILE A 1 67  ? 11.938  16.723  26.338  1.00 16.80 ? 67   ILE A O     1 
ATOM   494   C CB    . ILE A 1 67  ? 9.082   16.200  26.956  1.00 16.93 ? 67   ILE A CB    1 
ATOM   495   C CG1   . ILE A 1 67  ? 7.877   15.885  27.851  1.00 16.93 ? 67   ILE A CG1   1 
ATOM   496   C CG2   . ILE A 1 67  ? 8.652   16.165  25.483  1.00 14.57 ? 67   ILE A CG2   1 
ATOM   497   C CD1   . ILE A 1 67  ? 6.881   17.023  27.937  1.00 16.01 ? 67   ILE A CD1   1 
ATOM   498   N N     . LYS A 1 68  ? 12.003  14.591  25.615  1.00 16.60 ? 68   LYS A N     1 
ATOM   499   C CA    . LYS A 1 68  ? 13.129  14.837  24.735  1.00 16.94 ? 68   LYS A CA    1 
ATOM   500   C C     . LYS A 1 68  ? 12.857  14.269  23.352  1.00 16.38 ? 68   LYS A C     1 
ATOM   501   O O     . LYS A 1 68  ? 12.430  13.109  23.205  1.00 16.60 ? 68   LYS A O     1 
ATOM   502   C CB    . LYS A 1 68  ? 14.431  14.276  25.330  1.00 17.16 ? 68   LYS A CB    1 
ATOM   503   C CG    . LYS A 1 68  ? 14.903  15.033  26.595  1.00 17.85 ? 68   LYS A CG    1 
ATOM   504   C CD    . LYS A 1 68  ? 16.078  14.318  27.271  1.00 18.83 ? 68   LYS A CD    1 
ATOM   505   C CE    . LYS A 1 68  ? 16.568  15.062  28.529  1.00 20.24 ? 68   LYS A CE    1 
ATOM   506   N NZ    . LYS A 1 68  ? 17.813  14.384  29.064  1.00 20.92 ? 68   LYS A NZ    1 
ATOM   507   N N     . TRP A 1 69  ? 13.081  15.112  22.346  1.00 15.35 ? 69   TRP A N     1 
ATOM   508   C CA    . TRP A 1 69  ? 12.889  14.755  20.947  1.00 14.31 ? 69   TRP A CA    1 
ATOM   509   C C     . TRP A 1 69  ? 14.126  15.192  20.222  1.00 14.02 ? 69   TRP A C     1 
ATOM   510   O O     . TRP A 1 69  ? 14.571  16.337  20.392  1.00 13.61 ? 69   TRP A O     1 
ATOM   511   C CB    . TRP A 1 69  ? 11.668  15.478  20.351  1.00 13.72 ? 69   TRP A CB    1 
ATOM   512   C CG    . TRP A 1 69  ? 10.357  14.896  20.770  1.00 13.37 ? 69   TRP A CG    1 
ATOM   513   C CD1   . TRP A 1 69  ? 9.636   15.233  21.878  1.00 12.82 ? 69   TRP A CD1   1 
ATOM   514   C CD2   . TRP A 1 69  ? 9.616   13.862  20.103  1.00 12.27 ? 69   TRP A CD2   1 
ATOM   515   N NE1   . TRP A 1 69  ? 8.481   14.482  21.934  1.00 12.82 ? 69   TRP A NE1   1 
ATOM   516   C CE2   . TRP A 1 69  ? 8.445   13.635  20.855  1.00 12.72 ? 69   TRP A CE2   1 
ATOM   517   C CE3   . TRP A 1 69  ? 9.826   13.112  18.947  1.00 11.29 ? 69   TRP A CE3   1 
ATOM   518   C CZ2   . TRP A 1 69  ? 7.489   12.690  20.488  1.00 10.50 ? 69   TRP A CZ2   1 
ATOM   519   C CZ3   . TRP A 1 69  ? 8.872   12.174  18.584  1.00 11.70 ? 69   TRP A CZ3   1 
ATOM   520   C CH2   . TRP A 1 69  ? 7.721   11.977  19.355  1.00 12.03 ? 69   TRP A CH2   1 
ATOM   521   N N     . TYR A 1 70  ? 14.694  14.265  19.445  1.00 13.86 ? 70   TYR A N     1 
ATOM   522   C CA    . TYR A 1 70  ? 15.882  14.529  18.629  1.00 13.74 ? 70   TYR A CA    1 
ATOM   523   C C     . TYR A 1 70  ? 17.111  15.007  19.433  1.00 14.55 ? 70   TYR A C     1 
ATOM   524   O O     . TYR A 1 70  ? 17.887  15.858  18.958  1.00 14.94 ? 70   TYR A O     1 
ATOM   525   C CB    . TYR A 1 70  ? 15.538  15.581  17.567  1.00 13.12 ? 70   TYR A CB    1 
ATOM   526   C CG    . TYR A 1 70  ? 14.298  15.318  16.709  1.00 12.27 ? 70   TYR A CG    1 
ATOM   527   C CD1   . TYR A 1 70  ? 13.127  16.093  16.873  1.00 10.10 ? 70   TYR A CD1   1 
ATOM   528   C CD2   . TYR A 1 70  ? 14.303  14.324  15.717  1.00 10.45 ? 70   TYR A CD2   1 
ATOM   529   C CE1   . TYR A 1 70  ? 11.993  15.881  16.085  1.00 10.50 ? 70   TYR A CE1   1 
ATOM   530   C CE2   . TYR A 1 70  ? 13.173  14.101  14.903  1.00 11.67 ? 70   TYR A CE2   1 
ATOM   531   C CZ    . TYR A 1 70  ? 12.017  14.892  15.092  1.00 13.14 ? 70   TYR A CZ    1 
ATOM   532   O OH    . TYR A 1 70  ? 10.904  14.681  14.295  1.00 12.26 ? 70   TYR A OH    1 
ATOM   533   N N     . GLU A 1 71  ? 17.305  14.474  20.635  1.00 15.29 ? 71   GLU A N     1 
ATOM   534   C CA    . GLU A 1 71  ? 18.173  15.151  21.632  1.00 16.55 ? 71   GLU A CA    1 
ATOM   535   C C     . GLU A 1 71  ? 19.631  15.337  21.275  1.00 16.49 ? 71   GLU A C     1 
ATOM   536   O O     . GLU A 1 71  ? 20.233  16.330  21.661  1.00 16.50 ? 71   GLU A O     1 
ATOM   537   C CB    . GLU A 1 71  ? 18.097  14.484  23.011  1.00 17.18 ? 71   GLU A CB    1 
ATOM   538   C CG    . GLU A 1 71  ? 18.401  13.009  23.042  1.00 19.06 ? 71   GLU A CG    1 
ATOM   539   C CD    . GLU A 1 71  ? 17.903  12.370  24.319  1.00 22.92 ? 71   GLU A CD    1 
ATOM   540   O OE1   . GLU A 1 71  ? 16.767  11.841  24.314  1.00 23.33 ? 71   GLU A OE1   1 
ATOM   541   O OE2   . GLU A 1 71  ? 18.640  12.416  25.331  1.00 24.79 ? 71   GLU A OE2   1 
ATOM   542   N N     . ASP A 1 72  ? 20.197  14.378  20.551  1.00 16.87 ? 72   ASP A N     1 
ATOM   543   C CA    . ASP A 1 72  ? 21.612  14.406  20.234  1.00 17.06 ? 72   ASP A CA    1 
ATOM   544   C C     . ASP A 1 72  ? 21.877  15.112  18.901  1.00 16.47 ? 72   ASP A C     1 
ATOM   545   O O     . ASP A 1 72  ? 22.970  15.005  18.340  1.00 16.95 ? 72   ASP A O     1 
ATOM   546   C CB    . ASP A 1 72  ? 22.186  12.973  20.250  1.00 17.68 ? 72   ASP A CB    1 
ATOM   547   C CG    . ASP A 1 72  ? 21.375  11.994  19.383  1.00 19.21 ? 72   ASP A CG    1 
ATOM   548   O OD1   . ASP A 1 72  ? 20.504  12.450  18.579  1.00 19.45 ? 72   ASP A OD1   1 
ATOM   549   O OD2   . ASP A 1 72  ? 21.603  10.765  19.525  1.00 19.72 ? 72   ASP A OD2   1 
ATOM   550   N N     . GLY A 1 73  ? 20.875  15.819  18.398  1.00 15.68 ? 73   GLY A N     1 
ATOM   551   C CA    . GLY A 1 73  ? 21.001  16.587  17.163  1.00 14.99 ? 73   GLY A CA    1 
ATOM   552   C C     . GLY A 1 73  ? 21.116  18.085  17.414  1.00 14.43 ? 73   GLY A C     1 
ATOM   553   O O     . GLY A 1 73  ? 20.612  18.596  18.417  1.00 14.35 ? 73   GLY A O     1 
ATOM   554   N N     . THR A 1 74  ? 21.789  18.793  16.512  1.00 13.74 ? 74   THR A N     1 
ATOM   555   C CA    . THR A 1 74  ? 21.904  20.237  16.629  1.00 13.19 ? 74   THR A CA    1 
ATOM   556   C C     . THR A 1 74  ? 21.408  20.869  15.365  1.00 13.04 ? 74   THR A C     1 
ATOM   557   O O     . THR A 1 74  ? 21.370  20.220  14.312  1.00 14.20 ? 74   THR A O     1 
ATOM   558   C CB    . THR A 1 74  ? 23.343  20.711  16.797  1.00 13.26 ? 74   THR A CB    1 
ATOM   559   O OG1   . THR A 1 74  ? 24.054  20.428  15.583  1.00 14.32 ? 74   THR A OG1   1 
ATOM   560   C CG2   . THR A 1 74  ? 24.028  20.070  18.026  1.00 12.65 ? 74   THR A CG2   1 
ATOM   561   N N     . LEU A 1 75  ? 21.062  22.145  15.468  1.00 12.10 ? 75   LEU A N     1 
ATOM   562   C CA    . LEU A 1 75  ? 20.460  22.884  14.381  1.00 11.46 ? 75   LEU A CA    1 
ATOM   563   C C     . LEU A 1 75  ? 20.375  24.359  14.774  1.00 11.38 ? 75   LEU A C     1 
ATOM   564   O O     . LEU A 1 75  ? 20.756  24.750  15.873  1.00 10.87 ? 75   LEU A O     1 
ATOM   565   C CB    . LEU A 1 75  ? 19.047  22.364  14.104  1.00 11.45 ? 75   LEU A CB    1 
ATOM   566   C CG    . LEU A 1 75  ? 17.920  22.804  15.065  1.00 10.39 ? 75   LEU A CG    1 
ATOM   567   C CD1   . LEU A 1 75  ? 16.539  22.520  14.477  1.00 9.25  ? 75   LEU A CD1   1 
ATOM   568   C CD2   . LEU A 1 75  ? 18.071  22.114  16.415  1.00 8.62  ? 75   LEU A CD2   1 
ATOM   569   N N     . ASN A 1 76  ? 19.854  25.168  13.870  1.00 11.07 ? 76   ASN A N     1 
ATOM   570   C CA    . ASN A 1 76  ? 19.588  26.546  14.160  1.00 10.93 ? 76   ASN A CA    1 
ATOM   571   C C     . ASN A 1 76  ? 18.249  26.907  13.541  1.00 10.60 ? 76   ASN A C     1 
ATOM   572   O O     . ASN A 1 76  ? 18.011  26.641  12.355  1.00 10.59 ? 76   ASN A O     1 
ATOM   573   C CB    . ASN A 1 76  ? 20.705  27.411  13.590  1.00 11.09 ? 76   ASN A CB    1 
ATOM   574   C CG    . ASN A 1 76  ? 20.615  28.857  14.051  1.00 13.17 ? 76   ASN A CG    1 
ATOM   575   O OD1   . ASN A 1 76  ? 21.406  29.306  14.898  1.00 16.87 ? 76   ASN A OD1   1 
ATOM   576   N ND2   . ASN A 1 76  ? 19.651  29.590  13.514  1.00 12.54 ? 76   ASN A ND2   1 
ATOM   577   N N     . LEU A 1 77  ? 17.381  27.518  14.329  1.00 10.42 ? 77   LEU A N     1 
ATOM   578   C CA    . LEU A 1 77  ? 16.033  27.852  13.851  1.00 10.80 ? 77   LEU A CA    1 
ATOM   579   C C     . LEU A 1 77  ? 16.099  28.942  12.804  1.00 11.06 ? 77   LEU A C     1 
ATOM   580   O O     . LEU A 1 77  ? 15.394  28.881  11.793  1.00 10.99 ? 77   LEU A O     1 
ATOM   581   C CB    . LEU A 1 77  ? 15.062  28.239  14.999  1.00 10.46 ? 77   LEU A CB    1 
ATOM   582   C CG    . LEU A 1 77  ? 13.693  28.794  14.560  1.00 10.40 ? 77   LEU A CG    1 
ATOM   583   C CD1   . LEU A 1 77  ? 12.676  28.541  15.604  1.00 10.45 ? 77   LEU A CD1   1 
ATOM   584   C CD2   . LEU A 1 77  ? 13.704  30.274  14.202  1.00 7.76  ? 77   LEU A CD2   1 
ATOM   585   N N     . ALA A 1 78  ? 16.946  29.938  13.037  1.00 11.54 ? 78   ALA A N     1 
ATOM   586   C CA    . ALA A 1 78  ? 17.033  31.043  12.095  1.00 12.16 ? 78   ALA A CA    1 
ATOM   587   C C     . ALA A 1 78  ? 17.603  30.604  10.766  1.00 13.01 ? 78   ALA A C     1 
ATOM   588   O O     . ALA A 1 78  ? 17.196  31.134  9.745   1.00 14.47 ? 78   ALA A O     1 
ATOM   589   C CB    . ALA A 1 78  ? 17.808  32.174  12.666  1.00 12.25 ? 78   ALA A CB    1 
ATOM   590   N N     . ALA A 1 79  ? 18.514  29.629  10.747  1.00 13.34 ? 79   ALA A N     1 
ATOM   591   C CA    . ALA A 1 79  ? 19.028  29.104  9.468   1.00 13.69 ? 79   ALA A CA    1 
ATOM   592   C C     . ALA A 1 79  ? 17.984  28.253  8.720   1.00 14.33 ? 79   ALA A C     1 
ATOM   593   O O     . ALA A 1 79  ? 18.019  28.159  7.487   1.00 15.04 ? 79   ALA A O     1 
ATOM   594   C CB    . ALA A 1 79  ? 20.339  28.309  9.651   1.00 12.79 ? 79   ALA A CB    1 
ATOM   595   N N     . ASN A 1 80  ? 17.083  27.610  9.457   1.00 14.45 ? 80   ASN A N     1 
ATOM   596   C CA    . ASN A 1 80  ? 15.998  26.863  8.819   1.00 14.97 ? 80   ASN A CA    1 
ATOM   597   C C     . ASN A 1 80  ? 14.885  27.760  8.264   1.00 14.65 ? 80   ASN A C     1 
ATOM   598   O O     . ASN A 1 80  ? 14.210  27.381  7.317   1.00 15.40 ? 80   ASN A O     1 
ATOM   599   C CB    . ASN A 1 80  ? 15.420  25.812  9.778   1.00 15.08 ? 80   ASN A CB    1 
ATOM   600   C CG    . ASN A 1 80  ? 16.126  24.494  9.668   1.00 16.98 ? 80   ASN A CG    1 
ATOM   601   O OD1   . ASN A 1 80  ? 15.822  23.666  8.772   1.00 16.76 ? 80   ASN A OD1   1 
ATOM   602   N ND2   . ASN A 1 80  ? 17.117  24.290  10.545  1.00 17.10 ? 80   ASN A ND2   1 
ATOM   603   N N     . CYS A 1 81  ? 14.703  28.934  8.869   1.00 14.10 ? 81   CYS A N     1 
ATOM   604   C CA    . CYS A 1 81  ? 13.673  29.903  8.491   1.00 13.22 ? 81   CYS A CA    1 
ATOM   605   C C     . CYS A 1 81  ? 14.214  31.002  7.593   1.00 13.20 ? 81   CYS A C     1 
ATOM   606   O O     . CYS A 1 81  ? 13.426  31.796  7.072   1.00 13.26 ? 81   CYS A O     1 
ATOM   607   C CB    . CYS A 1 81  ? 13.094  30.568  9.738   1.00 12.93 ? 81   CYS A CB    1 
ATOM   608   S SG    . CYS A 1 81  ? 12.090  29.508  10.784  1.00 13.42 ? 81   CYS A SG    1 
ATOM   609   N N     . LEU A 1 82  ? 15.544  31.072  7.426   1.00 12.90 ? 82   LEU A N     1 
ATOM   610   C CA    . LEU A 1 82  ? 16.162  32.099  6.557   1.00 12.75 ? 82   LEU A CA    1 
ATOM   611   C C     . LEU A 1 82  ? 17.331  31.613  5.685   1.00 13.04 ? 82   LEU A C     1 
ATOM   612   O O     . LEU A 1 82  ? 17.228  31.625  4.455   1.00 13.94 ? 82   LEU A O     1 
ATOM   613   C CB    . LEU A 1 82  ? 16.598  33.336  7.370   1.00 12.36 ? 82   LEU A CB    1 
ATOM   614   C CG    . LEU A 1 82  ? 15.616  33.947  8.375   1.00 11.08 ? 82   LEU A CG    1 
ATOM   615   C CD1   . LEU A 1 82  ? 16.356  34.688  9.489   1.00 9.84  ? 82   LEU A CD1   1 
ATOM   616   C CD2   . LEU A 1 82  ? 14.627  34.860  7.654   1.00 9.32  ? 82   LEU A CD2   1 
ATOM   617   N N     . ASP A 1 83  ? 18.441  31.204  6.304   1.00 12.80 ? 83   ASP A N     1 
ATOM   618   C CA    . ASP A 1 83  ? 19.668  30.920  5.560   1.00 12.97 ? 83   ASP A CA    1 
ATOM   619   C C     . ASP A 1 83  ? 19.482  29.934  4.420   1.00 13.22 ? 83   ASP A C     1 
ATOM   620   O O     . ASP A 1 83  ? 19.898  30.196  3.285   1.00 12.12 ? 83   ASP A O     1 
ATOM   621   C CB    . ASP A 1 83  ? 20.772  30.457  6.494   1.00 12.99 ? 83   ASP A CB    1 
ATOM   622   C CG    . ASP A 1 83  ? 21.186  31.537  7.471   1.00 13.52 ? 83   ASP A CG    1 
ATOM   623   O OD1   . ASP A 1 83  ? 22.393  31.756  7.629   1.00 13.25 ? 83   ASP A OD1   1 
ATOM   624   O OD2   . ASP A 1 83  ? 20.298  32.177  8.064   1.00 14.77 ? 83   ASP A OD2   1 
ATOM   625   N N     . ARG A 1 84  ? 18.807  28.820  4.718   1.00 13.59 ? 84   ARG A N     1 
ATOM   626   C CA    . ARG A 1 84  ? 18.662  27.737  3.741   1.00 13.48 ? 84   ARG A CA    1 
ATOM   627   C C     . ARG A 1 84  ? 17.742  28.095  2.571   1.00 14.04 ? 84   ARG A C     1 
ATOM   628   O O     . ARG A 1 84  ? 17.667  27.374  1.593   1.00 14.60 ? 84   ARG A O     1 
ATOM   629   C CB    . ARG A 1 84  ? 18.204  26.457  4.430   1.00 13.28 ? 84   ARG A CB    1 
ATOM   630   C CG    . ARG A 1 84  ? 16.786  26.477  4.985   1.00 12.62 ? 84   ARG A CG    1 
ATOM   631   C CD    . ARG A 1 84  ? 16.454  25.121  5.509   1.00 11.58 ? 84   ARG A CD    1 
ATOM   632   N NE    . ARG A 1 84  ? 15.068  25.021  5.949   1.00 12.78 ? 84   ARG A NE    1 
ATOM   633   C CZ    . ARG A 1 84  ? 14.392  23.873  6.025   1.00 10.09 ? 84   ARG A CZ    1 
ATOM   634   N NH1   . ARG A 1 84  ? 14.980  22.719  5.689   1.00 7.59  ? 84   ARG A NH1   1 
ATOM   635   N NH2   . ARG A 1 84  ? 13.134  23.889  6.446   1.00 5.48  ? 84   ARG A NH2   1 
ATOM   636   N N     . HIS A 1 85  ? 17.033  29.207  2.665   1.00 14.27 ? 85   HIS A N     1 
ATOM   637   C CA    . HIS A 1 85  ? 16.135  29.578  1.584   1.00 14.54 ? 85   HIS A CA    1 
ATOM   638   C C     . HIS A 1 85  ? 16.817  30.539  0.593   1.00 14.51 ? 85   HIS A C     1 
ATOM   639   O O     . HIS A 1 85  ? 16.310  30.775  -0.494  1.00 13.21 ? 85   HIS A O     1 
ATOM   640   C CB    . HIS A 1 85  ? 14.832  30.169  2.156   1.00 14.61 ? 85   HIS A CB    1 
ATOM   641   C CG    . HIS A 1 85  ? 14.095  29.234  3.069   1.00 15.05 ? 85   HIS A CG    1 
ATOM   642   N ND1   . HIS A 1 85  ? 13.634  27.996  2.660   1.00 15.78 ? 85   HIS A ND1   1 
ATOM   643   C CD2   . HIS A 1 85  ? 13.734  29.359  4.370   1.00 14.18 ? 85   HIS A CD2   1 
ATOM   644   C CE1   . HIS A 1 85  ? 13.025  27.402  3.674   1.00 15.94 ? 85   HIS A CE1   1 
ATOM   645   N NE2   . HIS A 1 85  ? 13.075  28.205  4.722   1.00 14.86 ? 85   HIS A NE2   1 
ATOM   646   N N     . LEU A 1 86  ? 17.963  31.083  0.998   1.00 15.14 ? 86   LEU A N     1 
ATOM   647   C CA    . LEU A 1 86  ? 18.650  32.118  0.237   1.00 16.35 ? 86   LEU A CA    1 
ATOM   648   C C     . LEU A 1 86  ? 19.158  31.677  -1.136  1.00 17.12 ? 86   LEU A C     1 
ATOM   649   O O     . LEU A 1 86  ? 18.983  32.395  -2.107  1.00 17.33 ? 86   LEU A O     1 
ATOM   650   C CB    . LEU A 1 86  ? 19.840  32.689  1.006   1.00 16.19 ? 86   LEU A CB    1 
ATOM   651   C CG    . LEU A 1 86  ? 19.614  33.502  2.263   1.00 17.61 ? 86   LEU A CG    1 
ATOM   652   C CD1   . LEU A 1 86  ? 20.991  33.916  2.733   1.00 17.45 ? 86   LEU A CD1   1 
ATOM   653   C CD2   . LEU A 1 86  ? 18.698  34.715  1.998   1.00 17.10 ? 86   LEU A CD2   1 
ATOM   654   N N     . GLN A 1 87  ? 19.793  30.516  -1.230  1.00 17.73 ? 87   GLN A N     1 
ATOM   655   C CA    . GLN A 1 87  ? 20.361  30.125  -2.510  1.00 18.38 ? 87   GLN A CA    1 
ATOM   656   C C     . GLN A 1 87  ? 19.348  30.148  -3.656  1.00 18.35 ? 87   GLN A C     1 
ATOM   657   O O     . GLN A 1 87  ? 19.621  30.721  -4.707  1.00 18.79 ? 87   GLN A O     1 
ATOM   658   C CB    . GLN A 1 87  ? 21.047  28.780  -2.420  1.00 18.66 ? 87   GLN A CB    1 
ATOM   659   C CG    . GLN A 1 87  ? 21.710  28.379  -3.704  1.00 21.20 ? 87   GLN A CG    1 
ATOM   660   C CD    . GLN A 1 87  ? 22.372  27.061  -3.559  1.00 22.50 ? 87   GLN A CD    1 
ATOM   661   O OE1   . GLN A 1 87  ? 23.390  26.946  -2.886  1.00 25.29 ? 87   GLN A OE1   1 
ATOM   662   N NE2   . GLN A 1 87  ? 21.789  26.042  -4.160  1.00 22.32 ? 87   GLN A NE2   1 
ATOM   663   N N     . GLU A 1 88  ? 18.181  29.555  -3.443  1.00 18.12 ? 88   GLU A N     1 
ATOM   664   C CA    . GLU A 1 88  ? 17.189  29.412  -4.514  1.00 18.07 ? 88   GLU A CA    1 
ATOM   665   C C     . GLU A 1 88  ? 16.024  30.395  -4.448  1.00 17.00 ? 88   GLU A C     1 
ATOM   666   O O     . GLU A 1 88  ? 15.379  30.664  -5.451  1.00 16.47 ? 88   GLU A O     1 
ATOM   667   C CB    . GLU A 1 88  ? 16.639  27.976  -4.538  1.00 18.94 ? 88   GLU A CB    1 
ATOM   668   C CG    . GLU A 1 88  ? 17.706  26.909  -4.775  1.00 21.73 ? 88   GLU A CG    1 
ATOM   669   C CD    . GLU A 1 88  ? 18.354  27.106  -6.118  1.00 26.18 ? 88   GLU A CD    1 
ATOM   670   O OE1   . GLU A 1 88  ? 19.560  27.463  -6.159  1.00 28.00 ? 88   GLU A OE1   1 
ATOM   671   O OE2   . GLU A 1 88  ? 17.628  26.954  -7.132  1.00 28.56 ? 88   GLU A OE2   1 
ATOM   672   N N     . ASN A 1 89  ? 15.737  30.911  -3.262  1.00 16.29 ? 89   ASN A N     1 
ATOM   673   C CA    . ASN A 1 89  ? 14.539  31.703  -3.074  1.00 15.71 ? 89   ASN A CA    1 
ATOM   674   C C     . ASN A 1 89  ? 14.779  32.972  -2.310  1.00 15.58 ? 89   ASN A C     1 
ATOM   675   O O     . ASN A 1 89  ? 13.849  33.528  -1.725  1.00 16.11 ? 89   ASN A O     1 
ATOM   676   C CB    . ASN A 1 89  ? 13.419  30.872  -2.428  1.00 15.03 ? 89   ASN A CB    1 
ATOM   677   C CG    . ASN A 1 89  ? 12.721  29.996  -3.442  1.00 14.84 ? 89   ASN A CG    1 
ATOM   678   O OD1   . ASN A 1 89  ? 12.993  28.793  -3.539  1.00 11.96 ? 89   ASN A OD1   1 
ATOM   679   N ND2   . ASN A 1 89  ? 11.882  30.612  -4.269  1.00 14.31 ? 89   ASN A ND2   1 
ATOM   680   N N     . GLY A 1 90  ? 16.022  33.425  -2.317  1.00 14.70 ? 90   GLY A N     1 
ATOM   681   C CA    . GLY A 1 90  ? 16.375  34.651  -1.639  1.00 14.92 ? 90   GLY A CA    1 
ATOM   682   C C     . GLY A 1 90  ? 15.516  35.817  -2.097  1.00 15.12 ? 90   GLY A C     1 
ATOM   683   O O     . GLY A 1 90  ? 15.266  36.736  -1.324  1.00 15.89 ? 90   GLY A O     1 
ATOM   684   N N     . ASP A 1 91  ? 15.033  35.783  -3.334  1.00 15.12 ? 91   ASP A N     1 
ATOM   685   C CA    . ASP A 1 91  ? 14.193  36.881  -3.840  1.00 15.26 ? 91   ASP A CA    1 
ATOM   686   C C     . ASP A 1 91  ? 12.716  36.703  -3.631  1.00 14.78 ? 91   ASP A C     1 
ATOM   687   O O     . ASP A 1 91  ? 11.964  37.571  -3.990  1.00 14.55 ? 91   ASP A O     1 
ATOM   688   C CB    . ASP A 1 91  ? 14.433  37.084  -5.320  1.00 15.14 ? 91   ASP A CB    1 
ATOM   689   C CG    . ASP A 1 91  ? 15.811  37.527  -5.592  1.00 17.12 ? 91   ASP A CG    1 
ATOM   690   O OD1   . ASP A 1 91  ? 16.469  38.063  -4.650  1.00 21.38 ? 91   ASP A OD1   1 
ATOM   691   O OD2   . ASP A 1 91  ? 16.248  37.342  -6.737  1.00 19.40 ? 91   ASP A OD2   1 
ATOM   692   N N     . ARG A 1 92  ? 12.298  35.562  -3.095  1.00 15.06 ? 92   ARG A N     1 
ATOM   693   C CA    . ARG A 1 92  ? 10.893  35.347  -2.766  1.00 15.17 ? 92   ARG A CA    1 
ATOM   694   C C     . ARG A 1 92  ? 10.550  36.214  -1.551  1.00 14.47 ? 92   ARG A C     1 
ATOM   695   O O     . ARG A 1 92  ? 11.403  36.422  -0.660  1.00 13.30 ? 92   ARG A O     1 
ATOM   696   C CB    . ARG A 1 92  ? 10.630  33.874  -2.478  1.00 15.62 ? 92   ARG A CB    1 
ATOM   697   C CG    . ARG A 1 92  ? 9.163   33.477  -2.520  1.00 18.66 ? 92   ARG A CG    1 
ATOM   698   C CD    . ARG A 1 92  ? 8.961   32.063  -2.002  1.00 21.25 ? 92   ARG A CD    1 
ATOM   699   N NE    . ARG A 1 92  ? 8.973   31.035  -3.046  1.00 25.84 ? 92   ARG A NE    1 
ATOM   700   C CZ    . ARG A 1 92  ? 9.267   29.736  -2.825  1.00 29.68 ? 92   ARG A CZ    1 
ATOM   701   N NH1   . ARG A 1 92  ? 9.614   29.301  -1.605  1.00 28.78 ? 92   ARG A NH1   1 
ATOM   702   N NH2   . ARG A 1 92  ? 9.247   28.855  -3.829  1.00 28.57 ? 92   ARG A NH2   1 
ATOM   703   N N     . THR A 1 93  ? 9.333   36.774  -1.557  1.00 13.54 ? 93   THR A N     1 
ATOM   704   C CA    . THR A 1 93  ? 8.860   37.554  -0.421  1.00 12.50 ? 93   THR A CA    1 
ATOM   705   C C     . THR A 1 93  ? 8.711   36.613  0.777   1.00 12.68 ? 93   THR A C     1 
ATOM   706   O O     . THR A 1 93  ? 7.991   35.601  0.700   1.00 11.91 ? 93   THR A O     1 
ATOM   707   C CB    . THR A 1 93  ? 7.502   38.220  -0.671  1.00 12.26 ? 93   THR A CB    1 
ATOM   708   O OG1   . THR A 1 93  ? 7.559   39.048  -1.832  1.00 10.18 ? 93   THR A OG1   1 
ATOM   709   C CG2   . THR A 1 93  ? 7.097   39.051  0.558   1.00 11.57 ? 93   THR A CG2   1 
ATOM   710   N N     . ALA A 1 94  ? 9.402   36.961  1.869   1.00 12.61 ? 94   ALA A N     1 
ATOM   711   C CA    . ALA A 1 94  ? 9.309   36.232  3.118   1.00 12.13 ? 94   ALA A CA    1 
ATOM   712   C C     . ALA A 1 94  ? 8.113   36.743  3.930   1.00 12.19 ? 94   ALA A C     1 
ATOM   713   O O     . ALA A 1 94  ? 7.325   35.951  4.466   1.00 12.03 ? 94   ALA A O     1 
ATOM   714   C CB    . ALA A 1 94  ? 10.595  36.380  3.894   1.00 11.98 ? 94   ALA A CB    1 
ATOM   715   N N     . ILE A 1 95  ? 7.974   38.071  4.008   1.00 12.08 ? 95   ILE A N     1 
ATOM   716   C CA    . ILE A 1 95  ? 6.899   38.706  4.751   1.00 11.51 ? 95   ILE A CA    1 
ATOM   717   C C     . ILE A 1 95  ? 6.306   39.806  3.932   1.00 11.57 ? 95   ILE A C     1 
ATOM   718   O O     . ILE A 1 95  ? 7.032   40.677  3.456   1.00 12.34 ? 95   ILE A O     1 
ATOM   719   C CB    . ILE A 1 95  ? 7.371   39.295  6.099   1.00 11.55 ? 95   ILE A CB    1 
ATOM   720   C CG1   . ILE A 1 95  ? 7.732   38.170  7.063   1.00 12.21 ? 95   ILE A CG1   1 
ATOM   721   C CG2   . ILE A 1 95  ? 6.265   40.147  6.750   1.00 10.39 ? 95   ILE A CG2   1 
ATOM   722   C CD1   . ILE A 1 95  ? 8.518   38.629  8.309   1.00 11.90 ? 95   ILE A CD1   1 
ATOM   723   N N     . ILE A 1 96  ? 4.984   39.748  3.742   1.00 11.80 ? 96   ILE A N     1 
ATOM   724   C CA    . ILE A 1 96  ? 4.208   40.896  3.246   1.00 11.17 ? 96   ILE A CA    1 
ATOM   725   C C     . ILE A 1 96  ? 3.704   41.640  4.464   1.00 11.10 ? 96   ILE A C     1 
ATOM   726   O O     . ILE A 1 96  ? 3.033   41.055  5.320   1.00 11.08 ? 96   ILE A O     1 
ATOM   727   C CB    . ILE A 1 96  ? 2.971   40.481  2.435   1.00 11.10 ? 96   ILE A CB    1 
ATOM   728   C CG1   . ILE A 1 96  ? 3.364   39.706  1.183   1.00 9.15  ? 96   ILE A CG1   1 
ATOM   729   C CG2   . ILE A 1 96  ? 2.101   41.724  2.113   1.00 11.09 ? 96   ILE A CG2   1 
ATOM   730   C CD1   . ILE A 1 96  ? 2.180   39.299  0.348   1.00 7.75  ? 96   ILE A CD1   1 
ATOM   731   N N     . TRP A 1 97  ? 4.061   42.912  4.578   1.00 10.77 ? 97   TRP A N     1 
ATOM   732   C CA    . TRP A 1 97  ? 3.572   43.703  5.687   1.00 9.56  ? 97   TRP A CA    1 
ATOM   733   C C     . TRP A 1 97  ? 2.553   44.708  5.188   1.00 10.17 ? 97   TRP A C     1 
ATOM   734   O O     . TRP A 1 97  ? 2.827   45.523  4.255   1.00 10.11 ? 97   TRP A O     1 
ATOM   735   C CB    . TRP A 1 97  ? 4.713   44.359  6.448   1.00 9.27  ? 97   TRP A CB    1 
ATOM   736   C CG    . TRP A 1 97  ? 4.233   45.254  7.590   1.00 9.24  ? 97   TRP A CG    1 
ATOM   737   C CD1   . TRP A 1 97  ? 3.798   44.849  8.809   1.00 7.93  ? 97   TRP A CD1   1 
ATOM   738   C CD2   . TRP A 1 97  ? 4.120   46.680  7.582   1.00 7.65  ? 97   TRP A CD2   1 
ATOM   739   N NE1   . TRP A 1 97  ? 3.439   45.919  9.571   1.00 8.31  ? 97   TRP A NE1   1 
ATOM   740   C CE2   . TRP A 1 97  ? 3.616   47.063  8.846   1.00 8.74  ? 97   TRP A CE2   1 
ATOM   741   C CE3   . TRP A 1 97  ? 4.408   47.675  6.635   1.00 8.48  ? 97   TRP A CE3   1 
ATOM   742   C CZ2   . TRP A 1 97  ? 3.404   48.408  9.208   1.00 8.15  ? 97   TRP A CZ2   1 
ATOM   743   C CZ3   . TRP A 1 97  ? 4.172   49.036  6.979   1.00 8.50  ? 97   TRP A CZ3   1 
ATOM   744   C CH2   . TRP A 1 97  ? 3.691   49.382  8.263   1.00 7.80  ? 97   TRP A CH2   1 
ATOM   745   N N     . GLU A 1 98  ? 1.359   44.618  5.784   1.00 10.33 ? 98   GLU A N     1 
ATOM   746   C CA    . GLU A 1 98  ? 0.235   45.509  5.460   1.00 10.76 ? 98   GLU A CA    1 
ATOM   747   C C     . GLU A 1 98  ? -0.067  46.382  6.677   1.00 11.17 ? 98   GLU A C     1 
ATOM   748   O O     . GLU A 1 98  ? -0.446  45.867  7.744   1.00 10.72 ? 98   GLU A O     1 
ATOM   749   C CB    . GLU A 1 98  ? -1.018  44.705  5.052   1.00 10.81 ? 98   GLU A CB    1 
ATOM   750   C CG    . GLU A 1 98  ? -2.331  45.551  4.935   1.00 10.63 ? 98   GLU A CG    1 
ATOM   751   C CD    . GLU A 1 98  ? -2.450  46.331  3.609   1.00 11.86 ? 98   GLU A CD    1 
ATOM   752   O OE1   . GLU A 1 98  ? -1.556  46.229  2.733   1.00 10.59 ? 98   GLU A OE1   1 
ATOM   753   O OE2   . GLU A 1 98  ? -3.459  47.056  3.431   1.00 13.89 ? 98   GLU A OE2   1 
ATOM   754   N N     . GLY A 1 99  ? 0.087   47.698  6.509   1.00 11.63 ? 99   GLY A N     1 
ATOM   755   C CA    . GLY A 1 99  ? -0.126  48.647  7.615   1.00 11.32 ? 99   GLY A CA    1 
ATOM   756   C C     . GLY A 1 99  ? -1.596  48.875  7.928   1.00 11.40 ? 99   GLY A C     1 
ATOM   757   O O     . GLY A 1 99  ? -2.473  48.589  7.094   1.00 10.70 ? 99   GLY A O     1 
ATOM   758   N N     . ASP A 1 100 ? -1.859  49.354  9.144   1.00 11.43 ? 100  ASP A N     1 
ATOM   759   C CA    . ASP A 1 100 ? -3.167  49.869  9.512   1.00 12.13 ? 100  ASP A CA    1 
ATOM   760   C C     . ASP A 1 100 ? -3.748  50.797  8.438   1.00 12.33 ? 100  ASP A C     1 
ATOM   761   O O     . ASP A 1 100 ? -4.891  50.678  8.028   1.00 12.15 ? 100  ASP A O     1 
ATOM   762   C CB    . ASP A 1 100 ? -3.061  50.660  10.798  1.00 12.25 ? 100  ASP A CB    1 
ATOM   763   C CG    . ASP A 1 100 ? -4.393  50.767  11.517  1.00 12.44 ? 100  ASP A CG    1 
ATOM   764   O OD1   . ASP A 1 100 ? -5.021  49.724  11.757  1.00 14.70 ? 100  ASP A OD1   1 
ATOM   765   O OD2   . ASP A 1 100 ? -4.802  51.883  11.869  1.00 13.75 ? 100  ASP A OD2   1 
ATOM   766   N N     . ASP A 1 101 ? -2.927  51.740  8.027   1.00 12.92 ? 101  ASP A N     1 
ATOM   767   C CA    . ASP A 1 101 ? -3.133  52.585  6.871   1.00 13.64 ? 101  ASP A CA    1 
ATOM   768   C C     . ASP A 1 101 ? -2.698  51.756  5.638   1.00 13.31 ? 101  ASP A C     1 
ATOM   769   O O     . ASP A 1 101 ? -1.518  51.425  5.506   1.00 12.63 ? 101  ASP A O     1 
ATOM   770   C CB    . ASP A 1 101 ? -2.228  53.800  7.059   1.00 13.98 ? 101  ASP A CB    1 
ATOM   771   C CG    . ASP A 1 101 ? -2.385  54.828  5.993   1.00 17.04 ? 101  ASP A CG    1 
ATOM   772   O OD1   . ASP A 1 101 ? -2.603  54.476  4.808   1.00 18.56 ? 101  ASP A OD1   1 
ATOM   773   O OD2   . ASP A 1 101 ? -2.229  56.013  6.352   1.00 20.34 ? 101  ASP A OD2   1 
ATOM   774   N N     . THR A 1 102 ? -3.653  51.414  4.761   1.00 12.81 ? 102  THR A N     1 
ATOM   775   C CA    . THR A 1 102 ? -3.380  50.563  3.592   1.00 12.30 ? 102  THR A CA    1 
ATOM   776   C C     . THR A 1 102 ? -2.391  51.166  2.571   1.00 12.96 ? 102  THR A C     1 
ATOM   777   O O     . THR A 1 102 ? -1.898  50.446  1.715   1.00 14.23 ? 102  THR A O     1 
ATOM   778   C CB    . THR A 1 102 ? -4.704  50.054  2.849   1.00 12.78 ? 102  THR A CB    1 
ATOM   779   O OG1   . THR A 1 102 ? -4.376  48.964  1.976   1.00 12.12 ? 102  THR A OG1   1 
ATOM   780   C CG2   . THR A 1 102 ? -5.420  51.174  2.032   1.00 7.79  ? 102  THR A CG2   1 
ATOM   781   N N     . SER A 1 103 ? -2.087  52.455  2.657   1.00 12.51 ? 103  SER A N     1 
ATOM   782   C CA    . SER A 1 103 ? -1.102  53.045  1.752   1.00 12.94 ? 103  SER A CA    1 
ATOM   783   C C     . SER A 1 103 ? 0.318   52.668  2.167   1.00 13.44 ? 103  SER A C     1 
ATOM   784   O O     . SER A 1 103 ? 1.287   52.937  1.447   1.00 13.82 ? 103  SER A O     1 
ATOM   785   C CB    . SER A 1 103 ? -1.248  54.573  1.686   1.00 12.42 ? 103  SER A CB    1 
ATOM   786   O OG    . SER A 1 103 ? -1.029  55.140  2.965   1.00 12.36 ? 103  SER A OG    1 
ATOM   787   N N     . GLN A 1 104 ? 0.440   52.048  3.329   1.00 13.71 ? 104  GLN A N     1 
ATOM   788   C CA    . GLN A 1 104 ? 1.731   51.635  3.825   1.00 15.05 ? 104  GLN A CA    1 
ATOM   789   C C     . GLN A 1 104 ? 1.839   50.126  3.758   1.00 15.46 ? 104  GLN A C     1 
ATOM   790   O O     . GLN A 1 104 ? 1.074   49.409  4.435   1.00 16.41 ? 104  GLN A O     1 
ATOM   791   C CB    . GLN A 1 104 ? 1.933   52.123  5.260   1.00 14.00 ? 104  GLN A CB    1 
ATOM   792   C CG    . GLN A 1 104 ? 2.043   53.646  5.391   1.00 15.69 ? 104  GLN A CG    1 
ATOM   793   C CD    . GLN A 1 104 ? 2.466   54.114  6.798   1.00 17.76 ? 104  GLN A CD    1 
ATOM   794   O OE1   . GLN A 1 104 ? 2.309   53.400  7.809   1.00 20.74 ? 104  GLN A OE1   1 
ATOM   795   N NE2   . GLN A 1 104 ? 3.014   55.325  6.863   1.00 20.06 ? 104  GLN A NE2   1 
ATOM   796   N N     . SER A 1 105 ? 2.781   49.644  2.949   1.00 15.45 ? 105  SER A N     1 
ATOM   797   C CA    . SER A 1 105 ? 3.107   48.220  2.901   1.00 15.66 ? 105  SER A CA    1 
ATOM   798   C C     . SER A 1 105 ? 4.557   47.934  2.506   1.00 15.90 ? 105  SER A C     1 
ATOM   799   O O     . SER A 1 105 ? 5.301   48.827  2.117   1.00 15.56 ? 105  SER A O     1 
ATOM   800   C CB    . SER A 1 105 ? 2.180   47.490  1.948   1.00 15.84 ? 105  SER A CB    1 
ATOM   801   O OG    . SER A 1 105 ? 2.435   47.943  0.657   1.00 14.33 ? 105  SER A OG    1 
ATOM   802   N N     . LYS A 1 106 ? 4.945   46.668  2.644   1.00 16.35 ? 106  LYS A N     1 
ATOM   803   C CA    . LYS A 1 106 ? 6.301   46.210  2.343   1.00 16.64 ? 106  LYS A CA    1 
ATOM   804   C C     . LYS A 1 106 ? 6.274   44.775  1.872   1.00 16.25 ? 106  LYS A C     1 
ATOM   805   O O     . LYS A 1 106 ? 5.473   43.956  2.342   1.00 15.64 ? 106  LYS A O     1 
ATOM   806   C CB    . LYS A 1 106 ? 7.200   46.250  3.585   1.00 16.74 ? 106  LYS A CB    1 
ATOM   807   C CG    . LYS A 1 106 ? 7.667   47.595  3.995   1.00 18.00 ? 106  LYS A CG    1 
ATOM   808   C CD    . LYS A 1 106 ? 8.754   47.512  5.058   1.00 21.64 ? 106  LYS A CD    1 
ATOM   809   C CE    . LYS A 1 106 ? 9.293   48.926  5.358   1.00 24.76 ? 106  LYS A CE    1 
ATOM   810   N NZ    . LYS A 1 106 ? 9.939   49.041  6.694   1.00 27.23 ? 106  LYS A NZ    1 
ATOM   811   N N     . HIS A 1 107 ? 7.167   44.470  0.946   1.00 16.29 ? 107  HIS A N     1 
ATOM   812   C CA    . HIS A 1 107 ? 7.513   43.088  0.674   1.00 16.11 ? 107  HIS A CA    1 
ATOM   813   C C     . HIS A 1 107 ? 8.928   42.981  1.140   1.00 15.67 ? 107  HIS A C     1 
ATOM   814   O O     . HIS A 1 107 ? 9.800   43.742  0.684   1.00 15.38 ? 107  HIS A O     1 
ATOM   815   C CB    . HIS A 1 107 ? 7.358   42.748  -0.800  1.00 15.90 ? 107  HIS A CB    1 
ATOM   816   C CG    . HIS A 1 107 ? 5.930   42.742  -1.251  1.00 18.71 ? 107  HIS A CG    1 
ATOM   817   N ND1   . HIS A 1 107 ? 5.186   43.899  -1.377  1.00 19.56 ? 107  HIS A ND1   1 
ATOM   818   C CD2   . HIS A 1 107 ? 5.095   41.719  -1.571  1.00 19.15 ? 107  HIS A CD2   1 
ATOM   819   C CE1   . HIS A 1 107 ? 3.960   43.591  -1.766  1.00 20.29 ? 107  HIS A CE1   1 
ATOM   820   N NE2   . HIS A 1 107 ? 3.879   42.275  -1.894  1.00 19.34 ? 107  HIS A NE2   1 
ATOM   821   N N     . ILE A 1 108 ? 9.141   42.092  2.106   1.00 15.14 ? 108  ILE A N     1 
ATOM   822   C CA    . ILE A 1 108 ? 10.469  41.828  2.561   1.00 14.82 ? 108  ILE A CA    1 
ATOM   823   C C     . ILE A 1 108 ? 10.878  40.454  2.056   1.00 15.42 ? 108  ILE A C     1 
ATOM   824   O O     . ILE A 1 108 ? 10.347  39.416  2.502   1.00 15.69 ? 108  ILE A O     1 
ATOM   825   C CB    . ILE A 1 108 ? 10.595  41.939  4.071   1.00 15.15 ? 108  ILE A CB    1 
ATOM   826   C CG1   . ILE A 1 108 ? 10.302  43.367  4.528   1.00 14.64 ? 108  ILE A CG1   1 
ATOM   827   C CG2   . ILE A 1 108 ? 12.030  41.589  4.545   1.00 14.51 ? 108  ILE A CG2   1 
ATOM   828   C CD1   . ILE A 1 108 ? 9.695   43.400  5.913   1.00 14.86 ? 108  ILE A CD1   1 
ATOM   829   N N     . SER A 1 109 ? 11.826  40.467  1.116   1.00 15.10 ? 109  SER A N     1 
ATOM   830   C CA    . SER A 1 109 ? 12.443  39.252  0.568   1.00 14.41 ? 109  SER A CA    1 
ATOM   831   C C     . SER A 1 109 ? 13.200  38.527  1.664   1.00 14.15 ? 109  SER A C     1 
ATOM   832   O O     . SER A 1 109 ? 13.667  39.171  2.613   1.00 13.28 ? 109  SER A O     1 
ATOM   833   C CB    . SER A 1 109 ? 13.411  39.601  -0.577  1.00 14.08 ? 109  SER A CB    1 
ATOM   834   O OG    . SER A 1 109 ? 14.734  39.801  -0.104  1.00 13.59 ? 109  SER A OG    1 
ATOM   835   N N     . TYR A 1 110 ? 13.305  37.198  1.516   1.00 14.09 ? 110  TYR A N     1 
ATOM   836   C CA    . TYR A 1 110 ? 14.142  36.326  2.362   1.00 14.07 ? 110  TYR A CA    1 
ATOM   837   C C     . TYR A 1 110 ? 15.574  36.840  2.531   1.00 15.42 ? 110  TYR A C     1 
ATOM   838   O O     . TYR A 1 110 ? 16.119  36.817  3.650   1.00 15.00 ? 110  TYR A O     1 
ATOM   839   C CB    . TYR A 1 110 ? 14.156  34.888  1.818   1.00 12.92 ? 110  TYR A CB    1 
ATOM   840   C CG    . TYR A 1 110 ? 13.013  34.064  2.329   1.00 10.65 ? 110  TYR A CG    1 
ATOM   841   C CD1   . TYR A 1 110 ? 11.826  33.960  1.601   1.00 10.16 ? 110  TYR A CD1   1 
ATOM   842   C CD2   . TYR A 1 110 ? 13.103  33.411  3.544   1.00 6.87  ? 110  TYR A CD2   1 
ATOM   843   C CE1   . TYR A 1 110 ? 10.754  33.226  2.075   1.00 10.01 ? 110  TYR A CE1   1 
ATOM   844   C CE2   . TYR A 1 110 ? 12.052  32.658  4.025   1.00 8.27  ? 110  TYR A CE2   1 
ATOM   845   C CZ    . TYR A 1 110 ? 10.867  32.576  3.294   1.00 9.98  ? 110  TYR A CZ    1 
ATOM   846   O OH    . TYR A 1 110 ? 9.816   31.830  3.769   1.00 8.16  ? 110  TYR A OH    1 
ATOM   847   N N     . ARG A 1 111 ? 16.160  37.316  1.433   1.00 16.62 ? 111  ARG A N     1 
ATOM   848   C CA    . ARG A 1 111 ? 17.437  38.024  1.501   1.00 19.74 ? 111  ARG A CA    1 
ATOM   849   C C     . ARG A 1 111 ? 17.375  39.222  2.449   1.00 19.31 ? 111  ARG A C     1 
ATOM   850   O O     . ARG A 1 111 ? 18.150  39.263  3.415   1.00 20.16 ? 111  ARG A O     1 
ATOM   851   C CB    . ARG A 1 111 ? 17.972  38.432  0.103   1.00 19.73 ? 111  ARG A CB    1 
ATOM   852   C CG    . ARG A 1 111 ? 19.405  39.008  0.117   1.00 22.02 ? 111  ARG A CG    1 
ATOM   853   C CD    . ARG A 1 111 ? 20.066  38.987  -1.281  1.00 23.67 ? 111  ARG A CD    1 
ATOM   854   N NE    . ARG A 1 111 ? 20.333  37.605  -1.721  1.00 31.71 ? 111  ARG A NE    1 
ATOM   855   C CZ    . ARG A 1 111 ? 19.641  36.953  -2.662  1.00 32.87 ? 111  ARG A CZ    1 
ATOM   856   N NH1   . ARG A 1 111 ? 18.638  37.559  -3.313  1.00 31.65 ? 111  ARG A NH1   1 
ATOM   857   N NH2   . ARG A 1 111 ? 19.961  35.692  -2.950  1.00 31.04 ? 111  ARG A NH2   1 
ATOM   858   N N     . GLU A 1 112 ? 16.465  40.171  2.202   1.00 18.92 ? 112  GLU A N     1 
ATOM   859   C CA    . GLU A 1 112 ? 16.364  41.355  3.072   1.00 19.77 ? 112  GLU A CA    1 
ATOM   860   C C     . GLU A 1 112 ? 16.183  40.964  4.542   1.00 18.69 ? 112  GLU A C     1 
ATOM   861   O O     . GLU A 1 112 ? 16.747  41.589  5.442   1.00 19.15 ? 112  GLU A O     1 
ATOM   862   C CB    . GLU A 1 112 ? 15.243  42.293  2.639   1.00 19.38 ? 112  GLU A CB    1 
ATOM   863   C CG    . GLU A 1 112 ? 15.358  42.693  1.162   1.00 22.72 ? 112  GLU A CG    1 
ATOM   864   C CD    . GLU A 1 112 ? 14.037  43.186  0.523   1.00 22.86 ? 112  GLU A CD    1 
ATOM   865   O OE1   . GLU A 1 112 ? 12.920  42.943  1.047   1.00 24.85 ? 112  GLU A OE1   1 
ATOM   866   O OE2   . GLU A 1 112 ? 14.136  43.839  -0.537  1.00 27.54 ? 112  GLU A OE2   1 
ATOM   867   N N     . LEU A 1 113 ? 15.415  39.914  4.777   1.00 17.36 ? 113  LEU A N     1 
ATOM   868   C CA    . LEU A 1 113 ? 15.056  39.565  6.117   1.00 16.31 ? 113  LEU A CA    1 
ATOM   869   C C     . LEU A 1 113 ? 16.259  38.930  6.826   1.00 16.77 ? 113  LEU A C     1 
ATOM   870   O O     . LEU A 1 113 ? 16.523  39.193  8.002   1.00 16.07 ? 113  LEU A O     1 
ATOM   871   C CB    . LEU A 1 113 ? 13.845  38.638  6.094   1.00 15.83 ? 113  LEU A CB    1 
ATOM   872   C CG    . LEU A 1 113 ? 13.345  38.133  7.447   1.00 14.42 ? 113  LEU A CG    1 
ATOM   873   C CD1   . LEU A 1 113 ? 13.045  39.282  8.403   1.00 10.07 ? 113  LEU A CD1   1 
ATOM   874   C CD2   . LEU A 1 113 ? 12.140  37.221  7.265   1.00 14.65 ? 113  LEU A CD2   1 
ATOM   875   N N     . HIS A 1 114 ? 16.988  38.110  6.083   1.00 16.88 ? 114  HIS A N     1 
ATOM   876   C CA    . HIS A 1 114 ? 18.177  37.448  6.594   1.00 17.09 ? 114  HIS A CA    1 
ATOM   877   C C     . HIS A 1 114 ? 19.202  38.500  7.001   1.00 16.63 ? 114  HIS A C     1 
ATOM   878   O O     . HIS A 1 114 ? 19.700  38.494  8.131   1.00 16.29 ? 114  HIS A O     1 
ATOM   879   C CB    . HIS A 1 114 ? 18.734  36.513  5.509   1.00 16.98 ? 114  HIS A CB    1 
ATOM   880   C CG    . HIS A 1 114 ? 20.072  35.936  5.829   1.00 18.28 ? 114  HIS A CG    1 
ATOM   881   N ND1   . HIS A 1 114 ? 21.247  36.456  5.326   1.00 19.13 ? 114  HIS A ND1   1 
ATOM   882   C CD2   . HIS A 1 114 ? 20.427  34.870  6.587   1.00 19.79 ? 114  HIS A CD2   1 
ATOM   883   C CE1   . HIS A 1 114 ? 22.265  35.724  5.740   1.00 18.14 ? 114  HIS A CE1   1 
ATOM   884   N NE2   . HIS A 1 114 ? 21.795  34.755  6.506   1.00 20.64 ? 114  HIS A NE2   1 
ATOM   885   N N     . ARG A 1 115 ? 19.481  39.411  6.072   1.00 16.46 ? 115  ARG A N     1 
ATOM   886   C CA    . ARG A 1 115 ? 20.422  40.505  6.294   1.00 16.83 ? 115  ARG A CA    1 
ATOM   887   C C     . ARG A 1 115 ? 20.105  41.244  7.586   1.00 15.82 ? 115  ARG A C     1 
ATOM   888   O O     . ARG A 1 115 ? 21.021  41.561  8.353   1.00 16.16 ? 115  ARG A O     1 
ATOM   889   C CB    . ARG A 1 115 ? 20.434  41.472  5.100   1.00 16.54 ? 115  ARG A CB    1 
ATOM   890   C CG    . ARG A 1 115 ? 21.506  42.549  5.151   1.00 17.85 ? 115  ARG A CG    1 
ATOM   891   C CD    . ARG A 1 115 ? 21.642  43.248  3.803   1.00 20.05 ? 115  ARG A CD    1 
ATOM   892   N NE    . ARG A 1 115 ? 22.857  44.069  3.658   1.00 29.05 ? 115  ARG A NE    1 
ATOM   893   C CZ    . ARG A 1 115 ? 24.099  43.607  3.392   1.00 33.78 ? 115  ARG A CZ    1 
ATOM   894   N NH1   . ARG A 1 115 ? 24.367  42.289  3.281   1.00 33.03 ? 115  ARG A NH1   1 
ATOM   895   N NH2   . ARG A 1 115 ? 25.108  44.479  3.262   1.00 35.46 ? 115  ARG A NH2   1 
ATOM   896   N N     . ASP A 1 116 ? 18.829  41.508  7.840   1.00 14.90 ? 116  ASP A N     1 
ATOM   897   C CA    . ASP A 1 116 ? 18.465  42.255  9.029   1.00 14.98 ? 116  ASP A CA    1 
ATOM   898   C C     . ASP A 1 116 ? 18.583  41.451  10.295  1.00 14.56 ? 116  ASP A C     1 
ATOM   899   O O     . ASP A 1 116 ? 19.027  41.964  11.323  1.00 15.60 ? 116  ASP A O     1 
ATOM   900   C CB    . ASP A 1 116 ? 17.073  42.867  8.922   1.00 15.55 ? 116  ASP A CB    1 
ATOM   901   C CG    . ASP A 1 116 ? 17.090  44.208  8.238   1.00 16.63 ? 116  ASP A CG    1 
ATOM   902   O OD1   . ASP A 1 116 ? 18.194  44.793  8.058   1.00 19.64 ? 116  ASP A OD1   1 
ATOM   903   O OD2   . ASP A 1 116 ? 16.006  44.678  7.871   1.00 15.78 ? 116  ASP A OD2   1 
ATOM   904   N N     . VAL A 1 117 ? 18.200  40.188  10.227  1.00 13.53 ? 117  VAL A N     1 
ATOM   905   C CA    . VAL A 1 117 ? 18.391  39.283  11.346  1.00 12.71 ? 117  VAL A CA    1 
ATOM   906   C C     . VAL A 1 117 ? 19.876  39.153  11.727  1.00 13.15 ? 117  VAL A C     1 
ATOM   907   O O     . VAL A 1 117 ? 20.220  39.064  12.917  1.00 13.09 ? 117  VAL A O     1 
ATOM   908   C CB    . VAL A 1 117 ? 17.751  37.917  11.048  1.00 12.64 ? 117  VAL A CB    1 
ATOM   909   C CG1   . VAL A 1 117 ? 18.099  36.901  12.126  1.00 11.59 ? 117  VAL A CG1   1 
ATOM   910   C CG2   . VAL A 1 117 ? 16.212  38.084  10.928  1.00 11.39 ? 117  VAL A CG2   1 
ATOM   911   N N     . CYS A 1 118 ? 20.751  39.154  10.725  1.00 12.82 ? 118  CYS A N     1 
ATOM   912   C CA    . CYS A 1 118 ? 22.171  39.079  10.990  1.00 13.06 ? 118  CYS A CA    1 
ATOM   913   C C     . CYS A 1 118 ? 22.678  40.334  11.678  1.00 12.88 ? 118  CYS A C     1 
ATOM   914   O O     . CYS A 1 118 ? 23.448  40.241  12.632  1.00 12.31 ? 118  CYS A O     1 
ATOM   915   C CB    . CYS A 1 118 ? 22.961  38.796  9.703   1.00 13.41 ? 118  CYS A CB    1 
ATOM   916   S SG    . CYS A 1 118 ? 22.656  37.113  9.076   1.00 13.59 ? 118  CYS A SG    1 
ATOM   917   N N     . ARG A 1 119 ? 22.234  41.495  11.194  1.00 12.85 ? 119  ARG A N     1 
ATOM   918   C CA    . ARG A 1 119 ? 22.632  42.770  11.766  1.00 12.73 ? 119  ARG A CA    1 
ATOM   919   C C     . ARG A 1 119 ? 22.101  42.823  13.173  1.00 12.61 ? 119  ARG A C     1 
ATOM   920   O O     . ARG A 1 119 ? 22.825  43.218  14.089  1.00 13.20 ? 119  ARG A O     1 
ATOM   921   C CB    . ARG A 1 119 ? 22.105  43.971  10.974  1.00 12.97 ? 119  ARG A CB    1 
ATOM   922   C CG    . ARG A 1 119 ? 22.556  44.056  9.546   1.00 14.96 ? 119  ARG A CG    1 
ATOM   923   C CD    . ARG A 1 119 ? 22.560  45.485  9.027   1.00 18.32 ? 119  ARG A CD    1 
ATOM   924   N NE    . ARG A 1 119 ? 21.211  46.004  8.802   1.00 20.84 ? 119  ARG A NE    1 
ATOM   925   C CZ    . ARG A 1 119 ? 20.918  47.279  8.511   1.00 22.07 ? 119  ARG A CZ    1 
ATOM   926   N NH1   . ARG A 1 119 ? 21.882  48.190  8.415   1.00 21.94 ? 119  ARG A NH1   1 
ATOM   927   N NH2   . ARG A 1 119 ? 19.648  47.653  8.321   1.00 20.91 ? 119  ARG A NH2   1 
ATOM   928   N N     . PHE A 1 120 ? 20.849  42.399  13.364  1.00 12.60 ? 120  PHE A N     1 
ATOM   929   C CA    . PHE A 1 120 ? 20.272  42.426  14.702  1.00 11.87 ? 120  PHE A CA    1 
ATOM   930   C C     . PHE A 1 120 ? 20.851  41.383  15.654  1.00 11.92 ? 120  PHE A C     1 
ATOM   931   O O     . PHE A 1 120 ? 20.915  41.616  16.866  1.00 11.95 ? 120  PHE A O     1 
ATOM   932   C CB    . PHE A 1 120 ? 18.746  42.425  14.682  1.00 11.80 ? 120  PHE A CB    1 
ATOM   933   C CG    . PHE A 1 120 ? 18.135  43.015  15.930  1.00 10.34 ? 120  PHE A CG    1 
ATOM   934   C CD1   . PHE A 1 120 ? 18.164  44.395  16.148  1.00 11.58 ? 120  PHE A CD1   1 
ATOM   935   C CD2   . PHE A 1 120 ? 17.569  42.191  16.901  1.00 8.46  ? 120  PHE A CD2   1 
ATOM   936   C CE1   . PHE A 1 120 ? 17.624  44.946  17.316  1.00 10.35 ? 120  PHE A CE1   1 
ATOM   937   C CE2   . PHE A 1 120 ? 17.033  42.711  18.044  1.00 7.93  ? 120  PHE A CE2   1 
ATOM   938   C CZ    . PHE A 1 120 ? 17.062  44.094  18.263  1.00 10.27 ? 120  PHE A CZ    1 
ATOM   939   N N     . ALA A 1 121 ? 21.296  40.254  15.117  1.00 12.13 ? 121  ALA A N     1 
ATOM   940   C CA    . ALA A 1 121 ? 22.005  39.261  15.931  1.00 13.08 ? 121  ALA A CA    1 
ATOM   941   C C     . ALA A 1 121 ? 23.328  39.850  16.479  1.00 13.67 ? 121  ALA A C     1 
ATOM   942   O O     . ALA A 1 121 ? 23.623  39.793  17.683  1.00 13.68 ? 121  ALA A O     1 
ATOM   943   C CB    . ALA A 1 121 ? 22.258  37.976  15.140  1.00 12.20 ? 121  ALA A CB    1 
ATOM   944   N N     . ASN A 1 122 ? 24.117  40.429  15.586  1.00 14.45 ? 122  ASN A N     1 
ATOM   945   C CA    . ASN A 1 122 ? 25.319  41.156  15.999  1.00 14.63 ? 122  ASN A CA    1 
ATOM   946   C C     . ASN A 1 122 ? 24.994  42.244  17.024  1.00 15.32 ? 122  ASN A C     1 
ATOM   947   O O     . ASN A 1 122 ? 25.742  42.383  17.983  1.00 16.03 ? 122  ASN A O     1 
ATOM   948   C CB    . ASN A 1 122 ? 26.078  41.709  14.787  1.00 13.79 ? 122  ASN A CB    1 
ATOM   949   C CG    . ASN A 1 122 ? 26.830  40.620  14.033  1.00 13.58 ? 122  ASN A CG    1 
ATOM   950   O OD1   . ASN A 1 122 ? 27.407  39.728  14.654  1.00 12.57 ? 122  ASN A OD1   1 
ATOM   951   N ND2   . ASN A 1 122 ? 26.836  40.690  12.691  1.00 11.99 ? 122  ASN A ND2   1 
ATOM   952   N N     . THR A 1 123 ? 23.879  42.974  16.849  1.00 15.32 ? 123  THR A N     1 
ATOM   953   C CA    . THR A 1 123 ? 23.501  44.055  17.774  1.00 15.91 ? 123  THR A CA    1 
ATOM   954   C C     . THR A 1 123 ? 23.247  43.489  19.184  1.00 16.43 ? 123  THR A C     1 
ATOM   955   O O     . THR A 1 123 ? 23.774  43.980  20.186  1.00 16.21 ? 123  THR A O     1 
ATOM   956   C CB    . THR A 1 123 ? 22.253  44.807  17.277  1.00 16.01 ? 123  THR A CB    1 
ATOM   957   O OG1   . THR A 1 123 ? 22.487  45.307  15.960  1.00 16.81 ? 123  THR A OG1   1 
ATOM   958   C CG2   . THR A 1 123 ? 21.930  45.957  18.156  1.00 15.30 ? 123  THR A CG2   1 
ATOM   959   N N     . LEU A 1 124 ? 22.453  42.428  19.243  1.00 16.97 ? 124  LEU A N     1 
ATOM   960   C CA    . LEU A 1 124 ? 22.196  41.748  20.497  1.00 17.08 ? 124  LEU A CA    1 
ATOM   961   C C     . LEU A 1 124 ? 23.504  41.257  21.106  1.00 17.32 ? 124  LEU A C     1 
ATOM   962   O O     . LEU A 1 124 ? 23.754  41.454  22.296  1.00 17.80 ? 124  LEU A O     1 
ATOM   963   C CB    . LEU A 1 124 ? 21.215  40.587  20.290  1.00 17.09 ? 124  LEU A CB    1 
ATOM   964   C CG    . LEU A 1 124 ? 19.765  40.858  19.884  1.00 17.15 ? 124  LEU A CG    1 
ATOM   965   C CD1   . LEU A 1 124 ? 19.057  39.553  19.673  1.00 16.45 ? 124  LEU A CD1   1 
ATOM   966   C CD2   . LEU A 1 124 ? 19.004  41.694  20.916  1.00 16.95 ? 124  LEU A CD2   1 
ATOM   967   N N     . LEU A 1 125 ? 24.345  40.637  20.295  1.00 17.41 ? 125  LEU A N     1 
ATOM   968   C CA    . LEU A 1 125 ? 25.627  40.151  20.787  1.00 17.93 ? 125  LEU A CA    1 
ATOM   969   C C     . LEU A 1 125 ? 26.536  41.243  21.342  1.00 18.81 ? 125  LEU A C     1 
ATOM   970   O O     . LEU A 1 125 ? 27.203  41.000  22.351  1.00 19.34 ? 125  LEU A O     1 
ATOM   971   C CB    . LEU A 1 125 ? 26.354  39.319  19.737  1.00 17.48 ? 125  LEU A CB    1 
ATOM   972   C CG    . LEU A 1 125 ? 25.693  37.963  19.448  1.00 17.09 ? 125  LEU A CG    1 
ATOM   973   C CD1   . LEU A 1 125 ? 26.203  37.411  18.145  1.00 15.70 ? 125  LEU A CD1   1 
ATOM   974   C CD2   . LEU A 1 125 ? 25.921  36.958  20.584  1.00 15.58 ? 125  LEU A CD2   1 
ATOM   975   N N     . ASP A 1 126 ? 26.536  42.445  20.747  1.00 19.54 ? 126  ASP A N     1 
ATOM   976   C CA    . ASP A 1 126 ? 27.402  43.555  21.241  1.00 20.36 ? 126  ASP A CA    1 
ATOM   977   C C     . ASP A 1 126 ? 26.891  44.193  22.511  1.00 19.85 ? 126  ASP A C     1 
ATOM   978   O O     . ASP A 1 126 ? 27.650  44.796  23.257  1.00 19.48 ? 126  ASP A O     1 
ATOM   979   C CB    . ASP A 1 126 ? 27.501  44.693  20.246  1.00 20.86 ? 126  ASP A CB    1 
ATOM   980   C CG    . ASP A 1 126 ? 28.137  44.293  18.970  1.00 24.22 ? 126  ASP A CG    1 
ATOM   981   O OD1   . ASP A 1 126 ? 28.793  43.215  18.895  1.00 26.45 ? 126  ASP A OD1   1 
ATOM   982   O OD2   . ASP A 1 126 ? 27.970  45.092  18.021  1.00 28.94 ? 126  ASP A OD2   1 
ATOM   983   N N     . LEU A 1 127 ? 25.582  44.107  22.701  1.00 19.64 ? 127  LEU A N     1 
ATOM   984   C CA    . LEU A 1 127 ? 24.937  44.631  23.878  1.00 19.49 ? 127  LEU A CA    1 
ATOM   985   C C     . LEU A 1 127 ? 25.235  43.716  25.045  1.00 19.09 ? 127  LEU A C     1 
ATOM   986   O O     . LEU A 1 127 ? 24.928  44.058  26.180  1.00 19.12 ? 127  LEU A O     1 
ATOM   987   C CB    . LEU A 1 127 ? 23.424  44.718  23.658  1.00 19.39 ? 127  LEU A CB    1 
ATOM   988   C CG    . LEU A 1 127 ? 22.800  46.089  23.886  1.00 19.78 ? 127  LEU A CG    1 
ATOM   989   C CD1   . LEU A 1 127 ? 23.840  47.207  23.650  1.00 19.42 ? 127  LEU A CD1   1 
ATOM   990   C CD2   . LEU A 1 127 ? 21.583  46.268  22.968  1.00 18.40 ? 127  LEU A CD2   1 
ATOM   991   N N     . GLY A 1 128 ? 25.820  42.552  24.754  1.00 18.66 ? 128  GLY A N     1 
ATOM   992   C CA    . GLY A 1 128 ? 26.197  41.595  25.789  1.00 18.04 ? 128  GLY A CA    1 
ATOM   993   C C     . GLY A 1 128 ? 25.207  40.452  26.011  1.00 17.93 ? 128  GLY A C     1 
ATOM   994   O O     . GLY A 1 128 ? 25.380  39.654  26.936  1.00 18.18 ? 128  GLY A O     1 
ATOM   995   N N     . ILE A 1 129 ? 24.174  40.365  25.179  1.00 17.27 ? 129  ILE A N     1 
ATOM   996   C CA    . ILE A 1 129 ? 23.229  39.258  25.234  1.00 17.10 ? 129  ILE A CA    1 
ATOM   997   C C     . ILE A 1 129 ? 23.925  37.955  24.795  1.00 17.57 ? 129  ILE A C     1 
ATOM   998   O O     . ILE A 1 129 ? 24.634  37.920  23.784  1.00 16.98 ? 129  ILE A O     1 
ATOM   999   C CB    . ILE A 1 129 ? 21.966  39.546  24.361  1.00 16.80 ? 129  ILE A CB    1 
ATOM   1000  C CG1   . ILE A 1 129 ? 21.259  40.862  24.783  1.00 14.86 ? 129  ILE A CG1   1 
ATOM   1001  C CG2   . ILE A 1 129 ? 21.032  38.348  24.340  1.00 16.85 ? 129  ILE A CG2   1 
ATOM   1002  C CD1   . ILE A 1 129 ? 20.818  40.987  26.252  1.00 11.69 ? 129  ILE A CD1   1 
ATOM   1003  N N     . LYS A 1 130 ? 23.727  36.900  25.581  1.00 18.28 ? 130  LYS A N     1 
ATOM   1004  C CA    . LYS A 1 130 ? 24.391  35.605  25.385  1.00 19.08 ? 130  LYS A CA    1 
ATOM   1005  C C     . LYS A 1 130 ? 23.327  34.523  25.247  1.00 18.81 ? 130  LYS A C     1 
ATOM   1006  O O     . LYS A 1 130 ? 22.188  34.692  25.719  1.00 18.22 ? 130  LYS A O     1 
ATOM   1007  C CB    . LYS A 1 130 ? 25.245  35.237  26.612  1.00 19.20 ? 130  LYS A CB    1 
ATOM   1008  C CG    . LYS A 1 130 ? 26.225  36.322  27.148  1.00 21.44 ? 130  LYS A CG    1 
ATOM   1009  C CD    . LYS A 1 130 ? 26.815  35.974  28.569  1.00 20.25 ? 130  LYS A CD    1 
ATOM   1010  N N     . LYS A 1 131 ? 23.709  33.398  24.639  1.00 18.50 ? 131  LYS A N     1 
ATOM   1011  C CA    . LYS A 1 131 ? 22.888  32.193  24.652  1.00 17.90 ? 131  LYS A CA    1 
ATOM   1012  C C     . LYS A 1 131 ? 22.299  31.938  26.043  1.00 17.60 ? 131  LYS A C     1 
ATOM   1013  O O     . LYS A 1 131 ? 23.014  31.993  27.031  1.00 17.84 ? 131  LYS A O     1 
ATOM   1014  C CB    . LYS A 1 131 ? 23.728  30.994  24.242  1.00 18.01 ? 131  LYS A CB    1 
ATOM   1015  C CG    . LYS A 1 131 ? 22.947  29.673  24.339  1.00 18.30 ? 131  LYS A CG    1 
ATOM   1016  C CD    . LYS A 1 131 ? 23.590  28.590  23.536  1.00 15.78 ? 131  LYS A CD    1 
ATOM   1017  C CE    . LYS A 1 131 ? 22.781  27.340  23.650  1.00 16.09 ? 131  LYS A CE    1 
ATOM   1018  N NZ    . LYS A 1 131 ? 23.638  26.195  23.346  1.00 14.21 ? 131  LYS A NZ    1 
ATOM   1019  N N     . GLY A 1 132 ? 21.000  31.660  26.106  1.00 17.59 ? 132  GLY A N     1 
ATOM   1020  C CA    . GLY A 1 132 ? 20.275  31.427  27.368  1.00 16.28 ? 132  GLY A CA    1 
ATOM   1021  C C     . GLY A 1 132 ? 19.649  32.656  28.029  1.00 16.23 ? 132  GLY A C     1 
ATOM   1022  O O     . GLY A 1 132 ? 18.765  32.513  28.872  1.00 16.53 ? 132  GLY A O     1 
ATOM   1023  N N     . ASP A 1 133 ? 20.103  33.864  27.678  1.00 15.90 ? 133  ASP A N     1 
ATOM   1024  C CA    . ASP A 1 133 ? 19.516  35.088  28.222  1.00 15.51 ? 133  ASP A CA    1 
ATOM   1025  C C     . ASP A 1 133 ? 18.096  35.300  27.715  1.00 15.72 ? 133  ASP A C     1 
ATOM   1026  O O     . ASP A 1 133 ? 17.809  35.083  26.526  1.00 15.48 ? 133  ASP A O     1 
ATOM   1027  C CB    . ASP A 1 133 ? 20.336  36.308  27.832  1.00 15.61 ? 133  ASP A CB    1 
ATOM   1028  C CG    . ASP A 1 133 ? 21.671  36.352  28.513  1.00 16.99 ? 133  ASP A CG    1 
ATOM   1029  O OD1   . ASP A 1 133 ? 21.807  35.754  29.592  1.00 16.03 ? 133  ASP A OD1   1 
ATOM   1030  O OD2   . ASP A 1 133 ? 22.597  36.979  27.956  1.00 21.49 ? 133  ASP A OD2   1 
ATOM   1031  N N     . VAL A 1 134 ? 17.215  35.741  28.613  1.00 15.23 ? 134  VAL A N     1 
ATOM   1032  C CA    . VAL A 1 134 ? 15.856  36.090  28.222  1.00 14.72 ? 134  VAL A CA    1 
ATOM   1033  C C     . VAL A 1 134 ? 15.740  37.535  27.691  1.00 14.41 ? 134  VAL A C     1 
ATOM   1034  O O     . VAL A 1 134 ? 16.215  38.500  28.311  1.00 14.37 ? 134  VAL A O     1 
ATOM   1035  C CB    . VAL A 1 134 ? 14.856  35.821  29.366  1.00 15.09 ? 134  VAL A CB    1 
ATOM   1036  C CG1   . VAL A 1 134 ? 13.426  36.208  28.949  1.00 15.28 ? 134  VAL A CG1   1 
ATOM   1037  C CG2   . VAL A 1 134 ? 14.917  34.356  29.792  1.00 13.14 ? 134  VAL A CG2   1 
ATOM   1038  N N     . VAL A 1 135 ? 15.135  37.669  26.515  1.00 13.51 ? 135  VAL A N     1 
ATOM   1039  C CA    . VAL A 1 135 ? 14.884  38.986  25.945  1.00 12.54 ? 135  VAL A CA    1 
ATOM   1040  C C     . VAL A 1 135 ? 13.365  39.170  25.868  1.00 12.35 ? 135  VAL A C     1 
ATOM   1041  O O     . VAL A 1 135 ? 12.659  38.345  25.253  1.00 12.30 ? 135  VAL A O     1 
ATOM   1042  C CB    . VAL A 1 135 ? 15.545  39.145  24.526  1.00 12.39 ? 135  VAL A CB    1 
ATOM   1043  C CG1   . VAL A 1 135 ? 15.191  40.468  23.921  1.00 11.25 ? 135  VAL A CG1   1 
ATOM   1044  C CG2   . VAL A 1 135 ? 17.056  39.026  24.604  1.00 11.58 ? 135  VAL A CG2   1 
ATOM   1045  N N     . ALA A 1 136 ? 12.890  40.239  26.505  1.00 11.54 ? 136  ALA A N     1 
ATOM   1046  C CA    . ALA A 1 136 ? 11.486  40.660  26.502  1.00 11.50 ? 136  ALA A CA    1 
ATOM   1047  C C     . ALA A 1 136 ? 11.169  41.469  25.237  1.00 11.67 ? 136  ALA A C     1 
ATOM   1048  O O     . ALA A 1 136 ? 11.810  42.496  24.979  1.00 12.58 ? 136  ALA A O     1 
ATOM   1049  C CB    . ALA A 1 136 ? 11.170  41.495  27.750  1.00 10.85 ? 136  ALA A CB    1 
ATOM   1050  N N     . ILE A 1 137 ? 10.193  41.005  24.455  1.00 10.89 ? 137  ILE A N     1 
ATOM   1051  C CA    . ILE A 1 137 ? 9.796   41.687  23.229  1.00 10.79 ? 137  ILE A CA    1 
ATOM   1052  C C     . ILE A 1 137 ? 8.350   42.194  23.359  1.00 11.01 ? 137  ILE A C     1 
ATOM   1053  O O     . ILE A 1 137 ? 7.382   41.416  23.506  1.00 10.37 ? 137  ILE A O     1 
ATOM   1054  C CB    . ILE A 1 137 ? 9.980   40.784  21.954  1.00 10.74 ? 137  ILE A CB    1 
ATOM   1055  C CG1   . ILE A 1 137 ? 11.472  40.583  21.665  1.00 10.06 ? 137  ILE A CG1   1 
ATOM   1056  C CG2   . ILE A 1 137 ? 9.338   41.448  20.760  1.00 10.32 ? 137  ILE A CG2   1 
ATOM   1057  C CD1   . ILE A 1 137 ? 11.816  39.323  20.948  1.00 9.15  ? 137  ILE A CD1   1 
ATOM   1058  N N     . TYR A 1 138 ? 8.227   43.513  23.311  1.00 10.71 ? 138  TYR A N     1 
ATOM   1059  C CA    . TYR A 1 138 ? 6.973   44.187  23.573  1.00 10.97 ? 138  TYR A CA    1 
ATOM   1060  C C     . TYR A 1 138 ? 6.716   45.137  22.409  1.00 11.31 ? 138  TYR A C     1 
ATOM   1061  O O     . TYR A 1 138 ? 6.982   46.358  22.491  1.00 11.75 ? 138  TYR A O     1 
ATOM   1062  C CB    . TYR A 1 138 ? 7.041   44.908  24.927  1.00 10.04 ? 138  TYR A CB    1 
ATOM   1063  C CG    . TYR A 1 138 ? 5.756   45.599  25.410  1.00 9.38  ? 138  TYR A CG    1 
ATOM   1064  C CD1   . TYR A 1 138 ? 4.593   44.861  25.727  1.00 9.15  ? 138  TYR A CD1   1 
ATOM   1065  C CD2   . TYR A 1 138 ? 5.721   46.987  25.585  1.00 7.13  ? 138  TYR A CD2   1 
ATOM   1066  C CE1   . TYR A 1 138 ? 3.413   45.510  26.195  1.00 7.65  ? 138  TYR A CE1   1 
ATOM   1067  C CE2   . TYR A 1 138 ? 4.576   47.643  26.067  1.00 8.34  ? 138  TYR A CE2   1 
ATOM   1068  C CZ    . TYR A 1 138 ? 3.430   46.898  26.371  1.00 9.76  ? 138  TYR A CZ    1 
ATOM   1069  O OH    . TYR A 1 138 ? 2.334   47.555  26.849  1.00 9.74  ? 138  TYR A OH    1 
ATOM   1070  N N     . MET A 1 139 ? 6.175   44.557  21.343  1.00 11.52 ? 139  MET A N     1 
ATOM   1071  C CA    . MET A 1 139 ? 6.236   45.154  20.004  1.00 12.42 ? 139  MET A CA    1 
ATOM   1072  C C     . MET A 1 139 ? 4.879   45.060  19.349  1.00 12.68 ? 139  MET A C     1 
ATOM   1073  O O     . MET A 1 139 ? 4.148   44.100  19.584  1.00 12.37 ? 139  MET A O     1 
ATOM   1074  C CB    . MET A 1 139 ? 7.236   44.400  19.097  1.00 12.48 ? 139  MET A CB    1 
ATOM   1075  C CG    . MET A 1 139 ? 8.701   44.580  19.394  1.00 12.22 ? 139  MET A CG    1 
ATOM   1076  S SD    . MET A 1 139 ? 9.268   46.147  18.737  1.00 16.36 ? 139  MET A SD    1 
ATOM   1077  C CE    . MET A 1 139 ? 9.658   45.714  17.041  1.00 10.77 ? 139  MET A CE    1 
ATOM   1078  N N     . PRO A 1 140 ? 4.571   46.030  18.466  1.00 13.16 ? 140  PRO A N     1 
ATOM   1079  C CA    . PRO A 1 140 ? 3.344   46.000  17.649  1.00 12.98 ? 140  PRO A CA    1 
ATOM   1080  C C     . PRO A 1 140 ? 3.565   45.075  16.437  1.00 12.91 ? 140  PRO A C     1 
ATOM   1081  O O     . PRO A 1 140 ? 4.622   44.477  16.302  1.00 12.37 ? 140  PRO A O     1 
ATOM   1082  C CB    . PRO A 1 140 ? 3.180   47.448  17.190  1.00 12.58 ? 140  PRO A CB    1 
ATOM   1083  C CG    . PRO A 1 140 ? 4.548   48.077  17.352  1.00 13.63 ? 140  PRO A CG    1 
ATOM   1084  C CD    . PRO A 1 140 ? 5.454   47.158  18.118  1.00 12.36 ? 140  PRO A CD    1 
ATOM   1085  N N     . MET A 1 141 ? 2.572   44.946  15.573  1.00 12.99 ? 141  MET A N     1 
ATOM   1086  C CA    . MET A 1 141 ? 2.652   43.998  14.482  1.00 12.19 ? 141  MET A CA    1 
ATOM   1087  C C     . MET A 1 141 ? 3.371   44.664  13.308  1.00 12.77 ? 141  MET A C     1 
ATOM   1088  O O     . MET A 1 141 ? 2.781   45.039  12.287  1.00 13.30 ? 141  MET A O     1 
ATOM   1089  C CB    . MET A 1 141 ? 1.252   43.533  14.131  1.00 12.10 ? 141  MET A CB    1 
ATOM   1090  C CG    . MET A 1 141 ? 0.749   42.485  15.090  1.00 11.44 ? 141  MET A CG    1 
ATOM   1091  S SD    . MET A 1 141 ? 1.393   40.861  14.636  1.00 14.77 ? 141  MET A SD    1 
ATOM   1092  C CE    . MET A 1 141 ? 0.187   40.465  13.373  1.00 10.40 ? 141  MET A CE    1 
ATOM   1093  N N     . VAL A 1 142 ? 4.664   44.842  13.487  1.00 12.50 ? 142  VAL A N     1 
ATOM   1094  C CA    . VAL A 1 142 ? 5.524   45.362  12.451  1.00 12.20 ? 142  VAL A CA    1 
ATOM   1095  C C     . VAL A 1 142 ? 6.614   44.309  12.225  1.00 12.29 ? 142  VAL A C     1 
ATOM   1096  O O     . VAL A 1 142 ? 6.867   43.476  13.114  1.00 11.74 ? 142  VAL A O     1 
ATOM   1097  C CB    . VAL A 1 142 ? 6.146   46.717  12.874  1.00 12.68 ? 142  VAL A CB    1 
ATOM   1098  C CG1   . VAL A 1 142 ? 5.038   47.801  13.092  1.00 12.00 ? 142  VAL A CG1   1 
ATOM   1099  C CG2   . VAL A 1 142 ? 7.002   46.543  14.111  1.00 10.56 ? 142  VAL A CG2   1 
ATOM   1100  N N     . PRO A 1 143 ? 7.270   44.336  11.042  1.00 12.13 ? 143  PRO A N     1 
ATOM   1101  C CA    . PRO A 1 143 ? 8.221   43.266  10.684  1.00 11.48 ? 143  PRO A CA    1 
ATOM   1102  C C     . PRO A 1 143 ? 9.403   43.206  11.630  1.00 10.63 ? 143  PRO A C     1 
ATOM   1103  O O     . PRO A 1 143 ? 9.974   42.151  11.794  1.00 10.51 ? 143  PRO A O     1 
ATOM   1104  C CB    . PRO A 1 143 ? 8.706   43.657  9.280   1.00 11.50 ? 143  PRO A CB    1 
ATOM   1105  C CG    . PRO A 1 143 ? 7.671   44.637  8.773   1.00 12.46 ? 143  PRO A CG    1 
ATOM   1106  C CD    . PRO A 1 143 ? 7.178   45.367  9.991   1.00 11.98 ? 143  PRO A CD    1 
ATOM   1107  N N     . GLU A 1 144 ? 9.761   44.324  12.252  1.00 10.37 ? 144  GLU A N     1 
ATOM   1108  C CA    . GLU A 1 144 ? 10.889  44.354  13.210  1.00 10.33 ? 144  GLU A CA    1 
ATOM   1109  C C     . GLU A 1 144 ? 10.711  43.421  14.397  1.00 10.28 ? 144  GLU A C     1 
ATOM   1110  O O     . GLU A 1 144 ? 11.688  42.956  14.953  1.00 10.89 ? 144  GLU A O     1 
ATOM   1111  C CB    . GLU A 1 144 ? 11.183  45.765  13.696  1.00 9.68  ? 144  GLU A CB    1 
ATOM   1112  C CG    . GLU A 1 144 ? 11.730  46.660  12.601  1.00 11.17 ? 144  GLU A CG    1 
ATOM   1113  C CD    . GLU A 1 144 ? 10.635  47.401  11.812  1.00 14.86 ? 144  GLU A CD    1 
ATOM   1114  O OE1   . GLU A 1 144 ? 9.418   47.063  11.849  1.00 14.43 ? 144  GLU A OE1   1 
ATOM   1115  O OE2   . GLU A 1 144 ? 11.015  48.347  11.119  1.00 18.04 ? 144  GLU A OE2   1 
ATOM   1116  N N     . ALA A 1 145 ? 9.467   43.141  14.773  1.00 10.30 ? 145  ALA A N     1 
ATOM   1117  C CA    . ALA A 1 145 ? 9.193   42.167  15.816  1.00 10.59 ? 145  ALA A CA    1 
ATOM   1118  C C     . ALA A 1 145 ? 9.695   40.798  15.381  1.00 10.66 ? 145  ALA A C     1 
ATOM   1119  O O     . ALA A 1 145 ? 10.412  40.133  16.111  1.00 11.77 ? 145  ALA A O     1 
ATOM   1120  C CB    . ALA A 1 145 ? 7.699   42.144  16.159  1.00 10.12 ? 145  ALA A CB    1 
ATOM   1121  N N     . ALA A 1 146 ? 9.371   40.409  14.160  1.00 10.84 ? 146  ALA A N     1 
ATOM   1122  C CA    . ALA A 1 146 ? 9.897   39.181  13.573  1.00 10.71 ? 146  ALA A CA    1 
ATOM   1123  C C     . ALA A 1 146 ? 11.416  39.207  13.506  1.00 10.60 ? 146  ALA A C     1 
ATOM   1124  O O     . ALA A 1 146 ? 12.080  38.208  13.799  1.00 11.22 ? 146  ALA A O     1 
ATOM   1125  C CB    . ALA A 1 146 ? 9.297   38.954  12.168  1.00 10.33 ? 146  ALA A CB    1 
ATOM   1126  N N     . VAL A 1 147 ? 11.978  40.341  13.112  1.00 10.38 ? 147  VAL A N     1 
ATOM   1127  C CA    . VAL A 1 147 ? 13.431  40.451  13.049  1.00 9.97  ? 147  VAL A CA    1 
ATOM   1128  C C     . VAL A 1 147 ? 14.021  40.173  14.428  1.00 10.61 ? 147  VAL A C     1 
ATOM   1129  O O     . VAL A 1 147 ? 14.912  39.350  14.546  1.00 11.19 ? 147  VAL A O     1 
ATOM   1130  C CB    . VAL A 1 147 ? 13.890  41.825  12.566  1.00 9.58  ? 147  VAL A CB    1 
ATOM   1131  C CG1   . VAL A 1 147 ? 15.388  41.956  12.785  1.00 9.85  ? 147  VAL A CG1   1 
ATOM   1132  C CG2   . VAL A 1 147 ? 13.548  42.031  11.098  1.00 7.50  ? 147  VAL A CG2   1 
ATOM   1133  N N     . ALA A 1 148 ? 13.491  40.834  15.459  1.00 10.60 ? 148  ALA A N     1 
ATOM   1134  C CA    . ALA A 1 148 ? 13.895  40.601  16.848  1.00 11.41 ? 148  ALA A CA    1 
ATOM   1135  C C     . ALA A 1 148 ? 13.798  39.131  17.308  1.00 11.77 ? 148  ALA A C     1 
ATOM   1136  O O     . ALA A 1 148 ? 14.768  38.573  17.822  1.00 12.40 ? 148  ALA A O     1 
ATOM   1137  C CB    . ALA A 1 148 ? 13.107  41.534  17.810  1.00 10.97 ? 148  ALA A CB    1 
ATOM   1138  N N     . MET A 1 149 ? 12.638  38.509  17.120  1.00 11.82 ? 149  MET A N     1 
ATOM   1139  C CA    . MET A 1 149 ? 12.445  37.099  17.490  1.00 11.81 ? 149  MET A CA    1 
ATOM   1140  C C     . MET A 1 149 ? 13.422  36.144  16.792  1.00 11.48 ? 149  MET A C     1 
ATOM   1141  O O     . MET A 1 149 ? 14.036  35.288  17.456  1.00 11.22 ? 149  MET A O     1 
ATOM   1142  C CB    . MET A 1 149 ? 10.996  36.653  17.244  1.00 11.62 ? 149  MET A CB    1 
ATOM   1143  C CG    . MET A 1 149 ? 9.953   37.470  18.020  1.00 11.16 ? 149  MET A CG    1 
ATOM   1144  S SD    . MET A 1 149 ? 8.294   37.044  17.485  1.00 12.07 ? 149  MET A SD    1 
ATOM   1145  C CE    . MET A 1 149 ? 8.153   35.347  18.054  1.00 12.45 ? 149  MET A CE    1 
ATOM   1146  N N     . LEU A 1 150 ? 13.579  36.301  15.477  1.00 10.95 ? 150  LEU A N     1 
ATOM   1147  C CA    . LEU A 1 150 ? 14.532  35.462  14.702  1.00 10.99 ? 150  LEU A CA    1 
ATOM   1148  C C     . LEU A 1 150 ? 15.976  35.660  15.130  1.00 11.06 ? 150  LEU A C     1 
ATOM   1149  O O     . LEU A 1 150 ? 16.730  34.697  15.198  1.00 11.20 ? 150  LEU A O     1 
ATOM   1150  C CB    . LEU A 1 150 ? 14.416  35.705  13.206  1.00 10.39 ? 150  LEU A CB    1 
ATOM   1151  C CG    . LEU A 1 150 ? 13.088  35.231  12.603  1.00 11.10 ? 150  LEU A CG    1 
ATOM   1152  C CD1   . LEU A 1 150 ? 12.763  35.996  11.304  1.00 7.71  ? 150  LEU A CD1   1 
ATOM   1153  C CD2   . LEU A 1 150 ? 13.108  33.694  12.388  1.00 8.72  ? 150  LEU A CD2   1 
ATOM   1154  N N     . ALA A 1 151 ? 16.351  36.899  15.441  1.00 11.12 ? 151  ALA A N     1 
ATOM   1155  C CA    . ALA A 1 151 ? 17.715  37.181  15.844  1.00 11.51 ? 151  ALA A CA    1 
ATOM   1156  C C     . ALA A 1 151 ? 17.999  36.566  17.213  1.00 12.29 ? 151  ALA A C     1 
ATOM   1157  O O     . ALA A 1 151 ? 19.098  36.025  17.434  1.00 12.73 ? 151  ALA A O     1 
ATOM   1158  C CB    . ALA A 1 151 ? 17.988  38.667  15.847  1.00 11.18 ? 151  ALA A CB    1 
ATOM   1159  N N     . CYS A 1 152 ? 17.019  36.629  18.118  1.00 11.64 ? 152  CYS A N     1 
ATOM   1160  C CA    . CYS A 1 152 ? 17.153  35.917  19.372  1.00 12.07 ? 152  CYS A CA    1 
ATOM   1161  C C     . CYS A 1 152 ? 17.397  34.405  19.159  1.00 12.04 ? 152  CYS A C     1 
ATOM   1162  O O     . CYS A 1 152 ? 18.310  33.818  19.753  1.00 11.64 ? 152  CYS A O     1 
ATOM   1163  C CB    . CYS A 1 152 ? 15.943  36.160  20.266  1.00 12.15 ? 152  CYS A CB    1 
ATOM   1164  S SG    . CYS A 1 152 ? 15.866  37.855  20.920  1.00 12.95 ? 152  CYS A SG    1 
ATOM   1165  N N     . ALA A 1 153 ? 16.589  33.789  18.304  1.00 11.61 ? 153  ALA A N     1 
ATOM   1166  C CA    . ALA A 1 153 ? 16.725  32.375  18.045  1.00 11.57 ? 153  ALA A CA    1 
ATOM   1167  C C     . ALA A 1 153 ? 18.063  32.066  17.357  1.00 12.58 ? 153  ALA A C     1 
ATOM   1168  O O     . ALA A 1 153 ? 18.663  31.012  17.611  1.00 12.68 ? 153  ALA A O     1 
ATOM   1169  C CB    . ALA A 1 153 ? 15.573  31.883  17.221  1.00 10.54 ? 153  ALA A CB    1 
ATOM   1170  N N     . ARG A 1 154 ? 18.534  32.994  16.516  1.00 12.87 ? 154  ARG A N     1 
ATOM   1171  C CA    . ARG A 1 154 ? 19.757  32.796  15.771  1.00 13.07 ? 154  ARG A CA    1 
ATOM   1172  C C     . ARG A 1 154 ? 20.961  32.565  16.676  1.00 12.96 ? 154  ARG A C     1 
ATOM   1173  O O     . ARG A 1 154 ? 21.787  31.674  16.412  1.00 13.21 ? 154  ARG A O     1 
ATOM   1174  C CB    . ARG A 1 154 ? 20.049  33.993  14.880  1.00 13.59 ? 154  ARG A CB    1 
ATOM   1175  C CG    . ARG A 1 154 ? 21.136  33.691  13.874  1.00 13.17 ? 154  ARG A CG    1 
ATOM   1176  C CD    . ARG A 1 154 ? 21.214  34.723  12.779  1.00 13.80 ? 154  ARG A CD    1 
ATOM   1177  N NE    . ARG A 1 154 ? 22.290  34.419  11.819  1.00 13.33 ? 154  ARG A NE    1 
ATOM   1178  C CZ    . ARG A 1 154 ? 22.107  33.760  10.680  1.00 11.08 ? 154  ARG A CZ    1 
ATOM   1179  N NH1   . ARG A 1 154 ? 20.896  33.320  10.344  1.00 10.73 ? 154  ARG A NH1   1 
ATOM   1180  N NH2   . ARG A 1 154 ? 23.132  33.552  9.882   1.00 9.83  ? 154  ARG A NH2   1 
ATOM   1181  N N     . ILE A 1 155 ? 21.047  33.384  17.723  1.00 12.38 ? 155  ILE A N     1 
ATOM   1182  C CA    . ILE A 1 155 ? 22.143  33.371  18.695  1.00 11.45 ? 155  ILE A CA    1 
ATOM   1183  C C     . ILE A 1 155 ? 21.814  32.499  19.898  1.00 11.81 ? 155  ILE A C     1 
ATOM   1184  O O     . ILE A 1 155 ? 22.629  32.357  20.811  1.00 11.98 ? 155  ILE A O     1 
ATOM   1185  C CB    . ILE A 1 155 ? 22.531  34.807  19.156  1.00 11.47 ? 155  ILE A CB    1 
ATOM   1186  C CG1   . ILE A 1 155 ? 21.426  35.461  19.996  1.00 11.75 ? 155  ILE A CG1   1 
ATOM   1187  C CG2   . ILE A 1 155 ? 22.794  35.684  17.961  1.00 11.15 ? 155  ILE A CG2   1 
ATOM   1188  C CD1   . ILE A 1 155 ? 21.830  36.796  20.618  1.00 10.76 ? 155  ILE A CD1   1 
ATOM   1189  N N     . GLY A 1 156 ? 20.633  31.887  19.895  1.00 11.80 ? 156  GLY A N     1 
ATOM   1190  C CA    . GLY A 1 156 ? 20.255  31.011  20.988  1.00 11.92 ? 156  GLY A CA    1 
ATOM   1191  C C     . GLY A 1 156 ? 19.784  31.713  22.248  1.00 12.63 ? 156  GLY A C     1 
ATOM   1192  O O     . GLY A 1 156 ? 19.648  31.086  23.301  1.00 13.48 ? 156  GLY A O     1 
ATOM   1193  N N     . ALA A 1 157 ? 19.521  33.009  22.181  1.00 12.84 ? 157  ALA A N     1 
ATOM   1194  C CA    . ALA A 1 157 ? 18.881  33.658  23.330  1.00 13.29 ? 157  ALA A CA    1 
ATOM   1195  C C     . ALA A 1 157 ? 17.408  33.193  23.398  1.00 13.65 ? 157  ALA A C     1 
ATOM   1196  O O     . ALA A 1 157 ? 16.904  32.544  22.463  1.00 14.23 ? 157  ALA A O     1 
ATOM   1197  C CB    . ALA A 1 157 ? 18.989  35.188  23.234  1.00 13.53 ? 157  ALA A CB    1 
ATOM   1198  N N     . VAL A 1 158 ? 16.727  33.513  24.495  1.00 12.90 ? 158  VAL A N     1 
ATOM   1199  C CA    . VAL A 1 158 ? 15.402  32.993  24.755  1.00 11.99 ? 158  VAL A CA    1 
ATOM   1200  C C     . VAL A 1 158 ? 14.458  34.167  24.791  1.00 11.88 ? 158  VAL A C     1 
ATOM   1201  O O     . VAL A 1 158 ? 14.360  34.860  25.821  1.00 12.44 ? 158  VAL A O     1 
ATOM   1202  C CB    . VAL A 1 158 ? 15.342  32.250  26.108  1.00 12.08 ? 158  VAL A CB    1 
ATOM   1203  C CG1   . VAL A 1 158 ? 13.955  31.705  26.357  1.00 11.61 ? 158  VAL A CG1   1 
ATOM   1204  C CG2   . VAL A 1 158 ? 16.362  31.119  26.141  1.00 12.30 ? 158  VAL A CG2   1 
ATOM   1205  N N     . HIS A 1 159 ? 13.765  34.403  23.677  1.00 11.03 ? 159  HIS A N     1 
ATOM   1206  C CA    . HIS A 1 159 ? 12.895  35.551  23.607  1.00 10.73 ? 159  HIS A CA    1 
ATOM   1207  C C     . HIS A 1 159 ? 11.608  35.331  24.408  1.00 10.85 ? 159  HIS A C     1 
ATOM   1208  O O     . HIS A 1 159 ? 11.084  34.207  24.467  1.00 10.56 ? 159  HIS A O     1 
ATOM   1209  C CB    . HIS A 1 159 ? 12.627  36.001  22.148  1.00 10.51 ? 159  HIS A CB    1 
ATOM   1210  C CG    . HIS A 1 159 ? 11.790  35.055  21.334  1.00 9.87  ? 159  HIS A CG    1 
ATOM   1211  N ND1   . HIS A 1 159 ? 10.488  34.725  21.662  1.00 9.86  ? 159  HIS A ND1   1 
ATOM   1212  C CD2   . HIS A 1 159 ? 12.061  34.397  20.181  1.00 7.40  ? 159  HIS A CD2   1 
ATOM   1213  C CE1   . HIS A 1 159 ? 10.001  33.901  20.750  1.00 7.75  ? 159  HIS A CE1   1 
ATOM   1214  N NE2   . HIS A 1 159 ? 10.935  33.689  19.842  1.00 7.20  ? 159  HIS A NE2   1 
ATOM   1215  N N     . SER A 1 160 ? 11.114  36.400  25.036  1.00 10.87 ? 160  SER A N     1 
ATOM   1216  C CA    . SER A 1 160 ? 9.807   36.359  25.691  1.00 10.66 ? 160  SER A CA    1 
ATOM   1217  C C     . SER A 1 160 ? 8.936   37.473  25.121  1.00 11.32 ? 160  SER A C     1 
ATOM   1218  O O     . SER A 1 160 ? 9.103   38.649  25.472  1.00 11.32 ? 160  SER A O     1 
ATOM   1219  C CB    . SER A 1 160 ? 9.942   36.481  27.204  1.00 10.44 ? 160  SER A CB    1 
ATOM   1220  O OG    . SER A 1 160 ? 8.684   36.266  27.836  1.00 11.23 ? 160  SER A OG    1 
ATOM   1221  N N     . VAL A 1 161 ? 8.024   37.105  24.217  1.00 11.10 ? 161  VAL A N     1 
ATOM   1222  C CA    . VAL A 1 161 ? 7.190   38.078  23.569  1.00 10.73 ? 161  VAL A CA    1 
ATOM   1223  C C     . VAL A 1 161 ? 5.991   38.346  24.470  1.00 10.88 ? 161  VAL A C     1 
ATOM   1224  O O     . VAL A 1 161 ? 5.274   37.437  24.841  1.00 11.72 ? 161  VAL A O     1 
ATOM   1225  C CB    . VAL A 1 161 ? 6.727   37.630  22.167  1.00 10.97 ? 161  VAL A CB    1 
ATOM   1226  C CG1   . VAL A 1 161 ? 5.843   38.702  21.517  1.00 10.39 ? 161  VAL A CG1   1 
ATOM   1227  C CG2   . VAL A 1 161 ? 7.913   37.323  21.282  1.00 11.10 ? 161  VAL A CG2   1 
ATOM   1228  N N     . ILE A 1 162 ? 5.805   39.617  24.805  1.00 10.69 ? 162  ILE A N     1 
ATOM   1229  C CA    . ILE A 1 162 ? 4.751   40.109  25.647  1.00 10.17 ? 162  ILE A CA    1 
ATOM   1230  C C     . ILE A 1 162 ? 3.798   40.907  24.747  1.00 10.45 ? 162  ILE A C     1 
ATOM   1231  O O     . ILE A 1 162 ? 4.212   41.858  24.041  1.00 11.01 ? 162  ILE A O     1 
ATOM   1232  C CB    . ILE A 1 162 ? 5.355   41.049  26.713  1.00 10.89 ? 162  ILE A CB    1 
ATOM   1233  C CG1   . ILE A 1 162 ? 6.360   40.290  27.617  1.00 10.93 ? 162  ILE A CG1   1 
ATOM   1234  C CG2   . ILE A 1 162 ? 4.249   41.753  27.503  1.00 10.60 ? 162  ILE A CG2   1 
ATOM   1235  C CD1   . ILE A 1 162 ? 7.206   41.185  28.554  1.00 9.50  ? 162  ILE A CD1   1 
ATOM   1236  N N     . PHE A 1 163 ? 2.527   40.514  24.773  1.00 9.64  ? 163  PHE A N     1 
ATOM   1237  C CA    . PHE A 1 163 ? 1.489   41.060  23.915  1.00 8.00  ? 163  PHE A CA    1 
ATOM   1238  C C     . PHE A 1 163 ? 1.302   42.530  24.233  1.00 7.84  ? 163  PHE A C     1 
ATOM   1239  O O     . PHE A 1 163 ? 1.125   42.923  25.403  1.00 6.82  ? 163  PHE A O     1 
ATOM   1240  C CB    . PHE A 1 163 ? 0.187   40.260  24.129  1.00 7.95  ? 163  PHE A CB    1 
ATOM   1241  C CG    . PHE A 1 163 ? -1.078  40.911  23.569  1.00 8.47  ? 163  PHE A CG    1 
ATOM   1242  C CD1   . PHE A 1 163 ? -1.347  40.911  22.193  1.00 8.11  ? 163  PHE A CD1   1 
ATOM   1243  C CD2   . PHE A 1 163 ? -2.035  41.467  24.435  1.00 8.36  ? 163  PHE A CD2   1 
ATOM   1244  C CE1   . PHE A 1 163 ? -2.525  41.472  21.681  1.00 9.96  ? 163  PHE A CE1   1 
ATOM   1245  C CE2   . PHE A 1 163 ? -3.225  42.033  23.938  1.00 8.00  ? 163  PHE A CE2   1 
ATOM   1246  C CZ    . PHE A 1 163 ? -3.474  42.044  22.559  1.00 9.21  ? 163  PHE A CZ    1 
ATOM   1247  N N     . GLY A 1 164 ? 1.350   43.330  23.173  1.00 7.95  ? 164  GLY A N     1 
ATOM   1248  C CA    . GLY A 1 164 ? 1.274   44.791  23.244  1.00 8.73  ? 164  GLY A CA    1 
ATOM   1249  C C     . GLY A 1 164 ? 0.153   45.351  24.106  1.00 9.59  ? 164  GLY A C     1 
ATOM   1250  O O     . GLY A 1 164 ? 0.303   46.419  24.667  1.00 10.32 ? 164  GLY A O     1 
ATOM   1251  N N     . GLY A 1 165 ? -0.954  44.617  24.236  1.00 10.08 ? 165  GLY A N     1 
ATOM   1252  C CA    . GLY A 1 165 ? -2.119  45.076  24.982  1.00 9.63  ? 165  GLY A CA    1 
ATOM   1253  C C     . GLY A 1 165 ? -2.014  44.881  26.483  1.00 10.24 ? 165  GLY A C     1 
ATOM   1254  O O     . GLY A 1 165 ? -2.931  45.224  27.198  1.00 10.98 ? 165  GLY A O     1 
ATOM   1255  N N     . PHE A 1 166 ? -0.915  44.332  26.980  1.00 10.48 ? 166  PHE A N     1 
ATOM   1256  C CA    . PHE A 1 166 ? -0.727  44.225  28.427  1.00 10.72 ? 166  PHE A CA    1 
ATOM   1257  C C     . PHE A 1 166 ? -0.349  45.586  29.033  1.00 11.29 ? 166  PHE A C     1 
ATOM   1258  O O     . PHE A 1 166 ? 0.369   46.368  28.419  1.00 12.03 ? 166  PHE A O     1 
ATOM   1259  C CB    . PHE A 1 166 ? 0.345   43.194  28.776  1.00 10.16 ? 166  PHE A CB    1 
ATOM   1260  C CG    . PHE A 1 166 ? -0.137  41.761  28.723  1.00 11.11 ? 166  PHE A CG    1 
ATOM   1261  C CD1   . PHE A 1 166 ? 0.456   40.838  27.832  1.00 10.80 ? 166  PHE A CD1   1 
ATOM   1262  C CD2   . PHE A 1 166 ? -1.164  41.314  29.569  1.00 10.99 ? 166  PHE A CD2   1 
ATOM   1263  C CE1   . PHE A 1 166 ? 0.046   39.496  27.788  1.00 10.57 ? 166  PHE A CE1   1 
ATOM   1264  C CE2   . PHE A 1 166 ? -1.598  39.954  29.522  1.00 12.00 ? 166  PHE A CE2   1 
ATOM   1265  C CZ    . PHE A 1 166 ? -0.990  39.051  28.626  1.00 10.48 ? 166  PHE A CZ    1 
ATOM   1266  N N     . SER A 1 167 ? -0.870  45.861  30.222  1.00 11.98 ? 167  SER A N     1 
ATOM   1267  C CA    . SER A 1 167 ? -0.559  47.051  31.016  1.00 13.14 ? 167  SER A CA    1 
ATOM   1268  C C     . SER A 1 167 ? 0.907   47.046  31.528  1.00 12.91 ? 167  SER A C     1 
ATOM   1269  O O     . SER A 1 167 ? 1.567   46.002  31.543  1.00 13.35 ? 167  SER A O     1 
ATOM   1270  C CB    . SER A 1 167 ? -1.485  47.031  32.238  1.00 13.97 ? 167  SER A CB    1 
ATOM   1271  O OG    . SER A 1 167 ? -1.127  45.947  33.127  1.00 13.71 ? 167  SER A OG    1 
ATOM   1272  N N     . PRO A 1 168 ? 1.417   48.200  31.960  1.00 12.59 ? 168  PRO A N     1 
ATOM   1273  C CA    . PRO A 1 168 ? 2.762   48.236  32.617  1.00 12.72 ? 168  PRO A CA    1 
ATOM   1274  C C     . PRO A 1 168 ? 2.967   47.163  33.722  1.00 12.96 ? 168  PRO A C     1 
ATOM   1275  O O     . PRO A 1 168 ? 3.959   46.405  33.702  1.00 13.12 ? 168  PRO A O     1 
ATOM   1276  C CB    . PRO A 1 168 ? 2.825   49.656  33.199  1.00 12.07 ? 168  PRO A CB    1 
ATOM   1277  C CG    . PRO A 1 168 ? 1.982   50.465  32.225  1.00 12.32 ? 168  PRO A CG    1 
ATOM   1278  C CD    . PRO A 1 168 ? 0.823   49.542  31.827  1.00 12.42 ? 168  PRO A CD    1 
ATOM   1279  N N     . GLU A 1 169 ? 2.029   47.093  34.656  1.00 12.95 ? 169  GLU A N     1 
ATOM   1280  C CA    . GLU A 1 169 ? 2.039   46.108  35.725  1.00 13.31 ? 169  GLU A CA    1 
ATOM   1281  C C     . GLU A 1 169 ? 2.184   44.659  35.195  1.00 12.88 ? 169  GLU A C     1 
ATOM   1282  O O     . GLU A 1 169 ? 2.908   43.842  35.778  1.00 13.12 ? 169  GLU A O     1 
ATOM   1283  C CB    . GLU A 1 169 ? 0.752   46.280  36.547  1.00 14.15 ? 169  GLU A CB    1 
ATOM   1284  C CG    . GLU A 1 169 ? 0.520   45.249  37.637  1.00 16.61 ? 169  GLU A CG    1 
ATOM   1285  C CD    . GLU A 1 169 ? 1.498   45.400  38.772  1.00 20.60 ? 169  GLU A CD    1 
ATOM   1286  O OE1   . GLU A 1 169 ? 1.957   46.545  39.041  1.00 22.58 ? 169  GLU A OE1   1 
ATOM   1287  O OE2   . GLU A 1 169 ? 1.814   44.362  39.381  1.00 22.52 ? 169  GLU A OE2   1 
ATOM   1288  N N     . ALA A 1 170 ? 1.519   44.346  34.083  1.00 12.08 ? 170  ALA A N     1 
ATOM   1289  C CA    . ALA A 1 170 ? 1.619   43.011  33.473  1.00 11.20 ? 170  ALA A CA    1 
ATOM   1290  C C     . ALA A 1 170 ? 2.985   42.776  32.797  1.00 11.46 ? 170  ALA A C     1 
ATOM   1291  O O     . ALA A 1 170 ? 3.576   41.684  32.916  1.00 11.32 ? 170  ALA A O     1 
ATOM   1292  C CB    . ALA A 1 170 ? 0.511   42.809  32.486  1.00 10.77 ? 170  ALA A CB    1 
ATOM   1293  N N     . VAL A 1 171 ? 3.474   43.788  32.074  1.00 10.88 ? 171  VAL A N     1 
ATOM   1294  C CA    . VAL A 1 171 ? 4.825   43.742  31.531  1.00 11.13 ? 171  VAL A CA    1 
ATOM   1295  C C     . VAL A 1 171 ? 5.856   43.470  32.654  1.00 12.05 ? 171  VAL A C     1 
ATOM   1296  O O     . VAL A 1 171 ? 6.656   42.543  32.550  1.00 12.95 ? 171  VAL A O     1 
ATOM   1297  C CB    . VAL A 1 171 ? 5.171   45.032  30.743  1.00 10.76 ? 171  VAL A CB    1 
ATOM   1298  C CG1   . VAL A 1 171 ? 6.594   45.017  30.319  1.00 9.77  ? 171  VAL A CG1   1 
ATOM   1299  C CG2   . VAL A 1 171 ? 4.292   45.155  29.505  1.00 11.50 ? 171  VAL A CG2   1 
ATOM   1300  N N     . ALA A 1 172 ? 5.818   44.241  33.739  1.00 12.17 ? 172  ALA A N     1 
ATOM   1301  C CA    . ALA A 1 172 ? 6.848   44.147  34.761  1.00 12.20 ? 172  ALA A CA    1 
ATOM   1302  C C     . ALA A 1 172 ? 6.924   42.752  35.371  1.00 12.48 ? 172  ALA A C     1 
ATOM   1303  O O     . ALA A 1 172 ? 8.020   42.218  35.583  1.00 12.79 ? 172  ALA A O     1 
ATOM   1304  C CB    . ALA A 1 172 ? 6.617   45.200  35.842  1.00 12.46 ? 172  ALA A CB    1 
ATOM   1305  N N     . GLY A 1 173 ? 5.760   42.158  35.635  1.00 12.83 ? 173  GLY A N     1 
ATOM   1306  C CA    . GLY A 1 173 ? 5.666   40.807  36.197  1.00 12.56 ? 173  GLY A CA    1 
ATOM   1307  C C     . GLY A 1 173 ? 6.398   39.819  35.298  1.00 12.97 ? 173  GLY A C     1 
ATOM   1308  O O     . GLY A 1 173 ? 7.227   39.037  35.769  1.00 13.79 ? 173  GLY A O     1 
ATOM   1309  N N     . ARG A 1 174 ? 6.138   39.888  34.002  1.00 12.23 ? 174  ARG A N     1 
ATOM   1310  C CA    . ARG A 1 174 ? 6.800   39.022  33.068  1.00 12.82 ? 174  ARG A CA    1 
ATOM   1311  C C     . ARG A 1 174 ? 8.321   39.254  33.039  1.00 13.23 ? 174  ARG A C     1 
ATOM   1312  O O     . ARG A 1 174 ? 9.101   38.287  32.917  1.00 13.94 ? 174  ARG A O     1 
ATOM   1313  C CB    . ARG A 1 174 ? 6.162   39.152  31.676  1.00 13.25 ? 174  ARG A CB    1 
ATOM   1314  C CG    . ARG A 1 174 ? 4.788   38.528  31.615  1.00 13.08 ? 174  ARG A CG    1 
ATOM   1315  C CD    . ARG A 1 174 ? 3.991   39.005  30.418  1.00 15.74 ? 174  ARG A CD    1 
ATOM   1316  N NE    . ARG A 1 174 ? 2.754   38.239  30.303  1.00 16.62 ? 174  ARG A NE    1 
ATOM   1317  C CZ    . ARG A 1 174 ? 1.682   38.406  31.076  1.00 15.47 ? 174  ARG A CZ    1 
ATOM   1318  N NH1   . ARG A 1 174 ? 1.668   39.336  32.015  1.00 14.94 ? 174  ARG A NH1   1 
ATOM   1319  N NH2   . ARG A 1 174 ? 0.610   37.651  30.892  1.00 16.48 ? 174  ARG A NH2   1 
ATOM   1320  N N     . ILE A 1 175 ? 8.743   40.512  33.184  1.00 12.48 ? 175  ILE A N     1 
ATOM   1321  C CA    . ILE A 1 175 ? 10.157  40.835  33.225  1.00 12.26 ? 175  ILE A CA    1 
ATOM   1322  C C     . ILE A 1 175 ? 10.823  40.260  34.476  1.00 13.41 ? 175  ILE A C     1 
ATOM   1323  O O     . ILE A 1 175 ? 11.923  39.701  34.407  1.00 12.94 ? 175  ILE A O     1 
ATOM   1324  C CB    . ILE A 1 175 ? 10.377  42.346  33.141  1.00 12.26 ? 175  ILE A CB    1 
ATOM   1325  C CG1   . ILE A 1 175 ? 10.081  42.836  31.730  1.00 10.71 ? 175  ILE A CG1   1 
ATOM   1326  C CG2   . ILE A 1 175 ? 11.790  42.749  33.620  1.00 10.67 ? 175  ILE A CG2   1 
ATOM   1327  C CD1   . ILE A 1 175 ? 9.944   44.347  31.636  1.00 10.00 ? 175  ILE A CD1   1 
ATOM   1328  N N     . ILE A 1 176 ? 10.144  40.399  35.615  1.00 14.78 ? 176  ILE A N     1 
ATOM   1329  C CA    . ILE A 1 176 ? 10.668  39.924  36.906  1.00 15.65 ? 176  ILE A CA    1 
ATOM   1330  C C     . ILE A 1 176 ? 10.807  38.391  36.931  1.00 16.16 ? 176  ILE A C     1 
ATOM   1331  O O     . ILE A 1 176 ? 11.882  37.858  37.236  1.00 15.90 ? 176  ILE A O     1 
ATOM   1332  C CB    . ILE A 1 176 ? 9.780   40.400  38.076  1.00 16.01 ? 176  ILE A CB    1 
ATOM   1333  C CG1   . ILE A 1 176 ? 9.880   41.934  38.229  1.00 16.98 ? 176  ILE A CG1   1 
ATOM   1334  C CG2   . ILE A 1 176 ? 10.156  39.682  39.372  1.00 14.73 ? 176  ILE A CG2   1 
ATOM   1335  C CD1   . ILE A 1 176 ? 8.686   42.601  38.989  1.00 15.41 ? 176  ILE A CD1   1 
ATOM   1336  N N     . ASP A 1 177 ? 9.737   37.689  36.565  1.00 16.49 ? 177  ASP A N     1 
ATOM   1337  C CA    . ASP A 1 177 ? 9.778   36.243  36.575  1.00 16.91 ? 177  ASP A CA    1 
ATOM   1338  C C     . ASP A 1 177 ? 10.828  35.717  35.599  1.00 17.09 ? 177  ASP A C     1 
ATOM   1339  O O     . ASP A 1 177 ? 11.446  34.702  35.872  1.00 17.80 ? 177  ASP A O     1 
ATOM   1340  C CB    . ASP A 1 177 ? 8.405   35.619  36.288  1.00 16.59 ? 177  ASP A CB    1 
ATOM   1341  C CG    . ASP A 1 177 ? 8.449   34.097  36.339  1.00 18.74 ? 177  ASP A CG    1 
ATOM   1342  O OD1   . ASP A 1 177 ? 8.549   33.445  35.267  1.00 19.70 ? 177  ASP A OD1   1 
ATOM   1343  O OD2   . ASP A 1 177 ? 8.456   33.542  37.458  1.00 19.54 ? 177  ASP A OD2   1 
ATOM   1344  N N     . SER A 1 178 ? 11.043  36.398  34.477  1.00 17.14 ? 178  SER A N     1 
ATOM   1345  C CA    . SER A 1 178 ? 11.983  35.894  33.468  1.00 17.47 ? 178  SER A CA    1 
ATOM   1346  C C     . SER A 1 178 ? 13.437  36.369  33.650  1.00 17.94 ? 178  SER A C     1 
ATOM   1347  O O     . SER A 1 178 ? 14.353  35.794  33.073  1.00 17.75 ? 178  SER A O     1 
ATOM   1348  C CB    . SER A 1 178 ? 11.493  36.254  32.063  1.00 17.22 ? 178  SER A CB    1 
ATOM   1349  O OG    . SER A 1 178 ? 11.518  37.662  31.883  1.00 17.55 ? 178  SER A OG    1 
ATOM   1350  N N     . SER A 1 179 ? 13.652  37.415  34.449  1.00 18.68 ? 179  SER A N     1 
ATOM   1351  C CA    . SER A 1 179 ? 14.976  38.037  34.578  1.00 18.98 ? 179  SER A CA    1 
ATOM   1352  C C     . SER A 1 179 ? 15.479  38.511  33.193  1.00 19.07 ? 179  SER A C     1 
ATOM   1353  O O     . SER A 1 179 ? 16.661  38.341  32.859  1.00 19.62 ? 179  SER A O     1 
ATOM   1354  C CB    . SER A 1 179 ? 15.995  37.083  35.243  1.00 19.00 ? 179  SER A CB    1 
ATOM   1355  O OG    . SER A 1 179 ? 15.678  36.759  36.604  1.00 20.15 ? 179  SER A OG    1 
ATOM   1356  N N     . SER A 1 180 ? 14.580  39.093  32.399  1.00 18.44 ? 180  SER A N     1 
ATOM   1357  C CA    . SER A 1 180 ? 14.940  39.686  31.101  1.00 18.20 ? 180  SER A CA    1 
ATOM   1358  C C     . SER A 1 180 ? 16.031  40.742  31.246  1.00 17.91 ? 180  SER A C     1 
ATOM   1359  O O     . SER A 1 180 ? 15.950  41.652  32.108  1.00 17.81 ? 180  SER A O     1 
ATOM   1360  C CB    . SER A 1 180 ? 13.717  40.345  30.417  1.00 18.39 ? 180  SER A CB    1 
ATOM   1361  O OG    . SER A 1 180 ? 12.624  39.459  30.308  1.00 17.91 ? 180  SER A OG    1 
ATOM   1362  N N     . ARG A 1 181 ? 17.016  40.648  30.361  1.00 17.42 ? 181  ARG A N     1 
ATOM   1363  C CA    . ARG A 1 181 ? 18.213  41.494  30.420  1.00 17.47 ? 181  ARG A CA    1 
ATOM   1364  C C     . ARG A 1 181 ? 18.056  42.752  29.553  1.00 16.33 ? 181  ARG A C     1 
ATOM   1365  O O     . ARG A 1 181 ? 18.811  43.742  29.682  1.00 15.99 ? 181  ARG A O     1 
ATOM   1366  C CB    . ARG A 1 181 ? 19.419  40.657  29.975  1.00 18.37 ? 181  ARG A CB    1 
ATOM   1367  C CG    . ARG A 1 181 ? 19.966  39.716  31.047  1.00 20.07 ? 181  ARG A CG    1 
ATOM   1368  C CD    . ARG A 1 181 ? 21.047  40.461  31.823  1.00 24.45 ? 181  ARG A CD    1 
ATOM   1369  N NE    . ARG A 1 181 ? 21.507  39.796  33.048  1.00 28.24 ? 181  ARG A NE    1 
ATOM   1370  C CZ    . ARG A 1 181 ? 21.283  40.233  34.292  1.00 29.07 ? 181  ARG A CZ    1 
ATOM   1371  N NH1   . ARG A 1 181 ? 20.569  41.334  34.513  1.00 29.58 ? 181  ARG A NH1   1 
ATOM   1372  N NH2   . ARG A 1 181 ? 21.783  39.565  35.327  1.00 28.95 ? 181  ARG A NH2   1 
ATOM   1373  N N     . LEU A 1 182 ? 17.027  42.687  28.706  1.00 15.05 ? 182  LEU A N     1 
ATOM   1374  C CA    . LEU A 1 182 ? 16.756  43.611  27.628  1.00 14.08 ? 182  LEU A CA    1 
ATOM   1375  C C     . LEU A 1 182 ? 15.246  43.663  27.364  1.00 13.77 ? 182  LEU A C     1 
ATOM   1376  O O     . LEU A 1 182 ? 14.546  42.649  27.453  1.00 13.29 ? 182  LEU A O     1 
ATOM   1377  C CB    . LEU A 1 182 ? 17.455  43.106  26.362  1.00 13.44 ? 182  LEU A CB    1 
ATOM   1378  C CG    . LEU A 1 182 ? 17.376  43.976  25.106  1.00 14.37 ? 182  LEU A CG    1 
ATOM   1379  C CD1   . LEU A 1 182 ? 18.255  45.203  25.240  1.00 12.21 ? 182  LEU A CD1   1 
ATOM   1380  C CD2   . LEU A 1 182 ? 17.801  43.184  23.907  1.00 13.22 ? 182  LEU A CD2   1 
ATOM   1381  N N     . VAL A 1 183 ? 14.747  44.850  27.038  1.00 13.35 ? 183  VAL A N     1 
ATOM   1382  C CA    . VAL A 1 183 ? 13.400  45.001  26.486  1.00 12.67 ? 183  VAL A CA    1 
ATOM   1383  C C     . VAL A 1 183 ? 13.520  45.604  25.083  1.00 12.95 ? 183  VAL A C     1 
ATOM   1384  O O     . VAL A 1 183 ? 14.213  46.621  24.891  1.00 13.23 ? 183  VAL A O     1 
ATOM   1385  C CB    . VAL A 1 183 ? 12.515  45.922  27.357  1.00 12.29 ? 183  VAL A CB    1 
ATOM   1386  C CG1   . VAL A 1 183 ? 11.170  46.156  26.691  1.00 11.20 ? 183  VAL A CG1   1 
ATOM   1387  C CG2   . VAL A 1 183 ? 12.354  45.349  28.758  1.00 11.46 ? 183  VAL A CG2   1 
ATOM   1388  N N     . ILE A 1 184 ? 12.853  44.980  24.113  1.00 12.64 ? 184  ILE A N     1 
ATOM   1389  C CA    . ILE A 1 184 ? 12.773  45.533  22.757  1.00 12.29 ? 184  ILE A CA    1 
ATOM   1390  C C     . ILE A 1 184 ? 11.347  45.971  22.495  1.00 11.95 ? 184  ILE A C     1 
ATOM   1391  O O     . ILE A 1 184 ? 10.434  45.169  22.586  1.00 11.53 ? 184  ILE A O     1 
ATOM   1392  C CB    . ILE A 1 184 ? 13.170  44.538  21.631  1.00 12.18 ? 184  ILE A CB    1 
ATOM   1393  C CG1   . ILE A 1 184 ? 14.595  44.018  21.813  1.00 11.74 ? 184  ILE A CG1   1 
ATOM   1394  C CG2   . ILE A 1 184 ? 13.029  45.245  20.309  1.00 11.56 ? 184  ILE A CG2   1 
ATOM   1395  C CD1   . ILE A 1 184 ? 14.966  42.793  20.979  1.00 11.57 ? 184  ILE A CD1   1 
ATOM   1396  N N     . THR A 1 185 ? 11.179  47.240  22.150  1.00 11.83 ? 185  THR A N     1 
ATOM   1397  C CA    . THR A 1 185 ? 9.864   47.795  21.982  1.00 11.87 ? 185  THR A CA    1 
ATOM   1398  C C     . THR A 1 185 ? 9.831   48.834  20.881  1.00 11.40 ? 185  THR A C     1 
ATOM   1399  O O     . THR A 1 185 ? 10.748  48.927  20.084  1.00 11.98 ? 185  THR A O     1 
ATOM   1400  C CB    . THR A 1 185 ? 9.304   48.359  23.309  1.00 12.31 ? 185  THR A CB    1 
ATOM   1401  O OG1   . THR A 1 185 ? 7.914   48.688  23.124  1.00 13.64 ? 185  THR A OG1   1 
ATOM   1402  C CG2   . THR A 1 185 ? 10.090  49.584  23.775  1.00 11.54 ? 185  THR A CG2   1 
ATOM   1403  N N     . ALA A 1 186 ? 8.741   49.581  20.812  1.00 11.21 ? 186  ALA A N     1 
ATOM   1404  C CA    . ALA A 1 186 ? 8.581   50.648  19.829  1.00 10.90 ? 186  ALA A CA    1 
ATOM   1405  C C     . ALA A 1 186 ? 8.088   51.921  20.537  1.00 10.73 ? 186  ALA A C     1 
ATOM   1406  O O     . ALA A 1 186 ? 7.544   51.836  21.657  1.00 10.56 ? 186  ALA A O     1 
ATOM   1407  C CB    . ALA A 1 186 ? 7.599   50.207  18.766  1.00 10.05 ? 186  ALA A CB    1 
ATOM   1408  N N     . ASP A 1 187 ? 8.289   53.088  19.916  1.00 10.80 ? 187  ASP A N     1 
ATOM   1409  C CA    . ASP A 1 187 ? 7.741   54.326  20.481  1.00 11.55 ? 187  ASP A CA    1 
ATOM   1410  C C     . ASP A 1 187 ? 6.235   54.234  20.646  1.00 12.09 ? 187  ASP A C     1 
ATOM   1411  O O     . ASP A 1 187 ? 5.728   54.430  21.752  1.00 11.94 ? 187  ASP A O     1 
ATOM   1412  C CB    . ASP A 1 187 ? 8.150   55.605  19.731  1.00 11.23 ? 187  ASP A CB    1 
ATOM   1413  C CG    . ASP A 1 187 ? 7.846   55.578  18.246  1.00 12.40 ? 187  ASP A CG    1 
ATOM   1414  O OD1   . ASP A 1 187 ? 7.258   54.612  17.721  1.00 10.86 ? 187  ASP A OD1   1 
ATOM   1415  O OD2   . ASP A 1 187 ? 8.214   56.586  17.586  1.00 16.56 ? 187  ASP A OD2   1 
ATOM   1416  N N     . GLU A 1 188 ? 5.537   53.894  19.559  1.00 12.66 ? 188  GLU A N     1 
ATOM   1417  C CA    . GLU A 1 188 ? 4.094   53.644  19.599  1.00 13.72 ? 188  GLU A CA    1 
ATOM   1418  C C     . GLU A 1 188 ? 3.720   52.569  18.588  1.00 13.96 ? 188  GLU A C     1 
ATOM   1419  O O     . GLU A 1 188 ? 4.416   52.390  17.589  1.00 13.46 ? 188  GLU A O     1 
ATOM   1420  C CB    . GLU A 1 188 ? 3.293   54.923  19.267  1.00 13.53 ? 188  GLU A CB    1 
ATOM   1421  C CG    . GLU A 1 188 ? 3.241   55.977  20.340  1.00 14.26 ? 188  GLU A CG    1 
ATOM   1422  C CD    . GLU A 1 188 ? 2.564   57.254  19.877  1.00 14.26 ? 188  GLU A CD    1 
ATOM   1423  O OE1   . GLU A 1 188 ? 2.672   57.614  18.679  1.00 14.50 ? 188  GLU A OE1   1 
ATOM   1424  O OE2   . GLU A 1 188 ? 1.915   57.899  20.723  1.00 14.49 ? 188  GLU A OE2   1 
ATOM   1425  N N     . GLY A 1 189 ? 2.619   51.872  18.856  1.00 14.38 ? 189  GLY A N     1 
ATOM   1426  C CA    . GLY A 1 189 ? 1.999   50.998  17.869  1.00 15.48 ? 189  GLY A CA    1 
ATOM   1427  C C     . GLY A 1 189 ? 0.867   51.776  17.239  1.00 16.21 ? 189  GLY A C     1 
ATOM   1428  O O     . GLY A 1 189 ? 0.383   52.750  17.822  1.00 17.23 ? 189  GLY A O     1 
ATOM   1429  N N     . VAL A 1 190 ? 0.451   51.370  16.044  1.00 16.30 ? 190  VAL A N     1 
ATOM   1430  C CA    . VAL A 1 190 ? -0.675  51.982  15.363  1.00 16.19 ? 190  VAL A CA    1 
ATOM   1431  C C     . VAL A 1 190 ? -1.719  50.878  15.142  1.00 16.60 ? 190  VAL A C     1 
ATOM   1432  O O     . VAL A 1 190 ? -1.398  49.781  14.660  1.00 16.75 ? 190  VAL A O     1 
ATOM   1433  C CB    . VAL A 1 190 ? -0.235  52.668  14.038  1.00 16.71 ? 190  VAL A CB    1 
ATOM   1434  C CG1   . VAL A 1 190 ? -1.414  53.233  13.303  1.00 16.54 ? 190  VAL A CG1   1 
ATOM   1435  C CG2   . VAL A 1 190 ? 0.756   53.803  14.314  1.00 16.25 ? 190  VAL A CG2   1 
ATOM   1436  N N     . ARG A 1 191 ? -2.951  51.141  15.576  1.00 16.77 ? 191  ARG A N     1 
ATOM   1437  C CA    . ARG A 1 191 ? -4.052  50.191  15.454  1.00 16.86 ? 191  ARG A CA    1 
ATOM   1438  C C     . ARG A 1 191 ? -5.354  50.988  15.356  1.00 17.00 ? 191  ARG A C     1 
ATOM   1439  O O     . ARG A 1 191 ? -5.598  51.928  16.138  1.00 16.58 ? 191  ARG A O     1 
ATOM   1440  C CB    . ARG A 1 191 ? -4.085  49.164  16.603  1.00 16.01 ? 191  ARG A CB    1 
ATOM   1441  C CG    . ARG A 1 191 ? -5.456  48.440  16.700  1.00 18.46 ? 191  ARG A CG    1 
ATOM   1442  C CD    . ARG A 1 191 ? -5.598  47.464  17.885  1.00 16.94 ? 191  ARG A CD    1 
ATOM   1443  N NE    . ARG A 1 191 ? -5.003  46.196  17.499  1.00 19.78 ? 191  ARG A NE    1 
ATOM   1444  C CZ    . ARG A 1 191 ? -5.630  45.022  17.444  1.00 17.65 ? 191  ARG A CZ    1 
ATOM   1445  N NH1   . ARG A 1 191 ? -6.909  44.888  17.820  1.00 18.92 ? 191  ARG A NH1   1 
ATOM   1446  N NH2   . ARG A 1 191 ? -4.949  43.970  17.035  1.00 13.47 ? 191  ARG A NH2   1 
ATOM   1447  N N     . ALA A 1 192 ? -6.167  50.620  14.360  1.00 17.48 ? 192  ALA A N     1 
ATOM   1448  C CA    . ALA A 1 192 ? -7.446  51.299  14.059  1.00 18.34 ? 192  ALA A CA    1 
ATOM   1449  C C     . ALA A 1 192 ? -7.402  52.847  13.987  1.00 18.48 ? 192  ALA A C     1 
ATOM   1450  O O     . ALA A 1 192 ? -8.350  53.478  14.411  1.00 18.91 ? 192  ALA A O     1 
ATOM   1451  C CB    . ALA A 1 192 ? -8.564  50.832  15.053  1.00 17.61 ? 192  ALA A CB    1 
ATOM   1452  N N     . GLY A 1 193 ? -6.325  53.435  13.451  1.00 18.93 ? 193  GLY A N     1 
ATOM   1453  C CA    . GLY A 1 193 ? -6.170  54.905  13.313  1.00 19.72 ? 193  GLY A CA    1 
ATOM   1454  C C     . GLY A 1 193 ? -5.676  55.628  14.567  1.00 20.77 ? 193  GLY A C     1 
ATOM   1455  O O     . GLY A 1 193 ? -5.607  56.865  14.622  1.00 20.30 ? 193  GLY A O     1 
ATOM   1456  N N     . ARG A 1 194 ? -5.337  54.828  15.574  1.00 21.98 ? 194  ARG A N     1 
ATOM   1457  C CA    . ARG A 1 194 ? -4.932  55.295  16.890  1.00 22.97 ? 194  ARG A CA    1 
ATOM   1458  C C     . ARG A 1 194 ? -3.550  54.776  17.260  1.00 22.68 ? 194  ARG A C     1 
ATOM   1459  O O     . ARG A 1 194 ? -3.120  53.708  16.789  1.00 22.09 ? 194  ARG A O     1 
ATOM   1460  C CB    . ARG A 1 194 ? -5.877  54.749  17.956  1.00 23.54 ? 194  ARG A CB    1 
ATOM   1461  C CG    . ARG A 1 194 ? -7.275  55.232  17.878  1.00 25.95 ? 194  ARG A CG    1 
ATOM   1462  C CD    . ARG A 1 194 ? -7.824  55.188  19.267  1.00 31.36 ? 194  ARG A CD    1 
ATOM   1463  N NE    . ARG A 1 194 ? -9.171  54.661  19.286  1.00 34.59 ? 194  ARG A NE    1 
ATOM   1464  C CZ    . ARG A 1 194 ? -9.488  53.442  19.699  1.00 38.14 ? 194  ARG A CZ    1 
ATOM   1465  N NH1   . ARG A 1 194 ? -8.544  52.612  20.151  1.00 38.32 ? 194  ARG A NH1   1 
ATOM   1466  N NH2   . ARG A 1 194 ? -10.763 53.065  19.674  1.00 40.23 ? 194  ARG A NH2   1 
ATOM   1467  N N     . SER A 1 195 ? -2.914  55.530  18.164  1.00 22.38 ? 195  SER A N     1 
ATOM   1468  C CA    . SER A 1 195 ? -1.601  55.247  18.740  1.00 21.97 ? 195  SER A CA    1 
ATOM   1469  C C     . SER A 1 195 ? -1.713  54.426  20.001  1.00 21.23 ? 195  SER A C     1 
ATOM   1470  O O     . SER A 1 195 ? -2.541  54.713  20.856  1.00 21.02 ? 195  SER A O     1 
ATOM   1471  C CB    . SER A 1 195 ? -0.912  56.565  19.088  1.00 22.08 ? 195  SER A CB    1 
ATOM   1472  O OG    . SER A 1 195 ? -0.210  57.038  17.956  1.00 23.85 ? 195  SER A OG    1 
ATOM   1473  N N     . ILE A 1 196 ? -0.873  53.407  20.113  1.00 20.78 ? 196  ILE A N     1 
ATOM   1474  C CA    . ILE A 1 196 ? -0.746  52.656  21.350  1.00 20.99 ? 196  ILE A CA    1 
ATOM   1475  C C     . ILE A 1 196 ? 0.581   53.065  22.038  1.00 20.70 ? 196  ILE A C     1 
ATOM   1476  O O     . ILE A 1 196 ? 1.650   52.987  21.433  1.00 20.54 ? 196  ILE A O     1 
ATOM   1477  C CB    . ILE A 1 196 ? -0.815  51.125  21.093  1.00 21.64 ? 196  ILE A CB    1 
ATOM   1478  C CG1   . ILE A 1 196 ? -2.071  50.739  20.287  1.00 21.36 ? 196  ILE A CG1   1 
ATOM   1479  C CG2   . ILE A 1 196 ? -0.726  50.345  22.410  1.00 22.39 ? 196  ILE A CG2   1 
ATOM   1480  C CD1   . ILE A 1 196 ? -3.419  51.412  20.778  1.00 22.16 ? 196  ILE A CD1   1 
ATOM   1481  N N     . PRO A 1 197 ? 0.502   53.556  23.285  1.00 20.61 ? 197  PRO A N     1 
ATOM   1482  C CA    . PRO A 1 197 ? 1.701   54.033  23.990  1.00 20.32 ? 197  PRO A CA    1 
ATOM   1483  C C     . PRO A 1 197 ? 2.655   52.928  24.496  1.00 19.94 ? 197  PRO A C     1 
ATOM   1484  O O     . PRO A 1 197 ? 2.875   52.807  25.709  1.00 21.11 ? 197  PRO A O     1 
ATOM   1485  C CB    . PRO A 1 197 ? 1.119   54.834  25.169  1.00 20.03 ? 197  PRO A CB    1 
ATOM   1486  C CG    . PRO A 1 197 ? -0.227  54.125  25.462  1.00 20.43 ? 197  PRO A CG    1 
ATOM   1487  C CD    . PRO A 1 197 ? -0.738  53.761  24.077  1.00 21.02 ? 197  PRO A CD    1 
ATOM   1488  N N     . LEU A 1 198 ? 3.276   52.188  23.582  1.00 18.26 ? 198  LEU A N     1 
ATOM   1489  C CA    . LEU A 1 198 ? 4.194   51.117  23.958  1.00 16.37 ? 198  LEU A CA    1 
ATOM   1490  C C     . LEU A 1 198 ? 5.389   51.516  24.838  1.00 16.03 ? 198  LEU A C     1 
ATOM   1491  O O     . LEU A 1 198 ? 5.521   50.995  25.940  1.00 15.91 ? 198  LEU A O     1 
ATOM   1492  C CB    . LEU A 1 198 ? 4.659   50.354  22.726  1.00 15.36 ? 198  LEU A CB    1 
ATOM   1493  C CG    . LEU A 1 198 ? 3.596   49.533  22.003  1.00 13.76 ? 198  LEU A CG    1 
ATOM   1494  C CD1   . LEU A 1 198 ? 4.152   48.986  20.705  1.00 12.46 ? 198  LEU A CD1   1 
ATOM   1495  C CD2   . LEU A 1 198 ? 3.018   48.406  22.861  1.00 11.66 ? 198  LEU A CD2   1 
ATOM   1496  N N     . LYS A 1 199 ? 6.251   52.421  24.359  1.00 15.79 ? 199  LYS A N     1 
ATOM   1497  C CA    . LYS A 1 199 ? 7.478   52.813  25.084  1.00 14.80 ? 199  LYS A CA    1 
ATOM   1498  C C     . LYS A 1 199 ? 7.149   53.433  26.457  1.00 15.01 ? 199  LYS A C     1 
ATOM   1499  O O     . LYS A 1 199 ? 7.727   53.053  27.468  1.00 15.53 ? 199  LYS A O     1 
ATOM   1500  C CB    . LYS A 1 199 ? 8.408   53.669  24.177  1.00 14.16 ? 199  LYS A CB    1 
ATOM   1501  C CG    . LYS A 1 199 ? 9.439   54.577  24.855  1.00 13.12 ? 199  LYS A CG    1 
ATOM   1502  C CD    . LYS A 1 199 ? 10.403  53.852  25.733  1.00 11.91 ? 199  LYS A CD    1 
ATOM   1503  C CE    . LYS A 1 199 ? 11.705  54.623  25.913  1.00 13.14 ? 199  LYS A CE    1 
ATOM   1504  N NZ    . LYS A 1 199 ? 11.752  55.570  27.045  1.00 10.71 ? 199  LYS A NZ    1 
ATOM   1505  N N     . LYS A 1 200 ? 6.198   54.351  26.508  1.00 15.24 ? 200  LYS A N     1 
ATOM   1506  C CA    . LYS A 1 200 ? 5.712   54.829  27.795  1.00 16.04 ? 200  LYS A CA    1 
ATOM   1507  C C     . LYS A 1 200 ? 5.295   53.683  28.743  1.00 15.79 ? 200  LYS A C     1 
ATOM   1508  O O     . LYS A 1 200 ? 5.635   53.726  29.943  1.00 16.60 ? 200  LYS A O     1 
ATOM   1509  C CB    . LYS A 1 200 ? 4.574   55.851  27.631  1.00 16.10 ? 200  LYS A CB    1 
ATOM   1510  C CG    . LYS A 1 200 ? 4.218   56.559  28.919  1.00 17.01 ? 200  LYS A CG    1 
ATOM   1511  C CD    . LYS A 1 200 ? 3.186   57.669  28.743  1.00 17.53 ? 200  LYS A CD    1 
ATOM   1512  C CE    . LYS A 1 200 ? 3.594   58.926  29.594  1.00 20.54 ? 200  LYS A CE    1 
ATOM   1513  N NZ    . LYS A 1 200 ? 4.735   59.730  28.954  1.00 19.60 ? 200  LYS A NZ    1 
ATOM   1514  N N     . ASN A 1 201 ? 4.590   52.666  28.233  1.00 14.47 ? 201  ASN A N     1 
ATOM   1515  C CA    . ASN A 1 201 ? 4.237   51.503  29.061  1.00 13.71 ? 201  ASN A CA    1 
ATOM   1516  C C     . ASN A 1 201 ? 5.485   50.805  29.570  1.00 13.62 ? 201  ASN A C     1 
ATOM   1517  O O     . ASN A 1 201 ? 5.510   50.293  30.695  1.00 13.90 ? 201  ASN A O     1 
ATOM   1518  C CB    . ASN A 1 201 ? 3.441   50.454  28.279  1.00 13.92 ? 201  ASN A CB    1 
ATOM   1519  C CG    . ASN A 1 201 ? 1.966   50.802  28.083  1.00 13.07 ? 201  ASN A CG    1 
ATOM   1520  O OD1   . ASN A 1 201 ? 1.442   51.805  28.570  1.00 9.66  ? 201  ASN A OD1   1 
ATOM   1521  N ND2   . ASN A 1 201 ? 1.283   49.930  27.354  1.00 13.82 ? 201  ASN A ND2   1 
ATOM   1522  N N     . VAL A 1 202 ? 6.515   50.753  28.734  1.00 12.76 ? 202  VAL A N     1 
ATOM   1523  C CA    . VAL A 1 202 ? 7.775   50.161  29.142  1.00 12.64 ? 202  VAL A CA    1 
ATOM   1524  C C     . VAL A 1 202 ? 8.385   51.054  30.216  1.00 13.38 ? 202  VAL A C     1 
ATOM   1525  O O     . VAL A 1 202 ? 8.900   50.549  31.227  1.00 13.35 ? 202  VAL A O     1 
ATOM   1526  C CB    . VAL A 1 202 ? 8.755   49.939  27.947  1.00 12.65 ? 202  VAL A CB    1 
ATOM   1527  C CG1   . VAL A 1 202 ? 10.163  49.628  28.430  1.00 9.30  ? 202  VAL A CG1   1 
ATOM   1528  C CG2   . VAL A 1 202 ? 8.230   48.846  27.017  1.00 11.42 ? 202  VAL A CG2   1 
ATOM   1529  N N     . ASP A 1 203 ? 8.304   52.369  30.029  1.00 14.05 ? 203  ASP A N     1 
ATOM   1530  C CA    . ASP A 1 203 ? 8.822   53.289  31.065  1.00 15.56 ? 203  ASP A CA    1 
ATOM   1531  C C     . ASP A 1 203 ? 8.194   52.925  32.409  1.00 15.67 ? 203  ASP A C     1 
ATOM   1532  O O     . ASP A 1 203 ? 8.918   52.593  33.348  1.00 16.67 ? 203  ASP A O     1 
ATOM   1533  C CB    . ASP A 1 203 ? 8.601   54.783  30.723  1.00 15.39 ? 203  ASP A CB    1 
ATOM   1534  C CG    . ASP A 1 203 ? 9.537   55.286  29.624  1.00 17.01 ? 203  ASP A CG    1 
ATOM   1535  O OD1   . ASP A 1 203 ? 10.444  54.520  29.220  1.00 18.12 ? 203  ASP A OD1   1 
ATOM   1536  O OD2   . ASP A 1 203 ? 9.367   56.447  29.162  1.00 18.67 ? 203  ASP A OD2   1 
ATOM   1537  N N     . ASP A 1 204 ? 6.862   52.929  32.477  1.00 15.28 ? 204  ASP A N     1 
ATOM   1538  C CA    . ASP A 1 204 ? 6.147   52.666  33.721  1.00 15.38 ? 204  ASP A CA    1 
ATOM   1539  C C     . ASP A 1 204 ? 6.454   51.306  34.322  1.00 15.35 ? 204  ASP A C     1 
ATOM   1540  O O     . ASP A 1 204 ? 6.686   51.221  35.529  1.00 15.92 ? 204  ASP A O     1 
ATOM   1541  C CB    . ASP A 1 204 ? 4.623   52.834  33.556  1.00 15.99 ? 204  ASP A CB    1 
ATOM   1542  C CG    . ASP A 1 204 ? 4.205   54.261  33.133  1.00 16.87 ? 204  ASP A CG    1 
ATOM   1543  O OD1   . ASP A 1 204 ? 3.058   54.426  32.662  1.00 17.64 ? 204  ASP A OD1   1 
ATOM   1544  O OD2   . ASP A 1 204 ? 5.011   55.218  33.257  1.00 19.48 ? 204  ASP A OD2   1 
ATOM   1545  N N     . ALA A 1 205 ? 6.465   50.241  33.512  1.00 15.28 ? 205  ALA A N     1 
ATOM   1546  C CA    . ALA A 1 205 ? 6.830   48.898  34.022  1.00 15.09 ? 205  ALA A CA    1 
ATOM   1547  C C     . ALA A 1 205 ? 8.229   48.884  34.693  1.00 15.44 ? 205  ALA A C     1 
ATOM   1548  O O     . ALA A 1 205 ? 8.424   48.256  35.756  1.00 15.07 ? 205  ALA A O     1 
ATOM   1549  C CB    . ALA A 1 205 ? 6.765   47.879  32.927  1.00 14.45 ? 205  ALA A CB    1 
ATOM   1550  N N     . LEU A 1 206 ? 9.179   49.599  34.088  1.00 15.34 ? 206  LEU A N     1 
ATOM   1551  C CA    . LEU A 1 206 ? 10.558  49.587  34.580  1.00 16.38 ? 206  LEU A CA    1 
ATOM   1552  C C     . LEU A 1 206 ? 10.806  50.368  35.877  1.00 16.81 ? 206  LEU A C     1 
ATOM   1553  O O     . LEU A 1 206 ? 11.905  50.307  36.416  1.00 16.39 ? 206  LEU A O     1 
ATOM   1554  C CB    . LEU A 1 206 ? 11.565  49.985  33.500  1.00 16.08 ? 206  LEU A CB    1 
ATOM   1555  C CG    . LEU A 1 206 ? 11.813  48.979  32.374  1.00 15.91 ? 206  LEU A CG    1 
ATOM   1556  C CD1   . LEU A 1 206 ? 13.072  49.379  31.672  1.00 15.99 ? 206  LEU A CD1   1 
ATOM   1557  C CD2   . LEU A 1 206 ? 11.927  47.551  32.886  1.00 15.25 ? 206  LEU A CD2   1 
ATOM   1558  N N     . LYS A 1 207 ? 9.774   51.050  36.387  1.00 17.46 ? 207  LYS A N     1 
ATOM   1559  C CA    . LYS A 1 207 ? 9.864   51.792  37.660  1.00 17.53 ? 207  LYS A CA    1 
ATOM   1560  C C     . LYS A 1 207 ? 9.445   50.986  38.874  1.00 17.98 ? 207  LYS A C     1 
ATOM   1561  O O     . LYS A 1 207 ? 9.719   51.387  39.995  1.00 18.54 ? 207  LYS A O     1 
ATOM   1562  C CB    . LYS A 1 207 ? 9.080   53.105  37.591  1.00 16.96 ? 207  LYS A CB    1 
ATOM   1563  C CG    . LYS A 1 207 ? 9.865   54.192  36.901  1.00 16.27 ? 207  LYS A CG    1 
ATOM   1564  C CD    . LYS A 1 207 ? 8.961   55.292  36.456  1.00 17.97 ? 207  LYS A CD    1 
ATOM   1565  C CE    . LYS A 1 207 ? 9.760   56.455  35.870  1.00 19.83 ? 207  LYS A CE    1 
ATOM   1566  N NZ    . LYS A 1 207 ? 8.843   57.436  35.199  1.00 21.45 ? 207  LYS A NZ    1 
ATOM   1567  N N     . ASN A 1 208 ? 8.773   49.859  38.634  1.00 18.59 ? 208  ASN A N     1 
ATOM   1568  C CA    . ASN A 1 208 ? 8.430   48.887  39.659  1.00 18.55 ? 208  ASN A CA    1 
ATOM   1569  C C     . ASN A 1 208 ? 9.714   48.471  40.346  1.00 19.29 ? 208  ASN A C     1 
ATOM   1570  O O     . ASN A 1 208 ? 10.657  48.039  39.679  1.00 19.69 ? 208  ASN A O     1 
ATOM   1571  C CB    . ASN A 1 208 ? 7.752   47.682  38.993  1.00 18.58 ? 208  ASN A CB    1 
ATOM   1572  C CG    . ASN A 1 208 ? 7.447   46.539  39.962  1.00 17.11 ? 208  ASN A CG    1 
ATOM   1573  O OD1   . ASN A 1 208 ? 8.287   46.143  40.769  1.00 15.68 ? 208  ASN A OD1   1 
ATOM   1574  N ND2   . ASN A 1 208 ? 6.247   45.978  39.846  1.00 14.83 ? 208  ASN A ND2   1 
ATOM   1575  N N     . PRO A 1 209 ? 9.762   48.595  41.684  1.00 20.07 ? 209  PRO A N     1 
ATOM   1576  C CA    . PRO A 1 209 ? 11.048  48.455  42.375  1.00 19.91 ? 209  PRO A CA    1 
ATOM   1577  C C     . PRO A 1 209 ? 11.655  47.064  42.237  1.00 20.02 ? 209  PRO A C     1 
ATOM   1578  O O     . PRO A 1 209 ? 12.843  46.892  42.466  1.00 20.33 ? 209  PRO A O     1 
ATOM   1579  C CB    . PRO A 1 209 ? 10.706  48.768  43.839  1.00 20.06 ? 209  PRO A CB    1 
ATOM   1580  C CG    . PRO A 1 209 ? 9.208   48.563  43.967  1.00 19.99 ? 209  PRO A CG    1 
ATOM   1581  C CD    . PRO A 1 209 ? 8.636   48.866  42.616  1.00 20.35 ? 209  PRO A CD    1 
ATOM   1582  N N     . ASN A 1 210 ? 10.856  46.083  41.843  1.00 20.08 ? 210  ASN A N     1 
ATOM   1583  C CA    . ASN A 1 210 ? 11.333  44.715  41.789  1.00 20.23 ? 210  ASN A CA    1 
ATOM   1584  C C     . ASN A 1 210 ? 12.063  44.356  40.501  1.00 20.59 ? 210  ASN A C     1 
ATOM   1585  O O     . ASN A 1 210 ? 12.815  43.383  40.462  1.00 20.79 ? 210  ASN A O     1 
ATOM   1586  C CB    . ASN A 1 210 ? 10.180  43.754  42.019  1.00 20.33 ? 210  ASN A CB    1 
ATOM   1587  C CG    . ASN A 1 210 ? 9.733   43.733  43.448  1.00 19.98 ? 210  ASN A CG    1 
ATOM   1588  O OD1   . ASN A 1 210 ? 10.476  43.320  44.322  1.00 21.38 ? 210  ASN A OD1   1 
ATOM   1589  N ND2   . ASN A 1 210 ? 8.514   44.164  43.694  1.00 18.41 ? 210  ASN A ND2   1 
ATOM   1590  N N     . VAL A 1 211 ? 11.824  45.126  39.447  1.00 20.18 ? 211  VAL A N     1 
ATOM   1591  C CA    . VAL A 1 211 ? 12.553  44.952  38.200  1.00 19.97 ? 211  VAL A CA    1 
ATOM   1592  C C     . VAL A 1 211 ? 14.015  45.321  38.449  1.00 19.89 ? 211  VAL A C     1 
ATOM   1593  O O     . VAL A 1 211 ? 14.327  46.464  38.824  1.00 19.83 ? 211  VAL A O     1 
ATOM   1594  C CB    . VAL A 1 211 ? 11.966  45.845  37.081  1.00 19.98 ? 211  VAL A CB    1 
ATOM   1595  C CG1   . VAL A 1 211 ? 12.854  45.832  35.855  1.00 18.28 ? 211  VAL A CG1   1 
ATOM   1596  C CG2   . VAL A 1 211 ? 10.524  45.414  36.753  1.00 20.30 ? 211  VAL A CG2   1 
ATOM   1597  N N     . THR A 1 212 ? 14.890  44.338  38.261  1.00 19.38 ? 212  THR A N     1 
ATOM   1598  C CA    . THR A 1 212 ? 16.316  44.492  38.554  1.00 19.08 ? 212  THR A CA    1 
ATOM   1599  C C     . THR A 1 212 ? 17.247  43.972  37.444  1.00 18.86 ? 212  THR A C     1 
ATOM   1600  O O     . THR A 1 212 ? 18.456  44.182  37.509  1.00 18.37 ? 212  THR A O     1 
ATOM   1601  C CB    . THR A 1 212 ? 16.703  43.788  39.902  1.00 19.31 ? 212  THR A CB    1 
ATOM   1602  O OG1   . THR A 1 212 ? 16.367  42.394  39.853  1.00 16.45 ? 212  THR A OG1   1 
ATOM   1603  C CG2   . THR A 1 212 ? 15.992  44.442  41.076  1.00 19.67 ? 212  THR A CG2   1 
ATOM   1604  N N     . SER A 1 213 ? 16.679  43.316  36.430  1.00 18.42 ? 213  SER A N     1 
ATOM   1605  C CA    . SER A 1 213 ? 17.462  42.579  35.443  1.00 17.85 ? 213  SER A CA    1 
ATOM   1606  C C     . SER A 1 213 ? 17.716  43.324  34.138  1.00 18.07 ? 213  SER A C     1 
ATOM   1607  O O     . SER A 1 213 ? 18.558  42.903  33.338  1.00 17.54 ? 213  SER A O     1 
ATOM   1608  C CB    . SER A 1 213 ? 16.780  41.246  35.134  1.00 17.74 ? 213  SER A CB    1 
ATOM   1609  O OG    . SER A 1 213 ? 15.371  41.391  35.021  1.00 17.56 ? 213  SER A OG    1 
ATOM   1610  N N     . VAL A 1 214 ? 16.976  44.405  33.905  1.00 18.27 ? 214  VAL A N     1 
ATOM   1611  C CA    . VAL A 1 214 ? 16.994  45.036  32.587  1.00 18.56 ? 214  VAL A CA    1 
ATOM   1612  C C     . VAL A 1 214 ? 18.113  46.026  32.555  1.00 19.32 ? 214  VAL A C     1 
ATOM   1613  O O     . VAL A 1 214 ? 18.226  46.871  33.443  1.00 19.42 ? 214  VAL A O     1 
ATOM   1614  C CB    . VAL A 1 214 ? 15.671  45.746  32.239  1.00 18.56 ? 214  VAL A CB    1 
ATOM   1615  C CG1   . VAL A 1 214 ? 15.779  46.486  30.914  1.00 17.65 ? 214  VAL A CG1   1 
ATOM   1616  C CG2   . VAL A 1 214 ? 14.545  44.747  32.192  1.00 18.56 ? 214  VAL A CG2   1 
ATOM   1617  N N     . GLU A 1 215 ? 18.943  45.912  31.525  1.00 20.10 ? 215  GLU A N     1 
ATOM   1618  C CA    . GLU A 1 215 ? 20.101  46.782  31.363  1.00 21.17 ? 215  GLU A CA    1 
ATOM   1619  C C     . GLU A 1 215 ? 19.832  47.821  30.266  1.00 19.91 ? 215  GLU A C     1 
ATOM   1620  O O     . GLU A 1 215 ? 20.184  48.989  30.421  1.00 19.24 ? 215  GLU A O     1 
ATOM   1621  C CB    . GLU A 1 215 ? 21.361  45.942  31.070  1.00 21.06 ? 215  GLU A CB    1 
ATOM   1622  C CG    . GLU A 1 215 ? 21.793  45.051  32.257  1.00 22.98 ? 215  GLU A CG    1 
ATOM   1623  C CD    . GLU A 1 215 ? 23.030  44.162  31.970  1.00 24.72 ? 215  GLU A CD    1 
ATOM   1624  O OE1   . GLU A 1 215 ? 23.786  43.874  32.938  1.00 29.10 ? 215  GLU A OE1   1 
ATOM   1625  O OE2   . GLU A 1 215 ? 23.247  43.738  30.800  1.00 28.27 ? 215  GLU A OE2   1 
ATOM   1626  N N     . HIS A 1 216 ? 19.180  47.392  29.178  1.00 18.81 ? 216  HIS A N     1 
ATOM   1627  C CA    . HIS A 1 216 ? 18.848  48.289  28.074  1.00 17.63 ? 216  HIS A CA    1 
ATOM   1628  C C     . HIS A 1 216 ? 17.457  48.047  27.547  1.00 17.14 ? 216  HIS A C     1 
ATOM   1629  O O     . HIS A 1 216 ? 16.932  46.923  27.644  1.00 17.58 ? 216  HIS A O     1 
ATOM   1630  C CB    . HIS A 1 216 ? 19.835  48.136  26.938  1.00 17.48 ? 216  HIS A CB    1 
ATOM   1631  C CG    . HIS A 1 216 ? 21.231  48.514  27.305  1.00 19.17 ? 216  HIS A CG    1 
ATOM   1632  N ND1   . HIS A 1 216 ? 21.622  49.825  27.495  1.00 19.78 ? 216  HIS A ND1   1 
ATOM   1633  C CD2   . HIS A 1 216 ? 22.329  47.756  27.524  1.00 20.50 ? 216  HIS A CD2   1 
ATOM   1634  C CE1   . HIS A 1 216 ? 22.905  49.856  27.803  1.00 20.30 ? 216  HIS A CE1   1 
ATOM   1635  N NE2   . HIS A 1 216 ? 23.359  48.615  27.824  1.00 21.87 ? 216  HIS A NE2   1 
ATOM   1636  N N     . VAL A 1 217 ? 16.852  49.114  27.021  1.00 15.89 ? 217  VAL A N     1 
ATOM   1637  C CA    . VAL A 1 217 ? 15.616  49.039  26.259  1.00 14.16 ? 217  VAL A CA    1 
ATOM   1638  C C     . VAL A 1 217 ? 16.017  49.486  24.848  1.00 13.80 ? 217  VAL A C     1 
ATOM   1639  O O     . VAL A 1 217 ? 16.659  50.531  24.698  1.00 13.40 ? 217  VAL A O     1 
ATOM   1640  C CB    . VAL A 1 217 ? 14.545  50.025  26.812  1.00 13.98 ? 217  VAL A CB    1 
ATOM   1641  C CG1   . VAL A 1 217 ? 13.283  50.032  25.933  1.00 12.38 ? 217  VAL A CG1   1 
ATOM   1642  C CG2   . VAL A 1 217 ? 14.164  49.672  28.214  1.00 13.47 ? 217  VAL A CG2   1 
ATOM   1643  N N     . ILE A 1 218 ? 15.647  48.706  23.829  1.00 12.76 ? 218  ILE A N     1 
ATOM   1644  C CA    . ILE A 1 218 ? 15.864  49.099  22.445  1.00 11.97 ? 218  ILE A CA    1 
ATOM   1645  C C     . ILE A 1 218 ? 14.529  49.512  21.905  1.00 11.92 ? 218  ILE A C     1 
ATOM   1646  O O     . ILE A 1 218 ? 13.549  48.795  22.084  1.00 12.14 ? 218  ILE A O     1 
ATOM   1647  C CB    . ILE A 1 218 ? 16.421  47.955  21.614  1.00 12.38 ? 218  ILE A CB    1 
ATOM   1648  C CG1   . ILE A 1 218 ? 17.804  47.577  22.146  1.00 10.78 ? 218  ILE A CG1   1 
ATOM   1649  C CG2   . ILE A 1 218 ? 16.434  48.321  20.092  1.00 11.09 ? 218  ILE A CG2   1 
ATOM   1650  C CD1   . ILE A 1 218 ? 18.349  46.312  21.553  1.00 14.01 ? 218  ILE A CD1   1 
ATOM   1651  N N     . VAL A 1 219 ? 14.493  50.670  21.245  1.00 11.50 ? 219  VAL A N     1 
ATOM   1652  C CA    . VAL A 1 219 ? 13.229  51.302  20.853  1.00 10.53 ? 219  VAL A CA    1 
ATOM   1653  C C     . VAL A 1 219 ? 13.149  51.494  19.343  1.00 10.65 ? 219  VAL A C     1 
ATOM   1654  O O     . VAL A 1 219 ? 13.997  52.175  18.754  1.00 10.74 ? 219  VAL A O     1 
ATOM   1655  C CB    . VAL A 1 219 ? 13.021  52.710  21.541  1.00 10.21 ? 219  VAL A CB    1 
ATOM   1656  C CG1   . VAL A 1 219 ? 11.650  53.276  21.218  1.00 8.28  ? 219  VAL A CG1   1 
ATOM   1657  C CG2   . VAL A 1 219 ? 13.238  52.661  23.034  1.00 8.08  ? 219  VAL A CG2   1 
ATOM   1658  N N     . LEU A 1 220 ? 12.103  50.949  18.729  1.00 10.85 ? 220  LEU A N     1 
ATOM   1659  C CA    . LEU A 1 220 ? 11.852  51.205  17.311  1.00 11.62 ? 220  LEU A CA    1 
ATOM   1660  C C     . LEU A 1 220 ? 11.142  52.541  17.112  1.00 12.39 ? 220  LEU A C     1 
ATOM   1661  O O     . LEU A 1 220 ? 10.103  52.798  17.714  1.00 12.54 ? 220  LEU A O     1 
ATOM   1662  C CB    . LEU A 1 220 ? 11.045  50.077  16.698  1.00 10.67 ? 220  LEU A CB    1 
ATOM   1663  C CG    . LEU A 1 220 ? 10.553  50.326  15.277  1.00 10.95 ? 220  LEU A CG    1 
ATOM   1664  C CD1   . LEU A 1 220 ? 11.724  50.344  14.225  1.00 10.07 ? 220  LEU A CD1   1 
ATOM   1665  C CD2   . LEU A 1 220 ? 9.473   49.299  14.911  1.00 5.24  ? 220  LEU A CD2   1 
ATOM   1666  N N     . LYS A 1 221 ? 11.721  53.410  16.287  1.00 13.41 ? 221  LYS A N     1 
ATOM   1667  C CA    . LYS A 1 221 ? 11.073  54.682  15.971  1.00 14.16 ? 221  LYS A CA    1 
ATOM   1668  C C     . LYS A 1 221 ? 9.959   54.409  14.954  1.00 14.45 ? 221  LYS A C     1 
ATOM   1669  O O     . LYS A 1 221 ? 10.184  54.475  13.749  1.00 14.55 ? 221  LYS A O     1 
ATOM   1670  C CB    . LYS A 1 221 ? 12.085  55.719  15.457  1.00 13.50 ? 221  LYS A CB    1 
ATOM   1671  C CG    . LYS A 1 221 ? 11.458  57.094  15.093  1.00 15.07 ? 221  LYS A CG    1 
ATOM   1672  C CD    . LYS A 1 221 ? 12.446  58.318  15.158  1.00 15.18 ? 221  LYS A CD    1 
ATOM   1673  C CE    . LYS A 1 221 ? 12.836  58.617  16.639  1.00 16.94 ? 221  LYS A CE    1 
ATOM   1674  N NZ    . LYS A 1 221 ? 13.699  59.803  16.966  1.00 15.87 ? 221  LYS A NZ    1 
ATOM   1675  N N     . ARG A 1 222 ? 8.758   54.091  15.438  1.00 14.81 ? 222  ARG A N     1 
ATOM   1676  C CA    . ARG A 1 222 ? 7.688   53.671  14.537  1.00 14.78 ? 222  ARG A CA    1 
ATOM   1677  C C     . ARG A 1 222 ? 6.809   54.825  14.103  1.00 15.33 ? 222  ARG A C     1 
ATOM   1678  O O     . ARG A 1 222 ? 6.512   54.938  12.928  1.00 14.79 ? 222  ARG A O     1 
ATOM   1679  C CB    . ARG A 1 222 ? 6.848   52.524  15.146  1.00 15.23 ? 222  ARG A CB    1 
ATOM   1680  C CG    . ARG A 1 222 ? 5.498   52.245  14.446  1.00 13.74 ? 222  ARG A CG    1 
ATOM   1681  C CD    . ARG A 1 222 ? 5.729   51.686  13.061  1.00 15.92 ? 222  ARG A CD    1 
ATOM   1682  N NE    . ARG A 1 222 ? 4.490   51.608  12.297  1.00 13.04 ? 222  ARG A NE    1 
ATOM   1683  C CZ    . ARG A 1 222 ? 3.980   52.614  11.596  1.00 13.60 ? 222  ARG A CZ    1 
ATOM   1684  N NH1   . ARG A 1 222 ? 4.593   53.804  11.555  1.00 10.79 ? 222  ARG A NH1   1 
ATOM   1685  N NH2   . ARG A 1 222 ? 2.829   52.437  10.963  1.00 10.66 ? 222  ARG A NH2   1 
ATOM   1686  N N     . THR A 1 223 ? 6.365   55.664  15.041  1.00 16.33 ? 223  THR A N     1 
ATOM   1687  C CA    . THR A 1 223 ? 5.470   56.785  14.688  1.00 16.84 ? 223  THR A CA    1 
ATOM   1688  C C     . THR A 1 223 ? 6.227   58.096  14.708  1.00 18.12 ? 223  THR A C     1 
ATOM   1689  O O     . THR A 1 223 ? 5.781   59.091  14.106  1.00 18.27 ? 223  THR A O     1 
ATOM   1690  C CB    . THR A 1 223 ? 4.255   56.954  15.653  1.00 16.56 ? 223  THR A CB    1 
ATOM   1691  O OG1   . THR A 1 223 ? 4.720   57.196  16.987  1.00 15.60 ? 223  THR A OG1   1 
ATOM   1692  C CG2   . THR A 1 223 ? 3.346   55.754  15.631  1.00 15.10 ? 223  THR A CG2   1 
ATOM   1693  N N     . GLY A 1 224 ? 7.350   58.104  15.427  1.00 18.93 ? 224  GLY A N     1 
ATOM   1694  C CA    . GLY A 1 224 ? 8.132   59.326  15.619  1.00 20.16 ? 224  GLY A CA    1 
ATOM   1695  C C     . GLY A 1 224 ? 7.591   60.211  16.712  1.00 21.07 ? 224  GLY A C     1 
ATOM   1696  O O     . GLY A 1 224 ? 7.878   61.381  16.735  1.00 21.77 ? 224  GLY A O     1 
ATOM   1697  N N     . SER A 1 225 ? 6.809   59.647  17.627  1.00 22.38 ? 225  SER A N     1 
ATOM   1698  C CA    . SER A 1 225 ? 6.244   60.375  18.774  1.00 23.14 ? 225  SER A CA    1 
ATOM   1699  C C     . SER A 1 225 ? 7.222   60.909  19.819  1.00 23.54 ? 225  SER A C     1 
ATOM   1700  O O     . SER A 1 225 ? 8.267   60.301  20.063  1.00 23.89 ? 225  SER A O     1 
ATOM   1701  C CB    . SER A 1 225 ? 5.284   59.462  19.508  1.00 23.13 ? 225  SER A CB    1 
ATOM   1702  O OG    . SER A 1 225 ? 4.001   59.990  19.387  1.00 26.20 ? 225  SER A OG    1 
ATOM   1703  N N     . ASP A 1 226 ? 6.844   62.011  20.471  1.00 23.97 ? 226  ASP A N     1 
ATOM   1704  C CA    . ASP A 1 226 ? 7.585   62.548  21.615  1.00 24.85 ? 226  ASP A CA    1 
ATOM   1705  C C     . ASP A 1 226 ? 7.562   61.584  22.805  1.00 24.54 ? 226  ASP A C     1 
ATOM   1706  O O     . ASP A 1 226 ? 6.542   61.491  23.511  1.00 25.54 ? 226  ASP A O     1 
ATOM   1707  C CB    . ASP A 1 226 ? 6.976   63.881  22.073  1.00 25.51 ? 226  ASP A CB    1 
ATOM   1708  C CG    . ASP A 1 226 ? 7.577   65.074  21.364  1.00 27.88 ? 226  ASP A CG    1 
ATOM   1709  O OD1   . ASP A 1 226 ? 8.716   64.946  20.849  1.00 29.18 ? 226  ASP A OD1   1 
ATOM   1710  O OD2   . ASP A 1 226 ? 6.910   66.140  21.337  1.00 29.80 ? 226  ASP A OD2   1 
ATOM   1711  N N     . ILE A 1 227 ? 8.667   60.883  23.052  1.00 23.05 ? 227  ILE A N     1 
ATOM   1712  C CA    . ILE A 1 227 ? 8.699   59.966  24.181  1.00 21.36 ? 227  ILE A CA    1 
ATOM   1713  C C     . ILE A 1 227 ? 9.747   60.397  25.189  1.00 20.97 ? 227  ILE A C     1 
ATOM   1714  O O     . ILE A 1 227 ? 10.689  61.091  24.834  1.00 20.63 ? 227  ILE A O     1 
ATOM   1715  C CB    . ILE A 1 227 ? 8.939   58.519  23.726  1.00 21.40 ? 227  ILE A CB    1 
ATOM   1716  C CG1   . ILE A 1 227 ? 10.161  58.447  22.816  1.00 19.64 ? 227  ILE A CG1   1 
ATOM   1717  C CG2   . ILE A 1 227 ? 7.682   57.970  23.012  1.00 20.24 ? 227  ILE A CG2   1 
ATOM   1718  C CD1   . ILE A 1 227 ? 10.731  57.082  22.690  1.00 17.89 ? 227  ILE A CD1   1 
ATOM   1719  N N     . ASP A 1 228 ? 9.561   60.021  26.451  1.00 20.33 ? 228  ASP A N     1 
ATOM   1720  C CA    . ASP A 1 228 ? 10.608  60.184  27.458  1.00 19.58 ? 228  ASP A CA    1 
ATOM   1721  C C     . ASP A 1 228 ? 11.808  59.307  27.112  1.00 18.95 ? 228  ASP A C     1 
ATOM   1722  O O     . ASP A 1 228 ? 11.653  58.242  26.557  1.00 19.56 ? 228  ASP A O     1 
ATOM   1723  C CB    . ASP A 1 228 ? 10.061  59.839  28.849  1.00 19.85 ? 228  ASP A CB    1 
ATOM   1724  C CG    . ASP A 1 228 ? 8.795   60.634  29.187  1.00 20.82 ? 228  ASP A CG    1 
ATOM   1725  O OD1   . ASP A 1 228 ? 7.895   60.074  29.847  1.00 21.03 ? 228  ASP A OD1   1 
ATOM   1726  O OD2   . ASP A 1 228 ? 8.691   61.814  28.769  1.00 21.03 ? 228  ASP A OD2   1 
ATOM   1727  N N     . TRP A 1 229 ? 13.015  59.751  27.424  1.00 18.40 ? 229  TRP A N     1 
ATOM   1728  C CA    . TRP A 1 229 ? 14.188  58.999  27.041  1.00 17.24 ? 229  TRP A CA    1 
ATOM   1729  C C     . TRP A 1 229 ? 15.100  58.925  28.268  1.00 17.14 ? 229  TRP A C     1 
ATOM   1730  O O     . TRP A 1 229 ? 15.275  59.906  28.958  1.00 16.75 ? 229  TRP A O     1 
ATOM   1731  C CB    . TRP A 1 229 ? 14.839  59.657  25.803  1.00 16.28 ? 229  TRP A CB    1 
ATOM   1732  C CG    . TRP A 1 229 ? 15.837  58.778  25.073  1.00 15.99 ? 229  TRP A CG    1 
ATOM   1733  C CD1   . TRP A 1 229 ? 17.196  58.850  25.159  1.00 15.71 ? 229  TRP A CD1   1 
ATOM   1734  C CD2   . TRP A 1 229 ? 15.561  57.694  24.167  1.00 15.69 ? 229  TRP A CD2   1 
ATOM   1735  N NE1   . TRP A 1 229 ? 17.787  57.889  24.377  1.00 14.72 ? 229  TRP A NE1   1 
ATOM   1736  C CE2   . TRP A 1 229 ? 16.814  57.162  23.756  1.00 16.11 ? 229  TRP A CE2   1 
ATOM   1737  C CE3   . TRP A 1 229 ? 14.391  57.118  23.671  1.00 14.92 ? 229  TRP A CE3   1 
ATOM   1738  C CZ2   . TRP A 1 229 ? 16.928  56.084  22.871  1.00 15.49 ? 229  TRP A CZ2   1 
ATOM   1739  C CZ3   . TRP A 1 229 ? 14.504  56.038  22.785  1.00 15.57 ? 229  TRP A CZ3   1 
ATOM   1740  C CH2   . TRP A 1 229 ? 15.766  55.534  22.403  1.00 15.66 ? 229  TRP A CH2   1 
ATOM   1741  N N     . GLN A 1 230 ? 15.617  57.743  28.583  1.00 17.44 ? 230  GLN A N     1 
ATOM   1742  C CA    . GLN A 1 230 ? 16.613  57.616  29.656  1.00 17.53 ? 230  GLN A CA    1 
ATOM   1743  C C     . GLN A 1 230 ? 17.973  57.336  29.044  1.00 18.03 ? 230  GLN A C     1 
ATOM   1744  O O     . GLN A 1 230 ? 18.204  56.255  28.482  1.00 17.42 ? 230  GLN A O     1 
ATOM   1745  C CB    . GLN A 1 230 ? 16.238  56.518  30.659  1.00 17.26 ? 230  GLN A CB    1 
ATOM   1746  C CG    . GLN A 1 230 ? 17.199  56.364  31.844  1.00 15.98 ? 230  GLN A CG    1 
ATOM   1747  C CD    . GLN A 1 230 ? 16.695  55.342  32.867  1.00 17.19 ? 230  GLN A CD    1 
ATOM   1748  O OE1   . GLN A 1 230 ? 15.576  55.469  33.379  1.00 15.81 ? 230  GLN A OE1   1 
ATOM   1749  N NE2   . GLN A 1 230 ? 17.511  54.317  33.156  1.00 15.83 ? 230  GLN A NE2   1 
ATOM   1750  N N     . GLU A 1 231 ? 18.853  58.326  29.165  1.00 18.85 ? 231  GLU A N     1 
ATOM   1751  C CA    . GLU A 1 231 ? 20.184  58.300  28.577  1.00 20.44 ? 231  GLU A CA    1 
ATOM   1752  C C     . GLU A 1 231 ? 21.021  57.143  29.162  1.00 20.07 ? 231  GLU A C     1 
ATOM   1753  O O     . GLU A 1 231 ? 21.042  56.930  30.390  1.00 20.57 ? 231  GLU A O     1 
ATOM   1754  C CB    . GLU A 1 231 ? 20.872  59.661  28.785  1.00 20.97 ? 231  GLU A CB    1 
ATOM   1755  C CG    . GLU A 1 231 ? 21.757  60.091  27.597  1.00 25.39 ? 231  GLU A CG    1 
ATOM   1756  C CD    . GLU A 1 231 ? 20.951  60.310  26.304  1.00 29.34 ? 231  GLU A CD    1 
ATOM   1757  O OE1   . GLU A 1 231 ? 20.073  61.201  26.284  1.00 29.36 ? 231  GLU A OE1   1 
ATOM   1758  O OE2   . GLU A 1 231 ? 21.185  59.575  25.314  1.00 31.37 ? 231  GLU A OE2   1 
ATOM   1759  N N     . GLY A 1 232 ? 21.666  56.374  28.287  1.00 18.98 ? 232  GLY A N     1 
ATOM   1760  C CA    . GLY A 1 232 ? 22.404  55.197  28.729  1.00 18.08 ? 232  GLY A CA    1 
ATOM   1761  C C     . GLY A 1 232 ? 21.581  53.930  28.620  1.00 17.91 ? 232  GLY A C     1 
ATOM   1762  O O     . GLY A 1 232 ? 22.043  52.950  28.023  1.00 18.67 ? 232  GLY A O     1 
ATOM   1763  N N     . ARG A 1 233 ? 20.362  53.930  29.174  1.00 16.69 ? 233  ARG A N     1 
ATOM   1764  C CA    . ARG A 1 233 ? 19.498  52.732  29.105  1.00 15.53 ? 233  ARG A CA    1 
ATOM   1765  C C     . ARG A 1 233 ? 18.848  52.531  27.724  1.00 15.03 ? 233  ARG A C     1 
ATOM   1766  O O     . ARG A 1 233 ? 18.864  51.424  27.185  1.00 14.97 ? 233  ARG A O     1 
ATOM   1767  C CB    . ARG A 1 233 ? 18.417  52.738  30.202  1.00 15.39 ? 233  ARG A CB    1 
ATOM   1768  C CG    . ARG A 1 233 ? 17.568  51.459  30.296  1.00 13.69 ? 233  ARG A CG    1 
ATOM   1769  C CD    . ARG A 1 233 ? 16.279  51.732  31.063  1.00 13.02 ? 233  ARG A CD    1 
ATOM   1770  N NE    . ARG A 1 233 ? 15.352  52.577  30.300  1.00 11.82 ? 233  ARG A NE    1 
ATOM   1771  C CZ    . ARG A 1 233 ? 14.206  53.071  30.764  1.00 12.24 ? 233  ARG A CZ    1 
ATOM   1772  N NH1   . ARG A 1 233 ? 13.828  52.819  32.009  1.00 13.19 ? 233  ARG A NH1   1 
ATOM   1773  N NH2   . ARG A 1 233 ? 13.424  53.820  29.984  1.00 11.30 ? 233  ARG A NH2   1 
ATOM   1774  N N     . ASP A 1 234 ? 18.281  53.597  27.161  1.00 14.39 ? 234  ASP A N     1 
ATOM   1775  C CA    . ASP A 1 234 ? 17.481  53.484  25.938  1.00 13.41 ? 234  ASP A CA    1 
ATOM   1776  C C     . ASP A 1 234 ? 18.327  53.691  24.700  1.00 12.92 ? 234  ASP A C     1 
ATOM   1777  O O     . ASP A 1 234 ? 19.151  54.612  24.630  1.00 12.86 ? 234  ASP A O     1 
ATOM   1778  C CB    . ASP A 1 234 ? 16.300  54.471  25.937  1.00 13.17 ? 234  ASP A CB    1 
ATOM   1779  C CG    . ASP A 1 234 ? 15.439  54.352  27.166  1.00 12.89 ? 234  ASP A CG    1 
ATOM   1780  O OD1   . ASP A 1 234 ? 15.416  53.268  27.777  1.00 13.76 ? 234  ASP A OD1   1 
ATOM   1781  O OD2   . ASP A 1 234 ? 14.792  55.345  27.545  1.00 14.67 ? 234  ASP A OD2   1 
ATOM   1782  N N     . LEU A 1 235 ? 18.096  52.824  23.725  1.00 12.24 ? 235  LEU A N     1 
ATOM   1783  C CA    . LEU A 1 235 ? 18.783  52.843  22.446  1.00 11.89 ? 235  LEU A CA    1 
ATOM   1784  C C     . LEU A 1 235 ? 17.760  52.800  21.285  1.00 11.88 ? 235  LEU A C     1 
ATOM   1785  O O     . LEU A 1 235 ? 16.777  52.034  21.321  1.00 12.63 ? 235  LEU A O     1 
ATOM   1786  C CB    . LEU A 1 235 ? 19.766  51.666  22.406  1.00 11.78 ? 235  LEU A CB    1 
ATOM   1787  C CG    . LEU A 1 235 ? 20.698  51.596  23.656  1.00 11.61 ? 235  LEU A CG    1 
ATOM   1788  C CD1   . LEU A 1 235 ? 21.356  50.218  23.893  1.00 8.94  ? 235  LEU A CD1   1 
ATOM   1789  C CD2   . LEU A 1 235 ? 21.739  52.713  23.656  1.00 5.39  ? 235  LEU A CD2   1 
ATOM   1790  N N     . TRP A 1 236 ? 17.946  53.658  20.287  1.00 11.13 ? 236  TRP A N     1 
ATOM   1791  C CA    . TRP A 1 236 ? 17.133  53.581  19.078  1.00 10.80 ? 236  TRP A CA    1 
ATOM   1792  C C     . TRP A 1 236 ? 17.526  52.368  18.269  1.00 11.15 ? 236  TRP A C     1 
ATOM   1793  O O     . TRP A 1 236 ? 18.731  52.031  18.125  1.00 11.26 ? 236  TRP A O     1 
ATOM   1794  C CB    . TRP A 1 236 ? 17.291  54.821  18.213  1.00 10.71 ? 236  TRP A CB    1 
ATOM   1795  C CG    . TRP A 1 236 ? 16.689  56.041  18.819  1.00 10.48 ? 236  TRP A CG    1 
ATOM   1796  C CD1   . TRP A 1 236 ? 17.356  57.149  19.290  1.00 9.77  ? 236  TRP A CD1   1 
ATOM   1797  C CD2   . TRP A 1 236 ? 15.291  56.289  19.029  1.00 9.78  ? 236  TRP A CD2   1 
ATOM   1798  N NE1   . TRP A 1 236 ? 16.449  58.079  19.769  1.00 9.60  ? 236  TRP A NE1   1 
ATOM   1799  C CE2   . TRP A 1 236 ? 15.178  57.576  19.622  1.00 10.37 ? 236  TRP A CE2   1 
ATOM   1800  C CE3   . TRP A 1 236 ? 14.127  55.552  18.776  1.00 8.14  ? 236  TRP A CE3   1 
ATOM   1801  C CZ2   . TRP A 1 236 ? 13.940  58.130  19.976  1.00 10.04 ? 236  TRP A CZ2   1 
ATOM   1802  C CZ3   . TRP A 1 236 ? 12.902  56.109  19.094  1.00 10.12 ? 236  TRP A CZ3   1 
ATOM   1803  C CH2   . TRP A 1 236 ? 12.815  57.385  19.701  1.00 10.94 ? 236  TRP A CH2   1 
ATOM   1804  N N     . TRP A 1 237 ? 16.500  51.713  17.739  1.00 11.07 ? 237  TRP A N     1 
ATOM   1805  C CA    . TRP A 1 237 ? 16.666  50.555  16.873  1.00 11.34 ? 237  TRP A CA    1 
ATOM   1806  C C     . TRP A 1 237 ? 17.566  50.930  15.703  1.00 11.61 ? 237  TRP A C     1 
ATOM   1807  O O     . TRP A 1 237 ? 18.531  50.242  15.398  1.00 11.15 ? 237  TRP A O     1 
ATOM   1808  C CB    . TRP A 1 237 ? 15.304  50.123  16.362  1.00 11.11 ? 237  TRP A CB    1 
ATOM   1809  C CG    . TRP A 1 237 ? 15.345  49.004  15.415  1.00 11.01 ? 237  TRP A CG    1 
ATOM   1810  C CD1   . TRP A 1 237 ? 15.701  49.045  14.088  1.00 10.98 ? 237  TRP A CD1   1 
ATOM   1811  C CD2   . TRP A 1 237 ? 14.974  47.657  15.692  1.00 11.46 ? 237  TRP A CD2   1 
ATOM   1812  N NE1   . TRP A 1 237 ? 15.598  47.796  13.529  1.00 10.31 ? 237  TRP A NE1   1 
ATOM   1813  C CE2   . TRP A 1 237 ? 15.139  46.924  14.490  1.00 11.37 ? 237  TRP A CE2   1 
ATOM   1814  C CE3   . TRP A 1 237 ? 14.507  46.994  16.838  1.00 10.57 ? 237  TRP A CE3   1 
ATOM   1815  C CZ2   . TRP A 1 237 ? 14.877  45.550  14.413  1.00 10.74 ? 237  TRP A CZ2   1 
ATOM   1816  C CZ3   . TRP A 1 237 ? 14.248  45.635  16.759  1.00 11.66 ? 237  TRP A CZ3   1 
ATOM   1817  C CH2   . TRP A 1 237 ? 14.431  44.925  15.553  1.00 11.16 ? 237  TRP A CH2   1 
ATOM   1818  N N     . ARG A 1 238 ? 17.245  52.035  15.053  1.00 12.75 ? 238  ARG A N     1 
ATOM   1819  C CA    . ARG A 1 238 ? 17.979  52.416  13.857  1.00 14.31 ? 238  ARG A CA    1 
ATOM   1820  C C     . ARG A 1 238 ? 19.474  52.659  14.161  1.00 15.07 ? 238  ARG A C     1 
ATOM   1821  O O     . ARG A 1 238 ? 20.328  52.096  13.487  1.00 15.52 ? 238  ARG A O     1 
ATOM   1822  C CB    . ARG A 1 238 ? 17.317  53.622  13.176  1.00 14.15 ? 238  ARG A CB    1 
ATOM   1823  C CG    . ARG A 1 238 ? 17.682  53.705  11.740  1.00 15.42 ? 238  ARG A CG    1 
ATOM   1824  C CD    . ARG A 1 238 ? 17.478  55.086  11.129  1.00 17.21 ? 238  ARG A CD    1 
ATOM   1825  N NE    . ARG A 1 238 ? 18.525  55.389  10.142  1.00 16.58 ? 238  ARG A NE    1 
ATOM   1826  C CZ    . ARG A 1 238 ? 18.726  54.726  8.998   1.00 16.78 ? 238  ARG A CZ    1 
ATOM   1827  N NH1   . ARG A 1 238 ? 17.946  53.718  8.670   1.00 18.50 ? 238  ARG A NH1   1 
ATOM   1828  N NH2   . ARG A 1 238 ? 19.715  55.066  8.172   1.00 16.88 ? 238  ARG A NH2   1 
ATOM   1829  N N     . ASP A 1 239 ? 19.783  53.456  15.190  1.00 15.55 ? 239  ASP A N     1 
ATOM   1830  C CA    . ASP A 1 239 ? 21.182  53.751  15.558  1.00 16.10 ? 239  ASP A CA    1 
ATOM   1831  C C     . ASP A 1 239 ? 21.985  52.473  15.688  1.00 16.12 ? 239  ASP A C     1 
ATOM   1832  O O     . ASP A 1 239 ? 23.139  52.406  15.269  1.00 16.59 ? 239  ASP A O     1 
ATOM   1833  C CB    . ASP A 1 239 ? 21.287  54.550  16.880  1.00 16.03 ? 239  ASP A CB    1 
ATOM   1834  C CG    . ASP A 1 239 ? 20.600  55.933  16.819  1.00 17.78 ? 239  ASP A CG    1 
ATOM   1835  O OD1   . ASP A 1 239 ? 20.182  56.414  15.747  1.00 15.79 ? 239  ASP A OD1   1 
ATOM   1836  O OD2   . ASP A 1 239 ? 20.448  56.554  17.886  1.00 21.54 ? 239  ASP A OD2   1 
ATOM   1837  N N     . LEU A 1 240 ? 21.376  51.446  16.262  1.00 16.41 ? 240  LEU A N     1 
ATOM   1838  C CA    . LEU A 1 240 ? 22.115  50.230  16.554  1.00 16.52 ? 240  LEU A CA    1 
ATOM   1839  C C     . LEU A 1 240 ? 22.334  49.374  15.321  1.00 16.36 ? 240  LEU A C     1 
ATOM   1840  O O     . LEU A 1 240 ? 23.476  49.014  15.000  1.00 16.10 ? 240  LEU A O     1 
ATOM   1841  C CB    . LEU A 1 240 ? 21.402  49.404  17.629  1.00 16.70 ? 240  LEU A CB    1 
ATOM   1842  C CG    . LEU A 1 240 ? 21.354  49.989  19.035  1.00 16.46 ? 240  LEU A CG    1 
ATOM   1843  C CD1   . LEU A 1 240 ? 20.653  48.970  19.984  1.00 13.89 ? 240  LEU A CD1   1 
ATOM   1844  C CD2   . LEU A 1 240 ? 22.761  50.366  19.494  1.00 13.12 ? 240  LEU A CD2   1 
ATOM   1845  N N     . ILE A 1 241 ? 21.232  49.031  14.659  1.00 16.14 ? 241  ILE A N     1 
ATOM   1846  C CA    . ILE A 1 241 ? 21.268  48.116  13.526  1.00 15.97 ? 241  ILE A CA    1 
ATOM   1847  C C     . ILE A 1 241 ? 22.124  48.710  12.383  1.00 16.58 ? 241  ILE A C     1 
ATOM   1848  O O     . ILE A 1 241 ? 22.835  47.982  11.693  1.00 15.79 ? 241  ILE A O     1 
ATOM   1849  C CB    . ILE A 1 241 ? 19.817  47.698  13.054  1.00 16.10 ? 241  ILE A CB    1 
ATOM   1850  C CG1   . ILE A 1 241 ? 19.830  46.259  12.509  1.00 16.40 ? 241  ILE A CG1   1 
ATOM   1851  C CG2   . ILE A 1 241 ? 19.249  48.686  12.023  1.00 13.45 ? 241  ILE A CG2   1 
ATOM   1852  C CD1   . ILE A 1 241 ? 18.475  45.582  12.441  1.00 14.89 ? 241  ILE A CD1   1 
ATOM   1853  N N     . GLU A 1 242 ? 22.058  50.029  12.200  1.00 17.10 ? 242  GLU A N     1 
ATOM   1854  C CA    . GLU A 1 242 ? 22.873  50.679  11.185  1.00 18.53 ? 242  GLU A CA    1 
ATOM   1855  C C     . GLU A 1 242 ? 24.358  50.370  11.382  1.00 18.72 ? 242  GLU A C     1 
ATOM   1856  O O     . GLU A 1 242 ? 25.071  50.144  10.408  1.00 18.91 ? 242  GLU A O     1 
ATOM   1857  C CB    . GLU A 1 242 ? 22.648  52.205  11.149  1.00 18.68 ? 242  GLU A CB    1 
ATOM   1858  C CG    . GLU A 1 242 ? 21.508  52.637  10.214  1.00 20.84 ? 242  GLU A CG    1 
ATOM   1859  C CD    . GLU A 1 242 ? 21.386  51.775  8.937   1.00 24.21 ? 242  GLU A CD    1 
ATOM   1860  O OE1   . GLU A 1 242 ? 22.273  51.866  8.035   1.00 22.89 ? 242  GLU A OE1   1 
ATOM   1861  O OE2   . GLU A 1 242 ? 20.379  51.017  8.844   1.00 25.38 ? 242  GLU A OE2   1 
ATOM   1862  N N     . LYS A 1 243 ? 24.796  50.346  12.646  1.00 18.59 ? 243  LYS A N     1 
ATOM   1863  C CA    . LYS A 1 243 ? 26.213  50.195  13.002  1.00 18.38 ? 243  LYS A CA    1 
ATOM   1864  C C     . LYS A 1 243 ? 26.683  48.731  12.996  1.00 17.87 ? 243  LYS A C     1 
ATOM   1865  O O     . LYS A 1 243 ? 27.842  48.447  13.257  1.00 18.04 ? 243  LYS A O     1 
ATOM   1866  C CB    . LYS A 1 243 ? 26.513  50.875  14.372  1.00 18.05 ? 243  LYS A CB    1 
ATOM   1867  N N     . ALA A 1 244 ? 25.787  47.807  12.685  1.00 17.83 ? 244  ALA A N     1 
ATOM   1868  C CA    . ALA A 1 244 ? 26.048  46.377  12.891  1.00 17.33 ? 244  ALA A CA    1 
ATOM   1869  C C     . ALA A 1 244 ? 26.336  45.674  11.572  1.00 17.56 ? 244  ALA A C     1 
ATOM   1870  O O     . ALA A 1 244 ? 25.700  45.951  10.542  1.00 18.03 ? 244  ALA A O     1 
ATOM   1871  C CB    . ALA A 1 244 ? 24.875  45.714  13.602  1.00 16.31 ? 244  ALA A CB    1 
ATOM   1872  N N     . SER A 1 245 ? 27.289  44.750  11.618  1.00 17.22 ? 245  SER A N     1 
ATOM   1873  C CA    . SER A 1 245 ? 27.644  43.950  10.460  1.00 16.71 ? 245  SER A CA    1 
ATOM   1874  C C     . SER A 1 245 ? 26.489  43.064  9.974   1.00 16.89 ? 245  SER A C     1 
ATOM   1875  O O     . SER A 1 245 ? 25.791  42.423  10.765  1.00 16.91 ? 245  SER A O     1 
ATOM   1876  C CB    . SER A 1 245 ? 28.856  43.086  10.792  1.00 16.40 ? 245  SER A CB    1 
ATOM   1877  O OG    . SER A 1 245 ? 29.111  42.182  9.748   1.00 15.20 ? 245  SER A OG    1 
ATOM   1878  N N     . PRO A 1 246 ? 26.286  43.015  8.659   1.00 17.33 ? 246  PRO A N     1 
ATOM   1879  C CA    . PRO A 1 246 ? 25.299  42.063  8.126   1.00 17.85 ? 246  PRO A CA    1 
ATOM   1880  C C     . PRO A 1 246 ? 25.817  40.604  8.036   1.00 18.75 ? 246  PRO A C     1 
ATOM   1881  O O     . PRO A 1 246 ? 25.090  39.728  7.548   1.00 18.29 ? 246  PRO A O     1 
ATOM   1882  C CB    . PRO A 1 246 ? 24.996  42.620  6.744   1.00 17.25 ? 246  PRO A CB    1 
ATOM   1883  C CG    . PRO A 1 246 ? 26.312  43.301  6.337   1.00 17.79 ? 246  PRO A CG    1 
ATOM   1884  C CD    . PRO A 1 246 ? 26.929  43.827  7.608   1.00 17.24 ? 246  PRO A CD    1 
ATOM   1885  N N     . GLU A 1 247 ? 27.049  40.368  8.507   1.00 19.65 ? 247  GLU A N     1 
ATOM   1886  C CA    . GLU A 1 247 ? 27.674  39.041  8.518   1.00 20.87 ? 247  GLU A CA    1 
ATOM   1887  C C     . GLU A 1 247 ? 27.521  38.400  9.883   1.00 20.44 ? 247  GLU A C     1 
ATOM   1888  O O     . GLU A 1 247 ? 27.890  38.989  10.910  1.00 20.44 ? 247  GLU A O     1 
ATOM   1889  C CB    . GLU A 1 247 ? 29.183  39.109  8.191   1.00 21.52 ? 247  GLU A CB    1 
ATOM   1890  C CG    . GLU A 1 247 ? 29.612  39.914  6.932   1.00 26.33 ? 247  GLU A CG    1 
ATOM   1891  C CD    . GLU A 1 247 ? 28.900  39.501  5.621   1.00 32.23 ? 247  GLU A CD    1 
ATOM   1892  O OE1   . GLU A 1 247 ? 28.137  38.502  5.611   1.00 32.88 ? 247  GLU A OE1   1 
ATOM   1893  O OE2   . GLU A 1 247 ? 29.116  40.194  4.590   1.00 34.53 ? 247  GLU A OE2   1 
ATOM   1894  N N     . HIS A 1 248 ? 26.983  37.188  9.884   1.00 20.38 ? 248  HIS A N     1 
ATOM   1895  C CA    . HIS A 1 248 ? 26.817  36.404  11.098  1.00 20.24 ? 248  HIS A CA    1 
ATOM   1896  C C     . HIS A 1 248 ? 26.666  34.942  10.740  1.00 21.06 ? 248  HIS A C     1 
ATOM   1897  O O     . HIS A 1 248 ? 25.791  34.573  9.952   1.00 20.73 ? 248  HIS A O     1 
ATOM   1898  C CB    . HIS A 1 248 ? 25.600  36.858  11.898  1.00 19.71 ? 248  HIS A CB    1 
ATOM   1899  C CG    . HIS A 1 248 ? 25.479  36.172  13.217  1.00 18.29 ? 248  HIS A CG    1 
ATOM   1900  N ND1   . HIS A 1 248 ? 24.655  35.087  13.418  1.00 16.48 ? 248  HIS A ND1   1 
ATOM   1901  C CD2   . HIS A 1 248 ? 26.104  36.392  14.396  1.00 16.28 ? 248  HIS A CD2   1 
ATOM   1902  C CE1   . HIS A 1 248 ? 24.769  34.673  14.667  1.00 14.55 ? 248  HIS A CE1   1 
ATOM   1903  N NE2   . HIS A 1 248 ? 25.637  35.452  15.283  1.00 16.09 ? 248  HIS A NE2   1 
ATOM   1904  N N     . GLN A 1 249 ? 27.539  34.112  11.296  1.00 22.34 ? 249  GLN A N     1 
ATOM   1905  C CA    . GLN A 1 249 ? 27.420  32.672  11.073  1.00 24.05 ? 249  GLN A CA    1 
ATOM   1906  C C     . GLN A 1 249 ? 26.525  32.129  12.182  1.00 23.79 ? 249  GLN A C     1 
ATOM   1907  O O     . GLN A 1 249 ? 26.702  32.492  13.339  1.00 24.03 ? 249  GLN A O     1 
ATOM   1908  C CB    . GLN A 1 249 ? 28.784  31.949  11.066  1.00 24.29 ? 249  GLN A CB    1 
ATOM   1909  C CG    . GLN A 1 249 ? 29.880  32.545  10.160  1.00 28.23 ? 249  GLN A CG    1 
ATOM   1910  C CD    . GLN A 1 249 ? 29.395  32.978  8.747   1.00 33.52 ? 249  GLN A CD    1 
ATOM   1911  O OE1   . GLN A 1 249 ? 29.298  34.188  8.444   1.00 35.92 ? 249  GLN A OE1   1 
ATOM   1912  N NE2   . GLN A 1 249 ? 29.122  31.995  7.876   1.00 34.11 ? 249  GLN A NE2   1 
ATOM   1913  N N     . PRO A 1 250 ? 25.541  31.285  11.833  1.00 24.10 ? 250  PRO A N     1 
ATOM   1914  C CA    . PRO A 1 250 ? 24.705  30.680  12.891  1.00 24.36 ? 250  PRO A CA    1 
ATOM   1915  C C     . PRO A 1 250 ? 25.433  29.539  13.629  1.00 24.66 ? 250  PRO A C     1 
ATOM   1916  O O     . PRO A 1 250 ? 25.983  28.648  12.990  1.00 25.70 ? 250  PRO A O     1 
ATOM   1917  C CB    . PRO A 1 250 ? 23.494  30.150  12.119  1.00 24.23 ? 250  PRO A CB    1 
ATOM   1918  C CG    . PRO A 1 250 ? 24.010  29.881  10.713  1.00 24.14 ? 250  PRO A CG    1 
ATOM   1919  C CD    . PRO A 1 250 ? 25.144  30.859  10.471  1.00 23.84 ? 250  PRO A CD    1 
ATOM   1920  N N     . GLU A 1 251 ? 25.456  29.562  14.952  1.00 24.56 ? 251  GLU A N     1 
ATOM   1921  C CA    . GLU A 1 251 ? 26.081  28.470  15.686  1.00 25.33 ? 251  GLU A CA    1 
ATOM   1922  C C     . GLU A 1 251 ? 25.095  27.332  15.910  1.00 24.11 ? 251  GLU A C     1 
ATOM   1923  O O     . GLU A 1 251 ? 23.887  27.562  16.003  1.00 24.44 ? 251  GLU A O     1 
ATOM   1924  C CB    . GLU A 1 251 ? 26.614  28.967  17.033  1.00 25.80 ? 251  GLU A CB    1 
ATOM   1925  C CG    . GLU A 1 251 ? 27.896  29.835  16.959  1.00 27.69 ? 251  GLU A CG    1 
ATOM   1926  C CD    . GLU A 1 251 ? 28.359  30.305  18.339  1.00 28.64 ? 251  GLU A CD    1 
ATOM   1927  O OE1   . GLU A 1 251 ? 28.965  31.405  18.420  1.00 31.98 ? 251  GLU A OE1   1 
ATOM   1928  O OE2   . GLU A 1 251 ? 28.127  29.565  19.345  1.00 33.45 ? 251  GLU A OE2   1 
ATOM   1929  N N     . ALA A 1 252 ? 25.594  26.103  16.005  1.00 23.03 ? 252  ALA A N     1 
ATOM   1930  C CA    . ALA A 1 252 ? 24.720  24.965  16.334  1.00 21.33 ? 252  ALA A CA    1 
ATOM   1931  C C     . ALA A 1 252 ? 24.036  25.178  17.681  1.00 20.14 ? 252  ALA A C     1 
ATOM   1932  O O     . ALA A 1 252 ? 24.676  25.590  18.646  1.00 19.71 ? 252  ALA A O     1 
ATOM   1933  C CB    . ALA A 1 252 ? 25.514  23.676  16.351  1.00 21.16 ? 252  ALA A CB    1 
ATOM   1934  N N     . MET A 1 253 ? 22.739  24.907  17.742  1.00 18.89 ? 253  MET A N     1 
ATOM   1935  C CA    . MET A 1 253 ? 22.031  24.853  19.018  1.00 18.08 ? 253  MET A CA    1 
ATOM   1936  C C     . MET A 1 253 ? 21.640  23.405  19.244  1.00 18.05 ? 253  MET A C     1 
ATOM   1937  O O     . MET A 1 253 ? 21.343  22.681  18.293  1.00 17.92 ? 253  MET A O     1 
ATOM   1938  C CB    . MET A 1 253 ? 20.773  25.735  19.015  1.00 17.75 ? 253  MET A CB    1 
ATOM   1939  C CG    . MET A 1 253 ? 21.020  27.210  18.653  1.00 17.73 ? 253  MET A CG    1 
ATOM   1940  S SD    . MET A 1 253 ? 22.110  27.961  19.861  1.00 18.31 ? 253  MET A SD    1 
ATOM   1941  C CE    . MET A 1 253 ? 23.019  29.138  18.851  1.00 15.12 ? 253  MET A CE    1 
ATOM   1942  N N     . ASN A 1 254 ? 21.631  22.973  20.495  1.00 17.66 ? 254  ASN A N     1 
ATOM   1943  C CA    . ASN A 1 254 ? 21.135  21.652  20.772  1.00 17.78 ? 254  ASN A CA    1 
ATOM   1944  C C     . ASN A 1 254 ? 19.605  21.576  20.634  1.00 16.92 ? 254  ASN A C     1 
ATOM   1945  O O     . ASN A 1 254 ? 18.889  22.506  20.997  1.00 16.21 ? 254  ASN A O     1 
ATOM   1946  C CB    . ASN A 1 254 ? 21.609  21.148  22.134  1.00 18.24 ? 254  ASN A CB    1 
ATOM   1947  C CG    . ASN A 1 254 ? 21.216  19.696  22.360  1.00 21.46 ? 254  ASN A CG    1 
ATOM   1948  O OD1   . ASN A 1 254 ? 20.138  19.406  22.897  1.00 22.35 ? 254  ASN A OD1   1 
ATOM   1949  N ND2   . ASN A 1 254 ? 22.057  18.768  21.873  1.00 23.85 ? 254  ASN A ND2   1 
ATOM   1950  N N     . ALA A 1 255 ? 19.108  20.458  20.110  1.00 16.51 ? 255  ALA A N     1 
ATOM   1951  C CA    . ALA A 1 255 ? 17.661  20.279  19.863  1.00 15.72 ? 255  ALA A CA    1 
ATOM   1952  C C     . ALA A 1 255 ? 16.777  20.645  21.057  1.00 15.78 ? 255  ALA A C     1 
ATOM   1953  O O     . ALA A 1 255 ? 15.651  21.140  20.871  1.00 15.25 ? 255  ALA A O     1 
ATOM   1954  C CB    . ALA A 1 255 ? 17.378  18.877  19.458  1.00 15.59 ? 255  ALA A CB    1 
ATOM   1955  N N     . GLU A 1 256 ? 17.295  20.382  22.264  1.00 15.28 ? 256  GLU A N     1 
ATOM   1956  C CA    . GLU A 1 256 ? 16.596  20.662  23.516  1.00 15.04 ? 256  GLU A CA    1 
ATOM   1957  C C     . GLU A 1 256 ? 17.023  21.993  24.151  1.00 14.71 ? 256  GLU A C     1 
ATOM   1958  O O     . GLU A 1 256 ? 16.713  22.251  25.320  1.00 15.25 ? 256  GLU A O     1 
ATOM   1959  C CB    . GLU A 1 256 ? 16.757  19.502  24.535  1.00 14.76 ? 256  GLU A CB    1 
ATOM   1960  C CG    . GLU A 1 256 ? 15.906  18.238  24.281  1.00 14.37 ? 256  GLU A CG    1 
ATOM   1961  C CD    . GLU A 1 256 ? 14.442  18.514  23.874  1.00 14.41 ? 256  GLU A CD    1 
ATOM   1962  O OE1   . GLU A 1 256 ? 13.856  19.517  24.323  1.00 15.69 ? 256  GLU A OE1   1 
ATOM   1963  O OE2   . GLU A 1 256 ? 13.862  17.717  23.100  1.00 13.70 ? 256  GLU A OE2   1 
ATOM   1964  N N     . ASP A 1 257 ? 17.727  22.837  23.401  1.00 13.76 ? 257  ASP A N     1 
ATOM   1965  C CA    . ASP A 1 257 ? 18.009  24.181  23.889  1.00 13.11 ? 257  ASP A CA    1 
ATOM   1966  C C     . ASP A 1 257 ? 16.736  25.019  23.919  1.00 13.10 ? 257  ASP A C     1 
ATOM   1967  O O     . ASP A 1 257 ? 15.912  24.925  23.017  1.00 12.88 ? 257  ASP A O     1 
ATOM   1968  C CB    . ASP A 1 257 ? 19.083  24.859  23.060  1.00 12.41 ? 257  ASP A CB    1 
ATOM   1969  C CG    . ASP A 1 257 ? 20.501  24.421  23.458  1.00 13.57 ? 257  ASP A CG    1 
ATOM   1970  O OD1   . ASP A 1 257 ? 20.720  23.839  24.555  1.00 12.60 ? 257  ASP A OD1   1 
ATOM   1971  O OD2   . ASP A 1 257 ? 21.414  24.663  22.650  1.00 14.24 ? 257  ASP A OD2   1 
ATOM   1972  N N     . PRO A 1 258 ? 16.547  25.803  24.989  1.00 13.66 ? 258  PRO A N     1 
ATOM   1973  C CA    . PRO A 1 258 ? 15.363  26.668  25.144  1.00 13.80 ? 258  PRO A CA    1 
ATOM   1974  C C     . PRO A 1 258 ? 15.256  27.635  23.976  1.00 14.11 ? 258  PRO A C     1 
ATOM   1975  O O     . PRO A 1 258 ? 16.257  28.244  23.582  1.00 13.84 ? 258  PRO A O     1 
ATOM   1976  C CB    . PRO A 1 258 ? 15.651  27.454  26.431  1.00 14.15 ? 258  PRO A CB    1 
ATOM   1977  C CG    . PRO A 1 258 ? 16.689  26.640  27.190  1.00 14.41 ? 258  PRO A CG    1 
ATOM   1978  C CD    . PRO A 1 258 ? 17.478  25.889  26.137  1.00 13.57 ? 258  PRO A CD    1 
ATOM   1979  N N     . LEU A 1 259 ? 14.059  27.757  23.412  1.00 14.32 ? 259  LEU A N     1 
ATOM   1980  C CA    . LEU A 1 259 ? 13.864  28.606  22.252  1.00 14.05 ? 259  LEU A CA    1 
ATOM   1981  C C     . LEU A 1 259 ? 13.144  29.856  22.687  1.00 14.49 ? 259  LEU A C     1 
ATOM   1982  O O     . LEU A 1 259 ? 13.619  30.959  22.412  1.00 15.35 ? 259  LEU A O     1 
ATOM   1983  C CB    . LEU A 1 259 ? 13.058  27.886  21.164  1.00 14.17 ? 259  LEU A CB    1 
ATOM   1984  C CG    . LEU A 1 259 ? 12.727  28.687  19.891  1.00 13.99 ? 259  LEU A CG    1 
ATOM   1985  C CD1   . LEU A 1 259 ? 13.991  28.978  19.065  1.00 14.41 ? 259  LEU A CD1   1 
ATOM   1986  C CD2   . LEU A 1 259 ? 11.698  27.971  19.037  1.00 13.31 ? 259  LEU A CD2   1 
ATOM   1987  N N     . PHE A 1 260 ? 11.997  29.691  23.352  1.00 13.97 ? 260  PHE A N     1 
ATOM   1988  C CA    . PHE A 1 260 ? 11.271  30.825  23.912  1.00 13.72 ? 260  PHE A CA    1 
ATOM   1989  C C     . PHE A 1 260 ? 10.415  30.484  25.130  1.00 14.58 ? 260  PHE A C     1 
ATOM   1990  O O     . PHE A 1 260 ? 10.161  29.285  25.434  1.00 14.66 ? 260  PHE A O     1 
ATOM   1991  C CB    . PHE A 1 260 ? 10.423  31.544  22.840  1.00 13.17 ? 260  PHE A CB    1 
ATOM   1992  C CG    . PHE A 1 260 ? 9.287   30.725  22.284  1.00 11.43 ? 260  PHE A CG    1 
ATOM   1993  C CD1   . PHE A 1 260 ? 8.067   30.630  22.968  1.00 10.00 ? 260  PHE A CD1   1 
ATOM   1994  C CD2   . PHE A 1 260 ? 9.427   30.068  21.071  1.00 9.82  ? 260  PHE A CD2   1 
ATOM   1995  C CE1   . PHE A 1 260 ? 6.995   29.880  22.455  1.00 8.63  ? 260  PHE A CE1   1 
ATOM   1996  C CE2   . PHE A 1 260 ? 8.379   29.299  20.548  1.00 11.62 ? 260  PHE A CE2   1 
ATOM   1997  C CZ    . PHE A 1 260 ? 7.146   29.208  21.244  1.00 10.98 ? 260  PHE A CZ    1 
ATOM   1998  N N     . ILE A 1 261 ? 9.987   31.557  25.804  1.00 15.01 ? 261  ILE A N     1 
ATOM   1999  C CA    . ILE A 1 261 ? 9.027   31.538  26.901  1.00 16.03 ? 261  ILE A CA    1 
ATOM   2000  C C     . ILE A 1 261 ? 7.797   32.300  26.443  1.00 15.68 ? 261  ILE A C     1 
ATOM   2001  O O     . ILE A 1 261 ? 7.932   33.387  25.888  1.00 15.56 ? 261  ILE A O     1 
ATOM   2002  C CB    . ILE A 1 261 ? 9.548   32.338  28.125  1.00 17.21 ? 261  ILE A CB    1 
ATOM   2003  C CG1   . ILE A 1 261 ? 10.887  31.806  28.634  1.00 17.95 ? 261  ILE A CG1   1 
ATOM   2004  C CG2   . ILE A 1 261 ? 8.535   32.303  29.267  1.00 18.20 ? 261  ILE A CG2   1 
ATOM   2005  C CD1   . ILE A 1 261 ? 10.797  30.393  29.036  1.00 20.82 ? 261  ILE A CD1   1 
ATOM   2006  N N     . LEU A 1 262 ? 6.612   31.738  26.673  1.00 15.44 ? 262  LEU A N     1 
ATOM   2007  C CA    . LEU A 1 262 ? 5.360   32.481  26.542  1.00 15.23 ? 262  LEU A CA    1 
ATOM   2008  C C     . LEU A 1 262 ? 4.527   32.402  27.808  1.00 14.80 ? 262  LEU A C     1 
ATOM   2009  O O     . LEU A 1 262 ? 3.995   31.336  28.154  1.00 14.46 ? 262  LEU A O     1 
ATOM   2010  C CB    . LEU A 1 262 ? 4.503   31.969  25.390  1.00 15.39 ? 262  LEU A CB    1 
ATOM   2011  C CG    . LEU A 1 262 ? 4.357   32.849  24.156  1.00 16.76 ? 262  LEU A CG    1 
ATOM   2012  C CD1   . LEU A 1 262 ? 3.349   32.181  23.231  1.00 16.61 ? 262  LEU A CD1   1 
ATOM   2013  C CD2   . LEU A 1 262 ? 3.920   34.271  24.500  1.00 15.04 ? 262  LEU A CD2   1 
ATOM   2014  N N     . TYR A 1 263 ? 4.408   33.539  28.480  1.00 14.03 ? 263  TYR A N     1 
ATOM   2015  C CA    . TYR A 1 263 ? 3.535   33.666  29.633  1.00 14.32 ? 263  TYR A CA    1 
ATOM   2016  C C     . TYR A 1 263 ? 2.061   33.417  29.287  1.00 14.77 ? 263  TYR A C     1 
ATOM   2017  O O     . TYR A 1 263 ? 1.515   34.010  28.356  1.00 14.07 ? 263  TYR A O     1 
ATOM   2018  C CB    . TYR A 1 263 ? 3.779   35.000  30.351  1.00 13.23 ? 263  TYR A CB    1 
ATOM   2019  C CG    . TYR A 1 263 ? 5.082   34.911  31.087  1.00 12.68 ? 263  TYR A CG    1 
ATOM   2020  C CD1   . TYR A 1 263 ? 6.276   35.332  30.499  1.00 11.61 ? 263  TYR A CD1   1 
ATOM   2021  C CD2   . TYR A 1 263 ? 5.137   34.332  32.354  1.00 10.92 ? 263  TYR A CD2   1 
ATOM   2022  C CE1   . TYR A 1 263 ? 7.487   35.224  31.184  1.00 10.65 ? 263  TYR A CE1   1 
ATOM   2023  C CE2   . TYR A 1 263 ? 6.322   34.206  33.029  1.00 9.64  ? 263  TYR A CE2   1 
ATOM   2024  C CZ    . TYR A 1 263 ? 7.503   34.646  32.443  1.00 11.63 ? 263  TYR A CZ    1 
ATOM   2025  O OH    . TYR A 1 263 ? 8.695   34.502  33.133  1.00 11.32 ? 263  TYR A OH    1 
ATOM   2026  N N     . THR A 1 264 ? 1.467   32.490  30.040  1.00 15.87 ? 264  THR A N     1 
ATOM   2027  C CA    . THR A 1 264 ? 0.126   31.979  29.804  1.00 17.02 ? 264  THR A CA    1 
ATOM   2028  C C     . THR A 1 264 ? -0.668  31.879  31.101  1.00 17.86 ? 264  THR A C     1 
ATOM   2029  O O     . THR A 1 264 ? -0.149  31.462  32.164  1.00 16.72 ? 264  THR A O     1 
ATOM   2030  C CB    . THR A 1 264 ? 0.187   30.596  29.202  1.00 17.09 ? 264  THR A CB    1 
ATOM   2031  O OG1   . THR A 1 264 ? 0.914   30.670  27.981  1.00 19.11 ? 264  THR A OG1   1 
ATOM   2032  C CG2   . THR A 1 264 ? -1.200  30.099  28.890  1.00 17.93 ? 264  THR A CG2   1 
ATOM   2033  N N     . SER A 1 265 ? -1.932  32.276  30.995  1.00 18.63 ? 265  SER A N     1 
ATOM   2034  C CA    . SER A 1 265 ? -2.873  32.180  32.107  1.00 19.71 ? 265  SER A CA    1 
ATOM   2035  C C     . SER A 1 265 ? -3.242  30.726  32.388  1.00 20.75 ? 265  SER A C     1 
ATOM   2036  O O     . SER A 1 265 ? -3.503  29.934  31.457  1.00 20.85 ? 265  SER A O     1 
ATOM   2037  C CB    . SER A 1 265 ? -4.153  32.939  31.776  1.00 19.46 ? 265  SER A CB    1 
ATOM   2038  O OG    . SER A 1 265 ? -3.906  34.311  31.614  1.00 18.71 ? 265  SER A OG    1 
ATOM   2039  N N     . GLY A 1 266 ? -3.289  30.388  33.674  1.00 21.89 ? 266  GLY A N     1 
ATOM   2040  C CA    . GLY A 1 266 ? -3.768  29.082  34.094  1.00 22.95 ? 266  GLY A CA    1 
ATOM   2041  C C     . GLY A 1 266 ? -4.881  29.177  35.104  1.00 24.22 ? 266  GLY A C     1 
ATOM   2042  O O     . GLY A 1 266 ? -5.319  30.273  35.459  1.00 23.70 ? 266  GLY A O     1 
ATOM   2043  N N     . SER A 1 267 ? -5.317  28.004  35.568  1.00 25.98 ? 267  SER A N     1 
ATOM   2044  C CA    . SER A 1 267 ? -6.381  27.836  36.556  1.00 27.19 ? 267  SER A CA    1 
ATOM   2045  C C     . SER A 1 267 ? -6.071  28.512  37.910  1.00 27.98 ? 267  SER A C     1 
ATOM   2046  O O     . SER A 1 267 ? -6.952  29.144  38.527  1.00 28.01 ? 267  SER A O     1 
ATOM   2047  C CB    . SER A 1 267 ? -6.614  26.337  36.758  1.00 27.54 ? 267  SER A CB    1 
ATOM   2048  O OG    . SER A 1 267 ? -7.945  26.078  37.188  1.00 30.10 ? 267  SER A OG    1 
ATOM   2049  N N     . THR A 1 268 ? -4.815  28.372  38.364  1.00 28.44 ? 268  THR A N     1 
ATOM   2050  C CA    . THR A 1 268 ? -4.342  28.972  39.633  1.00 28.19 ? 268  THR A CA    1 
ATOM   2051  C C     . THR A 1 268 ? -3.268  29.978  39.315  1.00 27.78 ? 268  THR A C     1 
ATOM   2052  O O     . THR A 1 268 ? -2.773  30.001  38.191  1.00 27.86 ? 268  THR A O     1 
ATOM   2053  C CB    . THR A 1 268 ? -3.669  27.945  40.549  1.00 28.14 ? 268  THR A CB    1 
ATOM   2054  O OG1   . THR A 1 268 ? -2.600  27.329  39.812  1.00 27.80 ? 268  THR A OG1   1 
ATOM   2055  C CG2   . THR A 1 268 ? -4.693  26.892  41.049  1.00 27.60 ? 268  THR A CG2   1 
ATOM   2056  N N     . GLY A 1 269 ? -2.929  30.793  40.316  1.00 27.45 ? 269  GLY A N     1 
ATOM   2057  C CA    . GLY A 1 269 ? -1.803  31.717  40.290  1.00 26.55 ? 269  GLY A CA    1 
ATOM   2058  C C     . GLY A 1 269 ? -1.802  32.748  39.176  1.00 26.42 ? 269  GLY A C     1 
ATOM   2059  O O     . GLY A 1 269 ? -2.776  32.915  38.444  1.00 26.05 ? 269  GLY A O     1 
ATOM   2060  N N     . LYS A 1 270 ? -0.682  33.444  39.060  1.00 26.10 ? 270  LYS A N     1 
ATOM   2061  C CA    . LYS A 1 270 ? -0.514  34.408  38.013  1.00 26.03 ? 270  LYS A CA    1 
ATOM   2062  C C     . LYS A 1 270 ? 0.101   33.692  36.796  1.00 25.35 ? 270  LYS A C     1 
ATOM   2063  O O     . LYS A 1 270 ? 0.504   32.521  36.898  1.00 25.28 ? 270  LYS A O     1 
ATOM   2064  C CB    . LYS A 1 270 ? 0.261   35.637  38.537  1.00 26.41 ? 270  LYS A CB    1 
ATOM   2065  C CG    . LYS A 1 270 ? -0.702  36.663  39.250  1.00 26.76 ? 270  LYS A CG    1 
ATOM   2066  C CD    . LYS A 1 270 ? -0.001  37.900  39.828  1.00 26.56 ? 270  LYS A CD    1 
ATOM   2067  N N     . PRO A 1 271 ? 0.127   34.354  35.627  1.00 24.40 ? 271  PRO A N     1 
ATOM   2068  C CA    . PRO A 1 271 ? 0.489   33.539  34.469  1.00 23.55 ? 271  PRO A CA    1 
ATOM   2069  C C     . PRO A 1 271 ? 1.944   33.022  34.536  1.00 22.82 ? 271  PRO A C     1 
ATOM   2070  O O     . PRO A 1 271 ? 2.825   33.709  35.048  1.00 22.37 ? 271  PRO A O     1 
ATOM   2071  C CB    . PRO A 1 271 ? 0.264   34.501  33.273  1.00 23.81 ? 271  PRO A CB    1 
ATOM   2072  C CG    . PRO A 1 271 ? -0.532  35.674  33.819  1.00 23.19 ? 271  PRO A CG    1 
ATOM   2073  C CD    . PRO A 1 271 ? -0.121  35.762  35.258  1.00 24.11 ? 271  PRO A CD    1 
ATOM   2074  N N     . LYS A 1 272 ? 2.164   31.813  34.018  1.00 22.27 ? 272  LYS A N     1 
ATOM   2075  C CA    . LYS A 1 272 ? 3.471   31.141  34.036  1.00 20.99 ? 272  LYS A CA    1 
ATOM   2076  C C     . LYS A 1 272 ? 4.117   31.036  32.647  1.00 19.49 ? 272  LYS A C     1 
ATOM   2077  O O     . LYS A 1 272 ? 3.433   31.052  31.615  1.00 19.61 ? 272  LYS A O     1 
ATOM   2078  C CB    . LYS A 1 272 ? 3.344   29.766  34.691  1.00 21.53 ? 272  LYS A CB    1 
ATOM   2079  C CG    . LYS A 1 272 ? 3.165   29.814  36.219  1.00 25.00 ? 272  LYS A CG    1 
ATOM   2080  C CD    . LYS A 1 272 ? 4.105   30.873  36.879  1.00 31.32 ? 272  LYS A CD    1 
ATOM   2081  C CE    . LYS A 1 272 ? 5.028   30.279  37.975  1.00 35.71 ? 272  LYS A CE    1 
ATOM   2082  N NZ    . LYS A 1 272 ? 4.285   29.898  39.243  1.00 38.66 ? 272  LYS A NZ    1 
ATOM   2083  N N     . GLY A 1 273 ? 5.438   30.942  32.627  1.00 17.16 ? 273  GLY A N     1 
ATOM   2084  C CA    . GLY A 1 273 ? 6.172   31.026  31.393  1.00 15.04 ? 273  GLY A CA    1 
ATOM   2085  C C     . GLY A 1 273 ? 6.372   29.682  30.729  1.00 14.26 ? 273  GLY A C     1 
ATOM   2086  O O     . GLY A 1 273 ? 7.347   28.954  31.035  1.00 14.50 ? 273  GLY A O     1 
ATOM   2087  N N     . VAL A 1 274 ? 5.457   29.354  29.814  1.00 12.72 ? 274  VAL A N     1 
ATOM   2088  C CA    . VAL A 1 274 ? 5.499   28.105  29.083  1.00 11.23 ? 274  VAL A CA    1 
ATOM   2089  C C     . VAL A 1 274 ? 6.762   28.097  28.208  1.00 11.72 ? 274  VAL A C     1 
ATOM   2090  O O     . VAL A 1 274 ? 6.963   29.008  27.386  1.00 12.28 ? 274  VAL A O     1 
ATOM   2091  C CB    . VAL A 1 274 ? 4.247   27.945  28.206  1.00 10.89 ? 274  VAL A CB    1 
ATOM   2092  C CG1   . VAL A 1 274 ? 4.321   26.665  27.386  1.00 8.32  ? 274  VAL A CG1   1 
ATOM   2093  C CG2   . VAL A 1 274 ? 3.010   27.998  29.046  1.00 8.63  ? 274  VAL A CG2   1 
ATOM   2094  N N     . LEU A 1 275 ? 7.601   27.076  28.387  1.00 11.23 ? 275  LEU A N     1 
ATOM   2095  C CA    . LEU A 1 275 ? 8.867   26.982  27.678  1.00 10.85 ? 275  LEU A CA    1 
ATOM   2096  C C     . LEU A 1 275 ? 8.881   25.991  26.508  1.00 11.02 ? 275  LEU A C     1 
ATOM   2097  O O     . LEU A 1 275 ? 8.508   24.829  26.662  1.00 10.65 ? 275  LEU A O     1 
ATOM   2098  C CB    . LEU A 1 275 ? 10.001  26.653  28.653  1.00 10.35 ? 275  LEU A CB    1 
ATOM   2099  C CG    . LEU A 1 275 ? 11.470  26.772  28.142  1.00 10.53 ? 275  LEU A CG    1 
ATOM   2100  C CD1   . LEU A 1 275 ? 12.459  27.157  29.247  1.00 2.56  ? 275  LEU A CD1   1 
ATOM   2101  C CD2   . LEU A 1 275 ? 11.960  25.515  27.358  1.00 5.77  ? 275  LEU A CD2   1 
ATOM   2102  N N     . HIS A 1 276 ? 9.359   26.458  25.351  1.00 11.56 ? 276  HIS A N     1 
ATOM   2103  C CA    . HIS A 1 276 ? 9.640   25.572  24.211  1.00 11.66 ? 276  HIS A CA    1 
ATOM   2104  C C     . HIS A 1 276 ? 11.133  25.466  23.889  1.00 12.19 ? 276  HIS A C     1 
ATOM   2105  O O     . HIS A 1 276 ? 11.904  26.450  23.976  1.00 12.39 ? 276  HIS A O     1 
ATOM   2106  C CB    . HIS A 1 276 ? 8.864   25.993  22.965  1.00 11.28 ? 276  HIS A CB    1 
ATOM   2107  C CG    . HIS A 1 276 ? 7.398   25.684  23.038  1.00 12.72 ? 276  HIS A CG    1 
ATOM   2108  N ND1   . HIS A 1 276 ? 6.889   24.422  22.805  1.00 13.82 ? 276  HIS A ND1   1 
ATOM   2109  C CD2   . HIS A 1 276 ? 6.331   26.471  23.326  1.00 11.64 ? 276  HIS A CD2   1 
ATOM   2110  C CE1   . HIS A 1 276 ? 5.577   24.439  22.963  1.00 13.21 ? 276  HIS A CE1   1 
ATOM   2111  N NE2   . HIS A 1 276 ? 5.212   25.671  23.273  1.00 15.08 ? 276  HIS A NE2   1 
ATOM   2112  N N     . THR A 1 277 ? 11.543  24.262  23.512  1.00 12.25 ? 277  THR A N     1 
ATOM   2113  C CA    . THR A 1 277 ? 12.865  24.071  22.971  1.00 11.78 ? 277  THR A CA    1 
ATOM   2114  C C     . THR A 1 277 ? 12.819  24.211  21.456  1.00 12.35 ? 277  THR A C     1 
ATOM   2115  O O     . THR A 1 277 ? 11.881  24.811  20.904  1.00 12.66 ? 277  THR A O     1 
ATOM   2116  C CB    . THR A 1 277 ? 13.471  22.764  23.431  1.00 12.35 ? 277  THR A CB    1 
ATOM   2117  O OG1   . THR A 1 277 ? 12.546  21.700  23.168  1.00 11.66 ? 277  THR A OG1   1 
ATOM   2118  C CG2   . THR A 1 277 ? 13.817  22.842  24.959  1.00 10.02 ? 277  THR A CG2   1 
ATOM   2119  N N     . THR A 1 278 ? 13.831  23.688  20.781  1.00 12.44 ? 278  THR A N     1 
ATOM   2120  C CA    . THR A 1 278 ? 14.117  24.096  19.415  1.00 12.47 ? 278  THR A CA    1 
ATOM   2121  C C     . THR A 1 278 ? 13.766  23.071  18.342  1.00 12.37 ? 278  THR A C     1 
ATOM   2122  O O     . THR A 1 278 ? 13.072  23.405  17.385  1.00 12.33 ? 278  THR A O     1 
ATOM   2123  C CB    . THR A 1 278 ? 15.620  24.466  19.287  1.00 12.98 ? 278  THR A CB    1 
ATOM   2124  O OG1   . THR A 1 278 ? 15.938  25.480  20.248  1.00 13.85 ? 278  THR A OG1   1 
ATOM   2125  C CG2   . THR A 1 278 ? 15.974  24.957  17.876  1.00 11.94 ? 278  THR A CG2   1 
ATOM   2126  N N     . GLY A 1 279 ? 14.285  21.848  18.466  1.00 12.25 ? 279  GLY A N     1 
ATOM   2127  C CA    . GLY A 1 279 ? 14.199  20.858  17.368  1.00 11.77 ? 279  GLY A CA    1 
ATOM   2128  C C     . GLY A 1 279 ? 12.778  20.337  17.178  1.00 11.55 ? 279  GLY A C     1 
ATOM   2129  O O     . GLY A 1 279 ? 12.156  20.568  16.133  1.00 10.45 ? 279  GLY A O     1 
ATOM   2130  N N     . GLY A 1 280 ? 12.285  19.652  18.218  1.00 11.33 ? 280  GLY A N     1 
ATOM   2131  C CA    . GLY A 1 280 ? 10.938  19.150  18.295  1.00 10.84 ? 280  GLY A CA    1 
ATOM   2132  C C     . GLY A 1 280 ? 9.930   20.222  17.974  1.00 11.41 ? 280  GLY A C     1 
ATOM   2133  O O     . GLY A 1 280 ? 9.047   19.995  17.133  1.00 11.91 ? 280  GLY A O     1 
ATOM   2134  N N     . TYR A 1 281 ? 10.053  21.400  18.605  1.00 11.31 ? 281  TYR A N     1 
ATOM   2135  C CA    . TYR A 1 281 ? 9.100   22.504  18.329  1.00 10.79 ? 281  TYR A CA    1 
ATOM   2136  C C     . TYR A 1 281 ? 9.026   22.854  16.860  1.00 10.32 ? 281  TYR A C     1 
ATOM   2137  O O     . TYR A 1 281 ? 7.937   22.977  16.306  1.00 10.83 ? 281  TYR A O     1 
ATOM   2138  C CB    . TYR A 1 281 ? 9.385   23.783  19.137  1.00 11.07 ? 281  TYR A CB    1 
ATOM   2139  C CG    . TYR A 1 281 ? 8.607   24.996  18.639  1.00 10.81 ? 281  TYR A CG    1 
ATOM   2140  C CD1   . TYR A 1 281 ? 7.277   25.162  18.958  1.00 11.39 ? 281  TYR A CD1   1 
ATOM   2141  C CD2   . TYR A 1 281 ? 9.212   25.964  17.824  1.00 11.03 ? 281  TYR A CD2   1 
ATOM   2142  C CE1   . TYR A 1 281 ? 6.552   26.265  18.499  1.00 12.46 ? 281  TYR A CE1   1 
ATOM   2143  C CE2   . TYR A 1 281 ? 8.507   27.056  17.349  1.00 9.69  ? 281  TYR A CE2   1 
ATOM   2144  C CZ    . TYR A 1 281 ? 7.176   27.199  17.697  1.00 11.95 ? 281  TYR A CZ    1 
ATOM   2145  O OH    . TYR A 1 281 ? 6.457   28.285  17.269  1.00 12.34 ? 281  TYR A OH    1 
ATOM   2146  N N     . LEU A 1 282 ? 10.182  23.017  16.238  1.00 9.73  ? 282  LEU A N     1 
ATOM   2147  C CA    . LEU A 1 282 ? 10.243  23.502  14.878  1.00 10.08 ? 282  LEU A CA    1 
ATOM   2148  C C     . LEU A 1 282 ? 9.802   22.482  13.818  1.00 10.44 ? 282  LEU A C     1 
ATOM   2149  O O     . LEU A 1 282 ? 9.098   22.848  12.858  1.00 10.85 ? 282  LEU A O     1 
ATOM   2150  C CB    . LEU A 1 282 ? 11.627  24.066  14.557  1.00 10.29 ? 282  LEU A CB    1 
ATOM   2151  C CG    . LEU A 1 282 ? 11.733  24.803  13.214  1.00 10.41 ? 282  LEU A CG    1 
ATOM   2152  C CD1   . LEU A 1 282 ? 10.700  25.948  13.158  1.00 8.50  ? 282  LEU A CD1   1 
ATOM   2153  C CD2   . LEU A 1 282 ? 13.154  25.309  12.975  1.00 9.90  ? 282  LEU A CD2   1 
ATOM   2154  N N     . VAL A 1 283 ? 10.195  21.222  13.986  1.00 10.09 ? 283  VAL A N     1 
ATOM   2155  C CA    . VAL A 1 283 ? 9.691   20.150  13.134  1.00 10.37 ? 283  VAL A CA    1 
ATOM   2156  C C     . VAL A 1 283 ? 8.176   20.137  13.187  1.00 10.46 ? 283  VAL A C     1 
ATOM   2157  O O     . VAL A 1 283 ? 7.511   20.098  12.150  1.00 10.26 ? 283  VAL A O     1 
ATOM   2158  C CB    . VAL A 1 283 ? 10.151  18.722  13.583  1.00 10.83 ? 283  VAL A CB    1 
ATOM   2159  C CG1   . VAL A 1 283 ? 9.451   17.670  12.738  1.00 10.84 ? 283  VAL A CG1   1 
ATOM   2160  C CG2   . VAL A 1 283 ? 11.647  18.545  13.476  1.00 10.38 ? 283  VAL A CG2   1 
ATOM   2161  N N     . TYR A 1 284 ? 7.636   20.166  14.405  1.00 10.67 ? 284  TYR A N     1 
ATOM   2162  C CA    . TYR A 1 284 ? 6.183   20.111  14.592  1.00 10.66 ? 284  TYR A CA    1 
ATOM   2163  C C     . TYR A 1 284 ? 5.460   21.321  13.969  1.00 10.62 ? 284  TYR A C     1 
ATOM   2164  O O     . TYR A 1 284 ? 4.441   21.151  13.285  1.00 9.47  ? 284  TYR A O     1 
ATOM   2165  C CB    . TYR A 1 284 ? 5.833   19.952  16.073  1.00 10.64 ? 284  TYR A CB    1 
ATOM   2166  C CG    . TYR A 1 284 ? 4.490   19.318  16.260  1.00 10.31 ? 284  TYR A CG    1 
ATOM   2167  C CD1   . TYR A 1 284 ? 3.449   20.041  16.779  1.00 10.40 ? 284  TYR A CD1   1 
ATOM   2168  C CD2   . TYR A 1 284 ? 4.255   17.992  15.882  1.00 11.61 ? 284  TYR A CD2   1 
ATOM   2169  C CE1   . TYR A 1 284 ? 2.194   19.483  16.927  1.00 11.40 ? 284  TYR A CE1   1 
ATOM   2170  C CE2   . TYR A 1 284 ? 3.011   17.424  16.019  1.00 10.50 ? 284  TYR A CE2   1 
ATOM   2171  C CZ    . TYR A 1 284 ? 1.979   18.184  16.544  1.00 11.54 ? 284  TYR A CZ    1 
ATOM   2172  O OH    . TYR A 1 284 ? 0.706   17.675  16.701  1.00 11.58 ? 284  TYR A OH    1 
ATOM   2173  N N     . ALA A 1 285 ? 6.006   22.524  14.190  1.00 10.83 ? 285  ALA A N     1 
ATOM   2174  C CA    . ALA A 1 285 ? 5.450   23.758  13.584  1.00 11.86 ? 285  ALA A CA    1 
ATOM   2175  C C     . ALA A 1 285 ? 5.401   23.652  12.059  1.00 12.38 ? 285  ALA A C     1 
ATOM   2176  O O     . ALA A 1 285 ? 4.327   23.816  11.445  1.00 13.20 ? 285  ALA A O     1 
ATOM   2177  C CB    . ALA A 1 285 ? 6.250   25.005  14.004  1.00 11.17 ? 285  ALA A CB    1 
ATOM   2178  N N     . ALA A 1 286 ? 6.552   23.344  11.462  1.00 11.74 ? 286  ALA A N     1 
ATOM   2179  C CA    . ALA A 1 286 ? 6.667   23.226  10.016  1.00 12.12 ? 286  ALA A CA    1 
ATOM   2180  C C     . ALA A 1 286 ? 5.769   22.165  9.442   1.00 12.20 ? 286  ALA A C     1 
ATOM   2181  O O     . ALA A 1 286 ? 5.148   22.376  8.400   1.00 13.11 ? 286  ALA A O     1 
ATOM   2182  C CB    . ALA A 1 286 ? 8.092   22.913  9.631   1.00 12.55 ? 286  ALA A CB    1 
ATOM   2183  N N     . THR A 1 287 ? 5.740   21.017  10.108  1.00 12.13 ? 287  THR A N     1 
ATOM   2184  C CA    . THR A 1 287 ? 4.973   19.859  9.669   1.00 12.01 ? 287  THR A CA    1 
ATOM   2185  C C     . THR A 1 287 ? 3.469   20.145  9.675   1.00 12.11 ? 287  THR A C     1 
ATOM   2186  O O     . THR A 1 287 ? 2.790   19.984  8.645   1.00 11.74 ? 287  THR A O     1 
ATOM   2187  C CB    . THR A 1 287 ? 5.339   18.591  10.505  1.00 11.66 ? 287  THR A CB    1 
ATOM   2188  O OG1   . THR A 1 287 ? 6.742   18.332  10.357  1.00 11.52 ? 287  THR A OG1   1 
ATOM   2189  C CG2   . THR A 1 287 ? 4.562   17.367  10.033  1.00 11.24 ? 287  THR A CG2   1 
ATOM   2190  N N     . THR A 1 288 ? 2.962   20.584  10.825  1.00 12.42 ? 288  THR A N     1 
ATOM   2191  C CA    . THR A 1 288 ? 1.550   20.959  10.948  1.00 12.78 ? 288  THR A CA    1 
ATOM   2192  C C     . THR A 1 288 ? 1.188   22.065  9.974   1.00 13.43 ? 288  THR A C     1 
ATOM   2193  O O     . THR A 1 288 ? 0.146   21.993  9.329   1.00 14.12 ? 288  THR A O     1 
ATOM   2194  C CB    . THR A 1 288 ? 1.192   21.412  12.349  1.00 12.57 ? 288  THR A CB    1 
ATOM   2195  O OG1   . THR A 1 288 ? 2.140   22.388  12.766  1.00 13.05 ? 288  THR A OG1   1 
ATOM   2196  C CG2   . THR A 1 288 ? 1.215   20.226  13.330  1.00 12.37 ? 288  THR A CG2   1 
ATOM   2197  N N     . PHE A 1 289 ? 2.056   23.066  9.824   1.00 13.86 ? 289  PHE A N     1 
ATOM   2198  C CA    . PHE A 1 289 ? 1.788   24.124  8.867   1.00 13.80 ? 289  PHE A CA    1 
ATOM   2199  C C     . PHE A 1 289 ? 1.613   23.573  7.463   1.00 14.59 ? 289  PHE A C     1 
ATOM   2200  O O     . PHE A 1 289 ? 0.611   23.884  6.782   1.00 15.14 ? 289  PHE A O     1 
ATOM   2201  C CB    . PHE A 1 289 ? 2.895   25.146  8.858   1.00 13.50 ? 289  PHE A CB    1 
ATOM   2202  C CG    . PHE A 1 289 ? 2.746   26.166  7.780   1.00 12.73 ? 289  PHE A CG    1 
ATOM   2203  C CD1   . PHE A 1 289 ? 1.888   27.240  7.947   1.00 11.40 ? 289  PHE A CD1   1 
ATOM   2204  C CD2   . PHE A 1 289 ? 3.476   26.061  6.595   1.00 11.60 ? 289  PHE A CD2   1 
ATOM   2205  C CE1   . PHE A 1 289 ? 1.747   28.202  6.949   1.00 10.89 ? 289  PHE A CE1   1 
ATOM   2206  C CE2   . PHE A 1 289 ? 3.329   27.016  5.597   1.00 12.24 ? 289  PHE A CE2   1 
ATOM   2207  C CZ    . PHE A 1 289 ? 2.457   28.093  5.785   1.00 11.05 ? 289  PHE A CZ    1 
ATOM   2208  N N     . LYS A 1 290 ? 2.579   22.765  7.035   1.00 14.69 ? 290  LYS A N     1 
ATOM   2209  C CA    . LYS A 1 290 ? 2.585   22.221  5.697   1.00 14.83 ? 290  LYS A CA    1 
ATOM   2210  C C     . LYS A 1 290 ? 1.308   21.476  5.403   1.00 14.68 ? 290  LYS A C     1 
ATOM   2211  O O     . LYS A 1 290 ? 0.608   21.796  4.446   1.00 15.77 ? 290  LYS A O     1 
ATOM   2212  C CB    . LYS A 1 290 ? 3.758   21.274  5.522   1.00 15.21 ? 290  LYS A CB    1 
ATOM   2213  C CG    . LYS A 1 290 ? 4.016   20.851  4.087   1.00 17.25 ? 290  LYS A CG    1 
ATOM   2214  C CD    . LYS A 1 290 ? 5.518   20.762  3.868   1.00 21.45 ? 290  LYS A CD    1 
ATOM   2215  C CE    . LYS A 1 290 ? 5.871   19.788  2.767   1.00 23.58 ? 290  LYS A CE    1 
ATOM   2216  N NZ    . LYS A 1 290 ? 7.282   19.371  2.901   1.00 23.94 ? 290  LYS A NZ    1 
ATOM   2217  N N     . TYR A 1 291 ? 0.992   20.491  6.221   1.00 14.15 ? 291  TYR A N     1 
ATOM   2218  C CA    . TYR A 1 291 ? -0.055  19.546  5.879   1.00 14.17 ? 291  TYR A CA    1 
ATOM   2219  C C     . TYR A 1 291 ? -1.466  20.069  6.172   1.00 14.17 ? 291  TYR A C     1 
ATOM   2220  O O     . TYR A 1 291 ? -2.416  19.698  5.485   1.00 14.12 ? 291  TYR A O     1 
ATOM   2221  C CB    . TYR A 1 291 ? 0.172   18.222  6.627   1.00 15.00 ? 291  TYR A CB    1 
ATOM   2222  C CG    . TYR A 1 291 ? 1.401   17.451  6.198   1.00 15.26 ? 291  TYR A CG    1 
ATOM   2223  C CD1   . TYR A 1 291 ? 2.134   16.674  7.109   1.00 17.24 ? 291  TYR A CD1   1 
ATOM   2224  C CD2   . TYR A 1 291 ? 1.831   17.491  4.874   1.00 16.51 ? 291  TYR A CD2   1 
ATOM   2225  C CE1   . TYR A 1 291 ? 3.266   15.934  6.679   1.00 17.28 ? 291  TYR A CE1   1 
ATOM   2226  C CE2   . TYR A 1 291 ? 2.953   16.800  4.445   1.00 15.34 ? 291  TYR A CE2   1 
ATOM   2227  C CZ    . TYR A 1 291 ? 3.653   16.017  5.332   1.00 16.80 ? 291  TYR A CZ    1 
ATOM   2228  O OH    . TYR A 1 291 ? 4.733   15.347  4.839   1.00 16.46 ? 291  TYR A OH    1 
ATOM   2229  N N     . VAL A 1 292 ? -1.621  20.900  7.207   1.00 13.60 ? 292  VAL A N     1 
ATOM   2230  C CA    . VAL A 1 292 ? -2.957  21.387  7.564   1.00 12.40 ? 292  VAL A CA    1 
ATOM   2231  C C     . VAL A 1 292 ? -3.396  22.525  6.661   1.00 12.57 ? 292  VAL A C     1 
ATOM   2232  O O     . VAL A 1 292 ? -4.571  22.618  6.336   1.00 12.58 ? 292  VAL A O     1 
ATOM   2233  C CB    . VAL A 1 292 ? -3.058  21.808  9.040   1.00 12.60 ? 292  VAL A CB    1 
ATOM   2234  C CG1   . VAL A 1 292 ? -4.388  22.498  9.335   1.00 9.68  ? 292  VAL A CG1   1 
ATOM   2235  C CG2   . VAL A 1 292 ? -2.823  20.605  9.953   1.00 12.02 ? 292  VAL A CG2   1 
ATOM   2236  N N     . PHE A 1 293 ? -2.474  23.410  6.284   1.00 12.28 ? 293  PHE A N     1 
ATOM   2237  C CA    . PHE A 1 293 ? -2.819  24.462  5.333   1.00 12.66 ? 293  PHE A CA    1 
ATOM   2238  C C     . PHE A 1 293 ? -2.630  24.051  3.868   1.00 13.02 ? 293  PHE A C     1 
ATOM   2239  O O     . PHE A 1 293 ? -2.818  24.846  2.952   1.00 12.87 ? 293  PHE A O     1 
ATOM   2240  C CB    . PHE A 1 293 ? -2.068  25.750  5.664   1.00 12.45 ? 293  PHE A CB    1 
ATOM   2241  C CG    . PHE A 1 293 ? -2.452  26.316  6.987   1.00 12.27 ? 293  PHE A CG    1 
ATOM   2242  C CD1   . PHE A 1 293 ? -1.517  26.429  8.007   1.00 10.18 ? 293  PHE A CD1   1 
ATOM   2243  C CD2   . PHE A 1 293 ? -3.768  26.693  7.233   1.00 10.77 ? 293  PHE A CD2   1 
ATOM   2244  C CE1   . PHE A 1 293 ? -1.868  26.931  9.233   1.00 10.15 ? 293  PHE A CE1   1 
ATOM   2245  C CE2   . PHE A 1 293 ? -4.139  27.198  8.476   1.00 11.18 ? 293  PHE A CE2   1 
ATOM   2246  C CZ    . PHE A 1 293 ? -3.185  27.320  9.481   1.00 11.30 ? 293  PHE A CZ    1 
ATOM   2247  N N     . ASP A 1 294 ? -2.280  22.785  3.667   1.00 13.83 ? 294  ASP A N     1 
ATOM   2248  C CA    . ASP A 1 294 ? -1.989  22.235  2.347   1.00 14.31 ? 294  ASP A CA    1 
ATOM   2249  C C     . ASP A 1 294 ? -1.107  23.171  1.549   1.00 14.91 ? 294  ASP A C     1 
ATOM   2250  O O     . ASP A 1 294 ? -1.404  23.488  0.385   1.00 13.71 ? 294  ASP A O     1 
ATOM   2251  C CB    . ASP A 1 294 ? -3.255  21.878  1.568   1.00 13.91 ? 294  ASP A CB    1 
ATOM   2252  C CG    . ASP A 1 294 ? -3.002  20.804  0.536   1.00 14.00 ? 294  ASP A CG    1 
ATOM   2253  O OD1   . ASP A 1 294 ? -3.491  20.970  -0.593  1.00 13.08 ? 294  ASP A OD1   1 
ATOM   2254  O OD2   . ASP A 1 294 ? -2.293  19.803  0.846   1.00 14.73 ? 294  ASP A OD2   1 
ATOM   2255  N N     . TYR A 1 295 ? 0.004   23.555  2.192   1.00 15.68 ? 295  TYR A N     1 
ATOM   2256  C CA    . TYR A 1 295 ? 0.935   24.525  1.639   1.00 16.70 ? 295  TYR A CA    1 
ATOM   2257  C C     . TYR A 1 295 ? 1.789   24.050  0.466   1.00 17.42 ? 295  TYR A C     1 
ATOM   2258  O O     . TYR A 1 295 ? 2.570   23.075  0.595   1.00 17.17 ? 295  TYR A O     1 
ATOM   2259  C CB    . TYR A 1 295 ? 1.858   25.108  2.702   1.00 16.98 ? 295  TYR A CB    1 
ATOM   2260  C CG    . TYR A 1 295 ? 2.896   25.959  2.045   1.00 17.78 ? 295  TYR A CG    1 
ATOM   2261  C CD1   . TYR A 1 295 ? 2.625   27.295  1.705   1.00 17.46 ? 295  TYR A CD1   1 
ATOM   2262  C CD2   . TYR A 1 295 ? 4.138   25.416  1.700   1.00 18.33 ? 295  TYR A CD2   1 
ATOM   2263  C CE1   . TYR A 1 295 ? 3.555   28.059  1.072   1.00 16.32 ? 295  TYR A CE1   1 
ATOM   2264  C CE2   . TYR A 1 295 ? 5.075   26.166  1.075   1.00 18.72 ? 295  TYR A CE2   1 
ATOM   2265  C CZ    . TYR A 1 295 ? 4.780   27.487  0.765   1.00 17.86 ? 295  TYR A CZ    1 
ATOM   2266  O OH    . TYR A 1 295 ? 5.754   28.214  0.140   1.00 20.85 ? 295  TYR A OH    1 
ATOM   2267  N N     . HIS A 1 296 ? 1.658   24.791  -0.651  1.00 17.58 ? 296  HIS A N     1 
ATOM   2268  C CA    . HIS A 1 296 ? 2.409   24.566  -1.889  1.00 17.71 ? 296  HIS A CA    1 
ATOM   2269  C C     . HIS A 1 296 ? 3.237   25.815  -2.164  1.00 17.65 ? 296  HIS A C     1 
ATOM   2270  O O     . HIS A 1 296 ? 2.771   26.931  -1.913  1.00 17.42 ? 296  HIS A O     1 
ATOM   2271  C CB    . HIS A 1 296 ? 1.455   24.369  -3.071  1.00 18.25 ? 296  HIS A CB    1 
ATOM   2272  C CG    . HIS A 1 296 ? 0.756   23.047  -3.100  1.00 19.61 ? 296  HIS A CG    1 
ATOM   2273  N ND1   . HIS A 1 296 ? -0.177  22.673  -2.153  1.00 22.81 ? 296  HIS A ND1   1 
ATOM   2274  C CD2   . HIS A 1 296 ? 0.804   22.036  -3.998  1.00 20.49 ? 296  HIS A CD2   1 
ATOM   2275  C CE1   . HIS A 1 296 ? -0.648  21.472  -2.449  1.00 22.99 ? 296  HIS A CE1   1 
ATOM   2276  N NE2   . HIS A 1 296 ? -0.068  21.064  -3.564  1.00 22.97 ? 296  HIS A NE2   1 
ATOM   2277  N N     . PRO A 1 297 ? 4.463   25.647  -2.703  1.00 17.86 ? 297  PRO A N     1 
ATOM   2278  C CA    . PRO A 1 297 ? 5.306   26.825  -2.973  1.00 17.69 ? 297  PRO A CA    1 
ATOM   2279  C C     . PRO A 1 297 ? 4.515   27.854  -3.755  1.00 17.96 ? 297  PRO A C     1 
ATOM   2280  O O     . PRO A 1 297 ? 3.761   27.464  -4.649  1.00 17.70 ? 297  PRO A O     1 
ATOM   2281  C CB    . PRO A 1 297 ? 6.422   26.263  -3.849  1.00 17.58 ? 297  PRO A CB    1 
ATOM   2282  C CG    . PRO A 1 297 ? 6.528   24.796  -3.419  1.00 18.22 ? 297  PRO A CG    1 
ATOM   2283  C CD    . PRO A 1 297 ? 5.124   24.377  -3.084  1.00 17.78 ? 297  PRO A CD    1 
ATOM   2284  N N     . GLY A 1 298 ? 4.669   29.140  -3.405  1.00 17.99 ? 298  GLY A N     1 
ATOM   2285  C CA    . GLY A 1 298 ? 3.916   30.227  -4.030  1.00 17.36 ? 298  GLY A CA    1 
ATOM   2286  C C     . GLY A 1 298 ? 2.559   30.578  -3.404  1.00 17.82 ? 298  GLY A C     1 
ATOM   2287  O O     . GLY A 1 298 ? 1.949   31.601  -3.776  1.00 18.77 ? 298  GLY A O     1 
ATOM   2288  N N     . ASP A 1 299 ? 2.061   29.759  -2.468  1.00 16.78 ? 299  ASP A N     1 
ATOM   2289  C CA    . ASP A 1 299 ? 0.799   30.066  -1.794  1.00 15.73 ? 299  ASP A CA    1 
ATOM   2290  C C     . ASP A 1 299 ? 0.970   31.249  -0.867  1.00 15.03 ? 299  ASP A C     1 
ATOM   2291  O O     . ASP A 1 299 ? 1.842   31.232  -0.022  1.00 15.92 ? 299  ASP A O     1 
ATOM   2292  C CB    . ASP A 1 299 ? 0.306   28.875  -0.970  1.00 16.06 ? 299  ASP A CB    1 
ATOM   2293  C CG    . ASP A 1 299 ? -0.362  27.804  -1.821  1.00 15.52 ? 299  ASP A CG    1 
ATOM   2294  O OD1   . ASP A 1 299 ? -0.558  28.022  -3.029  1.00 13.65 ? 299  ASP A OD1   1 
ATOM   2295  O OD2   . ASP A 1 299 ? -0.695  26.741  -1.267  1.00 15.23 ? 299  ASP A OD2   1 
ATOM   2296  N N     . ILE A 1 300 ? 0.141   32.276  -1.028  1.00 14.05 ? 300  ILE A N     1 
ATOM   2297  C CA    . ILE A 1 300 ? 0.205   33.424  -0.150  1.00 12.51 ? 300  ILE A CA    1 
ATOM   2298  C C     . ILE A 1 300 ? -0.629  33.093  1.082   1.00 12.33 ? 300  ILE A C     1 
ATOM   2299  O O     . ILE A 1 300 ? -1.851  32.819  0.972   1.00 12.16 ? 300  ILE A O     1 
ATOM   2300  C CB    . ILE A 1 300 ? -0.316  34.706  -0.823  1.00 12.31 ? 300  ILE A CB    1 
ATOM   2301  C CG1   . ILE A 1 300 ? 0.246   34.879  -2.252  1.00 11.75 ? 300  ILE A CG1   1 
ATOM   2302  C CG2   . ILE A 1 300 ? -0.106  35.912  0.096   1.00 11.07 ? 300  ILE A CG2   1 
ATOM   2303  C CD1   . ILE A 1 300 ? 1.690   35.318  -2.363  1.00 7.45  ? 300  ILE A CD1   1 
ATOM   2304  N N     . TYR A 1 301 ? 0.038   33.145  2.237   1.00 11.03 ? 301  TYR A N     1 
ATOM   2305  C CA    . TYR A 1 301 ? -0.508  32.710  3.512   1.00 10.55 ? 301  TYR A CA    1 
ATOM   2306  C C     . TYR A 1 301 ? -0.651  33.846  4.514   1.00 10.71 ? 301  TYR A C     1 
ATOM   2307  O O     . TYR A 1 301 ? 0.320   34.604  4.764   1.00 10.72 ? 301  TYR A O     1 
ATOM   2308  C CB    . TYR A 1 301 ? 0.407   31.647  4.118   1.00 10.50 ? 301  TYR A CB    1 
ATOM   2309  C CG    . TYR A 1 301 ? 0.081   31.298  5.547   1.00 10.01 ? 301  TYR A CG    1 
ATOM   2310  C CD1   . TYR A 1 301 ? 0.750   31.905  6.604   1.00 8.24  ? 301  TYR A CD1   1 
ATOM   2311  C CD2   . TYR A 1 301 ? -0.921  30.359  5.836   1.00 10.66 ? 301  TYR A CD2   1 
ATOM   2312  C CE1   . TYR A 1 301 ? 0.461   31.574  7.911   1.00 9.47  ? 301  TYR A CE1   1 
ATOM   2313  C CE2   . TYR A 1 301 ? -1.238  30.026  7.133   1.00 10.04 ? 301  TYR A CE2   1 
ATOM   2314  C CZ    . TYR A 1 301 ? -0.541  30.623  8.180   1.00 10.77 ? 301  TYR A CZ    1 
ATOM   2315  O OH    . TYR A 1 301 ? -0.880  30.282  9.479   1.00 8.63  ? 301  TYR A OH    1 
ATOM   2316  N N     . TRP A 1 302 ? -1.832  33.923  5.137   1.00 10.29 ? 302  TRP A N     1 
ATOM   2317  C CA    . TRP A 1 302 ? -2.118  34.972  6.129   1.00 10.14 ? 302  TRP A CA    1 
ATOM   2318  C C     . TRP A 1 302 ? -2.782  34.462  7.398   1.00 10.01 ? 302  TRP A C     1 
ATOM   2319  O O     . TRP A 1 302 ? -3.948  34.025  7.390   1.00 10.42 ? 302  TRP A O     1 
ATOM   2320  C CB    . TRP A 1 302 ? -2.936  36.119  5.512   1.00 9.36  ? 302  TRP A CB    1 
ATOM   2321  C CG    . TRP A 1 302 ? -3.236  37.287  6.493   1.00 10.13 ? 302  TRP A CG    1 
ATOM   2322  C CD1   . TRP A 1 302 ? -2.501  37.653  7.590   1.00 8.87  ? 302  TRP A CD1   1 
ATOM   2323  C CD2   . TRP A 1 302 ? -4.313  38.243  6.407   1.00 7.00  ? 302  TRP A CD2   1 
ATOM   2324  N NE1   . TRP A 1 302 ? -3.075  38.736  8.205   1.00 8.10  ? 302  TRP A NE1   1 
ATOM   2325  C CE2   . TRP A 1 302 ? -4.186  39.117  7.496   1.00 7.61  ? 302  TRP A CE2   1 
ATOM   2326  C CE3   . TRP A 1 302 ? -5.389  38.408  5.543   1.00 8.52  ? 302  TRP A CE3   1 
ATOM   2327  C CZ2   . TRP A 1 302 ? -5.085  40.162  7.732   1.00 8.26  ? 302  TRP A CZ2   1 
ATOM   2328  C CZ3   . TRP A 1 302 ? -6.302  39.454  5.791   1.00 9.26  ? 302  TRP A CZ3   1 
ATOM   2329  C CH2   . TRP A 1 302 ? -6.126  40.320  6.865   1.00 8.31  ? 302  TRP A CH2   1 
ATOM   2330  N N     . CYS A 1 303 ? -2.023  34.525  8.487   1.00 10.20 ? 303  CYS A N     1 
ATOM   2331  C CA    . CYS A 1 303 ? -2.525  34.248  9.832   1.00 9.99  ? 303  CYS A CA    1 
ATOM   2332  C C     . CYS A 1 303 ? -2.718  35.611  10.494  1.00 9.73  ? 303  CYS A C     1 
ATOM   2333  O O     . CYS A 1 303 ? -1.787  36.415  10.475  1.00 9.40  ? 303  CYS A O     1 
ATOM   2334  C CB    . CYS A 1 303 ? -1.492  33.423  10.618  1.00 9.67  ? 303  CYS A CB    1 
ATOM   2335  S SG    . CYS A 1 303 ? -1.839  33.360  12.399  1.00 10.78 ? 303  CYS A SG    1 
ATOM   2336  N N     . THR A 1 304 ? -3.885  35.858  11.097  1.00 9.42  ? 304  THR A N     1 
ATOM   2337  C CA    . THR A 1 304 ? -4.216  37.199  11.608  1.00 9.84  ? 304  THR A CA    1 
ATOM   2338  C C     . THR A 1 304 ? -3.802  37.433  13.059  1.00 10.63 ? 304  THR A C     1 
ATOM   2339  O O     . THR A 1 304 ? -3.834  38.577  13.555  1.00 11.09 ? 304  THR A O     1 
ATOM   2340  C CB    . THR A 1 304 ? -5.724  37.559  11.406  1.00 10.27 ? 304  THR A CB    1 
ATOM   2341  O OG1   . THR A 1 304 ? -6.553  36.717  12.219  1.00 8.43  ? 304  THR A OG1   1 
ATOM   2342  C CG2   . THR A 1 304 ? -6.114  37.376  9.912   1.00 9.69  ? 304  THR A CG2   1 
ATOM   2343  N N     . ALA A 1 305 ? -3.380  36.358  13.724  1.00 10.31 ? 305  ALA A N     1 
ATOM   2344  C CA    . ALA A 1 305 ? -3.069  36.396  15.142  1.00 10.48 ? 305  ALA A CA    1 
ATOM   2345  C C     . ALA A 1 305 ? -1.828  37.199  15.444  1.00 11.09 ? 305  ALA A C     1 
ATOM   2346  O O     . ALA A 1 305 ? -0.872  37.224  14.669  1.00 11.83 ? 305  ALA A O     1 
ATOM   2347  C CB    . ALA A 1 305 ? -2.903  35.001  15.680  1.00 10.70 ? 305  ALA A CB    1 
ATOM   2348  N N     . ASP A 1 306 ? -1.833  37.815  16.618  1.00 11.67 ? 306  ASP A N     1 
ATOM   2349  C CA    . ASP A 1 306 ? -0.765  38.686  17.042  1.00 11.24 ? 306  ASP A CA    1 
ATOM   2350  C C     . ASP A 1 306 ? 0.479   37.868  17.440  1.00 11.36 ? 306  ASP A C     1 
ATOM   2351  O O     . ASP A 1 306 ? 0.404   36.805  18.104  1.00 10.52 ? 306  ASP A O     1 
ATOM   2352  C CB    . ASP A 1 306 ? -1.247  39.569  18.188  1.00 10.97 ? 306  ASP A CB    1 
ATOM   2353  C CG    . ASP A 1 306 ? -0.286  40.713  18.490  1.00 13.64 ? 306  ASP A CG    1 
ATOM   2354  O OD1   . ASP A 1 306 ? 0.672   40.537  19.301  1.00 12.06 ? 306  ASP A OD1   1 
ATOM   2355  O OD2   . ASP A 1 306 ? -0.507  41.801  17.919  1.00 16.77 ? 306  ASP A OD2   1 
ATOM   2356  N N     . VAL A 1 307 ? 1.611   38.389  16.991  1.00 11.06 ? 307  VAL A N     1 
ATOM   2357  C CA    . VAL A 1 307 ? 2.943   37.948  17.352  1.00 11.40 ? 307  VAL A CA    1 
ATOM   2358  C C     . VAL A 1 307 ? 3.055   37.640  18.863  1.00 11.97 ? 307  VAL A C     1 
ATOM   2359  O O     . VAL A 1 307 ? 3.809   36.762  19.260  1.00 12.59 ? 307  VAL A O     1 
ATOM   2360  C CB    . VAL A 1 307 ? 3.994   39.033  16.842  1.00 11.42 ? 307  VAL A CB    1 
ATOM   2361  C CG1   . VAL A 1 307 ? 4.250   40.139  17.895  1.00 11.31 ? 307  VAL A CG1   1 
ATOM   2362  C CG2   . VAL A 1 307 ? 5.262   38.400  16.383  1.00 9.83  ? 307  VAL A CG2   1 
ATOM   2363  N N     . GLY A 1 308 ? 2.259   38.308  19.699  1.00 12.19 ? 308  GLY A N     1 
ATOM   2364  C CA    . GLY A 1 308 ? 2.307   38.080  21.152  1.00 11.71 ? 308  GLY A CA    1 
ATOM   2365  C C     . GLY A 1 308 ? 1.692   36.796  21.681  1.00 11.69 ? 308  GLY A C     1 
ATOM   2366  O O     . GLY A 1 308 ? 1.751   36.529  22.884  1.00 12.50 ? 308  GLY A O     1 
ATOM   2367  N N     . TRP A 1 309 ? 1.102   35.994  20.803  1.00 11.31 ? 309  TRP A N     1 
ATOM   2368  C CA    . TRP A 1 309 ? 0.471   34.729  21.210  1.00 10.88 ? 309  TRP A CA    1 
ATOM   2369  C C     . TRP A 1 309 ? 1.124   33.560  20.503  1.00 10.87 ? 309  TRP A C     1 
ATOM   2370  O O     . TRP A 1 309 ? 1.841   33.756  19.526  1.00 11.36 ? 309  TRP A O     1 
ATOM   2371  C CB    . TRP A 1 309 ? -1.005  34.733  20.872  1.00 10.32 ? 309  TRP A CB    1 
ATOM   2372  C CG    . TRP A 1 309 ? -1.719  35.933  21.388  1.00 11.85 ? 309  TRP A CG    1 
ATOM   2373  C CD1   . TRP A 1 309 ? -2.432  36.834  20.661  1.00 10.46 ? 309  TRP A CD1   1 
ATOM   2374  C CD2   . TRP A 1 309 ? -1.788  36.374  22.762  1.00 13.88 ? 309  TRP A CD2   1 
ATOM   2375  N NE1   . TRP A 1 309 ? -2.950  37.810  21.488  1.00 10.89 ? 309  TRP A NE1   1 
ATOM   2376  C CE2   . TRP A 1 309 ? -2.581  37.551  22.781  1.00 13.05 ? 309  TRP A CE2   1 
ATOM   2377  C CE3   . TRP A 1 309 ? -1.272  35.877  23.979  1.00 12.51 ? 309  TRP A CE3   1 
ATOM   2378  C CZ2   . TRP A 1 309 ? -2.879  38.246  23.973  1.00 11.73 ? 309  TRP A CZ2   1 
ATOM   2379  C CZ3   . TRP A 1 309 ? -1.546  36.577  25.166  1.00 11.90 ? 309  TRP A CZ3   1 
ATOM   2380  C CH2   . TRP A 1 309 ? -2.341  37.758  25.150  1.00 11.78 ? 309  TRP A CH2   1 
ATOM   2381  N N     . VAL A 1 310 ? 0.868   32.347  20.975  1.00 10.70 ? 310  VAL A N     1 
ATOM   2382  C CA    . VAL A 1 310 ? 1.512   31.192  20.396  1.00 10.91 ? 310  VAL A CA    1 
ATOM   2383  C C     . VAL A 1 310 ? 1.194   30.993  18.910  1.00 11.44 ? 310  VAL A C     1 
ATOM   2384  O O     . VAL A 1 310 ? 2.076   30.573  18.148  1.00 12.10 ? 310  VAL A O     1 
ATOM   2385  C CB    . VAL A 1 310 ? 1.299   29.915  21.238  1.00 11.13 ? 310  VAL A CB    1 
ATOM   2386  C CG1   . VAL A 1 310 ? -0.152  29.485  21.247  1.00 9.79  ? 310  VAL A CG1   1 
ATOM   2387  C CG2   . VAL A 1 310 ? 2.263   28.810  20.772  1.00 10.40 ? 310  VAL A CG2   1 
ATOM   2388  N N     . THR A 1 311 ? -0.032  31.329  18.490  1.00 11.54 ? 311  THR A N     1 
ATOM   2389  C CA    . THR A 1 311 ? -0.432  31.201  17.096  1.00 11.43 ? 311  THR A CA    1 
ATOM   2390  C C     . THR A 1 311 ? 0.467   32.133  16.248  1.00 12.19 ? 311  THR A C     1 
ATOM   2391  O O     . THR A 1 311 ? 0.831   31.806  15.083  1.00 11.94 ? 311  THR A O     1 
ATOM   2392  C CB    . THR A 1 311 ? -1.926  31.503  16.943  1.00 11.68 ? 311  THR A CB    1 
ATOM   2393  O OG1   . THR A 1 311 ? -2.675  30.642  17.816  1.00 11.72 ? 311  THR A OG1   1 
ATOM   2394  C CG2   . THR A 1 311 ? -2.396  31.273  15.538  1.00 10.98 ? 311  THR A CG2   1 
ATOM   2395  N N     . GLY A 1 312 ? 0.853   33.257  16.864  1.00 11.90 ? 312  GLY A N     1 
ATOM   2396  C CA    . GLY A 1 312 ? 1.734   34.234  16.266  1.00 12.49 ? 312  GLY A CA    1 
ATOM   2397  C C     . GLY A 1 312 ? 3.133   33.688  16.181  1.00 13.32 ? 312  GLY A C     1 
ATOM   2398  O O     . GLY A 1 312 ? 3.850   33.960  15.228  1.00 14.66 ? 312  GLY A O     1 
ATOM   2399  N N     . HIS A 1 313 ? 3.529   32.886  17.158  1.00 13.30 ? 313  HIS A N     1 
ATOM   2400  C CA    . HIS A 1 313 ? 4.843   32.255  17.121  1.00 13.40 ? 313  HIS A CA    1 
ATOM   2401  C C     . HIS A 1 313 ? 4.892   31.107  16.064  1.00 13.47 ? 313  HIS A C     1 
ATOM   2402  O O     . HIS A 1 313 ? 5.725   31.116  15.144  1.00 13.18 ? 313  HIS A O     1 
ATOM   2403  C CB    . HIS A 1 313 ? 5.187   31.718  18.515  1.00 13.49 ? 313  HIS A CB    1 
ATOM   2404  C CG    . HIS A 1 313 ? 5.619   32.764  19.495  1.00 13.17 ? 313  HIS A CG    1 
ATOM   2405  N ND1   . HIS A 1 313 ? 4.978   33.978  19.635  1.00 13.04 ? 313  HIS A ND1   1 
ATOM   2406  C CD2   . HIS A 1 313 ? 6.606   32.754  20.424  1.00 13.24 ? 313  HIS A CD2   1 
ATOM   2407  C CE1   . HIS A 1 313 ? 5.571   34.682  20.584  1.00 12.29 ? 313  HIS A CE1   1 
ATOM   2408  N NE2   . HIS A 1 313 ? 6.552   33.956  21.090  1.00 12.99 ? 313  HIS A NE2   1 
ATOM   2409  N N     . SER A 1 314 ? 3.987   30.133  16.196  1.00 13.40 ? 314  SER A N     1 
ATOM   2410  C CA    . SER A 1 314 ? 4.017   28.931  15.349  1.00 13.27 ? 314  SER A CA    1 
ATOM   2411  C C     . SER A 1 314 ? 3.482   29.149  13.950  1.00 13.30 ? 314  SER A C     1 
ATOM   2412  O O     . SER A 1 314 ? 4.074   28.640  12.995  1.00 12.33 ? 314  SER A O     1 
ATOM   2413  C CB    . SER A 1 314 ? 3.284   27.769  16.015  1.00 12.47 ? 314  SER A CB    1 
ATOM   2414  O OG    . SER A 1 314 ? 3.852   27.517  17.283  1.00 13.15 ? 314  SER A OG    1 
ATOM   2415  N N     . TYR A 1 315 ? 2.377   29.894  13.818  1.00 13.86 ? 315  TYR A N     1 
ATOM   2416  C CA    . TYR A 1 315 ? 1.735   30.018  12.494  1.00 14.86 ? 315  TYR A CA    1 
ATOM   2417  C C     . TYR A 1 315 ? 1.784   31.374  11.798  1.00 15.20 ? 315  TYR A C     1 
ATOM   2418  O O     . TYR A 1 315 ? 1.375   31.480  10.662  1.00 15.40 ? 315  TYR A O     1 
ATOM   2419  C CB    . TYR A 1 315 ? 0.341   29.354  12.484  1.00 14.76 ? 315  TYR A CB    1 
ATOM   2420  C CG    . TYR A 1 315 ? 0.481   27.949  12.982  1.00 14.94 ? 315  TYR A CG    1 
ATOM   2421  C CD1   . TYR A 1 315 ? 0.160   27.626  14.290  1.00 14.84 ? 315  TYR A CD1   1 
ATOM   2422  C CD2   . TYR A 1 315 ? 1.063   26.954  12.175  1.00 14.69 ? 315  TYR A CD2   1 
ATOM   2423  C CE1   . TYR A 1 315 ? 0.347   26.341  14.768  1.00 14.91 ? 315  TYR A CE1   1 
ATOM   2424  C CE2   . TYR A 1 315 ? 1.251   25.673  12.644  1.00 12.08 ? 315  TYR A CE2   1 
ATOM   2425  C CZ    . TYR A 1 315 ? 0.896   25.372  13.938  1.00 14.42 ? 315  TYR A CZ    1 
ATOM   2426  O OH    . TYR A 1 315 ? 1.080   24.091  14.433  1.00 16.71 ? 315  TYR A OH    1 
ATOM   2427  N N     . LEU A 1 316 ? 2.307   32.400  12.461  1.00 16.29 ? 316  LEU A N     1 
ATOM   2428  C CA    . LEU A 1 316 ? 2.626   33.642  11.762  1.00 16.73 ? 316  LEU A CA    1 
ATOM   2429  C C     . LEU A 1 316 ? 4.062   33.507  11.221  1.00 17.07 ? 316  LEU A C     1 
ATOM   2430  O O     . LEU A 1 316 ? 4.286   33.571  10.012  1.00 17.21 ? 316  LEU A O     1 
ATOM   2431  C CB    . LEU A 1 316 ? 2.459   34.876  12.666  1.00 16.36 ? 316  LEU A CB    1 
ATOM   2432  C CG    . LEU A 1 316 ? 2.552   36.324  12.151  1.00 17.22 ? 316  LEU A CG    1 
ATOM   2433  C CD1   . LEU A 1 316 ? 3.768   36.622  11.269  1.00 20.83 ? 316  LEU A CD1   1 
ATOM   2434  C CD2   . LEU A 1 316 ? 1.328   36.707  11.372  1.00 19.43 ? 316  LEU A CD2   1 
ATOM   2435  N N     . LEU A 1 317 ? 5.021   33.295  12.116  1.00 17.24 ? 317  LEU A N     1 
ATOM   2436  C CA    . LEU A 1 317 ? 6.429   33.249  11.747  1.00 17.41 ? 317  LEU A CA    1 
ATOM   2437  C C     . LEU A 1 317 ? 7.008   31.871  11.509  1.00 16.41 ? 317  LEU A C     1 
ATOM   2438  O O     . LEU A 1 317 ? 7.302   31.521  10.370  1.00 17.40 ? 317  LEU A O     1 
ATOM   2439  C CB    . LEU A 1 317 ? 7.286   33.884  12.829  1.00 18.48 ? 317  LEU A CB    1 
ATOM   2440  C CG    . LEU A 1 317 ? 7.663   35.340  12.811  1.00 22.00 ? 317  LEU A CG    1 
ATOM   2441  C CD1   . LEU A 1 317 ? 6.664   36.095  13.670  1.00 25.36 ? 317  LEU A CD1   1 
ATOM   2442  C CD2   . LEU A 1 317 ? 9.029   35.385  13.448  1.00 25.07 ? 317  LEU A CD2   1 
ATOM   2443  N N     . TYR A 1 318 ? 7.235   31.103  12.570  1.00 15.00 ? 318  TYR A N     1 
ATOM   2444  C CA    . TYR A 1 318 ? 8.215   30.010  12.464  1.00 14.28 ? 318  TYR A CA    1 
ATOM   2445  C C     . TYR A 1 318 ? 7.836   28.872  11.515  1.00 14.62 ? 318  TYR A C     1 
ATOM   2446  O O     . TYR A 1 318 ? 8.615   28.517  10.630  1.00 15.37 ? 318  TYR A O     1 
ATOM   2447  C CB    . TYR A 1 318 ? 8.619   29.480  13.833  1.00 13.52 ? 318  TYR A CB    1 
ATOM   2448  C CG    . TYR A 1 318 ? 9.297   30.497  14.720  1.00 11.42 ? 318  TYR A CG    1 
ATOM   2449  C CD1   . TYR A 1 318 ? 10.231  31.381  14.202  1.00 8.61  ? 318  TYR A CD1   1 
ATOM   2450  C CD2   . TYR A 1 318 ? 8.999   30.568  16.082  1.00 10.41 ? 318  TYR A CD2   1 
ATOM   2451  C CE1   . TYR A 1 318 ? 10.840  32.300  14.998  1.00 10.26 ? 318  TYR A CE1   1 
ATOM   2452  C CE2   . TYR A 1 318 ? 9.613   31.490  16.909  1.00 9.30  ? 318  TYR A CE2   1 
ATOM   2453  C CZ    . TYR A 1 318 ? 10.545  32.352  16.363  1.00 11.86 ? 318  TYR A CZ    1 
ATOM   2454  O OH    . TYR A 1 318 ? 11.203  33.268  17.158  1.00 12.85 ? 318  TYR A OH    1 
ATOM   2455  N N     . GLY A 1 319 ? 6.634   28.331  11.662  1.00 14.18 ? 319  GLY A N     1 
ATOM   2456  C CA    . GLY A 1 319 ? 6.175   27.306  10.751  1.00 14.01 ? 319  GLY A CA    1 
ATOM   2457  C C     . GLY A 1 319 ? 6.216   27.793  9.319   1.00 14.04 ? 319  GLY A C     1 
ATOM   2458  O O     . GLY A 1 319 ? 6.938   27.208  8.490   1.00 14.51 ? 319  GLY A O     1 
ATOM   2459  N N     . PRO A 1 320 ? 5.461   28.876  9.004   1.00 13.66 ? 320  PRO A N     1 
ATOM   2460  C CA    . PRO A 1 320 ? 5.503   29.406  7.611   1.00 13.60 ? 320  PRO A CA    1 
ATOM   2461  C C     . PRO A 1 320 ? 6.916   29.535  7.042   1.00 13.11 ? 320  PRO A C     1 
ATOM   2462  O O     . PRO A 1 320 ? 7.145   29.092  5.904   1.00 12.94 ? 320  PRO A O     1 
ATOM   2463  C CB    . PRO A 1 320 ? 4.826   30.783  7.727   1.00 12.96 ? 320  PRO A CB    1 
ATOM   2464  C CG    . PRO A 1 320 ? 3.832   30.558  8.818   1.00 13.44 ? 320  PRO A CG    1 
ATOM   2465  C CD    . PRO A 1 320 ? 4.523   29.647  9.836   1.00 12.98 ? 320  PRO A CD    1 
ATOM   2466  N N     . LEU A 1 321 ? 7.849   30.097  7.827   1.00 12.33 ? 321  LEU A N     1 
ATOM   2467  C CA    . LEU A 1 321 ? 9.177   30.435  7.294   1.00 11.93 ? 321  LEU A CA    1 
ATOM   2468  C C     . LEU A 1 321 ? 10.090  29.209  7.193   1.00 12.03 ? 321  LEU A C     1 
ATOM   2469  O O     . LEU A 1 321 ? 11.022  29.176  6.377   1.00 11.39 ? 321  LEU A O     1 
ATOM   2470  C CB    . LEU A 1 321 ? 9.857   31.549  8.110   1.00 11.61 ? 321  LEU A CB    1 
ATOM   2471  C CG    . LEU A 1 321 ? 9.380   33.008  8.104   1.00 11.61 ? 321  LEU A CG    1 
ATOM   2472  C CD1   . LEU A 1 321 ? 10.236  33.794  9.077   1.00 8.46  ? 321  LEU A CD1   1 
ATOM   2473  C CD2   . LEU A 1 321 ? 9.393   33.662  6.675   1.00 9.45  ? 321  LEU A CD2   1 
ATOM   2474  N N     . ALA A 1 322 ? 9.838   28.200  8.023   1.00 11.86 ? 322  ALA A N     1 
ATOM   2475  C CA    . ALA A 1 322 ? 10.626  26.987  7.912   1.00 11.91 ? 322  ALA A CA    1 
ATOM   2476  C C     . ALA A 1 322 ? 10.344  26.366  6.552   1.00 12.49 ? 322  ALA A C     1 
ATOM   2477  O O     . ALA A 1 322 ? 11.254  25.843  5.895   1.00 13.21 ? 322  ALA A O     1 
ATOM   2478  C CB    . ALA A 1 322 ? 10.310  26.028  9.024   1.00 11.71 ? 322  ALA A CB    1 
ATOM   2479  N N     . CYS A 1 323 ? 9.090   26.465  6.112   1.00 12.85 ? 323  CYS A N     1 
ATOM   2480  C CA    . CYS A 1 323 ? 8.655   25.918  4.814   1.00 12.95 ? 323  CYS A CA    1 
ATOM   2481  C C     . CYS A 1 323 ? 8.913   26.825  3.593   1.00 12.76 ? 323  CYS A C     1 
ATOM   2482  O O     . CYS A 1 323 ? 8.603   26.445  2.459   1.00 12.98 ? 323  CYS A O     1 
ATOM   2483  C CB    . CYS A 1 323 ? 7.178   25.544  4.882   1.00 12.71 ? 323  CYS A CB    1 
ATOM   2484  S SG    . CYS A 1 323 ? 6.835   24.228  6.058   1.00 14.22 ? 323  CYS A SG    1 
ATOM   2485  N N     . GLY A 1 324 ? 9.483   28.006  3.812   1.00 12.79 ? 324  GLY A N     1 
ATOM   2486  C CA    . GLY A 1 324 ? 9.790   28.940  2.704   1.00 12.82 ? 324  GLY A CA    1 
ATOM   2487  C C     . GLY A 1 324 ? 8.548   29.633  2.132   1.00 13.15 ? 324  GLY A C     1 
ATOM   2488  O O     . GLY A 1 324 ? 8.533   30.065  0.980   1.00 13.22 ? 324  GLY A O     1 
ATOM   2489  N N     . ALA A 1 325 ? 7.504   29.752  2.947   1.00 12.67 ? 325  ALA A N     1 
ATOM   2490  C CA    . ALA A 1 325 ? 6.279   30.358  2.508   1.00 12.72 ? 325  ALA A CA    1 
ATOM   2491  C C     . ALA A 1 325 ? 6.383   31.879  2.476   1.00 12.83 ? 325  ALA A C     1 
ATOM   2492  O O     . ALA A 1 325 ? 7.321   32.447  3.023   1.00 13.53 ? 325  ALA A O     1 
ATOM   2493  C CB    . ALA A 1 325 ? 5.133   29.912  3.407   1.00 12.76 ? 325  ALA A CB    1 
ATOM   2494  N N     . THR A 1 326 ? 5.433   32.527  1.808   1.00 12.16 ? 326  THR A N     1 
ATOM   2495  C CA    . THR A 1 326 ? 5.231   33.935  1.983   1.00 12.03 ? 326  THR A CA    1 
ATOM   2496  C C     . THR A 1 326 ? 4.155   34.079  3.065   1.00 12.16 ? 326  THR A C     1 
ATOM   2497  O O     . THR A 1 326 ? 3.096   33.437  2.983   1.00 11.55 ? 326  THR A O     1 
ATOM   2498  C CB    . THR A 1 326 ? 4.787   34.605  0.702   1.00 11.77 ? 326  THR A CB    1 
ATOM   2499  O OG1   . THR A 1 326 ? 5.781   34.396  -0.302  1.00 14.72 ? 326  THR A OG1   1 
ATOM   2500  C CG2   . THR A 1 326 ? 4.655   36.103  0.919   1.00 13.33 ? 326  THR A CG2   1 
ATOM   2501  N N     . THR A 1 327 ? 4.451   34.885  4.090   1.00 11.65 ? 327  THR A N     1 
ATOM   2502  C CA    . THR A 1 327 ? 3.536   35.065  5.212   1.00 11.47 ? 327  THR A CA    1 
ATOM   2503  C C     . THR A 1 327 ? 3.218   36.549  5.371   1.00 11.88 ? 327  THR A C     1 
ATOM   2504  O O     . THR A 1 327 ? 4.091   37.414  5.195   1.00 12.24 ? 327  THR A O     1 
ATOM   2505  C CB    . THR A 1 327 ? 4.063   34.435  6.532   1.00 11.03 ? 327  THR A CB    1 
ATOM   2506  O OG1   . THR A 1 327 ? 2.984   34.316  7.463   1.00 11.12 ? 327  THR A OG1   1 
ATOM   2507  C CG2   . THR A 1 327 ? 5.199   35.262  7.180   1.00 10.39 ? 327  THR A CG2   1 
ATOM   2508  N N     . LEU A 1 328 ? 1.957   36.835  5.656   1.00 11.41 ? 328  LEU A N     1 
ATOM   2509  C CA    . LEU A 1 328 ? 1.480   38.193  5.712   1.00 10.99 ? 328  LEU A CA    1 
ATOM   2510  C C     . LEU A 1 328 ? 1.301   38.626  7.183   1.00 11.85 ? 328  LEU A C     1 
ATOM   2511  O O     . LEU A 1 328 ? 0.693   37.927  7.994   1.00 11.33 ? 328  LEU A O     1 
ATOM   2512  C CB    . LEU A 1 328 ? 0.175   38.295  4.955   1.00 9.82  ? 328  LEU A CB    1 
ATOM   2513  C CG    . LEU A 1 328 ? -0.336  39.684  4.600   1.00 9.92  ? 328  LEU A CG    1 
ATOM   2514  C CD1   . LEU A 1 328 ? -1.293  39.564  3.396   1.00 8.68  ? 328  LEU A CD1   1 
ATOM   2515  C CD2   . LEU A 1 328 ? -0.992  40.403  5.773   1.00 4.63  ? 328  LEU A CD2   1 
ATOM   2516  N N     . MET A 1 329 ? 1.870   39.779  7.513   1.00 12.92 ? 329  MET A N     1 
ATOM   2517  C CA    . MET A 1 329 ? 1.740   40.370  8.819   1.00 14.00 ? 329  MET A CA    1 
ATOM   2518  C C     . MET A 1 329 ? 0.953   41.645  8.621   1.00 13.38 ? 329  MET A C     1 
ATOM   2519  O O     . MET A 1 329 ? 1.410   42.567  7.937   1.00 13.38 ? 329  MET A O     1 
ATOM   2520  C CB    . MET A 1 329 ? 3.112   40.690  9.371   1.00 13.62 ? 329  MET A CB    1 
ATOM   2521  C CG    . MET A 1 329 ? 3.058   41.339  10.745  1.00 16.36 ? 329  MET A CG    1 
ATOM   2522  S SD    . MET A 1 329 ? 4.688   41.655  11.467  1.00 18.63 ? 329  MET A SD    1 
ATOM   2523  C CE    . MET A 1 329 ? 5.254   40.031  12.001  1.00 15.65 ? 329  MET A CE    1 
ATOM   2524  N N     . PHE A 1 330 ? -0.255  41.657  9.173   1.00 12.95 ? 330  PHE A N     1 
ATOM   2525  C CA    . PHE A 1 330 ? -1.155  42.795  9.160   1.00 12.16 ? 330  PHE A CA    1 
ATOM   2526  C C     . PHE A 1 330 ? -0.988  43.601  10.474  1.00 12.43 ? 330  PHE A C     1 
ATOM   2527  O O     . PHE A 1 330 ? -0.983  43.038  11.592  1.00 12.85 ? 330  PHE A O     1 
ATOM   2528  C CB    . PHE A 1 330 ? -2.586  42.277  9.016   1.00 12.12 ? 330  PHE A CB    1 
ATOM   2529  C CG    . PHE A 1 330 ? -3.638  43.352  8.991   1.00 12.24 ? 330  PHE A CG    1 
ATOM   2530  C CD1   . PHE A 1 330 ? -3.475  44.513  8.221   1.00 12.29 ? 330  PHE A CD1   1 
ATOM   2531  C CD2   . PHE A 1 330 ? -4.818  43.187  9.700   1.00 10.27 ? 330  PHE A CD2   1 
ATOM   2532  C CE1   . PHE A 1 330 ? -4.485  45.520  8.190   1.00 12.25 ? 330  PHE A CE1   1 
ATOM   2533  C CE2   . PHE A 1 330 ? -5.827  44.162  9.659   1.00 10.08 ? 330  PHE A CE2   1 
ATOM   2534  C CZ    . PHE A 1 330 ? -5.664  45.336  8.917   1.00 11.15 ? 330  PHE A CZ    1 
ATOM   2535  N N     . GLU A 1 331 ? -0.812  44.911  10.335  1.00 11.58 ? 331  GLU A N     1 
ATOM   2536  C CA    . GLU A 1 331 ? -0.582  45.775  11.469  1.00 11.55 ? 331  GLU A CA    1 
ATOM   2537  C C     . GLU A 1 331 ? -1.874  46.066  12.252  1.00 11.03 ? 331  GLU A C     1 
ATOM   2538  O O     . GLU A 1 331 ? -1.825  46.300  13.463  1.00 10.12 ? 331  GLU A O     1 
ATOM   2539  C CB    . GLU A 1 331 ? 0.052   47.081  11.001  1.00 11.33 ? 331  GLU A CB    1 
ATOM   2540  C CG    . GLU A 1 331 ? 0.493   48.041  12.119  1.00 12.73 ? 331  GLU A CG    1 
ATOM   2541  C CD    . GLU A 1 331 ? 0.940   49.423  11.604  1.00 12.44 ? 331  GLU A CD    1 
ATOM   2542  O OE1   . GLU A 1 331 ? 0.350   49.943  10.637  1.00 15.41 ? 331  GLU A OE1   1 
ATOM   2543  O OE2   . GLU A 1 331 ? 1.870   50.010  12.188  1.00 14.31 ? 331  GLU A OE2   1 
ATOM   2544  N N     . GLY A 1 332 ? -3.013  46.027  11.554  1.00 11.14 ? 332  GLY A N     1 
ATOM   2545  C CA    . GLY A 1 332 ? -4.270  46.631  12.030  1.00 11.10 ? 332  GLY A CA    1 
ATOM   2546  C C     . GLY A 1 332 ? -5.297  45.642  12.533  1.00 11.57 ? 332  GLY A C     1 
ATOM   2547  O O     . GLY A 1 332 ? -4.943  44.617  13.104  1.00 11.00 ? 332  GLY A O     1 
ATOM   2548  N N     . VAL A 1 333 ? -6.574  45.974  12.344  1.00 12.54 ? 333  VAL A N     1 
ATOM   2549  C CA    . VAL A 1 333 ? -7.689  45.084  12.713  1.00 13.14 ? 333  VAL A CA    1 
ATOM   2550  C C     . VAL A 1 333 ? -8.527  44.706  11.496  1.00 12.66 ? 333  VAL A C     1 
ATOM   2551  O O     . VAL A 1 333 ? -8.729  45.540  10.636  1.00 12.85 ? 333  VAL A O     1 
ATOM   2552  C CB    . VAL A 1 333 ? -8.643  45.711  13.817  1.00 13.85 ? 333  VAL A CB    1 
ATOM   2553  C CG1   . VAL A 1 333 ? -8.064  45.542  15.171  1.00 13.35 ? 333  VAL A CG1   1 
ATOM   2554  C CG2   . VAL A 1 333 ? -8.942  47.189  13.555  1.00 13.65 ? 333  VAL A CG2   1 
ATOM   2555  N N     . PRO A 1 334 ? -9.029  43.456  11.431  1.00 12.91 ? 334  PRO A N     1 
ATOM   2556  C CA    . PRO A 1 334 ? -9.870  43.011  10.290  1.00 13.02 ? 334  PRO A CA    1 
ATOM   2557  C C     . PRO A 1 334 ? -11.083 43.891  9.934   1.00 12.93 ? 334  PRO A C     1 
ATOM   2558  O O     . PRO A 1 334 ? -11.623 43.724  8.843   1.00 13.31 ? 334  PRO A O     1 
ATOM   2559  C CB    . PRO A 1 334 ? -10.370 41.628  10.736  1.00 13.49 ? 334  PRO A CB    1 
ATOM   2560  C CG    . PRO A 1 334 ? -10.109 41.584  12.252  1.00 13.67 ? 334  PRO A CG    1 
ATOM   2561  C CD    . PRO A 1 334 ? -8.840  42.363  12.405  1.00 12.70 ? 334  PRO A CD    1 
ATOM   2562  N N     . ASN A 1 335 ? -11.513 44.798  10.815  1.00 11.93 ? 335  ASN A N     1 
ATOM   2563  C CA    . ASN A 1 335 ? -12.624 45.694  10.482  1.00 11.85 ? 335  ASN A CA    1 
ATOM   2564  C C     . ASN A 1 335 ? -12.371 47.190  10.578  1.00 11.90 ? 335  ASN A C     1 
ATOM   2565  O O     . ASN A 1 335 ? -13.286 47.967  10.846  1.00 11.93 ? 335  ASN A O     1 
ATOM   2566  C CB    . ASN A 1 335 ? -13.912 45.344  11.248  1.00 12.05 ? 335  ASN A CB    1 
ATOM   2567  C CG    . ASN A 1 335 ? -13.736 45.318  12.763  1.00 12.44 ? 335  ASN A CG    1 
ATOM   2568  O OD1   . ASN A 1 335 ? -14.617 44.829  13.470  1.00 16.59 ? 335  ASN A OD1   1 
ATOM   2569  N ND2   . ASN A 1 335 ? -12.616 45.810  13.265  1.00 11.37 ? 335  ASN A ND2   1 
ATOM   2570  N N     . TRP A 1 336 ? -11.143 47.618  10.355  1.00 11.90 ? 336  TRP A N     1 
ATOM   2571  C CA    . TRP A 1 336 ? -10.918 49.045  10.305  1.00 11.88 ? 336  TRP A CA    1 
ATOM   2572  C C     . TRP A 1 336 ? -10.154 49.370  9.031   1.00 11.48 ? 336  TRP A C     1 
ATOM   2573  O O     . TRP A 1 336 ? -9.123  48.728  8.768   1.00 11.79 ? 336  TRP A O     1 
ATOM   2574  C CB    . TRP A 1 336 ? -10.172 49.527  11.558  1.00 12.04 ? 336  TRP A CB    1 
ATOM   2575  C CG    . TRP A 1 336 ? -10.201 51.016  11.690  1.00 12.07 ? 336  TRP A CG    1 
ATOM   2576  C CD1   . TRP A 1 336 ? -11.111 51.773  12.392  1.00 11.12 ? 336  TRP A CD1   1 
ATOM   2577  C CD2   . TRP A 1 336 ? -9.306  51.928  11.071  1.00 10.68 ? 336  TRP A CD2   1 
ATOM   2578  N NE1   . TRP A 1 336 ? -10.817 53.109  12.237  1.00 12.33 ? 336  TRP A NE1   1 
ATOM   2579  C CE2   . TRP A 1 336 ? -9.710  53.226  11.436  1.00 12.11 ? 336  TRP A CE2   1 
ATOM   2580  C CE3   . TRP A 1 336 ? -8.185  51.775  10.253  1.00 12.07 ? 336  TRP A CE3   1 
ATOM   2581  C CZ2   . TRP A 1 336 ? -9.039  54.370  10.983  1.00 13.97 ? 336  TRP A CZ2   1 
ATOM   2582  C CZ3   . TRP A 1 336 ? -7.499  52.912  9.809   1.00 11.57 ? 336  TRP A CZ3   1 
ATOM   2583  C CH2   . TRP A 1 336 ? -7.929  54.187  10.169  1.00 12.75 ? 336  TRP A CH2   1 
ATOM   2584  N N     . PRO A 1 337 ? -10.611 50.380  8.254   1.00 10.81 ? 337  PRO A N     1 
ATOM   2585  C CA    . PRO A 1 337 ? -11.773 51.310  8.395   1.00 10.66 ? 337  PRO A CA    1 
ATOM   2586  C C     . PRO A 1 337 ? -13.211 50.767  8.340   1.00 9.95  ? 337  PRO A C     1 
ATOM   2587  O O     . PRO A 1 337 ? -14.114 51.380  8.936   1.00 10.09 ? 337  PRO A O     1 
ATOM   2588  C CB    . PRO A 1 337 ? -11.594 52.311  7.218   1.00 10.62 ? 337  PRO A CB    1 
ATOM   2589  C CG    . PRO A 1 337 ? -10.195 52.134  6.712   1.00 10.13 ? 337  PRO A CG    1 
ATOM   2590  C CD    . PRO A 1 337 ? -9.768  50.720  7.087   1.00 10.53 ? 337  PRO A CD    1 
ATOM   2591  N N     . THR A 1 338 ? -13.432 49.673  7.609   1.00 9.02  ? 338  THR A N     1 
ATOM   2592  C CA    . THR A 1 338 ? -14.790 49.154  7.329   1.00 7.44  ? 338  THR A CA    1 
ATOM   2593  C C     . THR A 1 338 ? -14.700 47.654  7.550   1.00 7.49  ? 338  THR A C     1 
ATOM   2594  O O     . THR A 1 338 ? -13.589 47.106  7.549   1.00 6.61  ? 338  THR A O     1 
ATOM   2595  C CB    . THR A 1 338 ? -15.217 49.366  5.833   1.00 7.40  ? 338  THR A CB    1 
ATOM   2596  O OG1   . THR A 1 338 ? -14.456 48.473  4.996   1.00 7.24  ? 338  THR A OG1   1 
ATOM   2597  C CG2   . THR A 1 338 ? -15.023 50.841  5.341   1.00 4.44  ? 338  THR A CG2   1 
ATOM   2598  N N     . PRO A 1 339 ? -15.861 46.965  7.720   1.00 7.69  ? 339  PRO A N     1 
ATOM   2599  C CA    . PRO A 1 339 ? -15.798 45.483  7.875   1.00 7.49  ? 339  PRO A CA    1 
ATOM   2600  C C     . PRO A 1 339 ? -15.225 44.764  6.652   1.00 7.48  ? 339  PRO A C     1 
ATOM   2601  O O     . PRO A 1 339 ? -14.802 43.611  6.739   1.00 8.49  ? 339  PRO A O     1 
ATOM   2602  C CB    . PRO A 1 339 ? -17.255 45.095  8.117   1.00 7.24  ? 339  PRO A CB    1 
ATOM   2603  C CG    . PRO A 1 339 ? -17.901 46.466  8.612   1.00 6.32  ? 339  PRO A CG    1 
ATOM   2604  C CD    . PRO A 1 339 ? -17.245 47.473  7.814   1.00 6.21  ? 339  PRO A CD    1 
ATOM   2605  N N     . ALA A 1 340 ? -15.169 45.445  5.522   1.00 7.68  ? 340  ALA A N     1 
ATOM   2606  C CA    . ALA A 1 340 ? -14.612 44.841  4.314   1.00 7.65  ? 340  ALA A CA    1 
ATOM   2607  C C     . ALA A 1 340 ? -13.089 44.686  4.342   1.00 7.70  ? 340  ALA A C     1 
ATOM   2608  O O     . ALA A 1 340 ? -12.518 44.114  3.430   1.00 8.54  ? 340  ALA A O     1 
ATOM   2609  C CB    . ALA A 1 340 ? -15.045 45.625  3.100   1.00 7.22  ? 340  ALA A CB    1 
ATOM   2610  N N     . ARG A 1 341 ? -12.431 45.187  5.386   1.00 7.79  ? 341  ARG A N     1 
ATOM   2611  C CA    . ARG A 1 341 ? -10.968 45.247  5.414   1.00 7.28  ? 341  ARG A CA    1 
ATOM   2612  C C     . ARG A 1 341 ? -10.287 43.891  5.223   1.00 7.63  ? 341  ARG A C     1 
ATOM   2613  O O     . ARG A 1 341 ? -9.422  43.743  4.335   1.00 7.63  ? 341  ARG A O     1 
ATOM   2614  C CB    . ARG A 1 341 ? -10.442 45.928  6.681   1.00 6.65  ? 341  ARG A CB    1 
ATOM   2615  C CG    . ARG A 1 341 ? -8.920  46.114  6.670   1.00 6.39  ? 341  ARG A CG    1 
ATOM   2616  C CD    . ARG A 1 341 ? -8.494  47.149  5.574   1.00 3.86  ? 341  ARG A CD    1 
ATOM   2617  N NE    . ARG A 1 341 ? -7.031  47.280  5.372   1.00 3.95  ? 341  ARG A NE    1 
ATOM   2618  C CZ    . ARG A 1 341 ? -6.215  47.998  6.155   1.00 2.30  ? 341  ARG A CZ    1 
ATOM   2619  N NH1   . ARG A 1 341 ? -6.701  48.619  7.217   1.00 2.00  ? 341  ARG A NH1   1 
ATOM   2620  N NH2   . ARG A 1 341 ? -4.918  48.064  5.901   1.00 2.00  ? 341  ARG A NH2   1 
ATOM   2621  N N     . MET A 1 342 ? -10.646 42.910  6.050   1.00 7.65  ? 342  MET A N     1 
ATOM   2622  C CA    . MET A 1 342 ? -9.970  41.635  5.964   1.00 8.29  ? 342  MET A CA    1 
ATOM   2623  C C     . MET A 1 342 ? -9.985  41.146  4.512   1.00 8.47  ? 342  MET A C     1 
ATOM   2624  O O     . MET A 1 342 ? -8.923  40.830  3.954   1.00 9.48  ? 342  MET A O     1 
ATOM   2625  C CB    . MET A 1 342 ? -10.594 40.608  6.879   1.00 8.19  ? 342  MET A CB    1 
ATOM   2626  C CG    . MET A 1 342 ? -9.864  39.282  6.856   1.00 8.44  ? 342  MET A CG    1 
ATOM   2627  S SD    . MET A 1 342 ? -10.641 38.159  8.014   1.00 10.34 ? 342  MET A SD    1 
ATOM   2628  C CE    . MET A 1 342 ? -11.990 37.602  6.961   1.00 4.77  ? 342  MET A CE    1 
ATOM   2629  N N     . CYS A 1 343 ? -11.156 41.125  3.887   1.00 7.23  ? 343  CYS A N     1 
ATOM   2630  C CA    . CYS A 1 343 ? -11.210 40.734  2.501   1.00 7.94  ? 343  CYS A CA    1 
ATOM   2631  C C     . CYS A 1 343 ? -10.555 41.702  1.504   1.00 7.78  ? 343  CYS A C     1 
ATOM   2632  O O     . CYS A 1 343 ? -10.171 41.276  0.428   1.00 7.76  ? 343  CYS A O     1 
ATOM   2633  C CB    . CYS A 1 343 ? -12.640 40.403  2.078   1.00 8.12  ? 343  CYS A CB    1 
ATOM   2634  S SG    . CYS A 1 343 ? -13.337 39.036  3.036   1.00 9.70  ? 343  CYS A SG    1 
ATOM   2635  N N     . GLN A 1 344 ? -10.426 42.986  1.837   1.00 7.92  ? 344  GLN A N     1 
ATOM   2636  C CA    . GLN A 1 344 ? -9.645  43.896  0.991   1.00 8.70  ? 344  GLN A CA    1 
ATOM   2637  C C     . GLN A 1 344 ? -8.202  43.483  1.039   1.00 9.61  ? 344  GLN A C     1 
ATOM   2638  O O     . GLN A 1 344 ? -7.502  43.495  0.020   1.00 10.11 ? 344  GLN A O     1 
ATOM   2639  C CB    . GLN A 1 344 ? -9.791  45.347  1.429   1.00 8.66  ? 344  GLN A CB    1 
ATOM   2640  C CG    . GLN A 1 344 ? -11.036 46.004  0.831   1.00 8.47  ? 344  GLN A CG    1 
ATOM   2641  C CD    . GLN A 1 344 ? -11.581 47.189  1.641   1.00 9.75  ? 344  GLN A CD    1 
ATOM   2642  O OE1   . GLN A 1 344 ? -12.715 47.603  1.397   1.00 9.59  ? 344  GLN A OE1   1 
ATOM   2643  N NE2   . GLN A 1 344 ? -10.784 47.748  2.583   1.00 3.75  ? 344  GLN A NE2   1 
ATOM   2644  N N     . VAL A 1 345 ? -7.764  43.062  2.228   1.00 10.27 ? 345  VAL A N     1 
ATOM   2645  C CA    . VAL A 1 345 ? -6.397  42.601  2.383   1.00 10.37 ? 345  VAL A CA    1 
ATOM   2646  C C     . VAL A 1 345 ? -6.202  41.350  1.561   1.00 10.20 ? 345  VAL A C     1 
ATOM   2647  O O     . VAL A 1 345 ? -5.219  41.242  0.825   1.00 11.13 ? 345  VAL A O     1 
ATOM   2648  C CB    . VAL A 1 345 ? -5.987  42.399  3.851   1.00 10.83 ? 345  VAL A CB    1 
ATOM   2649  C CG1   . VAL A 1 345 ? -4.541  41.908  3.926   1.00 9.38  ? 345  VAL A CG1   1 
ATOM   2650  C CG2   . VAL A 1 345 ? -6.146  43.738  4.632   1.00 11.22 ? 345  VAL A CG2   1 
ATOM   2651  N N     . VAL A 1 346 ? -7.159  40.431  1.645   1.00 9.73  ? 346  VAL A N     1 
ATOM   2652  C CA    . VAL A 1 346 ? -7.097  39.195  0.885   1.00 8.48  ? 346  VAL A CA    1 
ATOM   2653  C C     . VAL A 1 346 ? -6.961  39.466  -0.623  1.00 8.72  ? 346  VAL A C     1 
ATOM   2654  O O     . VAL A 1 346 ? -6.092  38.877  -1.259  1.00 8.73  ? 346  VAL A O     1 
ATOM   2655  C CB    . VAL A 1 346 ? -8.262  38.296  1.251   1.00 8.28  ? 346  VAL A CB    1 
ATOM   2656  C CG1   . VAL A 1 346 ? -8.679  37.352  0.089   1.00 7.74  ? 346  VAL A CG1   1 
ATOM   2657  C CG2   . VAL A 1 346 ? -7.918  37.524  2.512   1.00 8.19  ? 346  VAL A CG2   1 
ATOM   2658  N N     . ASP A 1 347 ? -7.775  40.378  -1.169  1.00 9.15  ? 347  ASP A N     1 
ATOM   2659  C CA    . ASP A 1 347 ? -7.727  40.744  -2.597  1.00 9.80  ? 347  ASP A CA    1 
ATOM   2660  C C     . ASP A 1 347 ? -6.421  41.449  -2.968  1.00 10.36 ? 347  ASP A C     1 
ATOM   2661  O O     . ASP A 1 347 ? -5.765  41.115  -3.962  1.00 9.50  ? 347  ASP A O     1 
ATOM   2662  C CB    . ASP A 1 347 ? -8.857  41.699  -2.937  1.00 9.50  ? 347  ASP A CB    1 
ATOM   2663  C CG    . ASP A 1 347 ? -10.200 41.012  -3.058  1.00 10.30 ? 347  ASP A CG    1 
ATOM   2664  O OD1   . ASP A 1 347 ? -10.273 39.743  -2.990  1.00 8.51  ? 347  ASP A OD1   1 
ATOM   2665  O OD2   . ASP A 1 347 ? -11.182 41.775  -3.261  1.00 8.57  ? 347  ASP A OD2   1 
ATOM   2666  N N     . LYS A 1 348 ? -6.039  42.416  -2.144  1.00 10.82 ? 348  LYS A N     1 
ATOM   2667  C CA    . LYS A 1 348 ? -4.874  43.215  -2.446  1.00 11.68 ? 348  LYS A CA    1 
ATOM   2668  C C     . LYS A 1 348 ? -3.592  42.355  -2.552  1.00 12.37 ? 348  LYS A C     1 
ATOM   2669  O O     . LYS A 1 348 ? -2.765  42.580  -3.433  1.00 13.20 ? 348  LYS A O     1 
ATOM   2670  C CB    . LYS A 1 348 ? -4.726  44.350  -1.427  1.00 10.97 ? 348  LYS A CB    1 
ATOM   2671  C CG    . LYS A 1 348 ? -3.758  45.443  -1.859  1.00 10.51 ? 348  LYS A CG    1 
ATOM   2672  C CD    . LYS A 1 348 ? -3.006  45.927  -0.614  1.00 11.16 ? 348  LYS A CD    1 
ATOM   2673  C CE    . LYS A 1 348 ? -1.977  47.008  -0.858  1.00 10.06 ? 348  LYS A CE    1 
ATOM   2674  N NZ    . LYS A 1 348 ? -1.693  47.659  0.456   1.00 10.36 ? 348  LYS A NZ    1 
ATOM   2675  N N     . HIS A 1 349 ? -3.417  41.365  -1.686  1.00 12.29 ? 349  HIS A N     1 
ATOM   2676  C CA    . HIS A 1 349 ? -2.190  40.564  -1.772  1.00 12.20 ? 349  HIS A CA    1 
ATOM   2677  C C     . HIS A 1 349 ? -2.407  39.149  -2.289  1.00 11.98 ? 349  HIS A C     1 
ATOM   2678  O O     . HIS A 1 349 ? -1.547  38.275  -2.131  1.00 13.43 ? 349  HIS A O     1 
ATOM   2679  C CB    . HIS A 1 349 ? -1.484  40.536  -0.427  1.00 12.00 ? 349  HIS A CB    1 
ATOM   2680  C CG    . HIS A 1 349 ? -1.246  41.892  0.157   1.00 13.43 ? 349  HIS A CG    1 
ATOM   2681  N ND1   . HIS A 1 349 ? -0.273  42.749  -0.315  1.00 13.88 ? 349  HIS A ND1   1 
ATOM   2682  C CD2   . HIS A 1 349 ? -1.848  42.538  1.184   1.00 14.83 ? 349  HIS A CD2   1 
ATOM   2683  C CE1   . HIS A 1 349 ? -0.286  43.861  0.396   1.00 13.05 ? 349  HIS A CE1   1 
ATOM   2684  N NE2   . HIS A 1 349 ? -1.224  43.757  1.320   1.00 14.44 ? 349  HIS A NE2   1 
ATOM   2685  N N     . GLN A 1 350 ? -3.558  38.914  -2.905  1.00 11.47 ? 350  GLN A N     1 
ATOM   2686  C CA    . GLN A 1 350 ? -3.854  37.630  -3.522  1.00 10.77 ? 350  GLN A CA    1 
ATOM   2687  C C     . GLN A 1 350 ? -3.583  36.480  -2.545  1.00 11.21 ? 350  GLN A C     1 
ATOM   2688  O O     . GLN A 1 350 ? -2.863  35.520  -2.854  1.00 11.55 ? 350  GLN A O     1 
ATOM   2689  C CB    . GLN A 1 350 ? -3.072  37.477  -4.832  1.00 10.37 ? 350  GLN A CB    1 
ATOM   2690  C CG    . GLN A 1 350 ? -3.489  38.448  -5.914  1.00 8.59  ? 350  GLN A CG    1 
ATOM   2691  C CD    . GLN A 1 350 ? -4.947  38.188  -6.360  1.00 11.18 ? 350  GLN A CD    1 
ATOM   2692  O OE1   . GLN A 1 350 ? -5.853  38.910  -5.964  1.00 9.75  ? 350  GLN A OE1   1 
ATOM   2693  N NE2   . GLN A 1 350 ? -5.169  37.127  -7.151  1.00 11.08 ? 350  GLN A NE2   1 
ATOM   2694  N N     . VAL A 1 351 ? -4.189  36.590  -1.363  1.00 10.91 ? 351  VAL A N     1 
ATOM   2695  C CA    . VAL A 1 351 ? -4.026  35.601  -0.300  1.00 10.30 ? 351  VAL A CA    1 
ATOM   2696  C C     . VAL A 1 351 ? -4.740  34.302  -0.681  1.00 10.55 ? 351  VAL A C     1 
ATOM   2697  O O     . VAL A 1 351 ? -5.904  34.324  -1.121  1.00 11.27 ? 351  VAL A O     1 
ATOM   2698  C CB    . VAL A 1 351 ? -4.574  36.158  1.031   1.00 9.93  ? 351  VAL A CB    1 
ATOM   2699  C CG1   . VAL A 1 351 ? -4.663  35.064  2.085   1.00 9.74  ? 351  VAL A CG1   1 
ATOM   2700  C CG2   . VAL A 1 351 ? -3.730  37.334  1.497   1.00 8.12  ? 351  VAL A CG2   1 
ATOM   2701  N N     . ASN A 1 352 ? -4.053  33.173  -0.519  1.00 10.52 ? 352  ASN A N     1 
ATOM   2702  C CA    . ASN A 1 352 ? -4.639  31.850  -0.837  1.00 9.67  ? 352  ASN A CA    1 
ATOM   2703  C C     . ASN A 1 352 ? -5.035  31.075  0.383   1.00 10.35 ? 352  ASN A C     1 
ATOM   2704  O O     . ASN A 1 352 ? -5.879  30.173  0.278   1.00 10.87 ? 352  ASN A O     1 
ATOM   2705  C CB    . ASN A 1 352 ? -3.668  30.989  -1.620  1.00 8.81  ? 352  ASN A CB    1 
ATOM   2706  C CG    . ASN A 1 352 ? -3.114  31.697  -2.808  1.00 8.63  ? 352  ASN A CG    1 
ATOM   2707  O OD1   . ASN A 1 352 ? -1.905  31.887  -2.892  1.00 9.58  ? 352  ASN A OD1   1 
ATOM   2708  N ND2   . ASN A 1 352 ? -3.995  32.160  -3.712  1.00 4.80  ? 352  ASN A ND2   1 
ATOM   2709  N N     . ILE A 1 353 ? -4.397  31.390  1.520   1.00 10.03 ? 353  ILE A N     1 
ATOM   2710  C CA    . ILE A 1 353 ? -4.742  30.776  2.782   1.00 10.39 ? 353  ILE A CA    1 
ATOM   2711  C C     . ILE A 1 353 ? -5.035  31.814  3.873   1.00 11.60 ? 353  ILE A C     1 
ATOM   2712  O O     . ILE A 1 353 ? -4.210  32.686  4.153   1.00 11.98 ? 353  ILE A O     1 
ATOM   2713  C CB    . ILE A 1 353 ? -3.647  29.836  3.285   1.00 10.37 ? 353  ILE A CB    1 
ATOM   2714  C CG1   . ILE A 1 353 ? -3.169  28.877  2.173   1.00 9.80  ? 353  ILE A CG1   1 
ATOM   2715  C CG2   . ILE A 1 353 ? -4.193  29.053  4.475   1.00 9.09  ? 353  ILE A CG2   1 
ATOM   2716  C CD1   . ILE A 1 353 ? -1.719  28.402  2.327   1.00 8.10  ? 353  ILE A CD1   1 
ATOM   2717  N N     . LEU A 1 354 ? -6.211  31.717  4.488   1.00 11.37 ? 354  LEU A N     1 
ATOM   2718  C CA    . LEU A 1 354 ? -6.581  32.623  5.557   1.00 11.44 ? 354  LEU A CA    1 
ATOM   2719  C C     . LEU A 1 354 ? -6.830  31.805  6.818   1.00 11.71 ? 354  LEU A C     1 
ATOM   2720  O O     . LEU A 1 354 ? -7.575  30.809  6.816   1.00 11.59 ? 354  LEU A O     1 
ATOM   2721  C CB    . LEU A 1 354 ? -7.797  33.503  5.181   1.00 10.72 ? 354  LEU A CB    1 
ATOM   2722  C CG    . LEU A 1 354 ? -8.356  34.510  6.212   1.00 10.75 ? 354  LEU A CG    1 
ATOM   2723  C CD1   . LEU A 1 354 ? -7.348  35.556  6.658   1.00 8.08  ? 354  LEU A CD1   1 
ATOM   2724  C CD2   . LEU A 1 354 ? -9.640  35.220  5.711   1.00 11.49 ? 354  LEU A CD2   1 
ATOM   2725  N N     . TYR A 1 355 ? -6.186  32.237  7.895   1.00 11.56 ? 355  TYR A N     1 
ATOM   2726  C CA    . TYR A 1 355 ? -6.234  31.542  9.154   1.00 11.44 ? 355  TYR A CA    1 
ATOM   2727  C C     . TYR A 1 355 ? -6.601  32.628  10.168  1.00 11.91 ? 355  TYR A C     1 
ATOM   2728  O O     . TYR A 1 355 ? -5.841  33.579  10.368  1.00 13.03 ? 355  TYR A O     1 
ATOM   2729  C CB    . TYR A 1 355 ? -4.854  30.938  9.420   1.00 10.84 ? 355  TYR A CB    1 
ATOM   2730  C CG    . TYR A 1 355 ? -4.739  30.119  10.666  1.00 10.80 ? 355  TYR A CG    1 
ATOM   2731  C CD1   . TYR A 1 355 ? -5.810  29.324  11.109  1.00 10.76 ? 355  TYR A CD1   1 
ATOM   2732  C CD2   . TYR A 1 355 ? -3.541  30.111  11.401  1.00 11.87 ? 355  TYR A CD2   1 
ATOM   2733  C CE1   . TYR A 1 355 ? -5.705  28.556  12.274  1.00 11.56 ? 355  TYR A CE1   1 
ATOM   2734  C CE2   . TYR A 1 355 ? -3.404  29.336  12.558  1.00 11.93 ? 355  TYR A CE2   1 
ATOM   2735  C CZ    . TYR A 1 355 ? -4.498  28.566  12.999  1.00 11.83 ? 355  TYR A CZ    1 
ATOM   2736  O OH    . TYR A 1 355 ? -4.395  27.811  14.146  1.00 9.65  ? 355  TYR A OH    1 
ATOM   2737  N N     . THR A 1 356 ? -7.762  32.530  10.780  1.00 11.50 ? 356  THR A N     1 
ATOM   2738  C CA    . THR A 1 356 ? -8.171  33.623  11.634  1.00 12.46 ? 356  THR A CA    1 
ATOM   2739  C C     . THR A 1 356 ? -8.961  33.160  12.825  1.00 12.37 ? 356  THR A C     1 
ATOM   2740  O O     . THR A 1 356 ? -8.994  31.961  13.088  1.00 13.79 ? 356  THR A O     1 
ATOM   2741  C CB    . THR A 1 356 ? -8.905  34.769  10.857  1.00 12.79 ? 356  THR A CB    1 
ATOM   2742  O OG1   . THR A 1 356 ? -9.030  35.912  11.726  1.00 12.81 ? 356  THR A OG1   1 
ATOM   2743  C CG2   . THR A 1 356 ? -10.276 34.325  10.364  1.00 10.95 ? 356  THR A CG2   1 
ATOM   2744  N N     . ALA A 1 357 ? -9.570  34.097  13.549  1.00 12.02 ? 357  ALA A N     1 
ATOM   2745  C CA    . ALA A 1 357 ? -10.208 33.800  14.858  1.00 11.95 ? 357  ALA A CA    1 
ATOM   2746  C C     . ALA A 1 357 ? -11.728 33.905  14.841  1.00 11.62 ? 357  ALA A C     1 
ATOM   2747  O O     . ALA A 1 357 ? -12.279 34.831  14.248  1.00 12.44 ? 357  ALA A O     1 
ATOM   2748  C CB    . ALA A 1 357 ? -9.640  34.709  15.942  1.00 10.77 ? 357  ALA A CB    1 
ATOM   2749  N N     . PRO A 1 358 ? -12.415 32.955  15.481  1.00 11.69 ? 358  PRO A N     1 
ATOM   2750  C CA    . PRO A 1 358 ? -13.892 33.031  15.563  1.00 11.70 ? 358  PRO A CA    1 
ATOM   2751  C C     . PRO A 1 358 ? -14.429 34.368  16.083  1.00 11.92 ? 358  PRO A C     1 
ATOM   2752  O O     . PRO A 1 358 ? -15.457 34.855  15.590  1.00 11.55 ? 358  PRO A O     1 
ATOM   2753  C CB    . PRO A 1 358 ? -14.262 31.859  16.485  1.00 11.68 ? 358  PRO A CB    1 
ATOM   2754  C CG    . PRO A 1 358 ? -13.143 30.833  16.222  1.00 11.29 ? 358  PRO A CG    1 
ATOM   2755  C CD    . PRO A 1 358 ? -11.888 31.700  16.056  1.00 11.56 ? 358  PRO A CD    1 
ATOM   2756  N N     . THR A 1 359 ? -13.742 34.982  17.044  1.00 11.65 ? 359  THR A N     1 
ATOM   2757  C CA    . THR A 1 359 ? -14.180 36.296  17.481  1.00 11.06 ? 359  THR A CA    1 
ATOM   2758  C C     . THR A 1 359 ? -14.227 37.274  16.308  1.00 10.58 ? 359  THR A C     1 
ATOM   2759  O O     . THR A 1 359 ? -15.242 37.944  16.099  1.00 10.13 ? 359  THR A O     1 
ATOM   2760  C CB    . THR A 1 359 ? -13.333 36.843  18.638  1.00 10.90 ? 359  THR A CB    1 
ATOM   2761  O OG1   . THR A 1 359 ? -13.648 36.083  19.802  1.00 12.92 ? 359  THR A OG1   1 
ATOM   2762  C CG2   . THR A 1 359 ? -13.673 38.315  18.931  1.00 9.53  ? 359  THR A CG2   1 
ATOM   2763  N N     . ALA A 1 360 ? -13.136 37.350  15.546  1.00 10.01 ? 360  ALA A N     1 
ATOM   2764  C CA    . ALA A 1 360 ? -13.100 38.219  14.373  1.00 9.86  ? 360  ALA A CA    1 
ATOM   2765  C C     . ALA A 1 360 ? -14.200 37.824  13.399  1.00 9.62  ? 360  ALA A C     1 
ATOM   2766  O O     . ALA A 1 360 ? -14.994 38.661  12.984  1.00 9.35  ? 360  ALA A O     1 
ATOM   2767  C CB    . ALA A 1 360 ? -11.739 38.200  13.700  1.00 9.46  ? 360  ALA A CB    1 
ATOM   2768  N N     . ILE A 1 361 ? -14.279 36.534  13.094  1.00 9.75  ? 361  ILE A N     1 
ATOM   2769  C CA    . ILE A 1 361 ? -15.339 36.028  12.230  1.00 9.71  ? 361  ILE A CA    1 
ATOM   2770  C C     . ILE A 1 361 ? -16.728 36.496  12.672  1.00 9.84  ? 361  ILE A C     1 
ATOM   2771  O O     . ILE A 1 361 ? -17.512 36.995  11.846  1.00 10.14 ? 361  ILE A O     1 
ATOM   2772  C CB    . ILE A 1 361 ? -15.296 34.487  12.124  1.00 10.26 ? 361  ILE A CB    1 
ATOM   2773  C CG1   . ILE A 1 361 ? -14.011 34.027  11.398  1.00 8.87  ? 361  ILE A CG1   1 
ATOM   2774  C CG2   . ILE A 1 361 ? -16.609 33.927  11.507  1.00 7.92  ? 361  ILE A CG2   1 
ATOM   2775  C CD1   . ILE A 1 361 ? -13.652 32.535  11.698  1.00 9.25  ? 361  ILE A CD1   1 
ATOM   2776  N N     . ARG A 1 362 ? -17.025 36.342  13.961  1.00 9.90  ? 362  ARG A N     1 
ATOM   2777  C CA    . ARG A 1 362 ? -18.339 36.750  14.516  1.00 10.34 ? 362  ARG A CA    1 
ATOM   2778  C C     . ARG A 1 362 ? -18.595 38.253  14.407  1.00 10.57 ? 362  ARG A C     1 
ATOM   2779  O O     . ARG A 1 362 ? -19.725 38.664  14.147  1.00 10.82 ? 362  ARG A O     1 
ATOM   2780  C CB    . ARG A 1 362 ? -18.521 36.295  15.966  1.00 9.89  ? 362  ARG A CB    1 
ATOM   2781  C CG    . ARG A 1 362 ? -18.738 34.786  16.128  1.00 9.98  ? 362  ARG A CG    1 
ATOM   2782  C CD    . ARG A 1 362 ? -19.062 34.415  17.566  1.00 10.29 ? 362  ARG A CD    1 
ATOM   2783  N NE    . ARG A 1 362 ? -17.906 34.637  18.413  1.00 13.89 ? 362  ARG A NE    1 
ATOM   2784  C CZ    . ARG A 1 362 ? -17.111 33.676  18.876  1.00 17.20 ? 362  ARG A CZ    1 
ATOM   2785  N NH1   . ARG A 1 362 ? -17.370 32.390  18.615  1.00 18.73 ? 362  ARG A NH1   1 
ATOM   2786  N NH2   . ARG A 1 362 ? -16.042 34.007  19.591  1.00 17.86 ? 362  ARG A NH2   1 
ATOM   2787  N N     . ALA A 1 363 ? -17.552 39.061  14.588  1.00 10.54 ? 363  ALA A N     1 
ATOM   2788  C CA    . ALA A 1 363 ? -17.688 40.502  14.462  1.00 10.78 ? 363  ALA A CA    1 
ATOM   2789  C C     . ALA A 1 363 ? -17.965 40.870  13.024  1.00 10.69 ? 363  ALA A C     1 
ATOM   2790  O O     . ALA A 1 363 ? -18.805 41.711  12.754  1.00 11.86 ? 363  ALA A O     1 
ATOM   2791  C CB    . ALA A 1 363 ? -16.440 41.230  14.985  1.00 10.94 ? 363  ALA A CB    1 
ATOM   2792  N N     . LEU A 1 364 ? -17.254 40.248  12.101  1.00 10.93 ? 364  LEU A N     1 
ATOM   2793  C CA    . LEU A 1 364 ? -17.518 40.419  10.677  1.00 11.00 ? 364  LEU A CA    1 
ATOM   2794  C C     . LEU A 1 364 ? -18.925 39.936  10.329  1.00 11.91 ? 364  LEU A C     1 
ATOM   2795  O O     . LEU A 1 364 ? -19.623 40.579  9.531   1.00 12.61 ? 364  LEU A O     1 
ATOM   2796  C CB    . LEU A 1 364 ? -16.492 39.650  9.852   1.00 10.79 ? 364  LEU A CB    1 
ATOM   2797  C CG    . LEU A 1 364 ? -15.026 40.089  9.926   1.00 8.65  ? 364  LEU A CG    1 
ATOM   2798  C CD1   . LEU A 1 364 ? -14.246 39.483  8.783   1.00 4.67  ? 364  LEU A CD1   1 
ATOM   2799  C CD2   . LEU A 1 364 ? -14.944 41.583  9.858   1.00 7.87  ? 364  LEU A CD2   1 
ATOM   2800  N N     . MET A 1 365 ? -19.355 38.834  10.950  1.00 11.84 ? 365  MET A N     1 
ATOM   2801  C CA    . MET A 1 365 ? -20.673 38.247  10.664  1.00 12.44 ? 365  MET A CA    1 
ATOM   2802  C C     . MET A 1 365 ? -21.840 39.138  11.100  1.00 11.40 ? 365  MET A C     1 
ATOM   2803  O O     . MET A 1 365 ? -22.891 39.169  10.455  1.00 11.41 ? 365  MET A O     1 
ATOM   2804  C CB    . MET A 1 365 ? -20.793 36.856  11.296  1.00 12.50 ? 365  MET A CB    1 
ATOM   2805  C CG    . MET A 1 365 ? -22.067 36.135  10.920  1.00 13.32 ? 365  MET A CG    1 
ATOM   2806  S SD    . MET A 1 365 ? -22.143 34.430  11.457  1.00 15.41 ? 365  MET A SD    1 
ATOM   2807  C CE    . MET A 1 365 ? -22.215 34.629  13.248  1.00 16.44 ? 365  MET A CE    1 
ATOM   2808  N N     . ALA A 1 366 ? -21.656 39.857  12.195  1.00 11.09 ? 366  ALA A N     1 
ATOM   2809  C CA    . ALA A 1 366 ? -22.666 40.808  12.664  1.00 11.16 ? 366  ALA A CA    1 
ATOM   2810  C C     . ALA A 1 366 ? -23.009 41.841  11.595  1.00 11.11 ? 366  ALA A C     1 
ATOM   2811  O O     . ALA A 1 366 ? -24.158 42.303  11.550  1.00 11.56 ? 366  ALA A O     1 
ATOM   2812  C CB    . ALA A 1 366 ? -22.232 41.511  13.980  1.00 10.58 ? 366  ALA A CB    1 
ATOM   2813  N N     . GLU A 1 367 ? -22.020 42.188  10.761  1.00 10.75 ? 367  GLU A N     1 
ATOM   2814  C CA    . GLU A 1 367 ? -22.185 43.169  9.667   1.00 11.03 ? 367  GLU A CA    1 
ATOM   2815  C C     . GLU A 1 367 ? -22.609 42.570  8.320   1.00 10.32 ? 367  GLU A C     1 
ATOM   2816  O O     . GLU A 1 367 ? -22.709 43.289  7.339   1.00 9.48  ? 367  GLU A O     1 
ATOM   2817  C CB    . GLU A 1 367 ? -20.886 43.935  9.418   1.00 11.16 ? 367  GLU A CB    1 
ATOM   2818  C CG    . GLU A 1 367 ? -20.263 44.573  10.627  1.00 13.40 ? 367  GLU A CG    1 
ATOM   2819  C CD    . GLU A 1 367 ? -21.160 45.570  11.291  1.00 17.04 ? 367  GLU A CD    1 
ATOM   2820  O OE1   . GLU A 1 367 ? -22.222 45.926  10.725  1.00 19.71 ? 367  GLU A OE1   1 
ATOM   2821  O OE2   . GLU A 1 367 ? -20.806 45.994  12.404  1.00 18.44 ? 367  GLU A OE2   1 
ATOM   2822  N N     . GLY A 1 368 ? -22.820 41.258  8.270   1.00 10.21 ? 368  GLY A N     1 
ATOM   2823  C CA    . GLY A 1 368 ? -23.326 40.598  7.071   1.00 10.79 ? 368  GLY A CA    1 
ATOM   2824  C C     . GLY A 1 368 ? -22.522 40.905  5.827   1.00 11.32 ? 368  GLY A C     1 
ATOM   2825  O O     . GLY A 1 368 ? -21.290 40.787  5.832   1.00 12.39 ? 368  GLY A O     1 
ATOM   2826  N N     . ASP A 1 369 ? -23.199 41.321  4.764   1.00 11.17 ? 369  ASP A N     1 
ATOM   2827  C CA    . ASP A 1 369 ? -22.525 41.518  3.467   1.00 11.05 ? 369  ASP A CA    1 
ATOM   2828  C C     . ASP A 1 369 ? -21.552 42.719  3.422   1.00 11.23 ? 369  ASP A C     1 
ATOM   2829  O O     . ASP A 1 369 ? -20.704 42.844  2.512   1.00 11.02 ? 369  ASP A O     1 
ATOM   2830  C CB    . ASP A 1 369 ? -23.527 41.491  2.305   1.00 9.63  ? 369  ASP A CB    1 
ATOM   2831  C CG    . ASP A 1 369 ? -23.977 40.068  1.968   1.00 10.04 ? 369  ASP A CG    1 
ATOM   2832  O OD1   . ASP A 1 369 ? -23.504 39.083  2.597   1.00 5.30  ? 369  ASP A OD1   1 
ATOM   2833  O OD2   . ASP A 1 369 ? -24.813 39.919  1.055   1.00 13.01 ? 369  ASP A OD2   1 
ATOM   2834  N N     . LYS A 1 370 ? -21.655 43.580  4.429   1.00 11.34 ? 370  LYS A N     1 
ATOM   2835  C CA    . LYS A 1 370 ? -20.763 44.702  4.519   1.00 11.56 ? 370  LYS A CA    1 
ATOM   2836  C C     . LYS A 1 370 ? -19.354 44.144  4.713   1.00 12.30 ? 370  LYS A C     1 
ATOM   2837  O O     . LYS A 1 370 ? -18.372 44.815  4.385   1.00 13.58 ? 370  LYS A O     1 
ATOM   2838  C CB    . LYS A 1 370 ? -21.196 45.649  5.636   1.00 11.47 ? 370  LYS A CB    1 
ATOM   2839  C CG    . LYS A 1 370 ? -21.890 46.983  5.214   1.00 12.07 ? 370  LYS A CG    1 
ATOM   2840  C CD    . LYS A 1 370 ? -22.250 47.116  3.710   1.00 16.53 ? 370  LYS A CD    1 
ATOM   2841  C CE    . LYS A 1 370 ? -23.175 48.368  3.364   1.00 13.16 ? 370  LYS A CE    1 
ATOM   2842  N N     . ALA A 1 371 ? -19.246 42.899  5.184   1.00 12.02 ? 371  ALA A N     1 
ATOM   2843  C CA    . ALA A 1 371 ? -17.933 42.253  5.347   1.00 11.96 ? 371  ALA A CA    1 
ATOM   2844  C C     . ALA A 1 371 ? -17.280 41.804  4.042   1.00 11.99 ? 371  ALA A C     1 
ATOM   2845  O O     . ALA A 1 371 ? -16.087 41.491  4.038   1.00 11.87 ? 371  ALA A O     1 
ATOM   2846  C CB    . ALA A 1 371 ? -18.015 41.055  6.327   1.00 11.50 ? 371  ALA A CB    1 
ATOM   2847  N N     . ILE A 1 372 ? -18.061 41.733  2.961   1.00 12.20 ? 372  ILE A N     1 
ATOM   2848  C CA    . ILE A 1 372 ? -17.560 41.255  1.682   1.00 12.89 ? 372  ILE A CA    1 
ATOM   2849  C C     . ILE A 1 372 ? -17.802 42.230  0.514   1.00 14.24 ? 372  ILE A C     1 
ATOM   2850  O O     . ILE A 1 372 ? -17.309 41.988  -0.603  1.00 14.89 ? 372  ILE A O     1 
ATOM   2851  C CB    . ILE A 1 372 ? -18.131 39.840  1.290   1.00 13.00 ? 372  ILE A CB    1 
ATOM   2852  C CG1   . ILE A 1 372 ? -19.647 39.903  0.992   1.00 13.30 ? 372  ILE A CG1   1 
ATOM   2853  C CG2   . ILE A 1 372 ? -17.793 38.781  2.322   1.00 10.78 ? 372  ILE A CG2   1 
ATOM   2854  C CD1   . ILE A 1 372 ? -20.253 38.578  0.481   1.00 12.37 ? 372  ILE A CD1   1 
ATOM   2855  N N     . GLU A 1 373 ? -18.563 43.301  0.749   1.00 14.70 ? 373  GLU A N     1 
ATOM   2856  C CA    . GLU A 1 373 ? -18.962 44.221  -0.319  1.00 16.00 ? 373  GLU A CA    1 
ATOM   2857  C C     . GLU A 1 373 ? -17.765 44.820  -1.029  1.00 14.74 ? 373  GLU A C     1 
ATOM   2858  O O     . GLU A 1 373 ? -16.819 45.291  -0.384  1.00 14.96 ? 373  GLU A O     1 
ATOM   2859  C CB    . GLU A 1 373 ? -19.765 45.351  0.290   1.00 16.39 ? 373  GLU A CB    1 
ATOM   2860  C CG    . GLU A 1 373 ? -20.648 46.185  -0.662  1.00 18.80 ? 373  GLU A CG    1 
ATOM   2861  C CD    . GLU A 1 373 ? -21.103 47.481  0.027   1.00 20.56 ? 373  GLU A CD    1 
ATOM   2862  O OE1   . GLU A 1 373 ? -22.341 47.674  0.182   1.00 25.11 ? 373  GLU A OE1   1 
ATOM   2863  O OE2   . GLU A 1 373 ? -20.206 48.285  0.449   1.00 25.30 ? 373  GLU A OE2   1 
ATOM   2864  N N     . GLY A 1 374 ? -17.803 44.795  -2.355  1.00 14.30 ? 374  GLY A N     1 
ATOM   2865  C CA    . GLY A 1 374 ? -16.712 45.334  -3.193  1.00 13.62 ? 374  GLY A CA    1 
ATOM   2866  C C     . GLY A 1 374 ? -15.462 44.452  -3.266  1.00 13.93 ? 374  GLY A C     1 
ATOM   2867  O O     . GLY A 1 374 ? -14.438 44.858  -3.831  1.00 14.01 ? 374  GLY A O     1 
ATOM   2868  N N     . THR A 1 375 ? -15.513 43.256  -2.680  1.00 13.04 ? 375  THR A N     1 
ATOM   2869  C CA    . THR A 1 375 ? -14.327 42.419  -2.670  1.00 12.79 ? 375  THR A CA    1 
ATOM   2870  C C     . THR A 1 375 ? -14.579 41.191  -3.487  1.00 12.41 ? 375  THR A C     1 
ATOM   2871  O O     . THR A 1 375 ? -15.717 40.823  -3.740  1.00 11.91 ? 375  THR A O     1 
ATOM   2872  C CB    . THR A 1 375 ? -13.865 41.994  -1.249  1.00 13.05 ? 375  THR A CB    1 
ATOM   2873  O OG1   . THR A 1 375 ? -14.730 40.960  -0.728  1.00 13.83 ? 375  THR A OG1   1 
ATOM   2874  C CG2   . THR A 1 375 ? -13.807 43.195  -0.309  1.00 11.65 ? 375  THR A CG2   1 
ATOM   2875  N N     . ASP A 1 376 ? -13.500 40.542  -3.878  1.00 12.31 ? 376  ASP A N     1 
ATOM   2876  C CA    . ASP A 1 376 ? -13.595 39.427  -4.792  1.00 12.17 ? 376  ASP A CA    1 
ATOM   2877  C C     . ASP A 1 376 ? -13.391 38.062  -4.085  1.00 11.53 ? 376  ASP A C     1 
ATOM   2878  O O     . ASP A 1 376 ? -14.227 37.181  -4.205  1.00 11.49 ? 376  ASP A O     1 
ATOM   2879  C CB    . ASP A 1 376 ? -12.587 39.650  -5.898  1.00 12.64 ? 376  ASP A CB    1 
ATOM   2880  C CG    . ASP A 1 376 ? -12.637 38.584  -6.927  1.00 14.57 ? 376  ASP A CG    1 
ATOM   2881  O OD1   . ASP A 1 376 ? -12.143 37.464  -6.679  1.00 17.19 ? 376  ASP A OD1   1 
ATOM   2882  O OD2   . ASP A 1 376 ? -13.198 38.867  -7.988  1.00 18.79 ? 376  ASP A OD2   1 
ATOM   2883  N N     . ARG A 1 377 ? -12.299 37.903  -3.341  1.00 10.72 ? 377  ARG A N     1 
ATOM   2884  C CA    . ARG A 1 377 ? -11.995 36.658  -2.589  1.00 10.04 ? 377  ARG A CA    1 
ATOM   2885  C C     . ARG A 1 377 ? -11.673 35.379  -3.406  1.00 10.72 ? 377  ARG A C     1 
ATOM   2886  O O     . ARG A 1 377 ? -11.437 34.325  -2.800  1.00 11.22 ? 377  ARG A O     1 
ATOM   2887  C CB    . ARG A 1 377 ? -13.087 36.344  -1.563  1.00 9.60  ? 377  ARG A CB    1 
ATOM   2888  C CG    . ARG A 1 377 ? -13.256 37.360  -0.451  1.00 8.27  ? 377  ARG A CG    1 
ATOM   2889  C CD    . ARG A 1 377 ? -14.706 37.437  0.018   1.00 6.67  ? 377  ARG A CD    1 
ATOM   2890  N NE    . ARG A 1 377 ? -15.544 38.179  -0.935  1.00 6.46  ? 377  ARG A NE    1 
ATOM   2891  C CZ    . ARG A 1 377 ? -16.675 37.716  -1.441  1.00 5.13  ? 377  ARG A CZ    1 
ATOM   2892  N NH1   . ARG A 1 377 ? -17.135 36.528  -1.064  1.00 4.92  ? 377  ARG A NH1   1 
ATOM   2893  N NH2   . ARG A 1 377 ? -17.351 38.444  -2.311  1.00 4.31  ? 377  ARG A NH2   1 
ATOM   2894  N N     . SER A 1 378 ? -11.658 35.445  -4.745  1.00 10.59 ? 378  SER A N     1 
ATOM   2895  C CA    . SER A 1 378 ? -11.379 34.250  -5.581  1.00 10.95 ? 378  SER A CA    1 
ATOM   2896  C C     . SER A 1 378 ? -10.027 33.604  -5.320  1.00 10.97 ? 378  SER A C     1 
ATOM   2897  O O     . SER A 1 378 ? -9.839  32.460  -5.698  1.00 11.40 ? 378  SER A O     1 
ATOM   2898  C CB    . SER A 1 378 ? -11.385 34.586  -7.073  1.00 10.53 ? 378  SER A CB    1 
ATOM   2899  O OG    . SER A 1 378 ? -12.655 35.056  -7.461  1.00 13.47 ? 378  SER A OG    1 
ATOM   2900  N N     . SER A 1 379 ? -9.070  34.337  -4.746  1.00 10.42 ? 379  SER A N     1 
ATOM   2901  C CA    . SER A 1 379 ? -7.722  33.823  -4.629  1.00 10.46 ? 379  SER A CA    1 
ATOM   2902  C C     . SER A 1 379 ? -7.638  32.774  -3.503  1.00 10.99 ? 379  SER A C     1 
ATOM   2903  O O     . SER A 1 379 ? -6.725  31.949  -3.477  1.00 10.83 ? 379  SER A O     1 
ATOM   2904  C CB    . SER A 1 379 ? -6.719  34.974  -4.418  1.00 10.56 ? 379  SER A CB    1 
ATOM   2905  O OG    . SER A 1 379 ? -6.926  35.656  -3.190  1.00 9.38  ? 379  SER A OG    1 
ATOM   2906  N N     . LEU A 1 380 ? -8.610  32.814  -2.589  1.00 10.83 ? 380  LEU A N     1 
ATOM   2907  C CA    . LEU A 1 380 ? -8.632  31.949  -1.414  1.00 10.67 ? 380  LEU A CA    1 
ATOM   2908  C C     . LEU A 1 380 ? -8.896  30.513  -1.782  1.00 10.48 ? 380  LEU A C     1 
ATOM   2909  O O     . LEU A 1 380 ? -9.827  30.240  -2.529  1.00 10.19 ? 380  LEU A O     1 
ATOM   2910  C CB    . LEU A 1 380 ? -9.706  32.419  -0.420  1.00 10.30 ? 380  LEU A CB    1 
ATOM   2911  C CG    . LEU A 1 380 ? -9.367  33.649  0.429   1.00 9.68  ? 380  LEU A CG    1 
ATOM   2912  C CD1   . LEU A 1 380 ? -10.591 34.131  1.201   1.00 6.59  ? 380  LEU A CD1   1 
ATOM   2913  C CD2   . LEU A 1 380 ? -8.177  33.375  1.352   1.00 6.01  ? 380  LEU A CD2   1 
ATOM   2914  N N     . ARG A 1 381 ? -8.084  29.605  -1.237  1.00 10.65 ? 381  ARG A N     1 
ATOM   2915  C CA    . ARG A 1 381 ? -8.286  28.139  -1.398  1.00 10.62 ? 381  ARG A CA    1 
ATOM   2916  C C     . ARG A 1 381 ? -8.549  27.402  -0.077  1.00 9.69  ? 381  ARG A C     1 
ATOM   2917  O O     . ARG A 1 381 ? -9.178  26.348  -0.073  1.00 10.27 ? 381  ARG A O     1 
ATOM   2918  C CB    . ARG A 1 381 ? -7.102  27.478  -2.126  1.00 10.52 ? 381  ARG A CB    1 
ATOM   2919  C CG    . ARG A 1 381 ? -7.068  27.738  -3.634  1.00 10.99 ? 381  ARG A CG    1 
ATOM   2920  C CD    . ARG A 1 381 ? -5.899  27.027  -4.322  1.00 12.47 ? 381  ARG A CD    1 
ATOM   2921  N NE    . ARG A 1 381 ? -4.596  27.661  -4.062  1.00 17.11 ? 381  ARG A NE    1 
ATOM   2922  C CZ    . ARG A 1 381 ? -4.018  28.578  -4.847  1.00 17.60 ? 381  ARG A CZ    1 
ATOM   2923  N NH1   . ARG A 1 381 ? -4.623  29.004  -5.957  1.00 17.42 ? 381  ARG A NH1   1 
ATOM   2924  N NH2   . ARG A 1 381 ? -2.827  29.079  -4.526  1.00 16.14 ? 381  ARG A NH2   1 
ATOM   2925  N N     . ILE A 1 382 ? -8.067  27.959  1.030   1.00 8.68  ? 382  ILE A N     1 
ATOM   2926  C CA    . ILE A 1 382 ? -8.073  27.272  2.316   1.00 8.12  ? 382  ILE A CA    1 
ATOM   2927  C C     . ILE A 1 382 ? -8.380  28.277  3.431   1.00 8.37  ? 382  ILE A C     1 
ATOM   2928  O O     . ILE A 1 382 ? -7.862  29.390  3.423   1.00 8.04  ? 382  ILE A O     1 
ATOM   2929  C CB    . ILE A 1 382 ? -6.691  26.613  2.605   1.00 7.61  ? 382  ILE A CB    1 
ATOM   2930  C CG1   . ILE A 1 382 ? -6.316  25.593  1.532   1.00 6.12  ? 382  ILE A CG1   1 
ATOM   2931  C CG2   . ILE A 1 382 ? -6.689  25.974  3.982   1.00 7.21  ? 382  ILE A CG2   1 
ATOM   2932  C CD1   . ILE A 1 382 ? -7.152  24.308  1.596   1.00 3.50  ? 382  ILE A CD1   1 
ATOM   2933  N N     . LEU A 1 383 ? -9.241  27.891  4.369   1.00 8.53  ? 383  LEU A N     1 
ATOM   2934  C CA    . LEU A 1 383 ? -9.494  28.712  5.535   1.00 8.90  ? 383  LEU A CA    1 
ATOM   2935  C C     . LEU A 1 383 ? -9.210  27.899  6.762   1.00 9.77  ? 383  LEU A C     1 
ATOM   2936  O O     . LEU A 1 383 ? -9.302  26.667  6.740   1.00 10.04 ? 383  LEU A O     1 
ATOM   2937  C CB    . LEU A 1 383 ? -10.920 29.234  5.594   1.00 8.33  ? 383  LEU A CB    1 
ATOM   2938  C CG    . LEU A 1 383 ? -11.439 30.015  4.400   1.00 8.20  ? 383  LEU A CG    1 
ATOM   2939  C CD1   . LEU A 1 383 ? -12.969 30.040  4.550   1.00 7.43  ? 383  LEU A CD1   1 
ATOM   2940  C CD2   . LEU A 1 383 ? -10.803 31.428  4.286   1.00 4.89  ? 383  LEU A CD2   1 
ATOM   2941  N N     . GLY A 1 384 ? -8.831  28.609  7.819   1.00 9.92  ? 384  GLY A N     1 
ATOM   2942  C CA    . GLY A 1 384 ? -8.612  28.019  9.103   1.00 9.73  ? 384  GLY A CA    1 
ATOM   2943  C C     . GLY A 1 384 ? -9.224  28.894  10.164  1.00 10.43 ? 384  GLY A C     1 
ATOM   2944  O O     . GLY A 1 384 ? -9.364  30.113  10.004  1.00 9.79  ? 384  GLY A O     1 
ATOM   2945  N N     . SER A 1 385 ? -9.611  28.235  11.245  1.00 11.19 ? 385  SER A N     1 
ATOM   2946  C CA    . SER A 1 385 ? -10.176 28.876  12.411  1.00 12.51 ? 385  SER A CA    1 
ATOM   2947  C C     . SER A 1 385 ? -9.356  28.463  13.635  1.00 12.94 ? 385  SER A C     1 
ATOM   2948  O O     . SER A 1 385 ? -9.082  27.277  13.819  1.00 13.36 ? 385  SER A O     1 
ATOM   2949  C CB    . SER A 1 385 ? -11.611 28.397  12.575  1.00 12.43 ? 385  SER A CB    1 
ATOM   2950  O OG    . SER A 1 385 ? -12.173 28.969  13.723  1.00 13.31 ? 385  SER A OG    1 
ATOM   2951  N N     . VAL A 1 386 ? -8.974  29.414  14.473  1.00 13.20 ? 386  VAL A N     1 
ATOM   2952  C CA    . VAL A 1 386 ? -8.219  29.042  15.651  1.00 14.10 ? 386  VAL A CA    1 
ATOM   2953  C C     . VAL A 1 386 ? -8.608  29.764  16.907  1.00 14.40 ? 386  VAL A C     1 
ATOM   2954  O O     . VAL A 1 386 ? -9.050  30.892  16.842  1.00 14.76 ? 386  VAL A O     1 
ATOM   2955  C CB    . VAL A 1 386 ? -6.714  29.303  15.444  1.00 15.02 ? 386  VAL A CB    1 
ATOM   2956  C CG1   . VAL A 1 386 ? -6.413  30.827  15.151  1.00 14.44 ? 386  VAL A CG1   1 
ATOM   2957  C CG2   . VAL A 1 386 ? -5.902  28.758  16.643  1.00 14.56 ? 386  VAL A CG2   1 
ATOM   2958  N N     . GLY A 1 387 ? -8.410  29.116  18.054  1.00 15.20 ? 387  GLY A N     1 
ATOM   2959  C CA    . GLY A 1 387 ? -8.286  29.827  19.330  1.00 15.73 ? 387  GLY A CA    1 
ATOM   2960  C C     . GLY A 1 387 ? -9.405  29.705  20.326  1.00 17.05 ? 387  GLY A C     1 
ATOM   2961  O O     . GLY A 1 387 ? -9.277  30.118  21.506  1.00 17.75 ? 387  GLY A O     1 
ATOM   2962  N N     . GLU A 1 388 ? -10.520 29.155  19.855  1.00 17.63 ? 388  GLU A N     1 
ATOM   2963  C CA    . GLU A 1 388 ? -11.712 29.051  20.659  1.00 18.19 ? 388  GLU A CA    1 
ATOM   2964  C C     . GLU A 1 388 ? -12.755 28.297  19.896  1.00 18.91 ? 388  GLU A C     1 
ATOM   2965  O O     . GLU A 1 388 ? -12.648 28.143  18.665  1.00 19.41 ? 388  GLU A O     1 
ATOM   2966  C CB    . GLU A 1 388 ? -12.259 30.417  20.984  1.00 18.25 ? 388  GLU A CB    1 
ATOM   2967  C CG    . GLU A 1 388 ? -12.499 31.277  19.798  1.00 18.92 ? 388  GLU A CG    1 
ATOM   2968  C CD    . GLU A 1 388 ? -13.217 32.554  20.185  1.00 21.56 ? 388  GLU A CD    1 
ATOM   2969  O OE1   . GLU A 1 388 ? -14.245 32.456  20.905  1.00 23.27 ? 388  GLU A OE1   1 
ATOM   2970  O OE2   . GLU A 1 388 ? -12.752 33.638  19.764  1.00 20.23 ? 388  GLU A OE2   1 
ATOM   2971  N N     . PRO A 1 389 ? -13.796 27.832  20.603  1.00 18.79 ? 389  PRO A N     1 
ATOM   2972  C CA    . PRO A 1 389 ? -14.727 27.092  19.764  1.00 18.56 ? 389  PRO A CA    1 
ATOM   2973  C C     . PRO A 1 389 ? -15.425 28.078  18.833  1.00 18.07 ? 389  PRO A C     1 
ATOM   2974  O O     . PRO A 1 389 ? -15.586 29.252  19.161  1.00 18.46 ? 389  PRO A O     1 
ATOM   2975  C CB    . PRO A 1 389 ? -15.693 26.437  20.772  1.00 18.88 ? 389  PRO A CB    1 
ATOM   2976  C CG    . PRO A 1 389 ? -15.600 27.287  22.020  1.00 18.43 ? 389  PRO A CG    1 
ATOM   2977  C CD    . PRO A 1 389 ? -14.223 27.944  22.009  1.00 18.24 ? 389  PRO A CD    1 
ATOM   2978  N N     . ILE A 1 390 ? -15.773 27.590  17.656  1.00 17.55 ? 390  ILE A N     1 
ATOM   2979  C CA    . ILE A 1 390 ? -16.584 28.304  16.706  1.00 16.05 ? 390  ILE A CA    1 
ATOM   2980  C C     . ILE A 1 390 ? -17.870 27.488  16.583  1.00 15.85 ? 390  ILE A C     1 
ATOM   2981  O O     . ILE A 1 390 ? -17.815 26.278  16.404  1.00 15.82 ? 390  ILE A O     1 
ATOM   2982  C CB    . ILE A 1 390 ? -15.799 28.443  15.358  1.00 16.33 ? 390  ILE A CB    1 
ATOM   2983  C CG1   . ILE A 1 390 ? -16.490 29.406  14.390  1.00 15.08 ? 390  ILE A CG1   1 
ATOM   2984  C CG2   . ILE A 1 390 ? -15.490 27.087  14.729  1.00 15.18 ? 390  ILE A CG2   1 
ATOM   2985  C CD1   . ILE A 1 390 ? -15.732 29.629  13.109  1.00 14.97 ? 390  ILE A CD1   1 
ATOM   2986  N N     . ASN A 1 391 ? -19.029 28.119  16.706  1.00 15.76 ? 391  ASN A N     1 
ATOM   2987  C CA    . ASN A 1 391 ? -20.262 27.356  16.567  1.00 16.53 ? 391  ASN A CA    1 
ATOM   2988  C C     . ASN A 1 391 ? -20.675 27.133  15.082  1.00 16.01 ? 391  ASN A C     1 
ATOM   2989  O O     . ASN A 1 391 ? -20.307 27.921  14.182  1.00 16.04 ? 391  ASN A O     1 
ATOM   2990  C CB    . ASN A 1 391 ? -21.380 27.932  17.462  1.00 17.81 ? 391  ASN A CB    1 
ATOM   2991  C CG    . ASN A 1 391 ? -22.269 28.941  16.743  1.00 20.71 ? 391  ASN A CG    1 
ATOM   2992  O OD1   . ASN A 1 391 ? -21.819 30.026  16.369  1.00 24.23 ? 391  ASN A OD1   1 
ATOM   2993  N ND2   . ASN A 1 391 ? -23.540 28.573  16.537  1.00 22.44 ? 391  ASN A ND2   1 
ATOM   2994  N N     . PRO A 1 392 ? -21.402 26.044  14.809  1.00 15.08 ? 392  PRO A N     1 
ATOM   2995  C CA    . PRO A 1 392 ? -21.722 25.743  13.390  1.00 14.78 ? 392  PRO A CA    1 
ATOM   2996  C C     . PRO A 1 392 ? -22.139 26.977  12.554  1.00 14.91 ? 392  PRO A C     1 
ATOM   2997  O O     . PRO A 1 392 ? -21.704 27.130  11.395  1.00 14.48 ? 392  PRO A O     1 
ATOM   2998  C CB    . PRO A 1 392 ? -22.888 24.724  13.482  1.00 13.90 ? 392  PRO A CB    1 
ATOM   2999  C CG    . PRO A 1 392 ? -22.742 24.080  14.871  1.00 14.06 ? 392  PRO A CG    1 
ATOM   3000  C CD    . PRO A 1 392 ? -21.935 25.036  15.752  1.00 14.57 ? 392  PRO A CD    1 
ATOM   3001  N N     . GLU A 1 393 ? -22.985 27.832  13.120  1.00 14.71 ? 393  GLU A N     1 
ATOM   3002  C CA    . GLU A 1 393 ? -23.529 28.949  12.358  1.00 15.39 ? 393  GLU A CA    1 
ATOM   3003  C C     . GLU A 1 393 ? -22.452 29.951  11.916  1.00 14.24 ? 393  GLU A C     1 
ATOM   3004  O O     . GLU A 1 393 ? -22.482 30.434  10.798  1.00 14.40 ? 393  GLU A O     1 
ATOM   3005  C CB    . GLU A 1 393 ? -24.682 29.631  13.119  1.00 15.08 ? 393  GLU A CB    1 
ATOM   3006  C CG    . GLU A 1 393 ? -26.051 28.976  12.823  1.00 16.96 ? 393  GLU A CG    1 
ATOM   3007  C CD    . GLU A 1 393 ? -27.174 29.348  13.834  1.00 18.72 ? 393  GLU A CD    1 
ATOM   3008  O OE1   . GLU A 1 393 ? -26.898 30.094  14.828  1.00 19.32 ? 393  GLU A OE1   1 
ATOM   3009  O OE2   . GLU A 1 393 ? -28.338 28.889  13.601  1.00 21.32 ? 393  GLU A OE2   1 
ATOM   3010  N N     . ALA A 1 394 ? -21.495 30.248  12.786  1.00 13.26 ? 394  ALA A N     1 
ATOM   3011  C CA    . ALA A 1 394 ? -20.380 31.103  12.403  1.00 11.95 ? 394  ALA A CA    1 
ATOM   3012  C C     . ALA A 1 394 ? -19.419 30.356  11.475  1.00 11.19 ? 394  ALA A C     1 
ATOM   3013  O O     . ALA A 1 394 ? -18.875 30.934  10.544  1.00 12.21 ? 394  ALA A O     1 
ATOM   3014  C CB    . ALA A 1 394 ? -19.641 31.688  13.678  1.00 11.40 ? 394  ALA A CB    1 
ATOM   3015  N N     . TRP A 1 395 ? -19.189 29.082  11.727  1.00 10.12 ? 395  TRP A N     1 
ATOM   3016  C CA    . TRP A 1 395 ? -18.424 28.274  10.793  1.00 10.04 ? 395  TRP A CA    1 
ATOM   3017  C C     . TRP A 1 395 ? -19.072 28.317  9.395   1.00 10.24 ? 395  TRP A C     1 
ATOM   3018  O O     . TRP A 1 395 ? -18.394 28.606  8.389   1.00 10.22 ? 395  TRP A O     1 
ATOM   3019  C CB    . TRP A 1 395 ? -18.397 26.848  11.288  1.00 9.70  ? 395  TRP A CB    1 
ATOM   3020  C CG    . TRP A 1 395 ? -17.413 25.948  10.662  1.00 10.21 ? 395  TRP A CG    1 
ATOM   3021  C CD1   . TRP A 1 395 ? -16.229 25.541  11.215  1.00 11.01 ? 395  TRP A CD1   1 
ATOM   3022  C CD2   . TRP A 1 395 ? -17.518 25.263  9.399   1.00 9.17  ? 395  TRP A CD2   1 
ATOM   3023  N NE1   . TRP A 1 395 ? -15.589 24.679  10.374  1.00 9.96  ? 395  TRP A NE1   1 
ATOM   3024  C CE2   . TRP A 1 395 ? -16.352 24.482  9.254   1.00 9.55  ? 395  TRP A CE2   1 
ATOM   3025  C CE3   . TRP A 1 395 ? -18.471 25.238  8.384   1.00 9.33  ? 395  TRP A CE3   1 
ATOM   3026  C CZ2   . TRP A 1 395 ? -16.110 23.684  8.127   1.00 9.44  ? 395  TRP A CZ2   1 
ATOM   3027  C CZ3   . TRP A 1 395 ? -18.237 24.448  7.272   1.00 10.32 ? 395  TRP A CZ3   1 
ATOM   3028  C CH2   . TRP A 1 395 ? -17.058 23.679  7.148   1.00 9.69  ? 395  TRP A CH2   1 
ATOM   3029  N N     . GLU A 1 396 ? -20.375 28.038  9.337   1.00 10.00 ? 396  GLU A N     1 
ATOM   3030  C CA    . GLU A 1 396 ? -21.110 28.069  8.081   1.00 10.56 ? 396  GLU A CA    1 
ATOM   3031  C C     . GLU A 1 396 ? -21.002 29.425  7.377   1.00 10.46 ? 396  GLU A C     1 
ATOM   3032  O O     . GLU A 1 396 ? -20.762 29.471  6.147   1.00 10.52 ? 396  GLU A O     1 
ATOM   3033  C CB    . GLU A 1 396 ? -22.576 27.633  8.260   1.00 10.67 ? 396  GLU A CB    1 
ATOM   3034  C CG    . GLU A 1 396 ? -22.761 26.118  8.531   1.00 12.65 ? 396  GLU A CG    1 
ATOM   3035  C CD    . GLU A 1 396 ? -22.446 25.219  7.311   1.00 15.23 ? 396  GLU A CD    1 
ATOM   3036  O OE1   . GLU A 1 396 ? -22.268 25.764  6.190   1.00 14.87 ? 396  GLU A OE1   1 
ATOM   3037  O OE2   . GLU A 1 396 ? -22.396 23.964  7.477   1.00 15.80 ? 396  GLU A OE2   1 
ATOM   3038  N N     . TRP A 1 397 ? -21.107 30.524  8.131   1.00 9.49  ? 397  TRP A N     1 
ATOM   3039  C CA    . TRP A 1 397 ? -21.084 31.852  7.480   1.00 9.93  ? 397  TRP A CA    1 
ATOM   3040  C C     . TRP A 1 397 ? -19.688 32.125  6.902   1.00 10.86 ? 397  TRP A C     1 
ATOM   3041  O O     . TRP A 1 397 ? -19.555 32.660  5.795   1.00 11.90 ? 397  TRP A O     1 
ATOM   3042  C CB    . TRP A 1 397 ? -21.583 32.957  8.419   1.00 8.04  ? 397  TRP A CB    1 
ATOM   3043  C CG    . TRP A 1 397 ? -21.539 34.375  7.890   1.00 7.67  ? 397  TRP A CG    1 
ATOM   3044  C CD1   . TRP A 1 397 ? -22.609 35.134  7.450   1.00 7.34  ? 397  TRP A CD1   1 
ATOM   3045  C CD2   . TRP A 1 397 ? -20.396 35.235  7.809   1.00 6.40  ? 397  TRP A CD2   1 
ATOM   3046  N NE1   . TRP A 1 397 ? -22.191 36.393  7.072   1.00 4.20  ? 397  TRP A NE1   1 
ATOM   3047  C CE2   . TRP A 1 397 ? -20.836 36.479  7.281   1.00 7.31  ? 397  TRP A CE2   1 
ATOM   3048  C CE3   . TRP A 1 397 ? -19.036 35.071  8.094   1.00 6.90  ? 397  TRP A CE3   1 
ATOM   3049  C CZ2   . TRP A 1 397 ? -19.952 37.551  7.046   1.00 6.89  ? 397  TRP A CZ2   1 
ATOM   3050  C CZ3   . TRP A 1 397 ? -18.159 36.146  7.874   1.00 6.58  ? 397  TRP A CZ3   1 
ATOM   3051  C CH2   . TRP A 1 397 ? -18.623 37.364  7.356   1.00 6.63  ? 397  TRP A CH2   1 
ATOM   3052  N N     . TYR A 1 398 ? -18.660 31.727  7.652   1.00 11.58 ? 398  TYR A N     1 
ATOM   3053  C CA    . TYR A 1 398 ? -17.258 31.836  7.242   1.00 11.71 ? 398  TYR A CA    1 
ATOM   3054  C C     . TYR A 1 398 ? -17.005 31.010  5.974   1.00 12.06 ? 398  TYR A C     1 
ATOM   3055  O O     . TYR A 1 398 ? -16.518 31.552  4.961   1.00 12.97 ? 398  TYR A O     1 
ATOM   3056  C CB    . TYR A 1 398 ? -16.391 31.355  8.396   1.00 11.78 ? 398  TYR A CB    1 
ATOM   3057  C CG    . TYR A 1 398 ? -14.882 31.462  8.283   1.00 11.55 ? 398  TYR A CG    1 
ATOM   3058  C CD1   . TYR A 1 398 ? -14.246 32.664  7.938   1.00 9.98  ? 398  TYR A CD1   1 
ATOM   3059  C CD2   . TYR A 1 398 ? -14.086 30.372  8.618   1.00 11.37 ? 398  TYR A CD2   1 
ATOM   3060  C CE1   . TYR A 1 398 ? -12.861 32.762  7.888   1.00 9.16  ? 398  TYR A CE1   1 
ATOM   3061  C CE2   . TYR A 1 398 ? -12.685 30.456  8.574   1.00 13.05 ? 398  TYR A CE2   1 
ATOM   3062  C CZ    . TYR A 1 398 ? -12.081 31.650  8.214   1.00 12.23 ? 398  TYR A CZ    1 
ATOM   3063  O OH    . TYR A 1 398 ? -10.695 31.701  8.186   1.00 13.03 ? 398  TYR A OH    1 
ATOM   3064  N N     . TRP A 1 399 ? -17.377 29.728  6.016   1.00 11.08 ? 399  TRP A N     1 
ATOM   3065  C CA    . TRP A 1 399 ? -17.207 28.832  4.883   1.00 10.58 ? 399  TRP A CA    1 
ATOM   3066  C C     . TRP A 1 399 ? -17.828 29.442  3.617   1.00 10.78 ? 399  TRP A C     1 
ATOM   3067  O O     . TRP A 1 399 ? -17.224 29.409  2.533   1.00 10.80 ? 399  TRP A O     1 
ATOM   3068  C CB    . TRP A 1 399 ? -17.836 27.461  5.206   1.00 10.44 ? 399  TRP A CB    1 
ATOM   3069  C CG    . TRP A 1 399 ? -17.801 26.459  4.095   1.00 9.41  ? 399  TRP A CG    1 
ATOM   3070  C CD1   . TRP A 1 399 ? -16.721 25.699  3.700   1.00 11.15 ? 399  TRP A CD1   1 
ATOM   3071  C CD2   . TRP A 1 399 ? -18.878 26.101  3.230   1.00 9.78  ? 399  TRP A CD2   1 
ATOM   3072  N NE1   . TRP A 1 399 ? -17.066 24.877  2.643   1.00 11.47 ? 399  TRP A NE1   1 
ATOM   3073  C CE2   . TRP A 1 399 ? -18.382 25.119  2.321   1.00 11.61 ? 399  TRP A CE2   1 
ATOM   3074  C CE3   . TRP A 1 399 ? -20.223 26.516  3.119   1.00 12.42 ? 399  TRP A CE3   1 
ATOM   3075  C CZ2   . TRP A 1 399 ? -19.187 24.543  1.322   1.00 9.32  ? 399  TRP A CZ2   1 
ATOM   3076  C CZ3   . TRP A 1 399 ? -21.040 25.932  2.119   1.00 10.46 ? 399  TRP A CZ3   1 
ATOM   3077  C CH2   . TRP A 1 399 ? -20.508 24.959  1.241   1.00 10.61 ? 399  TRP A CH2   1 
ATOM   3078  N N     . LYS A 1 400 ? -19.017 30.020  3.799   1.00 11.01 ? 400  LYS A N     1 
ATOM   3079  C CA    . LYS A 1 400 ? -19.899 30.496  2.725   1.00 11.16 ? 400  LYS A CA    1 
ATOM   3080  C C     . LYS A 1 400 ? -19.541 31.883  2.183   1.00 10.75 ? 400  LYS A C     1 
ATOM   3081  O O     . LYS A 1 400 ? -19.479 32.071  0.969   1.00 10.20 ? 400  LYS A O     1 
ATOM   3082  C CB    . LYS A 1 400 ? -21.366 30.475  3.194   1.00 11.24 ? 400  LYS A CB    1 
ATOM   3083  C CG    . LYS A 1 400 ? -22.364 31.168  2.236   1.00 12.54 ? 400  LYS A CG    1 
ATOM   3084  C CD    . LYS A 1 400 ? -23.777 31.310  2.859   1.00 11.64 ? 400  LYS A CD    1 
ATOM   3085  C CE    . LYS A 1 400 ? -24.846 31.126  1.777   1.00 13.62 ? 400  LYS A CE    1 
ATOM   3086  N NZ    . LYS A 1 400 ? -25.890 32.178  1.755   1.00 10.16 ? 400  LYS A NZ    1 
ATOM   3087  N N     . LYS A 1 401 ? -19.303 32.852  3.067   1.00 10.32 ? 401  LYS A N     1 
ATOM   3088  C CA    . LYS A 1 401 ? -19.119 34.230  2.593   1.00 10.33 ? 401  LYS A CA    1 
ATOM   3089  C C     . LYS A 1 401 ? -17.658 34.535  2.315   1.00 10.63 ? 401  LYS A C     1 
ATOM   3090  O O     . LYS A 1 401 ? -17.330 35.226  1.360   1.00 10.08 ? 401  LYS A O     1 
ATOM   3091  C CB    . LYS A 1 401 ? -19.694 35.245  3.588   1.00 10.56 ? 401  LYS A CB    1 
ATOM   3092  C CG    . LYS A 1 401 ? -21.221 35.183  3.776   1.00 11.33 ? 401  LYS A CG    1 
ATOM   3093  C CD    . LYS A 1 401 ? -21.956 35.560  2.513   1.00 11.53 ? 401  LYS A CD    1 
ATOM   3094  C CE    . LYS A 1 401 ? -23.426 35.887  2.811   1.00 12.22 ? 401  LYS A CE    1 
ATOM   3095  N NZ    . LYS A 1 401 ? -24.192 36.122  1.564   1.00 9.19  ? 401  LYS A NZ    1 
ATOM   3096  N N     . ILE A 1 402 ? -16.772 34.017  3.165   1.00 11.13 ? 402  ILE A N     1 
ATOM   3097  C CA    . ILE A 1 402 ? -15.364 34.269  2.975   1.00 10.94 ? 402  ILE A CA    1 
ATOM   3098  C C     . ILE A 1 402 ? -14.779 33.275  1.988   1.00 11.40 ? 402  ILE A C     1 
ATOM   3099  O O     . ILE A 1 402 ? -13.956 33.667  1.175   1.00 11.14 ? 402  ILE A O     1 
ATOM   3100  C CB    . ILE A 1 402 ? -14.555 34.291  4.300   1.00 11.02 ? 402  ILE A CB    1 
ATOM   3101  C CG1   . ILE A 1 402 ? -15.262 35.159  5.366   1.00 9.61  ? 402  ILE A CG1   1 
ATOM   3102  C CG2   . ILE A 1 402 ? -13.111 34.769  4.034   1.00 9.99  ? 402  ILE A CG2   1 
ATOM   3103  C CD1   . ILE A 1 402 ? -15.401 36.600  5.045   1.00 7.94  ? 402  ILE A CD1   1 
ATOM   3104  N N     . GLY A 1 403 ? -15.223 32.013  2.032   1.00 11.83 ? 403  GLY A N     1 
ATOM   3105  C CA    . GLY A 1 403 ? -14.651 30.974  1.160   1.00 12.79 ? 403  GLY A CA    1 
ATOM   3106  C C     . GLY A 1 403 ? -15.469 30.668  -0.085  1.00 13.33 ? 403  GLY A C     1 
ATOM   3107  O O     . GLY A 1 403 ? -15.135 29.741  -0.839  1.00 12.64 ? 403  GLY A O     1 
ATOM   3108  N N     . LYS A 1 404 ? -16.566 31.416  -0.263  1.00 14.14 ? 404  LYS A N     1 
ATOM   3109  C CA    . LYS A 1 404 ? -17.480 31.291  -1.417  1.00 14.99 ? 404  LYS A CA    1 
ATOM   3110  C C     . LYS A 1 404 ? -17.927 29.854  -1.672  1.00 15.25 ? 404  LYS A C     1 
ATOM   3111  O O     . LYS A 1 404 ? -18.193 29.441  -2.808  1.00 15.58 ? 404  LYS A O     1 
ATOM   3112  C CB    . LYS A 1 404 ? -16.886 31.951  -2.665  1.00 14.97 ? 404  LYS A CB    1 
ATOM   3113  C CG    . LYS A 1 404 ? -16.695 33.454  -2.484  1.00 17.10 ? 404  LYS A CG    1 
ATOM   3114  C CD    . LYS A 1 404 ? -15.818 34.057  -3.567  1.00 20.45 ? 404  LYS A CD    1 
ATOM   3115  C CE    . LYS A 1 404 ? -16.575 34.220  -4.866  1.00 22.32 ? 404  LYS A CE    1 
ATOM   3116  N NZ    . LYS A 1 404 ? -15.581 34.295  -5.958  1.00 25.04 ? 404  LYS A NZ    1 
ATOM   3117  N N     . GLU A 1 405 ? -18.035 29.111  -0.576  1.00 15.59 ? 405  GLU A N     1 
ATOM   3118  C CA    . GLU A 1 405 ? -18.453 27.707  -0.578  1.00 16.22 ? 405  GLU A CA    1 
ATOM   3119  C C     . GLU A 1 405 ? -17.380 26.824  -1.215  1.00 15.78 ? 405  GLU A C     1 
ATOM   3120  O O     . GLU A 1 405 ? -17.637 25.687  -1.595  1.00 15.77 ? 405  GLU A O     1 
ATOM   3121  C CB    . GLU A 1 405 ? -19.844 27.531  -1.227  1.00 15.46 ? 405  GLU A CB    1 
ATOM   3122  C CG    . GLU A 1 405 ? -20.933 28.337  -0.495  1.00 16.80 ? 405  GLU A CG    1 
ATOM   3123  C CD    . GLU A 1 405 ? -22.268 28.379  -1.212  1.00 17.60 ? 405  GLU A CD    1 
ATOM   3124  O OE1   . GLU A 1 405 ? -22.690 29.468  -1.619  1.00 22.02 ? 405  GLU A OE1   1 
ATOM   3125  O OE2   . GLU A 1 405 ? -22.910 27.336  -1.390  1.00 20.10 ? 405  GLU A OE2   1 
ATOM   3126  N N     . LYS A 1 406 ? -16.160 27.343  -1.288  1.00 15.27 ? 406  LYS A N     1 
ATOM   3127  C CA    . LYS A 1 406 ? -15.117 26.637  -2.014  1.00 15.41 ? 406  LYS A CA    1 
ATOM   3128  C C     . LYS A 1 406 ? -13.950 26.126  -1.169  1.00 14.28 ? 406  LYS A C     1 
ATOM   3129  O O     . LYS A 1 406 ? -13.182 25.288  -1.634  1.00 15.07 ? 406  LYS A O     1 
ATOM   3130  C CB    . LYS A 1 406 ? -14.644 27.465  -3.220  1.00 15.17 ? 406  LYS A CB    1 
ATOM   3131  C CG    . LYS A 1 406 ? -15.769 27.684  -4.226  1.00 16.34 ? 406  LYS A CG    1 
ATOM   3132  C CD    . LYS A 1 406 ? -15.317 28.335  -5.538  1.00 17.69 ? 406  LYS A CD    1 
ATOM   3133  C CE    . LYS A 1 406 ? -16.542 28.791  -6.379  1.00 18.33 ? 406  LYS A CE    1 
ATOM   3134  N NZ    . LYS A 1 406 ? -16.293 28.620  -7.848  1.00 21.79 ? 406  LYS A NZ    1 
ATOM   3135  N N     . CYS A 1 407 ? -13.833 26.578  0.068   1.00 13.29 ? 407  CYS A N     1 
ATOM   3136  C CA    . CYS A 1 407 ? -12.614 26.341  0.807   1.00 12.72 ? 407  CYS A CA    1 
ATOM   3137  C C     . CYS A 1 407 ? -12.805 25.504  2.056   1.00 12.92 ? 407  CYS A C     1 
ATOM   3138  O O     . CYS A 1 407 ? -13.494 25.930  2.974   1.00 13.51 ? 407  CYS A O     1 
ATOM   3139  C CB    . CYS A 1 407 ? -11.968 27.670  1.223   1.00 12.61 ? 407  CYS A CB    1 
ATOM   3140  S SG    . CYS A 1 407 ? -11.671 28.829  -0.121  1.00 10.52 ? 407  CYS A SG    1 
ATOM   3141  N N     . PRO A 1 408 ? -12.120 24.353  2.139   1.00 12.15 ? 408  PRO A N     1 
ATOM   3142  C CA    . PRO A 1 408 ? -12.094 23.636  3.405   1.00 11.94 ? 408  PRO A CA    1 
ATOM   3143  C C     . PRO A 1 408 ? -11.768 24.611  4.540   1.00 11.90 ? 408  PRO A C     1 
ATOM   3144  O O     . PRO A 1 408 ? -10.877 25.441  4.386   1.00 11.88 ? 408  PRO A O     1 
ATOM   3145  C CB    . PRO A 1 408 ? -10.905 22.687  3.238   1.00 11.78 ? 408  PRO A CB    1 
ATOM   3146  C CG    . PRO A 1 408 ? -10.855 22.430  1.771   1.00 11.76 ? 408  PRO A CG    1 
ATOM   3147  C CD    . PRO A 1 408 ? -11.303 23.702  1.104   1.00 11.70 ? 408  PRO A CD    1 
ATOM   3148  N N     . VAL A 1 409 ? -12.477 24.512  5.664   1.00 11.48 ? 409  VAL A N     1 
ATOM   3149  C CA    . VAL A 1 409 ? -12.106 25.253  6.851   1.00 10.67 ? 409  VAL A CA    1 
ATOM   3150  C C     . VAL A 1 409 ? -11.463 24.294  7.841   1.00 10.84 ? 409  VAL A C     1 
ATOM   3151  O O     . VAL A 1 409 ? -12.101 23.339  8.282   1.00 11.21 ? 409  VAL A O     1 
ATOM   3152  C CB    . VAL A 1 409 ? -13.324 25.924  7.527   1.00 10.98 ? 409  VAL A CB    1 
ATOM   3153  C CG1   . VAL A 1 409 ? -12.988 26.418  8.922   1.00 10.10 ? 409  VAL A CG1   1 
ATOM   3154  C CG2   . VAL A 1 409 ? -13.845 27.060  6.686   1.00 11.19 ? 409  VAL A CG2   1 
ATOM   3155  N N     . VAL A 1 410 ? -10.212 24.577  8.203   1.00 10.39 ? 410  VAL A N     1 
ATOM   3156  C CA    . VAL A 1 410 ? -9.511  23.835  9.206   1.00 10.00 ? 410  VAL A CA    1 
ATOM   3157  C C     . VAL A 1 410 ? -9.672  24.539  10.557  1.00 10.95 ? 410  VAL A C     1 
ATOM   3158  O O     . VAL A 1 410 ? -9.122  25.616  10.779  1.00 11.84 ? 410  VAL A O     1 
ATOM   3159  C CB    . VAL A 1 410 ? -8.018  23.520  8.810   1.00 10.00 ? 410  VAL A CB    1 
ATOM   3160  C CG1   . VAL A 1 410 ? -7.950  22.666  7.503   1.00 8.00  ? 410  VAL A CG1   1 
ATOM   3161  C CG2   . VAL A 1 410 ? -7.170  24.786  8.663   1.00 9.06  ? 410  VAL A CG2   1 
ATOM   3162  N N     . ASP A 1 411 ? -10.481 23.933  11.432  1.00 10.94 ? 411  ASP A N     1 
ATOM   3163  C CA    . ASP A 1 411 ? -10.662 24.348  12.799  1.00 11.06 ? 411  ASP A CA    1 
ATOM   3164  C C     . ASP A 1 411 ? -9.582  23.643  13.596  1.00 11.04 ? 411  ASP A C     1 
ATOM   3165  O O     . ASP A 1 411 ? -9.624  22.436  13.768  1.00 11.45 ? 411  ASP A O     1 
ATOM   3166  C CB    . ASP A 1 411 ? -12.040 23.893  13.275  1.00 11.53 ? 411  ASP A CB    1 
ATOM   3167  C CG    . ASP A 1 411 ? -12.313 24.248  14.735  1.00 12.11 ? 411  ASP A CG    1 
ATOM   3168  O OD1   . ASP A 1 411 ? -11.458 24.899  15.380  1.00 10.93 ? 411  ASP A OD1   1 
ATOM   3169  O OD2   . ASP A 1 411 ? -13.406 23.887  15.222  1.00 14.81 ? 411  ASP A OD2   1 
ATOM   3170  N N     . THR A 1 412 ? -8.602  24.392  14.077  1.00 10.73 ? 412  THR A N     1 
ATOM   3171  C CA    . THR A 1 412 ? -7.399  23.773  14.641  1.00 9.97  ? 412  THR A CA    1 
ATOM   3172  C C     . THR A 1 412 ? -7.427  23.869  16.152  1.00 10.57 ? 412  THR A C     1 
ATOM   3173  O O     . THR A 1 412 ? -7.390  24.980  16.676  1.00 10.51 ? 412  THR A O     1 
ATOM   3174  C CB    . THR A 1 412 ? -6.104  24.489  14.197  1.00 10.17 ? 412  THR A CB    1 
ATOM   3175  O OG1   . THR A 1 412 ? -6.139  25.872  14.625  1.00 7.83  ? 412  THR A OG1   1 
ATOM   3176  C CG2   . THR A 1 412 ? -5.846  24.349  12.663  1.00 7.24  ? 412  THR A CG2   1 
ATOM   3177  N N     . TRP A 1 413 ? -7.488  22.721  16.846  1.00 10.41 ? 413  TRP A N     1 
ATOM   3178  C CA    . TRP A 1 413 ? -7.380  22.724  18.298  1.00 10.44 ? 413  TRP A CA    1 
ATOM   3179  C C     . TRP A 1 413 ? -5.947  22.452  18.769  1.00 10.27 ? 413  TRP A C     1 
ATOM   3180  O O     . TRP A 1 413 ? -5.298  21.466  18.350  1.00 10.55 ? 413  TRP A O     1 
ATOM   3181  C CB    . TRP A 1 413 ? -8.377  21.775  18.996  1.00 10.31 ? 413  TRP A CB    1 
ATOM   3182  C CG    . TRP A 1 413 ? -8.180  21.818  20.504  1.00 11.74 ? 413  TRP A CG    1 
ATOM   3183  C CD1   . TRP A 1 413 ? -8.688  22.753  21.385  1.00 12.63 ? 413  TRP A CD1   1 
ATOM   3184  C CD2   . TRP A 1 413 ? -7.360  20.942  21.287  1.00 11.53 ? 413  TRP A CD2   1 
ATOM   3185  N NE1   . TRP A 1 413 ? -8.261  22.484  22.678  1.00 11.62 ? 413  TRP A NE1   1 
ATOM   3186  C CE2   . TRP A 1 413 ? -7.434  21.390  22.644  1.00 12.25 ? 413  TRP A CE2   1 
ATOM   3187  C CE3   . TRP A 1 413 ? -6.572  19.826  20.980  1.00 12.23 ? 413  TRP A CE3   1 
ATOM   3188  C CZ2   . TRP A 1 413 ? -6.749  20.750  23.690  1.00 10.79 ? 413  TRP A CZ2   1 
ATOM   3189  C CZ3   . TRP A 1 413 ? -5.891  19.185  22.024  1.00 12.72 ? 413  TRP A CZ3   1 
ATOM   3190  C CH2   . TRP A 1 413 ? -5.991  19.655  23.366  1.00 11.96 ? 413  TRP A CH2   1 
ATOM   3191  N N     . TRP A 1 414 ? -5.478  23.327  19.654  1.00 10.06 ? 414  TRP A N     1 
ATOM   3192  C CA    . TRP A 1 414 ? -4.175  23.190  20.319  1.00 9.90  ? 414  TRP A CA    1 
ATOM   3193  C C     . TRP A 1 414 ? -4.056  24.236  21.410  1.00 10.48 ? 414  TRP A C     1 
ATOM   3194  O O     . TRP A 1 414 ? -5.040  24.912  21.739  1.00 10.58 ? 414  TRP A O     1 
ATOM   3195  C CB    . TRP A 1 414 ? -3.002  23.275  19.338  1.00 9.34  ? 414  TRP A CB    1 
ATOM   3196  C CG    . TRP A 1 414 ? -2.862  24.565  18.583  1.00 8.65  ? 414  TRP A CG    1 
ATOM   3197  C CD1   . TRP A 1 414 ? -3.758  25.110  17.733  1.00 7.59  ? 414  TRP A CD1   1 
ATOM   3198  C CD2   . TRP A 1 414 ? -1.733  25.444  18.600  1.00 8.69  ? 414  TRP A CD2   1 
ATOM   3199  N NE1   . TRP A 1 414 ? -3.286  26.282  17.238  1.00 7.77  ? 414  TRP A NE1   1 
ATOM   3200  C CE2   . TRP A 1 414 ? -2.042  26.523  17.753  1.00 8.11  ? 414  TRP A CE2   1 
ATOM   3201  C CE3   . TRP A 1 414 ? -0.502  25.443  19.285  1.00 9.68  ? 414  TRP A CE3   1 
ATOM   3202  C CZ2   . TRP A 1 414 ? -1.164  27.599  17.538  1.00 8.04  ? 414  TRP A CZ2   1 
ATOM   3203  C CZ3   . TRP A 1 414 ? 0.393   26.515  19.070  1.00 9.45  ? 414  TRP A CZ3   1 
ATOM   3204  C CH2   . TRP A 1 414 ? 0.046   27.574  18.181  1.00 9.33  ? 414  TRP A CH2   1 
ATOM   3205  N N     . GLN A 1 415 ? -2.864  24.341  21.993  1.00 10.85 ? 415  GLN A N     1 
ATOM   3206  C CA    . GLN A 1 415 ? -2.637  25.190  23.156  1.00 10.63 ? 415  GLN A CA    1 
ATOM   3207  C C     . GLN A 1 415 ? -1.212  25.693  23.143  1.00 10.85 ? 415  GLN A C     1 
ATOM   3208  O O     . GLN A 1 415 ? -0.326  25.074  22.562  1.00 10.65 ? 415  GLN A O     1 
ATOM   3209  C CB    . GLN A 1 415 ? -2.791  24.376  24.442  1.00 10.61 ? 415  GLN A CB    1 
ATOM   3210  C CG    . GLN A 1 415 ? -4.053  23.620  24.595  1.00 9.00  ? 415  GLN A CG    1 
ATOM   3211  C CD    . GLN A 1 415 ? -4.077  22.869  25.897  1.00 9.27  ? 415  GLN A CD    1 
ATOM   3212  O OE1   . GLN A 1 415 ? -3.211  22.005  26.162  1.00 10.56 ? 415  GLN A OE1   1 
ATOM   3213  N NE2   . GLN A 1 415 ? -5.062  23.176  26.728  1.00 5.58  ? 415  GLN A NE2   1 
ATOM   3214  N N     . THR A 1 416 ? -0.966  26.782  23.845  1.00 10.70 ? 416  THR A N     1 
ATOM   3215  C CA    . THR A 1 416 ? 0.419   27.200  24.043  1.00 10.84 ? 416  THR A CA    1 
ATOM   3216  C C     . THR A 1 416 ? 1.306   26.018  24.467  1.00 10.80 ? 416  THR A C     1 
ATOM   3217  O O     . THR A 1 416 ? 2.418   25.839  23.945  1.00 11.32 ? 416  THR A O     1 
ATOM   3218  C CB    . THR A 1 416 ? 0.478   28.286  25.110  1.00 10.89 ? 416  THR A CB    1 
ATOM   3219  O OG1   . THR A 1 416 ? -0.550  29.238  24.814  1.00 10.58 ? 416  THR A OG1   1 
ATOM   3220  C CG2   . THR A 1 416 ? 1.842   28.948  25.147  1.00 8.74  ? 416  THR A CG2   1 
ATOM   3221  N N     . GLU A 1 417 ? 0.816   25.214  25.401  1.00 10.07 ? 417  GLU A N     1 
ATOM   3222  C CA    . GLU A 1 417 ? 1.592   24.104  25.912  1.00 9.71  ? 417  GLU A CA    1 
ATOM   3223  C C     . GLU A 1 417 ? 1.763   22.972  24.926  1.00 9.69  ? 417  GLU A C     1 
ATOM   3224  O O     . GLU A 1 417 ? 2.480   22.034  25.254  1.00 10.82 ? 417  GLU A O     1 
ATOM   3225  C CB    . GLU A 1 417 ? 0.966   23.528  27.173  1.00 9.81  ? 417  GLU A CB    1 
ATOM   3226  C CG    . GLU A 1 417 ? 0.774   24.503  28.319  1.00 10.05 ? 417  GLU A CG    1 
ATOM   3227  C CD    . GLU A 1 417 ? -0.559  25.247  28.270  1.00 11.11 ? 417  GLU A CD    1 
ATOM   3228  O OE1   . GLU A 1 417 ? -1.088  25.488  27.153  1.00 11.84 ? 417  GLU A OE1   1 
ATOM   3229  O OE2   . GLU A 1 417 ? -1.067  25.610  29.353  1.00 9.57  ? 417  GLU A OE2   1 
ATOM   3230  N N     . THR A 1 418 ? 1.141   23.012  23.743  1.00 9.14  ? 418  THR A N     1 
ATOM   3231  C CA    . THR A 1 418 ? 1.347   21.908  22.753  1.00 9.02  ? 418  THR A CA    1 
ATOM   3232  C C     . THR A 1 418 ? 2.217   22.265  21.517  1.00 9.97  ? 418  THR A C     1 
ATOM   3233  O O     . THR A 1 418 ? 2.542   21.381  20.649  1.00 10.25 ? 418  THR A O     1 
ATOM   3234  C CB    . THR A 1 418 ? 0.043   21.317  22.210  1.00 8.59  ? 418  THR A CB    1 
ATOM   3235  O OG1   . THR A 1 418 ? -0.524  22.243  21.280  1.00 8.82  ? 418  THR A OG1   1 
ATOM   3236  C CG2   . THR A 1 418 ? -0.946  21.006  23.317  1.00 7.54  ? 418  THR A CG2   1 
ATOM   3237  N N     . GLY A 1 419 ? 2.570   23.543  21.406  1.00 9.22  ? 419  GLY A N     1 
ATOM   3238  C CA    . GLY A 1 419 ? 3.524   23.940  20.400  1.00 10.18 ? 419  GLY A CA    1 
ATOM   3239  C C     . GLY A 1 419 ? 2.911   24.028  19.023  1.00 10.84 ? 419  GLY A C     1 
ATOM   3240  O O     . GLY A 1 419 ? 3.181   24.993  18.307  1.00 10.94 ? 419  GLY A O     1 
ATOM   3241  N N     . GLY A 1 420 ? 2.101   23.032  18.650  1.00 10.32 ? 420  GLY A N     1 
ATOM   3242  C CA    . GLY A 1 420 ? 1.420   23.074  17.379  1.00 10.96 ? 420  GLY A CA    1 
ATOM   3243  C C     . GLY A 1 420 ? 0.045   22.427  17.389  1.00 11.56 ? 420  GLY A C     1 
ATOM   3244  O O     . GLY A 1 420 ? -0.453  22.019  18.460  1.00 11.98 ? 420  GLY A O     1 
ATOM   3245  N N     . PHE A 1 421 ? -0.555  22.308  16.197  1.00 10.70 ? 421  PHE A N     1 
ATOM   3246  C CA    . PHE A 1 421 ? -1.892  21.734  16.057  1.00 10.71 ? 421  PHE A CA    1 
ATOM   3247  C C     . PHE A 1 421 ? -1.942  20.344  16.603  1.00 10.62 ? 421  PHE A C     1 
ATOM   3248  O O     . PHE A 1 421 ? -1.017  19.559  16.383  1.00 10.67 ? 421  PHE A O     1 
ATOM   3249  C CB    . PHE A 1 421 ? -2.326  21.677  14.588  1.00 10.57 ? 421  PHE A CB    1 
ATOM   3250  C CG    . PHE A 1 421 ? -2.325  23.003  13.898  1.00 10.04 ? 421  PHE A CG    1 
ATOM   3251  C CD1   . PHE A 1 421 ? -2.040  23.082  12.544  1.00 9.68  ? 421  PHE A CD1   1 
ATOM   3252  C CD2   . PHE A 1 421 ? -2.612  24.174  14.598  1.00 9.60  ? 421  PHE A CD2   1 
ATOM   3253  C CE1   . PHE A 1 421 ? -2.041  24.302  11.892  1.00 10.26 ? 421  PHE A CE1   1 
ATOM   3254  C CE2   . PHE A 1 421 ? -2.602  25.400  13.964  1.00 8.29  ? 421  PHE A CE2   1 
ATOM   3255  C CZ    . PHE A 1 421 ? -2.321  25.469  12.605  1.00 9.45  ? 421  PHE A CZ    1 
ATOM   3256  N N     . MET A 1 422 ? -3.036  20.031  17.293  1.00 11.09 ? 422  MET A N     1 
ATOM   3257  C CA    . MET A 1 422 ? -3.195  18.727  17.953  1.00 11.30 ? 422  MET A CA    1 
ATOM   3258  C C     . MET A 1 422 ? -4.345  17.920  17.367  1.00 11.54 ? 422  MET A C     1 
ATOM   3259  O O     . MET A 1 422 ? -4.180  16.747  17.045  1.00 12.04 ? 422  MET A O     1 
ATOM   3260  C CB    . MET A 1 422 ? -3.365  18.913  19.463  1.00 11.24 ? 422  MET A CB    1 
ATOM   3261  C CG    . MET A 1 422 ? -2.165  19.574  20.103  1.00 11.48 ? 422  MET A CG    1 
ATOM   3262  S SD    . MET A 1 422 ? -0.760  18.446  20.112  1.00 16.02 ? 422  MET A SD    1 
ATOM   3263  C CE    . MET A 1 422 ? -1.355  17.384  21.429  1.00 13.16 ? 422  MET A CE    1 
ATOM   3264  N N     . ILE A 1 423 ? -5.504  18.553  17.244  1.00 11.13 ? 423  ILE A N     1 
ATOM   3265  C CA    . ILE A 1 423 ? -6.665  17.942  16.630  1.00 11.14 ? 423  ILE A CA    1 
ATOM   3266  C C     . ILE A 1 423 ? -7.181  18.926  15.582  1.00 11.56 ? 423  ILE A C     1 
ATOM   3267  O O     . ILE A 1 423 ? -7.521  20.090  15.901  1.00 11.00 ? 423  ILE A O     1 
ATOM   3268  C CB    . ILE A 1 423 ? -7.791  17.651  17.651  1.00 11.96 ? 423  ILE A CB    1 
ATOM   3269  C CG1   . ILE A 1 423 ? -7.265  16.817  18.846  1.00 11.57 ? 423  ILE A CG1   1 
ATOM   3270  C CG2   . ILE A 1 423 ? -9.039  17.031  16.943  1.00 11.10 ? 423  ILE A CG2   1 
ATOM   3271  C CD1   . ILE A 1 423 ? -8.360  16.430  19.839  1.00 10.19 ? 423  ILE A CD1   1 
ATOM   3272  N N     . THR A 1 424 ? -7.218  18.466  14.332  1.00 11.27 ? 424  THR A N     1 
ATOM   3273  C CA    . THR A 1 424 ? -7.429  19.367  13.220  1.00 11.83 ? 424  THR A CA    1 
ATOM   3274  C C     . THR A 1 424 ? -7.767  18.580  11.972  1.00 12.05 ? 424  THR A C     1 
ATOM   3275  O O     . THR A 1 424 ? -7.300  17.446  11.817  1.00 11.96 ? 424  THR A O     1 
ATOM   3276  C CB    . THR A 1 424 ? -6.167  20.237  12.966  1.00 12.02 ? 424  THR A CB    1 
ATOM   3277  O OG1   . THR A 1 424 ? -6.390  21.064  11.835  1.00 12.10 ? 424  THR A OG1   1 
ATOM   3278  C CG2   . THR A 1 424 ? -4.934  19.378  12.697  1.00 12.58 ? 424  THR A CG2   1 
ATOM   3279  N N     . PRO A 1 425 ? -8.592  19.172  11.086  1.00 11.99 ? 425  PRO A N     1 
ATOM   3280  C CA    . PRO A 1 425 ? -8.838  18.600  9.785   1.00 11.42 ? 425  PRO A CA    1 
ATOM   3281  C C     . PRO A 1 425 ? -7.621  18.733  8.915   1.00 11.89 ? 425  PRO A C     1 
ATOM   3282  O O     . PRO A 1 425 ? -6.801  19.608  9.130   1.00 12.34 ? 425  PRO A O     1 
ATOM   3283  C CB    . PRO A 1 425 ? -9.922  19.493  9.198   1.00 11.64 ? 425  PRO A CB    1 
ATOM   3284  C CG    . PRO A 1 425 ? -10.363 20.421  10.258  1.00 11.15 ? 425  PRO A CG    1 
ATOM   3285  C CD    . PRO A 1 425 ? -9.325  20.443  11.297  1.00 12.34 ? 425  PRO A CD    1 
ATOM   3286  N N     . LEU A 1 426 ? -7.479  17.841  7.946   1.00 12.71 ? 426  LEU A N     1 
ATOM   3287  C CA    . LEU A 1 426 ? -6.543  18.048  6.842   1.00 13.14 ? 426  LEU A CA    1 
ATOM   3288  C C     . LEU A 1 426 ? -7.430  18.221  5.630   1.00 12.76 ? 426  LEU A C     1 
ATOM   3289  O O     . LEU A 1 426 ? -8.392  17.450  5.456   1.00 13.56 ? 426  LEU A O     1 
ATOM   3290  C CB    . LEU A 1 426 ? -5.566  16.879  6.697   1.00 13.50 ? 426  LEU A CB    1 
ATOM   3291  C CG    . LEU A 1 426 ? -4.372  16.946  7.677   1.00 14.06 ? 426  LEU A CG    1 
ATOM   3292  C CD1   . LEU A 1 426 ? -4.781  16.704  9.113   1.00 10.64 ? 426  LEU A CD1   1 
ATOM   3293  C CD2   . LEU A 1 426 ? -3.234  15.990  7.270   1.00 13.76 ? 426  LEU A CD2   1 
ATOM   3294  N N     . PRO A 1 427 ? -7.176  19.282  4.838   1.00 12.23 ? 427  PRO A N     1 
ATOM   3295  C CA    . PRO A 1 427 ? -8.188  19.717  3.867   1.00 12.05 ? 427  PRO A CA    1 
ATOM   3296  C C     . PRO A 1 427 ? -8.556  18.677  2.766   1.00 12.61 ? 427  PRO A C     1 
ATOM   3297  O O     . PRO A 1 427 ? -9.709  18.651  2.330   1.00 12.51 ? 427  PRO A O     1 
ATOM   3298  C CB    . PRO A 1 427 ? -7.580  20.992  3.270   1.00 12.11 ? 427  PRO A CB    1 
ATOM   3299  C CG    . PRO A 1 427 ? -6.410  21.319  4.088   1.00 10.71 ? 427  PRO A CG    1 
ATOM   3300  C CD    . PRO A 1 427 ? -5.974  20.132  4.813   1.00 11.41 ? 427  PRO A CD    1 
ATOM   3301  N N     . GLY A 1 428 ? -7.597  17.835  2.347   1.00 12.56 ? 428  GLY A N     1 
ATOM   3302  C CA    . GLY A 1 428 ? -7.838  16.792  1.348   1.00 12.93 ? 428  GLY A CA    1 
ATOM   3303  C C     . GLY A 1 428 ? -7.951  15.366  1.889   1.00 13.57 ? 428  GLY A C     1 
ATOM   3304  O O     . GLY A 1 428 ? -8.031  14.408  1.114   1.00 13.64 ? 428  GLY A O     1 
ATOM   3305  N N     . ALA A 1 429 ? -7.954  15.227  3.216   1.00 13.61 ? 429  ALA A N     1 
ATOM   3306  C CA    . ALA A 1 429 ? -8.002  13.919  3.864   1.00 13.00 ? 429  ALA A CA    1 
ATOM   3307  C C     . ALA A 1 429 ? -9.290  13.689  4.625   1.00 12.81 ? 429  ALA A C     1 
ATOM   3308  O O     . ALA A 1 429 ? -9.856  12.599  4.551   1.00 12.06 ? 429  ALA A O     1 
ATOM   3309  C CB    . ALA A 1 429 ? -6.832  13.764  4.798   1.00 13.64 ? 429  ALA A CB    1 
ATOM   3310  N N     . ILE A 1 430 ? -9.746  14.730  5.334   1.00 13.01 ? 430  ILE A N     1 
ATOM   3311  C CA    . ILE A 1 430 ? -10.866 14.653  6.287   1.00 12.80 ? 430  ILE A CA    1 
ATOM   3312  C C     . ILE A 1 430 ? -12.096 15.550  5.927   1.00 12.94 ? 430  ILE A C     1 
ATOM   3313  O O     . ILE A 1 430 ? -11.981 16.787  5.837   1.00 12.54 ? 430  ILE A O     1 
ATOM   3314  C CB    . ILE A 1 430 ? -10.365 15.023  7.712   1.00 13.10 ? 430  ILE A CB    1 
ATOM   3315  C CG1   . ILE A 1 430 ? -9.364  13.991  8.226   1.00 12.41 ? 430  ILE A CG1   1 
ATOM   3316  C CG2   . ILE A 1 430 ? -11.528 15.219  8.720   1.00 12.68 ? 430  ILE A CG2   1 
ATOM   3317  C CD1   . ILE A 1 430 ? -8.370  14.639  9.154   1.00 11.99 ? 430  ILE A CD1   1 
ATOM   3318  N N     . GLU A 1 431 ? -13.265 14.912  5.770   1.00 12.42 ? 431  GLU A N     1 
ATOM   3319  C CA    . GLU A 1 431 ? -14.528 15.608  5.512   1.00 11.88 ? 431  GLU A CA    1 
ATOM   3320  C C     . GLU A 1 431 ? -14.937 16.435  6.714   1.00 11.87 ? 431  GLU A C     1 
ATOM   3321  O O     . GLU A 1 431 ? -14.783 15.987  7.843   1.00 12.50 ? 431  GLU A O     1 
ATOM   3322  C CB    . GLU A 1 431 ? -15.637 14.625  5.169   1.00 11.73 ? 431  GLU A CB    1 
ATOM   3323  C CG    . GLU A 1 431 ? -15.333 13.754  3.960   1.00 12.36 ? 431  GLU A CG    1 
ATOM   3324  C CD    . GLU A 1 431 ? -16.549 13.035  3.442   1.00 14.98 ? 431  GLU A CD    1 
ATOM   3325  O OE1   . GLU A 1 431 ? -17.204 12.291  4.215   1.00 17.03 ? 431  GLU A OE1   1 
ATOM   3326  O OE2   . GLU A 1 431 ? -16.846 13.204  2.249   1.00 16.14 ? 431  GLU A OE2   1 
ATOM   3327  N N     . LEU A 1 432 ? -15.491 17.622  6.473   1.00 10.59 ? 432  LEU A N     1 
ATOM   3328  C CA    . LEU A 1 432 ? -15.667 18.590  7.542   1.00 9.68  ? 432  LEU A CA    1 
ATOM   3329  C C     . LEU A 1 432 ? -17.068 18.588  8.163   1.00 10.05 ? 432  LEU A C     1 
ATOM   3330  O O     . LEU A 1 432 ? -18.087 18.521  7.446   1.00 10.10 ? 432  LEU A O     1 
ATOM   3331  C CB    . LEU A 1 432 ? -15.309 20.008  7.031   1.00 9.30  ? 432  LEU A CB    1 
ATOM   3332  C CG    . LEU A 1 432 ? -13.956 20.181  6.339   1.00 6.54  ? 432  LEU A CG    1 
ATOM   3333  C CD1   . LEU A 1 432 ? -13.802 21.543  5.673   1.00 4.58  ? 432  LEU A CD1   1 
ATOM   3334  C CD2   . LEU A 1 432 ? -12.817 19.882  7.335   1.00 2.00  ? 432  LEU A CD2   1 
ATOM   3335  N N     . LYS A 1 433 ? -17.106 18.656  9.492   1.00 9.46  ? 433  LYS A N     1 
ATOM   3336  C CA    . LYS A 1 433 ? -18.327 18.939  10.213  1.00 9.17  ? 433  LYS A CA    1 
ATOM   3337  C C     . LYS A 1 433 ? -18.188 20.341  10.836  1.00 10.28 ? 433  LYS A C     1 
ATOM   3338  O O     . LYS A 1 433 ? -17.178 20.640  11.498  1.00 11.54 ? 433  LYS A O     1 
ATOM   3339  C CB    . LYS A 1 433 ? -18.562 17.896  11.309  1.00 9.87  ? 433  LYS A CB    1 
ATOM   3340  C CG    . LYS A 1 433 ? -18.708 16.437  10.837  1.00 8.51  ? 433  LYS A CG    1 
ATOM   3341  C CD    . LYS A 1 433 ? -19.124 15.537  11.970  1.00 7.19  ? 433  LYS A CD    1 
ATOM   3342  C CE    . LYS A 1 433 ? -18.995 14.057  11.602  1.00 5.28  ? 433  LYS A CE    1 
ATOM   3343  N NZ    . LYS A 1 433 ? -20.018 13.199  12.318  1.00 3.75  ? 433  LYS A NZ    1 
ATOM   3344  N N     . ALA A 1 434 ? -19.170 21.207  10.609  1.00 9.70  ? 434  ALA A N     1 
ATOM   3345  C CA    . ALA A 1 434 ? -19.143 22.562  11.152  1.00 9.39  ? 434  ALA A CA    1 
ATOM   3346  C C     . ALA A 1 434 ? -19.011 22.617  12.676  1.00 9.49  ? 434  ALA A C     1 
ATOM   3347  O O     . ALA A 1 434 ? -19.846 22.079  13.409  1.00 10.56 ? 434  ALA A O     1 
ATOM   3348  C CB    . ALA A 1 434 ? -20.360 23.312  10.698  1.00 9.13  ? 434  ALA A CB    1 
ATOM   3349  N N     . GLY A 1 435 ? -17.962 23.272  13.161  1.00 9.41  ? 435  GLY A N     1 
ATOM   3350  C CA    . GLY A 1 435 ? -17.761 23.390  14.604  1.00 9.09  ? 435  GLY A CA    1 
ATOM   3351  C C     . GLY A 1 435 ? -16.964 22.255  15.227  1.00 9.42  ? 435  GLY A C     1 
ATOM   3352  O O     . GLY A 1 435 ? -16.730 22.254  16.428  1.00 9.11  ? 435  GLY A O     1 
ATOM   3353  N N     . SER A 1 436 ? -16.524 21.281  14.430  1.00 9.75  ? 436  SER A N     1 
ATOM   3354  C CA    . SER A 1 436 ? -15.736 20.194  14.986  1.00 9.67  ? 436  SER A CA    1 
ATOM   3355  C C     . SER A 1 436 ? -14.276 20.274  14.558  1.00 9.83  ? 436  SER A C     1 
ATOM   3356  O O     . SER A 1 436 ? -14.002 20.421  13.379  1.00 10.01 ? 436  SER A O     1 
ATOM   3357  C CB    . SER A 1 436 ? -16.311 18.842  14.607  1.00 9.51  ? 436  SER A CB    1 
ATOM   3358  O OG    . SER A 1 436 ? -15.312 17.836  14.717  1.00 8.98  ? 436  SER A OG    1 
ATOM   3359  N N     . ALA A 1 437 ? -13.357 20.137  15.516  1.00 9.49  ? 437  ALA A N     1 
ATOM   3360  C CA    . ALA A 1 437 ? -11.919 20.101  15.221  1.00 10.22 ? 437  ALA A CA    1 
ATOM   3361  C C     . ALA A 1 437 ? -11.475 18.826  14.483  1.00 10.43 ? 437  ALA A C     1 
ATOM   3362  O O     . ALA A 1 437 ? -10.384 18.773  13.891  1.00 9.96  ? 437  ALA A O     1 
ATOM   3363  C CB    . ALA A 1 437 ? -11.089 20.323  16.488  1.00 9.56  ? 437  ALA A CB    1 
ATOM   3364  N N     . THR A 1 438 ? -12.364 17.835  14.484  1.00 11.26 ? 438  THR A N     1 
ATOM   3365  C CA    . THR A 1 438 ? -12.201 16.538  13.791  1.00 12.17 ? 438  THR A CA    1 
ATOM   3366  C C     . THR A 1 438 ? -11.203 15.567  14.413  1.00 12.10 ? 438  THR A C     1 
ATOM   3367  O O     . THR A 1 438 ? -11.427 15.094  15.532  1.00 11.68 ? 438  THR A O     1 
ATOM   3368  C CB    . THR A 1 438 ? -12.009 16.650  12.242  1.00 12.74 ? 438  THR A CB    1 
ATOM   3369  O OG1   . THR A 1 438 ? -10.683 17.108  11.938  1.00 14.05 ? 438  THR A OG1   1 
ATOM   3370  C CG2   . THR A 1 438 ? -13.093 17.585  11.610  1.00 12.98 ? 438  THR A CG2   1 
ATOM   3371  N N     . ARG A 1 439 ? -10.144 15.236  13.680  1.00 12.37 ? 439  ARG A N     1 
ATOM   3372  C CA    . ARG A 1 439 ? -9.306  14.105  14.072  1.00 13.79 ? 439  ARG A CA    1 
ATOM   3373  C C     . ARG A 1 439 ? -7.949  14.550  14.584  1.00 14.04 ? 439  ARG A C     1 
ATOM   3374  O O     . ARG A 1 439 ? -7.463  15.610  14.198  1.00 14.75 ? 439  ARG A O     1 
ATOM   3375  C CB    . ARG A 1 439 ? -9.105  13.125  12.912  1.00 13.44 ? 439  ARG A CB    1 
ATOM   3376  C CG    . ARG A 1 439 ? -10.359 12.488  12.419  1.00 14.79 ? 439  ARG A CG    1 
ATOM   3377  C CD    . ARG A 1 439 ? -10.026 11.240  11.575  1.00 17.27 ? 439  ARG A CD    1 
ATOM   3378  N NE    . ARG A 1 439 ? -11.242 10.546  11.155  1.00 17.38 ? 439  ARG A NE    1 
ATOM   3379  C CZ    . ARG A 1 439 ? -11.994 9.797   11.955  1.00 17.58 ? 439  ARG A CZ    1 
ATOM   3380  N NH1   . ARG A 1 439 ? -11.660 9.618   13.226  1.00 17.44 ? 439  ARG A NH1   1 
ATOM   3381  N NH2   . ARG A 1 439 ? -13.087 9.220   11.479  1.00 17.50 ? 439  ARG A NH2   1 
ATOM   3382  N N     . PRO A 1 440 ? -7.331  13.734  15.453  1.00 14.36 ? 440  PRO A N     1 
ATOM   3383  C CA    . PRO A 1 440 ? -5.948  14.018  15.887  1.00 14.24 ? 440  PRO A CA    1 
ATOM   3384  C C     . PRO A 1 440 ? -4.956  14.089  14.735  1.00 14.37 ? 440  PRO A C     1 
ATOM   3385  O O     . PRO A 1 440 ? -5.120  13.407  13.720  1.00 14.86 ? 440  PRO A O     1 
ATOM   3386  C CB    . PRO A 1 440 ? -5.597  12.813  16.769  1.00 13.97 ? 440  PRO A CB    1 
ATOM   3387  C CG    . PRO A 1 440 ? -6.708  11.782  16.508  1.00 13.93 ? 440  PRO A CG    1 
ATOM   3388  C CD    . PRO A 1 440 ? -7.904  12.547  16.128  1.00 13.58 ? 440  PRO A CD    1 
ATOM   3389  N N     . PHE A 1 441 ? -3.912  14.891  14.921  1.00 14.28 ? 441  PHE A N     1 
ATOM   3390  C CA    . PHE A 1 441 ? -2.834  15.014  13.965  1.00 13.48 ? 441  PHE A CA    1 
ATOM   3391  C C     . PHE A 1 441 ? -1.821  13.894  14.241  1.00 14.29 ? 441  PHE A C     1 
ATOM   3392  O O     . PHE A 1 441 ? -1.874  13.228  15.287  1.00 14.92 ? 441  PHE A O     1 
ATOM   3393  C CB    . PHE A 1 441 ? -2.214  16.409  14.095  1.00 12.99 ? 441  PHE A CB    1 
ATOM   3394  C CG    . PHE A 1 441 ? -1.260  16.749  13.010  1.00 12.64 ? 441  PHE A CG    1 
ATOM   3395  C CD1   . PHE A 1 441 ? -1.722  17.111  11.749  1.00 12.83 ? 441  PHE A CD1   1 
ATOM   3396  C CD2   . PHE A 1 441 ? 0.103   16.685  13.228  1.00 11.54 ? 441  PHE A CD2   1 
ATOM   3397  C CE1   . PHE A 1 441 ? -0.843  17.403  10.737  1.00 10.47 ? 441  PHE A CE1   1 
ATOM   3398  C CE2   . PHE A 1 441 ? 0.999   16.975  12.209  1.00 10.69 ? 441  PHE A CE2   1 
ATOM   3399  C CZ    . PHE A 1 441 ? 0.525   17.340  10.967  1.00 11.64 ? 441  PHE A CZ    1 
ATOM   3400  N N     . PHE A 1 442 ? -0.930  13.653  13.282  1.00 14.35 ? 442  PHE A N     1 
ATOM   3401  C CA    . PHE A 1 442 ? 0.173   12.715  13.433  1.00 14.22 ? 442  PHE A CA    1 
ATOM   3402  C C     . PHE A 1 442 ? 0.893   12.893  14.779  1.00 14.34 ? 442  PHE A C     1 
ATOM   3403  O O     . PHE A 1 442 ? 1.271   14.012  15.163  1.00 14.09 ? 442  PHE A O     1 
ATOM   3404  C CB    . PHE A 1 442 ? 1.146   12.874  12.248  1.00 14.47 ? 442  PHE A CB    1 
ATOM   3405  C CG    . PHE A 1 442 ? 0.458   12.883  10.894  1.00 14.60 ? 442  PHE A CG    1 
ATOM   3406  C CD1   . PHE A 1 442 ? 0.783   13.828  9.942   1.00 15.18 ? 442  PHE A CD1   1 
ATOM   3407  C CD2   . PHE A 1 442 ? -0.548  11.949  10.589  1.00 15.50 ? 442  PHE A CD2   1 
ATOM   3408  C CE1   . PHE A 1 442 ? 0.129   13.842  8.708   1.00 15.01 ? 442  PHE A CE1   1 
ATOM   3409  C CE2   . PHE A 1 442 ? -1.191  11.948  9.354   1.00 14.32 ? 442  PHE A CE2   1 
ATOM   3410  C CZ    . PHE A 1 442 ? -0.858  12.898  8.418   1.00 14.89 ? 442  PHE A CZ    1 
ATOM   3411  N N     . GLY A 1 443 ? 1.041   11.779  15.501  1.00 14.23 ? 443  GLY A N     1 
ATOM   3412  C CA    . GLY A 1 443 ? 1.745   11.739  16.789  1.00 12.74 ? 443  GLY A CA    1 
ATOM   3413  C C     . GLY A 1 443 ? 0.875   11.986  17.997  1.00 12.20 ? 443  GLY A C     1 
ATOM   3414  O O     . GLY A 1 443 ? 1.340   11.861  19.106  1.00 12.27 ? 443  GLY A O     1 
ATOM   3415  N N     . VAL A 1 444 ? -0.388  12.338  17.782  1.00 12.45 ? 444  VAL A N     1 
ATOM   3416  C CA    . VAL A 1 444 ? -1.248  12.861  18.838  1.00 11.92 ? 444  VAL A CA    1 
ATOM   3417  C C     . VAL A 1 444 ? -2.280  11.838  19.233  1.00 12.51 ? 444  VAL A C     1 
ATOM   3418  O O     . VAL A 1 444 ? -3.054  11.413  18.394  1.00 12.41 ? 444  VAL A O     1 
ATOM   3419  C CB    . VAL A 1 444 ? -1.961  14.160  18.402  1.00 12.39 ? 444  VAL A CB    1 
ATOM   3420  C CG1   . VAL A 1 444 ? -2.977  14.629  19.481  1.00 9.82  ? 444  VAL A CG1   1 
ATOM   3421  C CG2   . VAL A 1 444 ? -0.931  15.255  18.018  1.00 10.47 ? 444  VAL A CG2   1 
ATOM   3422  N N     . GLN A 1 445 ? -2.262  11.458  20.518  1.00 13.19 ? 445  GLN A N     1 
ATOM   3423  C CA    . GLN A 1 445 ? -3.121  10.426  21.088  1.00 14.10 ? 445  GLN A CA    1 
ATOM   3424  C C     . GLN A 1 445 ? -4.068  11.029  22.120  1.00 14.12 ? 445  GLN A C     1 
ATOM   3425  O O     . GLN A 1 445 ? -3.778  11.052  23.326  1.00 14.36 ? 445  GLN A O     1 
ATOM   3426  C CB    . GLN A 1 445 ? -2.287  9.293   21.703  1.00 14.09 ? 445  GLN A CB    1 
ATOM   3427  C CG    . GLN A 1 445 ? -1.488  8.538   20.643  1.00 15.70 ? 445  GLN A CG    1 
ATOM   3428  C CD    . GLN A 1 445 ? -0.419  7.607   21.190  1.00 15.67 ? 445  GLN A CD    1 
ATOM   3429  O OE1   . GLN A 1 445 ? -0.684  6.450   21.506  1.00 17.14 ? 445  GLN A OE1   1 
ATOM   3430  N NE2   . GLN A 1 445 ? 0.815   8.111   21.269  1.00 17.92 ? 445  GLN A NE2   1 
ATOM   3431  N N     . PRO A 1 446 ? -5.222  11.516  21.647  1.00 13.73 ? 446  PRO A N     1 
ATOM   3432  C CA    . PRO A 1 446 ? -6.208  12.067  22.560  1.00 13.41 ? 446  PRO A CA    1 
ATOM   3433  C C     . PRO A 1 446 ? -6.967  10.957  23.271  1.00 13.09 ? 446  PRO A C     1 
ATOM   3434  O O     . PRO A 1 446 ? -7.051  9.826   22.787  1.00 13.00 ? 446  PRO A O     1 
ATOM   3435  C CB    . PRO A 1 446 ? -7.154  12.816  21.624  1.00 13.78 ? 446  PRO A CB    1 
ATOM   3436  C CG    . PRO A 1 446 ? -7.068  12.023  20.346  1.00 13.83 ? 446  PRO A CG    1 
ATOM   3437  C CD    . PRO A 1 446 ? -5.678  11.513  20.250  1.00 12.86 ? 446  PRO A CD    1 
ATOM   3438  N N     . ALA A 1 447 ? -7.518  11.286  24.421  1.00 12.98 ? 447  ALA A N     1 
ATOM   3439  C CA    . ALA A 1 447 ? -8.459  10.413  25.100  1.00 12.42 ? 447  ALA A CA    1 
ATOM   3440  C C     . ALA A 1 447 ? -9.349  11.321  25.936  1.00 12.46 ? 447  ALA A C     1 
ATOM   3441  O O     . ALA A 1 447 ? -9.012  12.484  26.206  1.00 12.03 ? 447  ALA A O     1 
ATOM   3442  C CB    . ALA A 1 447 ? -7.736  9.392   25.962  1.00 11.70 ? 447  ALA A CB    1 
ATOM   3443  N N     . LEU A 1 448 ? -10.498 10.787  26.322  1.00 12.89 ? 448  LEU A N     1 
ATOM   3444  C CA    . LEU A 1 448 ? -11.451 11.481  27.176  1.00 13.17 ? 448  LEU A CA    1 
ATOM   3445  C C     . LEU A 1 448 ? -11.585 10.679  28.458  1.00 13.78 ? 448  LEU A C     1 
ATOM   3446  O O     . LEU A 1 448 ? -11.700 9.457   28.403  1.00 14.38 ? 448  LEU A O     1 
ATOM   3447  C CB    . LEU A 1 448 ? -12.811 11.595  26.476  1.00 12.15 ? 448  LEU A CB    1 
ATOM   3448  C CG    . LEU A 1 448 ? -12.865 12.373  25.159  1.00 11.87 ? 448  LEU A CG    1 
ATOM   3449  C CD1   . LEU A 1 448 ? -14.241 12.270  24.529  1.00 12.73 ? 448  LEU A CD1   1 
ATOM   3450  C CD2   . LEU A 1 448 ? -12.466 13.848  25.299  1.00 10.30 ? 448  LEU A CD2   1 
ATOM   3451  N N     . VAL A 1 449 ? -11.572 11.360  29.605  1.00 14.32 ? 449  VAL A N     1 
ATOM   3452  C CA    . VAL A 1 449 ? -11.698 10.694  30.898  1.00 14.65 ? 449  VAL A CA    1 
ATOM   3453  C C     . VAL A 1 449 ? -12.747 11.360  31.772  1.00 16.12 ? 449  VAL A C     1 
ATOM   3454  O O     . VAL A 1 449 ? -13.030 12.546  31.602  1.00 17.21 ? 449  VAL A O     1 
ATOM   3455  C CB    . VAL A 1 449 ? -10.344 10.631  31.637  1.00 14.33 ? 449  VAL A CB    1 
ATOM   3456  C CG1   . VAL A 1 449 ? -9.399  9.683   30.914  1.00 12.59 ? 449  VAL A CG1   1 
ATOM   3457  C CG2   . VAL A 1 449 ? -9.722  12.017  31.789  1.00 13.21 ? 449  VAL A CG2   1 
ATOM   3458  N N     . ASP A 1 450 ? -13.334 10.618  32.706  1.00 17.02 ? 450  ASP A N     1 
ATOM   3459  C CA    . ASP A 1 450 ? -14.299 11.223  33.617  1.00 18.10 ? 450  ASP A CA    1 
ATOM   3460  C C     . ASP A 1 450 ? -13.473 11.914  34.691  1.00 18.80 ? 450  ASP A C     1 
ATOM   3461  O O     . ASP A 1 450 ? -12.250 11.830  34.672  1.00 18.50 ? 450  ASP A O     1 
ATOM   3462  C CB    . ASP A 1 450 ? -15.292 10.190  34.198  1.00 17.57 ? 450  ASP A CB    1 
ATOM   3463  C CG    . ASP A 1 450 ? -14.602 9.048   34.955  1.00 18.11 ? 450  ASP A CG    1 
ATOM   3464  O OD1   . ASP A 1 450 ? -13.447 9.191   35.405  1.00 18.40 ? 450  ASP A OD1   1 
ATOM   3465  O OD2   . ASP A 1 450 ? -15.226 7.990   35.123  1.00 18.41 ? 450  ASP A OD2   1 
ATOM   3466  N N     . ASN A 1 451 ? -14.131 12.595  35.623  1.00 20.13 ? 451  ASN A N     1 
ATOM   3467  C CA    . ASN A 1 451 ? -13.404 13.263  36.706  1.00 21.41 ? 451  ASN A CA    1 
ATOM   3468  C C     . ASN A 1 451 ? -12.551 12.368  37.600  1.00 22.19 ? 451  ASN A C     1 
ATOM   3469  O O     . ASN A 1 451 ? -11.734 12.887  38.354  1.00 22.09 ? 451  ASN A O     1 
ATOM   3470  C CB    . ASN A 1 451 ? -14.318 14.193  37.519  1.00 21.13 ? 451  ASN A CB    1 
ATOM   3471  C CG    . ASN A 1 451 ? -14.915 15.299  36.666  1.00 21.84 ? 451  ASN A CG    1 
ATOM   3472  O OD1   . ASN A 1 451 ? -14.224 15.952  35.855  1.00 23.64 ? 451  ASN A OD1   1 
ATOM   3473  N ND2   . ASN A 1 451 ? -16.202 15.501  36.815  1.00 20.33 ? 451  ASN A ND2   1 
ATOM   3474  N N     . GLU A 1 452 ? -12.711 11.039  37.500  1.00 23.66 ? 452  GLU A N     1 
ATOM   3475  C CA    . GLU A 1 452 ? -11.843 10.099  38.262  1.00 25.31 ? 452  GLU A CA    1 
ATOM   3476  C C     . GLU A 1 452 ? -10.716 9.464   37.460  1.00 25.59 ? 452  GLU A C     1 
ATOM   3477  O O     . GLU A 1 452 ? -9.986  8.611   37.998  1.00 25.88 ? 452  GLU A O     1 
ATOM   3478  C CB    . GLU A 1 452 ? -12.628 8.975   38.944  1.00 25.60 ? 452  GLU A CB    1 
ATOM   3479  C CG    . GLU A 1 452 ? -13.489 9.424   40.095  1.00 28.60 ? 452  GLU A CG    1 
ATOM   3480  C CD    . GLU A 1 452 ? -14.884 9.703   39.615  1.00 32.59 ? 452  GLU A CD    1 
ATOM   3481  O OE1   . GLU A 1 452 ? -15.502 8.759   39.048  1.00 35.97 ? 452  GLU A OE1   1 
ATOM   3482  O OE2   . GLU A 1 452 ? -15.347 10.858  39.774  1.00 32.97 ? 452  GLU A OE2   1 
ATOM   3483  N N     . GLY A 1 453 ? -10.591 9.861   36.189  1.00 25.55 ? 453  GLY A N     1 
ATOM   3484  C CA    . GLY A 1 453 ? -9.544  9.342   35.307  1.00 25.60 ? 453  GLY A CA    1 
ATOM   3485  C C     . GLY A 1 453 ? -9.885  8.116   34.475  1.00 25.02 ? 453  GLY A C     1 
ATOM   3486  O O     . GLY A 1 453 ? -9.034  7.603   33.745  1.00 25.02 ? 453  GLY A O     1 
ATOM   3487  N N     . HIS A 1 454 ? -11.121 7.651   34.598  1.00 25.10 ? 454  HIS A N     1 
ATOM   3488  C CA    . HIS A 1 454 ? -11.621 6.503   33.846  1.00 25.70 ? 454  HIS A CA    1 
ATOM   3489  C C     . HIS A 1 454 ? -11.761 6.836   32.352  1.00 25.18 ? 454  HIS A C     1 
ATOM   3490  O O     . HIS A 1 454 ? -12.578 7.681   31.982  1.00 24.85 ? 454  HIS A O     1 
ATOM   3491  C CB    . HIS A 1 454 ? -12.998 6.059   34.378  1.00 26.05 ? 454  HIS A CB    1 
ATOM   3492  C CG    . HIS A 1 454 ? -13.006 5.594   35.805  1.00 29.30 ? 454  HIS A CG    1 
ATOM   3493  N ND1   . HIS A 1 454 ? -14.111 5.737   36.625  1.00 31.69 ? 454  HIS A ND1   1 
ATOM   3494  C CD2   . HIS A 1 454 ? -12.059 4.978   36.557  1.00 31.55 ? 454  HIS A CD2   1 
ATOM   3495  C CE1   . HIS A 1 454 ? -13.850 5.224   37.814  1.00 32.25 ? 454  HIS A CE1   1 
ATOM   3496  N NE2   . HIS A 1 454 ? -12.609 4.763   37.802  1.00 34.07 ? 454  HIS A NE2   1 
ATOM   3497  N N     . PRO A 1 455 ? -10.978 6.168   31.486  1.00 25.09 ? 455  PRO A N     1 
ATOM   3498  C CA    . PRO A 1 455 ? -11.156 6.410   30.040  1.00 24.96 ? 455  PRO A CA    1 
ATOM   3499  C C     . PRO A 1 455 ? -12.594 6.149   29.555  1.00 24.61 ? 455  PRO A C     1 
ATOM   3500  O O     . PRO A 1 455 ? -13.202 5.168   29.966  1.00 24.58 ? 455  PRO A O     1 
ATOM   3501  C CB    . PRO A 1 455 ? -10.147 5.447   29.388  1.00 24.75 ? 455  PRO A CB    1 
ATOM   3502  C CG    . PRO A 1 455 ? -9.091  5.217   30.458  1.00 25.43 ? 455  PRO A CG    1 
ATOM   3503  C CD    . PRO A 1 455 ? -9.880  5.217   31.761  1.00 25.30 ? 455  PRO A CD    1 
ATOM   3504  N N     . GLN A 1 456 ? -13.128 7.053   28.729  1.00 24.26 ? 456  GLN A N     1 
ATOM   3505  C CA    . GLN A 1 456 ? -14.468 6.920   28.139  1.00 24.52 ? 456  GLN A CA    1 
ATOM   3506  C C     . GLN A 1 456 ? -14.381 6.426   26.678  1.00 24.88 ? 456  GLN A C     1 
ATOM   3507  O O     . GLN A 1 456 ? -13.751 7.058   25.827  1.00 25.11 ? 456  GLN A O     1 
ATOM   3508  C CB    . GLN A 1 456 ? -15.247 8.249   28.211  1.00 24.17 ? 456  GLN A CB    1 
ATOM   3509  C CG    . GLN A 1 456 ? -15.433 8.856   29.610  1.00 23.99 ? 456  GLN A CG    1 
ATOM   3510  C CD    . GLN A 1 456 ? -16.084 7.890   30.590  1.00 25.72 ? 456  GLN A CD    1 
ATOM   3511  O OE1   . GLN A 1 456 ? -15.454 7.481   31.576  1.00 25.99 ? 456  GLN A OE1   1 
ATOM   3512  N NE2   . GLN A 1 456 ? -17.340 7.491   30.310  1.00 23.57 ? 456  GLN A NE2   1 
ATOM   3513  N N     . GLU A 1 457 ? -15.006 5.286   26.399  1.00 25.21 ? 457  GLU A N     1 
ATOM   3514  C CA    . GLU A 1 457 ? -14.937 4.662   25.073  1.00 24.78 ? 457  GLU A CA    1 
ATOM   3515  C C     . GLU A 1 457 ? -16.141 5.049   24.254  1.00 24.01 ? 457  GLU A C     1 
ATOM   3516  O O     . GLU A 1 457 ? -17.209 5.369   24.813  1.00 23.40 ? 457  GLU A O     1 
ATOM   3517  C CB    . GLU A 1 457 ? -14.930 3.142   25.187  1.00 24.77 ? 457  GLU A CB    1 
ATOM   3518  C CG    . GLU A 1 457 ? -14.071 2.579   26.287  1.00 27.44 ? 457  GLU A CG    1 
ATOM   3519  C CD    . GLU A 1 457 ? -12.579 2.590   25.956  1.00 31.85 ? 457  GLU A CD    1 
ATOM   3520  O OE1   . GLU A 1 457 ? -12.078 3.589   25.349  1.00 32.06 ? 457  GLU A OE1   1 
ATOM   3521  O OE2   . GLU A 1 457 ? -11.909 1.586   26.322  1.00 32.37 ? 457  GLU A OE2   1 
ATOM   3522  N N     . GLY A 1 458 ? -15.963 4.982   22.934  1.00 23.32 ? 458  GLY A N     1 
ATOM   3523  C CA    . GLY A 1 458 ? -17.030 5.241   21.973  1.00 22.80 ? 458  GLY A CA    1 
ATOM   3524  C C     . GLY A 1 458 ? -17.362 6.720   21.910  1.00 22.59 ? 458  GLY A C     1 
ATOM   3525  O O     . GLY A 1 458 ? -16.530 7.570   22.278  1.00 22.23 ? 458  GLY A O     1 
ATOM   3526  N N     . ALA A 1 459 ? -18.567 7.018   21.412  1.00 22.18 ? 459  ALA A N     1 
ATOM   3527  C CA    . ALA A 1 459 ? -19.104 8.372   21.405  1.00 22.02 ? 459  ALA A CA    1 
ATOM   3528  C C     . ALA A 1 459 ? -19.455 8.727   22.842  1.00 21.89 ? 459  ALA A C     1 
ATOM   3529  O O     . ALA A 1 459 ? -20.219 8.029   23.493  1.00 22.30 ? 459  ALA A O     1 
ATOM   3530  C CB    . ALA A 1 459 ? -20.323 8.468   20.502  1.00 22.05 ? 459  ALA A CB    1 
ATOM   3531  N N     . THR A 1 460 ? -18.872 9.800   23.346  1.00 21.23 ? 460  THR A N     1 
ATOM   3532  C CA    . THR A 1 460 ? -18.941 10.072  24.759  1.00 20.77 ? 460  THR A CA    1 
ATOM   3533  C C     . THR A 1 460 ? -18.449 11.506  25.020  1.00 20.61 ? 460  THR A C     1 
ATOM   3534  O O     . THR A 1 460 ? -18.032 12.194  24.092  1.00 19.74 ? 460  THR A O     1 
ATOM   3535  C CB    . THR A 1 460 ? -18.076 9.017   25.506  1.00 20.64 ? 460  THR A CB    1 
ATOM   3536  O OG1   . THR A 1 460 ? -18.187 9.195   26.916  1.00 20.98 ? 460  THR A OG1   1 
ATOM   3537  C CG2   . THR A 1 460 ? -16.617 9.129   25.104  1.00 20.60 ? 460  THR A CG2   1 
ATOM   3538  N N     . GLU A 1 461 ? -18.516 11.963  26.267  1.00 21.00 ? 461  GLU A N     1 
ATOM   3539  C CA    . GLU A 1 461 ? -17.792 13.193  26.649  1.00 21.67 ? 461  GLU A CA    1 
ATOM   3540  C C     . GLU A 1 461 ? -16.953 13.077  27.916  1.00 20.59 ? 461  GLU A C     1 
ATOM   3541  O O     . GLU A 1 461 ? -17.174 12.199  28.778  1.00 20.72 ? 461  GLU A O     1 
ATOM   3542  C CB    . GLU A 1 461 ? -18.709 14.416  26.716  1.00 22.39 ? 461  GLU A CB    1 
ATOM   3543  C CG    . GLU A 1 461 ? -20.089 14.182  27.350  1.00 28.52 ? 461  GLU A CG    1 
ATOM   3544  C CD    . GLU A 1 461 ? -21.212 14.994  26.640  1.00 35.50 ? 461  GLU A CD    1 
ATOM   3545  O OE1   . GLU A 1 461 ? -21.511 14.741  25.432  1.00 35.99 ? 461  GLU A OE1   1 
ATOM   3546  O OE2   . GLU A 1 461 ? -21.800 15.886  27.304  1.00 38.41 ? 461  GLU A OE2   1 
ATOM   3547  N N     . GLY A 1 462 ? -15.969 13.962  28.028  1.00 19.44 ? 462  GLY A N     1 
ATOM   3548  C CA    . GLY A 1 462 ? -15.167 14.006  29.231  1.00 17.57 ? 462  GLY A CA    1 
ATOM   3549  C C     . GLY A 1 462 ? -14.069 15.014  29.143  1.00 16.86 ? 462  GLY A C     1 
ATOM   3550  O O     . GLY A 1 462 ? -14.076 15.890  28.260  1.00 16.84 ? 462  GLY A O     1 
ATOM   3551  N N     . ASN A 1 463 ? -13.125 14.872  30.070  1.00 15.93 ? 463  ASN A N     1 
ATOM   3552  C CA    . ASN A 1 463 ? -11.933 15.702  30.179  1.00 14.81 ? 463  ASN A CA    1 
ATOM   3553  C C     . ASN A 1 463 ? -10.920 15.308  29.108  1.00 14.43 ? 463  ASN A C     1 
ATOM   3554  O O     . ASN A 1 463 ? -10.462 14.176  29.064  1.00 14.23 ? 463  ASN A O     1 
ATOM   3555  C CB    . ASN A 1 463 ? -11.321 15.545  31.585  1.00 14.53 ? 463  ASN A CB    1 
ATOM   3556  C CG    . ASN A 1 463 ? -12.232 16.090  32.705  1.00 13.42 ? 463  ASN A CG    1 
ATOM   3557  O OD1   . ASN A 1 463 ? -12.553 17.259  32.722  1.00 13.33 ? 463  ASN A OD1   1 
ATOM   3558  N ND2   . ASN A 1 463 ? -12.629 15.236  33.643  1.00 13.04 ? 463  ASN A ND2   1 
ATOM   3559  N N     . LEU A 1 464 ? -10.592 16.240  28.222  1.00 14.27 ? 464  LEU A N     1 
ATOM   3560  C CA    . LEU A 1 464 ? -9.666  15.952  27.116  1.00 13.65 ? 464  LEU A CA    1 
ATOM   3561  C C     . LEU A 1 464 ? -8.199  15.845  27.561  1.00 13.68 ? 464  LEU A C     1 
ATOM   3562  O O     . LEU A 1 464 ? -7.611  16.852  27.990  1.00 13.64 ? 464  LEU A O     1 
ATOM   3563  C CB    . LEU A 1 464 ? -9.817  17.008  26.023  1.00 13.20 ? 464  LEU A CB    1 
ATOM   3564  C CG    . LEU A 1 464 ? -8.962  16.937  24.750  1.00 13.90 ? 464  LEU A CG    1 
ATOM   3565  C CD1   . LEU A 1 464 ? -8.935  15.546  24.062  1.00 12.51 ? 464  LEU A CD1   1 
ATOM   3566  C CD2   . LEU A 1 464 ? -9.394  18.022  23.774  1.00 12.50 ? 464  LEU A CD2   1 
ATOM   3567  N N     . VAL A 1 465 ? -7.635  14.631  27.463  1.00 13.47 ? 465  VAL A N     1 
ATOM   3568  C CA    . VAL A 1 465 ? -6.203  14.360  27.747  1.00 13.22 ? 465  VAL A CA    1 
ATOM   3569  C C     . VAL A 1 465 ? -5.418  13.864  26.521  1.00 13.37 ? 465  VAL A C     1 
ATOM   3570  O O     . VAL A 1 465 ? -6.006  13.457  25.520  1.00 13.34 ? 465  VAL A O     1 
ATOM   3571  C CB    . VAL A 1 465 ? -5.976  13.362  28.957  1.00 13.59 ? 465  VAL A CB    1 
ATOM   3572  C CG1   . VAL A 1 465 ? -6.578  13.901  30.249  1.00 13.04 ? 465  VAL A CG1   1 
ATOM   3573  C CG2   . VAL A 1 465 ? -6.497  11.940  28.665  1.00 13.24 ? 465  VAL A CG2   1 
ATOM   3574  N N     . ILE A 1 466 ? -4.088  13.929  26.591  1.00 13.60 ? 466  ILE A N     1 
ATOM   3575  C CA    . ILE A 1 466 ? -3.212  13.378  25.544  1.00 13.59 ? 466  ILE A CA    1 
ATOM   3576  C C     . ILE A 1 466 ? -2.302  12.361  26.217  1.00 14.22 ? 466  ILE A C     1 
ATOM   3577  O O     . ILE A 1 466 ? -1.671  12.700  27.218  1.00 14.77 ? 466  ILE A O     1 
ATOM   3578  C CB    . ILE A 1 466 ? -2.388  14.470  24.817  1.00 13.15 ? 466  ILE A CB    1 
ATOM   3579  C CG1   . ILE A 1 466 ? -3.258  15.697  24.493  1.00 12.54 ? 466  ILE A CG1   1 
ATOM   3580  C CG2   . ILE A 1 466 ? -1.750  13.897  23.549  1.00 12.64 ? 466  ILE A CG2   1 
ATOM   3581  C CD1   . ILE A 1 466 ? -4.472  15.452  23.492  1.00 9.22  ? 466  ILE A CD1   1 
ATOM   3582  N N     . THR A 1 467 ? -2.253  11.124  25.707  1.00 14.36 ? 467  THR A N     1 
ATOM   3583  C CA    . THR A 1 467 ? -1.709  9.990   26.489  1.00 14.64 ? 467  THR A CA    1 
ATOM   3584  C C     . THR A 1 467 ? -0.259  9.663   26.180  1.00 15.08 ? 467  THR A C     1 
ATOM   3585  O O     . THR A 1 467 ? 0.308   8.739   26.769  1.00 14.55 ? 467  THR A O     1 
ATOM   3586  C CB    . THR A 1 467 ? -2.523  8.673   26.295  1.00 14.76 ? 467  THR A CB    1 
ATOM   3587  O OG1   . THR A 1 467 ? -2.354  8.172   24.951  1.00 16.00 ? 467  THR A OG1   1 
ATOM   3588  C CG2   . THR A 1 467 ? -3.984  8.899   26.595  1.00 14.21 ? 467  THR A CG2   1 
ATOM   3589  N N     . ASP A 1 468 ? 0.310   10.367  25.198  1.00 15.13 ? 468  ASP A N     1 
ATOM   3590  C CA    . ASP A 1 468 ? 1.739   10.258  24.913  1.00 14.93 ? 468  ASP A CA    1 
ATOM   3591  C C     . ASP A 1 468 ? 2.209   11.627  24.462  1.00 14.87 ? 468  ASP A C     1 
ATOM   3592  O O     . ASP A 1 468 ? 1.395   12.526  24.159  1.00 14.59 ? 468  ASP A O     1 
ATOM   3593  C CB    . ASP A 1 468 ? 2.054   9.178   23.849  1.00 14.49 ? 468  ASP A CB    1 
ATOM   3594  C CG    . ASP A 1 468 ? 3.437   8.528   24.041  1.00 15.41 ? 468  ASP A CG    1 
ATOM   3595  O OD1   . ASP A 1 468 ? 4.378   9.174   24.562  1.00 16.98 ? 468  ASP A OD1   1 
ATOM   3596  O OD2   . ASP A 1 468 ? 3.607   7.353   23.676  1.00 15.41 ? 468  ASP A OD2   1 
ATOM   3597  N N     . SER A 1 469 ? 3.527   11.792  24.451  1.00 14.65 ? 469  SER A N     1 
ATOM   3598  C CA    . SER A 1 469 ? 4.140   13.016  23.970  1.00 14.54 ? 469  SER A CA    1 
ATOM   3599  C C     . SER A 1 469 ? 4.039   13.131  22.447  1.00 14.07 ? 469  SER A C     1 
ATOM   3600  O O     . SER A 1 469 ? 3.507   12.237  21.782  1.00 14.70 ? 469  SER A O     1 
ATOM   3601  C CB    . SER A 1 469 ? 5.591   13.087  24.406  1.00 13.98 ? 469  SER A CB    1 
ATOM   3602  O OG    . SER A 1 469 ? 6.112   14.362  24.110  1.00 14.83 ? 469  SER A OG    1 
ATOM   3603  N N     . TRP A 1 470 ? 4.537   14.252  21.929  1.00 13.30 ? 470  TRP A N     1 
ATOM   3604  C CA    . TRP A 1 470 ? 4.584   14.570  20.514  1.00 12.34 ? 470  TRP A CA    1 
ATOM   3605  C C     . TRP A 1 470 ? 5.658   15.693  20.388  1.00 12.15 ? 470  TRP A C     1 
ATOM   3606  O O     . TRP A 1 470 ? 5.845   16.496  21.319  1.00 11.32 ? 470  TRP A O     1 
ATOM   3607  C CB    . TRP A 1 470 ? 3.189   15.034  20.045  1.00 12.23 ? 470  TRP A CB    1 
ATOM   3608  C CG    . TRP A 1 470 ? 2.783   16.301  20.714  1.00 12.24 ? 470  TRP A CG    1 
ATOM   3609  C CD1   . TRP A 1 470 ? 2.980   17.583  20.257  1.00 12.66 ? 470  TRP A CD1   1 
ATOM   3610  C CD2   . TRP A 1 470 ? 2.172   16.422  21.988  1.00 11.80 ? 470  TRP A CD2   1 
ATOM   3611  N NE1   . TRP A 1 470 ? 2.517   18.495  21.176  1.00 11.37 ? 470  TRP A NE1   1 
ATOM   3612  C CE2   . TRP A 1 470 ? 2.011   17.808  22.247  1.00 12.64 ? 470  TRP A CE2   1 
ATOM   3613  C CE3   . TRP A 1 470 ? 1.724   15.498  22.937  1.00 11.99 ? 470  TRP A CE3   1 
ATOM   3614  C CZ2   . TRP A 1 470 ? 1.429   18.284  23.426  1.00 12.96 ? 470  TRP A CZ2   1 
ATOM   3615  C CZ3   . TRP A 1 470 ? 1.137   15.970  24.104  1.00 12.43 ? 470  TRP A CZ3   1 
ATOM   3616  C CH2   . TRP A 1 470 ? 0.999   17.351  24.339  1.00 12.75 ? 470  TRP A CH2   1 
ATOM   3617  N N     . PRO A 1 471 ? 6.367   15.750  19.247  1.00 11.92 ? 471  PRO A N     1 
ATOM   3618  C CA    . PRO A 1 471 ? 7.586   16.582  19.086  1.00 11.93 ? 471  PRO A CA    1 
ATOM   3619  C C     . PRO A 1 471 ? 7.485   18.064  19.498  1.00 11.56 ? 471  PRO A C     1 
ATOM   3620  O O     . PRO A 1 471 ? 8.471   18.654  19.929  1.00 11.52 ? 471  PRO A O     1 
ATOM   3621  C CB    . PRO A 1 471 ? 7.887   16.481  17.584  1.00 11.98 ? 471  PRO A CB    1 
ATOM   3622  C CG    . PRO A 1 471 ? 7.279   15.170  17.174  1.00 12.02 ? 471  PRO A CG    1 
ATOM   3623  C CD    . PRO A 1 471 ? 6.037   15.016  18.011  1.00 12.13 ? 471  PRO A CD    1 
ATOM   3624  N N     . GLY A 1 472 ? 6.320   18.671  19.365  1.00 11.27 ? 472  GLY A N     1 
ATOM   3625  C CA    . GLY A 1 472 ? 6.212   20.100  19.630  1.00 11.07 ? 472  GLY A CA    1 
ATOM   3626  C C     . GLY A 1 472 ? 5.800   20.448  21.045  1.00 11.20 ? 472  GLY A C     1 
ATOM   3627  O O     . GLY A 1 472 ? 5.651   21.629  21.366  1.00 11.55 ? 472  GLY A O     1 
ATOM   3628  N N     . GLN A 1 473 ? 5.593   19.431  21.885  1.00 10.78 ? 473  GLN A N     1 
ATOM   3629  C CA    . GLN A 1 473 ? 5.133   19.631  23.262  1.00 10.54 ? 473  GLN A CA    1 
ATOM   3630  C C     . GLN A 1 473 ? 6.020   20.605  24.045  1.00 10.64 ? 473  GLN A C     1 
ATOM   3631  O O     . GLN A 1 473 ? 7.246   20.581  23.922  1.00 11.32 ? 473  GLN A O     1 
ATOM   3632  C CB    . GLN A 1 473 ? 5.040   18.290  24.010  1.00 10.01 ? 473  GLN A CB    1 
ATOM   3633  C CG    . GLN A 1 473 ? 4.383   18.394  25.378  1.00 9.25  ? 473  GLN A CG    1 
ATOM   3634  C CD    . GLN A 1 473 ? 4.110   17.052  26.030  1.00 10.77 ? 473  GLN A CD    1 
ATOM   3635  O OE1   . GLN A 1 473 ? 4.591   15.989  25.574  1.00 12.40 ? 473  GLN A OE1   1 
ATOM   3636  N NE2   . GLN A 1 473 ? 3.348   17.084  27.121  1.00 7.60  ? 473  GLN A NE2   1 
ATOM   3637  N N     . ALA A 1 474 ? 5.404   21.454  24.859  1.00 10.53 ? 474  ALA A N     1 
ATOM   3638  C CA    . ALA A 1 474 ? 6.171   22.317  25.772  1.00 10.64 ? 474  ALA A CA    1 
ATOM   3639  C C     . ALA A 1 474 ? 6.948   21.450  26.766  1.00 10.66 ? 474  ALA A C     1 
ATOM   3640  O O     . ALA A 1 474 ? 6.487   20.351  27.148  1.00 10.16 ? 474  ALA A O     1 
ATOM   3641  C CB    . ALA A 1 474 ? 5.250   23.288  26.500  1.00 10.47 ? 474  ALA A CB    1 
ATOM   3642  N N     . ARG A 1 475 ? 8.120   21.934  27.171  1.00 10.61 ? 475  ARG A N     1 
ATOM   3643  C CA    . ARG A 1 475 ? 9.071   21.077  27.897  1.00 11.13 ? 475  ARG A CA    1 
ATOM   3644  C C     . ARG A 1 475 ? 9.025   21.332  29.375  1.00 11.41 ? 475  ARG A C     1 
ATOM   3645  O O     . ARG A 1 475 ? 9.356   20.440  30.141  1.00 11.77 ? 475  ARG A O     1 
ATOM   3646  C CB    . ARG A 1 475 ? 10.513  21.240  27.395  1.00 10.61 ? 475  ARG A CB    1 
ATOM   3647  C CG    . ARG A 1 475 ? 10.707  20.981  25.913  1.00 11.10 ? 475  ARG A CG    1 
ATOM   3648  C CD    . ARG A 1 475 ? 10.366  19.537  25.511  1.00 11.45 ? 475  ARG A CD    1 
ATOM   3649  N NE    . ARG A 1 475 ? 11.151  19.116  24.339  1.00 13.50 ? 475  ARG A NE    1 
ATOM   3650  C CZ    . ARG A 1 475 ? 10.656  18.907  23.108  1.00 14.87 ? 475  ARG A CZ    1 
ATOM   3651  N NH1   . ARG A 1 475 ? 9.352   19.046  22.847  1.00 12.89 ? 475  ARG A NH1   1 
ATOM   3652  N NH2   . ARG A 1 475 ? 11.475  18.534  22.126  1.00 14.62 ? 475  ARG A NH2   1 
ATOM   3653  N N     . THR A 1 476 ? 8.615   22.545  29.764  1.00 11.48 ? 476  THR A N     1 
ATOM   3654  C CA    . THR A 1 476 ? 8.598   22.973  31.165  1.00 11.59 ? 476  THR A CA    1 
ATOM   3655  C C     . THR A 1 476 ? 7.935   24.344  31.373  1.00 11.72 ? 476  THR A C     1 
ATOM   3656  O O     . THR A 1 476 ? 7.562   25.024  30.413  1.00 10.87 ? 476  THR A O     1 
ATOM   3657  C CB    . THR A 1 476 ? 10.033  22.960  31.792  1.00 11.78 ? 476  THR A CB    1 
ATOM   3658  O OG1   . THR A 1 476 ? 9.955   23.294  33.185  1.00 14.10 ? 476  THR A OG1   1 
ATOM   3659  C CG2   . THR A 1 476 ? 10.954  23.929  31.111  1.00 10.51 ? 476  THR A CG2   1 
ATOM   3660  N N     . LEU A 1 477 ? 7.760   24.729  32.633  1.00 12.17 ? 477  LEU A N     1 
ATOM   3661  C CA    . LEU A 1 477 ? 7.439   26.111  32.949  1.00 13.19 ? 477  LEU A CA    1 
ATOM   3662  C C     . LEU A 1 477 ? 8.734   26.738  33.370  1.00 13.73 ? 477  LEU A C     1 
ATOM   3663  O O     . LEU A 1 477 ? 9.496   26.136  34.131  1.00 13.74 ? 477  LEU A O     1 
ATOM   3664  C CB    . LEU A 1 477 ? 6.419   26.212  34.075  1.00 12.85 ? 477  LEU A CB    1 
ATOM   3665  C CG    . LEU A 1 477 ? 5.054   25.611  33.753  1.00 14.59 ? 477  LEU A CG    1 
ATOM   3666  C CD1   . LEU A 1 477 ? 4.070   25.827  34.921  1.00 13.05 ? 477  LEU A CD1   1 
ATOM   3667  C CD2   . LEU A 1 477 ? 4.487   26.145  32.383  1.00 15.94 ? 477  LEU A CD2   1 
ATOM   3668  N N     . PHE A 1 478 ? 8.991   27.948  32.880  1.00 14.57 ? 478  PHE A N     1 
ATOM   3669  C CA    . PHE A 1 478 ? 10.239  28.636  33.200  1.00 14.57 ? 478  PHE A CA    1 
ATOM   3670  C C     . PHE A 1 478 ? 10.543  28.645  34.682  1.00 14.70 ? 478  PHE A C     1 
ATOM   3671  O O     . PHE A 1 478 ? 9.752   29.144  35.476  1.00 14.95 ? 478  PHE A O     1 
ATOM   3672  C CB    . PHE A 1 478 ? 10.268  30.087  32.688  1.00 14.35 ? 478  PHE A CB    1 
ATOM   3673  C CG    . PHE A 1 478 ? 11.593  30.752  32.937  1.00 14.95 ? 478  PHE A CG    1 
ATOM   3674  C CD1   . PHE A 1 478 ? 12.745  30.321  32.239  1.00 13.75 ? 478  PHE A CD1   1 
ATOM   3675  C CD2   . PHE A 1 478 ? 11.731  31.731  33.933  1.00 14.13 ? 478  PHE A CD2   1 
ATOM   3676  C CE1   . PHE A 1 478 ? 14.012  30.896  32.510  1.00 12.60 ? 478  PHE A CE1   1 
ATOM   3677  C CE2   . PHE A 1 478 ? 12.997  32.299  34.212  1.00 13.58 ? 478  PHE A CE2   1 
ATOM   3678  C CZ    . PHE A 1 478 ? 14.130  31.874  33.491  1.00 12.93 ? 478  PHE A CZ    1 
ATOM   3679  N N     . GLY A 1 479 ? 11.707  28.105  35.047  1.00 15.54 ? 479  GLY A N     1 
ATOM   3680  C CA    . GLY A 1 479 ? 12.201  28.166  36.434  1.00 15.13 ? 479  GLY A CA    1 
ATOM   3681  C C     . GLY A 1 479 ? 11.445  27.237  37.374  1.00 15.46 ? 479  GLY A C     1 
ATOM   3682  O O     . GLY A 1 479 ? 11.766  27.167  38.549  1.00 16.35 ? 479  GLY A O     1 
ATOM   3683  N N     . ASP A 1 480 ? 10.466  26.489  36.857  1.00 15.16 ? 480  ASP A N     1 
ATOM   3684  C CA    . ASP A 1 480 ? 9.552   25.728  37.716  1.00 14.68 ? 480  ASP A CA    1 
ATOM   3685  C C     . ASP A 1 480 ? 9.040   24.391  37.109  1.00 13.41 ? 480  ASP A C     1 
ATOM   3686  O O     . ASP A 1 480 ? 7.840   24.213  36.875  1.00 12.96 ? 480  ASP A O     1 
ATOM   3687  C CB    . ASP A 1 480 ? 8.393   26.650  38.113  1.00 15.40 ? 480  ASP A CB    1 
ATOM   3688  C CG    . ASP A 1 480 ? 7.809   26.318  39.477  1.00 17.29 ? 480  ASP A CG    1 
ATOM   3689  O OD1   . ASP A 1 480 ? 8.108   25.220  40.014  1.00 20.08 ? 480  ASP A OD1   1 
ATOM   3690  O OD2   . ASP A 1 480 ? 7.016   27.145  39.986  1.00 19.78 ? 480  ASP A OD2   1 
ATOM   3691  N N     . HIS A 1 481 ? 9.953   23.451  36.868  1.00 12.41 ? 481  HIS A N     1 
ATOM   3692  C CA    . HIS A 1 481 ? 9.580   22.151  36.308  1.00 11.76 ? 481  HIS A CA    1 
ATOM   3693  C C     . HIS A 1 481 ? 8.621   21.379  37.199  1.00 11.81 ? 481  HIS A C     1 
ATOM   3694  O O     . HIS A 1 481 ? 7.765   20.630  36.701  1.00 11.61 ? 481  HIS A O     1 
ATOM   3695  C CB    . HIS A 1 481 ? 10.780  21.270  36.001  1.00 10.59 ? 481  HIS A CB    1 
ATOM   3696  C CG    . HIS A 1 481 ? 10.423  20.061  35.194  1.00 10.36 ? 481  HIS A CG    1 
ATOM   3697  N ND1   . HIS A 1 481 ? 10.367  18.791  35.733  1.00 7.18  ? 481  HIS A ND1   1 
ATOM   3698  C CD2   . HIS A 1 481 ? 10.083  19.933  33.883  1.00 9.34  ? 481  HIS A CD2   1 
ATOM   3699  C CE1   . HIS A 1 481 ? 10.024  17.932  34.787  1.00 8.60  ? 481  HIS A CE1   1 
ATOM   3700  N NE2   . HIS A 1 481 ? 9.845   18.598  33.655  1.00 9.18  ? 481  HIS A NE2   1 
ATOM   3701  N N     . GLU A 1 482 ? 8.784   21.552  38.505  1.00 11.61 ? 482  GLU A N     1 
ATOM   3702  C CA    . GLU A 1 482 ? 7.846   21.001  39.458  1.00 12.57 ? 482  GLU A CA    1 
ATOM   3703  C C     . GLU A 1 482 ? 6.410   21.489  39.265  1.00 12.94 ? 482  GLU A C     1 
ATOM   3704  O O     . GLU A 1 482 ? 5.485   20.687  39.372  1.00 13.16 ? 482  GLU A O     1 
ATOM   3705  C CB    . GLU A 1 482 ? 8.336   21.197  40.898  1.00 12.38 ? 482  GLU A CB    1 
ATOM   3706  C CG    . GLU A 1 482 ? 9.460   20.194  41.235  1.00 13.14 ? 482  GLU A CG    1 
ATOM   3707  C CD    . GLU A 1 482 ? 9.913   20.241  42.661  1.00 14.36 ? 482  GLU A CD    1 
ATOM   3708  O OE1   . GLU A 1 482 ? 9.073   20.507  43.540  1.00 14.41 ? 482  GLU A OE1   1 
ATOM   3709  O OE2   . GLU A 1 482 ? 11.115  20.009  42.910  1.00 15.91 ? 482  GLU A OE2   1 
ATOM   3710  N N     . ARG A 1 483 ? 6.216   22.779  38.971  1.00 13.34 ? 483  ARG A N     1 
ATOM   3711  C CA    . ARG A 1 483 ? 4.860   23.272  38.722  1.00 13.92 ? 483  ARG A CA    1 
ATOM   3712  C C     . ARG A 1 483 ? 4.299   22.704  37.419  1.00 13.97 ? 483  ARG A C     1 
ATOM   3713  O O     . ARG A 1 483 ? 3.118   22.386  37.352  1.00 14.09 ? 483  ARG A O     1 
ATOM   3714  C CB    . ARG A 1 483 ? 4.742   24.807  38.755  1.00 14.05 ? 483  ARG A CB    1 
ATOM   3715  C CG    . ARG A 1 483 ? 3.359   25.252  39.244  1.00 14.76 ? 483  ARG A CG    1 
ATOM   3716  C CD    . ARG A 1 483 ? 3.099   26.733  39.031  1.00 18.41 ? 483  ARG A CD    1 
ATOM   3717  N N     . PHE A 1 484 ? 5.157   22.574  36.404  1.00 14.42 ? 484  PHE A N     1 
ATOM   3718  C CA    . PHE A 1 484 ? 4.847   21.860  35.156  1.00 14.61 ? 484  PHE A CA    1 
ATOM   3719  C C     . PHE A 1 484 ? 4.319   20.446  35.419  1.00 15.12 ? 484  PHE A C     1 
ATOM   3720  O O     . PHE A 1 484 ? 3.291   20.082  34.849  1.00 14.41 ? 484  PHE A O     1 
ATOM   3721  C CB    . PHE A 1 484 ? 6.093   21.824  34.273  1.00 14.91 ? 484  PHE A CB    1 
ATOM   3722  C CG    . PHE A 1 484 ? 5.873   21.301  32.861  1.00 15.51 ? 484  PHE A CG    1 
ATOM   3723  C CD1   . PHE A 1 484 ? 5.136   22.026  31.932  1.00 15.51 ? 484  PHE A CD1   1 
ATOM   3724  C CD2   . PHE A 1 484 ? 6.487   20.117  32.440  1.00 15.59 ? 484  PHE A CD2   1 
ATOM   3725  C CE1   . PHE A 1 484 ? 4.984   21.559  30.617  1.00 15.79 ? 484  PHE A CE1   1 
ATOM   3726  C CE2   . PHE A 1 484 ? 6.340   19.644  31.119  1.00 15.79 ? 484  PHE A CE2   1 
ATOM   3727  C CZ    . PHE A 1 484 ? 5.585   20.368  30.215  1.00 15.92 ? 484  PHE A CZ    1 
ATOM   3728  N N     . GLU A 1 485 ? 4.980   19.667  36.291  1.00 16.16 ? 485  GLU A N     1 
ATOM   3729  C CA    . GLU A 1 485 ? 4.504   18.291  36.573  1.00 18.36 ? 485  GLU A CA    1 
ATOM   3730  C C     . GLU A 1 485 ? 3.095   18.411  37.110  1.00 17.85 ? 485  GLU A C     1 
ATOM   3731  O O     . GLU A 1 485 ? 2.178   17.806  36.557  1.00 18.55 ? 485  GLU A O     1 
ATOM   3732  C CB    . GLU A 1 485 ? 5.427   17.436  37.498  1.00 17.84 ? 485  GLU A CB    1 
ATOM   3733  C CG    . GLU A 1 485 ? 6.871   17.209  36.918  1.00 21.08 ? 485  GLU A CG    1 
ATOM   3734  C CD    . GLU A 1 485 ? 7.896   16.385  37.808  1.00 22.11 ? 485  GLU A CD    1 
ATOM   3735  O OE1   . GLU A 1 485 ? 8.103   16.714  39.025  1.00 25.03 ? 485  GLU A OE1   1 
ATOM   3736  O OE2   . GLU A 1 485 ? 8.550   15.446  37.225  1.00 23.66 ? 485  GLU A OE2   1 
ATOM   3737  N N     . GLN A 1 486 ? 2.906   19.266  38.109  1.00 17.65 ? 486  GLN A N     1 
ATOM   3738  C CA    . GLN A 1 486 ? 1.638   19.309  38.833  1.00 18.46 ? 486  GLN A CA    1 
ATOM   3739  C C     . GLN A 1 486 ? 0.494   19.943  38.080  1.00 17.40 ? 486  GLN A C     1 
ATOM   3740  O O     . GLN A 1 486 ? -0.640  19.470  38.187  1.00 17.66 ? 486  GLN A O     1 
ATOM   3741  C CB    . GLN A 1 486 ? 1.777   20.009  40.177  1.00 19.25 ? 486  GLN A CB    1 
ATOM   3742  C CG    . GLN A 1 486 ? 2.883   19.480  41.027  1.00 24.27 ? 486  GLN A CG    1 
ATOM   3743  C CD    . GLN A 1 486 ? 3.458   20.600  41.879  1.00 33.72 ? 486  GLN A CD    1 
ATOM   3744  O OE1   . GLN A 1 486 ? 2.852   21.697  41.978  1.00 39.15 ? 486  GLN A OE1   1 
ATOM   3745  N NE2   . GLN A 1 486 ? 4.626   20.353  42.498  1.00 33.29 ? 486  GLN A NE2   1 
ATOM   3746  N N     . THR A 1 487 ? 0.768   21.014  37.342  1.00 16.27 ? 487  THR A N     1 
ATOM   3747  C CA    . THR A 1 487 ? -0.281  21.668  36.587  1.00 15.26 ? 487  THR A CA    1 
ATOM   3748  C C     . THR A 1 487 ? -0.849  20.741  35.531  1.00 14.72 ? 487  THR A C     1 
ATOM   3749  O O     . THR A 1 487 ? -2.035  20.757  35.301  1.00 14.90 ? 487  THR A O     1 
ATOM   3750  C CB    . THR A 1 487 ? 0.204   22.961  35.941  1.00 15.49 ? 487  THR A CB    1 
ATOM   3751  O OG1   . THR A 1 487 ? 0.590   23.874  36.973  1.00 16.09 ? 487  THR A OG1   1 
ATOM   3752  C CG2   . THR A 1 487 ? -0.888  23.601  35.139  1.00 13.80 ? 487  THR A CG2   1 
ATOM   3753  N N     . TYR A 1 488 ? -0.018  19.923  34.905  1.00 14.20 ? 488  TYR A N     1 
ATOM   3754  C CA    . TYR A 1 488 ? -0.450  19.183  33.731  1.00 13.88 ? 488  TYR A CA    1 
ATOM   3755  C C     . TYR A 1 488 ? -0.453  17.660  33.857  1.00 14.64 ? 488  TYR A C     1 
ATOM   3756  O O     . TYR A 1 488 ? -1.152  16.995  33.085  1.00 14.95 ? 488  TYR A O     1 
ATOM   3757  C CB    . TYR A 1 488 ? 0.404   19.573  32.519  1.00 13.20 ? 488  TYR A CB    1 
ATOM   3758  C CG    . TYR A 1 488 ? 0.403   21.039  32.236  1.00 12.44 ? 488  TYR A CG    1 
ATOM   3759  C CD1   . TYR A 1 488 ? 1.525   21.822  32.529  1.00 12.70 ? 488  TYR A CD1   1 
ATOM   3760  C CD2   . TYR A 1 488 ? -0.728  21.660  31.698  1.00 11.37 ? 488  TYR A CD2   1 
ATOM   3761  C CE1   . TYR A 1 488 ? 1.513   23.183  32.301  1.00 12.90 ? 488  TYR A CE1   1 
ATOM   3762  C CE2   . TYR A 1 488 ? -0.755  23.003  31.454  1.00 11.17 ? 488  TYR A CE2   1 
ATOM   3763  C CZ    . TYR A 1 488 ? 0.361   23.770  31.755  1.00 13.28 ? 488  TYR A CZ    1 
ATOM   3764  O OH    . TYR A 1 488 ? 0.340   25.124  31.497  1.00 12.92 ? 488  TYR A OH    1 
ATOM   3765  N N     . PHE A 1 489 ? 0.338   17.105  34.778  1.00 14.79 ? 489  PHE A N     1 
ATOM   3766  C CA    . PHE A 1 489 ? 0.537   15.655  34.828  1.00 15.48 ? 489  PHE A CA    1 
ATOM   3767  C C     . PHE A 1 489 ? 0.199   15.043  36.213  1.00 16.52 ? 489  PHE A C     1 
ATOM   3768  O O     . PHE A 1 489 ? 0.695   13.950  36.557  1.00 17.11 ? 489  PHE A O     1 
ATOM   3769  C CB    . PHE A 1 489 ? 1.983   15.302  34.425  1.00 15.19 ? 489  PHE A CB    1 
ATOM   3770  C CG    . PHE A 1 489 ? 2.417   15.855  33.071  1.00 15.57 ? 489  PHE A CG    1 
ATOM   3771  C CD1   . PHE A 1 489 ? 3.054   17.103  32.975  1.00 15.66 ? 489  PHE A CD1   1 
ATOM   3772  C CD2   . PHE A 1 489 ? 2.223   15.116  31.893  1.00 15.35 ? 489  PHE A CD2   1 
ATOM   3773  C CE1   . PHE A 1 489 ? 3.474   17.615  31.729  1.00 15.32 ? 489  PHE A CE1   1 
ATOM   3774  C CE2   . PHE A 1 489 ? 2.641   15.612  30.631  1.00 13.46 ? 489  PHE A CE2   1 
ATOM   3775  C CZ    . PHE A 1 489 ? 3.271   16.859  30.550  1.00 15.16 ? 489  PHE A CZ    1 
ATOM   3776  N N     . SER A 1 490 ? -0.629  15.734  37.006  1.00 16.54 ? 490  SER A N     1 
ATOM   3777  C CA    . SER A 1 490 ? -1.012  15.231  38.329  1.00 17.32 ? 490  SER A CA    1 
ATOM   3778  C C     . SER A 1 490 ? -2.498  14.937  38.535  1.00 17.12 ? 490  SER A C     1 
ATOM   3779  O O     . SER A 1 490 ? -2.850  14.177  39.425  1.00 16.77 ? 490  SER A O     1 
ATOM   3780  C CB    . SER A 1 490 ? -0.492  16.146  39.465  1.00 17.77 ? 490  SER A CB    1 
ATOM   3781  O OG    . SER A 1 490 ? -1.126  17.414  39.446  1.00 18.91 ? 490  SER A OG    1 
ATOM   3782  N N     . THR A 1 491 ? -3.373  15.543  37.738  1.00 17.56 ? 491  THR A N     1 
ATOM   3783  C CA    . THR A 1 491 ? -4.809  15.232  37.836  1.00 17.25 ? 491  THR A CA    1 
ATOM   3784  C C     . THR A 1 491 ? -5.055  13.809  37.356  1.00 17.21 ? 491  THR A C     1 
ATOM   3785  O O     . THR A 1 491 ? -5.744  13.035  38.006  1.00 16.34 ? 491  THR A O     1 
ATOM   3786  C CB    . THR A 1 491 ? -5.674  16.207  37.028  1.00 16.65 ? 491  THR A CB    1 
ATOM   3787  O OG1   . THR A 1 491 ? -5.379  17.535  37.457  1.00 16.83 ? 491  THR A OG1   1 
ATOM   3788  C CG2   . THR A 1 491 ? -7.156  15.939  37.252  1.00 16.23 ? 491  THR A CG2   1 
ATOM   3789  N N     . PHE A 1 492 ? -4.478  13.485  36.208  1.00 17.52 ? 492  PHE A N     1 
ATOM   3790  C CA    . PHE A 1 492 ? -4.662  12.179  35.605  1.00 17.96 ? 492  PHE A CA    1 
ATOM   3791  C C     . PHE A 1 492 ? -3.273  11.628  35.373  1.00 17.85 ? 492  PHE A C     1 
ATOM   3792  O O     . PHE A 1 492 ? -2.598  12.017  34.436  1.00 16.89 ? 492  PHE A O     1 
ATOM   3793  C CB    . PHE A 1 492 ? -5.467  12.296  34.316  1.00 18.23 ? 492  PHE A CB    1 
ATOM   3794  C CG    . PHE A 1 492 ? -6.779  13.044  34.477  1.00 19.53 ? 492  PHE A CG    1 
ATOM   3795  C CD1   . PHE A 1 492 ? -7.014  14.226  33.777  1.00 19.16 ? 492  PHE A CD1   1 
ATOM   3796  C CD2   . PHE A 1 492 ? -7.772  12.575  35.337  1.00 21.12 ? 492  PHE A CD2   1 
ATOM   3797  C CE1   . PHE A 1 492 ? -8.225  14.926  33.911  1.00 19.40 ? 492  PHE A CE1   1 
ATOM   3798  C CE2   . PHE A 1 492 ? -8.993  13.281  35.491  1.00 21.71 ? 492  PHE A CE2   1 
ATOM   3799  C CZ    . PHE A 1 492 ? -9.214  14.456  34.760  1.00 19.83 ? 492  PHE A CZ    1 
ATOM   3800  N N     . LYS A 1 493 ? -2.842  10.752  36.290  1.00 18.46 ? 493  LYS A N     1 
ATOM   3801  C CA    . LYS A 1 493 ? -1.473  10.272  36.341  1.00 18.39 ? 493  LYS A CA    1 
ATOM   3802  C C     . LYS A 1 493 ? -1.106  9.591   35.033  1.00 18.30 ? 493  LYS A C     1 
ATOM   3803  O O     . LYS A 1 493 ? -1.907  8.835   34.485  1.00 18.02 ? 493  LYS A O     1 
ATOM   3804  C CB    . LYS A 1 493 ? -1.275  9.360   37.554  1.00 18.96 ? 493  LYS A CB    1 
ATOM   3805  C CG    . LYS A 1 493 ? -1.018  10.118  38.894  1.00 19.62 ? 493  LYS A CG    1 
ATOM   3806  N N     . ASN A 1 494 ? 0.084   9.924   34.522  1.00 18.22 ? 494  ASN A N     1 
ATOM   3807  C CA    . ASN A 1 494 ? 0.629   9.420   33.230  1.00 18.44 ? 494  ASN A CA    1 
ATOM   3808  C C     . ASN A 1 494 ? 0.072   10.060  31.986  1.00 18.08 ? 494  ASN A C     1 
ATOM   3809  O O     . ASN A 1 494 ? 0.326   9.600   30.880  1.00 17.34 ? 494  ASN A O     1 
ATOM   3810  C CB    . ASN A 1 494 ? 0.589   7.880   33.108  1.00 18.84 ? 494  ASN A CB    1 
ATOM   3811  C CG    . ASN A 1 494 ? 1.907   7.246   33.489  1.00 20.50 ? 494  ASN A CG    1 
ATOM   3812  O OD1   . ASN A 1 494 ? 2.954   7.553   32.900  1.00 23.27 ? 494  ASN A OD1   1 
ATOM   3813  N ND2   . ASN A 1 494 ? 1.877   6.385   34.493  1.00 21.05 ? 494  ASN A ND2   1 
ATOM   3814  N N     . MET A 1 495 ? -0.678  11.137  32.165  1.00 18.39 ? 495  MET A N     1 
ATOM   3815  C CA    . MET A 1 495 ? -1.351  11.771  31.045  1.00 18.95 ? 495  MET A CA    1 
ATOM   3816  C C     . MET A 1 495 ? -1.231  13.285  31.045  1.00 17.64 ? 495  MET A C     1 
ATOM   3817  O O     . MET A 1 495 ? -1.208  13.910  32.105  1.00 17.46 ? 495  MET A O     1 
ATOM   3818  C CB    . MET A 1 495 ? -2.815  11.361  31.041  1.00 18.35 ? 495  MET A CB    1 
ATOM   3819  C CG    . MET A 1 495 ? -3.012  9.887   30.820  1.00 19.76 ? 495  MET A CG    1 
ATOM   3820  S SD    . MET A 1 495 ? -4.755  9.540   30.668  1.00 23.98 ? 495  MET A SD    1 
ATOM   3821  C CE    . MET A 1 495 ? -5.229  9.183   32.376  1.00 24.69 ? 495  MET A CE    1 
ATOM   3822  N N     . TYR A 1 496 ? -1.159  13.868  29.842  1.00 16.65 ? 496  TYR A N     1 
ATOM   3823  C CA    . TYR A 1 496 ? -1.239  15.318  29.675  1.00 14.96 ? 496  TYR A CA    1 
ATOM   3824  C C     . TYR A 1 496 ? -2.701  15.783  29.751  1.00 14.51 ? 496  TYR A C     1 
ATOM   3825  O O     . TYR A 1 496 ? -3.498  15.428  28.889  1.00 14.65 ? 496  TYR A O     1 
ATOM   3826  C CB    . TYR A 1 496 ? -0.584  15.772  28.356  1.00 13.97 ? 496  TYR A CB    1 
ATOM   3827  C CG    . TYR A 1 496 ? -0.716  17.255  28.182  1.00 13.42 ? 496  TYR A CG    1 
ATOM   3828  C CD1   . TYR A 1 496 ? 0.073   18.137  28.943  1.00 14.58 ? 496  TYR A CD1   1 
ATOM   3829  C CD2   . TYR A 1 496 ? -1.671  17.799  27.321  1.00 10.50 ? 496  TYR A CD2   1 
ATOM   3830  C CE1   . TYR A 1 496 ? -0.086  19.530  28.826  1.00 13.95 ? 496  TYR A CE1   1 
ATOM   3831  C CE2   . TYR A 1 496 ? -1.820  19.165  27.193  1.00 10.40 ? 496  TYR A CE2   1 
ATOM   3832  C CZ    . TYR A 1 496 ? -1.023  20.023  27.944  1.00 12.40 ? 496  TYR A CZ    1 
ATOM   3833  O OH    . TYR A 1 496 ? -1.164  21.372  27.834  1.00 12.39 ? 496  TYR A OH    1 
ATOM   3834  N N     . PHE A 1 497 ? -3.047  16.572  30.771  1.00 14.20 ? 497  PHE A N     1 
ATOM   3835  C CA    . PHE A 1 497 ? -4.415  17.107  30.916  1.00 14.75 ? 497  PHE A CA    1 
ATOM   3836  C C     . PHE A 1 497 ? -4.498  18.513  30.320  1.00 15.17 ? 497  PHE A C     1 
ATOM   3837  O O     . PHE A 1 497 ? -3.825  19.413  30.792  1.00 16.67 ? 497  PHE A O     1 
ATOM   3838  C CB    . PHE A 1 497 ? -4.839  17.133  32.399  1.00 14.53 ? 497  PHE A CB    1 
ATOM   3839  C CG    . PHE A 1 497 ? -6.242  17.683  32.634  1.00 15.17 ? 497  PHE A CG    1 
ATOM   3840  C CD1   . PHE A 1 497 ? -7.258  17.508  31.676  1.00 15.06 ? 497  PHE A CD1   1 
ATOM   3841  C CD2   . PHE A 1 497 ? -6.550  18.359  33.814  1.00 14.18 ? 497  PHE A CD2   1 
ATOM   3842  C CE1   . PHE A 1 497 ? -8.547  18.008  31.880  1.00 13.95 ? 497  PHE A CE1   1 
ATOM   3843  C CE2   . PHE A 1 497 ? -7.847  18.858  34.042  1.00 15.85 ? 497  PHE A CE2   1 
ATOM   3844  C CZ    . PHE A 1 497 ? -8.844  18.685  33.065  1.00 16.08 ? 497  PHE A CZ    1 
ATOM   3845  N N     . SER A 1 498 ? -5.316  18.712  29.303  1.00 15.10 ? 498  SER A N     1 
ATOM   3846  C CA    . SER A 1 498 ? -5.359  19.986  28.573  1.00 15.06 ? 498  SER A CA    1 
ATOM   3847  C C     . SER A 1 498 ? -6.042  21.134  29.335  1.00 16.00 ? 498  SER A C     1 
ATOM   3848  O O     . SER A 1 498 ? -5.823  22.302  29.006  1.00 15.93 ? 498  SER A O     1 
ATOM   3849  C CB    . SER A 1 498 ? -6.131  19.785  27.277  1.00 14.37 ? 498  SER A CB    1 
ATOM   3850  O OG    . SER A 1 498 ? -7.476  19.455  27.589  1.00 11.99 ? 498  SER A OG    1 
ATOM   3851  N N     . GLY A 1 499 ? -6.905  20.794  30.307  1.00 16.77 ? 499  GLY A N     1 
ATOM   3852  C CA    . GLY A 1 499 ? -7.843  21.755  30.927  1.00 16.43 ? 499  GLY A CA    1 
ATOM   3853  C C     . GLY A 1 499 ? -9.161  21.912  30.174  1.00 16.84 ? 499  GLY A C     1 
ATOM   3854  O O     . GLY A 1 499 ? -10.094 22.578  30.643  1.00 16.82 ? 499  GLY A O     1 
ATOM   3855  N N     . ASP A 1 500 ? -9.236  21.305  28.987  1.00 16.76 ? 500  ASP A N     1 
ATOM   3856  C CA    . ASP A 1 500 ? -10.426 21.381  28.148  1.00 15.76 ? 500  ASP A CA    1 
ATOM   3857  C C     . ASP A 1 500 ? -11.372 20.195  28.331  1.00 15.50 ? 500  ASP A C     1 
ATOM   3858  O O     . ASP A 1 500 ? -10.967 19.104  28.740  1.00 14.97 ? 500  ASP A O     1 
ATOM   3859  C CB    . ASP A 1 500 ? -9.991  21.469  26.696  1.00 15.61 ? 500  ASP A CB    1 
ATOM   3860  C CG    . ASP A 1 500 ? -9.618  22.878  26.276  1.00 15.15 ? 500  ASP A CG    1 
ATOM   3861  O OD1   . ASP A 1 500 ? -10.442 23.820  26.429  1.00 11.91 ? 500  ASP A OD1   1 
ATOM   3862  O OD2   . ASP A 1 500 ? -8.501  23.028  25.739  1.00 14.57 ? 500  ASP A OD2   1 
ATOM   3863  N N     . GLY A 1 501 ? -12.643 20.427  28.038  1.00 15.70 ? 501  GLY A N     1 
ATOM   3864  C CA    . GLY A 1 501 ? -13.627 19.352  27.965  1.00 15.92 ? 501  GLY A CA    1 
ATOM   3865  C C     . GLY A 1 501 ? -13.895 19.099  26.491  1.00 16.19 ? 501  GLY A C     1 
ATOM   3866  O O     . GLY A 1 501 ? -13.782 20.014  25.662  1.00 16.72 ? 501  GLY A O     1 
ATOM   3867  N N     . ALA A 1 502 ? -14.259 17.872  26.144  1.00 15.77 ? 502  ALA A N     1 
ATOM   3868  C CA    . ALA A 1 502 ? -14.573 17.570  24.742  1.00 15.10 ? 502  ALA A CA    1 
ATOM   3869  C C     . ALA A 1 502 ? -15.639 16.503  24.585  1.00 14.70 ? 502  ALA A C     1 
ATOM   3870  O O     . ALA A 1 502 ? -15.825 15.662  25.468  1.00 14.68 ? 502  ALA A O     1 
ATOM   3871  C CB    . ALA A 1 502 ? -13.312 17.188  23.974  1.00 14.09 ? 502  ALA A CB    1 
ATOM   3872  N N     . ARG A 1 503 ? -16.321 16.548  23.447  1.00 14.71 ? 503  ARG A N     1 
ATOM   3873  C CA    . ARG A 1 503 ? -17.235 15.486  23.026  1.00 15.08 ? 503  ARG A CA    1 
ATOM   3874  C C     . ARG A 1 503 ? -16.610 14.745  21.845  1.00 14.92 ? 503  ARG A C     1 
ATOM   3875  O O     . ARG A 1 503 ? -16.091 15.382  20.915  1.00 15.37 ? 503  ARG A O     1 
ATOM   3876  C CB    . ARG A 1 503 ? -18.610 16.077  22.645  1.00 14.79 ? 503  ARG A CB    1 
ATOM   3877  C CG    . ARG A 1 503 ? -19.772 15.058  22.556  1.00 15.63 ? 503  ARG A CG    1 
ATOM   3878  C CD    . ARG A 1 503 ? -21.153 15.691  22.214  1.00 15.73 ? 503  ARG A CD    1 
ATOM   3879  N NE    . ARG A 1 503 ? -21.207 16.410  20.919  1.00 18.43 ? 503  ARG A NE    1 
ATOM   3880  C CZ    . ARG A 1 503 ? -21.197 15.842  19.703  1.00 17.27 ? 503  ARG A CZ    1 
ATOM   3881  N NH1   . ARG A 1 503 ? -21.103 14.530  19.553  1.00 19.93 ? 503  ARG A NH1   1 
ATOM   3882  N NH2   . ARG A 1 503 ? -21.278 16.593  18.621  1.00 17.59 ? 503  ARG A NH2   1 
ATOM   3883  N N     . ARG A 1 504 ? -16.634 13.411  21.885  1.00 14.64 ? 504  ARG A N     1 
ATOM   3884  C CA    . ARG A 1 504 ? -16.325 12.591  20.700  1.00 14.23 ? 504  ARG A CA    1 
ATOM   3885  C C     . ARG A 1 504 ? -17.576 11.912  20.152  1.00 14.31 ? 504  ARG A C     1 
ATOM   3886  O O     . ARG A 1 504 ? -18.323 11.261  20.909  1.00 14.01 ? 504  ARG A O     1 
ATOM   3887  C CB    . ARG A 1 504 ? -15.259 11.549  21.004  1.00 14.26 ? 504  ARG A CB    1 
ATOM   3888  C CG    . ARG A 1 504 ? -14.571 10.963  19.742  1.00 15.29 ? 504  ARG A CG    1 
ATOM   3889  C CD    . ARG A 1 504 ? -13.487 9.894   20.080  1.00 14.41 ? 504  ARG A CD    1 
ATOM   3890  N NE    . ARG A 1 504 ? -14.016 8.928   21.047  1.00 15.40 ? 504  ARG A NE    1 
ATOM   3891  C CZ    . ARG A 1 504 ? -13.478 8.644   22.226  1.00 15.46 ? 504  ARG A CZ    1 
ATOM   3892  N NH1   . ARG A 1 504 ? -12.326 9.184   22.613  1.00 15.38 ? 504  ARG A NH1   1 
ATOM   3893  N NH2   . ARG A 1 504 ? -14.091 7.773   23.003  1.00 16.51 ? 504  ARG A NH2   1 
ATOM   3894  N N     . ASP A 1 505 ? -17.802 12.053  18.844  1.00 13.89 ? 505  ASP A N     1 
ATOM   3895  C CA    . ASP A 1 505 ? -18.980 11.448  18.204  1.00 13.65 ? 505  ASP A CA    1 
ATOM   3896  C C     . ASP A 1 505 ? -18.669 10.047  17.620  1.00 13.64 ? 505  ASP A C     1 
ATOM   3897  O O     . ASP A 1 505 ? -17.577 9.526   17.780  1.00 13.86 ? 505  ASP A O     1 
ATOM   3898  C CB    . ASP A 1 505 ? -19.604 12.421  17.178  1.00 13.00 ? 505  ASP A CB    1 
ATOM   3899  C CG    . ASP A 1 505 ? -18.711 12.660  15.966  1.00 13.35 ? 505  ASP A CG    1 
ATOM   3900  O OD1   . ASP A 1 505 ? -17.785 11.857  15.711  1.00 14.59 ? 505  ASP A OD1   1 
ATOM   3901  O OD2   . ASP A 1 505 ? -18.933 13.642  15.241  1.00 11.73 ? 505  ASP A OD2   1 
ATOM   3902  N N     . GLU A 1 506 ? -19.614 9.448   16.912  1.00 14.53 ? 506  GLU A N     1 
ATOM   3903  C CA    . GLU A 1 506 ? -19.458 8.051   16.457  1.00 14.84 ? 506  GLU A CA    1 
ATOM   3904  C C     . GLU A 1 506 ? -18.351 7.847   15.414  1.00 14.86 ? 506  GLU A C     1 
ATOM   3905  O O     . GLU A 1 506 ? -17.739 6.753   15.333  1.00 13.95 ? 506  GLU A O     1 
ATOM   3906  C CB    . GLU A 1 506 ? -20.798 7.491   15.962  1.00 15.02 ? 506  GLU A CB    1 
ATOM   3907  C CG    . GLU A 1 506 ? -21.938 7.498   17.016  1.00 17.56 ? 506  GLU A CG    1 
ATOM   3908  C CD    . GLU A 1 506 ? -22.706 8.867   17.133  1.00 22.23 ? 506  GLU A CD    1 
ATOM   3909  O OE1   . GLU A 1 506 ? -23.729 8.906   17.860  1.00 23.23 ? 506  GLU A OE1   1 
ATOM   3910  O OE2   . GLU A 1 506 ? -22.301 9.892   16.510  1.00 22.73 ? 506  GLU A OE2   1 
ATOM   3911  N N     . ASP A 1 507 ? -18.080 8.908   14.633  1.00 15.15 ? 507  ASP A N     1 
ATOM   3912  C CA    . ASP A 1 507 ? -16.970 8.908   13.668  1.00 14.51 ? 507  ASP A CA    1 
ATOM   3913  C C     . ASP A 1 507 ? -15.630 9.145   14.356  1.00 14.49 ? 507  ASP A C     1 
ATOM   3914  O O     . ASP A 1 507 ? -14.581 9.029   13.721  1.00 14.73 ? 507  ASP A O     1 
ATOM   3915  C CB    . ASP A 1 507 ? -17.182 9.926   12.554  1.00 14.15 ? 507  ASP A CB    1 
ATOM   3916  C CG    . ASP A 1 507 ? -18.370 9.587   11.659  1.00 16.96 ? 507  ASP A CG    1 
ATOM   3917  O OD1   . ASP A 1 507 ? -18.433 8.445   11.114  1.00 19.85 ? 507  ASP A OD1   1 
ATOM   3918  O OD2   . ASP A 1 507 ? -19.259 10.465  11.502  1.00 17.97 ? 507  ASP A OD2   1 
ATOM   3919  N N     . GLY A 1 508 ? -15.641 9.458   15.652  1.00 13.78 ? 508  GLY A N     1 
ATOM   3920  C CA    . GLY A 1 508 ? -14.381 9.727   16.344  1.00 13.53 ? 508  GLY A CA    1 
ATOM   3921  C C     . GLY A 1 508 ? -13.916 11.170  16.137  1.00 13.66 ? 508  GLY A C     1 
ATOM   3922  O O     . GLY A 1 508 ? -12.745 11.486  16.343  1.00 13.36 ? 508  GLY A O     1 
ATOM   3923  N N     . TYR A 1 509 ? -14.843 12.037  15.733  1.00 13.51 ? 509  TYR A N     1 
ATOM   3924  C CA    . TYR A 1 509 ? -14.591 13.466  15.667  1.00 14.79 ? 509  TYR A CA    1 
ATOM   3925  C C     . TYR A 1 509 ? -14.717 14.132  17.039  1.00 14.81 ? 509  TYR A C     1 
ATOM   3926  O O     . TYR A 1 509 ? -15.702 13.927  17.754  1.00 15.28 ? 509  TYR A O     1 
ATOM   3927  C CB    . TYR A 1 509 ? -15.568 14.134  14.701  1.00 14.71 ? 509  TYR A CB    1 
ATOM   3928  C CG    . TYR A 1 509 ? -15.265 13.966  13.238  1.00 15.52 ? 509  TYR A CG    1 
ATOM   3929  C CD1   . TYR A 1 509 ? -14.774 12.759  12.716  1.00 17.35 ? 509  TYR A CD1   1 
ATOM   3930  C CD2   . TYR A 1 509 ? -15.536 15.000  12.356  1.00 15.42 ? 509  TYR A CD2   1 
ATOM   3931  C CE1   . TYR A 1 509 ? -14.537 12.621  11.333  1.00 17.28 ? 509  TYR A CE1   1 
ATOM   3932  C CE2   . TYR A 1 509 ? -15.306 14.875  11.005  1.00 14.26 ? 509  TYR A CE2   1 
ATOM   3933  C CZ    . TYR A 1 509 ? -14.801 13.705  10.493  1.00 14.90 ? 509  TYR A CZ    1 
ATOM   3934  O OH    . TYR A 1 509 ? -14.601 13.643  9.134   1.00 14.79 ? 509  TYR A OH    1 
ATOM   3935  N N     . TYR A 1 510 ? -13.727 14.944  17.390  1.00 14.86 ? 510  TYR A N     1 
ATOM   3936  C CA    . TYR A 1 510 ? -13.770 15.704  18.630  1.00 14.75 ? 510  TYR A CA    1 
ATOM   3937  C C     . TYR A 1 510 ? -14.490 17.033  18.436  1.00 15.12 ? 510  TYR A C     1 
ATOM   3938  O O     . TYR A 1 510 ? -14.445 17.657  17.363  1.00 14.99 ? 510  TYR A O     1 
ATOM   3939  C CB    . TYR A 1 510 ? -12.371 15.897  19.197  1.00 14.76 ? 510  TYR A CB    1 
ATOM   3940  C CG    . TYR A 1 510 ? -11.767 14.588  19.630  1.00 14.77 ? 510  TYR A CG    1 
ATOM   3941  C CD1   . TYR A 1 510 ? -11.149 13.736  18.699  1.00 13.77 ? 510  TYR A CD1   1 
ATOM   3942  C CD2   . TYR A 1 510 ? -11.859 14.170  20.957  1.00 13.56 ? 510  TYR A CD2   1 
ATOM   3943  C CE1   . TYR A 1 510 ? -10.638 12.497  19.079  1.00 13.65 ? 510  TYR A CE1   1 
ATOM   3944  C CE2   . TYR A 1 510 ? -11.352 12.943  21.353  1.00 14.71 ? 510  TYR A CE2   1 
ATOM   3945  C CZ    . TYR A 1 510 ? -10.735 12.104  20.411  1.00 15.52 ? 510  TYR A CZ    1 
ATOM   3946  O OH    . TYR A 1 510 ? -10.213 10.883  20.817  1.00 15.53 ? 510  TYR A OH    1 
ATOM   3947  N N     . TRP A 1 511 ? -15.202 17.419  19.483  1.00 14.83 ? 511  TRP A N     1 
ATOM   3948  C CA    . TRP A 1 511 ? -15.903 18.666  19.552  1.00 14.53 ? 511  TRP A CA    1 
ATOM   3949  C C     . TRP A 1 511 ? -15.441 19.226  20.881  1.00 15.35 ? 511  TRP A C     1 
ATOM   3950  O O     . TRP A 1 511 ? -15.823 18.719  21.931  1.00 15.70 ? 511  TRP A O     1 
ATOM   3951  C CB    . TRP A 1 511 ? -17.418 18.428  19.548  1.00 13.19 ? 511  TRP A CB    1 
ATOM   3952  C CG    . TRP A 1 511 ? -17.940 17.745  18.298  1.00 12.72 ? 511  TRP A CG    1 
ATOM   3953  C CD1   . TRP A 1 511 ? -17.833 16.409  17.978  1.00 12.76 ? 511  TRP A CD1   1 
ATOM   3954  C CD2   . TRP A 1 511 ? -18.663 18.352  17.213  1.00 11.81 ? 511  TRP A CD2   1 
ATOM   3955  N NE1   . TRP A 1 511 ? -18.445 16.150  16.769  1.00 10.43 ? 511  TRP A NE1   1 
ATOM   3956  C CE2   . TRP A 1 511 ? -18.958 17.319  16.272  1.00 10.84 ? 511  TRP A CE2   1 
ATOM   3957  C CE3   . TRP A 1 511 ? -19.072 19.668  16.925  1.00 12.22 ? 511  TRP A CE3   1 
ATOM   3958  C CZ2   . TRP A 1 511 ? -19.646 17.561  15.060  1.00 10.57 ? 511  TRP A CZ2   1 
ATOM   3959  C CZ3   . TRP A 1 511 ? -19.779 19.906  15.697  1.00 12.46 ? 511  TRP A CZ3   1 
ATOM   3960  C CH2   . TRP A 1 511 ? -20.057 18.843  14.799  1.00 11.29 ? 511  TRP A CH2   1 
ATOM   3961  N N     . ILE A 1 512 ? -14.579 20.239  20.832  1.00 16.37 ? 512  ILE A N     1 
ATOM   3962  C CA    . ILE A 1 512 ? -14.035 20.854  22.030  1.00 17.19 ? 512  ILE A CA    1 
ATOM   3963  C C     . ILE A 1 512 ? -15.079 21.796  22.581  1.00 18.52 ? 512  ILE A C     1 
ATOM   3964  O O     . ILE A 1 512 ? -15.499 22.730  21.892  1.00 19.40 ? 512  ILE A O     1 
ATOM   3965  C CB    . ILE A 1 512 ? -12.752 21.669  21.742  1.00 17.22 ? 512  ILE A CB    1 
ATOM   3966  C CG1   . ILE A 1 512 ? -11.507 20.767  21.713  1.00 15.66 ? 512  ILE A CG1   1 
ATOM   3967  C CG2   . ILE A 1 512 ? -12.542 22.716  22.853  1.00 17.10 ? 512  ILE A CG2   1 
ATOM   3968  C CD1   . ILE A 1 512 ? -11.327 19.964  20.464  1.00 14.48 ? 512  ILE A CD1   1 
ATOM   3969  N N     . THR A 1 513 ? -15.489 21.568  23.818  1.00 19.28 ? 513  THR A N     1 
ATOM   3970  C CA    . THR A 1 513 ? -16.533 22.384  24.413  1.00 20.53 ? 513  THR A CA    1 
ATOM   3971  C C     . THR A 1 513 ? -16.056 23.496  25.357  1.00 20.90 ? 513  THR A C     1 
ATOM   3972  O O     . THR A 1 513 ? -16.892 24.179  25.960  1.00 22.13 ? 513  THR A O     1 
ATOM   3973  C CB    . THR A 1 513 ? -17.517 21.513  25.166  1.00 20.74 ? 513  THR A CB    1 
ATOM   3974  O OG1   . THR A 1 513 ? -16.779 20.472  25.820  1.00 22.30 ? 513  THR A OG1   1 
ATOM   3975  C CG2   . THR A 1 513 ? -18.522 20.899  24.176  1.00 21.89 ? 513  THR A CG2   1 
ATOM   3976  N N     . GLY A 1 514 ? -14.745 23.712  25.481  1.00 20.30 ? 514  GLY A N     1 
ATOM   3977  C CA    . GLY A 1 514 ? -14.262 24.766  26.357  1.00 18.94 ? 514  GLY A CA    1 
ATOM   3978  C C     . GLY A 1 514 ? -13.545 24.252  27.573  1.00 18.42 ? 514  GLY A C     1 
ATOM   3979  O O     . GLY A 1 514 ? -13.451 23.051  27.795  1.00 18.43 ? 514  GLY A O     1 
ATOM   3980  N N     . ARG A 1 515 ? -12.997 25.175  28.343  1.00 18.33 ? 515  ARG A N     1 
ATOM   3981  C CA    . ARG A 1 515 ? -12.206 24.823  29.518  1.00 18.68 ? 515  ARG A CA    1 
ATOM   3982  C C     . ARG A 1 515 ? -13.057 24.282  30.674  1.00 18.86 ? 515  ARG A C     1 
ATOM   3983  O O     . ARG A 1 515 ? -14.112 24.812  30.974  1.00 18.79 ? 515  ARG A O     1 
ATOM   3984  C CB    . ARG A 1 515 ? -11.393 26.025  29.994  1.00 18.11 ? 515  ARG A CB    1 
ATOM   3985  C CG    . ARG A 1 515 ? -10.549 26.713  28.916  1.00 17.87 ? 515  ARG A CG    1 
ATOM   3986  C CD    . ARG A 1 515 ? -9.213  26.033  28.626  1.00 14.94 ? 515  ARG A CD    1 
ATOM   3987  N NE    . ARG A 1 515 ? -8.463  25.744  29.835  1.00 14.51 ? 515  ARG A NE    1 
ATOM   3988  C CZ    . ARG A 1 515 ? -7.139  25.605  29.896  1.00 14.65 ? 515  ARG A CZ    1 
ATOM   3989  N NH1   . ARG A 1 515 ? -6.403  25.734  28.802  1.00 13.85 ? 515  ARG A NH1   1 
ATOM   3990  N NH2   . ARG A 1 515 ? -6.557  25.323  31.056  1.00 11.13 ? 515  ARG A NH2   1 
ATOM   3991  N N     . VAL A 1 516 ? -12.577 23.231  31.321  1.00 19.35 ? 516  VAL A N     1 
ATOM   3992  C CA    . VAL A 1 516 ? -13.258 22.652  32.467  1.00 19.20 ? 516  VAL A CA    1 
ATOM   3993  C C     . VAL A 1 516 ? -12.607 23.139  33.748  1.00 20.12 ? 516  VAL A C     1 
ATOM   3994  O O     . VAL A 1 516 ? -13.102 22.870  34.845  1.00 20.60 ? 516  VAL A O     1 
ATOM   3995  C CB    . VAL A 1 516 ? -13.297 21.091  32.423  1.00 19.22 ? 516  VAL A CB    1 
ATOM   3996  C CG1   . VAL A 1 516 ? -14.196 20.616  31.289  1.00 17.82 ? 516  VAL A CG1   1 
ATOM   3997  C CG2   . VAL A 1 516 ? -11.903 20.495  32.274  1.00 17.76 ? 516  VAL A CG2   1 
ATOM   3998  N N     . ASP A 1 517 ? -11.498 23.856  33.634  1.00 20.38 ? 517  ASP A N     1 
ATOM   3999  C CA    . ASP A 1 517 ? -10.949 24.477  34.834  1.00 20.75 ? 517  ASP A CA    1 
ATOM   4000  C C     . ASP A 1 517 ? -11.358 25.967  34.919  1.00 21.12 ? 517  ASP A C     1 
ATOM   4001  O O     . ASP A 1 517 ? -12.156 26.455  34.112  1.00 20.71 ? 517  ASP A O     1 
ATOM   4002  C CB    . ASP A 1 517 ? -9.427  24.259  34.932  1.00 20.63 ? 517  ASP A CB    1 
ATOM   4003  C CG    . ASP A 1 517 ? -8.665  24.791  33.718  1.00 20.19 ? 517  ASP A CG    1 
ATOM   4004  O OD1   . ASP A 1 517 ? -7.426  24.555  33.626  1.00 18.22 ? 517  ASP A OD1   1 
ATOM   4005  O OD2   . ASP A 1 517 ? -9.309  25.440  32.862  1.00 18.64 ? 517  ASP A OD2   1 
ATOM   4006  N N     . ASP A 1 518 ? -10.805 26.698  35.880  1.00 21.14 ? 518  ASP A N     1 
ATOM   4007  C CA    . ASP A 1 518 ? -11.251 28.059  36.112  1.00 20.94 ? 518  ASP A CA    1 
ATOM   4008  C C     . ASP A 1 518 ? -10.529 29.028  35.189  1.00 20.65 ? 518  ASP A C     1 
ATOM   4009  O O     . ASP A 1 518 ? -9.933  30.015  35.617  1.00 21.28 ? 518  ASP A O     1 
ATOM   4010  C CB    . ASP A 1 518 ? -11.111 28.402  37.591  1.00 21.58 ? 518  ASP A CB    1 
ATOM   4011  C CG    . ASP A 1 518 ? -11.781 27.364  38.487  1.00 21.92 ? 518  ASP A CG    1 
ATOM   4012  O OD1   . ASP A 1 518 ? -12.877 27.643  39.003  1.00 23.24 ? 518  ASP A OD1   1 
ATOM   4013  O OD2   . ASP A 1 518 ? -11.230 26.248  38.646  1.00 23.97 ? 518  ASP A OD2   1 
ATOM   4014  N N     . VAL A 1 519 ? -10.597 28.722  33.898  1.00 20.14 ? 519  VAL A N     1 
ATOM   4015  C CA    . VAL A 1 519 ? -9.969  29.525  32.867  1.00 19.19 ? 519  VAL A CA    1 
ATOM   4016  C C     . VAL A 1 519 ? -11.032 30.016  31.906  1.00 19.40 ? 519  VAL A C     1 
ATOM   4017  O O     . VAL A 1 519 ? -11.860 29.243  31.443  1.00 19.84 ? 519  VAL A O     1 
ATOM   4018  C CB    . VAL A 1 519 ? -8.868  28.721  32.117  1.00 19.09 ? 519  VAL A CB    1 
ATOM   4019  C CG1   . VAL A 1 519 ? -8.507  29.382  30.773  1.00 19.59 ? 519  VAL A CG1   1 
ATOM   4020  C CG2   . VAL A 1 519 ? -7.622  28.559  32.985  1.00 16.62 ? 519  VAL A CG2   1 
ATOM   4021  N N     . LEU A 1 520 ? -10.999 31.301  31.592  1.00 19.71 ? 520  LEU A N     1 
ATOM   4022  C CA    . LEU A 1 520 ? -11.930 31.891  30.634  1.00 20.41 ? 520  LEU A CA    1 
ATOM   4023  C C     . LEU A 1 520 ? -11.355 32.051  29.243  1.00 20.76 ? 520  LEU A C     1 
ATOM   4024  O O     . LEU A 1 520 ? -10.146 32.125  29.065  1.00 21.15 ? 520  LEU A O     1 
ATOM   4025  C CB    . LEU A 1 520 ? -12.359 33.273  31.107  1.00 20.81 ? 520  LEU A CB    1 
ATOM   4026  C CG    . LEU A 1 520 ? -13.054 33.337  32.454  1.00 20.16 ? 520  LEU A CG    1 
ATOM   4027  C CD1   . LEU A 1 520 ? -13.585 34.736  32.617  1.00 20.59 ? 520  LEU A CD1   1 
ATOM   4028  C CD2   . LEU A 1 520 ? -14.162 32.293  32.478  1.00 19.25 ? 520  LEU A CD2   1 
ATOM   4029  N N     . ASN A 1 521 ? -12.240 32.130  28.259  1.00 20.92 ? 521  ASN A N     1 
ATOM   4030  C CA    . ASN A 1 521 ? -11.825 32.398  26.911  1.00 21.07 ? 521  ASN A CA    1 
ATOM   4031  C C     . ASN A 1 521 ? -12.545 33.636  26.428  1.00 20.70 ? 521  ASN A C     1 
ATOM   4032  O O     . ASN A 1 521 ? -13.712 33.572  26.009  1.00 20.21 ? 521  ASN A O     1 
ATOM   4033  C CB    . ASN A 1 521 ? -12.117 31.204  26.011  1.00 22.05 ? 521  ASN A CB    1 
ATOM   4034  C CG    . ASN A 1 521 ? -10.874 30.727  25.257  1.00 24.12 ? 521  ASN A CG    1 
ATOM   4035  O OD1   . ASN A 1 521 ? -10.272 31.481  24.484  1.00 27.40 ? 521  ASN A OD1   1 
ATOM   4036  N ND2   . ASN A 1 521 ? -10.485 29.462  25.486  1.00 24.81 ? 521  ASN A ND2   1 
ATOM   4037  N N     . VAL A 1 522 ? -11.853 34.766  26.519  1.00 19.73 ? 522  VAL A N     1 
ATOM   4038  C CA    . VAL A 1 522 ? -12.445 36.062  26.189  1.00 19.35 ? 522  VAL A CA    1 
ATOM   4039  C C     . VAL A 1 522 ? -11.850 36.628  24.899  1.00 18.80 ? 522  VAL A C     1 
ATOM   4040  O O     . VAL A 1 522 ? -10.646 36.918  24.832  1.00 18.00 ? 522  VAL A O     1 
ATOM   4041  C CB    . VAL A 1 522 ? -12.318 37.072  27.369  1.00 19.95 ? 522  VAL A CB    1 
ATOM   4042  C CG1   . VAL A 1 522 ? -12.957 38.444  27.003  1.00 19.53 ? 522  VAL A CG1   1 
ATOM   4043  C CG2   . VAL A 1 522 ? -12.950 36.469  28.634  1.00 18.35 ? 522  VAL A CG2   1 
ATOM   4044  N N     . SER A 1 523 ? -12.703 36.768  23.881  1.00 18.12 ? 523  SER A N     1 
ATOM   4045  C CA    . SER A 1 523 ? -12.272 37.150  22.518  1.00 17.95 ? 523  SER A CA    1 
ATOM   4046  C C     . SER A 1 523 ? -11.189 36.229  21.977  1.00 17.53 ? 523  SER A C     1 
ATOM   4047  O O     . SER A 1 523 ? -10.326 36.665  21.235  1.00 17.76 ? 523  SER A O     1 
ATOM   4048  C CB    . SER A 1 523 ? -11.755 38.594  22.491  1.00 17.63 ? 523  SER A CB    1 
ATOM   4049  O OG    . SER A 1 523 ? -12.705 39.472  23.044  1.00 18.81 ? 523  SER A OG    1 
ATOM   4050  N N     . GLY A 1 524 ? -11.202 34.969  22.390  1.00 17.37 ? 524  GLY A N     1 
ATOM   4051  C CA    . GLY A 1 524 ? -10.121 34.048  22.044  1.00 17.52 ? 524  GLY A CA    1 
ATOM   4052  C C     . GLY A 1 524 ? -8.818  34.281  22.791  1.00 17.67 ? 524  GLY A C     1 
ATOM   4053  O O     . GLY A 1 524 ? -7.772  33.832  22.343  1.00 18.62 ? 524  GLY A O     1 
ATOM   4054  N N     . HIS A 1 525 ? -8.871  35.015  23.898  1.00 17.57 ? 525  HIS A N     1 
ATOM   4055  C CA    . HIS A 1 525 ? -7.748  35.126  24.811  1.00 17.85 ? 525  HIS A CA    1 
ATOM   4056  C C     . HIS A 1 525 ? -8.032  34.266  26.036  1.00 17.48 ? 525  HIS A C     1 
ATOM   4057  O O     . HIS A 1 525 ? -9.103  34.342  26.608  1.00 17.30 ? 525  HIS A O     1 
ATOM   4058  C CB    . HIS A 1 525 ? -7.502  36.574  25.269  1.00 17.93 ? 525  HIS A CB    1 
ATOM   4059  C CG    . HIS A 1 525 ? -7.207  37.524  24.154  1.00 20.80 ? 525  HIS A CG    1 
ATOM   4060  N ND1   . HIS A 1 525 ? -7.989  38.633  23.891  1.00 24.24 ? 525  HIS A ND1   1 
ATOM   4061  C CD2   . HIS A 1 525 ? -6.233  37.520  23.213  1.00 22.35 ? 525  HIS A CD2   1 
ATOM   4062  C CE1   . HIS A 1 525 ? -7.506  39.270  22.839  1.00 23.25 ? 525  HIS A CE1   1 
ATOM   4063  N NE2   . HIS A 1 525 ? -6.449  38.610  22.401  1.00 23.37 ? 525  HIS A NE2   1 
ATOM   4064  N N     . ARG A 1 526 ? -7.038  33.484  26.440  1.00 17.34 ? 526  ARG A N     1 
ATOM   4065  C CA    . ARG A 1 526 ? -7.118  32.612  27.578  1.00 17.33 ? 526  ARG A CA    1 
ATOM   4066  C C     . ARG A 1 526 ? -6.792  33.452  28.820  1.00 17.65 ? 526  ARG A C     1 
ATOM   4067  O O     . ARG A 1 526 ? -5.753  34.094  28.869  1.00 17.79 ? 526  ARG A O     1 
ATOM   4068  C CB    . ARG A 1 526 ? -6.085  31.500  27.349  1.00 17.62 ? 526  ARG A CB    1 
ATOM   4069  C CG    . ARG A 1 526 ? -5.806  30.540  28.498  1.00 17.12 ? 526  ARG A CG    1 
ATOM   4070  C CD    . ARG A 1 526 ? -4.671  29.629  28.089  1.00 15.57 ? 526  ARG A CD    1 
ATOM   4071  N NE    . ARG A 1 526 ? -4.194  28.760  29.160  1.00 12.35 ? 526  ARG A NE    1 
ATOM   4072  C CZ    . ARG A 1 526 ? -3.481  27.658  28.944  1.00 11.78 ? 526  ARG A CZ    1 
ATOM   4073  N NH1   . ARG A 1 526 ? -3.182  27.294  27.702  1.00 7.67  ? 526  ARG A NH1   1 
ATOM   4074  N NH2   . ARG A 1 526 ? -3.079  26.906  29.965  1.00 13.22 ? 526  ARG A NH2   1 
ATOM   4075  N N     . LEU A 1 527 ? -7.668  33.430  29.826  1.00 17.73 ? 527  LEU A N     1 
ATOM   4076  C CA    . LEU A 1 527 ? -7.488  34.223  31.069  1.00 17.89 ? 527  LEU A CA    1 
ATOM   4077  C C     . LEU A 1 527 ? -7.874  33.484  32.339  1.00 17.38 ? 527  LEU A C     1 
ATOM   4078  O O     . LEU A 1 527 ? -8.908  32.839  32.374  1.00 18.06 ? 527  LEU A O     1 
ATOM   4079  C CB    . LEU A 1 527 ? -8.333  35.487  31.010  1.00 18.23 ? 527  LEU A CB    1 
ATOM   4080  C CG    . LEU A 1 527 ? -7.695  36.614  30.219  1.00 19.51 ? 527  LEU A CG    1 
ATOM   4081  C CD1   . LEU A 1 527 ? -8.751  37.685  30.056  1.00 22.17 ? 527  LEU A CD1   1 
ATOM   4082  C CD2   . LEU A 1 527 ? -6.455  37.167  30.963  1.00 19.12 ? 527  LEU A CD2   1 
ATOM   4083  N N     . GLY A 1 528 ? -7.078  33.593  33.397  1.00 16.70 ? 528  GLY A N     1 
ATOM   4084  C CA    . GLY A 1 528 ? -7.404  32.873  34.620  1.00 15.30 ? 528  GLY A CA    1 
ATOM   4085  C C     . GLY A 1 528 ? -8.399  33.671  35.418  1.00 14.83 ? 528  GLY A C     1 
ATOM   4086  O O     . GLY A 1 528 ? -8.202  34.858  35.635  1.00 14.57 ? 528  GLY A O     1 
ATOM   4087  N N     . THR A 1 529 ? -9.476  33.048  35.876  1.00 15.02 ? 529  THR A N     1 
ATOM   4088  C CA    . THR A 1 529 ? -10.398 33.789  36.767  1.00 14.54 ? 529  THR A CA    1 
ATOM   4089  C C     . THR A 1 529 ? -9.681  34.239  38.028  1.00 14.84 ? 529  THR A C     1 
ATOM   4090  O O     . THR A 1 529 ? -9.921  35.340  38.506  1.00 15.39 ? 529  THR A O     1 
ATOM   4091  C CB    . THR A 1 529 ? -11.667 33.011  37.179  1.00 14.27 ? 529  THR A CB    1 
ATOM   4092  O OG1   . THR A 1 529 ? -11.301 31.769  37.811  1.00 15.05 ? 529  THR A OG1   1 
ATOM   4093  C CG2   . THR A 1 529 ? -12.583 32.786  35.989  1.00 12.55 ? 529  THR A CG2   1 
ATOM   4094  N N     . ALA A 1 530 ? -8.792  33.404  38.557  1.00 15.10 ? 530  ALA A N     1 
ATOM   4095  C CA    . ALA A 1 530 ? -8.135  33.738  39.809  1.00 15.50 ? 530  ALA A CA    1 
ATOM   4096  C C     . ALA A 1 530 ? -7.282  35.004  39.699  1.00 15.94 ? 530  ALA A C     1 
ATOM   4097  O O     . ALA A 1 530 ? -7.198  35.788  40.657  1.00 16.20 ? 530  ALA A O     1 
ATOM   4098  C CB    . ALA A 1 530 ? -7.333  32.549  40.372  1.00 14.70 ? 530  ALA A CB    1 
ATOM   4099  N N     . GLU A 1 531 ? -6.696  35.235  38.528  1.00 16.41 ? 531  GLU A N     1 
ATOM   4100  C CA    . GLU A 1 531 ? -5.811  36.390  38.352  1.00 17.15 ? 531  GLU A CA    1 
ATOM   4101  C C     . GLU A 1 531 ? -6.595  37.696  38.224  1.00 17.16 ? 531  GLU A C     1 
ATOM   4102  O O     . GLU A 1 531 ? -6.096  38.770  38.565  1.00 17.19 ? 531  GLU A O     1 
ATOM   4103  C CB    . GLU A 1 531 ? -4.846  36.179  37.193  1.00 16.38 ? 531  GLU A CB    1 
ATOM   4104  C CG    . GLU A 1 531 ? -5.401  36.457  35.792  1.00 18.17 ? 531  GLU A CG    1 
ATOM   4105  C CD    . GLU A 1 531 ? -4.314  36.334  34.712  1.00 19.04 ? 531  GLU A CD    1 
ATOM   4106  O OE1   . GLU A 1 531 ? -3.418  37.233  34.664  1.00 19.99 ? 531  GLU A OE1   1 
ATOM   4107  O OE2   . GLU A 1 531 ? -4.346  35.326  33.945  1.00 18.91 ? 531  GLU A OE2   1 
ATOM   4108  N N     . ILE A 1 532 ? -7.835  37.590  37.756  1.00 17.48 ? 532  ILE A N     1 
ATOM   4109  C CA    . ILE A 1 532 ? -8.705  38.759  37.671  1.00 17.61 ? 532  ILE A CA    1 
ATOM   4110  C C     . ILE A 1 532 ? -9.220  39.143  39.061  1.00 18.27 ? 532  ILE A C     1 
ATOM   4111  O O     . ILE A 1 532 ? -9.311  40.325  39.374  1.00 18.49 ? 532  ILE A O     1 
ATOM   4112  C CB    . ILE A 1 532 ? -9.888  38.543  36.710  1.00 17.00 ? 532  ILE A CB    1 
ATOM   4113  C CG1   . ILE A 1 532 ? -9.409  38.281  35.295  1.00 14.60 ? 532  ILE A CG1   1 
ATOM   4114  C CG2   . ILE A 1 532 ? -10.812 39.766  36.700  1.00 18.02 ? 532  ILE A CG2   1 
ATOM   4115  C CD1   . ILE A 1 532 ? -10.543 37.953  34.362  1.00 13.69 ? 532  ILE A CD1   1 
ATOM   4116  N N     . GLU A 1 533 ? -9.571  38.134  39.867  1.00 18.85 ? 533  GLU A N     1 
ATOM   4117  C CA    . GLU A 1 533 ? -9.989  38.297  41.267  1.00 18.90 ? 533  GLU A CA    1 
ATOM   4118  C C     . GLU A 1 533 ? -8.923  38.971  42.142  1.00 19.13 ? 533  GLU A C     1 
ATOM   4119  O O     . GLU A 1 533 ? -9.223  39.957  42.825  1.00 19.29 ? 533  GLU A O     1 
ATOM   4120  C CB    . GLU A 1 533 ? -10.364 36.939  41.857  1.00 19.00 ? 533  GLU A CB    1 
ATOM   4121  C CG    . GLU A 1 533 ? -11.600 36.352  41.199  1.00 19.90 ? 533  GLU A CG    1 
ATOM   4122  C CD    . GLU A 1 533 ? -11.876 34.914  41.603  1.00 20.62 ? 533  GLU A CD    1 
ATOM   4123  O OE1   . GLU A 1 533 ? -11.022 34.288  42.257  1.00 22.75 ? 533  GLU A OE1   1 
ATOM   4124  O OE2   . GLU A 1 533 ? -12.960 34.414  41.263  1.00 20.72 ? 533  GLU A OE2   1 
ATOM   4125  N N     . SER A 1 534 ? -7.695  38.443  42.114  1.00 18.58 ? 534  SER A N     1 
ATOM   4126  C CA    . SER A 1 534 ? -6.531  39.130  42.680  1.00 18.65 ? 534  SER A CA    1 
ATOM   4127  C C     . SER A 1 534 ? -6.373  40.591  42.220  1.00 18.25 ? 534  SER A C     1 
ATOM   4128  O O     . SER A 1 534 ? -6.055  41.476  43.032  1.00 17.98 ? 534  SER A O     1 
ATOM   4129  C CB    . SER A 1 534 ? -5.256  38.368  42.341  1.00 18.67 ? 534  SER A CB    1 
ATOM   4130  O OG    . SER A 1 534 ? -5.355  37.059  42.866  1.00 22.05 ? 534  SER A OG    1 
ATOM   4131  N N     . ALA A 1 535 ? -6.569  40.845  40.926  1.00 17.30 ? 535  ALA A N     1 
ATOM   4132  C CA    . ALA A 1 535 ? -6.460  42.210  40.440  1.00 16.97 ? 535  ALA A CA    1 
ATOM   4133  C C     . ALA A 1 535 ? -7.579  43.108  41.054  1.00 16.99 ? 535  ALA A C     1 
ATOM   4134  O O     . ALA A 1 535 ? -7.337  44.290  41.417  1.00 16.19 ? 535  ALA A O     1 
ATOM   4135  C CB    . ALA A 1 535 ? -6.453  42.248  38.924  1.00 15.99 ? 535  ALA A CB    1 
ATOM   4136  N N     . LEU A 1 536 ? -8.778  42.525  41.215  1.00 16.75 ? 536  LEU A N     1 
ATOM   4137  C CA    . LEU A 1 536 ? -9.908  43.216  41.887  1.00 16.79 ? 536  LEU A CA    1 
ATOM   4138  C C     . LEU A 1 536 ? -9.634  43.469  43.373  1.00 17.45 ? 536  LEU A C     1 
ATOM   4139  O O     . LEU A 1 536 ? -9.762  44.606  43.832  1.00 17.73 ? 536  LEU A O     1 
ATOM   4140  C CB    . LEU A 1 536 ? -11.229 42.458  41.705  1.00 16.10 ? 536  LEU A CB    1 
ATOM   4141  C CG    . LEU A 1 536 ? -11.812 42.537  40.279  1.00 14.44 ? 536  LEU A CG    1 
ATOM   4142  C CD1   . LEU A 1 536 ? -12.680 41.351  39.948  1.00 7.71  ? 536  LEU A CD1   1 
ATOM   4143  C CD2   . LEU A 1 536 ? -12.589 43.847  40.056  1.00 14.39 ? 536  LEU A CD2   1 
ATOM   4144  N N     . VAL A 1 537 ? -9.228  42.420  44.096  1.00 17.74 ? 537  VAL A N     1 
ATOM   4145  C CA    . VAL A 1 537 ? -8.955  42.476  45.542  1.00 17.80 ? 537  VAL A CA    1 
ATOM   4146  C C     . VAL A 1 537 ? -7.750  43.381  45.867  1.00 18.38 ? 537  VAL A C     1 
ATOM   4147  O O     . VAL A 1 537 ? -7.643  43.892  46.993  1.00 18.53 ? 537  VAL A O     1 
ATOM   4148  C CB    . VAL A 1 537 ? -8.773  41.026  46.145  1.00 17.95 ? 537  VAL A CB    1 
ATOM   4149  C CG1   . VAL A 1 537 ? -8.243  41.041  47.582  1.00 16.32 ? 537  VAL A CG1   1 
ATOM   4150  C CG2   . VAL A 1 537 ? -10.070 40.230  46.059  1.00 17.20 ? 537  VAL A CG2   1 
ATOM   4151  N N     . ALA A 1 538 ? -6.849  43.602  44.903  1.00 18.63 ? 538  ALA A N     1 
ATOM   4152  C CA    . ALA A 1 538 ? -5.720  44.532  45.153  1.00 18.95 ? 538  ALA A CA    1 
ATOM   4153  C C     . ALA A 1 538 ? -6.213  45.983  45.220  1.00 19.41 ? 538  ALA A C     1 
ATOM   4154  O O     . ALA A 1 538 ? -5.479  46.863  45.659  1.00 19.31 ? 538  ALA A O     1 
ATOM   4155  C CB    . ALA A 1 538 ? -4.608  44.379  44.123  1.00 18.15 ? 538  ALA A CB    1 
ATOM   4156  N N     . HIS A 1 539 ? -7.462  46.212  44.802  1.00 20.03 ? 539  HIS A N     1 
ATOM   4157  C CA    . HIS A 1 539 ? -8.101  47.518  44.933  1.00 21.06 ? 539  HIS A CA    1 
ATOM   4158  C C     . HIS A 1 539 ? -8.408  47.796  46.404  1.00 21.40 ? 539  HIS A C     1 
ATOM   4159  O O     . HIS A 1 539 ? -8.976  46.919  47.094  1.00 21.55 ? 539  HIS A O     1 
ATOM   4160  C CB    . HIS A 1 539 ? -9.369  47.612  44.081  1.00 21.04 ? 539  HIS A CB    1 
ATOM   4161  C CG    . HIS A 1 539 ? -9.879  49.013  43.917  1.00 23.07 ? 539  HIS A CG    1 
ATOM   4162  N ND1   . HIS A 1 539 ? -10.537 49.689  44.925  1.00 23.56 ? 539  HIS A ND1   1 
ATOM   4163  C CD2   . HIS A 1 539 ? -9.794  49.879  42.876  1.00 23.40 ? 539  HIS A CD2   1 
ATOM   4164  C CE1   . HIS A 1 539 ? -10.857 50.900  44.503  1.00 23.41 ? 539  HIS A CE1   1 
ATOM   4165  N NE2   . HIS A 1 539 ? -10.417 51.042  43.263  1.00 23.37 ? 539  HIS A NE2   1 
ATOM   4166  N N     . PRO A 1 540 ? -8.007  48.994  46.901  1.00 21.32 ? 540  PRO A N     1 
ATOM   4167  C CA    . PRO A 1 540 ? -8.078  49.274  48.342  1.00 21.56 ? 540  PRO A CA    1 
ATOM   4168  C C     . PRO A 1 540 ? -9.511  49.286  48.873  1.00 21.53 ? 540  PRO A C     1 
ATOM   4169  O O     . PRO A 1 540 ? -9.728  49.148  50.066  1.00 21.76 ? 540  PRO A O     1 
ATOM   4170  C CB    . PRO A 1 540 ? -7.411  50.655  48.478  1.00 21.56 ? 540  PRO A CB    1 
ATOM   4171  C CG    . PRO A 1 540 ? -7.545  51.291  47.136  1.00 21.61 ? 540  PRO A CG    1 
ATOM   4172  C CD    . PRO A 1 540 ? -7.459  50.136  46.146  1.00 21.51 ? 540  PRO A CD    1 
ATOM   4173  N N     . LYS A 1 541 ? -10.472 49.416  47.971  1.00 21.92 ? 541  LYS A N     1 
ATOM   4174  C CA    . LYS A 1 541 ? -11.888 49.400  48.313  1.00 22.13 ? 541  LYS A CA    1 
ATOM   4175  C C     . LYS A 1 541 ? -12.542 48.016  48.242  1.00 22.08 ? 541  LYS A C     1 
ATOM   4176  O O     . LYS A 1 541 ? -13.614 47.800  48.824  1.00 22.19 ? 541  LYS A O     1 
ATOM   4177  C CB    . LYS A 1 541 ? -12.659 50.344  47.394  1.00 22.55 ? 541  LYS A CB    1 
ATOM   4178  C CG    . LYS A 1 541 ? -12.484 51.814  47.660  1.00 22.58 ? 541  LYS A CG    1 
ATOM   4179  C CD    . LYS A 1 541 ? -13.741 52.535  47.213  1.00 23.54 ? 541  LYS A CD    1 
ATOM   4180  C CE    . LYS A 1 541 ? -13.684 54.029  47.511  1.00 23.57 ? 541  LYS A CE    1 
ATOM   4181  N NZ    . LYS A 1 541 ? -12.791 54.677  46.526  1.00 23.22 ? 541  LYS A NZ    1 
ATOM   4182  N N     . ILE A 1 542 ? -11.926 47.088  47.515  1.00 21.78 ? 542  ILE A N     1 
ATOM   4183  C CA    . ILE A 1 542 ? -12.471 45.724  47.409  1.00 21.22 ? 542  ILE A CA    1 
ATOM   4184  C C     . ILE A 1 542 ? -11.950 44.755  48.500  1.00 21.36 ? 542  ILE A C     1 
ATOM   4185  O O     . ILE A 1 542 ? -10.763 44.756  48.835  1.00 21.22 ? 542  ILE A O     1 
ATOM   4186  C CB    . ILE A 1 542 ? -12.271 45.155  45.972  1.00 20.65 ? 542  ILE A CB    1 
ATOM   4187  C CG1   . ILE A 1 542 ? -12.955 46.082  44.964  1.00 20.38 ? 542  ILE A CG1   1 
ATOM   4188  C CG2   . ILE A 1 542 ? -12.796 43.731  45.866  1.00 18.81 ? 542  ILE A CG2   1 
ATOM   4189  C CD1   . ILE A 1 542 ? -12.656 45.799  43.526  1.00 18.83 ? 542  ILE A CD1   1 
ATOM   4190  N N     . ALA A 1 543 ? -12.861 43.940  49.033  1.00 21.67 ? 543  ALA A N     1 
ATOM   4191  C CA    . ALA A 1 543 ? -12.543 42.883  50.000  1.00 22.65 ? 543  ALA A CA    1 
ATOM   4192  C C     . ALA A 1 543 ? -12.365 41.494  49.366  1.00 23.13 ? 543  ALA A C     1 
ATOM   4193  O O     . ALA A 1 543 ? -11.381 40.775  49.642  1.00 23.20 ? 543  ALA A O     1 
ATOM   4194  C CB    . ALA A 1 543 ? -13.637 42.815  51.064  1.00 22.72 ? 543  ALA A CB    1 
ATOM   4195  N N     . GLU A 1 544 ? -13.356 41.116  48.563  1.00 23.21 ? 544  GLU A N     1 
ATOM   4196  C CA    . GLU A 1 544 ? -13.419 39.808  47.941  1.00 24.13 ? 544  GLU A CA    1 
ATOM   4197  C C     . GLU A 1 544 ? -14.053 39.978  46.578  1.00 24.13 ? 544  GLU A C     1 
ATOM   4198  O O     . GLU A 1 544 ? -14.898 40.865  46.386  1.00 24.37 ? 544  GLU A O     1 
ATOM   4199  C CB    . GLU A 1 544 ? -14.321 38.866  48.732  1.00 24.21 ? 544  GLU A CB    1 
ATOM   4200  C CG    . GLU A 1 544 ? -13.892 38.538  50.128  1.00 26.66 ? 544  GLU A CG    1 
ATOM   4201  C CD    . GLU A 1 544 ? -15.013 37.876  50.880  1.00 30.43 ? 544  GLU A CD    1 
ATOM   4202  O OE1   . GLU A 1 544 ? -15.914 38.596  51.373  1.00 32.69 ? 544  GLU A OE1   1 
ATOM   4203  O OE2   . GLU A 1 544 ? -15.010 36.631  50.967  1.00 32.56 ? 544  GLU A OE2   1 
ATOM   4204  N N     . ALA A 1 545 ? -13.653 39.120  45.645  1.00 23.73 ? 545  ALA A N     1 
ATOM   4205  C CA    . ALA A 1 545 ? -14.332 39.008  44.370  1.00 23.34 ? 545  ALA A CA    1 
ATOM   4206  C C     . ALA A 1 545 ? -14.311 37.588  43.856  1.00 22.70 ? 545  ALA A C     1 
ATOM   4207  O O     . ALA A 1 545 ? -13.381 36.839  44.109  1.00 22.88 ? 545  ALA A O     1 
ATOM   4208  C CB    . ALA A 1 545 ? -13.718 39.943  43.337  1.00 23.27 ? 545  ALA A CB    1 
ATOM   4209  N N     . ALA A 1 546 ? -15.349 37.240  43.116  1.00 22.11 ? 546  ALA A N     1 
ATOM   4210  C CA    . ALA A 1 546 ? -15.413 35.990  42.376  1.00 21.15 ? 546  ALA A CA    1 
ATOM   4211  C C     . ALA A 1 546 ? -15.797 36.330  40.940  1.00 20.63 ? 546  ALA A C     1 
ATOM   4212  O O     . ALA A 1 546 ? -16.755 37.085  40.666  1.00 19.71 ? 546  ALA A O     1 
ATOM   4213  C CB    . ALA A 1 546 ? -16.433 35.026  43.012  1.00 21.06 ? 546  ALA A CB    1 
ATOM   4214  N N     . VAL A 1 547 ? -15.028 35.770  40.021  1.00 20.42 ? 547  VAL A N     1 
ATOM   4215  C CA    . VAL A 1 547 ? -15.187 36.074  38.613  1.00 19.94 ? 547  VAL A CA    1 
ATOM   4216  C C     . VAL A 1 547 ? -15.624 34.829  37.882  1.00 20.02 ? 547  VAL A C     1 
ATOM   4217  O O     . VAL A 1 547 ? -15.083 33.735  38.097  1.00 20.67 ? 547  VAL A O     1 
ATOM   4218  C CB    . VAL A 1 547 ? -13.873 36.603  38.021  1.00 19.60 ? 547  VAL A CB    1 
ATOM   4219  C CG1   . VAL A 1 547 ? -13.977 36.746  36.518  1.00 18.53 ? 547  VAL A CG1   1 
ATOM   4220  C CG2   . VAL A 1 547 ? -13.525 37.933  38.657  1.00 18.99 ? 547  VAL A CG2   1 
ATOM   4221  N N     . VAL A 1 548 ? -16.605 35.003  37.012  1.00 20.05 ? 548  VAL A N     1 
ATOM   4222  C CA    . VAL A 1 548 ? -17.041 33.930  36.131  1.00 20.38 ? 548  VAL A CA    1 
ATOM   4223  C C     . VAL A 1 548 ? -17.132 34.438  34.686  1.00 20.48 ? 548  VAL A C     1 
ATOM   4224  O O     . VAL A 1 548 ? -17.122 35.668  34.415  1.00 20.29 ? 548  VAL A O     1 
ATOM   4225  C CB    . VAL A 1 548 ? -18.411 33.310  36.609  1.00 20.84 ? 548  VAL A CB    1 
ATOM   4226  C CG1   . VAL A 1 548 ? -18.374 32.982  38.103  1.00 21.46 ? 548  VAL A CG1   1 
ATOM   4227  C CG2   . VAL A 1 548 ? -19.584 34.253  36.348  1.00 21.20 ? 548  VAL A CG2   1 
ATOM   4228  N N     . GLY A 1 549 ? -17.214 33.486  33.762  1.00 20.44 ? 549  GLY A N     1 
ATOM   4229  C CA    . GLY A 1 549 ? -17.570 33.777  32.380  1.00 20.41 ? 549  GLY A CA    1 
ATOM   4230  C C     . GLY A 1 549 ? -19.065 33.612  32.132  1.00 20.32 ? 549  GLY A C     1 
ATOM   4231  O O     . GLY A 1 549 ? -19.694 32.736  32.702  1.00 19.98 ? 549  GLY A O     1 
ATOM   4232  N N     . ILE A 1 550 ? -19.618 34.489  31.296  1.00 20.96 ? 550  ILE A N     1 
ATOM   4233  C CA    . ILE A 1 550 ? -20.973 34.379  30.753  1.00 21.41 ? 550  ILE A CA    1 
ATOM   4234  C C     . ILE A 1 550 ? -20.856 34.337  29.230  1.00 21.59 ? 550  ILE A C     1 
ATOM   4235  O O     . ILE A 1 550 ? -19.874 34.854  28.680  1.00 22.85 ? 550  ILE A O     1 
ATOM   4236  C CB    . ILE A 1 550 ? -21.856 35.594  31.137  1.00 21.37 ? 550  ILE A CB    1 
ATOM   4237  C CG1   . ILE A 1 550 ? -21.414 36.875  30.406  1.00 22.77 ? 550  ILE A CG1   1 
ATOM   4238  C CG2   . ILE A 1 550 ? -21.882 35.803  32.651  1.00 21.68 ? 550  ILE A CG2   1 
ATOM   4239  C CD1   . ILE A 1 550 ? -22.365 38.084  30.633  1.00 22.11 ? 550  ILE A CD1   1 
ATOM   4240  N N     . PRO A 1 551 ? -21.825 33.705  28.539  1.00 21.07 ? 551  PRO A N     1 
ATOM   4241  C CA    . PRO A 1 551 ? -21.834 33.727  27.070  1.00 20.79 ? 551  PRO A CA    1 
ATOM   4242  C C     . PRO A 1 551 ? -21.910 35.145  26.480  1.00 20.18 ? 551  PRO A C     1 
ATOM   4243  O O     . PRO A 1 551 ? -22.578 35.998  27.038  1.00 20.63 ? 551  PRO A O     1 
ATOM   4244  C CB    . PRO A 1 551 ? -23.098 32.933  26.718  1.00 20.87 ? 551  PRO A CB    1 
ATOM   4245  C CG    . PRO A 1 551 ? -23.330 32.056  27.895  1.00 21.27 ? 551  PRO A CG    1 
ATOM   4246  C CD    . PRO A 1 551 ? -22.939 32.901  29.074  1.00 21.22 ? 551  PRO A CD    1 
ATOM   4247  N N     . HIS A 1 552 ? -21.201 35.392  25.381  1.00 19.31 ? 552  HIS A N     1 
ATOM   4248  C CA    . HIS A 1 552 ? -21.243 36.682  24.697  1.00 18.53 ? 552  HIS A CA    1 
ATOM   4249  C C     . HIS A 1 552 ? -21.229 36.452  23.186  1.00 18.04 ? 552  HIS A C     1 
ATOM   4250  O O     . HIS A 1 552 ? -20.365 35.734  22.663  1.00 17.44 ? 552  HIS A O     1 
ATOM   4251  C CB    . HIS A 1 552 ? -20.068 37.582  25.114  1.00 18.44 ? 552  HIS A CB    1 
ATOM   4252  C CG    . HIS A 1 552 ? -20.133 38.965  24.533  1.00 20.01 ? 552  HIS A CG    1 
ATOM   4253  N ND1   . HIS A 1 552 ? -20.491 40.070  25.273  1.00 21.30 ? 552  HIS A ND1   1 
ATOM   4254  C CD2   . HIS A 1 552 ? -19.908 39.419  23.277  1.00 21.27 ? 552  HIS A CD2   1 
ATOM   4255  C CE1   . HIS A 1 552 ? -20.475 41.146  24.504  1.00 20.94 ? 552  HIS A CE1   1 
ATOM   4256  N NE2   . HIS A 1 552 ? -20.117 40.777  23.289  1.00 21.57 ? 552  HIS A NE2   1 
ATOM   4257  N N     . ALA A 1 553 ? -22.177 37.077  22.495  1.00 17.29 ? 553  ALA A N     1 
ATOM   4258  C CA    . ALA A 1 553 ? -22.367 36.850  21.072  1.00 17.12 ? 553  ALA A CA    1 
ATOM   4259  C C     . ALA A 1 553 ? -21.092 36.990  20.230  1.00 16.72 ? 553  ALA A C     1 
ATOM   4260  O O     . ALA A 1 553 ? -20.812 36.139  19.400  1.00 17.34 ? 553  ALA A O     1 
ATOM   4261  C CB    . ALA A 1 553 ? -23.502 37.737  20.515  1.00 17.32 ? 553  ALA A CB    1 
ATOM   4262  N N     . ILE A 1 554 ? -20.329 38.052  20.429  1.00 16.37 ? 554  ILE A N     1 
ATOM   4263  C CA    . ILE A 1 554 ? -19.134 38.289  19.608  1.00 16.17 ? 554  ILE A CA    1 
ATOM   4264  C C     . ILE A 1 554 ? -17.934 37.623  20.249  1.00 16.74 ? 554  ILE A C     1 
ATOM   4265  O O     . ILE A 1 554 ? -17.255 36.812  19.615  1.00 16.20 ? 554  ILE A O     1 
ATOM   4266  C CB    . ILE A 1 554 ? -18.817 39.791  19.458  1.00 15.48 ? 554  ILE A CB    1 
ATOM   4267  C CG1   . ILE A 1 554 ? -20.034 40.574  18.958  1.00 14.65 ? 554  ILE A CG1   1 
ATOM   4268  C CG2   . ILE A 1 554 ? -17.561 40.014  18.598  1.00 15.92 ? 554  ILE A CG2   1 
ATOM   4269  C CD1   . ILE A 1 554 ? -20.575 40.126  17.663  1.00 13.54 ? 554  ILE A CD1   1 
ATOM   4270  N N     . LYS A 1 555 ? -17.718 37.966  21.525  1.00 17.60 ? 555  LYS A N     1 
ATOM   4271  C CA    . LYS A 1 555 ? -16.513 37.642  22.289  1.00 18.37 ? 555  LYS A CA    1 
ATOM   4272  C C     . LYS A 1 555 ? -16.377 36.182  22.778  1.00 18.38 ? 555  LYS A C     1 
ATOM   4273  O O     . LYS A 1 555 ? -15.287 35.787  23.199  1.00 18.28 ? 555  LYS A O     1 
ATOM   4274  C CB    . LYS A 1 555 ? -16.443 38.547  23.517  1.00 18.64 ? 555  LYS A CB    1 
ATOM   4275  C CG    . LYS A 1 555 ? -16.211 40.027  23.270  1.00 21.14 ? 555  LYS A CG    1 
ATOM   4276  C CD    . LYS A 1 555 ? -15.978 40.680  24.636  1.00 22.64 ? 555  LYS A CD    1 
ATOM   4277  C CE    . LYS A 1 555 ? -16.127 42.197  24.636  1.00 23.43 ? 555  LYS A CE    1 
ATOM   4278  N NZ    . LYS A 1 555 ? -16.238 42.623  26.086  1.00 19.71 ? 555  LYS A NZ    1 
ATOM   4279  N N     . GLY A 1 556 ? -17.471 35.407  22.747  1.00 18.41 ? 556  GLY A N     1 
ATOM   4280  C CA    . GLY A 1 556 ? -17.505 34.017  23.258  1.00 18.28 ? 556  GLY A CA    1 
ATOM   4281  C C     . GLY A 1 556 ? -17.935 33.988  24.717  1.00 18.77 ? 556  GLY A C     1 
ATOM   4282  O O     . GLY A 1 556 ? -19.016 33.496  25.062  1.00 18.17 ? 556  GLY A O     1 
ATOM   4283  N N     . GLN A 1 557 ? -17.075 34.556  25.559  1.00 19.27 ? 557  GLN A N     1 
ATOM   4284  C CA    . GLN A 1 557 ? -17.345 34.773  26.981  1.00 20.15 ? 557  GLN A CA    1 
ATOM   4285  C C     . GLN A 1 557 ? -16.976 36.207  27.312  1.00 20.21 ? 557  GLN A C     1 
ATOM   4286  O O     . GLN A 1 557 ? -15.997 36.734  26.801  1.00 20.86 ? 557  GLN A O     1 
ATOM   4287  C CB    . GLN A 1 557 ? -16.493 33.861  27.884  1.00 20.10 ? 557  GLN A CB    1 
ATOM   4288  C CG    . GLN A 1 557 ? -16.928 32.417  27.957  1.00 20.50 ? 557  GLN A CG    1 
ATOM   4289  C CD    . GLN A 1 557 ? -16.114 31.651  28.973  1.00 20.18 ? 557  GLN A CD    1 
ATOM   4290  O OE1   . GLN A 1 557 ? -14.940 31.354  28.742  1.00 19.99 ? 557  GLN A OE1   1 
ATOM   4291  N NE2   . GLN A 1 557 ? -16.736 31.322  30.112  1.00 18.78 ? 557  GLN A NE2   1 
ATOM   4292  N N     . ALA A 1 558 ? -17.760 36.840  28.166  1.00 20.26 ? 558  ALA A N     1 
ATOM   4293  C CA    . ALA A 1 558 ? -17.335 38.077  28.762  1.00 20.04 ? 558  ALA A CA    1 
ATOM   4294  C C     . ALA A 1 558 ? -17.187 37.832  30.273  1.00 20.32 ? 558  ALA A C     1 
ATOM   4295  O O     . ALA A 1 558 ? -17.567 36.763  30.797  1.00 19.65 ? 558  ALA A O     1 
ATOM   4296  C CB    . ALA A 1 558 ? -18.322 39.169  28.469  1.00 20.34 ? 558  ALA A CB    1 
ATOM   4297  N N     . ILE A 1 559 ? -16.616 38.827  30.945  1.00 20.62 ? 559  ILE A N     1 
ATOM   4298  C CA    . ILE A 1 559 ? -16.196 38.709  32.331  1.00 20.84 ? 559  ILE A CA    1 
ATOM   4299  C C     . ILE A 1 559 ? -17.216 39.427  33.179  1.00 21.80 ? 559  ILE A C     1 
ATOM   4300  O O     . ILE A 1 559 ? -17.499 40.631  32.989  1.00 22.21 ? 559  ILE A O     1 
ATOM   4301  C CB    . ILE A 1 559 ? -14.766 39.256  32.568  1.00 20.50 ? 559  ILE A CB    1 
ATOM   4302  C CG1   . ILE A 1 559 ? -13.752 38.598  31.620  1.00 18.85 ? 559  ILE A CG1   1 
ATOM   4303  C CG2   . ILE A 1 559 ? -14.321 38.998  33.976  1.00 21.76 ? 559  ILE A CG2   1 
ATOM   4304  C CD1   . ILE A 1 559 ? -12.567 39.467  31.281  1.00 15.00 ? 559  ILE A CD1   1 
ATOM   4305  N N     . TYR A 1 560 ? -17.778 38.645  34.099  1.00 22.51 ? 560  TYR A N     1 
ATOM   4306  C CA    . TYR A 1 560 ? -18.812 39.065  35.009  1.00 23.03 ? 560  TYR A CA    1 
ATOM   4307  C C     . TYR A 1 560 ? -18.216 38.904  36.407  1.00 23.75 ? 560  TYR A C     1 
ATOM   4308  O O     . TYR A 1 560 ? -17.956 37.764  36.868  1.00 24.27 ? 560  TYR A O     1 
ATOM   4309  C CB    . TYR A 1 560 ? -19.993 38.125  34.822  1.00 23.59 ? 560  TYR A CB    1 
ATOM   4310  C CG    . TYR A 1 560 ? -21.231 38.465  35.617  1.00 24.55 ? 560  TYR A CG    1 
ATOM   4311  C CD1   . TYR A 1 560 ? -21.270 38.267  36.992  1.00 25.45 ? 560  TYR A CD1   1 
ATOM   4312  C CD2   . TYR A 1 560 ? -22.381 38.951  34.980  1.00 23.51 ? 560  TYR A CD2   1 
ATOM   4313  C CE1   . TYR A 1 560 ? -22.405 38.552  37.717  1.00 25.64 ? 560  TYR A CE1   1 
ATOM   4314  C CE2   . TYR A 1 560 ? -23.506 39.244  35.688  1.00 23.34 ? 560  TYR A CE2   1 
ATOM   4315  C CZ    . TYR A 1 560 ? -23.516 39.050  37.065  1.00 25.16 ? 560  TYR A CZ    1 
ATOM   4316  O OH    . TYR A 1 560 ? -24.636 39.355  37.806  1.00 26.12 ? 560  TYR A OH    1 
ATOM   4317  N N     . ALA A 1 561 ? -17.971 40.033  37.071  1.00 23.65 ? 561  ALA A N     1 
ATOM   4318  C CA    . ALA A 1 561 ? -17.319 40.018  38.376  1.00 23.81 ? 561  ALA A CA    1 
ATOM   4319  C C     . ALA A 1 561 ? -18.286 40.335  39.491  1.00 23.88 ? 561  ALA A C     1 
ATOM   4320  O O     . ALA A 1 561 ? -19.021 41.340  39.426  1.00 23.99 ? 561  ALA A O     1 
ATOM   4321  C CB    . ALA A 1 561 ? -16.123 40.977  38.408  1.00 24.02 ? 561  ALA A CB    1 
ATOM   4322  N N     . TYR A 1 562 ? -18.297 39.447  40.491  1.00 23.95 ? 562  TYR A N     1 
ATOM   4323  C CA    . TYR A 1 562 ? -19.028 39.644  41.743  1.00 23.64 ? 562  TYR A CA    1 
ATOM   4324  C C     . TYR A 1 562 ? -18.018 40.260  42.681  1.00 23.57 ? 562  TYR A C     1 
ATOM   4325  O O     . TYR A 1 562 ? -16.897 39.765  42.784  1.00 23.13 ? 562  TYR A O     1 
ATOM   4326  C CB    . TYR A 1 562 ? -19.490 38.323  42.337  1.00 23.45 ? 562  TYR A CB    1 
ATOM   4327  C CG    . TYR A 1 562 ? -20.550 37.597  41.555  1.00 23.46 ? 562  TYR A CG    1 
ATOM   4328  C CD1   . TYR A 1 562 ? -20.209 36.710  40.536  1.00 22.15 ? 562  TYR A CD1   1 
ATOM   4329  C CD2   . TYR A 1 562 ? -21.905 37.769  41.859  1.00 24.04 ? 562  TYR A CD2   1 
ATOM   4330  C CE1   . TYR A 1 562 ? -21.191 36.033  39.823  1.00 21.74 ? 562  TYR A CE1   1 
ATOM   4331  C CE2   . TYR A 1 562 ? -22.900 37.089  41.157  1.00 22.85 ? 562  TYR A CE2   1 
ATOM   4332  C CZ    . TYR A 1 562 ? -22.530 36.226  40.142  1.00 23.06 ? 562  TYR A CZ    1 
ATOM   4333  O OH    . TYR A 1 562 ? -23.505 35.545  39.461  1.00 24.03 ? 562  TYR A OH    1 
ATOM   4334  N N     . VAL A 1 563 ? -18.410 41.341  43.354  1.00 23.53 ? 563  VAL A N     1 
ATOM   4335  C CA    . VAL A 1 563 ? -17.468 42.154  44.119  1.00 22.94 ? 563  VAL A CA    1 
ATOM   4336  C C     . VAL A 1 563 ? -18.072 42.564  45.441  1.00 23.00 ? 563  VAL A C     1 
ATOM   4337  O O     . VAL A 1 563 ? -19.187 43.106  45.511  1.00 22.49 ? 563  VAL A O     1 
ATOM   4338  C CB    . VAL A 1 563 ? -17.027 43.412  43.343  1.00 22.87 ? 563  VAL A CB    1 
ATOM   4339  C CG1   . VAL A 1 563 ? -16.086 44.265  44.175  1.00 21.55 ? 563  VAL A CG1   1 
ATOM   4340  C CG2   . VAL A 1 563 ? -16.356 43.018  42.020  1.00 24.03 ? 563  VAL A CG2   1 
ATOM   4341  N N     . THR A 1 564 ? -17.305 42.279  46.483  1.00 23.12 ? 564  THR A N     1 
ATOM   4342  C CA    . THR A 1 564 ? -17.652 42.594  47.830  1.00 23.48 ? 564  THR A CA    1 
ATOM   4343  C C     . THR A 1 564 ? -16.687 43.714  48.262  1.00 24.25 ? 564  THR A C     1 
ATOM   4344  O O     . THR A 1 564 ? -15.457 43.503  48.327  1.00 24.46 ? 564  THR A O     1 
ATOM   4345  C CB    . THR A 1 564 ? -17.524 41.308  48.702  1.00 23.55 ? 564  THR A CB    1 
ATOM   4346  O OG1   . THR A 1 564 ? -18.300 40.265  48.099  1.00 24.37 ? 564  THR A OG1   1 
ATOM   4347  C CG2   . THR A 1 564 ? -18.001 41.517  50.133  1.00 21.48 ? 564  THR A CG2   1 
ATOM   4348  N N     . LEU A 1 565 ? -17.249 44.899  48.519  1.00 24.50 ? 565  LEU A N     1 
ATOM   4349  C CA    . LEU A 1 565 ? -16.497 46.052  49.035  1.00 25.12 ? 565  LEU A CA    1 
ATOM   4350  C C     . LEU A 1 565 ? -16.200 45.880  50.513  1.00 25.86 ? 565  LEU A C     1 
ATOM   4351  O O     . LEU A 1 565 ? -16.947 45.207  51.241  1.00 26.17 ? 565  LEU A O     1 
ATOM   4352  C CB    . LEU A 1 565 ? -17.265 47.367  48.808  1.00 24.54 ? 565  LEU A CB    1 
ATOM   4353  C CG    . LEU A 1 565 ? -17.713 47.588  47.364  1.00 23.50 ? 565  LEU A CG    1 
ATOM   4354  C CD1   . LEU A 1 565 ? -18.525 48.844  47.159  1.00 21.64 ? 565  LEU A CD1   1 
ATOM   4355  C CD2   . LEU A 1 565 ? -16.513 47.548  46.447  1.00 23.15 ? 565  LEU A CD2   1 
ATOM   4356  N N     . ASN A 1 566 ? -15.100 46.473  50.951  1.00 26.69 ? 566  ASN A N     1 
ATOM   4357  C CA    . ASN A 1 566 ? -14.798 46.565  52.371  1.00 28.11 ? 566  ASN A CA    1 
ATOM   4358  C C     . ASN A 1 566 ? -15.985 47.183  53.173  1.00 29.12 ? 566  ASN A C     1 
ATOM   4359  O O     . ASN A 1 566 ? -16.762 47.970  52.617  1.00 28.90 ? 566  ASN A O     1 
ATOM   4360  C CB    . ASN A 1 566 ? -13.478 47.323  52.555  1.00 27.50 ? 566  ASN A CB    1 
ATOM   4361  C CG    . ASN A 1 566 ? -12.288 46.559  51.976  1.00 28.00 ? 566  ASN A CG    1 
ATOM   4362  O OD1   . ASN A 1 566 ? -12.161 45.353  52.179  1.00 27.21 ? 566  ASN A OD1   1 
ATOM   4363  N ND2   . ASN A 1 566 ? -11.414 47.259  51.252  1.00 28.31 ? 566  ASN A ND2   1 
ATOM   4364  N N     . HIS A 1 567 ? -16.156 46.787  54.440  1.00 30.38 ? 567  HIS A N     1 
ATOM   4365  C CA    . HIS A 1 567 ? -17.213 47.368  55.288  1.00 32.20 ? 567  HIS A CA    1 
ATOM   4366  C C     . HIS A 1 567 ? -17.146 48.902  55.329  1.00 32.58 ? 567  HIS A C     1 
ATOM   4367  O O     . HIS A 1 567 ? -16.082 49.499  55.553  1.00 32.51 ? 567  HIS A O     1 
ATOM   4368  C CB    . HIS A 1 567 ? -17.214 46.771  56.710  1.00 32.81 ? 567  HIS A CB    1 
ATOM   4369  C CG    . HIS A 1 567 ? -18.045 45.520  56.847  1.00 35.84 ? 567  HIS A CG    1 
ATOM   4370  N ND1   . HIS A 1 567 ? -18.914 45.311  57.905  1.00 37.43 ? 567  HIS A ND1   1 
ATOM   4371  C CD2   . HIS A 1 567 ? -18.147 44.419  56.053  1.00 35.82 ? 567  HIS A CD2   1 
ATOM   4372  C CE1   . HIS A 1 567 ? -19.504 44.132  57.760  1.00 37.90 ? 567  HIS A CE1   1 
ATOM   4373  N NE2   . HIS A 1 567 ? -19.060 43.575  56.643  1.00 37.25 ? 567  HIS A NE2   1 
ATOM   4374  N N     . GLY A 1 568 ? -18.289 49.526  55.067  1.00 33.09 ? 568  GLY A N     1 
ATOM   4375  C CA    . GLY A 1 568 ? -18.394 50.982  55.068  1.00 33.72 ? 568  GLY A CA    1 
ATOM   4376  C C     . GLY A 1 568 ? -18.687 51.502  53.676  1.00 34.11 ? 568  GLY A C     1 
ATOM   4377  O O     . GLY A 1 568 ? -19.535 52.386  53.505  1.00 34.49 ? 568  GLY A O     1 
ATOM   4378  N N     . GLU A 1 569 ? -18.007 50.919  52.684  1.00 33.75 ? 569  GLU A N     1 
ATOM   4379  C CA    . GLU A 1 569 ? -18.015 51.409  51.298  1.00 33.41 ? 569  GLU A CA    1 
ATOM   4380  C C     . GLU A 1 569 ? -19.386 51.356  50.626  1.00 33.43 ? 569  GLU A C     1 
ATOM   4381  O O     . GLU A 1 569 ? -20.276 50.639  51.084  1.00 33.61 ? 569  GLU A O     1 
ATOM   4382  C CB    . GLU A 1 569 ? -16.979 50.654  50.458  1.00 33.12 ? 569  GLU A CB    1 
ATOM   4383  C CG    . GLU A 1 569 ? -15.554 50.732  51.007  1.00 32.19 ? 569  GLU A CG    1 
ATOM   4384  C CD    . GLU A 1 569 ? -14.929 52.120  50.897  1.00 30.67 ? 569  GLU A CD    1 
ATOM   4385  O OE1   . GLU A 1 569 ? -15.464 52.986  50.157  1.00 30.28 ? 569  GLU A OE1   1 
ATOM   4386  O OE2   . GLU A 1 569 ? -13.884 52.332  51.549  1.00 27.94 ? 569  GLU A OE2   1 
ATOM   4387  N N     . GLU A 1 570 ? -19.548 52.124  49.547  1.00 33.26 ? 570  GLU A N     1 
ATOM   4388  C CA    . GLU A 1 570 ? -20.834 52.205  48.850  1.00 33.11 ? 570  GLU A CA    1 
ATOM   4389  C C     . GLU A 1 570 ? -20.669 52.256  47.326  1.00 32.59 ? 570  GLU A C     1 
ATOM   4390  O O     . GLU A 1 570 ? -19.875 53.042  46.817  1.00 32.41 ? 570  GLU A O     1 
ATOM   4391  C CB    . GLU A 1 570 ? -21.698 53.384  49.366  1.00 33.03 ? 570  GLU A CB    1 
ATOM   4392  N N     . PRO A 1 571 ? -21.427 51.403  46.604  1.00 32.23 ? 571  PRO A N     1 
ATOM   4393  C CA    . PRO A 1 571 ? -21.493 51.459  45.141  1.00 31.98 ? 571  PRO A CA    1 
ATOM   4394  C C     . PRO A 1 571 ? -21.893 52.852  44.617  1.00 31.94 ? 571  PRO A C     1 
ATOM   4395  O O     . PRO A 1 571 ? -22.754 53.517  45.193  1.00 31.78 ? 571  PRO A O     1 
ATOM   4396  C CB    . PRO A 1 571 ? -22.597 50.453  44.795  1.00 31.90 ? 571  PRO A CB    1 
ATOM   4397  C CG    . PRO A 1 571 ? -22.727 49.569  45.991  1.00 31.78 ? 571  PRO A CG    1 
ATOM   4398  C CD    . PRO A 1 571 ? -22.276 50.334  47.174  1.00 31.67 ? 571  PRO A CD    1 
ATOM   4399  N N     . SER A 1 572 ? -21.244 53.286  43.545  1.00 31.72 ? 572  SER A N     1 
ATOM   4400  C CA    . SER A 1 572 ? -21.670 54.449  42.793  1.00 31.49 ? 572  SER A CA    1 
ATOM   4401  C C     . SER A 1 572 ? -21.324 54.142  41.350  1.00 31.56 ? 572  SER A C     1 
ATOM   4402  O O     . SER A 1 572 ? -20.585 53.192  41.088  1.00 31.32 ? 572  SER A O     1 
ATOM   4403  C CB    . SER A 1 572 ? -20.950 55.711  43.277  1.00 31.57 ? 572  SER A CB    1 
ATOM   4404  O OG    . SER A 1 572 ? -19.540 55.575  43.189  1.00 31.57 ? 572  SER A OG    1 
ATOM   4405  N N     . PRO A 1 573 ? -21.879 54.909  40.395  1.00 31.84 ? 573  PRO A N     1 
ATOM   4406  C CA    . PRO A 1 573 ? -21.441 54.727  39.006  1.00 31.62 ? 573  PRO A CA    1 
ATOM   4407  C C     . PRO A 1 573 ? -20.003 55.181  38.768  1.00 31.11 ? 573  PRO A C     1 
ATOM   4408  O O     . PRO A 1 573 ? -19.378 54.712  37.812  1.00 31.26 ? 573  PRO A O     1 
ATOM   4409  C CB    . PRO A 1 573 ? -22.414 55.600  38.193  1.00 31.82 ? 573  PRO A CB    1 
ATOM   4410  C CG    . PRO A 1 573 ? -23.553 55.908  39.127  1.00 32.55 ? 573  PRO A CG    1 
ATOM   4411  C CD    . PRO A 1 573 ? -22.938 55.928  40.504  1.00 32.27 ? 573  PRO A CD    1 
ATOM   4412  N N     . GLU A 1 574 ? -19.477 56.081  39.605  1.00 30.31 ? 574  GLU A N     1 
ATOM   4413  C CA    . GLU A 1 574 ? -18.082 56.488  39.441  1.00 29.71 ? 574  GLU A CA    1 
ATOM   4414  C C     . GLU A 1 574 ? -17.206 55.296  39.828  1.00 28.68 ? 574  GLU A C     1 
ATOM   4415  O O     . GLU A 1 574 ? -16.188 55.037  39.186  1.00 28.76 ? 574  GLU A O     1 
ATOM   4416  C CB    . GLU A 1 574 ? -17.712 57.757  40.228  1.00 29.22 ? 574  GLU A CB    1 
ATOM   4417  C CG    . GLU A 1 574 ? -18.628 58.973  39.970  1.00 31.03 ? 574  GLU A CG    1 
ATOM   4418  C CD    . GLU A 1 574 ? -18.198 60.285  40.711  1.00 31.45 ? 574  GLU A CD    1 
ATOM   4419  O OE1   . GLU A 1 574 ? -17.243 60.265  41.523  1.00 32.80 ? 574  GLU A OE1   1 
ATOM   4420  O OE2   . GLU A 1 574 ? -18.822 61.354  40.469  1.00 33.20 ? 574  GLU A OE2   1 
ATOM   4421  N N     . LEU A 1 575 ? -17.638 54.543  40.839  1.00 27.51 ? 575  LEU A N     1 
ATOM   4422  C CA    . LEU A 1 575 ? -16.865 53.412  41.345  1.00 26.13 ? 575  LEU A CA    1 
ATOM   4423  C C     . LEU A 1 575 ? -16.769 52.272  40.328  1.00 25.39 ? 575  LEU A C     1 
ATOM   4424  O O     . LEU A 1 575 ? -15.696 51.654  40.144  1.00 24.43 ? 575  LEU A O     1 
ATOM   4425  C CB    . LEU A 1 575 ? -17.442 52.921  42.668  1.00 26.19 ? 575  LEU A CB    1 
ATOM   4426  C CG    . LEU A 1 575 ? -16.624 51.825  43.355  1.00 26.90 ? 575  LEU A CG    1 
ATOM   4427  C CD1   . LEU A 1 575 ? -15.199 52.295  43.655  1.00 27.93 ? 575  LEU A CD1   1 
ATOM   4428  C CD2   . LEU A 1 575 ? -17.317 51.378  44.626  1.00 27.47 ? 575  LEU A CD2   1 
ATOM   4429  N N     . TYR A 1 576 ? -17.900 52.013  39.670  1.00 24.50 ? 576  TYR A N     1 
ATOM   4430  C CA    . TYR A 1 576 ? -17.981 51.069  38.555  1.00 23.64 ? 576  TYR A CA    1 
ATOM   4431  C C     . TYR A 1 576 ? -16.876 51.326  37.523  1.00 23.49 ? 576  TYR A C     1 
ATOM   4432  O O     . TYR A 1 576 ? -16.037 50.462  37.290  1.00 23.62 ? 576  TYR A O     1 
ATOM   4433  C CB    . TYR A 1 576 ? -19.347 51.180  37.908  1.00 23.37 ? 576  TYR A CB    1 
ATOM   4434  C CG    . TYR A 1 576 ? -19.814 49.964  37.147  1.00 23.42 ? 576  TYR A CG    1 
ATOM   4435  C CD1   . TYR A 1 576 ? -20.771 49.108  37.713  1.00 23.56 ? 576  TYR A CD1   1 
ATOM   4436  C CD2   . TYR A 1 576 ? -19.342 49.685  35.838  1.00 22.21 ? 576  TYR A CD2   1 
ATOM   4437  C CE1   . TYR A 1 576 ? -21.239 47.999  37.014  1.00 23.63 ? 576  TYR A CE1   1 
ATOM   4438  C CE2   . TYR A 1 576 ? -19.800 48.577  35.129  1.00 21.84 ? 576  TYR A CE2   1 
ATOM   4439  C CZ    . TYR A 1 576 ? -20.751 47.733  35.732  1.00 23.42 ? 576  TYR A CZ    1 
ATOM   4440  O OH    . TYR A 1 576 ? -21.243 46.623  35.081  1.00 22.36 ? 576  TYR A OH    1 
ATOM   4441  N N     . ALA A 1 577 ? -16.844 52.523  36.937  1.00 23.12 ? 577  ALA A N     1 
ATOM   4442  C CA    . ALA A 1 577 ? -15.756 52.885  36.026  1.00 22.37 ? 577  ALA A CA    1 
ATOM   4443  C C     . ALA A 1 577 ? -14.343 52.815  36.630  1.00 22.09 ? 577  ALA A C     1 
ATOM   4444  O O     . ALA A 1 577 ? -13.397 52.407  35.942  1.00 21.65 ? 577  ALA A O     1 
ATOM   4445  C CB    . ALA A 1 577 ? -16.003 54.233  35.426  1.00 22.61 ? 577  ALA A CB    1 
ATOM   4446  N N     . GLU A 1 578 ? -14.191 53.217  37.895  1.00 21.89 ? 578  GLU A N     1 
ATOM   4447  C CA    . GLU A 1 578 ? -12.867 53.207  38.539  1.00 21.87 ? 578  GLU A CA    1 
ATOM   4448  C C     . GLU A 1 578 ? -12.326 51.786  38.627  1.00 21.25 ? 578  GLU A C     1 
ATOM   4449  O O     . GLU A 1 578 ? -11.130 51.564  38.390  1.00 21.31 ? 578  GLU A O     1 
ATOM   4450  C CB    . GLU A 1 578 ? -12.890 53.840  39.936  1.00 21.78 ? 578  GLU A CB    1 
ATOM   4451  C CG    . GLU A 1 578 ? -11.502 53.972  40.634  1.00 22.81 ? 578  GLU A CG    1 
ATOM   4452  C CD    . GLU A 1 578 ? -11.570 54.167  42.184  1.00 24.67 ? 578  GLU A CD    1 
ATOM   4453  O OE1   . GLU A 1 578 ? -12.639 54.558  42.745  1.00 25.98 ? 578  GLU A OE1   1 
ATOM   4454  O OE2   . GLU A 1 578 ? -10.516 53.956  42.846  1.00 28.17 ? 578  GLU A OE2   1 
ATOM   4455  N N     . VAL A 1 579 ? -13.215 50.841  38.955  1.00 19.73 ? 579  VAL A N     1 
ATOM   4456  C CA    . VAL A 1 579 ? -12.839 49.463  39.181  1.00 18.55 ? 579  VAL A CA    1 
ATOM   4457  C C     . VAL A 1 579 ? -12.516 48.788  37.857  1.00 18.24 ? 579  VAL A C     1 
ATOM   4458  O O     . VAL A 1 579 ? -11.534 48.055  37.758  1.00 17.65 ? 579  VAL A O     1 
ATOM   4459  C CB    . VAL A 1 579 ? -13.938 48.695  39.992  1.00 18.82 ? 579  VAL A CB    1 
ATOM   4460  C CG1   . VAL A 1 579 ? -13.773 47.196  39.900  1.00 16.26 ? 579  VAL A CG1   1 
ATOM   4461  C CG2   . VAL A 1 579 ? -13.908 49.132  41.428  1.00 18.29 ? 579  VAL A CG2   1 
ATOM   4462  N N     . ARG A 1 580 ? -13.335 49.039  36.838  1.00 17.88 ? 580  ARG A N     1 
ATOM   4463  C CA    . ARG A 1 580 ? -12.977 48.628  35.472  1.00 17.78 ? 580  ARG A CA    1 
ATOM   4464  C C     . ARG A 1 580 ? -11.571 49.162  35.047  1.00 17.42 ? 580  ARG A C     1 
ATOM   4465  O O     . ARG A 1 580 ? -10.741 48.377  34.626  1.00 17.30 ? 580  ARG A O     1 
ATOM   4466  C CB    . ARG A 1 580 ? -14.065 49.011  34.461  1.00 17.72 ? 580  ARG A CB    1 
ATOM   4467  C CG    . ARG A 1 580 ? -15.430 48.334  34.728  1.00 19.60 ? 580  ARG A CG    1 
ATOM   4468  C CD    . ARG A 1 580 ? -16.202 48.027  33.430  1.00 20.45 ? 580  ARG A CD    1 
ATOM   4469  N NE    . ARG A 1 580 ? -15.948 49.055  32.432  1.00 24.58 ? 580  ARG A NE    1 
ATOM   4470  C CZ    . ARG A 1 580 ? -15.898 48.849  31.125  1.00 25.92 ? 580  ARG A CZ    1 
ATOM   4471  N NH1   . ARG A 1 580 ? -16.095 47.631  30.614  1.00 24.91 ? 580  ARG A NH1   1 
ATOM   4472  N NH2   . ARG A 1 580 ? -15.639 49.877  30.330  1.00 26.74 ? 580  ARG A NH2   1 
ATOM   4473  N N     . ASN A 1 581 ? -11.321 50.473  35.185  1.00 16.96 ? 581  ASN A N     1 
ATOM   4474  C CA    . ASN A 1 581 ? -10.015 51.095  34.874  1.00 17.25 ? 581  ASN A CA    1 
ATOM   4475  C C     . ASN A 1 581 ? -8.843  50.504  35.697  1.00 17.01 ? 581  ASN A C     1 
ATOM   4476  O O     . ASN A 1 581 ? -7.711  50.414  35.211  1.00 16.24 ? 581  ASN A O     1 
ATOM   4477  C CB    . ASN A 1 581 ? -10.064 52.623  35.080  1.00 16.96 ? 581  ASN A CB    1 
ATOM   4478  C CG    . ASN A 1 581 ? -10.758 53.369  33.930  1.00 18.32 ? 581  ASN A CG    1 
ATOM   4479  O OD1   . ASN A 1 581 ? -10.479 53.125  32.762  1.00 19.82 ? 581  ASN A OD1   1 
ATOM   4480  N ND2   . ASN A 1 581 ? -11.650 54.306  34.270  1.00 18.92 ? 581  ASN A ND2   1 
ATOM   4481  N N     . TRP A 1 582 ? -9.138  50.095  36.935  1.00 16.57 ? 582  TRP A N     1 
ATOM   4482  C CA    . TRP A 1 582 ? -8.163  49.453  37.796  1.00 16.45 ? 582  TRP A CA    1 
ATOM   4483  C C     . TRP A 1 582 ? -7.759  48.084  37.235  1.00 16.99 ? 582  TRP A C     1 
ATOM   4484  O O     . TRP A 1 582 ? -6.558  47.773  37.147  1.00 16.79 ? 582  TRP A O     1 
ATOM   4485  C CB    . TRP A 1 582 ? -8.713  49.300  39.214  1.00 15.93 ? 582  TRP A CB    1 
ATOM   4486  C CG    . TRP A 1 582 ? -7.785  48.578  40.153  1.00 15.55 ? 582  TRP A CG    1 
ATOM   4487  C CD1   . TRP A 1 582 ? -7.757  47.242  40.413  1.00 14.00 ? 582  TRP A CD1   1 
ATOM   4488  C CD2   . TRP A 1 582 ? -6.764  49.172  40.966  1.00 14.41 ? 582  TRP A CD2   1 
ATOM   4489  N NE1   . TRP A 1 582 ? -6.779  46.962  41.332  1.00 13.57 ? 582  TRP A NE1   1 
ATOM   4490  C CE2   . TRP A 1 582 ? -6.150  48.125  41.686  1.00 13.79 ? 582  TRP A CE2   1 
ATOM   4491  C CE3   . TRP A 1 582 ? -6.321  50.496  41.165  1.00 12.81 ? 582  TRP A CE3   1 
ATOM   4492  C CZ2   . TRP A 1 582 ? -5.102  48.350  42.580  1.00 14.37 ? 582  TRP A CZ2   1 
ATOM   4493  C CZ3   . TRP A 1 582 ? -5.286  50.728  42.051  1.00 13.33 ? 582  TRP A CZ3   1 
ATOM   4494  C CH2   . TRP A 1 582 ? -4.679  49.659  42.746  1.00 14.97 ? 582  TRP A CH2   1 
ATOM   4495  N N     . VAL A 1 583 ? -8.739  47.272  36.850  1.00 17.23 ? 583  VAL A N     1 
ATOM   4496  C CA    . VAL A 1 583 ? -8.400  45.963  36.301  1.00 18.67 ? 583  VAL A CA    1 
ATOM   4497  C C     . VAL A 1 583 ? -7.576  46.138  35.025  1.00 19.38 ? 583  VAL A C     1 
ATOM   4498  O O     . VAL A 1 583 ? -6.594  45.433  34.807  1.00 19.85 ? 583  VAL A O     1 
ATOM   4499  C CB    . VAL A 1 583 ? -9.628  45.059  36.044  1.00 18.29 ? 583  VAL A CB    1 
ATOM   4500  C CG1   . VAL A 1 583 ? -9.153  43.741  35.471  1.00 18.31 ? 583  VAL A CG1   1 
ATOM   4501  C CG2   . VAL A 1 583 ? -10.386 44.813  37.330  1.00 17.83 ? 583  VAL A CG2   1 
ATOM   4502  N N     . ARG A 1 584 ? -7.968  47.126  34.226  1.00 20.49 ? 584  ARG A N     1 
ATOM   4503  C CA    . ARG A 1 584 ? -7.295  47.492  32.980  1.00 21.78 ? 584  ARG A CA    1 
ATOM   4504  C C     . ARG A 1 584 ? -5.822  47.884  33.164  1.00 21.90 ? 584  ARG A C     1 
ATOM   4505  O O     . ARG A 1 584 ? -4.998  47.645  32.264  1.00 22.55 ? 584  ARG A O     1 
ATOM   4506  C CB    . ARG A 1 584 ? -8.083  48.623  32.302  1.00 22.05 ? 584  ARG A CB    1 
ATOM   4507  C CG    . ARG A 1 584 ? -7.371  49.305  31.170  1.00 25.37 ? 584  ARG A CG    1 
ATOM   4508  C CD    . ARG A 1 584 ? -7.976  50.669  30.857  1.00 29.80 ? 584  ARG A CD    1 
ATOM   4509  N NE    . ARG A 1 584 ? -8.234  50.769  29.418  1.00 33.73 ? 584  ARG A NE    1 
ATOM   4510  C CZ    . ARG A 1 584 ? -9.283  50.219  28.788  1.00 33.12 ? 584  ARG A CZ    1 
ATOM   4511  N NH1   . ARG A 1 584 ? -10.203 49.502  29.463  1.00 31.93 ? 584  ARG A NH1   1 
ATOM   4512  N NH2   . ARG A 1 584 ? -9.392  50.375  27.473  1.00 29.72 ? 584  ARG A NH2   1 
ATOM   4513  N N     . LYS A 1 585 ? -5.503  48.496  34.309  1.00 21.29 ? 585  LYS A N     1 
ATOM   4514  C CA    . LYS A 1 585 ? -4.146  48.915  34.623  1.00 21.67 ? 585  LYS A CA    1 
ATOM   4515  C C     . LYS A 1 585 ? -3.364  47.752  35.258  1.00 21.23 ? 585  LYS A C     1 
ATOM   4516  O O     . LYS A 1 585 ? -2.149  47.643  35.091  1.00 21.71 ? 585  LYS A O     1 
ATOM   4517  C CB    . LYS A 1 585 ? -4.180  50.162  35.523  1.00 21.37 ? 585  LYS A CB    1 
ATOM   4518  C CG    . LYS A 1 585 ? -2.982  50.344  36.432  1.00 22.55 ? 585  LYS A CG    1 
ATOM   4519  C CD    . LYS A 1 585 ? -3.252  51.359  37.589  1.00 23.49 ? 585  LYS A CD    1 
ATOM   4520  N N     . GLU A 1 586 ? -4.069  46.883  35.976  1.00 20.61 ? 586  GLU A N     1 
ATOM   4521  C CA    . GLU A 1 586 ? -3.462  45.706  36.622  1.00 20.00 ? 586  GLU A CA    1 
ATOM   4522  C C     . GLU A 1 586 ? -3.000  44.661  35.627  1.00 19.21 ? 586  GLU A C     1 
ATOM   4523  O O     . GLU A 1 586 ? -1.943  44.076  35.805  1.00 18.37 ? 586  GLU A O     1 
ATOM   4524  C CB    . GLU A 1 586 ? -4.456  45.043  37.589  1.00 20.00 ? 586  GLU A CB    1 
ATOM   4525  C CG    . GLU A 1 586 ? -4.607  45.772  38.926  1.00 21.11 ? 586  GLU A CG    1 
ATOM   4526  C CD    . GLU A 1 586 ? -3.296  45.845  39.690  1.00 23.46 ? 586  GLU A CD    1 
ATOM   4527  O OE1   . GLU A 1 586 ? -2.976  44.822  40.339  1.00 23.84 ? 586  GLU A OE1   1 
ATOM   4528  O OE2   . GLU A 1 586 ? -2.600  46.906  39.629  1.00 22.49 ? 586  GLU A OE2   1 
ATOM   4529  N N     . ILE A 1 587 ? -3.827  44.421  34.607  1.00 18.57 ? 587  ILE A N     1 
ATOM   4530  C CA    . ILE A 1 587 ? -3.576  43.418  33.590  1.00 18.21 ? 587  ILE A CA    1 
ATOM   4531  C C     . ILE A 1 587 ? -3.669  44.055  32.193  1.00 18.62 ? 587  ILE A C     1 
ATOM   4532  O O     . ILE A 1 587 ? -2.698  44.083  31.441  1.00 18.00 ? 587  ILE A O     1 
ATOM   4533  C CB    . ILE A 1 587 ? -4.541  42.222  33.749  1.00 18.19 ? 587  ILE A CB    1 
ATOM   4534  C CG1   . ILE A 1 587 ? -4.295  41.528  35.094  1.00 17.78 ? 587  ILE A CG1   1 
ATOM   4535  C CG2   . ILE A 1 587 ? -4.361  41.215  32.622  1.00 16.52 ? 587  ILE A CG2   1 
ATOM   4536  C CD1   . ILE A 1 587 ? -5.484  40.751  35.630  1.00 18.67 ? 587  ILE A CD1   1 
ATOM   4537  N N     . GLY A 1 588 ? -4.831  44.592  31.853  1.00 19.45 ? 588  GLY A N     1 
ATOM   4538  C CA    . GLY A 1 588 ? -4.980  45.299  30.567  1.00 19.59 ? 588  GLY A CA    1 
ATOM   4539  C C     . GLY A 1 588 ? -6.395  45.236  30.044  1.00 19.41 ? 588  GLY A C     1 
ATOM   4540  O O     . GLY A 1 588 ? -7.223  44.556  30.623  1.00 18.52 ? 588  GLY A O     1 
ATOM   4541  N N     . PRO A 1 589 ? -6.671  45.936  28.930  1.00 20.56 ? 589  PRO A N     1 
ATOM   4542  C CA    . PRO A 1 589 ? -8.026  45.986  28.328  1.00 21.02 ? 589  PRO A CA    1 
ATOM   4543  C C     . PRO A 1 589 ? -8.650  44.599  28.147  1.00 22.15 ? 589  PRO A C     1 
ATOM   4544  O O     . PRO A 1 589 ? -9.867  44.425  28.394  1.00 22.25 ? 589  PRO A O     1 
ATOM   4545  C CB    . PRO A 1 589 ? -7.782  46.659  26.978  1.00 20.45 ? 589  PRO A CB    1 
ATOM   4546  C CG    . PRO A 1 589 ? -6.545  47.524  27.218  1.00 20.22 ? 589  PRO A CG    1 
ATOM   4547  C CD    . PRO A 1 589 ? -5.697  46.755  28.171  1.00 20.49 ? 589  PRO A CD    1 
ATOM   4548  N N     . LEU A 1 590 ? -7.805  43.629  27.774  1.00 22.93 ? 590  LEU A N     1 
ATOM   4549  C CA    . LEU A 1 590 ? -8.200  42.245  27.517  1.00 23.64 ? 590  LEU A CA    1 
ATOM   4550  C C     . LEU A 1 590 ? -8.961  41.650  28.676  1.00 24.21 ? 590  LEU A C     1 
ATOM   4551  O O     . LEU A 1 590 ? -9.764  40.725  28.470  1.00 24.04 ? 590  LEU A O     1 
ATOM   4552  C CB    . LEU A 1 590 ? -6.979  41.361  27.153  1.00 24.06 ? 590  LEU A CB    1 
ATOM   4553  C CG    . LEU A 1 590 ? -5.886  40.818  28.137  1.00 26.03 ? 590  LEU A CG    1 
ATOM   4554  C CD1   . LEU A 1 590 ? -4.849  39.906  27.418  1.00 26.02 ? 590  LEU A CD1   1 
ATOM   4555  C CD2   . LEU A 1 590 ? -5.124  41.885  28.910  1.00 24.10 ? 590  LEU A CD2   1 
ATOM   4556  N N     . ALA A 1 591 ? -8.738  42.202  29.880  1.00 24.40 ? 591  ALA A N     1 
ATOM   4557  C CA    . ALA A 1 591 ? -9.251  41.609  31.116  1.00 24.87 ? 591  ALA A CA    1 
ATOM   4558  C C     . ALA A 1 591 ? -10.269 42.463  31.866  1.00 25.39 ? 591  ALA A C     1 
ATOM   4559  O O     . ALA A 1 591 ? -10.623 42.168  33.023  1.00 25.05 ? 591  ALA A O     1 
ATOM   4560  C CB    . ALA A 1 591 ? -8.094  41.228  32.040  1.00 24.87 ? 591  ALA A CB    1 
ATOM   4561  N N     . THR A 1 592 ? -10.735 43.516  31.213  1.00 25.90 ? 592  THR A N     1 
ATOM   4562  C CA    . THR A 1 592 ? -11.717 44.407  31.814  1.00 27.12 ? 592  THR A CA    1 
ATOM   4563  C C     . THR A 1 592 ? -13.047 43.681  31.995  1.00 26.86 ? 592  THR A C     1 
ATOM   4564  O O     . THR A 1 592 ? -13.570 43.135  31.038  1.00 27.25 ? 592  THR A O     1 
ATOM   4565  C CB    . THR A 1 592 ? -11.924 45.626  30.914  1.00 27.64 ? 592  THR A CB    1 
ATOM   4566  O OG1   . THR A 1 592 ? -10.710 46.406  30.875  1.00 30.00 ? 592  THR A OG1   1 
ATOM   4567  C CG2   . THR A 1 592 ? -13.083 46.479  31.429  1.00 28.43 ? 592  THR A CG2   1 
ATOM   4568  N N     . PRO A 1 593 ? -13.587 43.635  33.226  1.00 26.88 ? 593  PRO A N     1 
ATOM   4569  C CA    . PRO A 1 593 ? -14.897 43.016  33.421  1.00 26.82 ? 593  PRO A CA    1 
ATOM   4570  C C     . PRO A 1 593 ? -16.022 43.772  32.723  1.00 26.79 ? 593  PRO A C     1 
ATOM   4571  O O     . PRO A 1 593 ? -16.108 44.991  32.810  1.00 26.32 ? 593  PRO A O     1 
ATOM   4572  C CB    . PRO A 1 593 ? -15.086 43.080  34.936  1.00 26.26 ? 593  PRO A CB    1 
ATOM   4573  C CG    . PRO A 1 593 ? -13.739 43.212  35.466  1.00 25.97 ? 593  PRO A CG    1 
ATOM   4574  C CD    . PRO A 1 593 ? -13.037 44.082  34.509  1.00 26.83 ? 593  PRO A CD    1 
ATOM   4575  N N     . ASP A 1 594 ? -16.884 43.033  32.041  1.00 27.21 ? 594  ASP A N     1 
ATOM   4576  C CA    . ASP A 1 594 ? -17.979 43.645  31.314  1.00 27.84 ? 594  ASP A CA    1 
ATOM   4577  C C     . ASP A 1 594 ? -19.070 44.102  32.286  1.00 27.85 ? 594  ASP A C     1 
ATOM   4578  O O     . ASP A 1 594 ? -19.796 45.078  32.020  1.00 27.86 ? 594  ASP A O     1 
ATOM   4579  C CB    . ASP A 1 594 ? -18.526 42.665  30.288  1.00 28.15 ? 594  ASP A CB    1 
ATOM   4580  C CG    . ASP A 1 594 ? -17.521 42.355  29.199  1.00 30.23 ? 594  ASP A CG    1 
ATOM   4581  O OD1   . ASP A 1 594 ? -17.818 42.724  28.041  1.00 32.69 ? 594  ASP A OD1   1 
ATOM   4582  O OD2   . ASP A 1 594 ? -16.450 41.736  29.493  1.00 30.37 ? 594  ASP A OD2   1 
ATOM   4583  N N     . VAL A 1 595 ? -19.147 43.401  33.419  1.00 26.96 ? 595  VAL A N     1 
ATOM   4584  C CA    . VAL A 1 595 ? -20.171 43.617  34.411  1.00 25.92 ? 595  VAL A CA    1 
ATOM   4585  C C     . VAL A 1 595 ? -19.570 43.512  35.807  1.00 25.25 ? 595  VAL A C     1 
ATOM   4586  O O     . VAL A 1 595 ? -18.803 42.587  36.119  1.00 24.55 ? 595  VAL A O     1 
ATOM   4587  C CB    . VAL A 1 595 ? -21.357 42.622  34.242  1.00 26.36 ? 595  VAL A CB    1 
ATOM   4588  C CG1   . VAL A 1 595 ? -22.490 42.955  35.218  1.00 26.77 ? 595  VAL A CG1   1 
ATOM   4589  C CG2   . VAL A 1 595 ? -21.895 42.659  32.807  1.00 26.70 ? 595  VAL A CG2   1 
ATOM   4590  N N     . LEU A 1 596 ? -19.914 44.497  36.631  1.00 24.66 ? 596  LEU A N     1 
ATOM   4591  C CA    . LEU A 1 596 ? -19.585 44.492  38.026  1.00 24.38 ? 596  LEU A CA    1 
ATOM   4592  C C     . LEU A 1 596 ? -20.864 44.298  38.826  1.00 25.08 ? 596  LEU A C     1 
ATOM   4593  O O     . LEU A 1 596 ? -21.841 45.046  38.689  1.00 25.19 ? 596  LEU A O     1 
ATOM   4594  C CB    . LEU A 1 596 ? -18.863 45.775  38.391  1.00 24.06 ? 596  LEU A CB    1 
ATOM   4595  C CG    . LEU A 1 596 ? -17.482 45.950  37.731  1.00 23.72 ? 596  LEU A CG    1 
ATOM   4596  C CD1   . LEU A 1 596 ? -16.910 47.301  38.117  1.00 21.59 ? 596  LEU A CD1   1 
ATOM   4597  C CD2   . LEU A 1 596 ? -16.513 44.812  38.100  1.00 19.85 ? 596  LEU A CD2   1 
ATOM   4598  N N     . HIS A 1 597 ? -20.877 43.246  39.630  1.00 25.61 ? 597  HIS A N     1 
ATOM   4599  C CA    . HIS A 1 597 ? -22.046 42.919  40.404  1.00 26.04 ? 597  HIS A CA    1 
ATOM   4600  C C     . HIS A 1 597 ? -21.653 43.069  41.857  1.00 26.44 ? 597  HIS A C     1 
ATOM   4601  O O     . HIS A 1 597 ? -21.021 42.167  42.446  1.00 26.15 ? 597  HIS A O     1 
ATOM   4602  C CB    . HIS A 1 597 ? -22.497 41.505  40.055  1.00 26.37 ? 597  HIS A CB    1 
ATOM   4603  C CG    . HIS A 1 597 ? -23.648 40.993  40.868  1.00 26.69 ? 597  HIS A CG    1 
ATOM   4604  N ND1   . HIS A 1 597 ? -24.658 40.239  40.317  1.00 26.82 ? 597  HIS A ND1   1 
ATOM   4605  C CD2   . HIS A 1 597 ? -23.917 41.069  42.193  1.00 27.07 ? 597  HIS A CD2   1 
ATOM   4606  C CE1   . HIS A 1 597 ? -25.515 39.899  41.260  1.00 27.89 ? 597  HIS A CE1   1 
ATOM   4607  N NE2   . HIS A 1 597 ? -25.085 40.384  42.409  1.00 26.73 ? 597  HIS A NE2   1 
ATOM   4608  N N     . TRP A 1 598 ? -21.998 44.241  42.400  1.00 26.89 ? 598  TRP A N     1 
ATOM   4609  C CA    . TRP A 1 598 ? -21.771 44.578  43.798  1.00 27.62 ? 598  TRP A CA    1 
ATOM   4610  C C     . TRP A 1 598 ? -22.552 43.612  44.671  1.00 28.12 ? 598  TRP A C     1 
ATOM   4611  O O     . TRP A 1 598 ? -23.729 43.344  44.405  1.00 28.14 ? 598  TRP A O     1 
ATOM   4612  C CB    . TRP A 1 598 ? -22.224 46.013  44.083  1.00 27.93 ? 598  TRP A CB    1 
ATOM   4613  C CG    . TRP A 1 598 ? -21.741 47.049  43.082  1.00 28.64 ? 598  TRP A CG    1 
ATOM   4614  C CD1   . TRP A 1 598 ? -22.521 47.861  42.299  1.00 29.05 ? 598  TRP A CD1   1 
ATOM   4615  C CD2   . TRP A 1 598 ? -20.376 47.380  42.764  1.00 28.45 ? 598  TRP A CD2   1 
ATOM   4616  N NE1   . TRP A 1 598 ? -21.726 48.677  41.516  1.00 29.72 ? 598  TRP A NE1   1 
ATOM   4617  C CE2   . TRP A 1 598 ? -20.410 48.404  41.783  1.00 28.48 ? 598  TRP A CE2   1 
ATOM   4618  C CE3   . TRP A 1 598 ? -19.131 46.908  43.210  1.00 27.35 ? 598  TRP A CE3   1 
ATOM   4619  C CZ2   . TRP A 1 598 ? -19.251 48.970  41.251  1.00 28.42 ? 598  TRP A CZ2   1 
ATOM   4620  C CZ3   . TRP A 1 598 ? -17.980 47.461  42.675  1.00 28.79 ? 598  TRP A CZ3   1 
ATOM   4621  C CH2   . TRP A 1 598 ? -18.046 48.488  41.704  1.00 29.14 ? 598  TRP A CH2   1 
ATOM   4622  N N     . THR A 1 599 ? -21.905 43.079  45.706  1.00 28.73 ? 599  THR A N     1 
ATOM   4623  C CA    . THR A 1 599 ? -22.569 42.121  46.574  1.00 29.19 ? 599  THR A CA    1 
ATOM   4624  C C     . THR A 1 599 ? -21.924 41.901  47.946  1.00 30.30 ? 599  THR A C     1 
ATOM   4625  O O     . THR A 1 599 ? -20.694 41.927  48.085  1.00 30.67 ? 599  THR A O     1 
ATOM   4626  C CB    . THR A 1 599 ? -22.703 40.766  45.869  1.00 29.03 ? 599  THR A CB    1 
ATOM   4627  O OG1   . THR A 1 599 ? -23.843 40.074  46.392  1.00 28.52 ? 599  THR A OG1   1 
ATOM   4628  C CG2   . THR A 1 599 ? -21.431 39.925  46.053  1.00 28.27 ? 599  THR A CG2   1 
ATOM   4629  N N     . ASP A 1 600 ? -22.771 41.666  48.950  1.00 31.00 ? 600  ASP A N     1 
ATOM   4630  C CA    . ASP A 1 600 ? -22.328 41.192  50.264  1.00 31.88 ? 600  ASP A CA    1 
ATOM   4631  C C     . ASP A 1 600 ? -22.728 39.737  50.437  1.00 32.13 ? 600  ASP A C     1 
ATOM   4632  O O     . ASP A 1 600 ? -22.752 39.207  51.553  1.00 32.12 ? 600  ASP A O     1 
ATOM   4633  C CB    . ASP A 1 600 ? -22.959 42.037  51.377  1.00 31.92 ? 600  ASP A CB    1 
ATOM   4634  C CG    . ASP A 1 600 ? -22.365 43.423  51.452  1.00 33.19 ? 600  ASP A CG    1 
ATOM   4635  O OD1   . ASP A 1 600 ? -21.114 43.527  51.459  1.00 34.91 ? 600  ASP A OD1   1 
ATOM   4636  O OD2   . ASP A 1 600 ? -23.139 44.411  51.503  1.00 33.29 ? 600  ASP A OD2   1 
ATOM   4637  N N     . SER A 1 601 ? -23.057 39.099  49.322  1.00 32.52 ? 601  SER A N     1 
ATOM   4638  C CA    . SER A 1 601 ? -23.723 37.807  49.369  1.00 33.21 ? 601  SER A CA    1 
ATOM   4639  C C     . SER A 1 601 ? -22.996 36.671  48.630  1.00 33.60 ? 601  SER A C     1 
ATOM   4640  O O     . SER A 1 601 ? -23.636 35.772  48.073  1.00 34.07 ? 601  SER A O     1 
ATOM   4641  C CB    . SER A 1 601 ? -25.176 37.951  48.880  1.00 33.16 ? 601  SER A CB    1 
ATOM   4642  O OG    . SER A 1 601 ? -25.973 38.653  49.827  1.00 33.28 ? 601  SER A OG    1 
ATOM   4643  N N     . LEU A 1 602 ? -21.667 36.696  48.629  1.00 33.91 ? 602  LEU A N     1 
ATOM   4644  C CA    . LEU A 1 602 ? -20.911 35.571  48.097  1.00 34.37 ? 602  LEU A CA    1 
ATOM   4645  C C     . LEU A 1 602 ? -21.310 34.288  48.814  1.00 35.51 ? 602  LEU A C     1 
ATOM   4646  O O     . LEU A 1 602 ? -21.381 34.253  50.041  1.00 35.45 ? 602  LEU A O     1 
ATOM   4647  C CB    . LEU A 1 602 ? -19.413 35.808  48.224  1.00 33.79 ? 602  LEU A CB    1 
ATOM   4648  C CG    . LEU A 1 602 ? -18.814 36.801  47.222  1.00 32.33 ? 602  LEU A CG    1 
ATOM   4649  C CD1   . LEU A 1 602 ? -17.309 36.888  47.421  1.00 30.86 ? 602  LEU A CD1   1 
ATOM   4650  C CD2   . LEU A 1 602 ? -19.151 36.450  45.773  1.00 28.85 ? 602  LEU A CD2   1 
ATOM   4651  N N     . PRO A 1 603 ? -21.609 33.230  48.048  1.00 36.98 ? 603  PRO A N     1 
ATOM   4652  C CA    . PRO A 1 603 ? -22.066 31.980  48.660  1.00 38.05 ? 603  PRO A CA    1 
ATOM   4653  C C     . PRO A 1 603 ? -20.900 31.050  49.034  1.00 39.30 ? 603  PRO A C     1 
ATOM   4654  O O     . PRO A 1 603 ? -20.187 30.546  48.158  1.00 39.31 ? 603  PRO A O     1 
ATOM   4655  C CB    . PRO A 1 603 ? -22.947 31.372  47.569  1.00 37.89 ? 603  PRO A CB    1 
ATOM   4656  C CG    . PRO A 1 603 ? -22.574 32.095  46.289  1.00 36.95 ? 603  PRO A CG    1 
ATOM   4657  C CD    . PRO A 1 603 ? -21.552 33.126  46.582  1.00 36.73 ? 603  PRO A CD    1 
ATOM   4658  N N     . LYS A 1 604 ? -20.715 30.839  50.336  1.00 41.18 ? 604  LYS A N     1 
ATOM   4659  C CA    . LYS A 1 604 ? -19.551 30.101  50.861  1.00 42.94 ? 604  LYS A CA    1 
ATOM   4660  C C     . LYS A 1 604 ? -19.923 28.853  51.706  1.00 43.88 ? 604  LYS A C     1 
ATOM   4661  O O     . LYS A 1 604 ? -21.039 28.756  52.223  1.00 43.63 ? 604  LYS A O     1 
ATOM   4662  C CB    . LYS A 1 604 ? -18.613 31.068  51.621  1.00 42.83 ? 604  LYS A CB    1 
ATOM   4663  C CG    . LYS A 1 604 ? -17.888 32.072  50.710  1.00 42.50 ? 604  LYS A CG    1 
ATOM   4664  C CD    . LYS A 1 604 ? -17.940 33.501  51.258  1.00 42.70 ? 604  LYS A CD    1 
ATOM   4665  C CE    . LYS A 1 604 ? -16.679 33.894  52.014  1.00 42.31 ? 604  LYS A CE    1 
ATOM   4666  N NZ    . LYS A 1 604 ? -16.949 35.090  52.860  1.00 41.63 ? 604  LYS A NZ    1 
ATOM   4667  N N     . THR A 1 605 ? -18.986 27.900  51.805  1.00 45.47 ? 605  THR A N     1 
ATOM   4668  C CA    . THR A 1 605 ? -19.161 26.648  52.582  1.00 46.71 ? 605  THR A CA    1 
ATOM   4669  C C     . THR A 1 605 ? -18.772 26.829  54.039  1.00 47.51 ? 605  THR A C     1 
ATOM   4670  O O     . THR A 1 605 ? -18.730 27.953  54.546  1.00 47.65 ? 605  THR A O     1 
ATOM   4671  C CB    . THR A 1 605 ? -18.300 25.469  52.029  1.00 46.83 ? 605  THR A CB    1 
ATOM   4672  O OG1   . THR A 1 605 ? -17.133 25.982  51.358  1.00 46.97 ? 605  THR A OG1   1 
ATOM   4673  C CG2   . THR A 1 605 ? -19.115 24.566  51.086  1.00 46.86 ? 605  THR A CG2   1 
ATOM   4674  N N     . ARG A 1 606 ? -18.485 25.706  54.702  1.00 48.43 ? 606  ARG A N     1 
ATOM   4675  C CA    . ARG A 1 606 ? -17.982 25.706  56.075  1.00 49.31 ? 606  ARG A CA    1 
ATOM   4676  C C     . ARG A 1 606 ? -16.692 26.533  56.211  1.00 49.83 ? 606  ARG A C     1 
ATOM   4677  O O     . ARG A 1 606 ? -16.569 27.362  57.124  1.00 49.57 ? 606  ARG A O     1 
ATOM   4678  C CB    . ARG A 1 606 ? -17.755 24.263  56.563  1.00 49.16 ? 606  ARG A CB    1 
ATOM   4679  N N     . SER A 1 607 ? -15.764 26.328  55.269  1.00 50.65 ? 607  SER A N     1 
ATOM   4680  C CA    . SER A 1 607 ? -14.370 26.805  55.386  1.00 51.30 ? 607  SER A CA    1 
ATOM   4681  C C     . SER A 1 607 ? -13.990 28.103  54.630  1.00 51.58 ? 607  SER A C     1 
ATOM   4682  O O     . SER A 1 607 ? -12.844 28.572  54.729  1.00 51.45 ? 607  SER A O     1 
ATOM   4683  C CB    . SER A 1 607 ? -13.387 25.663  55.047  1.00 51.26 ? 607  SER A CB    1 
ATOM   4684  O OG    . SER A 1 607 ? -13.667 25.081  53.784  1.00 51.31 ? 607  SER A OG    1 
ATOM   4685  N N     . GLY A 1 608 ? -14.942 28.686  53.898  1.00 52.00 ? 608  GLY A N     1 
ATOM   4686  C CA    . GLY A 1 608 ? -14.682 29.910  53.112  1.00 52.23 ? 608  GLY A CA    1 
ATOM   4687  C C     . GLY A 1 608 ? -14.535 29.653  51.619  1.00 52.27 ? 608  GLY A C     1 
ATOM   4688  O O     . GLY A 1 608 ? -14.546 30.598  50.815  1.00 52.26 ? 608  GLY A O     1 
ATOM   4689  N N     . LYS A 1 609 ? -14.380 28.370  51.265  1.00 52.31 ? 609  LYS A N     1 
ATOM   4690  C CA    . LYS A 1 609 ? -14.405 27.895  49.874  1.00 52.17 ? 609  LYS A CA    1 
ATOM   4691  C C     . LYS A 1 609 ? -15.675 28.446  49.214  1.00 51.94 ? 609  LYS A C     1 
ATOM   4692  O O     . LYS A 1 609 ? -16.766 28.434  49.803  1.00 52.16 ? 609  LYS A O     1 
ATOM   4693  C CB    . LYS A 1 609 ? -14.352 26.356  49.822  1.00 52.10 ? 609  LYS A CB    1 
ATOM   4694  C CG    . LYS A 1 609 ? -14.151 25.741  48.432  1.00 52.09 ? 609  LYS A CG    1 
ATOM   4695  C CD    . LYS A 1 609 ? -14.342 24.216  48.467  1.00 51.97 ? 609  LYS A CD    1 
ATOM   4696  N N     . ILE A 1 610 ? -15.517 28.961  48.006  1.00 51.21 ? 610  ILE A N     1 
ATOM   4697  C CA    . ILE A 1 610 ? -16.553 29.777  47.395  1.00 50.48 ? 610  ILE A CA    1 
ATOM   4698  C C     . ILE A 1 610 ? -17.293 29.003  46.292  1.00 49.71 ? 610  ILE A C     1 
ATOM   4699  O O     . ILE A 1 610 ? -16.666 28.302  45.496  1.00 49.75 ? 610  ILE A O     1 
ATOM   4700  C CB    . ILE A 1 610 ? -15.949 31.161  46.963  1.00 50.66 ? 610  ILE A CB    1 
ATOM   4701  C CG1   . ILE A 1 610 ? -16.749 31.816  45.842  1.00 50.78 ? 610  ILE A CG1   1 
ATOM   4702  C CG2   . ILE A 1 610 ? -14.423 31.035  46.630  1.00 51.16 ? 610  ILE A CG2   1 
ATOM   4703  C CD1   . ILE A 1 610 ? -16.191 31.557  44.450  1.00 52.54 ? 610  ILE A CD1   1 
ATOM   4704  N N     . MET A 1 611 ? -18.622 29.124  46.259  1.00 48.71 ? 611  MET A N     1 
ATOM   4705  C CA    . MET A 1 611 ? -19.469 28.287  45.376  1.00 47.81 ? 611  MET A CA    1 
ATOM   4706  C C     . MET A 1 611 ? -19.670 28.753  43.931  1.00 46.25 ? 611  MET A C     1 
ATOM   4707  O O     . MET A 1 611 ? -20.613 29.485  43.612  1.00 45.87 ? 611  MET A O     1 
ATOM   4708  C CB    . MET A 1 611 ? -20.818 27.983  46.036  1.00 48.40 ? 611  MET A CB    1 
ATOM   4709  C CG    . MET A 1 611 ? -20.689 27.005  47.172  1.00 50.52 ? 611  MET A CG    1 
ATOM   4710  S SD    . MET A 1 611 ? -20.397 25.283  46.680  1.00 57.20 ? 611  MET A SD    1 
ATOM   4711  C CE    . MET A 1 611 ? -19.668 25.373  45.014  1.00 55.58 ? 611  MET A CE    1 
ATOM   4712  N N     . ARG A 1 612 ? -18.800 28.266  43.058  1.00 44.62 ? 612  ARG A N     1 
ATOM   4713  C CA    . ARG A 1 612 ? -18.661 28.819  41.716  1.00 43.32 ? 612  ARG A CA    1 
ATOM   4714  C C     . ARG A 1 612 ? -19.761 28.459  40.712  1.00 42.17 ? 612  ARG A C     1 
ATOM   4715  O O     . ARG A 1 612 ? -20.033 29.237  39.793  1.00 41.98 ? 612  ARG A O     1 
ATOM   4716  C CB    . ARG A 1 612 ? -17.283 28.465  41.151  1.00 43.46 ? 612  ARG A CB    1 
ATOM   4717  C CG    . ARG A 1 612 ? -16.167 28.883  42.063  1.00 43.78 ? 612  ARG A CG    1 
ATOM   4718  C CD    . ARG A 1 612 ? -14.840 28.880  41.364  1.00 45.56 ? 612  ARG A CD    1 
ATOM   4719  N NE    . ARG A 1 612 ? -13.980 29.869  41.989  1.00 47.18 ? 612  ARG A NE    1 
ATOM   4720  C CZ    . ARG A 1 612 ? -13.839 31.123  41.559  1.00 48.12 ? 612  ARG A CZ    1 
ATOM   4721  N NH1   . ARG A 1 612 ? -14.474 31.543  40.465  1.00 47.79 ? 612  ARG A NH1   1 
ATOM   4722  N NH2   . ARG A 1 612 ? -13.046 31.954  42.223  1.00 47.71 ? 612  ARG A NH2   1 
ATOM   4723  N N     . ARG A 1 613 ? -20.372 27.283  40.869  1.00 40.79 ? 613  ARG A N     1 
ATOM   4724  C CA    . ARG A 1 613 ? -21.375 26.802  39.904  1.00 39.60 ? 613  ARG A CA    1 
ATOM   4725  C C     . ARG A 1 613 ? -22.631 27.670  39.964  1.00 38.42 ? 613  ARG A C     1 
ATOM   4726  O O     . ARG A 1 613 ? -23.190 28.074  38.932  1.00 37.75 ? 613  ARG A O     1 
ATOM   4727  C CB    . ARG A 1 613 ? -21.717 25.311  40.119  1.00 39.48 ? 613  ARG A CB    1 
ATOM   4728  N N     . ILE A 1 614 ? -23.058 27.971  41.182  1.00 37.27 ? 614  ILE A N     1 
ATOM   4729  C CA    . ILE A 1 614 ? -24.232 28.797  41.353  1.00 36.59 ? 614  ILE A CA    1 
ATOM   4730  C C     . ILE A 1 614 ? -23.955 30.197  40.810  1.00 35.80 ? 614  ILE A C     1 
ATOM   4731  O O     . ILE A 1 614 ? -24.800 30.752  40.101  1.00 36.00 ? 614  ILE A O     1 
ATOM   4732  C CB    . ILE A 1 614 ? -24.862 28.716  42.797  1.00 36.88 ? 614  ILE A CB    1 
ATOM   4733  C CG1   . ILE A 1 614 ? -25.229 30.097  43.340  1.00 36.91 ? 614  ILE A CG1   1 
ATOM   4734  C CG2   . ILE A 1 614 ? -23.974 27.934  43.786  1.00 37.92 ? 614  ILE A CG2   1 
ATOM   4735  N N     . LEU A 1 615 ? -22.754 30.726  41.068  1.00 34.57 ? 615  LEU A N     1 
ATOM   4736  C CA    . LEU A 1 615 ? -22.350 32.042  40.533  1.00 33.25 ? 615  LEU A CA    1 
ATOM   4737  C C     . LEU A 1 615 ? -22.371 32.097  38.994  1.00 32.84 ? 615  LEU A C     1 
ATOM   4738  O O     . LEU A 1 615 ? -22.827 33.087  38.401  1.00 32.28 ? 615  LEU A O     1 
ATOM   4739  C CB    . LEU A 1 615 ? -20.997 32.495  41.108  1.00 32.63 ? 615  LEU A CB    1 
ATOM   4740  C CG    . LEU A 1 615 ? -20.996 32.764  42.619  1.00 32.48 ? 615  LEU A CG    1 
ATOM   4741  C CD1   . LEU A 1 615 ? -19.603 32.833  43.217  1.00 29.73 ? 615  LEU A CD1   1 
ATOM   4742  C CD2   . LEU A 1 615 ? -21.790 34.015  42.957  1.00 32.82 ? 615  LEU A CD2   1 
ATOM   4743  N N     . ARG A 1 616 ? -21.915 31.018  38.363  1.00 32.45 ? 616  ARG A N     1 
ATOM   4744  C CA    . ARG A 1 616 ? -21.932 30.894  36.901  1.00 33.02 ? 616  ARG A CA    1 
ATOM   4745  C C     . ARG A 1 616 ? -23.343 30.988  36.299  1.00 31.91 ? 616  ARG A C     1 
ATOM   4746  O O     . ARG A 1 616 ? -23.622 31.887  35.495  1.00 31.49 ? 616  ARG A O     1 
ATOM   4747  C CB    . ARG A 1 616 ? -21.271 29.577  36.478  1.00 33.68 ? 616  ARG A CB    1 
ATOM   4748  C CG    . ARG A 1 616 ? -20.859 29.513  35.005  1.00 37.65 ? 616  ARG A CG    1 
ATOM   4749  C CD    . ARG A 1 616 ? -19.721 28.489  34.783  1.00 44.00 ? 616  ARG A CD    1 
ATOM   4750  N NE    . ARG A 1 616 ? -18.477 28.909  35.456  1.00 47.85 ? 616  ARG A NE    1 
ATOM   4751  C CZ    . ARG A 1 616 ? -17.932 28.308  36.519  1.00 48.37 ? 616  ARG A CZ    1 
ATOM   4752  N NH1   . ARG A 1 616 ? -18.490 27.222  37.060  1.00 47.50 ? 616  ARG A NH1   1 
ATOM   4753  N NH2   . ARG A 1 616 ? -16.806 28.796  37.033  1.00 48.41 ? 616  ARG A NH2   1 
ATOM   4754  N N     . LYS A 1 617 ? -24.215 30.060  36.704  1.00 31.13 ? 617  LYS A N     1 
ATOM   4755  C CA    . LYS A 1 617 ? -25.600 29.974  36.208  1.00 30.20 ? 617  LYS A CA    1 
ATOM   4756  C C     . LYS A 1 617 ? -26.376 31.289  36.380  1.00 29.46 ? 617  LYS A C     1 
ATOM   4757  O O     . LYS A 1 617 ? -27.029 31.744  35.430  1.00 29.32 ? 617  LYS A O     1 
ATOM   4758  C CB    . LYS A 1 617 ? -26.350 28.783  36.839  1.00 29.93 ? 617  LYS A CB    1 
ATOM   4759  N N     . ILE A 1 618 ? -26.277 31.905  37.562  1.00 28.66 ? 618  ILE A N     1 
ATOM   4760  C CA    . ILE A 1 618 ? -26.941 33.191  37.835  1.00 28.43 ? 618  ILE A CA    1 
ATOM   4761  C C     . ILE A 1 618 ? -26.547 34.257  36.812  1.00 28.37 ? 618  ILE A C     1 
ATOM   4762  O O     . ILE A 1 618 ? -27.409 34.926  36.228  1.00 27.73 ? 618  ILE A O     1 
ATOM   4763  C CB    . ILE A 1 618 ? -26.696 33.680  39.298  1.00 28.69 ? 618  ILE A CB    1 
ATOM   4764  C CG1   . ILE A 1 618 ? -27.567 32.881  40.282  1.00 28.74 ? 618  ILE A CG1   1 
ATOM   4765  C CG2   . ILE A 1 618 ? -26.962 35.197  39.450  1.00 28.58 ? 618  ILE A CG2   1 
ATOM   4766  C CD1   . ILE A 1 618 ? -27.229 33.104  41.759  1.00 28.17 ? 618  ILE A CD1   1 
ATOM   4767  N N     . ALA A 1 619 ? -25.238 34.382  36.589  1.00 28.98 ? 619  ALA A N     1 
ATOM   4768  C CA    . ALA A 1 619 ? -24.677 35.325  35.615  1.00 29.31 ? 619  ALA A CA    1 
ATOM   4769  C C     . ALA A 1 619 ? -25.164 35.057  34.184  1.00 29.73 ? 619  ALA A C     1 
ATOM   4770  O O     . ALA A 1 619 ? -25.517 35.987  33.457  1.00 29.45 ? 619  ALA A O     1 
ATOM   4771  C CB    . ALA A 1 619 ? -23.167 35.314  35.693  1.00 29.27 ? 619  ALA A CB    1 
ATOM   4772  N N     . ALA A 1 620 ? -25.212 33.782  33.799  1.00 30.47 ? 620  ALA A N     1 
ATOM   4773  C CA    . ALA A 1 620 ? -25.833 33.382  32.541  1.00 31.47 ? 620  ALA A CA    1 
ATOM   4774  C C     . ALA A 1 620 ? -27.301 33.844  32.447  1.00 32.48 ? 620  ALA A C     1 
ATOM   4775  O O     . ALA A 1 620 ? -27.891 33.828  31.355  1.00 32.88 ? 620  ALA A O     1 
ATOM   4776  C CB    . ALA A 1 620 ? -25.742 31.884  32.364  1.00 31.20 ? 620  ALA A CB    1 
ATOM   4777  N N     . GLY A 1 621 ? -27.874 34.262  33.584  1.00 32.97 ? 621  GLY A N     1 
ATOM   4778  C CA    . GLY A 1 621 ? -29.287 34.633  33.673  1.00 33.33 ? 621  GLY A CA    1 
ATOM   4779  C C     . GLY A 1 621 ? -30.207 33.432  33.855  1.00 33.61 ? 621  GLY A C     1 
ATOM   4780  O O     . GLY A 1 621 ? -31.238 33.349  33.191  1.00 34.04 ? 621  GLY A O     1 
ATOM   4781  N N     . ASP A 1 622 ? -29.841 32.508  34.749  1.00 33.65 ? 622  ASP A N     1 
ATOM   4782  C CA    . ASP A 1 622 ? -30.654 31.307  35.049  1.00 33.61 ? 622  ASP A CA    1 
ATOM   4783  C C     . ASP A 1 622 ? -31.459 31.404  36.335  1.00 33.07 ? 622  ASP A C     1 
ATOM   4784  O O     . ASP A 1 622 ? -31.121 32.203  37.209  1.00 33.04 ? 622  ASP A O     1 
ATOM   4785  C CB    . ASP A 1 622 ? -29.773 30.063  35.171  1.00 33.61 ? 622  ASP A CB    1 
ATOM   4786  C CG    . ASP A 1 622 ? -29.156 29.663  33.871  1.00 34.77 ? 622  ASP A CG    1 
ATOM   4787  O OD1   . ASP A 1 622 ? -28.369 28.699  33.888  1.00 36.13 ? 622  ASP A OD1   1 
ATOM   4788  O OD2   . ASP A 1 622 ? -29.447 30.304  32.836  1.00 36.04 ? 622  ASP A OD2   1 
ATOM   4789  N N     . THR A 1 623 ? -32.501 30.560  36.424  1.00 32.63 ? 623  THR A N     1 
ATOM   4790  C CA    . THR A 1 623 ? -33.276 30.282  37.656  1.00 31.73 ? 623  THR A CA    1 
ATOM   4791  C C     . THR A 1 623 ? -33.659 28.780  37.820  1.00 31.58 ? 623  THR A C     1 
ATOM   4792  O O     . THR A 1 623 ? -34.821 28.413  37.661  1.00 31.63 ? 623  THR A O     1 
ATOM   4793  C CB    . THR A 1 623 ? -34.553 31.150  37.735  1.00 31.50 ? 623  THR A CB    1 
ATOM   4794  O OG1   . THR A 1 623 ? -34.321 32.409  37.095  1.00 30.62 ? 623  THR A OG1   1 
ATOM   4795  C CG2   . THR A 1 623 ? -34.967 31.378  39.192  1.00 31.24 ? 623  THR A CG2   1 
ATOM   4796  N N     . SER A 1 624 ? -32.670 27.928  38.116  1.00 31.42 ? 624  SER A N     1 
ATOM   4797  C CA    . SER A 1 624 ? -32.865 26.518  38.503  1.00 31.29 ? 624  SER A CA    1 
ATOM   4798  C C     . SER A 1 624 ? -31.553 25.889  38.965  1.00 31.21 ? 624  SER A C     1 
ATOM   4799  O O     . SER A 1 624 ? -30.798 25.345  38.157  1.00 30.60 ? 624  SER A O     1 
ATOM   4800  C CB    . SER A 1 624 ? -33.464 25.697  37.362  1.00 31.44 ? 624  SER A CB    1 
ATOM   4801  N N     . SER A 1 630 ? -27.160 23.207  45.199  1.00 51.06 ? 630  SER A N     1 
ATOM   4802  C CA    . SER A 1 630 ? -27.028 22.581  46.517  1.00 51.45 ? 630  SER A CA    1 
ATOM   4803  C C     . SER A 1 630 ? -26.972 23.565  47.714  1.00 51.68 ? 630  SER A C     1 
ATOM   4804  O O     . SER A 1 630 ? -27.005 24.787  47.542  1.00 51.21 ? 630  SER A O     1 
ATOM   4805  C CB    . SER A 1 630 ? -25.840 21.604  46.531  1.00 51.14 ? 630  SER A CB    1 
ATOM   4806  N N     . THR A 1 631 ? -26.900 23.008  48.926  1.00 52.24 ? 631  THR A N     1 
ATOM   4807  C CA    . THR A 1 631 ? -27.036 23.760  50.180  1.00 52.42 ? 631  THR A CA    1 
ATOM   4808  C C     . THR A 1 631 ? -25.682 24.200  50.755  1.00 52.49 ? 631  THR A C     1 
ATOM   4809  O O     . THR A 1 631 ? -24.779 23.377  50.970  1.00 52.44 ? 631  THR A O     1 
ATOM   4810  C CB    . THR A 1 631 ? -27.759 22.913  51.241  1.00 52.72 ? 631  THR A CB    1 
ATOM   4811  O OG1   . THR A 1 631 ? -26.987 21.736  51.498  1.00 53.03 ? 631  THR A OG1   1 
ATOM   4812  C CG2   . THR A 1 631 ? -29.170 22.493  50.775  1.00 52.86 ? 631  THR A CG2   1 
ATOM   4813  N N     . LEU A 1 632 ? -25.577 25.497  51.040  1.00 52.50 ? 632  LEU A N     1 
ATOM   4814  C CA    . LEU A 1 632 ? -24.308 26.169  51.375  1.00 52.62 ? 632  LEU A CA    1 
ATOM   4815  C C     . LEU A 1 632 ? -24.036 26.243  52.872  1.00 52.74 ? 632  LEU A C     1 
ATOM   4816  O O     . LEU A 1 632 ? -24.135 25.237  53.578  1.00 53.10 ? 632  LEU A O     1 
ATOM   4817  C CB    . LEU A 1 632 ? -24.322 27.598  50.824  1.00 52.56 ? 632  LEU A CB    1 
ATOM   4818  C CG    . LEU A 1 632 ? -24.970 27.808  49.454  1.00 52.52 ? 632  LEU A CG    1 
ATOM   4819  C CD1   . LEU A 1 632 ? -25.600 29.176  49.337  1.00 51.91 ? 632  LEU A CD1   1 
ATOM   4820  C CD2   . LEU A 1 632 ? -23.971 27.562  48.353  1.00 52.61 ? 632  LEU A CD2   1 
ATOM   4821  N N     . ALA A 1 633 ? -23.680 27.443  53.340  1.00 52.56 ? 633  ALA A N     1 
ATOM   4822  C CA    . ALA A 1 633 ? -23.542 27.735  54.770  1.00 52.60 ? 633  ALA A CA    1 
ATOM   4823  C C     . ALA A 1 633 ? -24.607 28.742  55.236  1.00 52.64 ? 633  ALA A C     1 
ATOM   4824  O O     . ALA A 1 633 ? -24.891 28.865  56.430  1.00 52.66 ? 633  ALA A O     1 
ATOM   4825  C CB    . ALA A 1 633 ? -22.140 28.247  55.083  1.00 52.42 ? 633  ALA A CB    1 
ATOM   4826  N N     . ASP A 1 634 ? -25.181 29.465  54.277  1.00 52.50 ? 634  ASP A N     1 
ATOM   4827  C CA    . ASP A 1 634 ? -26.310 30.362  54.510  1.00 52.17 ? 634  ASP A CA    1 
ATOM   4828  C C     . ASP A 1 634 ? -27.093 30.473  53.198  1.00 52.06 ? 634  ASP A C     1 
ATOM   4829  O O     . ASP A 1 634 ? -26.619 31.106  52.249  1.00 52.27 ? 634  ASP A O     1 
ATOM   4830  C CB    . ASP A 1 634 ? -25.819 31.735  54.977  1.00 52.00 ? 634  ASP A CB    1 
ATOM   4831  C CG    . ASP A 1 634 ? -26.878 32.820  54.841  1.00 52.09 ? 634  ASP A CG    1 
ATOM   4832  O OD1   . ASP A 1 634 ? -28.087 32.500  54.805  1.00 52.49 ? 634  ASP A OD1   1 
ATOM   4833  O OD2   . ASP A 1 634 ? -26.498 34.007  54.774  1.00 51.83 ? 634  ASP A OD2   1 
ATOM   4834  N N     . PRO A 1 635 ? -28.296 29.872  53.140  1.00 51.73 ? 635  PRO A N     1 
ATOM   4835  C CA    . PRO A 1 635 ? -28.963 29.695  51.845  1.00 51.42 ? 635  PRO A CA    1 
ATOM   4836  C C     . PRO A 1 635 ? -29.644 30.949  51.265  1.00 50.96 ? 635  PRO A C     1 
ATOM   4837  O O     . PRO A 1 635 ? -29.742 31.070  50.040  1.00 51.13 ? 635  PRO A O     1 
ATOM   4838  C CB    . PRO A 1 635 ? -29.986 28.589  52.127  1.00 51.45 ? 635  PRO A CB    1 
ATOM   4839  C CG    . PRO A 1 635 ? -30.321 28.743  53.580  1.00 51.94 ? 635  PRO A CG    1 
ATOM   4840  C CD    . PRO A 1 635 ? -29.101 29.345  54.259  1.00 51.91 ? 635  PRO A CD    1 
ATOM   4841  N N     . GLY A 1 636 ? -30.088 31.868  52.123  1.00 50.29 ? 636  GLY A N     1 
ATOM   4842  C CA    . GLY A 1 636 ? -30.818 33.069  51.689  1.00 49.59 ? 636  GLY A CA    1 
ATOM   4843  C C     . GLY A 1 636 ? -30.046 34.078  50.843  1.00 49.12 ? 636  GLY A C     1 
ATOM   4844  O O     . GLY A 1 636 ? -30.555 35.159  50.547  1.00 49.15 ? 636  GLY A O     1 
ATOM   4845  N N     . VAL A 1 637 ? -28.822 33.732  50.452  1.00 48.54 ? 637  VAL A N     1 
ATOM   4846  C CA    . VAL A 1 637 ? -28.017 34.588  49.569  1.00 48.06 ? 637  VAL A CA    1 
ATOM   4847  C C     . VAL A 1 637 ? -28.239 34.314  48.076  1.00 47.34 ? 637  VAL A C     1 
ATOM   4848  O O     . VAL A 1 637 ? -27.955 35.160  47.242  1.00 46.83 ? 637  VAL A O     1 
ATOM   4849  C CB    . VAL A 1 637 ? -26.501 34.532  49.897  1.00 48.12 ? 637  VAL A CB    1 
ATOM   4850  C CG1   . VAL A 1 637 ? -26.230 35.135  51.275  1.00 48.58 ? 637  VAL A CG1   1 
ATOM   4851  C CG2   . VAL A 1 637 ? -25.959 33.105  49.794  1.00 48.34 ? 637  VAL A CG2   1 
ATOM   4852  N N     . VAL A 1 638 ? -28.755 33.131  47.756  1.00 47.01 ? 638  VAL A N     1 
ATOM   4853  C CA    . VAL A 1 638 ? -29.125 32.782  46.380  1.00 46.68 ? 638  VAL A CA    1 
ATOM   4854  C C     . VAL A 1 638 ? -30.307 33.634  45.906  1.00 46.39 ? 638  VAL A C     1 
ATOM   4855  O O     . VAL A 1 638 ? -30.413 33.970  44.723  1.00 46.58 ? 638  VAL A O     1 
ATOM   4856  C CB    . VAL A 1 638 ? -29.473 31.273  46.237  1.00 46.70 ? 638  VAL A CB    1 
ATOM   4857  C CG1   . VAL A 1 638 ? -29.931 30.943  44.809  1.00 46.82 ? 638  VAL A CG1   1 
ATOM   4858  C CG2   . VAL A 1 638 ? -28.286 30.393  46.639  1.00 46.27 ? 638  VAL A CG2   1 
ATOM   4859  N N     . GLU A 1 639 ? -31.192 33.976  46.837  1.00 45.90 ? 639  GLU A N     1 
ATOM   4860  C CA    . GLU A 1 639 ? -32.322 34.846  46.538  1.00 45.50 ? 639  GLU A CA    1 
ATOM   4861  C C     . GLU A 1 639 ? -31.826 36.288  46.323  1.00 44.54 ? 639  GLU A C     1 
ATOM   4862  O O     . GLU A 1 639 ? -32.211 36.947  45.343  1.00 44.18 ? 639  GLU A O     1 
ATOM   4863  C CB    . GLU A 1 639 ? -33.417 34.703  47.632  1.00 45.84 ? 639  GLU A CB    1 
ATOM   4864  C CG    . GLU A 1 639 ? -34.338 35.919  47.891  1.00 47.03 ? 639  GLU A CG    1 
ATOM   4865  C CD    . GLU A 1 639 ? -35.087 36.422  46.653  1.00 48.54 ? 639  GLU A CD    1 
ATOM   4866  O OE1   . GLU A 1 639 ? -35.198 35.673  45.643  1.00 47.73 ? 639  GLU A OE1   1 
ATOM   4867  O OE2   . GLU A 1 639 ? -35.558 37.585  46.704  1.00 48.92 ? 639  GLU A OE2   1 
ATOM   4868  N N     . LYS A 1 640 ? -30.949 36.744  47.225  1.00 43.41 ? 640  LYS A N     1 
ATOM   4869  C CA    . LYS A 1 640 ? -30.371 38.082  47.155  1.00 42.11 ? 640  LYS A CA    1 
ATOM   4870  C C     . LYS A 1 640 ? -29.606 38.241  45.844  1.00 41.35 ? 640  LYS A C     1 
ATOM   4871  O O     . LYS A 1 640 ? -29.800 39.237  45.143  1.00 41.66 ? 640  LYS A O     1 
ATOM   4872  C CB    . LYS A 1 640 ? -29.491 38.384  48.376  1.00 41.68 ? 640  LYS A CB    1 
ATOM   4873  N N     . LEU A 1 641 ? -28.786 37.240  45.499  1.00 40.24 ? 641  LEU A N     1 
ATOM   4874  C CA    . LEU A 1 641 ? -27.956 37.258  44.283  1.00 38.81 ? 641  LEU A CA    1 
ATOM   4875  C C     . LEU A 1 641 ? -28.763 37.243  42.993  1.00 38.72 ? 641  LEU A C     1 
ATOM   4876  O O     . LEU A 1 641 ? -28.265 37.701  41.968  1.00 39.14 ? 641  LEU A O     1 
ATOM   4877  C CB    . LEU A 1 641 ? -26.956 36.100  44.257  1.00 38.29 ? 641  LEU A CB    1 
ATOM   4878  C CG    . LEU A 1 641 ? -25.755 36.070  45.202  1.00 37.22 ? 641  LEU A CG    1 
ATOM   4879  C CD1   . LEU A 1 641 ? -25.229 34.652  45.304  1.00 35.64 ? 641  LEU A CD1   1 
ATOM   4880  C CD2   . LEU A 1 641 ? -24.644 37.012  44.782  1.00 35.62 ? 641  LEU A CD2   1 
ATOM   4881  N N     . LEU A 1 642 ? -29.981 36.695  43.031  1.00 38.28 ? 642  LEU A N     1 
ATOM   4882  C CA    . LEU A 1 642 ? -30.909 36.758  41.896  1.00 37.80 ? 642  LEU A CA    1 
ATOM   4883  C C     . LEU A 1 642 ? -31.492 38.155  41.696  1.00 37.84 ? 642  LEU A C     1 
ATOM   4884  O O     . LEU A 1 642 ? -31.422 38.702  40.596  1.00 37.55 ? 642  LEU A O     1 
ATOM   4885  C CB    . LEU A 1 642 ? -32.053 35.760  42.062  1.00 37.63 ? 642  LEU A CB    1 
ATOM   4886  C CG    . LEU A 1 642 ? -31.938 34.350  41.480  1.00 37.66 ? 642  LEU A CG    1 
ATOM   4887  C CD1   . LEU A 1 642 ? -33.190 33.571  41.828  1.00 36.20 ? 642  LEU A CD1   1 
ATOM   4888  C CD2   . LEU A 1 642 ? -31.701 34.361  39.955  1.00 37.15 ? 642  LEU A CD2   1 
ATOM   4889  N N     . GLU A 1 643 ? -32.081 38.715  42.755  1.00 38.10 ? 643  GLU A N     1 
ATOM   4890  C CA    . GLU A 1 643 ? -32.678 40.051  42.701  1.00 38.41 ? 643  GLU A CA    1 
ATOM   4891  C C     . GLU A 1 643 ? -31.648 41.046  42.193  1.00 38.65 ? 643  GLU A C     1 
ATOM   4892  O O     . GLU A 1 643 ? -31.888 41.729  41.199  1.00 38.52 ? 643  GLU A O     1 
ATOM   4893  C CB    . GLU A 1 643 ? -33.239 40.491  44.068  1.00 38.36 ? 643  GLU A CB    1 
ATOM   4894  C CG    . GLU A 1 643 ? -34.725 40.182  44.276  1.00 37.97 ? 643  GLU A CG    1 
ATOM   4895  N N     . GLU A 1 644 ? -30.497 41.091  42.870  1.00 39.05 ? 644  GLU A N     1 
ATOM   4896  C CA    . GLU A 1 644 ? -29.341 41.920  42.477  1.00 39.10 ? 644  GLU A CA    1 
ATOM   4897  C C     . GLU A 1 644 ? -29.028 41.857  40.970  1.00 39.70 ? 644  GLU A C     1 
ATOM   4898  O O     . GLU A 1 644 ? -28.707 42.877  40.351  1.00 39.73 ? 644  GLU A O     1 
ATOM   4899  C CB    . GLU A 1 644 ? -28.096 41.525  43.288  1.00 39.26 ? 644  GLU A CB    1 
ATOM   4900  C CG    . GLU A 1 644 ? -28.049 42.034  44.748  1.00 38.39 ? 644  GLU A CG    1 
ATOM   4901  C CD    . GLU A 1 644 ? -26.887 41.439  45.550  1.00 37.97 ? 644  GLU A CD    1 
ATOM   4902  O OE1   . GLU A 1 644 ? -26.167 40.579  45.016  1.00 35.57 ? 644  GLU A OE1   1 
ATOM   4903  O OE2   . GLU A 1 644 ? -26.693 41.823  46.720  1.00 36.70 ? 644  GLU A OE2   1 
ATOM   4904  N N     . LYS A 1 645 ? -29.144 40.660  40.396  1.00 40.10 ? 645  LYS A N     1 
ATOM   4905  C CA    . LYS A 1 645 ? -28.878 40.416  38.980  1.00 40.62 ? 645  LYS A CA    1 
ATOM   4906  C C     . LYS A 1 645 ? -29.933 41.043  38.065  1.00 41.27 ? 645  LYS A C     1 
ATOM   4907  O O     . LYS A 1 645 ? -29.712 41.153  36.848  1.00 41.55 ? 645  LYS A O     1 
ATOM   4908  C CB    . LYS A 1 645 ? -28.806 38.904  38.722  1.00 40.39 ? 645  LYS A CB    1 
ATOM   4909  C CG    . LYS A 1 645 ? -27.826 38.482  37.655  1.00 40.19 ? 645  LYS A CG    1 
ATOM   4910  C CD    . LYS A 1 645 ? -28.465 38.372  36.300  1.00 40.17 ? 645  LYS A CD    1 
ATOM   4911  C CE    . LYS A 1 645 ? -27.409 38.392  35.221  1.00 39.42 ? 645  LYS A CE    1 
ATOM   4912  N NZ    . LYS A 1 645 ? -28.011 38.803  33.932  1.00 39.33 ? 645  LYS A NZ    1 
ATOM   4913  N N     . GLN A 1 646 ? -31.075 41.450  38.628  1.00 41.55 ? 646  GLN A N     1 
ATOM   4914  C CA    . GLN A 1 646 ? -32.149 42.017  37.800  1.00 41.97 ? 646  GLN A CA    1 
ATOM   4915  C C     . GLN A 1 646 ? -31.946 43.499  37.481  1.00 41.90 ? 646  GLN A C     1 
ATOM   4916  O O     . GLN A 1 646 ? -32.685 44.067  36.678  1.00 41.90 ? 646  GLN A O     1 
ATOM   4917  C CB    . GLN A 1 646 ? -33.563 41.750  38.366  1.00 42.40 ? 646  GLN A CB    1 
ATOM   4918  C CG    . GLN A 1 646 ? -33.888 40.279  38.784  1.00 43.28 ? 646  GLN A CG    1 
ATOM   4919  C CD    . GLN A 1 646 ? -33.778 39.230  37.655  1.00 43.19 ? 646  GLN A CD    1 
ATOM   4920  O OE1   . GLN A 1 646 ? -34.770 38.583  37.289  1.00 41.72 ? 646  GLN A OE1   1 
ATOM   4921  N NE2   . GLN A 1 646 ? -32.563 39.040  37.135  1.00 42.79 ? 646  GLN A NE2   1 
ATOM   4922  N N     . ALA A 1 647 ? -30.949 44.127  38.096  1.00 41.92 ? 647  ALA A N     1 
ATOM   4923  C CA    . ALA A 1 647 ? -30.472 45.422  37.599  1.00 42.05 ? 647  ALA A CA    1 
ATOM   4924  C C     . ALA A 1 647 ? -28.999 45.346  37.153  1.00 41.89 ? 647  ALA A C     1 
ATOM   4925  O O     . ALA A 1 647 ? -28.635 44.562  36.260  1.00 41.34 ? 647  ALA A O     1 
ATOM   4926  C CB    . ALA A 1 647 ? -30.698 46.535  38.637  1.00 42.06 ? 647  ALA A CB    1 
ATOM   4927  N N     . HIS B 1 5   ? -31.832 67.644  47.059  1.00 43.79 ? 5    HIS B N     1 
ATOM   4928  C CA    . HIS B 1 5   ? -30.509 68.351  47.109  1.00 43.92 ? 5    HIS B CA    1 
ATOM   4929  C C     . HIS B 1 5   ? -30.402 69.496  46.079  1.00 42.26 ? 5    HIS B C     1 
ATOM   4930  O O     . HIS B 1 5   ? -30.156 69.249  44.890  1.00 42.23 ? 5    HIS B O     1 
ATOM   4931  C CB    . HIS B 1 5   ? -29.334 67.353  46.925  1.00 44.87 ? 5    HIS B CB    1 
ATOM   4932  C CG    . HIS B 1 5   ? -27.978 67.922  47.274  1.00 47.93 ? 5    HIS B CG    1 
ATOM   4933  N ND1   . HIS B 1 5   ? -27.490 69.100  46.734  1.00 50.12 ? 5    HIS B ND1   1 
ATOM   4934  C CD2   . HIS B 1 5   ? -27.002 67.459  48.097  1.00 50.20 ? 5    HIS B CD2   1 
ATOM   4935  C CE1   . HIS B 1 5   ? -26.282 69.342  47.218  1.00 51.20 ? 5    HIS B CE1   1 
ATOM   4936  N NE2   . HIS B 1 5   ? -25.961 68.359  48.045  1.00 51.90 ? 5    HIS B NE2   1 
ATOM   4937  N N     . LYS B 1 6   ? -30.552 70.737  46.548  1.00 40.13 ? 6    LYS B N     1 
ATOM   4938  C CA    . LYS B 1 6   ? -30.328 71.904  45.697  1.00 38.24 ? 6    LYS B CA    1 
ATOM   4939  C C     . LYS B 1 6   ? -28.848 72.248  45.495  1.00 37.17 ? 6    LYS B C     1 
ATOM   4940  O O     . LYS B 1 6   ? -28.001 72.005  46.366  1.00 37.30 ? 6    LYS B O     1 
ATOM   4941  C CB    . LYS B 1 6   ? -31.128 73.124  46.166  1.00 38.03 ? 6    LYS B CB    1 
ATOM   4942  C CG    . LYS B 1 6   ? -32.487 73.262  45.453  1.00 37.57 ? 6    LYS B CG    1 
ATOM   4943  C CD    . LYS B 1 6   ? -33.422 74.258  46.160  1.00 38.16 ? 6    LYS B CD    1 
ATOM   4944  C CE    . LYS B 1 6   ? -34.772 74.352  45.471  1.00 36.15 ? 6    LYS B CE    1 
ATOM   4945  N NZ    . LYS B 1 6   ? -35.639 75.346  46.134  1.00 33.98 ? 6    LYS B NZ    1 
ATOM   4946  N N     . HIS B 1 7   ? -28.553 72.779  44.311  1.00 35.04 ? 7    HIS B N     1 
ATOM   4947  C CA    . HIS B 1 7   ? -27.269 73.370  44.020  1.00 33.01 ? 7    HIS B CA    1 
ATOM   4948  C C     . HIS B 1 7   ? -27.493 74.864  43.983  1.00 32.06 ? 7    HIS B C     1 
ATOM   4949  O O     . HIS B 1 7   ? -28.184 75.394  43.092  1.00 32.39 ? 7    HIS B O     1 
ATOM   4950  C CB    . HIS B 1 7   ? -26.722 72.857  42.689  1.00 32.78 ? 7    HIS B CB    1 
ATOM   4951  C CG    . HIS B 1 7   ? -26.143 71.482  42.767  1.00 30.46 ? 7    HIS B CG    1 
ATOM   4952  N ND1   . HIS B 1 7   ? -24.827 71.252  43.101  1.00 28.18 ? 7    HIS B ND1   1 
ATOM   4953  C CD2   . HIS B 1 7   ? -26.697 70.266  42.553  1.00 29.13 ? 7    HIS B CD2   1 
ATOM   4954  C CE1   . HIS B 1 7   ? -24.593 69.951  43.085  1.00 28.29 ? 7    HIS B CE1   1 
ATOM   4955  N NE2   . HIS B 1 7   ? -25.709 69.331  42.749  1.00 28.53 ? 7    HIS B NE2   1 
ATOM   4956  N N     . ALA B 1 8   ? -26.950 75.536  44.987  1.00 30.50 ? 8    ALA B N     1 
ATOM   4957  C CA    . ALA B 1 8   ? -27.065 76.981  45.085  1.00 29.21 ? 8    ALA B CA    1 
ATOM   4958  C C     . ALA B 1 8   ? -26.305 77.627  43.930  1.00 28.56 ? 8    ALA B C     1 
ATOM   4959  O O     . ALA B 1 8   ? -25.352 77.033  43.371  1.00 28.15 ? 8    ALA B O     1 
ATOM   4960  C CB    . ALA B 1 8   ? -26.516 77.468  46.419  1.00 29.00 ? 8    ALA B CB    1 
ATOM   4961  N N     . ILE B 1 9   ? -26.738 78.836  43.577  1.00 27.25 ? 9    ILE B N     1 
ATOM   4962  C CA    . ILE B 1 9   ? -26.101 79.620  42.539  1.00 25.91 ? 9    ILE B CA    1 
ATOM   4963  C C     . ILE B 1 9   ? -24.760 80.096  43.079  1.00 25.42 ? 9    ILE B C     1 
ATOM   4964  O O     . ILE B 1 9   ? -24.732 80.790  44.081  1.00 25.48 ? 9    ILE B O     1 
ATOM   4965  C CB    . ILE B 1 9   ? -26.979 80.821  42.137  1.00 25.57 ? 9    ILE B CB    1 
ATOM   4966  C CG1   . ILE B 1 9   ? -28.281 80.327  41.503  1.00 24.82 ? 9    ILE B CG1   1 
ATOM   4967  C CG2   . ILE B 1 9   ? -26.228 81.754  41.185  1.00 25.29 ? 9    ILE B CG2   1 
ATOM   4968  C CD1   . ILE B 1 9   ? -29.391 81.351  41.497  1.00 23.61 ? 9    ILE B CD1   1 
ATOM   4969  N N     . PRO B 1 10  ? -23.646 79.713  42.422  1.00 24.74 ? 10   PRO B N     1 
ATOM   4970  C CA    . PRO B 1 10  ? -22.302 80.085  42.875  1.00 24.20 ? 10   PRO B CA    1 
ATOM   4971  C C     . PRO B 1 10  ? -22.094 81.601  42.908  1.00 23.84 ? 10   PRO B C     1 
ATOM   4972  O O     . PRO B 1 10  ? -22.741 82.326  42.155  1.00 23.65 ? 10   PRO B O     1 
ATOM   4973  C CB    . PRO B 1 10  ? -21.397 79.472  41.814  1.00 24.30 ? 10   PRO B CB    1 
ATOM   4974  C CG    . PRO B 1 10  ? -22.200 78.375  41.219  1.00 25.04 ? 10   PRO B CG    1 
ATOM   4975  C CD    . PRO B 1 10  ? -23.600 78.896  41.202  1.00 24.48 ? 10   PRO B CD    1 
ATOM   4976  N N     . ALA B 1 11  ? -21.183 82.060  43.767  1.00 23.21 ? 11   ALA B N     1 
ATOM   4977  C CA    . ALA B 1 11  ? -20.906 83.486  43.962  1.00 22.48 ? 11   ALA B CA    1 
ATOM   4978  C C     . ALA B 1 11  ? -20.413 84.175  42.693  1.00 22.34 ? 11   ALA B C     1 
ATOM   4979  O O     . ALA B 1 11  ? -20.826 85.300  42.412  1.00 22.36 ? 11   ALA B O     1 
ATOM   4980  C CB    . ALA B 1 11  ? -19.883 83.680  45.094  1.00 22.73 ? 11   ALA B CB    1 
ATOM   4981  N N     . ASN B 1 12  ? -19.526 83.503  41.946  1.00 21.87 ? 12   ASN B N     1 
ATOM   4982  C CA    . ASN B 1 12  ? -19.005 84.013  40.676  1.00 21.20 ? 12   ASN B CA    1 
ATOM   4983  C C     . ASN B 1 12  ? -20.129 84.258  39.658  1.00 20.95 ? 12   ASN B C     1 
ATOM   4984  O O     . ASN B 1 12  ? -20.117 85.283  38.961  1.00 21.23 ? 12   ASN B O     1 
ATOM   4985  C CB    . ASN B 1 12  ? -17.904 83.096  40.089  1.00 21.44 ? 12   ASN B CB    1 
ATOM   4986  C CG    . ASN B 1 12  ? -18.447 81.749  39.561  1.00 21.92 ? 12   ASN B CG    1 
ATOM   4987  O OD1   . ASN B 1 12  ? -19.120 81.007  40.286  1.00 22.82 ? 12   ASN B OD1   1 
ATOM   4988  N ND2   . ASN B 1 12  ? -18.141 81.433  38.298  1.00 20.61 ? 12   ASN B ND2   1 
ATOM   4989  N N     . ILE B 1 13  ? -21.106 83.352  39.599  1.00 19.57 ? 13   ILE B N     1 
ATOM   4990  C CA    . ILE B 1 13  ? -22.220 83.506  38.665  1.00 19.18 ? 13   ILE B CA    1 
ATOM   4991  C C     . ILE B 1 13  ? -23.195 84.597  39.144  1.00 18.71 ? 13   ILE B C     1 
ATOM   4992  O O     . ILE B 1 13  ? -23.640 85.442  38.359  1.00 18.44 ? 13   ILE B O     1 
ATOM   4993  C CB    . ILE B 1 13  ? -22.935 82.145  38.388  1.00 19.11 ? 13   ILE B CB    1 
ATOM   4994  C CG1   . ILE B 1 13  ? -21.904 81.077  37.986  1.00 18.75 ? 13   ILE B CG1   1 
ATOM   4995  C CG2   . ILE B 1 13  ? -23.983 82.284  37.293  1.00 18.14 ? 13   ILE B CG2   1 
ATOM   4996  C CD1   . ILE B 1 13  ? -21.275 81.280  36.612  1.00 16.35 ? 13   ILE B CD1   1 
ATOM   4997  N N     . ALA B 1 14  ? -23.494 84.595  40.438  1.00 18.24 ? 14   ALA B N     1 
ATOM   4998  C CA    . ALA B 1 14  ? -24.314 85.643  41.043  1.00 17.92 ? 14   ALA B CA    1 
ATOM   4999  C C     . ALA B 1 14  ? -23.822 87.049  40.684  1.00 17.95 ? 14   ALA B C     1 
ATOM   5000  O O     . ALA B 1 14  ? -24.620 87.935  40.383  1.00 17.48 ? 14   ALA B O     1 
ATOM   5001  C CB    . ALA B 1 14  ? -24.357 85.473  42.553  1.00 17.16 ? 14   ALA B CB    1 
ATOM   5002  N N     . ASP B 1 15  ? -22.504 87.233  40.716  1.00 18.09 ? 15   ASP B N     1 
ATOM   5003  C CA    . ASP B 1 15  ? -21.880 88.527  40.534  1.00 18.57 ? 15   ASP B CA    1 
ATOM   5004  C C     . ASP B 1 15  ? -21.987 89.057  39.114  1.00 18.73 ? 15   ASP B C     1 
ATOM   5005  O O     . ASP B 1 15  ? -22.024 90.250  38.896  1.00 19.11 ? 15   ASP B O     1 
ATOM   5006  C CB    . ASP B 1 15  ? -20.408 88.448  40.961  1.00 18.90 ? 15   ASP B CB    1 
ATOM   5007  C CG    . ASP B 1 15  ? -20.226 88.426  42.493  1.00 20.72 ? 15   ASP B CG    1 
ATOM   5008  O OD1   . ASP B 1 15  ? -21.205 88.646  43.254  1.00 20.91 ? 15   ASP B OD1   1 
ATOM   5009  O OD2   . ASP B 1 15  ? -19.083 88.181  42.943  1.00 23.50 ? 15   ASP B OD2   1 
ATOM   5010  N N     . ARG B 1 16  ? -22.032 88.160  38.145  1.00 19.15 ? 16   ARG B N     1 
ATOM   5011  C CA    . ARG B 1 16  ? -21.978 88.540  36.743  1.00 19.59 ? 16   ARG B CA    1 
ATOM   5012  C C     . ARG B 1 16  ? -23.256 88.260  35.932  1.00 17.83 ? 16   ARG B C     1 
ATOM   5013  O O     . ARG B 1 16  ? -23.339 88.710  34.803  1.00 17.50 ? 16   ARG B O     1 
ATOM   5014  C CB    . ARG B 1 16  ? -20.754 87.876  36.063  1.00 19.90 ? 16   ARG B CB    1 
ATOM   5015  C CG    . ARG B 1 16  ? -20.842 86.306  35.931  1.00 23.33 ? 16   ARG B CG    1 
ATOM   5016  C CD    . ARG B 1 16  ? -19.476 85.624  35.587  1.00 23.19 ? 16   ARG B CD    1 
ATOM   5017  N NE    . ARG B 1 16  ? -19.404 85.199  34.179  1.00 31.73 ? 16   ARG B NE    1 
ATOM   5018  C CZ    . ARG B 1 16  ? -18.871 85.925  33.187  1.00 33.83 ? 16   ARG B CZ    1 
ATOM   5019  N NH1   . ARG B 1 16  ? -18.350 87.139  33.436  1.00 33.43 ? 16   ARG B NH1   1 
ATOM   5020  N NH2   . ARG B 1 16  ? -18.861 85.433  31.945  1.00 33.68 ? 16   ARG B NH2   1 
ATOM   5021  N N     . CYS B 1 17  ? -24.230 87.518  36.471  1.00 16.48 ? 17   CYS B N     1 
ATOM   5022  C CA    . CYS B 1 17  ? -25.353 87.064  35.640  1.00 15.97 ? 17   CYS B CA    1 
ATOM   5023  C C     . CYS B 1 17  ? -26.183 88.181  35.006  1.00 16.16 ? 17   CYS B C     1 
ATOM   5024  O O     . CYS B 1 17  ? -26.245 89.298  35.512  1.00 16.62 ? 17   CYS B O     1 
ATOM   5025  C CB    . CYS B 1 17  ? -26.257 86.106  36.394  1.00 15.98 ? 17   CYS B CB    1 
ATOM   5026  S SG    . CYS B 1 17  ? -27.213 86.832  37.757  1.00 16.83 ? 17   CYS B SG    1 
ATOM   5027  N N     . LEU B 1 18  ? -26.815 87.879  33.883  1.00 16.08 ? 18   LEU B N     1 
ATOM   5028  C CA    . LEU B 1 18  ? -27.723 88.827  33.229  1.00 15.73 ? 18   LEU B CA    1 
ATOM   5029  C C     . LEU B 1 18  ? -29.090 88.853  33.940  1.00 16.43 ? 18   LEU B C     1 
ATOM   5030  O O     . LEU B 1 18  ? -29.710 89.917  34.093  1.00 16.28 ? 18   LEU B O     1 
ATOM   5031  C CB    . LEU B 1 18  ? -27.877 88.484  31.737  1.00 14.65 ? 18   LEU B CB    1 
ATOM   5032  C CG    . LEU B 1 18  ? -26.591 88.319  30.918  1.00 13.76 ? 18   LEU B CG    1 
ATOM   5033  C CD1   . LEU B 1 18  ? -26.861 87.643  29.597  1.00 11.56 ? 18   LEU B CD1   1 
ATOM   5034  C CD2   . LEU B 1 18  ? -25.794 89.641  30.704  1.00 14.20 ? 18   LEU B CD2   1 
ATOM   5035  N N     . ILE B 1 19  ? -29.528 87.677  34.398  1.00 16.64 ? 19   ILE B N     1 
ATOM   5036  C CA    . ILE B 1 19  ? -30.843 87.500  34.998  1.00 17.01 ? 19   ILE B CA    1 
ATOM   5037  C C     . ILE B 1 19  ? -30.679 86.871  36.359  1.00 17.38 ? 19   ILE B C     1 
ATOM   5038  O O     . ILE B 1 19  ? -30.283 85.703  36.447  1.00 17.56 ? 19   ILE B O     1 
ATOM   5039  C CB    . ILE B 1 19  ? -31.722 86.569  34.139  1.00 17.18 ? 19   ILE B CB    1 
ATOM   5040  C CG1   . ILE B 1 19  ? -31.701 87.004  32.666  1.00 18.44 ? 19   ILE B CG1   1 
ATOM   5041  C CG2   . ILE B 1 19  ? -33.132 86.433  34.708  1.00 16.66 ? 19   ILE B CG2   1 
ATOM   5042  C CD1   . ILE B 1 19  ? -32.560 88.201  32.316  1.00 20.79 ? 19   ILE B CD1   1 
ATOM   5043  N N     . ASN B 1 20  ? -30.964 87.642  37.416  1.00 17.77 ? 20   ASN B N     1 
ATOM   5044  C CA    . ASN B 1 20  ? -30.864 87.127  38.780  1.00 18.36 ? 20   ASN B CA    1 
ATOM   5045  C C     . ASN B 1 20  ? -32.233 86.601  39.229  1.00 19.01 ? 20   ASN B C     1 
ATOM   5046  O O     . ASN B 1 20  ? -33.199 86.730  38.482  1.00 19.48 ? 20   ASN B O     1 
ATOM   5047  C CB    . ASN B 1 20  ? -30.325 88.196  39.720  1.00 18.23 ? 20   ASN B CB    1 
ATOM   5048  C CG    . ASN B 1 20  ? -31.297 89.366  39.912  1.00 19.60 ? 20   ASN B CG    1 
ATOM   5049  O OD1   . ASN B 1 20  ? -32.529 89.204  39.846  1.00 20.38 ? 20   ASN B OD1   1 
ATOM   5050  N ND2   . ASN B 1 20  ? -30.740 90.557  40.156  1.00 16.46 ? 20   ASN B ND2   1 
ATOM   5051  N N     . PRO B 1 21  ? -32.330 86.016  40.437  1.00 19.66 ? 21   PRO B N     1 
ATOM   5052  C CA    . PRO B 1 21  ? -33.595 85.368  40.798  1.00 20.15 ? 21   PRO B CA    1 
ATOM   5053  C C     . PRO B 1 21  ? -34.830 86.274  40.659  1.00 21.22 ? 21   PRO B C     1 
ATOM   5054  O O     . PRO B 1 21  ? -35.799 85.882  39.994  1.00 21.12 ? 21   PRO B O     1 
ATOM   5055  C CB    . PRO B 1 21  ? -33.366 84.932  42.247  1.00 19.87 ? 21   PRO B CB    1 
ATOM   5056  C CG    . PRO B 1 21  ? -31.872 84.788  42.360  1.00 19.42 ? 21   PRO B CG    1 
ATOM   5057  C CD    . PRO B 1 21  ? -31.322 85.890  41.513  1.00 19.74 ? 21   PRO B CD    1 
ATOM   5058  N N     . GLU B 1 22  ? -34.796 87.471  41.249  1.00 22.53 ? 22   GLU B N     1 
ATOM   5059  C CA    . GLU B 1 22  ? -35.930 88.418  41.140  1.00 23.77 ? 22   GLU B CA    1 
ATOM   5060  C C     . GLU B 1 22  ? -36.233 88.875  39.697  1.00 23.48 ? 22   GLU B C     1 
ATOM   5061  O O     . GLU B 1 22  ? -37.400 88.888  39.281  1.00 23.79 ? 22   GLU B O     1 
ATOM   5062  C CB    . GLU B 1 22  ? -35.765 89.637  42.046  1.00 23.88 ? 22   GLU B CB    1 
ATOM   5063  C CG    . GLU B 1 22  ? -36.511 90.883  41.512  1.00 27.77 ? 22   GLU B CG    1 
ATOM   5064  C CD    . GLU B 1 22  ? -36.913 91.867  42.615  1.00 33.38 ? 22   GLU B CD    1 
ATOM   5065  O OE1   . GLU B 1 22  ? -38.141 91.975  42.892  1.00 34.36 ? 22   GLU B OE1   1 
ATOM   5066  O OE2   . GLU B 1 22  ? -36.005 92.517  43.205  1.00 33.46 ? 22   GLU B OE2   1 
ATOM   5067  N N     . GLN B 1 23  ? -35.206 89.256  38.943  1.00 22.91 ? 23   GLN B N     1 
ATOM   5068  C CA    . GLN B 1 23  ? -35.428 89.623  37.544  1.00 22.59 ? 23   GLN B CA    1 
ATOM   5069  C C     . GLN B 1 23  ? -36.111 88.504  36.769  1.00 21.89 ? 23   GLN B C     1 
ATOM   5070  O O     . GLN B 1 23  ? -36.984 88.779  35.944  1.00 21.84 ? 23   GLN B O     1 
ATOM   5071  C CB    . GLN B 1 23  ? -34.128 90.026  36.860  1.00 22.81 ? 23   GLN B CB    1 
ATOM   5072  C CG    . GLN B 1 23  ? -33.439 91.195  37.522  1.00 23.59 ? 23   GLN B CG    1 
ATOM   5073  C CD    . GLN B 1 23  ? -31.996 91.370  37.060  1.00 25.04 ? 23   GLN B CD    1 
ATOM   5074  O OE1   . GLN B 1 23  ? -31.356 90.438  36.536  1.00 26.24 ? 23   GLN B OE1   1 
ATOM   5075  N NE2   . GLN B 1 23  ? -31.472 92.565  37.263  1.00 22.71 ? 23   GLN B NE2   1 
ATOM   5076  N N     . TYR B 1 24  ? -35.718 87.253  37.033  1.00 21.19 ? 24   TYR B N     1 
ATOM   5077  C CA    . TYR B 1 24  ? -36.425 86.106  36.462  1.00 20.76 ? 24   TYR B CA    1 
ATOM   5078  C C     . TYR B 1 24  ? -37.931 86.136  36.801  1.00 20.95 ? 24   TYR B C     1 
ATOM   5079  O O     . TYR B 1 24  ? -38.768 86.098  35.903  1.00 21.27 ? 24   TYR B O     1 
ATOM   5080  C CB    . TYR B 1 24  ? -35.803 84.737  36.835  1.00 20.01 ? 24   TYR B CB    1 
ATOM   5081  C CG    . TYR B 1 24  ? -36.716 83.609  36.399  1.00 19.15 ? 24   TYR B CG    1 
ATOM   5082  C CD1   . TYR B 1 24  ? -36.809 83.232  35.056  1.00 19.55 ? 24   TYR B CD1   1 
ATOM   5083  C CD2   . TYR B 1 24  ? -37.542 82.968  37.316  1.00 19.74 ? 24   TYR B CD2   1 
ATOM   5084  C CE1   . TYR B 1 24  ? -37.691 82.224  34.642  1.00 18.81 ? 24   TYR B CE1   1 
ATOM   5085  C CE2   . TYR B 1 24  ? -38.426 81.968  36.920  1.00 20.00 ? 24   TYR B CE2   1 
ATOM   5086  C CZ    . TYR B 1 24  ? -38.500 81.600  35.582  1.00 19.49 ? 24   TYR B CZ    1 
ATOM   5087  O OH    . TYR B 1 24  ? -39.380 80.603  35.207  1.00 17.97 ? 24   TYR B OH    1 
ATOM   5088  N N     . GLU B 1 25  ? -38.277 86.197  38.087  1.00 21.05 ? 25   GLU B N     1 
ATOM   5089  C CA    . GLU B 1 25  ? -39.688 86.262  38.491  1.00 20.93 ? 25   GLU B CA    1 
ATOM   5090  C C     . GLU B 1 25  ? -40.435 87.390  37.758  1.00 20.25 ? 25   GLU B C     1 
ATOM   5091  O O     . GLU B 1 25  ? -41.500 87.156  37.186  1.00 20.28 ? 25   GLU B O     1 
ATOM   5092  C CB    . GLU B 1 25  ? -39.859 86.356  40.027  1.00 21.16 ? 25   GLU B CB    1 
ATOM   5093  C CG    . GLU B 1 25  ? -39.587 85.031  40.830  1.00 24.46 ? 25   GLU B CG    1 
ATOM   5094  C CD    . GLU B 1 25  ? -40.230 83.771  40.206  1.00 28.03 ? 25   GLU B CD    1 
ATOM   5095  O OE1   . GLU B 1 25  ? -41.216 83.905  39.435  1.00 31.03 ? 25   GLU B OE1   1 
ATOM   5096  O OE2   . GLU B 1 25  ? -39.748 82.644  40.472  1.00 28.01 ? 25   GLU B OE2   1 
ATOM   5097  N N     . THR B 1 26  ? -39.848 88.586  37.748  1.00 19.08 ? 26   THR B N     1 
ATOM   5098  C CA    . THR B 1 26  ? -40.469 89.762  37.171  1.00 18.29 ? 26   THR B CA    1 
ATOM   5099  C C     . THR B 1 26  ? -40.617 89.629  35.659  1.00 18.48 ? 26   THR B C     1 
ATOM   5100  O O     . THR B 1 26  ? -41.726 89.791  35.141  1.00 18.20 ? 26   THR B O     1 
ATOM   5101  C CB    . THR B 1 26  ? -39.700 91.045  37.559  1.00 18.19 ? 26   THR B CB    1 
ATOM   5102  O OG1   . THR B 1 26  ? -39.722 91.163  38.981  1.00 17.22 ? 26   THR B OG1   1 
ATOM   5103  C CG2   . THR B 1 26  ? -40.314 92.310  36.908  1.00 16.63 ? 26   THR B CG2   1 
ATOM   5104  N N     . LYS B 1 27  ? -39.520 89.325  34.962  1.00 18.31 ? 27   LYS B N     1 
ATOM   5105  C CA    . LYS B 1 27  ? -39.583 89.103  33.518  1.00 18.95 ? 27   LYS B CA    1 
ATOM   5106  C C     . LYS B 1 27  ? -40.555 87.977  33.127  1.00 18.71 ? 27   LYS B C     1 
ATOM   5107  O O     . LYS B 1 27  ? -41.371 88.146  32.217  1.00 18.65 ? 27   LYS B O     1 
ATOM   5108  C CB    . LYS B 1 27  ? -38.189 88.922  32.902  1.00 19.15 ? 27   LYS B CB    1 
ATOM   5109  C CG    . LYS B 1 27  ? -37.394 90.233  32.861  1.00 20.13 ? 27   LYS B CG    1 
ATOM   5110  C CD    . LYS B 1 27  ? -36.033 90.133  32.147  1.00 20.43 ? 27   LYS B CD    1 
ATOM   5111  C CE    . LYS B 1 27  ? -35.369 91.536  32.079  1.00 22.91 ? 27   LYS B CE    1 
ATOM   5112  N NZ    . LYS B 1 27  ? -34.358 91.584  30.982  1.00 26.82 ? 27   LYS B NZ    1 
ATOM   5113  N N     . TYR B 1 28  ? -40.514 86.856  33.845  1.00 18.88 ? 28   TYR B N     1 
ATOM   5114  C CA    . TYR B 1 28  ? -41.439 85.766  33.567  1.00 18.81 ? 28   TYR B CA    1 
ATOM   5115  C C     . TYR B 1 28  ? -42.886 86.229  33.650  1.00 19.21 ? 28   TYR B C     1 
ATOM   5116  O O     . TYR B 1 28  ? -43.639 86.041  32.704  1.00 19.89 ? 28   TYR B O     1 
ATOM   5117  C CB    . TYR B 1 28  ? -41.222 84.519  34.453  1.00 18.08 ? 28   TYR B CB    1 
ATOM   5118  C CG    . TYR B 1 28  ? -42.194 83.421  34.077  1.00 16.16 ? 28   TYR B CG    1 
ATOM   5119  C CD1   . TYR B 1 28  ? -41.945 82.588  32.976  1.00 16.42 ? 28   TYR B CD1   1 
ATOM   5120  C CD2   . TYR B 1 28  ? -43.396 83.255  34.767  1.00 15.05 ? 28   TYR B CD2   1 
ATOM   5121  C CE1   . TYR B 1 28  ? -42.857 81.584  32.596  1.00 15.79 ? 28   TYR B CE1   1 
ATOM   5122  C CE2   . TYR B 1 28  ? -44.304 82.249  34.412  1.00 14.99 ? 28   TYR B CE2   1 
ATOM   5123  C CZ    . TYR B 1 28  ? -44.029 81.428  33.323  1.00 16.38 ? 28   TYR B CZ    1 
ATOM   5124  O OH    . TYR B 1 28  ? -44.929 80.467  32.944  1.00 16.55 ? 28   TYR B OH    1 
ATOM   5125  N N     . LYS B 1 29  ? -43.283 86.829  34.765  1.00 19.46 ? 29   LYS B N     1 
ATOM   5126  C CA    . LYS B 1 29  ? -44.691 87.188  34.931  1.00 20.01 ? 29   LYS B CA    1 
ATOM   5127  C C     . LYS B 1 29  ? -45.168 88.263  33.929  1.00 20.33 ? 29   LYS B C     1 
ATOM   5128  O O     . LYS B 1 29  ? -46.316 88.228  33.488  1.00 20.71 ? 29   LYS B O     1 
ATOM   5129  C CB    . LYS B 1 29  ? -45.030 87.544  36.386  1.00 20.21 ? 29   LYS B CB    1 
ATOM   5130  N N     . GLN B 1 30  ? -44.296 89.200  33.557  1.00 20.64 ? 30   GLN B N     1 
ATOM   5131  C CA    . GLN B 1 30  ? -44.627 90.143  32.487  1.00 20.80 ? 30   GLN B CA    1 
ATOM   5132  C C     . GLN B 1 30  ? -44.791 89.376  31.162  1.00 20.55 ? 30   GLN B C     1 
ATOM   5133  O O     . GLN B 1 30  ? -45.682 89.691  30.371  1.00 20.65 ? 30   GLN B O     1 
ATOM   5134  C CB    . GLN B 1 30  ? -43.614 91.308  32.365  1.00 20.35 ? 30   GLN B CB    1 
ATOM   5135  C CG    . GLN B 1 30  ? -44.142 92.508  31.515  1.00 20.78 ? 30   GLN B CG    1 
ATOM   5136  C CD    . GLN B 1 30  ? -43.036 93.433  30.916  1.00 21.83 ? 30   GLN B CD    1 
ATOM   5137  O OE1   . GLN B 1 30  ? -41.889 93.024  30.727  1.00 21.22 ? 30   GLN B OE1   1 
ATOM   5138  N NE2   . GLN B 1 30  ? -43.409 94.685  30.604  1.00 22.31 ? 30   GLN B NE2   1 
ATOM   5139  N N     . SER B 1 31  ? -43.968 88.354  30.938  1.00 20.41 ? 31   SER B N     1 
ATOM   5140  C CA    . SER B 1 31  ? -44.059 87.586  29.700  1.00 20.65 ? 31   SER B CA    1 
ATOM   5141  C C     . SER B 1 31  ? -45.385 86.840  29.554  1.00 21.55 ? 31   SER B C     1 
ATOM   5142  O O     . SER B 1 31  ? -45.825 86.583  28.422  1.00 21.74 ? 31   SER B O     1 
ATOM   5143  C CB    . SER B 1 31  ? -42.895 86.622  29.554  1.00 20.25 ? 31   SER B CB    1 
ATOM   5144  O OG    . SER B 1 31  ? -43.170 85.419  30.230  1.00 18.78 ? 31   SER B OG    1 
ATOM   5145  N N     . ILE B 1 32  ? -46.015 86.503  30.681  1.00 22.46 ? 32   ILE B N     1 
ATOM   5146  C CA    . ILE B 1 32  ? -47.308 85.823  30.671  1.00 23.88 ? 32   ILE B CA    1 
ATOM   5147  C C     . ILE B 1 32  ? -48.474 86.817  30.663  1.00 24.90 ? 32   ILE B C     1 
ATOM   5148  O O     . ILE B 1 32  ? -49.368 86.710  29.821  1.00 25.41 ? 32   ILE B O     1 
ATOM   5149  C CB    . ILE B 1 32  ? -47.465 84.838  31.864  1.00 24.14 ? 32   ILE B CB    1 
ATOM   5150  C CG1   . ILE B 1 32  ? -46.346 83.787  31.872  1.00 25.25 ? 32   ILE B CG1   1 
ATOM   5151  C CG2   . ILE B 1 32  ? -48.827 84.157  31.846  1.00 23.60 ? 32   ILE B CG2   1 
ATOM   5152  C CD1   . ILE B 1 32  ? -45.964 83.205  30.508  1.00 24.03 ? 32   ILE B CD1   1 
ATOM   5153  N N     . ASN B 1 33  ? -48.461 87.779  31.589  1.00 25.71 ? 33   ASN B N     1 
ATOM   5154  C CA    . ASN B 1 33  ? -49.553 88.760  31.718  1.00 26.52 ? 33   ASN B CA    1 
ATOM   5155  C C     . ASN B 1 33  ? -49.671 89.731  30.539  1.00 26.34 ? 33   ASN B C     1 
ATOM   5156  O O     . ASN B 1 33  ? -50.772 90.184  30.206  1.00 26.30 ? 33   ASN B O     1 
ATOM   5157  C CB    . ASN B 1 33  ? -49.446 89.547  33.036  1.00 26.63 ? 33   ASN B CB    1 
ATOM   5158  C CG    . ASN B 1 33  ? -49.607 88.656  34.264  1.00 29.00 ? 33   ASN B CG    1 
ATOM   5159  O OD1   . ASN B 1 33  ? -49.976 87.472  34.156  1.00 30.08 ? 33   ASN B OD1   1 
ATOM   5160  N ND2   . ASN B 1 33  ? -49.339 89.224  35.447  1.00 30.20 ? 33   ASN B ND2   1 
ATOM   5161  N N     . ASP B 1 34  ? -48.540 90.057  29.922  1.00 25.79 ? 34   ASP B N     1 
ATOM   5162  C CA    . ASP B 1 34  ? -48.541 91.014  28.820  1.00 25.29 ? 34   ASP B CA    1 
ATOM   5163  C C     . ASP B 1 34  ? -47.440 90.712  27.778  1.00 24.74 ? 34   ASP B C     1 
ATOM   5164  O O     . ASP B 1 34  ? -46.405 91.383  27.743  1.00 24.74 ? 34   ASP B O     1 
ATOM   5165  C CB    . ASP B 1 34  ? -48.429 92.429  29.382  1.00 25.09 ? 34   ASP B CB    1 
ATOM   5166  C CG    . ASP B 1 34  ? -48.645 93.504  28.330  1.00 26.34 ? 34   ASP B CG    1 
ATOM   5167  O OD1   . ASP B 1 34  ? -49.128 93.215  27.206  1.00 26.29 ? 34   ASP B OD1   1 
ATOM   5168  O OD2   . ASP B 1 34  ? -48.328 94.666  28.645  1.00 27.59 ? 34   ASP B OD2   1 
ATOM   5169  N N     . PRO B 1 35  ? -47.668 89.694  26.925  1.00 24.30 ? 35   PRO B N     1 
ATOM   5170  C CA    . PRO B 1 35  ? -46.680 89.284  25.913  1.00 23.53 ? 35   PRO B CA    1 
ATOM   5171  C C     . PRO B 1 35  ? -46.360 90.355  24.879  1.00 22.56 ? 35   PRO B C     1 
ATOM   5172  O O     . PRO B 1 35  ? -45.207 90.474  24.487  1.00 22.64 ? 35   PRO B O     1 
ATOM   5173  C CB    . PRO B 1 35  ? -47.331 88.068  25.233  1.00 23.51 ? 35   PRO B CB    1 
ATOM   5174  C CG    . PRO B 1 35  ? -48.392 87.596  26.194  1.00 24.53 ? 35   PRO B CG    1 
ATOM   5175  C CD    . PRO B 1 35  ? -48.880 88.850  26.884  1.00 24.50 ? 35   PRO B CD    1 
ATOM   5176  N N     . ASP B 1 36  ? -47.354 91.122  24.444  1.00 21.77 ? 36   ASP B N     1 
ATOM   5177  C CA    . ASP B 1 36  ? -47.124 92.196  23.461  1.00 21.24 ? 36   ASP B CA    1 
ATOM   5178  C C     . ASP B 1 36  ? -46.062 93.195  23.962  1.00 20.70 ? 36   ASP B C     1 
ATOM   5179  O O     . ASP B 1 36  ? -45.202 93.641  23.202  1.00 20.09 ? 36   ASP B O     1 
ATOM   5180  C CB    . ASP B 1 36  ? -48.429 92.950  23.102  1.00 21.21 ? 36   ASP B CB    1 
ATOM   5181  C CG    . ASP B 1 36  ? -49.333 92.189  22.114  1.00 21.06 ? 36   ASP B CG    1 
ATOM   5182  O OD1   . ASP B 1 36  ? -50.511 92.541  22.037  1.00 21.80 ? 36   ASP B OD1   1 
ATOM   5183  O OD2   . ASP B 1 36  ? -48.900 91.268  21.403  1.00 20.12 ? 36   ASP B OD2   1 
ATOM   5184  N N     . THR B 1 37  ? -46.124 93.539  25.247  1.00 20.14 ? 37   THR B N     1 
ATOM   5185  C CA    . THR B 1 37  ? -45.185 94.515  25.799  1.00 19.47 ? 37   THR B CA    1 
ATOM   5186  C C     . THR B 1 37  ? -43.814 93.851  25.921  1.00 18.92 ? 37   THR B C     1 
ATOM   5187  O O     . THR B 1 37  ? -42.806 94.372  25.418  1.00 19.25 ? 37   THR B O     1 
ATOM   5188  C CB    . THR B 1 37  ? -45.688 95.083  27.164  1.00 19.81 ? 37   THR B CB    1 
ATOM   5189  O OG1   . THR B 1 37  ? -46.956 95.735  26.973  1.00 19.14 ? 37   THR B OG1   1 
ATOM   5190  C CG2   . THR B 1 37  ? -44.677 96.067  27.790  1.00 18.69 ? 37   THR B CG2   1 
ATOM   5191  N N     . PHE B 1 38  ? -43.795 92.678  26.546  1.00 17.58 ? 38   PHE B N     1 
ATOM   5192  C CA    . PHE B 1 38  ? -42.553 91.972  26.783  1.00 16.77 ? 38   PHE B CA    1 
ATOM   5193  C C     . PHE B 1 38  ? -41.830 91.628  25.482  1.00 16.61 ? 38   PHE B C     1 
ATOM   5194  O O     . PHE B 1 38  ? -40.699 92.072  25.248  1.00 17.44 ? 38   PHE B O     1 
ATOM   5195  C CB    . PHE B 1 38  ? -42.785 90.737  27.641  1.00 16.16 ? 38   PHE B CB    1 
ATOM   5196  C CG    . PHE B 1 38  ? -41.546 89.964  27.914  1.00 16.01 ? 38   PHE B CG    1 
ATOM   5197  C CD1   . PHE B 1 38  ? -40.819 90.192  29.073  1.00 17.04 ? 38   PHE B CD1   1 
ATOM   5198  C CD2   . PHE B 1 38  ? -41.094 89.000  27.000  1.00 15.24 ? 38   PHE B CD2   1 
ATOM   5199  C CE1   . PHE B 1 38  ? -39.668 89.465  29.334  1.00 16.55 ? 38   PHE B CE1   1 
ATOM   5200  C CE2   . PHE B 1 38  ? -39.956 88.274  27.234  1.00 14.18 ? 38   PHE B CE2   1 
ATOM   5201  C CZ    . PHE B 1 38  ? -39.235 88.498  28.403  1.00 16.63 ? 38   PHE B CZ    1 
ATOM   5202  N N     . TRP B 1 39  ? -42.485 90.876  24.616  1.00 16.26 ? 39   TRP B N     1 
ATOM   5203  C CA    . TRP B 1 39  ? -41.870 90.518  23.335  1.00 16.12 ? 39   TRP B CA    1 
ATOM   5204  C C     . TRP B 1 39  ? -41.588 91.713  22.405  1.00 16.68 ? 39   TRP B C     1 
ATOM   5205  O O     . TRP B 1 39  ? -40.654 91.655  21.594  1.00 17.07 ? 39   TRP B O     1 
ATOM   5206  C CB    . TRP B 1 39  ? -42.640 89.376  22.664  1.00 15.11 ? 39   TRP B CB    1 
ATOM   5207  C CG    . TRP B 1 39  ? -42.433 88.065  23.416  1.00 14.42 ? 39   TRP B CG    1 
ATOM   5208  C CD1   . TRP B 1 39  ? -43.388 87.316  24.048  1.00 13.81 ? 39   TRP B CD1   1 
ATOM   5209  C CD2   . TRP B 1 39  ? -41.184 87.388  23.642  1.00 13.03 ? 39   TRP B CD2   1 
ATOM   5210  N NE1   . TRP B 1 39  ? -42.821 86.203  24.629  1.00 13.44 ? 39   TRP B NE1   1 
ATOM   5211  C CE2   . TRP B 1 39  ? -41.469 86.223  24.396  1.00 14.47 ? 39   TRP B CE2   1 
ATOM   5212  C CE3   . TRP B 1 39  ? -39.857 87.640  23.267  1.00 11.90 ? 39   TRP B CE3   1 
ATOM   5213  C CZ2   . TRP B 1 39  ? -40.467 85.318  24.787  1.00 14.03 ? 39   TRP B CZ2   1 
ATOM   5214  C CZ3   . TRP B 1 39  ? -38.870 86.732  23.639  1.00 12.68 ? 39   TRP B CZ3   1 
ATOM   5215  C CH2   . TRP B 1 39  ? -39.179 85.590  24.394  1.00 13.23 ? 39   TRP B CH2   1 
ATOM   5216  N N     . GLY B 1 40  ? -42.354 92.800  22.561  1.00 17.02 ? 40   GLY B N     1 
ATOM   5217  C CA    . GLY B 1 40  ? -42.108 94.040  21.834  1.00 17.17 ? 40   GLY B CA    1 
ATOM   5218  C C     . GLY B 1 40  ? -40.783 94.673  22.216  1.00 17.89 ? 40   GLY B C     1 
ATOM   5219  O O     . GLY B 1 40  ? -40.048 95.142  21.359  1.00 17.75 ? 40   GLY B O     1 
ATOM   5220  N N     . GLU B 1 41  ? -40.453 94.694  23.502  1.00 18.86 ? 41   GLU B N     1 
ATOM   5221  C CA    . GLU B 1 41  ? -39.139 95.211  23.902  1.00 20.06 ? 41   GLU B CA    1 
ATOM   5222  C C     . GLU B 1 41  ? -38.055 94.170  23.624  1.00 19.21 ? 41   GLU B C     1 
ATOM   5223  O O     . GLU B 1 41  ? -36.958 94.511  23.186  1.00 19.52 ? 41   GLU B O     1 
ATOM   5224  C CB    . GLU B 1 41  ? -39.120 95.680  25.369  1.00 20.09 ? 41   GLU B CB    1 
ATOM   5225  C CG    . GLU B 1 41  ? -39.831 97.047  25.577  1.00 22.57 ? 41   GLU B CG    1 
ATOM   5226  C CD    . GLU B 1 41  ? -40.436 97.252  27.009  1.00 23.13 ? 41   GLU B CD    1 
ATOM   5227  O OE1   . GLU B 1 41  ? -41.104 98.301  27.234  1.00 25.72 ? 41   GLU B OE1   1 
ATOM   5228  O OE2   . GLU B 1 41  ? -40.246 96.379  27.900  1.00 25.16 ? 41   GLU B OE2   1 
ATOM   5229  N N     . GLN B 1 42  ? -38.368 92.899  23.834  1.00 18.25 ? 42   GLN B N     1 
ATOM   5230  C CA    . GLN B 1 42  ? -37.347 91.868  23.691  1.00 17.64 ? 42   GLN B CA    1 
ATOM   5231  C C     . GLN B 1 42  ? -36.926 91.592  22.210  1.00 17.06 ? 42   GLN B C     1 
ATOM   5232  O O     . GLN B 1 42  ? -35.759 91.328  21.922  1.00 16.91 ? 42   GLN B O     1 
ATOM   5233  C CB    . GLN B 1 42  ? -37.773 90.619  24.460  1.00 17.07 ? 42   GLN B CB    1 
ATOM   5234  C CG    . GLN B 1 42  ? -36.731 89.551  24.527  1.00 18.05 ? 42   GLN B CG    1 
ATOM   5235  C CD    . GLN B 1 42  ? -35.373 90.062  24.953  1.00 16.70 ? 42   GLN B CD    1 
ATOM   5236  O OE1   . GLN B 1 42  ? -34.350 89.673  24.394  1.00 15.24 ? 42   GLN B OE1   1 
ATOM   5237  N NE2   . GLN B 1 42  ? -35.356 90.915  25.948  1.00 16.61 ? 42   GLN B NE2   1 
ATOM   5238  N N     . GLY B 1 43  ? -37.861 91.719  21.276  1.00 16.54 ? 43   GLY B N     1 
ATOM   5239  C CA    . GLY B 1 43  ? -37.532 91.628  19.862  1.00 16.30 ? 43   GLY B CA    1 
ATOM   5240  C C     . GLY B 1 43  ? -36.517 92.647  19.345  1.00 15.93 ? 43   GLY B C     1 
ATOM   5241  O O     . GLY B 1 43  ? -36.065 92.523  18.222  1.00 15.77 ? 43   GLY B O     1 
ATOM   5242  N N     . LYS B 1 44  ? -36.152 93.646  20.149  1.00 16.00 ? 44   LYS B N     1 
ATOM   5243  C CA    . LYS B 1 44  ? -35.099 94.618  19.770  1.00 16.13 ? 44   LYS B CA    1 
ATOM   5244  C C     . LYS B 1 44  ? -33.683 93.995  19.838  1.00 15.95 ? 44   LYS B C     1 
ATOM   5245  O O     . LYS B 1 44  ? -32.678 94.631  19.510  1.00 15.47 ? 44   LYS B O     1 
ATOM   5246  C CB    . LYS B 1 44  ? -35.165 95.910  20.624  1.00 17.14 ? 44   LYS B CB    1 
ATOM   5247  C CG    . LYS B 1 44  ? -36.492 96.736  20.606  1.00 17.24 ? 44   LYS B CG    1 
ATOM   5248  C CD    . LYS B 1 44  ? -37.034 96.945  19.178  1.00 21.68 ? 44   LYS B CD    1 
ATOM   5249  C CE    . LYS B 1 44  ? -38.385 97.726  19.134  1.00 22.52 ? 44   LYS B CE    1 
ATOM   5250  N NZ    . LYS B 1 44  ? -38.376 99.015  19.912  1.00 22.92 ? 44   LYS B NZ    1 
ATOM   5251  N N     . ILE B 1 45  ? -33.606 92.740  20.269  1.00 15.65 ? 45   ILE B N     1 
ATOM   5252  C CA    . ILE B 1 45  ? -32.355 91.994  20.229  1.00 15.05 ? 45   ILE B CA    1 
ATOM   5253  C C     . ILE B 1 45  ? -31.870 91.810  18.774  1.00 15.36 ? 45   ILE B C     1 
ATOM   5254  O O     . ILE B 1 45  ? -30.666 91.656  18.523  1.00 15.34 ? 45   ILE B O     1 
ATOM   5255  C CB    . ILE B 1 45  ? -32.519 90.633  20.948  1.00 15.02 ? 45   ILE B CB    1 
ATOM   5256  C CG1   . ILE B 1 45  ? -31.151 89.992  21.219  1.00 12.19 ? 45   ILE B CG1   1 
ATOM   5257  C CG2   . ILE B 1 45  ? -33.537 89.729  20.173  1.00 14.48 ? 45   ILE B CG2   1 
ATOM   5258  C CD1   . ILE B 1 45  ? -31.177 88.908  22.268  1.00 11.44 ? 45   ILE B CD1   1 
ATOM   5259  N N     . LEU B 1 46  ? -32.815 91.832  17.830  1.00 15.25 ? 46   LEU B N     1 
ATOM   5260  C CA    . LEU B 1 46  ? -32.516 91.868  16.389  1.00 15.02 ? 46   LEU B CA    1 
ATOM   5261  C C     . LEU B 1 46  ? -32.655 93.264  15.835  1.00 15.18 ? 46   LEU B C     1 
ATOM   5262  O O     . LEU B 1 46  ? -33.366 94.098  16.404  1.00 14.51 ? 46   LEU B O     1 
ATOM   5263  C CB    . LEU B 1 46  ? -33.475 90.972  15.609  1.00 14.40 ? 46   LEU B CB    1 
ATOM   5264  C CG    . LEU B 1 46  ? -33.696 89.563  16.136  1.00 14.18 ? 46   LEU B CG    1 
ATOM   5265  C CD1   . LEU B 1 46  ? -34.550 88.787  15.142  1.00 13.14 ? 46   LEU B CD1   1 
ATOM   5266  C CD2   . LEU B 1 46  ? -32.349 88.855  16.397  1.00 13.07 ? 46   LEU B CD2   1 
ATOM   5267  N N     . ASP B 1 47  ? -31.969 93.500  14.718  1.00 15.91 ? 47   ASP B N     1 
ATOM   5268  C CA    . ASP B 1 47  ? -32.213 94.664  13.873  1.00 16.64 ? 47   ASP B CA    1 
ATOM   5269  C C     . ASP B 1 47  ? -33.388 94.323  12.970  1.00 16.67 ? 47   ASP B C     1 
ATOM   5270  O O     . ASP B 1 47  ? -33.420 93.252  12.351  1.00 17.07 ? 47   ASP B O     1 
ATOM   5271  C CB    . ASP B 1 47  ? -31.000 94.990  12.976  1.00 17.17 ? 47   ASP B CB    1 
ATOM   5272  C CG    . ASP B 1 47  ? -29.788 95.515  13.756  1.00 18.90 ? 47   ASP B CG    1 
ATOM   5273  O OD1   . ASP B 1 47  ? -28.798 95.892  13.092  1.00 21.84 ? 47   ASP B OD1   1 
ATOM   5274  O OD2   . ASP B 1 47  ? -29.809 95.566  15.005  1.00 19.17 ? 47   ASP B OD2   1 
ATOM   5275  N N     . TRP B 1 48  ? -34.346 95.239  12.893  1.00 16.32 ? 48   TRP B N     1 
ATOM   5276  C CA    . TRP B 1 48  ? -35.459 95.125  11.959  1.00 16.13 ? 48   TRP B CA    1 
ATOM   5277  C C     . TRP B 1 48  ? -35.288 96.172  10.844  1.00 16.85 ? 48   TRP B C     1 
ATOM   5278  O O     . TRP B 1 48  ? -34.731 97.258  11.065  1.00 17.00 ? 48   TRP B O     1 
ATOM   5279  C CB    . TRP B 1 48  ? -36.791 95.286  12.708  1.00 15.01 ? 48   TRP B CB    1 
ATOM   5280  C CG    . TRP B 1 48  ? -36.985 94.190  13.704  1.00 14.11 ? 48   TRP B CG    1 
ATOM   5281  C CD1   . TRP B 1 48  ? -36.396 94.081  14.937  1.00 12.31 ? 48   TRP B CD1   1 
ATOM   5282  C CD2   . TRP B 1 48  ? -37.790 93.017  13.539  1.00 12.16 ? 48   TRP B CD2   1 
ATOM   5283  N NE1   . TRP B 1 48  ? -36.791 92.913  15.550  1.00 11.55 ? 48   TRP B NE1   1 
ATOM   5284  C CE2   . TRP B 1 48  ? -37.652 92.243  14.723  1.00 11.27 ? 48   TRP B CE2   1 
ATOM   5285  C CE3   . TRP B 1 48  ? -38.633 92.556  12.522  1.00 11.67 ? 48   TRP B CE3   1 
ATOM   5286  C CZ2   . TRP B 1 48  ? -38.314 91.024  14.916  1.00 11.63 ? 48   TRP B CZ2   1 
ATOM   5287  C CZ3   . TRP B 1 48  ? -39.308 91.330  12.717  1.00 13.45 ? 48   TRP B CZ3   1 
ATOM   5288  C CH2   . TRP B 1 48  ? -39.129 90.574  13.914  1.00 12.58 ? 48   TRP B CH2   1 
ATOM   5289  N N     . ILE B 1 49  ? -35.718 95.821  9.639   1.00 17.12 ? 49   ILE B N     1 
ATOM   5290  C CA    . ILE B 1 49  ? -35.611 96.717  8.510   1.00 17.01 ? 49   ILE B CA    1 
ATOM   5291  C C     . ILE B 1 49  ? -36.821 97.662  8.518   1.00 17.93 ? 49   ILE B C     1 
ATOM   5292  O O     . ILE B 1 49  ? -36.671 98.881  8.482   1.00 17.90 ? 49   ILE B O     1 
ATOM   5293  C CB    . ILE B 1 49  ? -35.457 95.929  7.192   1.00 16.53 ? 49   ILE B CB    1 
ATOM   5294  C CG1   . ILE B 1 49  ? -34.146 95.160  7.257   1.00 15.06 ? 49   ILE B CG1   1 
ATOM   5295  C CG2   . ILE B 1 49  ? -35.545 96.886  5.950   1.00 15.50 ? 49   ILE B CG2   1 
ATOM   5296  C CD1   . ILE B 1 49  ? -33.939 94.127  6.174   1.00 14.06 ? 49   ILE B CD1   1 
ATOM   5297  N N     . THR B 1 50  ? -38.023 97.108  8.557   1.00 18.70 ? 50   THR B N     1 
ATOM   5298  C CA    . THR B 1 50  ? -39.152 97.944  8.879   1.00 19.88 ? 50   THR B CA    1 
ATOM   5299  C C     . THR B 1 50  ? -39.747 97.361  10.173  1.00 20.15 ? 50   THR B C     1 
ATOM   5300  O O     . THR B 1 50  ? -40.082 96.169  10.225  1.00 19.77 ? 50   THR B O     1 
ATOM   5301  C CB    . THR B 1 50  ? -40.160 98.151  7.686   1.00 19.98 ? 50   THR B CB    1 
ATOM   5302  O OG1   . THR B 1 50  ? -41.344 97.376  7.886   1.00 21.88 ? 50   THR B OG1   1 
ATOM   5303  C CG2   . THR B 1 50  ? -39.543 97.797  6.337   1.00 19.63 ? 50   THR B CG2   1 
ATOM   5304  N N     . PRO B 1 51  ? -39.813 98.195  11.238  1.00 20.50 ? 51   PRO B N     1 
ATOM   5305  C CA    . PRO B 1 51  ? -40.216 97.768  12.583  1.00 20.14 ? 51   PRO B CA    1 
ATOM   5306  C C     . PRO B 1 51  ? -41.574 97.132  12.548  1.00 19.97 ? 51   PRO B C     1 
ATOM   5307  O O     . PRO B 1 51  ? -42.371 97.443  11.686  1.00 20.21 ? 51   PRO B O     1 
ATOM   5308  C CB    . PRO B 1 51  ? -40.292 99.083  13.381  1.00 20.06 ? 51   PRO B CB    1 
ATOM   5309  C CG    . PRO B 1 51  ? -40.279 100.200 12.339  1.00 20.44 ? 51   PRO B CG    1 
ATOM   5310  C CD    . PRO B 1 51  ? -39.504 99.641  11.188  1.00 20.55 ? 51   PRO B CD    1 
ATOM   5311  N N     . TYR B 1 52  ? -41.827 96.219  13.465  1.00 20.36 ? 52   TYR B N     1 
ATOM   5312  C CA    . TYR B 1 52  ? -43.155 95.640  13.593  1.00 20.35 ? 52   TYR B CA    1 
ATOM   5313  C C     . TYR B 1 52  ? -44.007 96.589  14.453  1.00 21.16 ? 52   TYR B C     1 
ATOM   5314  O O     . TYR B 1 52  ? -43.465 97.423  15.209  1.00 21.12 ? 52   TYR B O     1 
ATOM   5315  C CB    . TYR B 1 52  ? -43.063 94.240  14.234  1.00 19.20 ? 52   TYR B CB    1 
ATOM   5316  C CG    . TYR B 1 52  ? -42.198 94.218  15.469  1.00 18.30 ? 52   TYR B CG    1 
ATOM   5317  C CD1   . TYR B 1 52  ? -42.697 94.651  16.716  1.00 14.27 ? 52   TYR B CD1   1 
ATOM   5318  C CD2   . TYR B 1 52  ? -40.867 93.789  15.398  1.00 18.23 ? 52   TYR B CD2   1 
ATOM   5319  C CE1   . TYR B 1 52  ? -41.902 94.655  17.839  1.00 11.21 ? 52   TYR B CE1   1 
ATOM   5320  C CE2   . TYR B 1 52  ? -40.064 93.775  16.531  1.00 15.23 ? 52   TYR B CE2   1 
ATOM   5321  C CZ    . TYR B 1 52  ? -40.591 94.216  17.739  1.00 15.18 ? 52   TYR B CZ    1 
ATOM   5322  O OH    . TYR B 1 52  ? -39.773 94.212  18.847  1.00 18.34 ? 52   TYR B OH    1 
ATOM   5323  N N     . GLN B 1 53  ? -45.327 96.468  14.331  1.00 21.70 ? 53   GLN B N     1 
ATOM   5324  C CA    . GLN B 1 53  ? -46.228 97.058  15.317  1.00 22.55 ? 53   GLN B CA    1 
ATOM   5325  C C     . GLN B 1 53  ? -47.034 95.960  16.051  1.00 22.14 ? 53   GLN B C     1 
ATOM   5326  O O     . GLN B 1 53  ? -47.146 96.001  17.271  1.00 22.43 ? 53   GLN B O     1 
ATOM   5327  C CB    . GLN B 1 53  ? -47.130 98.150  14.697  1.00 22.96 ? 53   GLN B CB    1 
ATOM   5328  C CG    . GLN B 1 53  ? -46.384 99.377  14.042  1.00 26.18 ? 53   GLN B CG    1 
ATOM   5329  C CD    . GLN B 1 53  ? -45.386 100.121 14.987  1.00 29.68 ? 53   GLN B CD    1 
ATOM   5330  O OE1   . GLN B 1 53  ? -45.713 100.434 16.139  1.00 31.67 ? 53   GLN B OE1   1 
ATOM   5331  N NE2   . GLN B 1 53  ? -44.174 100.411 14.480  1.00 28.69 ? 53   GLN B NE2   1 
ATOM   5332  N N     . LYS B 1 54  ? -47.580 94.977  15.323  1.00 21.56 ? 54   LYS B N     1 
ATOM   5333  C CA    . LYS B 1 54  ? -48.249 93.841  15.970  1.00 20.94 ? 54   LYS B CA    1 
ATOM   5334  C C     . LYS B 1 54  ? -47.205 92.945  16.592  1.00 19.27 ? 54   LYS B C     1 
ATOM   5335  O O     . LYS B 1 54  ? -46.137 92.758  16.023  1.00 19.29 ? 54   LYS B O     1 
ATOM   5336  C CB    . LYS B 1 54  ? -49.054 93.019  14.970  1.00 21.45 ? 54   LYS B CB    1 
ATOM   5337  C CG    . LYS B 1 54  ? -50.430 93.590  14.620  1.00 22.89 ? 54   LYS B CG    1 
ATOM   5338  C CD    . LYS B 1 54  ? -51.248 92.565  13.785  1.00 22.97 ? 54   LYS B CD    1 
ATOM   5339  C CE    . LYS B 1 54  ? -52.481 93.208  13.122  1.00 24.85 ? 54   LYS B CE    1 
ATOM   5340  N NZ    . LYS B 1 54  ? -52.041 94.173  12.072  1.00 25.03 ? 54   LYS B NZ    1 
ATOM   5341  N N     . VAL B 1 55  ? -47.484 92.402  17.766  1.00 17.66 ? 55   VAL B N     1 
ATOM   5342  C CA    . VAL B 1 55  ? -46.572 91.423  18.319  1.00 16.42 ? 55   VAL B CA    1 
ATOM   5343  C C     . VAL B 1 55  ? -47.205 90.019  18.243  1.00 16.12 ? 55   VAL B C     1 
ATOM   5344  O O     . VAL B 1 55  ? -47.010 89.309  17.259  1.00 15.60 ? 55   VAL B O     1 
ATOM   5345  C CB    . VAL B 1 55  ? -46.104 91.810  19.737  1.00 16.58 ? 55   VAL B CB    1 
ATOM   5346  C CG1   . VAL B 1 55  ? -45.158 90.765  20.288  1.00 16.04 ? 55   VAL B CG1   1 
ATOM   5347  C CG2   . VAL B 1 55  ? -45.434 93.169  19.736  1.00 15.81 ? 55   VAL B CG2   1 
ATOM   5348  N N     . LYS B 1 56  ? -48.000 89.653  19.251  1.00 15.80 ? 56   LYS B N     1 
ATOM   5349  C CA    . LYS B 1 56  ? -48.585 88.333  19.353  1.00 15.40 ? 56   LYS B CA    1 
ATOM   5350  C C     . LYS B 1 56  ? -49.952 88.260  18.676  1.00 15.64 ? 56   LYS B C     1 
ATOM   5351  O O     . LYS B 1 56  ? -50.890 88.946  19.067  1.00 15.53 ? 56   LYS B O     1 
ATOM   5352  C CB    . LYS B 1 56  ? -48.698 87.948  20.824  1.00 15.85 ? 56   LYS B CB    1 
ATOM   5353  C CG    . LYS B 1 56  ? -49.193 86.522  21.131  1.00 14.72 ? 56   LYS B CG    1 
ATOM   5354  C CD    . LYS B 1 56  ? -49.222 86.356  22.635  1.00 12.84 ? 56   LYS B CD    1 
ATOM   5355  C CE    . LYS B 1 56  ? -49.358 84.912  23.065  1.00 13.90 ? 56   LYS B CE    1 
ATOM   5356  N NZ    . LYS B 1 56  ? -50.670 84.361  22.604  1.00 13.88 ? 56   LYS B NZ    1 
ATOM   5357  N N     . ASN B 1 57  ? -50.044 87.410  17.654  1.00 15.58 ? 57   ASN B N     1 
ATOM   5358  C CA    . ASN B 1 57  ? -51.290 87.130  16.947  1.00 14.97 ? 57   ASN B CA    1 
ATOM   5359  C C     . ASN B 1 57  ? -51.431 85.618  16.698  1.00 14.47 ? 57   ASN B C     1 
ATOM   5360  O O     . ASN B 1 57  ? -51.081 85.106  15.626  1.00 14.50 ? 57   ASN B O     1 
ATOM   5361  C CB    . ASN B 1 57  ? -51.349 87.929  15.640  1.00 14.82 ? 57   ASN B CB    1 
ATOM   5362  C CG    . ASN B 1 57  ? -52.680 87.771  14.925  1.00 15.55 ? 57   ASN B CG    1 
ATOM   5363  O OD1   . ASN B 1 57  ? -53.673 87.372  15.539  1.00 16.50 ? 57   ASN B OD1   1 
ATOM   5364  N ND2   . ASN B 1 57  ? -52.710 88.078  13.628  1.00 14.33 ? 57   ASN B ND2   1 
ATOM   5365  N N     . THR B 1 58  ? -51.918 84.903  17.704  1.00 14.11 ? 58   THR B N     1 
ATOM   5366  C CA    . THR B 1 58  ? -51.906 83.439  17.676  1.00 13.90 ? 58   THR B CA    1 
ATOM   5367  C C     . THR B 1 58  ? -53.193 82.852  18.236  1.00 14.66 ? 58   THR B C     1 
ATOM   5368  O O     . THR B 1 58  ? -53.839 83.446  19.116  1.00 14.05 ? 58   THR B O     1 
ATOM   5369  C CB    . THR B 1 58  ? -50.756 82.832  18.519  1.00 13.40 ? 58   THR B CB    1 
ATOM   5370  O OG1   . THR B 1 58  ? -51.139 82.801  19.895  1.00 12.41 ? 58   THR B OG1   1 
ATOM   5371  C CG2   . THR B 1 58  ? -49.479 83.614  18.376  1.00 12.92 ? 58   THR B CG2   1 
ATOM   5372  N N     . SER B 1 59  ? -53.528 81.663  17.734  1.00 15.04 ? 59   SER B N     1 
ATOM   5373  C CA    . SER B 1 59  ? -54.675 80.882  18.208  1.00 15.31 ? 59   SER B CA    1 
ATOM   5374  C C     . SER B 1 59  ? -54.399 79.383  18.057  1.00 15.22 ? 59   SER B C     1 
ATOM   5375  O O     . SER B 1 59  ? -53.872 78.927  17.030  1.00 15.87 ? 59   SER B O     1 
ATOM   5376  C CB    . SER B 1 59  ? -55.956 81.247  17.429  1.00 14.94 ? 59   SER B CB    1 
ATOM   5377  O OG    . SER B 1 59  ? -57.118 80.659  18.019  1.00 14.71 ? 59   SER B OG    1 
ATOM   5378  N N     . PHE B 1 60  ? -54.775 78.620  19.070  1.00 14.68 ? 60   PHE B N     1 
ATOM   5379  C CA    . PHE B 1 60  ? -54.712 77.171  18.991  1.00 14.49 ? 60   PHE B CA    1 
ATOM   5380  C C     . PHE B 1 60  ? -56.119 76.591  18.765  1.00 14.52 ? 60   PHE B C     1 
ATOM   5381  O O     . PHE B 1 60  ? -56.366 75.407  19.043  1.00 14.62 ? 60   PHE B O     1 
ATOM   5382  C CB    . PHE B 1 60  ? -54.108 76.593  20.289  1.00 14.55 ? 60   PHE B CB    1 
ATOM   5383  C CG    . PHE B 1 60  ? -52.646 76.906  20.506  1.00 13.77 ? 60   PHE B CG    1 
ATOM   5384  C CD1   . PHE B 1 60  ? -52.035 76.547  21.710  1.00 14.06 ? 60   PHE B CD1   1 
ATOM   5385  C CD2   . PHE B 1 60  ? -51.876 77.550  19.523  1.00 12.90 ? 60   PHE B CD2   1 
ATOM   5386  C CE1   . PHE B 1 60  ? -50.663 76.805  21.936  1.00 16.35 ? 60   PHE B CE1   1 
ATOM   5387  C CE2   . PHE B 1 60  ? -50.506 77.818  19.719  1.00 14.78 ? 60   PHE B CE2   1 
ATOM   5388  C CZ    . PHE B 1 60  ? -49.881 77.440  20.929  1.00 15.94 ? 60   PHE B CZ    1 
ATOM   5389  N N     . ALA B 1 61  ? -57.044 77.424  18.291  1.00 14.05 ? 61   ALA B N     1 
ATOM   5390  C CA    . ALA B 1 61  ? -58.428 76.986  18.104  1.00 14.33 ? 61   ALA B CA    1 
ATOM   5391  C C     . ALA B 1 61  ? -58.462 75.750  17.218  1.00 14.35 ? 61   ALA B C     1 
ATOM   5392  O O     . ALA B 1 61  ? -57.791 75.726  16.185  1.00 14.47 ? 61   ALA B O     1 
ATOM   5393  C CB    . ALA B 1 61  ? -59.293 78.111  17.516  1.00 14.09 ? 61   ALA B CB    1 
ATOM   5394  N N     . PRO B 1 62  ? -59.213 74.709  17.637  1.00 14.55 ? 62   PRO B N     1 
ATOM   5395  C CA    . PRO B 1 62  ? -59.320 73.458  16.873  1.00 14.55 ? 62   PRO B CA    1 
ATOM   5396  C C     . PRO B 1 62  ? -59.850 73.730  15.455  1.00 14.94 ? 62   PRO B C     1 
ATOM   5397  O O     . PRO B 1 62  ? -60.867 74.441  15.287  1.00 14.79 ? 62   PRO B O     1 
ATOM   5398  C CB    . PRO B 1 62  ? -60.338 72.632  17.677  1.00 14.34 ? 62   PRO B CB    1 
ATOM   5399  C CG    . PRO B 1 62  ? -60.377 73.232  19.001  1.00 14.57 ? 62   PRO B CG    1 
ATOM   5400  C CD    . PRO B 1 62  ? -60.028 74.676  18.867  1.00 14.11 ? 62   PRO B CD    1 
ATOM   5401  N N     . GLY B 1 63  ? -59.153 73.208  14.444  1.00 15.09 ? 63   GLY B N     1 
ATOM   5402  C CA    . GLY B 1 63  ? -59.547 73.442  13.047  1.00 15.62 ? 63   GLY B CA    1 
ATOM   5403  C C     . GLY B 1 63  ? -59.146 74.795  12.460  1.00 15.80 ? 63   GLY B C     1 
ATOM   5404  O O     . GLY B 1 63  ? -59.477 75.112  11.306  1.00 15.69 ? 63   GLY B O     1 
ATOM   5405  N N     . ASN B 1 64  ? -58.423 75.591  13.245  1.00 15.79 ? 64   ASN B N     1 
ATOM   5406  C CA    . ASN B 1 64  ? -57.978 76.906  12.802  1.00 16.27 ? 64   ASN B CA    1 
ATOM   5407  C C     . ASN B 1 64  ? -56.802 77.441  13.595  1.00 16.81 ? 64   ASN B C     1 
ATOM   5408  O O     . ASN B 1 64  ? -56.775 78.623  13.943  1.00 16.84 ? 64   ASN B O     1 
ATOM   5409  C CB    . ASN B 1 64  ? -59.117 77.921  12.852  1.00 16.65 ? 64   ASN B CB    1 
ATOM   5410  C CG    . ASN B 1 64  ? -58.957 79.040  11.820  1.00 15.85 ? 64   ASN B CG    1 
ATOM   5411  O OD1   . ASN B 1 64  ? -59.518 80.117  11.991  1.00 13.06 ? 64   ASN B OD1   1 
ATOM   5412  N ND2   . ASN B 1 64  ? -58.218 78.774  10.739  1.00 14.23 ? 64   ASN B ND2   1 
ATOM   5413  N N     . VAL B 1 65  ? -55.838 76.559  13.875  1.00 17.27 ? 65   VAL B N     1 
ATOM   5414  C CA    . VAL B 1 65  ? -54.562 76.932  14.493  1.00 17.30 ? 65   VAL B CA    1 
ATOM   5415  C C     . VAL B 1 65  ? -53.806 77.934  13.602  1.00 17.37 ? 65   VAL B C     1 
ATOM   5416  O O     . VAL B 1 65  ? -53.616 77.701  12.398  1.00 17.34 ? 65   VAL B O     1 
ATOM   5417  C CB    . VAL B 1 65  ? -53.688 75.673  14.735  1.00 17.66 ? 65   VAL B CB    1 
ATOM   5418  C CG1   . VAL B 1 65  ? -52.350 76.046  15.421  1.00 17.47 ? 65   VAL B CG1   1 
ATOM   5419  C CG2   . VAL B 1 65  ? -54.471 74.638  15.539  1.00 16.63 ? 65   VAL B CG2   1 
ATOM   5420  N N     . SER B 1 66  ? -53.395 79.057  14.180  1.00 17.20 ? 66   SER B N     1 
ATOM   5421  C CA    . SER B 1 66  ? -52.736 80.103  13.396  1.00 16.89 ? 66   SER B CA    1 
ATOM   5422  C C     . SER B 1 66  ? -51.759 80.835  14.293  1.00 16.64 ? 66   SER B C     1 
ATOM   5423  O O     . SER B 1 66  ? -52.167 81.412  15.318  1.00 17.15 ? 66   SER B O     1 
ATOM   5424  C CB    . SER B 1 66  ? -53.784 81.070  12.813  1.00 17.40 ? 66   SER B CB    1 
ATOM   5425  O OG    . SER B 1 66  ? -53.182 82.068  12.002  1.00 17.94 ? 66   SER B OG    1 
ATOM   5426  N N     . ILE B 1 67  ? -50.476 80.805  13.925  1.00 15.87 ? 67   ILE B N     1 
ATOM   5427  C CA    . ILE B 1 67  ? -49.415 81.372  14.760  1.00 14.70 ? 67   ILE B CA    1 
ATOM   5428  C C     . ILE B 1 67  ? -48.641 82.493  14.036  1.00 15.18 ? 67   ILE B C     1 
ATOM   5429  O O     . ILE B 1 67  ? -47.952 82.268  13.032  1.00 14.54 ? 67   ILE B O     1 
ATOM   5430  C CB    . ILE B 1 67  ? -48.455 80.244  15.228  1.00 15.07 ? 67   ILE B CB    1 
ATOM   5431  C CG1   . ILE B 1 67  ? -49.220 79.189  16.065  1.00 13.43 ? 67   ILE B CG1   1 
ATOM   5432  C CG2   . ILE B 1 67  ? -47.193 80.813  15.923  1.00 13.02 ? 67   ILE B CG2   1 
ATOM   5433  C CD1   . ILE B 1 67  ? -48.721 77.764  15.860  1.00 8.00  ? 67   ILE B CD1   1 
ATOM   5434  N N     . LYS B 1 68  ? -48.775 83.716  14.543  1.00 15.38 ? 68   LYS B N     1 
ATOM   5435  C CA    . LYS B 1 68  ? -48.038 84.855  13.983  1.00 15.27 ? 68   LYS B CA    1 
ATOM   5436  C C     . LYS B 1 68  ? -47.371 85.693  15.079  1.00 14.85 ? 68   LYS B C     1 
ATOM   5437  O O     . LYS B 1 68  ? -47.951 85.940  16.134  1.00 14.55 ? 68   LYS B O     1 
ATOM   5438  C CB    . LYS B 1 68  ? -48.946 85.726  13.093  1.00 15.39 ? 68   LYS B CB    1 
ATOM   5439  C CG    . LYS B 1 68  ? -49.407 85.032  11.820  1.00 15.76 ? 68   LYS B CG    1 
ATOM   5440  C CD    . LYS B 1 68  ? -50.310 85.883  10.924  1.00 16.00 ? 68   LYS B CD    1 
ATOM   5441  C CE    . LYS B 1 68  ? -50.597 85.092  9.646   1.00 18.88 ? 68   LYS B CE    1 
ATOM   5442  N NZ    . LYS B 1 68  ? -51.617 85.756  8.802   1.00 20.92 ? 68   LYS B NZ    1 
ATOM   5443  N N     . TRP B 1 69  ? -46.138 86.108  14.816  1.00 14.72 ? 69   TRP B N     1 
ATOM   5444  C CA    . TRP B 1 69  ? -45.399 86.983  15.699  1.00 14.49 ? 69   TRP B CA    1 
ATOM   5445  C C     . TRP B 1 69  ? -44.706 87.980  14.808  1.00 14.26 ? 69   TRP B C     1 
ATOM   5446  O O     . TRP B 1 69  ? -44.238 87.619  13.749  1.00 14.28 ? 69   TRP B O     1 
ATOM   5447  C CB    . TRP B 1 69  ? -44.365 86.206  16.511  1.00 15.01 ? 69   TRP B CB    1 
ATOM   5448  C CG    . TRP B 1 69  ? -44.947 85.334  17.606  1.00 15.61 ? 69   TRP B CG    1 
ATOM   5449  C CD1   . TRP B 1 69  ? -45.392 84.050  17.477  1.00 15.70 ? 69   TRP B CD1   1 
ATOM   5450  C CD2   . TRP B 1 69  ? -45.136 85.683  18.985  1.00 15.75 ? 69   TRP B CD2   1 
ATOM   5451  N NE1   . TRP B 1 69  ? -45.856 83.580  18.683  1.00 15.60 ? 69   TRP B NE1   1 
ATOM   5452  C CE2   . TRP B 1 69  ? -45.710 84.554  19.628  1.00 15.05 ? 69   TRP B CE2   1 
ATOM   5453  C CE3   . TRP B 1 69  ? -44.878 86.837  19.740  1.00 16.28 ? 69   TRP B CE3   1 
ATOM   5454  C CZ2   . TRP B 1 69  ? -46.021 84.535  20.991  1.00 15.19 ? 69   TRP B CZ2   1 
ATOM   5455  C CZ3   . TRP B 1 69  ? -45.183 86.820  21.107  1.00 16.33 ? 69   TRP B CZ3   1 
ATOM   5456  C CH2   . TRP B 1 69  ? -45.745 85.668  21.716  1.00 15.94 ? 69   TRP B CH2   1 
ATOM   5457  N N     . TYR B 1 70  ? -44.677 89.242  15.228  1.00 14.60 ? 70   TYR B N     1 
ATOM   5458  C CA    . TYR B 1 70  ? -44.017 90.350  14.493  1.00 14.50 ? 70   TYR B CA    1 
ATOM   5459  C C     . TYR B 1 70  ? -44.421 90.494  13.028  1.00 14.93 ? 70   TYR B C     1 
ATOM   5460  O O     . TYR B 1 70  ? -43.595 90.871  12.196  1.00 15.52 ? 70   TYR B O     1 
ATOM   5461  C CB    . TYR B 1 70  ? -42.495 90.232  14.598  1.00 13.45 ? 70   TYR B CB    1 
ATOM   5462  C CG    . TYR B 1 70  ? -41.991 90.053  16.008  1.00 11.73 ? 70   TYR B CG    1 
ATOM   5463  C CD1   . TYR B 1 70  ? -41.468 88.826  16.425  1.00 10.00 ? 70   TYR B CD1   1 
ATOM   5464  C CD2   . TYR B 1 70  ? -42.053 91.100  16.936  1.00 11.63 ? 70   TYR B CD2   1 
ATOM   5465  C CE1   . TYR B 1 70  ? -40.988 88.638  17.704  1.00 8.47  ? 70   TYR B CE1   1 
ATOM   5466  C CE2   . TYR B 1 70  ? -41.570 90.932  18.243  1.00 11.43 ? 70   TYR B CE2   1 
ATOM   5467  C CZ    . TYR B 1 70  ? -41.042 89.689  18.603  1.00 11.74 ? 70   TYR B CZ    1 
ATOM   5468  O OH    . TYR B 1 70  ? -40.572 89.497  19.865  1.00 13.99 ? 70   TYR B OH    1 
ATOM   5469  N N     . GLU B 1 71  ? -45.687 90.220  12.718  1.00 14.88 ? 71   GLU B N     1 
ATOM   5470  C CA    . GLU B 1 71  ? -46.047 89.884  11.362  1.00 14.96 ? 71   GLU B CA    1 
ATOM   5471  C C     . GLU B 1 71  ? -45.861 91.025  10.384  1.00 15.47 ? 71   GLU B C     1 
ATOM   5472  O O     . GLU B 1 71  ? -45.631 90.793  9.207   1.00 15.15 ? 71   GLU B O     1 
ATOM   5473  C CB    . GLU B 1 71  ? -47.457 89.345  11.294  1.00 14.99 ? 71   GLU B CB    1 
ATOM   5474  C CG    . GLU B 1 71  ? -48.534 90.382  11.358  1.00 15.90 ? 71   GLU B CG    1 
ATOM   5475  C CD    . GLU B 1 71  ? -49.881 89.763  11.627  1.00 18.25 ? 71   GLU B CD    1 
ATOM   5476  O OE1   . GLU B 1 71  ? -50.096 89.246  12.748  1.00 18.88 ? 71   GLU B OE1   1 
ATOM   5477  O OE2   . GLU B 1 71  ? -50.728 89.784  10.717  1.00 20.33 ? 71   GLU B OE2   1 
ATOM   5478  N N     . ASP B 1 72  ? -45.964 92.258  10.866  1.00 16.15 ? 72   ASP B N     1 
ATOM   5479  C CA    . ASP B 1 72  ? -45.792 93.402  9.984   1.00 16.62 ? 72   ASP B CA    1 
ATOM   5480  C C     . ASP B 1 72  ? -44.354 93.925  9.972   1.00 16.75 ? 72   ASP B C     1 
ATOM   5481  O O     . ASP B 1 72  ? -44.087 94.961  9.369   1.00 17.44 ? 72   ASP B O     1 
ATOM   5482  C CB    . ASP B 1 72  ? -46.816 94.518  10.263  1.00 16.48 ? 72   ASP B CB    1 
ATOM   5483  C CG    . ASP B 1 72  ? -46.828 94.982  11.715  1.00 18.81 ? 72   ASP B CG    1 
ATOM   5484  O OD1   . ASP B 1 72  ? -46.004 94.480  12.544  1.00 17.99 ? 72   ASP B OD1   1 
ATOM   5485  O OD2   . ASP B 1 72  ? -47.689 95.860  12.018  1.00 19.85 ? 72   ASP B OD2   1 
ATOM   5486  N N     . GLY B 1 73  ? -43.429 93.209  10.608  1.00 16.36 ? 73   GLY B N     1 
ATOM   5487  C CA    . GLY B 1 73  ? -42.027 93.580  10.565  1.00 15.72 ? 73   GLY B CA    1 
ATOM   5488  C C     . GLY B 1 73  ? -41.292 92.815  9.487   1.00 16.30 ? 73   GLY B C     1 
ATOM   5489  O O     . GLY B 1 73  ? -41.685 91.707  9.109   1.00 16.02 ? 73   GLY B O     1 
ATOM   5490  N N     . THR B 1 74  ? -40.218 93.419  8.986   1.00 16.28 ? 74   THR B N     1 
ATOM   5491  C CA    . THR B 1 74  ? -39.333 92.774  8.026   1.00 16.00 ? 74   THR B CA    1 
ATOM   5492  C C     . THR B 1 74  ? -37.896 92.830  8.544   1.00 16.02 ? 74   THR B C     1 
ATOM   5493  O O     . THR B 1 74  ? -37.512 93.775  9.234   1.00 16.00 ? 74   THR B O     1 
ATOM   5494  C CB    . THR B 1 74  ? -39.374 93.461  6.624   1.00 16.32 ? 74   THR B CB    1 
ATOM   5495  O OG1   . THR B 1 74  ? -38.592 94.665  6.663   1.00 16.28 ? 74   THR B OG1   1 
ATOM   5496  C CG2   . THR B 1 74  ? -40.836 93.757  6.159   1.00 14.89 ? 74   THR B CG2   1 
ATOM   5497  N N     . LEU B 1 75  ? -37.107 91.821  8.192   1.00 15.99 ? 75   LEU B N     1 
ATOM   5498  C CA    . LEU B 1 75  ? -35.744 91.662  8.697   1.00 15.82 ? 75   LEU B CA    1 
ATOM   5499  C C     . LEU B 1 75  ? -34.935 90.715  7.804   1.00 15.89 ? 75   LEU B C     1 
ATOM   5500  O O     . LEU B 1 75  ? -35.439 90.197  6.816   1.00 16.09 ? 75   LEU B O     1 
ATOM   5501  C CB    . LEU B 1 75  ? -35.760 91.124  10.129  1.00 14.86 ? 75   LEU B CB    1 
ATOM   5502  C CG    . LEU B 1 75  ? -36.159 89.658  10.274  1.00 15.06 ? 75   LEU B CG    1 
ATOM   5503  C CD1   . LEU B 1 75  ? -35.779 89.154  11.649  1.00 13.90 ? 75   LEU B CD1   1 
ATOM   5504  C CD2   . LEU B 1 75  ? -37.651 89.403  9.978   1.00 13.41 ? 75   LEU B CD2   1 
ATOM   5505  N N     . ASN B 1 76  ? -33.677 90.503  8.160   1.00 15.88 ? 76   ASN B N     1 
ATOM   5506  C CA    . ASN B 1 76  ? -32.854 89.543  7.457   1.00 15.96 ? 76   ASN B CA    1 
ATOM   5507  C C     . ASN B 1 76  ? -32.008 88.737  8.443   1.00 15.66 ? 76   ASN B C     1 
ATOM   5508  O O     . ASN B 1 76  ? -31.269 89.300  9.250   1.00 15.43 ? 76   ASN B O     1 
ATOM   5509  C CB    . ASN B 1 76  ? -31.996 90.247  6.392   1.00 15.94 ? 76   ASN B CB    1 
ATOM   5510  C CG    . ASN B 1 76  ? -31.305 89.269  5.452   1.00 16.56 ? 76   ASN B CG    1 
ATOM   5511  O OD1   . ASN B 1 76  ? -31.612 89.223  4.254   1.00 17.19 ? 76   ASN B OD1   1 
ATOM   5512  N ND2   . ASN B 1 76  ? -30.360 88.482  5.989   1.00 16.37 ? 76   ASN B ND2   1 
ATOM   5513  N N     . LEU B 1 77  ? -32.116 87.415  8.369   1.00 15.59 ? 77   LEU B N     1 
ATOM   5514  C CA    . LEU B 1 77  ? -31.426 86.578  9.341   1.00 15.32 ? 77   LEU B CA    1 
ATOM   5515  C C     . LEU B 1 77  ? -29.915 86.720  9.234   1.00 15.43 ? 77   LEU B C     1 
ATOM   5516  O O     . LEU B 1 77  ? -29.230 86.821  10.275  1.00 16.00 ? 77   LEU B O     1 
ATOM   5517  C CB    . LEU B 1 77  ? -31.862 85.118  9.262   1.00 14.33 ? 77   LEU B CB    1 
ATOM   5518  C CG    . LEU B 1 77  ? -31.070 84.245  10.239  1.00 14.98 ? 77   LEU B CG    1 
ATOM   5519  C CD1   . LEU B 1 77  ? -31.936 83.115  10.814  1.00 16.03 ? 77   LEU B CD1   1 
ATOM   5520  C CD2   . LEU B 1 77  ? -29.751 83.685  9.612   1.00 12.30 ? 77   LEU B CD2   1 
ATOM   5521  N N     . ALA B 1 78  ? -29.389 86.742  8.007   1.00 14.71 ? 78   ALA B N     1 
ATOM   5522  C CA    . ALA B 1 78  ? -27.934 86.873  7.825   1.00 15.00 ? 78   ALA B CA    1 
ATOM   5523  C C     . ALA B 1 78  ? -27.405 88.243  8.288   1.00 15.28 ? 78   ALA B C     1 
ATOM   5524  O O     . ALA B 1 78  ? -26.331 88.334  8.884   1.00 15.15 ? 78   ALA B O     1 
ATOM   5525  C CB    . ALA B 1 78  ? -27.533 86.603  6.372   1.00 15.27 ? 78   ALA B CB    1 
ATOM   5526  N N     . ALA B 1 79  ? -28.174 89.298  8.018   1.00 15.61 ? 79   ALA B N     1 
ATOM   5527  C CA    . ALA B 1 79  ? -27.813 90.655  8.446   1.00 16.13 ? 79   ALA B CA    1 
ATOM   5528  C C     . ALA B 1 79  ? -27.651 90.713  9.948   1.00 16.22 ? 79   ALA B C     1 
ATOM   5529  O O     . ALA B 1 79  ? -26.778 91.406  10.448  1.00 15.65 ? 79   ALA B O     1 
ATOM   5530  C CB    . ALA B 1 79  ? -28.859 91.684  7.975   1.00 15.69 ? 79   ALA B CB    1 
ATOM   5531  N N     . ASN B 1 80  ? -28.508 89.979  10.662  1.00 17.19 ? 80   ASN B N     1 
ATOM   5532  C CA    . ASN B 1 80  ? -28.420 89.888  12.125  1.00 17.94 ? 80   ASN B CA    1 
ATOM   5533  C C     . ASN B 1 80  ? -27.248 89.003  12.638  1.00 18.35 ? 80   ASN B C     1 
ATOM   5534  O O     . ASN B 1 80  ? -26.621 89.316  13.667  1.00 18.50 ? 80   ASN B O     1 
ATOM   5535  C CB    . ASN B 1 80  ? -29.763 89.447  12.721  1.00 17.83 ? 80   ASN B CB    1 
ATOM   5536  C CG    . ASN B 1 80  ? -30.732 90.607  12.937  1.00 18.32 ? 80   ASN B CG    1 
ATOM   5537  O OD1   . ASN B 1 80  ? -30.586 91.381  13.895  1.00 19.97 ? 80   ASN B OD1   1 
ATOM   5538  N ND2   . ASN B 1 80  ? -31.753 90.712  12.069  1.00 16.31 ? 80   ASN B ND2   1 
ATOM   5539  N N     . CYS B 1 81  ? -26.949 87.920  11.914  1.00 18.46 ? 81   CYS B N     1 
ATOM   5540  C CA    . CYS B 1 81  ? -25.839 87.030  12.282  1.00 18.62 ? 81   CYS B CA    1 
ATOM   5541  C C     . CYS B 1 81  ? -24.505 87.470  11.685  1.00 18.92 ? 81   CYS B C     1 
ATOM   5542  O O     . CYS B 1 81  ? -23.453 86.936  12.071  1.00 19.71 ? 81   CYS B O     1 
ATOM   5543  C CB    . CYS B 1 81  ? -26.149 85.577  11.888  1.00 18.09 ? 81   CYS B CB    1 
ATOM   5544  S SG    . CYS B 1 81  ? -27.784 85.042  12.457  1.00 18.16 ? 81   CYS B SG    1 
ATOM   5545  N N     . LEU B 1 82  ? -24.531 88.433  10.756  1.00 18.23 ? 82   LEU B N     1 
ATOM   5546  C CA    . LEU B 1 82  ? -23.300 88.842  10.069  1.00 17.64 ? 82   LEU B CA    1 
ATOM   5547  C C     . LEU B 1 82  ? -23.045 90.367  9.931   1.00 17.42 ? 82   LEU B C     1 
ATOM   5548  O O     . LEU B 1 82  ? -22.179 90.941  10.636  1.00 16.97 ? 82   LEU B O     1 
ATOM   5549  C CB    . LEU B 1 82  ? -23.224 88.157  8.704   1.00 17.47 ? 82   LEU B CB    1 
ATOM   5550  C CG    . LEU B 1 82  ? -23.294 86.628  8.710   1.00 18.00 ? 82   LEU B CG    1 
ATOM   5551  C CD1   . LEU B 1 82  ? -23.540 86.104  7.316   1.00 18.68 ? 82   LEU B CD1   1 
ATOM   5552  C CD2   . LEU B 1 82  ? -22.034 86.004  9.309   1.00 16.89 ? 82   LEU B CD2   1 
ATOM   5553  N N     . ASP B 1 83  ? -23.782 91.006  9.022   1.00 16.76 ? 83   ASP B N     1 
ATOM   5554  C CA    . ASP B 1 83  ? -23.515 92.397  8.633   1.00 16.55 ? 83   ASP B CA    1 
ATOM   5555  C C     . ASP B 1 83  ? -23.401 93.310  9.826   1.00 16.65 ? 83   ASP B C     1 
ATOM   5556  O O     . ASP B 1 83  ? -22.394 94.012  9.978   1.00 17.16 ? 83   ASP B O     1 
ATOM   5557  C CB    . ASP B 1 83  ? -24.574 92.916  7.669   1.00 15.93 ? 83   ASP B CB    1 
ATOM   5558  C CG    . ASP B 1 83  ? -24.726 92.026  6.447   1.00 17.95 ? 83   ASP B CG    1 
ATOM   5559  O OD1   . ASP B 1 83  ? -24.648 92.541  5.311   1.00 21.07 ? 83   ASP B OD1   1 
ATOM   5560  O OD2   . ASP B 1 83  ? -24.912 90.803  6.611   1.00 17.10 ? 83   ASP B OD2   1 
ATOM   5561  N N     . ARG B 1 84  ? -24.405 93.263  10.704  1.00 16.12 ? 84   ARG B N     1 
ATOM   5562  C CA    . ARG B 1 84  ? -24.542 94.252  11.772  1.00 15.12 ? 84   ARG B CA    1 
ATOM   5563  C C     . ARG B 1 84  ? -23.400 94.167  12.786  1.00 14.86 ? 84   ARG B C     1 
ATOM   5564  O O     . ARG B 1 84  ? -23.223 95.066  13.612  1.00 14.21 ? 84   ARG B O     1 
ATOM   5565  C CB    . ARG B 1 84  ? -25.913 94.132  12.449  1.00 14.95 ? 84   ARG B CB    1 
ATOM   5566  C CG    . ARG B 1 84  ? -26.100 92.874  13.307  1.00 13.91 ? 84   ARG B CG    1 
ATOM   5567  C CD    . ARG B 1 84  ? -27.267 93.045  14.253  1.00 13.66 ? 84   ARG B CD    1 
ATOM   5568  N NE    . ARG B 1 84  ? -27.562 91.825  14.998  1.00 11.33 ? 84   ARG B NE    1 
ATOM   5569  C CZ    . ARG B 1 84  ? -28.386 91.752  16.036  1.00 8.92  ? 84   ARG B CZ    1 
ATOM   5570  N NH1   . ARG B 1 84  ? -29.026 92.818  16.479  1.00 7.00  ? 84   ARG B NH1   1 
ATOM   5571  N NH2   . ARG B 1 84  ? -28.593 90.582  16.613  1.00 10.68 ? 84   ARG B NH2   1 
ATOM   5572  N N     . HIS B 1 85  ? -22.629 93.083  12.700  1.00 14.84 ? 85   HIS B N     1 
ATOM   5573  C CA    . HIS B 1 85  ? -21.463 92.861  13.563  1.00 14.97 ? 85   HIS B CA    1 
ATOM   5574  C C     . HIS B 1 85  ? -20.149 93.344  12.945  1.00 15.69 ? 85   HIS B C     1 
ATOM   5575  O O     . HIS B 1 85  ? -19.125 93.373  13.632  1.00 15.91 ? 85   HIS B O     1 
ATOM   5576  C CB    . HIS B 1 85  ? -21.313 91.384  13.903  1.00 14.57 ? 85   HIS B CB    1 
ATOM   5577  C CG    . HIS B 1 85  ? -22.510 90.800  14.570  1.00 14.34 ? 85   HIS B CG    1 
ATOM   5578  N ND1   . HIS B 1 85  ? -22.942 91.216  15.809  1.00 14.16 ? 85   HIS B ND1   1 
ATOM   5579  C CD2   . HIS B 1 85  ? -23.378 89.846  14.169  1.00 14.55 ? 85   HIS B CD2   1 
ATOM   5580  C CE1   . HIS B 1 85  ? -24.010 90.527  16.156  1.00 12.67 ? 85   HIS B CE1   1 
ATOM   5581  N NE2   . HIS B 1 85  ? -24.294 89.684  15.180  1.00 15.71 ? 85   HIS B NE2   1 
ATOM   5582  N N     . LEU B 1 86  ? -20.161 93.712  11.660  1.00 16.18 ? 86   LEU B N     1 
ATOM   5583  C CA    . LEU B 1 86  ? -18.925 94.144  11.002  1.00 16.75 ? 86   LEU B CA    1 
ATOM   5584  C C     . LEU B 1 86  ? -18.368 95.449  11.601  1.00 16.83 ? 86   LEU B C     1 
ATOM   5585  O O     . LEU B 1 86  ? -17.176 95.551  11.920  1.00 16.37 ? 86   LEU B O     1 
ATOM   5586  C CB    . LEU B 1 86  ? -19.122 94.282  9.483   1.00 16.75 ? 86   LEU B CB    1 
ATOM   5587  C CG    . LEU B 1 86  ? -19.634 93.062  8.720   1.00 17.26 ? 86   LEU B CG    1 
ATOM   5588  C CD1   . LEU B 1 86  ? -19.990 93.448  7.327   1.00 16.38 ? 86   LEU B CD1   1 
ATOM   5589  C CD2   . LEU B 1 86  ? -18.615 91.940  8.696   1.00 18.98 ? 86   LEU B CD2   1 
ATOM   5590  N N     . GLN B 1 87  ? -19.244 96.434  11.766  1.00 17.29 ? 87   GLN B N     1 
ATOM   5591  C CA    . GLN B 1 87  ? -18.811 97.799  12.088  1.00 17.99 ? 87   GLN B CA    1 
ATOM   5592  C C     . GLN B 1 87  ? -17.873 97.851  13.304  1.00 18.17 ? 87   GLN B C     1 
ATOM   5593  O O     . GLN B 1 87  ? -16.777 98.406  13.204  1.00 18.12 ? 87   GLN B O     1 
ATOM   5594  C CB    . GLN B 1 87  ? -20.028 98.700  12.278  1.00 17.84 ? 87   GLN B CB    1 
ATOM   5595  C CG    . GLN B 1 87  ? -19.698 100.101 12.624  1.00 18.48 ? 87   GLN B CG    1 
ATOM   5596  C CD    . GLN B 1 87  ? -20.942 100.945 12.779  1.00 20.13 ? 87   GLN B CD    1 
ATOM   5597  O OE1   . GLN B 1 87  ? -21.042 102.027 12.184  1.00 20.89 ? 87   GLN B OE1   1 
ATOM   5598  N NE2   . GLN B 1 87  ? -21.903 100.462 13.580  1.00 17.62 ? 87   GLN B NE2   1 
ATOM   5599  N N     . GLU B 1 88  ? -18.300 97.243  14.418  1.00 18.09 ? 88   GLU B N     1 
ATOM   5600  C CA    . GLU B 1 88  ? -17.487 97.139  15.636  1.00 18.23 ? 88   GLU B CA    1 
ATOM   5601  C C     . GLU B 1 88  ? -16.792 95.792  15.864  1.00 18.07 ? 88   GLU B C     1 
ATOM   5602  O O     . GLU B 1 88  ? -15.869 95.718  16.668  1.00 17.19 ? 88   GLU B O     1 
ATOM   5603  C CB    . GLU B 1 88  ? -18.328 97.487  16.866  1.00 18.43 ? 88   GLU B CB    1 
ATOM   5604  C CG    . GLU B 1 88  ? -18.848 98.905  16.821  1.00 20.37 ? 88   GLU B CG    1 
ATOM   5605  C CD    . GLU B 1 88  ? -19.736 99.256  17.979  1.00 22.17 ? 88   GLU B CD    1 
ATOM   5606  O OE1   . GLU B 1 88  ? -19.215 99.593  19.067  1.00 24.97 ? 88   GLU B OE1   1 
ATOM   5607  O OE2   . GLU B 1 88  ? -20.963 99.244  17.787  1.00 24.87 ? 88   GLU B OE2   1 
ATOM   5608  N N     . ASN B 1 89  ? -17.231 94.724  15.187  1.00 18.10 ? 89   ASN B N     1 
ATOM   5609  C CA    . ASN B 1 89  ? -16.652 93.393  15.458  1.00 18.69 ? 89   ASN B CA    1 
ATOM   5610  C C     . ASN B 1 89  ? -16.248 92.534  14.255  1.00 19.06 ? 89   ASN B C     1 
ATOM   5611  O O     . ASN B 1 89  ? -16.207 91.311  14.362  1.00 19.51 ? 89   ASN B O     1 
ATOM   5612  C CB    . ASN B 1 89  ? -17.536 92.584  16.424  1.00 18.04 ? 89   ASN B CB    1 
ATOM   5613  C CG    . ASN B 1 89  ? -17.418 93.070  17.870  1.00 19.01 ? 89   ASN B CG    1 
ATOM   5614  O OD1   . ASN B 1 89  ? -18.203 93.933  18.317  1.00 19.14 ? 89   ASN B OD1   1 
ATOM   5615  N ND2   . ASN B 1 89  ? -16.430 92.546  18.599  1.00 16.28 ? 89   ASN B ND2   1 
ATOM   5616  N N     . GLY B 1 90  ? -15.938 93.169  13.126  1.00 19.27 ? 90   GLY B N     1 
ATOM   5617  C CA    . GLY B 1 90  ? -15.375 92.473  11.965  1.00 19.58 ? 90   GLY B CA    1 
ATOM   5618  C C     . GLY B 1 90  ? -14.283 91.451  12.279  1.00 20.13 ? 90   GLY B C     1 
ATOM   5619  O O     . GLY B 1 90  ? -14.239 90.377  11.680  1.00 20.75 ? 90   GLY B O     1 
ATOM   5620  N N     . ASP B 1 91  ? -13.427 91.753  13.250  1.00 20.33 ? 91   ASP B N     1 
ATOM   5621  C CA    . ASP B 1 91  ? -12.202 90.981  13.438  1.00 20.53 ? 91   ASP B CA    1 
ATOM   5622  C C     . ASP B 1 91  ? -12.317 89.898  14.534  1.00 20.20 ? 91   ASP B C     1 
ATOM   5623  O O     . ASP B 1 91  ? -11.402 89.086  14.722  1.00 19.89 ? 91   ASP B O     1 
ATOM   5624  C CB    . ASP B 1 91  ? -10.981 91.923  13.620  1.00 20.68 ? 91   ASP B CB    1 
ATOM   5625  C CG    . ASP B 1 91  ? -10.832 92.933  12.454  1.00 21.72 ? 91   ASP B CG    1 
ATOM   5626  O OD1   . ASP B 1 91  ? -10.679 92.521  11.283  1.00 22.59 ? 91   ASP B OD1   1 
ATOM   5627  O OD2   . ASP B 1 91  ? -10.893 94.152  12.700  1.00 23.03 ? 91   ASP B OD2   1 
ATOM   5628  N N     . ARG B 1 92  ? -13.446 89.890  15.236  1.00 19.58 ? 92   ARG B N     1 
ATOM   5629  C CA    . ARG B 1 92  ? -13.754 88.827  16.191  1.00 19.71 ? 92   ARG B CA    1 
ATOM   5630  C C     . ARG B 1 92  ? -13.924 87.467  15.464  1.00 18.84 ? 92   ARG B C     1 
ATOM   5631  O O     . ARG B 1 92  ? -14.386 87.414  14.319  1.00 19.15 ? 92   ARG B O     1 
ATOM   5632  C CB    . ARG B 1 92  ? -15.024 89.197  16.976  1.00 19.47 ? 92   ARG B CB    1 
ATOM   5633  C CG    . ARG B 1 92  ? -15.594 88.087  17.878  1.00 20.32 ? 92   ARG B CG    1 
ATOM   5634  C CD    . ARG B 1 92  ? -16.490 88.634  18.973  1.00 21.68 ? 92   ARG B CD    1 
ATOM   5635  N NE    . ARG B 1 92  ? -15.727 89.478  19.889  1.00 26.95 ? 92   ARG B NE    1 
ATOM   5636  C CZ    . ARG B 1 92  ? -16.245 90.396  20.697  1.00 29.39 ? 92   ARG B CZ    1 
ATOM   5637  N NH1   . ARG B 1 92  ? -17.554 90.637  20.734  1.00 32.57 ? 92   ARG B NH1   1 
ATOM   5638  N NH2   . ARG B 1 92  ? -15.435 91.091  21.467  1.00 31.80 ? 92   ARG B NH2   1 
ATOM   5639  N N     . THR B 1 93  ? -13.530 86.378  16.114  1.00 17.78 ? 93   THR B N     1 
ATOM   5640  C CA    . THR B 1 93  ? -13.828 85.053  15.604  1.00 16.75 ? 93   THR B CA    1 
ATOM   5641  C C     . THR B 1 93  ? -15.324 84.739  15.696  1.00 16.55 ? 93   THR B C     1 
ATOM   5642  O O     . THR B 1 93  ? -15.937 84.824  16.764  1.00 15.93 ? 93   THR B O     1 
ATOM   5643  C CB    . THR B 1 93  ? -13.047 84.011  16.340  1.00 16.42 ? 93   THR B CB    1 
ATOM   5644  O OG1   . THR B 1 93  ? -11.663 84.369  16.294  1.00 16.92 ? 93   THR B OG1   1 
ATOM   5645  C CG2   . THR B 1 93  ? -13.220 82.711  15.660  1.00 16.61 ? 93   THR B CG2   1 
ATOM   5646  N N     . ALA B 1 94  ? -15.901 84.375  14.556  1.00 16.33 ? 94   ALA B N     1 
ATOM   5647  C CA    . ALA B 1 94  ? -17.301 83.977  14.486  1.00 15.95 ? 94   ALA B CA    1 
ATOM   5648  C C     . ALA B 1 94  ? -17.413 82.474  14.740  1.00 15.55 ? 94   ALA B C     1 
ATOM   5649  O O     . ALA B 1 94  ? -18.183 82.020  15.585  1.00 15.96 ? 94   ALA B O     1 
ATOM   5650  C CB    . ALA B 1 94  ? -17.906 84.355  13.133  1.00 15.29 ? 94   ALA B CB    1 
ATOM   5651  N N     . ILE B 1 95  ? -16.610 81.723  14.014  1.00 15.04 ? 95   ILE B N     1 
ATOM   5652  C CA    . ILE B 1 95  ? -16.593 80.287  14.085  1.00 14.60 ? 95   ILE B CA    1 
ATOM   5653  C C     . ILE B 1 95  ? -15.157 79.851  14.302  1.00 14.62 ? 95   ILE B C     1 
ATOM   5654  O O     . ILE B 1 95  ? -14.270 80.190  13.500  1.00 15.37 ? 95   ILE B O     1 
ATOM   5655  C CB    . ILE B 1 95  ? -17.112 79.644  12.759  1.00 14.26 ? 95   ILE B CB    1 
ATOM   5656  C CG1   . ILE B 1 95  ? -18.586 79.950  12.538  1.00 13.06 ? 95   ILE B CG1   1 
ATOM   5657  C CG2   . ILE B 1 95  ? -16.896 78.156  12.769  1.00 13.48 ? 95   ILE B CG2   1 
ATOM   5658  C CD1   . ILE B 1 95  ? -19.158 79.304  11.321  1.00 9.54  ? 95   ILE B CD1   1 
ATOM   5659  N N     . ILE B 1 96  ? -14.923 79.132  15.393  1.00 14.24 ? 96   ILE B N     1 
ATOM   5660  C CA    . ILE B 1 96  ? -13.722 78.314  15.528  1.00 13.75 ? 96   ILE B CA    1 
ATOM   5661  C C     . ILE B 1 96  ? -14.021 76.909  14.996  1.00 13.60 ? 96   ILE B C     1 
ATOM   5662  O O     . ILE B 1 96  ? -14.889 76.220  15.520  1.00 13.99 ? 96   ILE B O     1 
ATOM   5663  C CB    . ILE B 1 96  ? -13.306 78.160  16.997  1.00 13.60 ? 96   ILE B CB    1 
ATOM   5664  C CG1   . ILE B 1 96  ? -12.712 79.448  17.543  1.00 12.05 ? 96   ILE B CG1   1 
ATOM   5665  C CG2   . ILE B 1 96  ? -12.302 77.004  17.149  1.00 13.88 ? 96   ILE B CG2   1 
ATOM   5666  C CD1   . ILE B 1 96  ? -12.578 79.437  19.036  1.00 8.47  ? 96   ILE B CD1   1 
ATOM   5667  N N     . TRP B 1 97  ? -13.301 76.484  13.967  1.00 13.33 ? 97   TRP B N     1 
ATOM   5668  C CA    . TRP B 1 97  ? -13.439 75.123  13.451  1.00 12.95 ? 97   TRP B CA    1 
ATOM   5669  C C     . TRP B 1 97  ? -12.321 74.199  13.912  1.00 13.18 ? 97   TRP B C     1 
ATOM   5670  O O     . TRP B 1 97  ? -11.152 74.488  13.691  1.00 14.05 ? 97   TRP B O     1 
ATOM   5671  C CB    . TRP B 1 97  ? -13.442 75.111  11.927  1.00 12.12 ? 97   TRP B CB    1 
ATOM   5672  C CG    . TRP B 1 97  ? -13.669 73.711  11.407  1.00 11.74 ? 97   TRP B CG    1 
ATOM   5673  C CD1   . TRP B 1 97  ? -14.809 72.976  11.520  1.00 10.13 ? 97   TRP B CD1   1 
ATOM   5674  C CD2   . TRP B 1 97  ? -12.726 72.880  10.717  1.00 11.58 ? 97   TRP B CD2   1 
ATOM   5675  N NE1   . TRP B 1 97  ? -14.642 71.745  10.943  1.00 10.34 ? 97   TRP B NE1   1 
ATOM   5676  C CE2   . TRP B 1 97  ? -13.372 71.655  10.447  1.00 10.57 ? 97   TRP B CE2   1 
ATOM   5677  C CE3   . TRP B 1 97  ? -11.399 73.053  10.300  1.00 10.61 ? 97   TRP B CE3   1 
ATOM   5678  C CZ2   . TRP B 1 97  ? -12.746 70.617  9.788   1.00 9.69  ? 97   TRP B CZ2   1 
ATOM   5679  C CZ3   . TRP B 1 97  ? -10.781 72.027  9.651   1.00 9.79  ? 97   TRP B CZ3   1 
ATOM   5680  C CH2   . TRP B 1 97  ? -11.453 70.820  9.394   1.00 11.20 ? 97   TRP B CH2   1 
ATOM   5681  N N     . GLU B 1 98  ? -12.679 73.065  14.496  1.00 12.97 ? 98   GLU B N     1 
ATOM   5682  C CA    . GLU B 1 98  ? -11.696 72.109  14.985  1.00 12.39 ? 98   GLU B CA    1 
ATOM   5683  C C     . GLU B 1 98  ? -11.871 70.796  14.237  1.00 12.49 ? 98   GLU B C     1 
ATOM   5684  O O     . GLU B 1 98  ? -12.969 70.243  14.219  1.00 12.27 ? 98   GLU B O     1 
ATOM   5685  C CB    . GLU B 1 98  ? -11.881 71.916  16.482  1.00 11.97 ? 98   GLU B CB    1 
ATOM   5686  C CG    . GLU B 1 98  ? -11.077 70.788  17.089  1.00 13.54 ? 98   GLU B CG    1 
ATOM   5687  C CD    . GLU B 1 98  ? -9.605  71.121  17.299  1.00 14.83 ? 98   GLU B CD    1 
ATOM   5688  O OE1   . GLU B 1 98  ? -9.205  72.321  17.198  1.00 15.08 ? 98   GLU B OE1   1 
ATOM   5689  O OE2   . GLU B 1 98  ? -8.856  70.166  17.591  1.00 13.51 ? 98   GLU B OE2   1 
ATOM   5690  N N     . GLY B 1 99  ? -10.791 70.309  13.608  1.00 12.80 ? 99   GLY B N     1 
ATOM   5691  C CA    . GLY B 1 99  ? -10.836 69.110  12.753  1.00 11.92 ? 99   GLY B CA    1 
ATOM   5692  C C     . GLY B 1 99  ? -10.986 67.823  13.536  1.00 12.42 ? 99   GLY B C     1 
ATOM   5693  O O     . GLY B 1 99  ? -10.618 67.775  14.702  1.00 11.73 ? 99   GLY B O     1 
ATOM   5694  N N     . ASP B 1 100 ? -11.534 66.773  12.912  1.00 13.39 ? 100  ASP B N     1 
ATOM   5695  C CA    . ASP B 1 100 ? -11.411 65.411  13.468  1.00 14.18 ? 100  ASP B CA    1 
ATOM   5696  C C     . ASP B 1 100 ? -9.907  65.182  13.791  1.00 14.79 ? 100  ASP B C     1 
ATOM   5697  O O     . ASP B 1 100 ? -9.526  64.623  14.828  1.00 14.32 ? 100  ASP B O     1 
ATOM   5698  C CB    . ASP B 1 100 ? -11.918 64.386  12.457  1.00 13.89 ? 100  ASP B CB    1 
ATOM   5699  C CG    . ASP B 1 100 ? -12.079 63.000  13.042  1.00 14.21 ? 100  ASP B CG    1 
ATOM   5700  O OD1   . ASP B 1 100 ? -12.969 62.817  13.890  1.00 16.60 ? 100  ASP B OD1   1 
ATOM   5701  O OD2   . ASP B 1 100 ? -11.347 62.070  12.632  1.00 14.12 ? 100  ASP B OD2   1 
ATOM   5702  N N     . ASP B 1 101 ? -9.055  65.648  12.892  1.00 15.43 ? 101  ASP B N     1 
ATOM   5703  C CA    . ASP B 1 101 ? -7.642  65.613  13.152  1.00 16.65 ? 101  ASP B CA    1 
ATOM   5704  C C     . ASP B 1 101 ? -7.277  66.982  13.737  1.00 16.74 ? 101  ASP B C     1 
ATOM   5705  O O     . ASP B 1 101 ? -7.425  68.016  13.074  1.00 17.05 ? 101  ASP B O     1 
ATOM   5706  C CB    . ASP B 1 101 ? -6.857  65.191  11.893  1.00 16.29 ? 101  ASP B CB    1 
ATOM   5707  C CG    . ASP B 1 101 ? -5.368  65.514  11.969  1.00 18.97 ? 101  ASP B CG    1 
ATOM   5708  O OD1   . ASP B 1 101 ? -4.850  66.034  13.004  1.00 19.65 ? 101  ASP B OD1   1 
ATOM   5709  O OD2   . ASP B 1 101 ? -4.706  65.278  10.940  1.00 21.03 ? 101  ASP B OD2   1 
ATOM   5710  N N     . THR B 1 102 ? -6.825  66.966  14.994  1.00 17.23 ? 102  THR B N     1 
ATOM   5711  C CA    . THR B 1 102 ? -6.636  68.186  15.782  1.00 17.94 ? 102  THR B CA    1 
ATOM   5712  C C     . THR B 1 102 ? -5.634  69.167  15.169  1.00 18.38 ? 102  THR B C     1 
ATOM   5713  O O     . THR B 1 102 ? -5.707  70.362  15.447  1.00 18.01 ? 102  THR B O     1 
ATOM   5714  C CB    . THR B 1 102 ? -6.251  67.892  17.259  1.00 18.03 ? 102  THR B CB    1 
ATOM   5715  O OG1   . THR B 1 102 ? -6.392  69.094  18.039  1.00 20.14 ? 102  THR B OG1   1 
ATOM   5716  C CG2   . THR B 1 102 ? -4.797  67.346  17.369  1.00 16.71 ? 102  THR B CG2   1 
ATOM   5717  N N     . SER B 1 103 ? -4.722  68.661  14.330  1.00 19.10 ? 103  SER B N     1 
ATOM   5718  C CA    . SER B 1 103 ? -3.807  69.521  13.550  1.00 19.81 ? 103  SER B CA    1 
ATOM   5719  C C     . SER B 1 103 ? -4.531  70.370  12.487  1.00 19.99 ? 103  SER B C     1 
ATOM   5720  O O     . SER B 1 103 ? -3.913  71.192  11.814  1.00 20.29 ? 103  SER B O     1 
ATOM   5721  C CB    . SER B 1 103 ? -2.725  68.682  12.857  1.00 19.52 ? 103  SER B CB    1 
ATOM   5722  O OG    . SER B 1 103 ? -3.291  68.006  11.753  1.00 19.25 ? 103  SER B OG    1 
ATOM   5723  N N     . GLN B 1 104 ? -5.825  70.149  12.302  1.00 19.93 ? 104  GLN B N     1 
ATOM   5724  C CA    . GLN B 1 104 ? -6.559  70.972  11.372  1.00 20.03 ? 104  GLN B CA    1 
ATOM   5725  C C     . GLN B 1 104 ? -7.518  71.819  12.164  1.00 20.61 ? 104  GLN B C     1 
ATOM   5726  O O     . GLN B 1 104 ? -8.315  71.294  12.948  1.00 20.89 ? 104  GLN B O     1 
ATOM   5727  C CB    . GLN B 1 104 ? -7.273  70.105  10.345  1.00 19.64 ? 104  GLN B CB    1 
ATOM   5728  C CG    . GLN B 1 104 ? -6.316  69.529  9.297   1.00 19.69 ? 104  GLN B CG    1 
ATOM   5729  C CD    . GLN B 1 104 ? -6.961  68.526  8.366   1.00 20.00 ? 104  GLN B CD    1 
ATOM   5730  O OE1   . GLN B 1 104 ? -8.176  68.390  8.304   1.00 20.80 ? 104  GLN B OE1   1 
ATOM   5731  N NE2   . GLN B 1 104 ? -6.139  67.807  7.636   1.00 22.55 ? 104  GLN B NE2   1 
ATOM   5732  N N     . SER B 1 105 ? -7.415  73.132  11.991  1.00 21.20 ? 105  SER B N     1 
ATOM   5733  C CA    . SER B 1 105 ? -8.353  74.063  12.608  1.00 22.18 ? 105  SER B CA    1 
ATOM   5734  C C     . SER B 1 105 ? -8.295  75.439  11.983  1.00 22.44 ? 105  SER B C     1 
ATOM   5735  O O     . SER B 1 105 ? -7.229  75.886  11.573  1.00 22.95 ? 105  SER B O     1 
ATOM   5736  C CB    . SER B 1 105 ? -8.095  74.183  14.104  1.00 22.09 ? 105  SER B CB    1 
ATOM   5737  O OG    . SER B 1 105 ? -6.825  74.749  14.324  1.00 24.47 ? 105  SER B OG    1 
ATOM   5738  N N     . LYS B 1 106 ? -9.448  76.109  11.948  1.00 22.62 ? 106  LYS B N     1 
ATOM   5739  C CA    . LYS B 1 106 ? -9.592  77.461  11.422  1.00 22.07 ? 106  LYS B CA    1 
ATOM   5740  C C     . LYS B 1 106 ? -10.250 78.359  12.468  1.00 21.78 ? 106  LYS B C     1 
ATOM   5741  O O     . LYS B 1 106 ? -11.121 77.918  13.256  1.00 21.12 ? 106  LYS B O     1 
ATOM   5742  C CB    . LYS B 1 106 ? -10.505 77.445  10.204  1.00 22.51 ? 106  LYS B CB    1 
ATOM   5743  C CG    . LYS B 1 106 ? -9.830  77.509  8.837   1.00 23.95 ? 106  LYS B CG    1 
ATOM   5744  C CD    . LYS B 1 106 ? -10.889 77.395  7.729   1.00 22.99 ? 106  LYS B CD    1 
ATOM   5745  C CE    . LYS B 1 106 ? -10.366 76.575  6.525   1.00 24.59 ? 106  LYS B CE    1 
ATOM   5746  N NZ    . LYS B 1 106 ? -11.446 76.264  5.513   1.00 25.09 ? 106  LYS B NZ    1 
ATOM   5747  N N     . HIS B 1 107 ? -9.823  79.620  12.480  1.00 20.81 ? 107  HIS B N     1 
ATOM   5748  C CA    . HIS B 1 107 ? -10.578 80.667  13.139  1.00 19.97 ? 107  HIS B CA    1 
ATOM   5749  C C     . HIS B 1 107 ? -11.253 81.473  12.009  1.00 19.40 ? 107  HIS B C     1 
ATOM   5750  O O     . HIS B 1 107 ? -10.584 81.933  11.110  1.00 20.23 ? 107  HIS B O     1 
ATOM   5751  C CB    . HIS B 1 107 ? -9.648  81.521  14.013  1.00 19.41 ? 107  HIS B CB    1 
ATOM   5752  C CG    . HIS B 1 107 ? -9.297  80.896  15.340  1.00 19.49 ? 107  HIS B CG    1 
ATOM   5753  N ND1   . HIS B 1 107 ? -8.468  79.796  15.459  1.00 18.28 ? 107  HIS B ND1   1 
ATOM   5754  C CD2   . HIS B 1 107 ? -9.642  81.242  16.612  1.00 17.78 ? 107  HIS B CD2   1 
ATOM   5755  C CE1   . HIS B 1 107 ? -8.335  79.479  16.739  1.00 17.08 ? 107  HIS B CE1   1 
ATOM   5756  N NE2   . HIS B 1 107 ? -9.034  80.344  17.459  1.00 16.48 ? 107  HIS B NE2   1 
ATOM   5757  N N     . ILE B 1 108 ? -12.573 81.597  11.997  1.00 18.39 ? 108  ILE B N     1 
ATOM   5758  C CA    . ILE B 1 108 ? -13.201 82.372  10.919  1.00 16.99 ? 108  ILE B CA    1 
ATOM   5759  C C     . ILE B 1 108 ? -13.863 83.610  11.485  1.00 17.04 ? 108  ILE B C     1 
ATOM   5760  O O     . ILE B 1 108 ? -14.809 83.516  12.278  1.00 16.44 ? 108  ILE B O     1 
ATOM   5761  C CB    . ILE B 1 108 ? -14.196 81.549  10.080  1.00 16.95 ? 108  ILE B CB    1 
ATOM   5762  C CG1   . ILE B 1 108 ? -13.459 80.387  9.418   1.00 15.57 ? 108  ILE B CG1   1 
ATOM   5763  C CG2   . ILE B 1 108 ? -14.861 82.440  8.990   1.00 15.35 ? 108  ILE B CG2   1 
ATOM   5764  C CD1   . ILE B 1 108 ? -14.305 79.197  9.222   1.00 14.11 ? 108  ILE B CD1   1 
ATOM   5765  N N     . SER B 1 109 ? -13.341 84.768  11.085  1.00 16.59 ? 109  SER B N     1 
ATOM   5766  C CA    . SER B 1 109 ? -13.758 86.032  11.660  1.00 16.30 ? 109  SER B CA    1 
ATOM   5767  C C     . SER B 1 109 ? -15.087 86.412  11.071  1.00 16.46 ? 109  SER B C     1 
ATOM   5768  O O     . SER B 1 109 ? -15.476 85.911  10.016  1.00 15.97 ? 109  SER B O     1 
ATOM   5769  C CB    . SER B 1 109 ? -12.731 87.128  11.373  1.00 16.33 ? 109  SER B CB    1 
ATOM   5770  O OG    . SER B 1 109 ? -13.016 87.804  10.158  1.00 16.54 ? 109  SER B OG    1 
ATOM   5771  N N     . TYR B 1 110 ? -15.784 87.312  11.755  1.00 16.96 ? 110  TYR B N     1 
ATOM   5772  C CA    . TYR B 1 110 ? -17.064 87.814  11.251  1.00 17.28 ? 110  TYR B CA    1 
ATOM   5773  C C     . TYR B 1 110 ? -16.954 88.416  9.851   1.00 17.87 ? 110  TYR B C     1 
ATOM   5774  O O     . TYR B 1 110 ? -17.792 88.130  9.027   1.00 18.50 ? 110  TYR B O     1 
ATOM   5775  C CB    . TYR B 1 110 ? -17.733 88.765  12.243  1.00 16.65 ? 110  TYR B CB    1 
ATOM   5776  C CG    . TYR B 1 110 ? -18.609 88.054  13.225  1.00 15.12 ? 110  TYR B CG    1 
ATOM   5777  C CD1   . TYR B 1 110 ? -18.104 87.632  14.457  1.00 16.13 ? 110  TYR B CD1   1 
ATOM   5778  C CD2   . TYR B 1 110 ? -19.937 87.759  12.921  1.00 14.84 ? 110  TYR B CD2   1 
ATOM   5779  C CE1   . TYR B 1 110 ? -18.920 86.939  15.381  1.00 15.87 ? 110  TYR B CE1   1 
ATOM   5780  C CE2   . TYR B 1 110 ? -20.775 87.065  13.839  1.00 13.47 ? 110  TYR B CE2   1 
ATOM   5781  C CZ    . TYR B 1 110 ? -20.253 86.666  15.061  1.00 15.55 ? 110  TYR B CZ    1 
ATOM   5782  O OH    . TYR B 1 110 ? -21.043 86.010  15.981  1.00 16.31 ? 110  TYR B OH    1 
ATOM   5783  N N     . ARG B 1 111 ? -15.906 89.187  9.571   1.00 18.48 ? 111  ARG B N     1 
ATOM   5784  C CA    . ARG B 1 111 ? -15.684 89.701  8.217   1.00 19.78 ? 111  ARG B CA    1 
ATOM   5785  C C     . ARG B 1 111 ? -15.446 88.574  7.192   1.00 19.49 ? 111  ARG B C     1 
ATOM   5786  O O     . ARG B 1 111 ? -16.000 88.620  6.095   1.00 19.27 ? 111  ARG B O     1 
ATOM   5787  C CB    . ARG B 1 111 ? -14.576 90.788  8.187   1.00 19.87 ? 111  ARG B CB    1 
ATOM   5788  C CG    . ARG B 1 111 ? -14.103 91.224  6.792   1.00 20.72 ? 111  ARG B CG    1 
ATOM   5789  C CD    . ARG B 1 111 ? -13.437 92.598  6.793   1.00 21.07 ? 111  ARG B CD    1 
ATOM   5790  N NE    . ARG B 1 111 ? -14.445 93.669  6.785   1.00 25.53 ? 111  ARG B NE    1 
ATOM   5791  C CZ    . ARG B 1 111 ? -14.761 94.431  7.839   1.00 25.34 ? 111  ARG B CZ    1 
ATOM   5792  N NH1   . ARG B 1 111 ? -14.128 94.277  9.010   1.00 25.66 ? 111  ARG B NH1   1 
ATOM   5793  N NH2   . ARG B 1 111 ? -15.705 95.356  7.718   1.00 22.12 ? 111  ARG B NH2   1 
ATOM   5794  N N     . GLU B 1 112 ? -14.650 87.564  7.560   1.00 19.73 ? 112  GLU B N     1 
ATOM   5795  C CA    . GLU B 1 112 ? -14.429 86.380  6.683   1.00 19.74 ? 112  GLU B CA    1 
ATOM   5796  C C     . GLU B 1 112 ? -15.721 85.595  6.412   1.00 18.95 ? 112  GLU B C     1 
ATOM   5797  O O     . GLU B 1 112 ? -16.015 85.274  5.268   1.00 19.37 ? 112  GLU B O     1 
ATOM   5798  C CB    . GLU B 1 112 ? -13.299 85.453  7.188   1.00 20.02 ? 112  GLU B CB    1 
ATOM   5799  C CG    . GLU B 1 112 ? -11.862 85.971  6.952   1.00 21.16 ? 112  GLU B CG    1 
ATOM   5800  C CD    . GLU B 1 112 ? -10.872 85.631  8.090   1.00 23.71 ? 112  GLU B CD    1 
ATOM   5801  O OE1   . GLU B 1 112 ? -11.179 84.813  8.992   1.00 23.27 ? 112  GLU B OE1   1 
ATOM   5802  O OE2   . GLU B 1 112 ? -9.761  86.207  8.095   1.00 25.13 ? 112  GLU B OE2   1 
ATOM   5803  N N     . LEU B 1 113 ? -16.494 85.299  7.446   1.00 18.33 ? 113  LEU B N     1 
ATOM   5804  C CA    . LEU B 1 113 ? -17.772 84.631  7.257   1.00 17.86 ? 113  LEU B CA    1 
ATOM   5805  C C     . LEU B 1 113 ? -18.722 85.470  6.393   1.00 18.88 ? 113  LEU B C     1 
ATOM   5806  O O     . LEU B 1 113 ? -19.320 84.934  5.448   1.00 19.29 ? 113  LEU B O     1 
ATOM   5807  C CB    . LEU B 1 113 ? -18.421 84.299  8.603   1.00 18.10 ? 113  LEU B CB    1 
ATOM   5808  C CG    . LEU B 1 113 ? -19.582 83.287  8.659   1.00 16.74 ? 113  LEU B CG    1 
ATOM   5809  C CD1   . LEU B 1 113 ? -19.242 81.965  7.967   1.00 14.95 ? 113  LEU B CD1   1 
ATOM   5810  C CD2   . LEU B 1 113 ? -19.980 83.046  10.100  1.00 16.04 ? 113  LEU B CD2   1 
ATOM   5811  N N     . HIS B 1 114 ? -18.853 86.770  6.691   1.00 18.60 ? 114  HIS B N     1 
ATOM   5812  C CA    . HIS B 1 114 ? -19.652 87.672  5.846   1.00 19.15 ? 114  HIS B CA    1 
ATOM   5813  C C     . HIS B 1 114 ? -19.247 87.590  4.367   1.00 19.26 ? 114  HIS B C     1 
ATOM   5814  O O     . HIS B 1 114 ? -20.093 87.518  3.467   1.00 19.30 ? 114  HIS B O     1 
ATOM   5815  C CB    . HIS B 1 114 ? -19.572 89.135  6.332   1.00 19.24 ? 114  HIS B CB    1 
ATOM   5816  C CG    . HIS B 1 114 ? -20.434 90.086  5.547   1.00 20.24 ? 114  HIS B CG    1 
ATOM   5817  N ND1   . HIS B 1 114 ? -19.928 90.925  4.571   1.00 20.35 ? 114  HIS B ND1   1 
ATOM   5818  C CD2   . HIS B 1 114 ? -21.770 90.323  5.587   1.00 19.41 ? 114  HIS B CD2   1 
ATOM   5819  C CE1   . HIS B 1 114 ? -20.911 91.644  4.055   1.00 19.06 ? 114  HIS B CE1   1 
ATOM   5820  N NE2   . HIS B 1 114 ? -22.040 91.296  4.654   1.00 19.98 ? 114  HIS B NE2   1 
ATOM   5821  N N     . ARG B 1 115 ? -17.947 87.591  4.133   1.00 18.99 ? 115  ARG B N     1 
ATOM   5822  C CA    . ARG B 1 115 ? -17.427 87.657  2.801   1.00 19.77 ? 115  ARG B CA    1 
ATOM   5823  C C     . ARG B 1 115 ? -17.811 86.376  2.053   1.00 18.55 ? 115  ARG B C     1 
ATOM   5824  O O     . ARG B 1 115 ? -18.336 86.450  0.952   1.00 18.26 ? 115  ARG B O     1 
ATOM   5825  C CB    . ARG B 1 115 ? -15.917 87.892  2.875   1.00 19.84 ? 115  ARG B CB    1 
ATOM   5826  C CG    . ARG B 1 115 ? -15.178 87.774  1.576   1.00 21.90 ? 115  ARG B CG    1 
ATOM   5827  C CD    . ARG B 1 115 ? -13.681 88.072  1.761   1.00 23.35 ? 115  ARG B CD    1 
ATOM   5828  N NE    . ARG B 1 115 ? -13.007 88.024  0.455   1.00 32.41 ? 115  ARG B NE    1 
ATOM   5829  C CZ    . ARG B 1 115 ? -13.031 89.005  -0.458  1.00 33.61 ? 115  ARG B CZ    1 
ATOM   5830  N NH1   . ARG B 1 115 ? -13.674 90.154  -0.213  1.00 34.68 ? 115  ARG B NH1   1 
ATOM   5831  N NH2   . ARG B 1 115 ? -12.405 88.838  -1.620  1.00 32.55 ? 115  ARG B NH2   1 
ATOM   5832  N N     . ASP B 1 116 ? -17.585 85.211  2.659   1.00 17.70 ? 116  ASP B N     1 
ATOM   5833  C CA    . ASP B 1 116 ? -17.986 83.954  2.029   1.00 17.13 ? 116  ASP B CA    1 
ATOM   5834  C C     . ASP B 1 116 ? -19.500 83.809  1.916   1.00 16.32 ? 116  ASP B C     1 
ATOM   5835  O O     . ASP B 1 116 ? -19.995 83.232  0.951   1.00 16.04 ? 116  ASP B O     1 
ATOM   5836  C CB    . ASP B 1 116 ? -17.374 82.733  2.726   1.00 17.49 ? 116  ASP B CB    1 
ATOM   5837  C CG    . ASP B 1 116 ? -15.881 82.583  2.439   1.00 19.35 ? 116  ASP B CG    1 
ATOM   5838  O OD1   . ASP B 1 116 ? -15.447 82.768  1.275   1.00 19.56 ? 116  ASP B OD1   1 
ATOM   5839  O OD2   . ASP B 1 116 ? -15.134 82.285  3.391   1.00 21.99 ? 116  ASP B OD2   1 
ATOM   5840  N N     . VAL B 1 117 ? -20.254 84.327  2.875   1.00 15.59 ? 117  VAL B N     1 
ATOM   5841  C CA    . VAL B 1 117 ? -21.705 84.238  2.732   1.00 15.45 ? 117  VAL B CA    1 
ATOM   5842  C C     . VAL B 1 117 ? -22.265 85.043  1.518   1.00 15.61 ? 117  VAL B C     1 
ATOM   5843  O O     . VAL B 1 117 ? -23.069 84.523  0.733   1.00 15.06 ? 117  VAL B O     1 
ATOM   5844  C CB    . VAL B 1 117 ? -22.436 84.535  4.052   1.00 15.44 ? 117  VAL B CB    1 
ATOM   5845  C CG1   . VAL B 1 117 ? -23.895 84.895  3.780   1.00 13.86 ? 117  VAL B CG1   1 
ATOM   5846  C CG2   . VAL B 1 117 ? -22.332 83.313  4.979   1.00 14.05 ? 117  VAL B CG2   1 
ATOM   5847  N N     . CYS B 1 118 ? -21.806 86.282  1.353   1.00 15.84 ? 118  CYS B N     1 
ATOM   5848  C CA    . CYS B 1 118 ? -22.132 87.066  0.172   1.00 16.49 ? 118  CYS B CA    1 
ATOM   5849  C C     . CYS B 1 118 ? -21.818 86.363  -1.173  1.00 17.04 ? 118  CYS B C     1 
ATOM   5850  O O     . CYS B 1 118 ? -22.698 86.240  -2.050  1.00 16.89 ? 118  CYS B O     1 
ATOM   5851  C CB    . CYS B 1 118 ? -21.429 88.412  0.256   1.00 16.90 ? 118  CYS B CB    1 
ATOM   5852  S SG    . CYS B 1 118 ? -22.071 89.411  1.576   1.00 16.79 ? 118  CYS B SG    1 
ATOM   5853  N N     . ARG B 1 119 ? -20.578 85.897  -1.318  1.00 17.22 ? 119  ARG B N     1 
ATOM   5854  C CA    . ARG B 1 119 ? -20.140 85.167  -2.506  1.00 17.80 ? 119  ARG B CA    1 
ATOM   5855  C C     . ARG B 1 119 ? -20.984 83.951  -2.776  1.00 17.68 ? 119  ARG B C     1 
ATOM   5856  O O     . ARG B 1 119 ? -21.197 83.564  -3.922  1.00 18.04 ? 119  ARG B O     1 
ATOM   5857  C CB    . ARG B 1 119 ? -18.683 84.759  -2.368  1.00 18.03 ? 119  ARG B CB    1 
ATOM   5858  C CG    . ARG B 1 119 ? -17.787 85.958  -2.312  1.00 20.92 ? 119  ARG B CG    1 
ATOM   5859  C CD    . ARG B 1 119 ? -16.442 85.700  -2.888  1.00 27.37 ? 119  ARG B CD    1 
ATOM   5860  N NE    . ARG B 1 119 ? -15.648 84.857  -2.005  1.00 32.75 ? 119  ARG B NE    1 
ATOM   5861  C CZ    . ARG B 1 119 ? -14.440 84.386  -2.310  1.00 36.65 ? 119  ARG B CZ    1 
ATOM   5862  N NH1   . ARG B 1 119 ? -13.883 84.686  -3.489  1.00 37.74 ? 119  ARG B NH1   1 
ATOM   5863  N NH2   . ARG B 1 119 ? -13.791 83.603  -1.443  1.00 37.69 ? 119  ARG B NH2   1 
ATOM   5864  N N     . PHE B 1 120 ? -21.479 83.346  -1.710  1.00 17.85 ? 120  PHE B N     1 
ATOM   5865  C CA    . PHE B 1 120 ? -22.241 82.141  -1.859  1.00 17.35 ? 120  PHE B CA    1 
ATOM   5866  C C     . PHE B 1 120 ? -23.718 82.440  -2.048  1.00 17.30 ? 120  PHE B C     1 
ATOM   5867  O O     . PHE B 1 120 ? -24.432 81.675  -2.726  1.00 17.78 ? 120  PHE B O     1 
ATOM   5868  C CB    . PHE B 1 120 ? -22.005 81.155  -0.721  1.00 17.24 ? 120  PHE B CB    1 
ATOM   5869  C CG    . PHE B 1 120 ? -22.479 79.785  -1.054  1.00 17.05 ? 120  PHE B CG    1 
ATOM   5870  C CD1   . PHE B 1 120 ? -21.749 78.986  -1.913  1.00 16.52 ? 120  PHE B CD1   1 
ATOM   5871  C CD2   . PHE B 1 120 ? -23.701 79.331  -0.598  1.00 16.20 ? 120  PHE B CD2   1 
ATOM   5872  C CE1   . PHE B 1 120 ? -22.218 77.728  -2.269  1.00 17.40 ? 120  PHE B CE1   1 
ATOM   5873  C CE2   . PHE B 1 120 ? -24.169 78.070  -0.944  1.00 17.89 ? 120  PHE B CE2   1 
ATOM   5874  C CZ    . PHE B 1 120 ? -23.426 77.263  -1.773  1.00 17.10 ? 120  PHE B CZ    1 
ATOM   5875  N N     . ALA B 1 121 ? -24.179 83.545  -1.472  1.00 16.71 ? 121  ALA B N     1 
ATOM   5876  C CA    . ALA B 1 121 ? -25.499 84.057  -1.813  1.00 16.35 ? 121  ALA B CA    1 
ATOM   5877  C C     . ALA B 1 121 ? -25.551 84.379  -3.317  1.00 16.32 ? 121  ALA B C     1 
ATOM   5878  O O     . ALA B 1 121 ? -26.541 84.066  -4.000  1.00 16.83 ? 121  ALA B O     1 
ATOM   5879  C CB    . ALA B 1 121 ? -25.807 85.272  -1.003  1.00 16.05 ? 121  ALA B CB    1 
ATOM   5880  N N     . ASN B 1 122 ? -24.481 84.991  -3.828  1.00 15.62 ? 122  ASN B N     1 
ATOM   5881  C CA    . ASN B 1 122 ? -24.396 85.321  -5.236  1.00 15.12 ? 122  ASN B CA    1 
ATOM   5882  C C     . ASN B 1 122 ? -24.312 84.059  -6.075  1.00 15.59 ? 122  ASN B C     1 
ATOM   5883  O O     . ASN B 1 122 ? -24.877 83.987  -7.184  1.00 15.78 ? 122  ASN B O     1 
ATOM   5884  C CB    . ASN B 1 122 ? -23.235 86.278  -5.519  1.00 14.17 ? 122  ASN B CB    1 
ATOM   5885  C CG    . ASN B 1 122 ? -23.600 87.717  -5.225  1.00 13.39 ? 122  ASN B CG    1 
ATOM   5886  O OD1   . ASN B 1 122 ? -24.739 88.131  -5.448  1.00 15.12 ? 122  ASN B OD1   1 
ATOM   5887  N ND2   . ASN B 1 122 ? -22.649 88.487  -4.704  1.00 9.15  ? 122  ASN B ND2   1 
ATOM   5888  N N     . THR B 1 123 ? -23.631 83.056  -5.539  1.00 15.64 ? 123  THR B N     1 
ATOM   5889  C CA    . THR B 1 123 ? -23.526 81.799  -6.241  1.00 16.14 ? 123  THR B CA    1 
ATOM   5890  C C     . THR B 1 123 ? -24.922 81.236  -6.433  1.00 16.55 ? 123  THR B C     1 
ATOM   5891  O O     . THR B 1 123 ? -25.278 80.874  -7.566  1.00 17.49 ? 123  THR B O     1 
ATOM   5892  C CB    . THR B 1 123 ? -22.604 80.823  -5.515  1.00 16.43 ? 123  THR B CB    1 
ATOM   5893  O OG1   . THR B 1 123 ? -21.250 81.244  -5.700  1.00 16.74 ? 123  THR B OG1   1 
ATOM   5894  C CG2   . THR B 1 123 ? -22.730 79.440  -6.088  1.00 16.75 ? 123  THR B CG2   1 
ATOM   5895  N N     . LEU B 1 124 ? -25.720 81.207  -5.353  1.00 16.21 ? 124  LEU B N     1 
ATOM   5896  C CA    . LEU B 1 124 ? -27.101 80.688  -5.388  1.00 15.72 ? 124  LEU B CA    1 
ATOM   5897  C C     . LEU B 1 124 ? -27.965 81.409  -6.411  1.00 15.90 ? 124  LEU B C     1 
ATOM   5898  O O     . LEU B 1 124 ? -28.543 80.776  -7.307  1.00 15.99 ? 124  LEU B O     1 
ATOM   5899  C CB    . LEU B 1 124 ? -27.756 80.766  -4.010  1.00 15.69 ? 124  LEU B CB    1 
ATOM   5900  C CG    . LEU B 1 124 ? -27.119 79.910  -2.910  1.00 15.35 ? 124  LEU B CG    1 
ATOM   5901  C CD1   . LEU B 1 124 ? -27.983 79.914  -1.701  1.00 14.45 ? 124  LEU B CD1   1 
ATOM   5902  C CD2   . LEU B 1 124 ? -26.860 78.492  -3.380  1.00 13.51 ? 124  LEU B CD2   1 
ATOM   5903  N N     . LEU B 1 125 ? -28.021 82.735  -6.302  1.00 15.93 ? 125  LEU B N     1 
ATOM   5904  C CA    . LEU B 1 125 ? -28.682 83.563  -7.315  1.00 15.72 ? 125  LEU B CA    1 
ATOM   5905  C C     . LEU B 1 125 ? -28.235 83.251  -8.764  1.00 16.06 ? 125  LEU B C     1 
ATOM   5906  O O     . LEU B 1 125 ? -29.092 83.091  -9.630  1.00 15.44 ? 125  LEU B O     1 
ATOM   5907  C CB    . LEU B 1 125 ? -28.543 85.047  -6.986  1.00 15.23 ? 125  LEU B CB    1 
ATOM   5908  C CG    . LEU B 1 125 ? -29.258 85.490  -5.703  1.00 15.27 ? 125  LEU B CG    1 
ATOM   5909  C CD1   . LEU B 1 125 ? -28.601 86.749  -5.090  1.00 12.60 ? 125  LEU B CD1   1 
ATOM   5910  C CD2   . LEU B 1 125 ? -30.798 85.649  -5.892  1.00 11.80 ? 125  LEU B CD2   1 
ATOM   5911  N N     . ASP B 1 126 ? -26.919 83.146  -9.019  1.00 16.35 ? 126  ASP B N     1 
ATOM   5912  C CA    . ASP B 1 126 ? -26.416 82.797  -10.377 1.00 16.50 ? 126  ASP B CA    1 
ATOM   5913  C C     . ASP B 1 126 ? -26.930 81.449  -10.871 1.00 16.05 ? 126  ASP B C     1 
ATOM   5914  O O     . ASP B 1 126 ? -27.044 81.238  -12.064 1.00 15.29 ? 126  ASP B O     1 
ATOM   5915  C CB    . ASP B 1 126 ? -24.884 82.790  -10.483 1.00 16.52 ? 126  ASP B CB    1 
ATOM   5916  C CG    . ASP B 1 126 ? -24.252 84.162  -10.239 1.00 19.09 ? 126  ASP B CG    1 
ATOM   5917  O OD1   . ASP B 1 126 ? -24.990 85.167  -10.089 1.00 21.84 ? 126  ASP B OD1   1 
ATOM   5918  O OD2   . ASP B 1 126 ? -22.999 84.233  -10.177 1.00 19.20 ? 126  ASP B OD2   1 
ATOM   5919  N N     . LEU B 1 127 ? -27.225 80.532  -9.960  1.00 16.04 ? 127  LEU B N     1 
ATOM   5920  C CA    . LEU B 1 127 ? -27.797 79.250  -10.374 1.00 16.18 ? 127  LEU B CA    1 
ATOM   5921  C C     . LEU B 1 127 ? -29.306 79.304  -10.594 1.00 16.28 ? 127  LEU B C     1 
ATOM   5922  O O     . LEU B 1 127 ? -29.906 78.290  -10.958 1.00 15.87 ? 127  LEU B O     1 
ATOM   5923  C CB    . LEU B 1 127 ? -27.468 78.153  -9.356  1.00 16.17 ? 127  LEU B CB    1 
ATOM   5924  C CG    . LEU B 1 127 ? -26.337 77.177  -9.666  1.00 14.89 ? 127  LEU B CG    1 
ATOM   5925  C CD1   . LEU B 1 127 ? -25.347 77.694  -10.739 1.00 11.96 ? 127  LEU B CD1   1 
ATOM   5926  C CD2   . LEU B 1 127 ? -25.668 76.854  -8.359  1.00 12.95 ? 127  LEU B CD2   1 
ATOM   5927  N N     . GLY B 1 128 ? -29.899 80.479  -10.347 1.00 16.32 ? 128  GLY B N     1 
ATOM   5928  C CA    . GLY B 1 128 ? -31.336 80.709  -10.504 1.00 16.40 ? 128  GLY B CA    1 
ATOM   5929  C C     . GLY B 1 128 ? -32.171 80.394  -9.271  1.00 16.87 ? 128  GLY B C     1 
ATOM   5930  O O     . GLY B 1 128 ? -33.394 80.276  -9.346  1.00 16.35 ? 128  GLY B O     1 
ATOM   5931  N N     . ILE B 1 129 ? -31.525 80.216  -8.127  1.00 17.70 ? 129  ILE B N     1 
ATOM   5932  C CA    . ILE B 1 129 ? -32.256 79.920  -6.906  1.00 18.16 ? 129  ILE B CA    1 
ATOM   5933  C C     . ILE B 1 129 ? -32.907 81.236  -6.503  1.00 18.66 ? 129  ILE B C     1 
ATOM   5934  O O     . ILE B 1 129 ? -32.246 82.279  -6.540  1.00 18.79 ? 129  ILE B O     1 
ATOM   5935  C CB    . ILE B 1 129 ? -31.306 79.400  -5.790  1.00 18.47 ? 129  ILE B CB    1 
ATOM   5936  C CG1   . ILE B 1 129 ? -30.544 78.147  -6.253  1.00 18.23 ? 129  ILE B CG1   1 
ATOM   5937  C CG2   . ILE B 1 129 ? -32.071 79.147  -4.471  1.00 17.70 ? 129  ILE B CG2   1 
ATOM   5938  C CD1   . ILE B 1 129 ? -31.418 77.021  -6.730  1.00 17.82 ? 129  ILE B CD1   1 
ATOM   5939  N N     . LYS B 1 130 ? -34.197 81.204  -6.169  1.00 18.92 ? 130  LYS B N     1 
ATOM   5940  C CA    . LYS B 1 130 ? -34.918 82.424  -5.776  1.00 20.01 ? 130  LYS B CA    1 
ATOM   5941  C C     . LYS B 1 130 ? -35.614 82.258  -4.427  1.00 19.55 ? 130  LYS B C     1 
ATOM   5942  O O     . LYS B 1 130 ? -35.739 81.140  -3.915  1.00 20.36 ? 130  LYS B O     1 
ATOM   5943  C CB    . LYS B 1 130 ? -35.909 82.881  -6.872  1.00 19.75 ? 130  LYS B CB    1 
ATOM   5944  C CG    . LYS B 1 130 ? -36.654 81.738  -7.570  1.00 22.33 ? 130  LYS B CG    1 
ATOM   5945  C CD    . LYS B 1 130 ? -37.691 82.194  -8.634  1.00 21.89 ? 130  LYS B CD    1 
ATOM   5946  C CE    . LYS B 1 130 ? -38.832 81.164  -8.735  1.00 24.68 ? 130  LYS B CE    1 
ATOM   5947  N NZ    . LYS B 1 130 ? -38.306 79.752  -8.881  1.00 25.94 ? 130  LYS B NZ    1 
ATOM   5948  N N     . LYS B 1 131 ? -36.054 83.373  -3.851  1.00 19.07 ? 131  LYS B N     1 
ATOM   5949  C CA    . LYS B 1 131 ? -36.797 83.382  -2.600  1.00 17.96 ? 131  LYS B CA    1 
ATOM   5950  C C     . LYS B 1 131 ? -37.849 82.262  -2.606  1.00 17.74 ? 131  LYS B C     1 
ATOM   5951  O O     . LYS B 1 131 ? -38.486 81.992  -3.636  1.00 18.14 ? 131  LYS B O     1 
ATOM   5952  C CB    . LYS B 1 131 ? -37.426 84.760  -2.392  1.00 17.59 ? 131  LYS B CB    1 
ATOM   5953  C CG    . LYS B 1 131 ? -38.383 84.858  -1.192  1.00 18.05 ? 131  LYS B CG    1 
ATOM   5954  C CD    . LYS B 1 131 ? -38.523 86.289  -0.687  1.00 15.66 ? 131  LYS B CD    1 
ATOM   5955  C CE    . LYS B 1 131 ? -39.495 86.382  0.460   1.00 15.19 ? 131  LYS B CE    1 
ATOM   5956  N NZ    . LYS B 1 131 ? -39.748 87.815  0.736   1.00 17.21 ? 131  LYS B NZ    1 
ATOM   5957  N N     . GLY B 1 132 ? -37.999 81.580  -1.476  1.00 17.04 ? 132  GLY B N     1 
ATOM   5958  C CA    . GLY B 1 132 ? -38.944 80.465  -1.376  1.00 16.33 ? 132  GLY B CA    1 
ATOM   5959  C C     . GLY B 1 132 ? -38.492 79.102  -1.902  1.00 16.30 ? 132  GLY B C     1 
ATOM   5960  O O     . GLY B 1 132 ? -39.084 78.099  -1.528  1.00 16.62 ? 132  GLY B O     1 
ATOM   5961  N N     . ASP B 1 133 ? -37.487 79.035  -2.783  1.00 15.85 ? 133  ASP B N     1 
ATOM   5962  C CA    . ASP B 1 133 ? -36.990 77.727  -3.240  1.00 16.26 ? 133  ASP B CA    1 
ATOM   5963  C C     . ASP B 1 133 ? -36.422 76.966  -2.069  1.00 15.75 ? 133  ASP B C     1 
ATOM   5964  O O     . ASP B 1 133 ? -35.827 77.578  -1.174  1.00 16.17 ? 133  ASP B O     1 
ATOM   5965  C CB    . ASP B 1 133 ? -35.866 77.878  -4.262  1.00 16.76 ? 133  ASP B CB    1 
ATOM   5966  C CG    . ASP B 1 133 ? -36.370 78.316  -5.606  1.00 17.72 ? 133  ASP B CG    1 
ATOM   5967  O OD1   . ASP B 1 133 ? -37.583 78.172  -5.844  1.00 18.76 ? 133  ASP B OD1   1 
ATOM   5968  O OD2   . ASP B 1 133 ? -35.556 78.797  -6.418  1.00 19.06 ? 133  ASP B OD2   1 
ATOM   5969  N N     . VAL B 1 134 ? -36.590 75.650  -2.073  1.00 14.53 ? 134  VAL B N     1 
ATOM   5970  C CA    . VAL B 1 134 ? -36.030 74.817  -1.008  1.00 13.73 ? 134  VAL B CA    1 
ATOM   5971  C C     . VAL B 1 134 ? -34.671 74.293  -1.450  1.00 13.56 ? 134  VAL B C     1 
ATOM   5972  O O     . VAL B 1 134 ? -34.539 73.745  -2.555  1.00 13.24 ? 134  VAL B O     1 
ATOM   5973  C CB    . VAL B 1 134 ? -36.958 73.623  -0.622  1.00 13.94 ? 134  VAL B CB    1 
ATOM   5974  C CG1   . VAL B 1 134 ? -36.241 72.652  0.300   1.00 12.19 ? 134  VAL B CG1   1 
ATOM   5975  C CG2   . VAL B 1 134 ? -38.267 74.116  0.023   1.00 13.18 ? 134  VAL B CG2   1 
ATOM   5976  N N     . VAL B 1 135 ? -33.674 74.467  -0.572  1.00 13.25 ? 135  VAL B N     1 
ATOM   5977  C CA    . VAL B 1 135 ? -32.302 73.994  -0.807  1.00 12.21 ? 135  VAL B CA    1 
ATOM   5978  C C     . VAL B 1 135 ? -31.889 72.885  0.151   1.00 12.36 ? 135  VAL B C     1 
ATOM   5979  O O     . VAL B 1 135 ? -31.961 73.032  1.370   1.00 12.53 ? 135  VAL B O     1 
ATOM   5980  C CB    . VAL B 1 135 ? -31.306 75.167  -0.781  1.00 12.17 ? 135  VAL B CB    1 
ATOM   5981  C CG1   . VAL B 1 135 ? -29.867 74.658  -0.820  1.00 10.61 ? 135  VAL B CG1   1 
ATOM   5982  C CG2   . VAL B 1 135 ? -31.615 76.105  -1.946  1.00 10.04 ? 135  VAL B CG2   1 
ATOM   5983  N N     . ALA B 1 136 ? -31.486 71.753  -0.416  1.00 12.88 ? 136  ALA B N     1 
ATOM   5984  C CA    . ALA B 1 136 ? -31.076 70.573  0.371   1.00 12.72 ? 136  ALA B CA    1 
ATOM   5985  C C     . ALA B 1 136 ? -29.604 70.708  0.702   1.00 12.68 ? 136  ALA B C     1 
ATOM   5986  O O     . ALA B 1 136 ? -28.769 70.891  -0.191  1.00 12.72 ? 136  ALA B O     1 
ATOM   5987  C CB    . ALA B 1 136 ? -31.343 69.275  -0.402  1.00 12.91 ? 136  ALA B CB    1 
ATOM   5988  N N     . ILE B 1 137 ? -29.291 70.666  1.995   1.00 12.91 ? 137  ILE B N     1 
ATOM   5989  C CA    . ILE B 1 137 ? -27.920 70.779  2.465   1.00 12.17 ? 137  ILE B CA    1 
ATOM   5990  C C     . ILE B 1 137 ? -27.583 69.480  3.173   1.00 12.50 ? 137  ILE B C     1 
ATOM   5991  O O     . ILE B 1 137 ? -28.154 69.172  4.215   1.00 13.36 ? 137  ILE B O     1 
ATOM   5992  C CB    . ILE B 1 137 ? -27.719 72.002  3.410   1.00 12.12 ? 137  ILE B CB    1 
ATOM   5993  C CG1   . ILE B 1 137 ? -28.158 73.282  2.716   1.00 9.14  ? 137  ILE B CG1   1 
ATOM   5994  C CG2   . ILE B 1 137 ? -26.251 72.100  3.896   1.00 11.05 ? 137  ILE B CG2   1 
ATOM   5995  C CD1   . ILE B 1 137 ? -27.673 74.500  3.359   1.00 7.33  ? 137  ILE B CD1   1 
ATOM   5996  N N     . TYR B 1 138 ? -26.666 68.714  2.592   1.00 12.02 ? 138  TYR B N     1 
ATOM   5997  C CA    . TYR B 1 138 ? -26.269 67.432  3.137   1.00 11.97 ? 138  TYR B CA    1 
ATOM   5998  C C     . TYR B 1 138 ? -24.781 67.502  3.330   1.00 12.38 ? 138  TYR B C     1 
ATOM   5999  O O     . TYR B 1 138 ? -24.006 67.127  2.451   1.00 12.12 ? 138  TYR B O     1 
ATOM   6000  C CB    . TYR B 1 138 ? -26.642 66.349  2.140   1.00 11.25 ? 138  TYR B CB    1 
ATOM   6001  C CG    . TYR B 1 138 ? -26.403 64.898  2.512   1.00 11.13 ? 138  TYR B CG    1 
ATOM   6002  C CD1   . TYR B 1 138 ? -26.980 64.305  3.653   1.00 8.70  ? 138  TYR B CD1   1 
ATOM   6003  C CD2   . TYR B 1 138 ? -25.685 64.082  1.653   1.00 12.64 ? 138  TYR B CD2   1 
ATOM   6004  C CE1   . TYR B 1 138 ? -26.789 62.958  3.929   1.00 8.86  ? 138  TYR B CE1   1 
ATOM   6005  C CE2   . TYR B 1 138 ? -25.505 62.718  1.921   1.00 11.73 ? 138  TYR B CE2   1 
ATOM   6006  C CZ    . TYR B 1 138 ? -26.043 62.173  3.037   1.00 9.88  ? 138  TYR B CZ    1 
ATOM   6007  O OH    . TYR B 1 138 ? -25.818 60.843  3.226   1.00 9.74  ? 138  TYR B OH    1 
ATOM   6008  N N     . MET B 1 139 ? -24.380 68.002  4.489   1.00 13.06 ? 139  MET B N     1 
ATOM   6009  C CA    . MET B 1 139 ? -22.994 68.361  4.695   1.00 13.88 ? 139  MET B CA    1 
ATOM   6010  C C     . MET B 1 139 ? -22.448 67.861  6.019   1.00 14.44 ? 139  MET B C     1 
ATOM   6011  O O     . MET B 1 139 ? -23.206 67.551  6.931   1.00 13.78 ? 139  MET B O     1 
ATOM   6012  C CB    . MET B 1 139 ? -22.854 69.868  4.604   1.00 13.78 ? 139  MET B CB    1 
ATOM   6013  C CG    . MET B 1 139 ? -23.046 70.367  3.222   1.00 15.92 ? 139  MET B CG    1 
ATOM   6014  S SD    . MET B 1 139 ? -21.513 70.838  2.490   1.00 22.92 ? 139  MET B SD    1 
ATOM   6015  C CE    . MET B 1 139 ? -21.657 72.561  2.873   1.00 24.29 ? 139  MET B CE    1 
ATOM   6016  N N     . PRO B 1 140 ? -21.115 67.748  6.107   1.00 15.36 ? 140  PRO B N     1 
ATOM   6017  C CA    . PRO B 1 140 ? -20.513 67.373  7.368   1.00 15.82 ? 140  PRO B CA    1 
ATOM   6018  C C     . PRO B 1 140 ? -20.289 68.649  8.190   1.00 16.36 ? 140  PRO B C     1 
ATOM   6019  O O     . PRO B 1 140 ? -20.623 69.749  7.736   1.00 16.49 ? 140  PRO B O     1 
ATOM   6020  C CB    . PRO B 1 140 ? -19.168 66.736  6.948   1.00 16.03 ? 140  PRO B CB    1 
ATOM   6021  C CG    . PRO B 1 140 ? -18.792 67.406  5.648   1.00 16.20 ? 140  PRO B CG    1 
ATOM   6022  C CD    . PRO B 1 140 ? -20.110 67.956  5.037   1.00 15.33 ? 140  PRO B CD    1 
ATOM   6023  N N     . MET B 1 141 ? -19.719 68.482  9.383   1.00 16.10 ? 141  MET B N     1 
ATOM   6024  C CA    . MET B 1 141 ? -19.495 69.566  10.320  1.00 15.01 ? 141  MET B CA    1 
ATOM   6025  C C     . MET B 1 141 ? -18.217 70.278  9.911   1.00 15.21 ? 141  MET B C     1 
ATOM   6026  O O     . MET B 1 141 ? -17.138 70.069  10.490  1.00 15.42 ? 141  MET B O     1 
ATOM   6027  C CB    . MET B 1 141 ? -19.421 68.989  11.726  1.00 14.19 ? 141  MET B CB    1 
ATOM   6028  C CG    . MET B 1 141 ? -20.770 68.564  12.239  1.00 13.06 ? 141  MET B CG    1 
ATOM   6029  S SD    . MET B 1 141 ? -21.700 70.020  12.809  1.00 13.27 ? 141  MET B SD    1 
ATOM   6030  C CE    . MET B 1 141 ? -21.028 70.149  14.484  1.00 11.59 ? 141  MET B CE    1 
ATOM   6031  N N     . VAL B 1 142 ? -18.356 71.073  8.853   1.00 15.11 ? 142  VAL B N     1 
ATOM   6032  C CA    . VAL B 1 142 ? -17.299 71.927  8.323   1.00 14.53 ? 142  VAL B CA    1 
ATOM   6033  C C     . VAL B 1 142 ? -17.898 73.314  8.164   1.00 14.47 ? 142  VAL B C     1 
ATOM   6034  O O     . VAL B 1 142 ? -19.120 73.437  7.931   1.00 14.02 ? 142  VAL B O     1 
ATOM   6035  C CB    . VAL B 1 142 ? -16.821 71.446  6.948   1.00 14.61 ? 142  VAL B CB    1 
ATOM   6036  C CG1   . VAL B 1 142 ? -16.074 70.141  7.072   1.00 13.91 ? 142  VAL B CG1   1 
ATOM   6037  C CG2   . VAL B 1 142 ? -17.998 71.351  5.940   1.00 14.48 ? 142  VAL B CG2   1 
ATOM   6038  N N     . PRO B 1 143 ? -17.056 74.371  8.250   1.00 14.28 ? 143  PRO B N     1 
ATOM   6039  C CA    . PRO B 1 143 ? -17.642 75.717  8.316   1.00 14.28 ? 143  PRO B CA    1 
ATOM   6040  C C     . PRO B 1 143 ? -18.521 76.022  7.117   1.00 14.75 ? 143  PRO B C     1 
ATOM   6041  O O     . PRO B 1 143 ? -19.447 76.832  7.214   1.00 15.06 ? 143  PRO B O     1 
ATOM   6042  C CB    . PRO B 1 143 ? -16.417 76.625  8.335   1.00 14.01 ? 143  PRO B CB    1 
ATOM   6043  C CG    . PRO B 1 143 ? -15.332 75.761  8.887   1.00 13.17 ? 143  PRO B CG    1 
ATOM   6044  C CD    . PRO B 1 143 ? -15.584 74.427  8.282   1.00 13.58 ? 143  PRO B CD    1 
ATOM   6045  N N     . GLU B 1 144 ? -18.256 75.346  6.002   1.00 15.32 ? 144  GLU B N     1 
ATOM   6046  C CA    . GLU B 1 144 ? -19.010 75.560  4.768   1.00 15.17 ? 144  GLU B CA    1 
ATOM   6047  C C     . GLU B 1 144 ? -20.528 75.249  4.829   1.00 15.52 ? 144  GLU B C     1 
ATOM   6048  O O     . GLU B 1 144 ? -21.333 75.902  4.147   1.00 16.26 ? 144  GLU B O     1 
ATOM   6049  C CB    . GLU B 1 144 ? -18.327 74.850  3.616   1.00 15.66 ? 144  GLU B CB    1 
ATOM   6050  C CG    . GLU B 1 144 ? -16.997 75.461  3.213   1.00 14.13 ? 144  GLU B CG    1 
ATOM   6051  C CD    . GLU B 1 144 ? -15.795 74.850  3.921   1.00 14.89 ? 144  GLU B CD    1 
ATOM   6052  O OE1   . GLU B 1 144 ? -15.945 73.986  4.847   1.00 14.29 ? 144  GLU B OE1   1 
ATOM   6053  O OE2   . GLU B 1 144 ? -14.679 75.243  3.510   1.00 13.18 ? 144  GLU B OE2   1 
ATOM   6054  N N     . ALA B 1 145 ? -20.923 74.271  5.639   1.00 15.21 ? 145  ALA B N     1 
ATOM   6055  C CA    . ALA B 1 145 ? -22.329 74.069  5.973   1.00 15.05 ? 145  ALA B CA    1 
ATOM   6056  C C     . ALA B 1 145 ? -22.937 75.399  6.442   1.00 15.53 ? 145  ALA B C     1 
ATOM   6057  O O     . ALA B 1 145 ? -23.951 75.870  5.906   1.00 15.73 ? 145  ALA B O     1 
ATOM   6058  C CB    . ALA B 1 145 ? -22.459 73.012  7.080   1.00 15.02 ? 145  ALA B CB    1 
ATOM   6059  N N     . ALA B 1 146 ? -22.304 76.019  7.438   1.00 15.44 ? 146  ALA B N     1 
ATOM   6060  C CA    . ALA B 1 146 ? -22.823 77.254  8.000   1.00 15.54 ? 146  ALA B CA    1 
ATOM   6061  C C     . ALA B 1 146 ? -22.952 78.302  6.899   1.00 15.50 ? 146  ALA B C     1 
ATOM   6062  O O     . ALA B 1 146 ? -23.952 79.002  6.818   1.00 15.49 ? 146  ALA B O     1 
ATOM   6063  C CB    . ALA B 1 146 ? -21.931 77.746  9.118   1.00 14.97 ? 146  ALA B CB    1 
ATOM   6064  N N     . VAL B 1 147 ? -21.934 78.371  6.048   1.00 16.16 ? 147  VAL B N     1 
ATOM   6065  C CA    . VAL B 1 147 ? -21.884 79.322  4.942   1.00 16.23 ? 147  VAL B CA    1 
ATOM   6066  C C     . VAL B 1 147 ? -23.082 79.092  4.038   1.00 16.34 ? 147  VAL B C     1 
ATOM   6067  O O     . VAL B 1 147 ? -23.749 80.056  3.657   1.00 16.12 ? 147  VAL B O     1 
ATOM   6068  C CB    . VAL B 1 147 ? -20.601 79.163  4.111   1.00 16.23 ? 147  VAL B CB    1 
ATOM   6069  C CG1   . VAL B 1 147 ? -20.681 80.005  2.848   1.00 17.34 ? 147  VAL B CG1   1 
ATOM   6070  C CG2   . VAL B 1 147 ? -19.406 79.564  4.909   1.00 15.81 ? 147  VAL B CG2   1 
ATOM   6071  N N     . ALA B 1 148 ? -23.352 77.814  3.720   1.00 16.24 ? 148  ALA B N     1 
ATOM   6072  C CA    . ALA B 1 148 ? -24.516 77.418  2.895   1.00 15.83 ? 148  ALA B CA    1 
ATOM   6073  C C     . ALA B 1 148 ? -25.857 77.764  3.559   1.00 15.96 ? 148  ALA B C     1 
ATOM   6074  O O     . ALA B 1 148 ? -26.758 78.323  2.911   1.00 16.35 ? 148  ALA B O     1 
ATOM   6075  C CB    . ALA B 1 148 ? -24.445 75.934  2.540   1.00 15.17 ? 148  ALA B CB    1 
ATOM   6076  N N     . MET B 1 149 ? -25.999 77.466  4.850   1.00 15.62 ? 149  MET B N     1 
ATOM   6077  C CA    . MET B 1 149 ? -27.244 77.840  5.532   1.00 15.44 ? 149  MET B CA    1 
ATOM   6078  C C     . MET B 1 149 ? -27.450 79.359  5.570   1.00 15.21 ? 149  MET B C     1 
ATOM   6079  O O     . MET B 1 149 ? -28.515 79.871  5.202   1.00 15.38 ? 149  MET B O     1 
ATOM   6080  C CB    . MET B 1 149 ? -27.334 77.233  6.929   1.00 15.19 ? 149  MET B CB    1 
ATOM   6081  C CG    . MET B 1 149 ? -27.599 75.731  6.925   1.00 13.59 ? 149  MET B CG    1 
ATOM   6082  S SD    . MET B 1 149 ? -27.000 75.051  8.482   1.00 15.71 ? 149  MET B SD    1 
ATOM   6083  C CE    . MET B 1 149 ? -28.344 75.394  9.673   1.00 9.73  ? 149  MET B CE    1 
ATOM   6084  N N     . LEU B 1 150 ? -26.423 80.082  5.985   1.00 14.61 ? 150  LEU B N     1 
ATOM   6085  C CA    . LEU B 1 150 ? -26.550 81.518  6.134   1.00 14.01 ? 150  LEU B CA    1 
ATOM   6086  C C     . LEU B 1 150 ? -26.943 82.163  4.812   1.00 14.21 ? 150  LEU B C     1 
ATOM   6087  O O     . LEU B 1 150 ? -27.758 83.112  4.773   1.00 13.91 ? 150  LEU B O     1 
ATOM   6088  C CB    . LEU B 1 150 ? -25.244 82.091  6.685   1.00 13.64 ? 150  LEU B CB    1 
ATOM   6089  C CG    . LEU B 1 150 ? -25.224 81.790  8.183   1.00 13.07 ? 150  LEU B CG    1 
ATOM   6090  C CD1   . LEU B 1 150 ? -23.865 82.017  8.812   1.00 11.00 ? 150  LEU B CD1   1 
ATOM   6091  C CD2   . LEU B 1 150 ? -26.283 82.663  8.833   1.00 12.27 ? 150  LEU B CD2   1 
ATOM   6092  N N     . ALA B 1 151 ? -26.392 81.611  3.728   1.00 13.93 ? 151  ALA B N     1 
ATOM   6093  C CA    . ALA B 1 151 ? -26.585 82.170  2.396   1.00 13.67 ? 151  ALA B CA    1 
ATOM   6094  C C     . ALA B 1 151 ? -28.010 81.962  1.884   1.00 13.40 ? 151  ALA B C     1 
ATOM   6095  O O     . ALA B 1 151 ? -28.585 82.868  1.286   1.00 13.33 ? 151  ALA B O     1 
ATOM   6096  C CB    . ALA B 1 151 ? -25.547 81.633  1.415   1.00 13.51 ? 151  ALA B CB    1 
ATOM   6097  N N     . CYS B 1 152 ? -28.578 80.783  2.118   1.00 13.07 ? 152  CYS B N     1 
ATOM   6098  C CA    . CYS B 1 152 ? -29.987 80.564  1.798   1.00 13.02 ? 152  CYS B CA    1 
ATOM   6099  C C     . CYS B 1 152 ? -30.859 81.585  2.508   1.00 12.90 ? 152  CYS B C     1 
ATOM   6100  O O     . CYS B 1 152 ? -31.728 82.189  1.882   1.00 12.48 ? 152  CYS B O     1 
ATOM   6101  C CB    . CYS B 1 152 ? -30.438 79.165  2.197   1.00 12.59 ? 152  CYS B CB    1 
ATOM   6102  S SG    . CYS B 1 152 ? -29.673 77.860  1.235   1.00 16.82 ? 152  CYS B SG    1 
ATOM   6103  N N     . ALA B 1 153 ? -30.632 81.755  3.816   1.00 13.16 ? 153  ALA B N     1 
ATOM   6104  C CA    . ALA B 1 153 ? -31.421 82.659  4.647   1.00 13.97 ? 153  ALA B CA    1 
ATOM   6105  C C     . ALA B 1 153 ? -31.291 84.070  4.117   1.00 14.77 ? 153  ALA B C     1 
ATOM   6106  O O     . ALA B 1 153 ? -32.284 84.786  4.010   1.00 14.78 ? 153  ALA B O     1 
ATOM   6107  C CB    . ALA B 1 153 ? -30.969 82.608  6.111   1.00 13.52 ? 153  ALA B CB    1 
ATOM   6108  N N     . ARG B 1 154 ? -30.059 84.455  3.788   1.00 15.57 ? 154  ARG B N     1 
ATOM   6109  C CA    . ARG B 1 154 ? -29.789 85.777  3.229   1.00 16.63 ? 154  ARG B CA    1 
ATOM   6110  C C     . ARG B 1 154 ? -30.701 86.136  2.052   1.00 16.28 ? 154  ARG B C     1 
ATOM   6111  O O     . ARG B 1 154 ? -31.165 87.266  1.952   1.00 16.90 ? 154  ARG B O     1 
ATOM   6112  C CB    . ARG B 1 154 ? -28.321 85.910  2.808   1.00 16.92 ? 154  ARG B CB    1 
ATOM   6113  C CG    . ARG B 1 154 ? -27.970 87.336  2.397   1.00 18.25 ? 154  ARG B CG    1 
ATOM   6114  C CD    . ARG B 1 154 ? -26.479 87.538  2.220   1.00 16.72 ? 154  ARG B CD    1 
ATOM   6115  N NE    . ARG B 1 154 ? -26.179 88.967  2.111   1.00 16.75 ? 154  ARG B NE    1 
ATOM   6116  C CZ    . ARG B 1 154 ? -25.777 89.728  3.123   1.00 17.37 ? 154  ARG B CZ    1 
ATOM   6117  N NH1   . ARG B 1 154 ? -25.631 89.212  4.349   1.00 16.17 ? 154  ARG B NH1   1 
ATOM   6118  N NH2   . ARG B 1 154 ? -25.510 91.007  2.913   1.00 17.12 ? 154  ARG B NH2   1 
ATOM   6119  N N     . ILE B 1 155 ? -30.980 85.170  1.186   1.00 16.13 ? 155  ILE B N     1 
ATOM   6120  C CA    . ILE B 1 155 ? -31.735 85.443  -0.041  1.00 15.49 ? 155  ILE B CA    1 
ATOM   6121  C C     . ILE B 1 155 ? -33.209 85.022  0.044   1.00 15.53 ? 155  ILE B C     1 
ATOM   6122  O O     . ILE B 1 155 ? -33.971 85.204  -0.904  1.00 16.00 ? 155  ILE B O     1 
ATOM   6123  C CB    . ILE B 1 155 ? -31.061 84.791  -1.295  1.00 15.31 ? 155  ILE B CB    1 
ATOM   6124  C CG1   . ILE B 1 155 ? -30.987 83.272  -1.135  1.00 14.46 ? 155  ILE B CG1   1 
ATOM   6125  C CG2   . ILE B 1 155 ? -29.683 85.417  -1.584  1.00 14.95 ? 155  ILE B CG2   1 
ATOM   6126  C CD1   . ILE B 1 155 ? -30.683 82.520  -2.412  1.00 14.47 ? 155  ILE B CD1   1 
ATOM   6127  N N     . GLY B 1 156 ? -33.609 84.443  1.166   1.00 15.21 ? 156  GLY B N     1 
ATOM   6128  C CA    . GLY B 1 156 ? -34.986 84.019  1.324   1.00 14.92 ? 156  GLY B CA    1 
ATOM   6129  C C     . GLY B 1 156 ? -35.224 82.609  0.844   1.00 15.21 ? 156  GLY B C     1 
ATOM   6130  O O     . GLY B 1 156 ? -36.371 82.146  0.804   1.00 16.05 ? 156  GLY B O     1 
ATOM   6131  N N     . ALA B 1 157 ? -34.154 81.916  0.476   1.00 14.56 ? 157  ALA B N     1 
ATOM   6132  C CA    . ALA B 1 157 ? -34.258 80.510  0.145   1.00 15.02 ? 157  ALA B CA    1 
ATOM   6133  C C     . ALA B 1 157 ? -34.621 79.774  1.423   1.00 14.88 ? 157  ALA B C     1 
ATOM   6134  O O     . ALA B 1 157 ? -34.411 80.294  2.502   1.00 15.66 ? 157  ALA B O     1 
ATOM   6135  C CB    . ALA B 1 157 ? -32.935 79.978  -0.418  1.00 15.22 ? 157  ALA B CB    1 
ATOM   6136  N N     . VAL B 1 158 ? -35.175 78.579  1.305   1.00 14.37 ? 158  VAL B N     1 
ATOM   6137  C CA    . VAL B 1 158 ? -35.628 77.832  2.467   1.00 14.34 ? 158  VAL B CA    1 
ATOM   6138  C C     . VAL B 1 158 ? -34.733 76.604  2.609   1.00 13.75 ? 158  VAL B C     1 
ATOM   6139  O O     . VAL B 1 158 ? -34.922 75.620  1.880   1.00 14.62 ? 158  VAL B O     1 
ATOM   6140  C CB    . VAL B 1 158 ? -37.097 77.413  2.279   1.00 14.19 ? 158  VAL B CB    1 
ATOM   6141  C CG1   . VAL B 1 158 ? -37.576 76.596  3.458   1.00 13.08 ? 158  VAL B CG1   1 
ATOM   6142  C CG2   . VAL B 1 158 ? -37.953 78.667  2.107   1.00 16.45 ? 158  VAL B CG2   1 
ATOM   6143  N N     . HIS B 1 159 ? -33.737 76.642  3.492   1.00 12.28 ? 159  HIS B N     1 
ATOM   6144  C CA    . HIS B 1 159 ? -32.873 75.478  3.533   1.00 11.33 ? 159  HIS B CA    1 
ATOM   6145  C C     . HIS B 1 159 ? -33.543 74.303  4.206   1.00 10.95 ? 159  HIS B C     1 
ATOM   6146  O O     . HIS B 1 159 ? -34.438 74.458  5.023   1.00 10.30 ? 159  HIS B O     1 
ATOM   6147  C CB    . HIS B 1 159 ? -31.480 75.741  4.095   1.00 11.09 ? 159  HIS B CB    1 
ATOM   6148  C CG    . HIS B 1 159 ? -31.455 76.091  5.547   1.00 11.17 ? 159  HIS B CG    1 
ATOM   6149  N ND1   . HIS B 1 159 ? -31.753 75.182  6.540   1.00 11.39 ? 159  HIS B ND1   1 
ATOM   6150  C CD2   . HIS B 1 159 ? -31.122 77.243  6.174   1.00 10.79 ? 159  HIS B CD2   1 
ATOM   6151  C CE1   . HIS B 1 159 ? -31.627 75.774  7.716   1.00 13.09 ? 159  HIS B CE1   1 
ATOM   6152  N NE2   . HIS B 1 159 ? -31.250 77.026  7.521   1.00 11.34 ? 159  HIS B NE2   1 
ATOM   6153  N N     . SER B 1 160 ? -33.103 73.117  3.821   1.00 11.00 ? 160  SER B N     1 
ATOM   6154  C CA    . SER B 1 160 ? -33.552 71.891  4.438   1.00 10.62 ? 160  SER B CA    1 
ATOM   6155  C C     . SER B 1 160 ? -32.327 71.011  4.690   1.00 10.84 ? 160  SER B C     1 
ATOM   6156  O O     . SER B 1 160 ? -31.894 70.242  3.807   1.00 10.74 ? 160  SER B O     1 
ATOM   6157  C CB    . SER B 1 160 ? -34.515 71.216  3.500   1.00 10.40 ? 160  SER B CB    1 
ATOM   6158  O OG    . SER B 1 160 ? -34.851 69.997  4.052   1.00 12.28 ? 160  SER B OG    1 
ATOM   6159  N N     . VAL B 1 161 ? -31.742 71.151  5.877   1.00 10.30 ? 161  VAL B N     1 
ATOM   6160  C CA    . VAL B 1 161 ? -30.539 70.427  6.206   1.00 10.24 ? 161  VAL B CA    1 
ATOM   6161  C C     . VAL B 1 161 ? -30.859 68.976  6.475   1.00 10.45 ? 161  VAL B C     1 
ATOM   6162  O O     . VAL B 1 161 ? -31.733 68.669  7.298   1.00 11.21 ? 161  VAL B O     1 
ATOM   6163  C CB    . VAL B 1 161 ? -29.836 71.033  7.423   1.00 10.41 ? 161  VAL B CB    1 
ATOM   6164  C CG1   . VAL B 1 161 ? -28.647 70.193  7.814   1.00 10.10 ? 161  VAL B CG1   1 
ATOM   6165  C CG2   . VAL B 1 161 ? -29.414 72.484  7.124   1.00 11.65 ? 161  VAL B CG2   1 
ATOM   6166  N N     . ILE B 1 162 ? -30.165 68.088  5.774   1.00 10.23 ? 162  ILE B N     1 
ATOM   6167  C CA    . ILE B 1 162 ? -30.314 66.673  5.985   1.00 10.45 ? 162  ILE B CA    1 
ATOM   6168  C C     . ILE B 1 162 ? -29.077 66.112  6.684   1.00 11.06 ? 162  ILE B C     1 
ATOM   6169  O O     . ILE B 1 162 ? -27.990 66.099  6.137   1.00 11.67 ? 162  ILE B O     1 
ATOM   6170  C CB    . ILE B 1 162 ? -30.501 65.938  4.659   1.00 10.48 ? 162  ILE B CB    1 
ATOM   6171  C CG1   . ILE B 1 162 ? -31.711 66.488  3.894   1.00 10.57 ? 162  ILE B CG1   1 
ATOM   6172  C CG2   . ILE B 1 162 ? -30.624 64.422  4.886   1.00 10.34 ? 162  ILE B CG2   1 
ATOM   6173  C CD1   . ILE B 1 162 ? -31.710 66.076  2.374   1.00 9.16  ? 162  ILE B CD1   1 
ATOM   6174  N N     . PHE B 1 163 ? -29.255 65.649  7.901   1.00 11.57 ? 163  PHE B N     1 
ATOM   6175  C CA    . PHE B 1 163 ? -28.188 64.993  8.665   1.00 11.88 ? 163  PHE B CA    1 
ATOM   6176  C C     . PHE B 1 163 ? -27.364 63.989  7.836   1.00 11.74 ? 163  PHE B C     1 
ATOM   6177  O O     . PHE B 1 163 ? -27.904 63.045  7.243   1.00 12.15 ? 163  PHE B O     1 
ATOM   6178  C CB    . PHE B 1 163 ? -28.824 64.311  9.876   1.00 11.23 ? 163  PHE B CB    1 
ATOM   6179  C CG    . PHE B 1 163 ? -27.891 63.453  10.664  1.00 12.42 ? 163  PHE B CG    1 
ATOM   6180  C CD1   . PHE B 1 163 ? -26.890 64.025  11.472  1.00 13.46 ? 163  PHE B CD1   1 
ATOM   6181  C CD2   . PHE B 1 163 ? -28.042 62.071  10.666  1.00 12.69 ? 163  PHE B CD2   1 
ATOM   6182  C CE1   . PHE B 1 163 ? -26.039 63.228  12.245  1.00 11.78 ? 163  PHE B CE1   1 
ATOM   6183  C CE2   . PHE B 1 163 ? -27.193 61.260  11.440  1.00 12.23 ? 163  PHE B CE2   1 
ATOM   6184  C CZ    . PHE B 1 163 ? -26.189 61.845  12.226  1.00 12.24 ? 163  PHE B CZ    1 
ATOM   6185  N N     . GLY B 1 164 ? -26.050 64.190  7.832   1.00 11.80 ? 164  GLY B N     1 
ATOM   6186  C CA    . GLY B 1 164 ? -25.115 63.385  7.044   1.00 11.56 ? 164  GLY B CA    1 
ATOM   6187  C C     . GLY B 1 164 ? -25.147 61.877  7.298   1.00 12.00 ? 164  GLY B C     1 
ATOM   6188  O O     . GLY B 1 164 ? -24.580 61.117  6.525   1.00 11.95 ? 164  GLY B O     1 
ATOM   6189  N N     . GLY B 1 165 ? -25.784 61.422  8.378   1.00 11.55 ? 165  GLY B N     1 
ATOM   6190  C CA    . GLY B 1 165 ? -25.901 59.990  8.598   1.00 11.04 ? 165  GLY B CA    1 
ATOM   6191  C C     . GLY B 1 165 ? -27.152 59.363  8.009   1.00 11.44 ? 165  GLY B C     1 
ATOM   6192  O O     . GLY B 1 165 ? -27.368 58.143  8.140   1.00 11.46 ? 165  GLY B O     1 
ATOM   6193  N N     . PHE B 1 166 ? -27.995 60.173  7.371   1.00 11.01 ? 166  PHE B N     1 
ATOM   6194  C CA    . PHE B 1 166 ? -29.105 59.594  6.612   1.00 11.05 ? 166  PHE B CA    1 
ATOM   6195  C C     . PHE B 1 166 ? -28.615 58.834  5.375   1.00 11.00 ? 166  PHE B C     1 
ATOM   6196  O O     . PHE B 1 166 ? -27.511 59.073  4.867   1.00 11.71 ? 166  PHE B O     1 
ATOM   6197  C CB    . PHE B 1 166 ? -30.177 60.634  6.285   1.00 10.84 ? 166  PHE B CB    1 
ATOM   6198  C CG    . PHE B 1 166 ? -31.097 60.917  7.447   1.00 10.78 ? 166  PHE B CG    1 
ATOM   6199  C CD1   . PHE B 1 166 ? -31.183 62.208  7.999   1.00 12.21 ? 166  PHE B CD1   1 
ATOM   6200  C CD2   . PHE B 1 166 ? -31.851 59.891  8.019   1.00 10.53 ? 166  PHE B CD2   1 
ATOM   6201  C CE1   . PHE B 1 166 ? -32.057 62.482  9.096   1.00 11.68 ? 166  PHE B CE1   1 
ATOM   6202  C CE2   . PHE B 1 166 ? -32.720 60.142  9.123   1.00 12.11 ? 166  PHE B CE2   1 
ATOM   6203  C CZ    . PHE B 1 166 ? -32.821 61.440  9.657   1.00 10.93 ? 166  PHE B CZ    1 
ATOM   6204  N N     . SER B 1 167 ? -29.405 57.886  4.921   1.00 10.79 ? 167  SER B N     1 
ATOM   6205  C CA    . SER B 1 167 ? -28.985 57.063  3.821   1.00 11.88 ? 167  SER B CA    1 
ATOM   6206  C C     . SER B 1 167 ? -29.499 57.715  2.519   1.00 12.49 ? 167  SER B C     1 
ATOM   6207  O O     . SER B 1 167 ? -30.391 58.551  2.566   1.00 12.14 ? 167  SER B O     1 
ATOM   6208  C CB    . SER B 1 167 ? -29.598 55.679  3.972   1.00 11.79 ? 167  SER B CB    1 
ATOM   6209  O OG    . SER B 1 167 ? -30.996 55.750  3.627   1.00 13.14 ? 167  SER B OG    1 
ATOM   6210  N N     . PRO B 1 168 ? -28.942 57.305  1.355   1.00 13.27 ? 168  PRO B N     1 
ATOM   6211  C CA    . PRO B 1 168 ? -29.435 57.755  0.057   1.00 13.31 ? 168  PRO B CA    1 
ATOM   6212  C C     . PRO B 1 168 ? -30.970 57.700  -0.023  1.00 14.75 ? 168  PRO B C     1 
ATOM   6213  O O     . PRO B 1 168 ? -31.632 58.669  -0.445  1.00 15.22 ? 168  PRO B O     1 
ATOM   6214  C CB    . PRO B 1 168 ? -28.803 56.772  -0.903  1.00 13.56 ? 168  PRO B CB    1 
ATOM   6215  C CG    . PRO B 1 168 ? -27.507 56.291  -0.169  1.00 13.17 ? 168  PRO B CG    1 
ATOM   6216  C CD    . PRO B 1 168 ? -27.785 56.372  1.254   1.00 12.61 ? 168  PRO B CD    1 
ATOM   6217  N N     . GLU B 1 169 ? -31.546 56.588  0.407   1.00 15.42 ? 169  GLU B N     1 
ATOM   6218  C CA    . GLU B 1 169 ? -32.988 56.450  0.425   1.00 15.94 ? 169  GLU B CA    1 
ATOM   6219  C C     . GLU B 1 169 ? -33.654 57.575  1.213   1.00 15.39 ? 169  GLU B C     1 
ATOM   6220  O O     . GLU B 1 169 ? -34.557 58.226  0.708   1.00 15.78 ? 169  GLU B O     1 
ATOM   6221  C CB    . GLU B 1 169 ? -33.351 55.093  1.024   1.00 16.61 ? 169  GLU B CB    1 
ATOM   6222  C CG    . GLU B 1 169 ? -34.839 54.849  1.120   1.00 21.15 ? 169  GLU B CG    1 
ATOM   6223  C CD    . GLU B 1 169 ? -35.498 54.743  -0.248  1.00 26.80 ? 169  GLU B CD    1 
ATOM   6224  O OE1   . GLU B 1 169 ? -34.808 54.256  -1.203  1.00 27.23 ? 169  GLU B OE1   1 
ATOM   6225  O OE2   . GLU B 1 169 ? -36.693 55.154  -0.351  1.00 27.13 ? 169  GLU B OE2   1 
ATOM   6226  N N     . ALA B 1 170 ? -33.206 57.783  2.454   1.00 14.84 ? 170  ALA B N     1 
ATOM   6227  C CA    . ALA B 1 170 ? -33.688 58.862  3.320   1.00 14.11 ? 170  ALA B CA    1 
ATOM   6228  C C     . ALA B 1 170 ? -33.451 60.235  2.691   1.00 13.75 ? 170  ALA B C     1 
ATOM   6229  O O     . ALA B 1 170 ? -34.295 61.147  2.808   1.00 13.26 ? 170  ALA B O     1 
ATOM   6230  C CB    . ALA B 1 170 ? -32.999 58.788  4.701   1.00 14.08 ? 170  ALA B CB    1 
ATOM   6231  N N     . VAL B 1 171 ? -32.320 60.367  2.001   1.00 12.76 ? 171  VAL B N     1 
ATOM   6232  C CA    . VAL B 1 171 ? -32.002 61.614  1.317   1.00 13.13 ? 171  VAL B CA    1 
ATOM   6233  C C     . VAL B 1 171 ? -32.991 61.884  0.173   1.00 13.44 ? 171  VAL B C     1 
ATOM   6234  O O     . VAL B 1 171 ? -33.497 63.012  0.025   1.00 13.57 ? 171  VAL B O     1 
ATOM   6235  C CB    . VAL B 1 171 ? -30.518 61.667  0.858   1.00 12.94 ? 171  VAL B CB    1 
ATOM   6236  C CG1   . VAL B 1 171 ? -30.275 62.845  -0.017  1.00 12.69 ? 171  VAL B CG1   1 
ATOM   6237  C CG2   . VAL B 1 171 ? -29.601 61.757  2.068   1.00 12.48 ? 171  VAL B CG2   1 
ATOM   6238  N N     . ALA B 1 172 ? -33.283 60.834  -0.599  1.00 13.58 ? 172  ALA B N     1 
ATOM   6239  C CA    . ALA B 1 172 ? -34.253 60.876  -1.692  1.00 13.81 ? 172  ALA B CA    1 
ATOM   6240  C C     . ALA B 1 172 ? -35.641 61.365  -1.261  1.00 14.51 ? 172  ALA B C     1 
ATOM   6241  O O     . ALA B 1 172 ? -36.178 62.305  -1.845  1.00 14.53 ? 172  ALA B O     1 
ATOM   6242  C CB    . ALA B 1 172 ? -34.360 59.511  -2.347  1.00 13.69 ? 172  ALA B CB    1 
ATOM   6243  N N     . GLY B 1 173 ? -36.216 60.726  -0.246  1.00 15.30 ? 173  GLY B N     1 
ATOM   6244  C CA    . GLY B 1 173 ? -37.557 61.068  0.240   1.00 16.12 ? 173  GLY B CA    1 
ATOM   6245  C C     . GLY B 1 173 ? -37.661 62.522  0.658   1.00 17.04 ? 173  GLY B C     1 
ATOM   6246  O O     . GLY B 1 173 ? -38.627 63.197  0.302   1.00 17.74 ? 173  GLY B O     1 
ATOM   6247  N N     . ARG B 1 174 ? -36.647 63.019  1.367   1.00 17.48 ? 174  ARG B N     1 
ATOM   6248  C CA    . ARG B 1 174 ? -36.638 64.415  1.834   1.00 17.92 ? 174  ARG B CA    1 
ATOM   6249  C C     . ARG B 1 174 ? -36.580 65.403  0.674   1.00 18.24 ? 174  ARG B C     1 
ATOM   6250  O O     . ARG B 1 174 ? -37.236 66.441  0.734   1.00 18.55 ? 174  ARG B O     1 
ATOM   6251  C CB    . ARG B 1 174 ? -35.505 64.672  2.856   1.00 17.59 ? 174  ARG B CB    1 
ATOM   6252  C CG    . ARG B 1 174 ? -35.725 63.952  4.161   1.00 17.16 ? 174  ARG B CG    1 
ATOM   6253  C CD    . ARG B 1 174 ? -34.523 64.021  5.077   1.00 18.08 ? 174  ARG B CD    1 
ATOM   6254  N NE    . ARG B 1 174 ? -34.857 63.575  6.428   1.00 17.11 ? 174  ARG B NE    1 
ATOM   6255  C CZ    . ARG B 1 174 ? -35.157 62.323  6.769   1.00 16.95 ? 174  ARG B CZ    1 
ATOM   6256  N NH1   . ARG B 1 174 ? -35.167 61.339  5.885   1.00 14.81 ? 174  ARG B NH1   1 
ATOM   6257  N NH2   . ARG B 1 174 ? -35.454 62.054  8.025   1.00 20.45 ? 174  ARG B NH2   1 
ATOM   6258  N N     . ILE B 1 175 ? -35.806 65.072  -0.367  1.00 18.50 ? 175  ILE B N     1 
ATOM   6259  C CA    . ILE B 1 175 ? -35.726 65.874  -1.597  1.00 18.54 ? 175  ILE B CA    1 
ATOM   6260  C C     . ILE B 1 175 ? -37.005 65.836  -2.432  1.00 19.09 ? 175  ILE B C     1 
ATOM   6261  O O     . ILE B 1 175 ? -37.423 66.876  -2.981  1.00 19.25 ? 175  ILE B O     1 
ATOM   6262  C CB    . ILE B 1 175 ? -34.553 65.431  -2.502  1.00 18.83 ? 175  ILE B CB    1 
ATOM   6263  C CG1   . ILE B 1 175 ? -33.216 65.800  -1.854  1.00 19.07 ? 175  ILE B CG1   1 
ATOM   6264  C CG2   . ILE B 1 175 ? -34.645 66.061  -3.928  1.00 17.17 ? 175  ILE B CG2   1 
ATOM   6265  C CD1   . ILE B 1 175 ? -32.030 65.092  -2.513  1.00 16.09 ? 175  ILE B CD1   1 
ATOM   6266  N N     . ILE B 1 176 ? -37.588 64.641  -2.572  1.00 18.96 ? 176  ILE B N     1 
ATOM   6267  C CA    . ILE B 1 176 ? -38.819 64.472  -3.332  1.00 18.68 ? 176  ILE B CA    1 
ATOM   6268  C C     . ILE B 1 176 ? -39.895 65.280  -2.636  1.00 19.07 ? 176  ILE B C     1 
ATOM   6269  O O     . ILE B 1 176 ? -40.623 65.985  -3.276  1.00 19.16 ? 176  ILE B O     1 
ATOM   6270  C CB    . ILE B 1 176 ? -39.277 62.986  -3.416  1.00 18.94 ? 176  ILE B CB    1 
ATOM   6271  C CG1   . ILE B 1 176 ? -38.263 62.133  -4.203  1.00 19.23 ? 176  ILE B CG1   1 
ATOM   6272  C CG2   . ILE B 1 176 ? -40.706 62.870  -4.024  1.00 17.20 ? 176  ILE B CG2   1 
ATOM   6273  C CD1   . ILE B 1 176 ? -38.470 60.597  -4.050  1.00 18.38 ? 176  ILE B CD1   1 
ATOM   6274  N N     . ASP B 1 177 ? -39.961 65.187  -1.312  1.00 19.62 ? 177  ASP B N     1 
ATOM   6275  C CA    . ASP B 1 177 ? -41.011 65.827  -0.542  1.00 19.77 ? 177  ASP B CA    1 
ATOM   6276  C C     . ASP B 1 177 ? -40.861 67.347  -0.476  1.00 19.84 ? 177  ASP B C     1 
ATOM   6277  O O     . ASP B 1 177 ? -41.849 68.060  -0.336  1.00 19.08 ? 177  ASP B O     1 
ATOM   6278  C CB    . ASP B 1 177 ? -41.034 65.278  0.889   1.00 19.74 ? 177  ASP B CB    1 
ATOM   6279  C CG    . ASP B 1 177 ? -42.213 65.816  1.696   1.00 20.76 ? 177  ASP B CG    1 
ATOM   6280  O OD1   . ASP B 1 177 ? -42.081 66.821  2.441   1.00 20.14 ? 177  ASP B OD1   1 
ATOM   6281  O OD2   . ASP B 1 177 ? -43.303 65.242  1.545   1.00 23.33 ? 177  ASP B OD2   1 
ATOM   6282  N N     . SER B 1 178 ? -39.623 67.836  -0.531  1.00 19.65 ? 178  SER B N     1 
ATOM   6283  C CA    . SER B 1 178 ? -39.400 69.267  -0.440  1.00 19.51 ? 178  SER B CA    1 
ATOM   6284  C C     . SER B 1 178 ? -39.304 69.887  -1.834  1.00 19.59 ? 178  SER B C     1 
ATOM   6285  O O     . SER B 1 178 ? -39.231 71.104  -1.965  1.00 19.50 ? 178  SER B O     1 
ATOM   6286  C CB    . SER B 1 178 ? -38.148 69.563  0.391   1.00 19.14 ? 178  SER B CB    1 
ATOM   6287  O OG    . SER B 1 178 ? -36.957 69.126  -0.274  1.00 20.08 ? 178  SER B OG    1 
ATOM   6288  N N     . SER B 1 179 ? -39.316 69.055  -2.873  1.00 19.56 ? 179  SER B N     1 
ATOM   6289  C CA    . SER B 1 179 ? -39.035 69.548  -4.211  1.00 20.65 ? 179  SER B CA    1 
ATOM   6290  C C     . SER B 1 179 ? -37.763 70.437  -4.265  1.00 20.79 ? 179  SER B C     1 
ATOM   6291  O O     . SER B 1 179 ? -37.805 71.532  -4.808  1.00 22.18 ? 179  SER B O     1 
ATOM   6292  C CB    . SER B 1 179 ? -40.238 70.346  -4.737  1.00 20.58 ? 179  SER B CB    1 
ATOM   6293  O OG    . SER B 1 179 ? -41.134 69.512  -5.452  1.00 22.56 ? 179  SER B OG    1 
ATOM   6294  N N     . SER B 1 180 ? -36.643 69.979  -3.717  1.00 20.38 ? 180  SER B N     1 
ATOM   6295  C CA    . SER B 1 180 ? -35.401 70.766  -3.713  1.00 19.63 ? 180  SER B CA    1 
ATOM   6296  C C     . SER B 1 180 ? -34.795 70.908  -5.087  1.00 19.55 ? 180  SER B C     1 
ATOM   6297  O O     . SER B 1 180 ? -34.686 69.935  -5.832  1.00 19.40 ? 180  SER B O     1 
ATOM   6298  C CB    . SER B 1 180 ? -34.372 70.153  -2.769  1.00 19.76 ? 180  SER B CB    1 
ATOM   6299  O OG    . SER B 1 180 ? -34.908 69.991  -1.457  1.00 20.90 ? 180  SER B OG    1 
ATOM   6300  N N     . ARG B 1 181 ? -34.398 72.136  -5.417  1.00 20.08 ? 181  ARG B N     1 
ATOM   6301  C CA    . ARG B 1 181 ? -33.847 72.478  -6.744  1.00 20.00 ? 181  ARG B CA    1 
ATOM   6302  C C     . ARG B 1 181 ? -32.355 72.182  -6.781  1.00 19.04 ? 181  ARG B C     1 
ATOM   6303  O O     . ARG B 1 181 ? -31.759 71.999  -7.854  1.00 19.27 ? 181  ARG B O     1 
ATOM   6304  C CB    . ARG B 1 181 ? -34.057 73.970  -7.043  1.00 20.81 ? 181  ARG B CB    1 
ATOM   6305  C CG    . ARG B 1 181 ? -35.426 74.538  -6.620  1.00 25.10 ? 181  ARG B CG    1 
ATOM   6306  C CD    . ARG B 1 181 ? -36.499 74.319  -7.702  1.00 30.96 ? 181  ARG B CD    1 
ATOM   6307  N NE    . ARG B 1 181 ? -37.781 73.850  -7.130  1.00 34.76 ? 181  ARG B NE    1 
ATOM   6308  C CZ    . ARG B 1 181 ? -38.704 73.129  -7.791  1.00 34.74 ? 181  ARG B CZ    1 
ATOM   6309  N NH1   . ARG B 1 181 ? -38.514 72.757  -9.062  1.00 34.99 ? 181  ARG B NH1   1 
ATOM   6310  N NH2   . ARG B 1 181 ? -39.823 72.762  -7.180  1.00 32.89 ? 181  ARG B NH2   1 
ATOM   6311  N N     . LEU B 1 182 ? -31.763 72.116  -5.591  1.00 17.48 ? 182  LEU B N     1 
ATOM   6312  C CA    . LEU B 1 182 ? -30.333 72.051  -5.450  1.00 16.33 ? 182  LEU B CA    1 
ATOM   6313  C C     . LEU B 1 182 ? -29.962 71.210  -4.238  1.00 15.92 ? 182  LEU B C     1 
ATOM   6314  O O     . LEU B 1 182 ? -30.603 71.314  -3.187  1.00 16.07 ? 182  LEU B O     1 
ATOM   6315  C CB    . LEU B 1 182 ? -29.788 73.487  -5.276  1.00 16.22 ? 182  LEU B CB    1 
ATOM   6316  C CG    . LEU B 1 182 ? -28.315 73.715  -4.941  1.00 15.10 ? 182  LEU B CG    1 
ATOM   6317  C CD1   . LEU B 1 182 ? -27.401 73.348  -6.144  1.00 12.60 ? 182  LEU B CD1   1 
ATOM   6318  C CD2   . LEU B 1 182 ? -28.072 75.153  -4.459  1.00 15.38 ? 182  LEU B CD2   1 
ATOM   6319  N N     . VAL B 1 183 ? -28.926 70.386  -4.387  1.00 14.71 ? 183  VAL B N     1 
ATOM   6320  C CA    . VAL B 1 183 ? -28.320 69.717  -3.253  1.00 13.61 ? 183  VAL B CA    1 
ATOM   6321  C C     . VAL B 1 183 ? -26.900 70.264  -3.064  1.00 13.68 ? 183  VAL B C     1 
ATOM   6322  O O     . VAL B 1 183 ? -26.128 70.388  -4.021  1.00 12.99 ? 183  VAL B O     1 
ATOM   6323  C CB    . VAL B 1 183 ? -28.264 68.178  -3.412  1.00 14.12 ? 183  VAL B CB    1 
ATOM   6324  C CG1   . VAL B 1 183 ? -27.593 67.555  -2.171  1.00 14.21 ? 183  VAL B CG1   1 
ATOM   6325  C CG2   . VAL B 1 183 ? -29.660 67.570  -3.641  1.00 11.61 ? 183  VAL B CG2   1 
ATOM   6326  N N     . ILE B 1 184 ? -26.577 70.625  -1.827  1.00 13.31 ? 184  ILE B N     1 
ATOM   6327  C CA    . ILE B 1 184 ? -25.261 71.106  -1.504  1.00 13.01 ? 184  ILE B CA    1 
ATOM   6328  C C     . ILE B 1 184 ? -24.645 70.058  -0.611  1.00 13.22 ? 184  ILE B C     1 
ATOM   6329  O O     . ILE B 1 184 ? -25.218 69.698  0.415   1.00 13.28 ? 184  ILE B O     1 
ATOM   6330  C CB    . ILE B 1 184 ? -25.302 72.433  -0.747  1.00 13.06 ? 184  ILE B CB    1 
ATOM   6331  C CG1   . ILE B 1 184 ? -25.869 73.547  -1.644  1.00 12.52 ? 184  ILE B CG1   1 
ATOM   6332  C CG2   . ILE B 1 184 ? -23.897 72.760  -0.186  1.00 12.58 ? 184  ILE B CG2   1 
ATOM   6333  C CD1   . ILE B 1 184 ? -26.127 74.838  -0.903  1.00 12.24 ? 184  ILE B CD1   1 
ATOM   6334  N N     . THR B 1 185 ? -23.477 69.569  -1.001  1.00 12.96 ? 185  THR B N     1 
ATOM   6335  C CA    . THR B 1 185 ? -22.841 68.520  -0.243  1.00 13.00 ? 185  THR B CA    1 
ATOM   6336  C C     . THR B 1 185 ? -21.304 68.569  -0.308  1.00 12.31 ? 185  THR B C     1 
ATOM   6337  O O     . THR B 1 185 ? -20.729 69.574  -0.714  1.00 11.61 ? 185  THR B O     1 
ATOM   6338  C CB    . THR B 1 185 ? -23.399 67.139  -0.670  1.00 13.04 ? 185  THR B CB    1 
ATOM   6339  O OG1   . THR B 1 185 ? -22.961 66.154  0.272   1.00 15.00 ? 185  THR B OG1   1 
ATOM   6340  C CG2   . THR B 1 185 ? -22.944 66.756  -2.091  1.00 13.13 ? 185  THR B CG2   1 
ATOM   6341  N N     . ALA B 1 186 ? -20.657 67.489  0.128   1.00 12.12 ? 186  ALA B N     1 
ATOM   6342  C CA    . ALA B 1 186 ? -19.198 67.400  0.133   1.00 12.39 ? 186  ALA B CA    1 
ATOM   6343  C C     . ALA B 1 186 ? -18.766 66.060  -0.460  1.00 12.66 ? 186  ALA B C     1 
ATOM   6344  O O     . ALA B 1 186 ? -19.533 65.080  -0.434  1.00 12.32 ? 186  ALA B O     1 
ATOM   6345  C CB    . ALA B 1 186 ? -18.655 67.558  1.549   1.00 11.63 ? 186  ALA B CB    1 
ATOM   6346  N N     . ASP B 1 187 ? -17.549 66.004  -0.996  1.00 13.05 ? 187  ASP B N     1 
ATOM   6347  C CA    . ASP B 1 187 ? -17.104 64.728  -1.554  1.00 13.75 ? 187  ASP B CA    1 
ATOM   6348  C C     . ASP B 1 187 ? -17.179 63.674  -0.438  1.00 13.91 ? 187  ASP B C     1 
ATOM   6349  O O     . ASP B 1 187 ? -17.803 62.627  -0.623  1.00 13.98 ? 187  ASP B O     1 
ATOM   6350  C CB    . ASP B 1 187 ? -15.735 64.804  -2.283  1.00 13.19 ? 187  ASP B CB    1 
ATOM   6351  C CG    . ASP B 1 187 ? -14.607 65.376  -1.415  1.00 13.08 ? 187  ASP B CG    1 
ATOM   6352  O OD1   . ASP B 1 187 ? -14.810 65.662  -0.231  1.00 12.13 ? 187  ASP B OD1   1 
ATOM   6353  O OD2   . ASP B 1 187 ? -13.485 65.532  -1.929  1.00 14.41 ? 187  ASP B OD2   1 
ATOM   6354  N N     . GLU B 1 188 ? -16.604 63.982  0.722   1.00 13.34 ? 188  GLU B N     1 
ATOM   6355  C CA    . GLU B 1 188 ? -16.619 63.060  1.842   1.00 13.95 ? 188  GLU B CA    1 
ATOM   6356  C C     . GLU B 1 188 ? -16.619 63.798  3.180   1.00 14.89 ? 188  GLU B C     1 
ATOM   6357  O O     . GLU B 1 188 ? -16.076 64.898  3.289   1.00 15.59 ? 188  GLU B O     1 
ATOM   6358  C CB    . GLU B 1 188 ? -15.405 62.156  1.796   1.00 13.33 ? 188  GLU B CB    1 
ATOM   6359  C CG    . GLU B 1 188 ? -15.505 60.990  0.871   1.00 13.20 ? 188  GLU B CG    1 
ATOM   6360  C CD    . GLU B 1 188 ? -14.271 60.102  0.905   1.00 14.23 ? 188  GLU B CD    1 
ATOM   6361  O OE1   . GLU B 1 188 ? -13.177 60.571  1.317   1.00 12.81 ? 188  GLU B OE1   1 
ATOM   6362  O OE2   . GLU B 1 188 ? -14.393 58.922  0.495   1.00 15.24 ? 188  GLU B OE2   1 
ATOM   6363  N N     . GLY B 1 189 ? -17.230 63.188  4.196   1.00 15.35 ? 189  GLY B N     1 
ATOM   6364  C CA    . GLY B 1 189 ? -17.091 63.624  5.578   1.00 15.16 ? 189  GLY B CA    1 
ATOM   6365  C C     . GLY B 1 189 ? -15.936 62.900  6.253   1.00 15.92 ? 189  GLY B C     1 
ATOM   6366  O O     . GLY B 1 189 ? -15.578 61.765  5.877   1.00 15.98 ? 189  GLY B O     1 
ATOM   6367  N N     . VAL B 1 190 ? -15.323 63.575  7.226   1.00 16.47 ? 190  VAL B N     1 
ATOM   6368  C CA    . VAL B 1 190 ? -14.335 62.978  8.100   1.00 17.12 ? 190  VAL B CA    1 
ATOM   6369  C C     . VAL B 1 190 ? -14.860 62.902  9.550   1.00 17.54 ? 190  VAL B C     1 
ATOM   6370  O O     . VAL B 1 190 ? -15.195 63.918  10.178  1.00 18.71 ? 190  VAL B O     1 
ATOM   6371  C CB    . VAL B 1 190 ? -12.999 63.730  8.001   1.00 17.82 ? 190  VAL B CB    1 
ATOM   6372  C CG1   . VAL B 1 190 ? -11.923 63.074  8.891   1.00 18.07 ? 190  VAL B CG1   1 
ATOM   6373  C CG2   . VAL B 1 190 ? -12.518 63.761  6.538   1.00 18.10 ? 190  VAL B CG2   1 
ATOM   6374  N N     . ARG B 1 191 ? -14.955 61.693  10.076  1.00 17.40 ? 191  ARG B N     1 
ATOM   6375  C CA    . ARG B 1 191 ? -15.307 61.503  11.486  1.00 17.45 ? 191  ARG B CA    1 
ATOM   6376  C C     . ARG B 1 191 ? -14.655 60.246  12.061  1.00 16.82 ? 191  ARG B C     1 
ATOM   6377  O O     . ARG B 1 191 ? -14.747 59.172  11.459  1.00 16.36 ? 191  ARG B O     1 
ATOM   6378  C CB    . ARG B 1 191 ? -16.817 61.479  11.669  1.00 17.51 ? 191  ARG B CB    1 
ATOM   6379  C CG    . ARG B 1 191 ? -17.313 60.540  12.751  1.00 19.57 ? 191  ARG B CG    1 
ATOM   6380  C CD    . ARG B 1 191 ? -18.848 60.460  12.700  1.00 21.18 ? 191  ARG B CD    1 
ATOM   6381  N NE    . ARG B 1 191 ? -19.434 61.471  13.570  1.00 23.33 ? 191  ARG B NE    1 
ATOM   6382  C CZ    . ARG B 1 191 ? -20.096 61.183  14.682  1.00 23.23 ? 191  ARG B CZ    1 
ATOM   6383  N NH1   . ARG B 1 191 ? -20.255 59.919  15.032  1.00 23.89 ? 191  ARG B NH1   1 
ATOM   6384  N NH2   . ARG B 1 191 ? -20.597 62.140  15.441  1.00 22.54 ? 191  ARG B NH2   1 
ATOM   6385  N N     . ALA B 1 192 ? -13.972 60.417  13.199  1.00 16.03 ? 192  ALA B N     1 
ATOM   6386  C CA    . ALA B 1 192 ? -13.318 59.332  13.933  1.00 15.73 ? 192  ALA B CA    1 
ATOM   6387  C C     . ALA B 1 192 ? -12.204 58.644  13.120  1.00 16.46 ? 192  ALA B C     1 
ATOM   6388  O O     . ALA B 1 192 ? -12.008 57.424  13.205  1.00 16.05 ? 192  ALA B O     1 
ATOM   6389  C CB    . ALA B 1 192 ? -14.351 58.320  14.479  1.00 14.48 ? 192  ALA B CB    1 
ATOM   6390  N N     . GLY B 1 193 ? -11.470 59.444  12.340  1.00 17.45 ? 193  GLY B N     1 
ATOM   6391  C CA    . GLY B 1 193 ? -10.405 58.940  11.464  1.00 18.09 ? 193  GLY B CA    1 
ATOM   6392  C C     . GLY B 1 193 ? -10.915 58.140  10.276  1.00 19.29 ? 193  GLY B C     1 
ATOM   6393  O O     . GLY B 1 193 ? -10.220 57.260  9.779   1.00 19.48 ? 193  GLY B O     1 
ATOM   6394  N N     . ARG B 1 194 ? -12.119 58.457  9.803   1.00 20.50 ? 194  ARG B N     1 
ATOM   6395  C CA    . ARG B 1 194 ? -12.762 57.703  8.720   1.00 21.91 ? 194  ARG B CA    1 
ATOM   6396  C C     . ARG B 1 194 ? -13.596 58.558  7.775   1.00 22.33 ? 194  ARG B C     1 
ATOM   6397  O O     . ARG B 1 194 ? -14.031 59.662  8.122   1.00 23.17 ? 194  ARG B O     1 
ATOM   6398  C CB    . ARG B 1 194 ? -13.707 56.675  9.312   1.00 22.32 ? 194  ARG B CB    1 
ATOM   6399  C CG    . ARG B 1 194 ? -13.051 55.571  10.045  1.00 24.06 ? 194  ARG B CG    1 
ATOM   6400  C CD    . ARG B 1 194 ? -13.995 54.467  9.934   1.00 29.45 ? 194  ARG B CD    1 
ATOM   6401  N NE    . ARG B 1 194 ? -14.364 53.996  11.245  1.00 35.40 ? 194  ARG B NE    1 
ATOM   6402  C CZ    . ARG B 1 194 ? -15.572 53.551  11.549  1.00 38.53 ? 194  ARG B CZ    1 
ATOM   6403  N NH1   . ARG B 1 194 ? -16.528 53.535  10.621  1.00 39.97 ? 194  ARG B NH1   1 
ATOM   6404  N NH2   . ARG B 1 194 ? -15.818 53.125  12.780  1.00 40.45 ? 194  ARG B NH2   1 
ATOM   6405  N N     . SER B 1 195 ? -13.877 57.997  6.613   1.00 22.51 ? 195  SER B N     1 
ATOM   6406  C CA    . SER B 1 195 ? -14.607 58.662  5.540   1.00 23.02 ? 195  SER B CA    1 
ATOM   6407  C C     . SER B 1 195 ? -16.111 58.355  5.507   1.00 23.02 ? 195  SER B C     1 
ATOM   6408  O O     . SER B 1 195 ? -16.485 57.183  5.530   1.00 23.96 ? 195  SER B O     1 
ATOM   6409  C CB    . SER B 1 195 ? -14.004 58.219  4.209   1.00 22.51 ? 195  SER B CB    1 
ATOM   6410  O OG    . SER B 1 195 ? -13.135 59.220  3.759   1.00 23.57 ? 195  SER B OG    1 
ATOM   6411  N N     . ILE B 1 196 ? -16.957 59.387  5.433   1.00 22.13 ? 196  ILE B N     1 
ATOM   6412  C CA    . ILE B 1 196 ? -18.385 59.211  5.176   1.00 21.68 ? 196  ILE B CA    1 
ATOM   6413  C C     . ILE B 1 196 ? -18.594 59.562  3.705   1.00 21.24 ? 196  ILE B C     1 
ATOM   6414  O O     . ILE B 1 196 ? -18.352 60.714  3.324   1.00 21.18 ? 196  ILE B O     1 
ATOM   6415  C CB    . ILE B 1 196 ? -19.288 60.191  6.013   1.00 22.33 ? 196  ILE B CB    1 
ATOM   6416  C CG1   . ILE B 1 196 ? -18.935 60.221  7.519   1.00 23.28 ? 196  ILE B CG1   1 
ATOM   6417  C CG2   . ILE B 1 196 ? -20.789 59.901  5.789   1.00 22.39 ? 196  ILE B CG2   1 
ATOM   6418  C CD1   . ILE B 1 196 ? -18.789 58.837  8.172   1.00 27.00 ? 196  ILE B CD1   1 
ATOM   6419  N N     . PRO B 1 197 ? -19.091 58.607  2.881   1.00 20.36 ? 197  PRO B N     1 
ATOM   6420  C CA    . PRO B 1 197 ? -19.130 58.856  1.430   1.00 19.69 ? 197  PRO B CA    1 
ATOM   6421  C C     . PRO B 1 197 ? -20.348 59.714  1.000   1.00 19.21 ? 197  PRO B C     1 
ATOM   6422  O O     . PRO B 1 197 ? -21.204 59.233  0.246   1.00 19.34 ? 197  PRO B O     1 
ATOM   6423  C CB    . PRO B 1 197 ? -19.211 57.434  0.837   1.00 19.82 ? 197  PRO B CB    1 
ATOM   6424  C CG    . PRO B 1 197 ? -19.964 56.616  1.894   1.00 19.54 ? 197  PRO B CG    1 
ATOM   6425  C CD    . PRO B 1 197 ? -19.671 57.292  3.237   1.00 20.25 ? 197  PRO B CD    1 
ATOM   6426  N N     . LEU B 1 198 ? -20.412 60.963  1.467   1.00 17.74 ? 198  LEU B N     1 
ATOM   6427  C CA    . LEU B 1 198 ? -21.530 61.859  1.193   1.00 16.46 ? 198  LEU B CA    1 
ATOM   6428  C C     . LEU B 1 198 ? -21.962 62.025  -0.279  1.00 16.98 ? 198  LEU B C     1 
ATOM   6429  O O     . LEU B 1 198 ? -23.170 61.884  -0.600  1.00 17.51 ? 198  LEU B O     1 
ATOM   6430  C CB    . LEU B 1 198 ? -21.285 63.241  1.833   1.00 16.08 ? 198  LEU B CB    1 
ATOM   6431  C CG    . LEU B 1 198 ? -21.310 63.334  3.367   1.00 13.64 ? 198  LEU B CG    1 
ATOM   6432  C CD1   . LEU B 1 198 ? -20.936 64.688  3.846   1.00 8.32  ? 198  LEU B CD1   1 
ATOM   6433  C CD2   . LEU B 1 198 ? -22.650 62.916  3.947   1.00 11.95 ? 198  LEU B CD2   1 
ATOM   6434  N N     . LYS B 1 199 ? -21.015 62.362  -1.163  1.00 16.24 ? 199  LYS B N     1 
ATOM   6435  C CA    . LYS B 1 199 ? -21.362 62.694  -2.543  1.00 15.85 ? 199  LYS B CA    1 
ATOM   6436  C C     . LYS B 1 199 ? -21.874 61.466  -3.301  1.00 15.83 ? 199  LYS B C     1 
ATOM   6437  O O     . LYS B 1 199 ? -22.820 61.559  -4.096  1.00 16.24 ? 199  LYS B O     1 
ATOM   6438  C CB    . LYS B 1 199 ? -20.194 63.389  -3.265  1.00 15.73 ? 199  LYS B CB    1 
ATOM   6439  C CG    . LYS B 1 199 ? -20.143 63.246  -4.790  1.00 15.51 ? 199  LYS B CG    1 
ATOM   6440  C CD    . LYS B 1 199 ? -21.252 63.997  -5.497  1.00 16.26 ? 199  LYS B CD    1 
ATOM   6441  C CE    . LYS B 1 199 ? -20.885 64.395  -6.950  1.00 15.44 ? 199  LYS B CE    1 
ATOM   6442  N NZ    . LYS B 1 199 ? -21.027 63.311  -7.939  1.00 13.61 ? 199  LYS B NZ    1 
ATOM   6443  N N     . LYS B 1 200 ? -21.238 60.330  -3.058  1.00 15.58 ? 200  LYS B N     1 
ATOM   6444  C CA    . LYS B 1 200 ? -21.725 59.044  -3.539  1.00 15.94 ? 200  LYS B CA    1 
ATOM   6445  C C     . LYS B 1 200 ? -23.145 58.770  -3.042  1.00 15.43 ? 200  LYS B C     1 
ATOM   6446  O O     . LYS B 1 200 ? -23.954 58.240  -3.787  1.00 16.19 ? 200  LYS B O     1 
ATOM   6447  C CB    . LYS B 1 200 ? -20.797 57.917  -3.096  1.00 16.14 ? 200  LYS B CB    1 
ATOM   6448  C CG    . LYS B 1 200 ? -21.150 56.574  -3.694  1.00 19.03 ? 200  LYS B CG    1 
ATOM   6449  C CD    . LYS B 1 200 ? -19.892 55.817  -4.120  1.00 23.56 ? 200  LYS B CD    1 
ATOM   6450  C CE    . LYS B 1 200 ? -20.169 54.311  -4.203  1.00 23.48 ? 200  LYS B CE    1 
ATOM   6451  N NZ    . LYS B 1 200 ? -20.971 53.973  -5.409  1.00 24.76 ? 200  LYS B NZ    1 
ATOM   6452  N N     . ASN B 1 201 ? -23.462 59.132  -1.804  1.00 14.60 ? 201  ASN B N     1 
ATOM   6453  C CA    . ASN B 1 201 ? -24.815 58.921  -1.296  1.00 14.31 ? 201  ASN B CA    1 
ATOM   6454  C C     . ASN B 1 201 ? -25.809 59.754  -2.107  1.00 14.25 ? 201  ASN B C     1 
ATOM   6455  O O     . ASN B 1 201 ? -26.920 59.293  -2.413  1.00 14.21 ? 201  ASN B O     1 
ATOM   6456  C CB    . ASN B 1 201 ? -24.926 59.269  0.193   1.00 14.14 ? 201  ASN B CB    1 
ATOM   6457  C CG    . ASN B 1 201 ? -24.344 58.206  1.105   1.00 13.36 ? 201  ASN B CG    1 
ATOM   6458  O OD1   . ASN B 1 201 ? -24.038 57.093  0.672   1.00 13.91 ? 201  ASN B OD1   1 
ATOM   6459  N ND2   . ASN B 1 201 ? -24.219 58.540  2.404   1.00 12.10 ? 201  ASN B ND2   1 
ATOM   6460  N N     . VAL B 1 202 ? -25.386 60.969  -2.472  1.00 13.94 ? 202  VAL B N     1 
ATOM   6461  C CA    . VAL B 1 202 ? -26.224 61.873  -3.263  1.00 13.46 ? 202  VAL B CA    1 
ATOM   6462  C C     . VAL B 1 202 ? -26.475 61.302  -4.648  1.00 13.50 ? 202  VAL B C     1 
ATOM   6463  O O     . VAL B 1 202 ? -27.622 61.286  -5.113  1.00 13.00 ? 202  VAL B O     1 
ATOM   6464  C CB    . VAL B 1 202 ? -25.649 63.306  -3.345  1.00 13.11 ? 202  VAL B CB    1 
ATOM   6465  C CG1   . VAL B 1 202 ? -26.324 64.090  -4.450  1.00 14.09 ? 202  VAL B CG1   1 
ATOM   6466  C CG2   . VAL B 1 202 ? -25.847 64.031  -2.039  1.00 12.13 ? 202  VAL B CG2   1 
ATOM   6467  N N     . ASP B 1 203 ? -25.409 60.821  -5.295  1.00 13.90 ? 203  ASP B N     1 
ATOM   6468  C CA    . ASP B 1 203 ? -25.540 60.145  -6.590  1.00 14.24 ? 203  ASP B CA    1 
ATOM   6469  C C     . ASP B 1 203 ? -26.628 59.090  -6.478  1.00 14.65 ? 203  ASP B C     1 
ATOM   6470  O O     . ASP B 1 203 ? -27.552 59.074  -7.304  1.00 14.79 ? 203  ASP B O     1 
ATOM   6471  C CB    . ASP B 1 203 ? -24.253 59.435  -7.020  1.00 13.91 ? 203  ASP B CB    1 
ATOM   6472  C CG    . ASP B 1 203 ? -23.140 60.383  -7.360  1.00 14.67 ? 203  ASP B CG    1 
ATOM   6473  O OD1   . ASP B 1 203 ? -23.382 61.595  -7.362  1.00 14.74 ? 203  ASP B OD1   1 
ATOM   6474  O OD2   . ASP B 1 203 ? -22.016 59.902  -7.644  1.00 16.70 ? 203  ASP B OD2   1 
ATOM   6475  N N     . ASP B 1 204 ? -26.521 58.226  -5.455  1.00 14.56 ? 204  ASP B N     1 
ATOM   6476  C CA    . ASP B 1 204 ? -27.442 57.105  -5.314  1.00 15.31 ? 204  ASP B CA    1 
ATOM   6477  C C     . ASP B 1 204 ? -28.866 57.597  -5.089  1.00 15.66 ? 204  ASP B C     1 
ATOM   6478  O O     . ASP B 1 204 ? -29.805 57.075  -5.704  1.00 16.10 ? 204  ASP B O     1 
ATOM   6479  C CB    . ASP B 1 204 ? -26.982 56.098  -4.257  1.00 14.96 ? 204  ASP B CB    1 
ATOM   6480  C CG    . ASP B 1 204 ? -25.680 55.403  -4.647  1.00 16.62 ? 204  ASP B CG    1 
ATOM   6481  O OD1   . ASP B 1 204 ? -25.015 54.848  -3.742  1.00 17.32 ? 204  ASP B OD1   1 
ATOM   6482  O OD2   . ASP B 1 204 ? -25.295 55.433  -5.854  1.00 17.75 ? 204  ASP B OD2   1 
ATOM   6483  N N     . ALA B 1 205 ? -29.007 58.631  -4.262  1.00 15.71 ? 205  ALA B N     1 
ATOM   6484  C CA    . ALA B 1 205 ? -30.291 59.300  -4.079  1.00 16.05 ? 205  ALA B CA    1 
ATOM   6485  C C     . ALA B 1 205 ? -30.922 59.785  -5.397  1.00 16.35 ? 205  ALA B C     1 
ATOM   6486  O O     . ALA B 1 205 ? -32.115 59.628  -5.603  1.00 16.25 ? 205  ALA B O     1 
ATOM   6487  C CB    . ALA B 1 205 ? -30.154 60.455  -3.074  1.00 15.21 ? 205  ALA B CB    1 
ATOM   6488  N N     . LEU B 1 206 ? -30.125 60.372  -6.284  1.00 17.72 ? 206  LEU B N     1 
ATOM   6489  C CA    . LEU B 1 206 ? -30.666 60.983  -7.514  1.00 19.25 ? 206  LEU B CA    1 
ATOM   6490  C C     . LEU B 1 206 ? -30.879 59.990  -8.696  1.00 20.01 ? 206  LEU B C     1 
ATOM   6491  O O     . LEU B 1 206 ? -31.361 60.369  -9.762  1.00 20.34 ? 206  LEU B O     1 
ATOM   6492  C CB    . LEU B 1 206 ? -29.826 62.201  -7.940  1.00 18.70 ? 206  LEU B CB    1 
ATOM   6493  C CG    . LEU B 1 206 ? -29.549 63.351  -6.955  1.00 19.21 ? 206  LEU B CG    1 
ATOM   6494  C CD1   . LEU B 1 206 ? -28.659 64.352  -7.648  1.00 19.63 ? 206  LEU B CD1   1 
ATOM   6495  C CD2   . LEU B 1 206 ? -30.773 64.057  -6.439  1.00 16.65 ? 206  LEU B CD2   1 
ATOM   6496  N N     . LYS B 1 207 ? -30.516 58.726  -8.499  1.00 20.84 ? 207  LYS B N     1 
ATOM   6497  C CA    . LYS B 1 207 ? -30.879 57.684  -9.437  1.00 21.67 ? 207  LYS B CA    1 
ATOM   6498  C C     . LYS B 1 207 ? -32.297 57.229  -9.145  1.00 21.82 ? 207  LYS B C     1 
ATOM   6499  O O     . LYS B 1 207 ? -32.892 56.530  -9.948  1.00 21.86 ? 207  LYS B O     1 
ATOM   6500  C CB    . LYS B 1 207 ? -29.913 56.506  -9.331  1.00 22.23 ? 207  LYS B CB    1 
ATOM   6501  C CG    . LYS B 1 207 ? -28.520 56.800  -9.902  1.00 23.29 ? 207  LYS B CG    1 
ATOM   6502  C CD    . LYS B 1 207 ? -27.492 55.771  -9.391  1.00 26.14 ? 207  LYS B CD    1 
ATOM   6503  C CE    . LYS B 1 207 ? -26.107 55.943  -10.059 1.00 25.72 ? 207  LYS B CE    1 
ATOM   6504  N NZ    . LYS B 1 207 ? -25.185 54.804  -9.727  1.00 26.05 ? 207  LYS B NZ    1 
ATOM   6505  N N     . ASN B 1 208 ? -32.833 57.616  -7.988  1.00 22.04 ? 208  ASN B N     1 
ATOM   6506  C CA    . ASN B 1 208 ? -34.240 57.395  -7.687  1.00 22.39 ? 208  ASN B CA    1 
ATOM   6507  C C     . ASN B 1 208 ? -35.117 58.130  -8.709  1.00 23.23 ? 208  ASN B C     1 
ATOM   6508  O O     . ASN B 1 208 ? -35.214 59.370  -8.686  1.00 23.46 ? 208  ASN B O     1 
ATOM   6509  C CB    . ASN B 1 208 ? -34.558 57.860  -6.271  1.00 22.01 ? 208  ASN B CB    1 
ATOM   6510  C CG    . ASN B 1 208 ? -36.010 57.574  -5.843  1.00 21.11 ? 208  ASN B CG    1 
ATOM   6511  O OD1   . ASN B 1 208 ? -36.963 57.707  -6.616  1.00 19.92 ? 208  ASN B OD1   1 
ATOM   6512  N ND2   . ASN B 1 208 ? -36.170 57.220  -4.585  1.00 20.54 ? 208  ASN B ND2   1 
ATOM   6513  N N     . PRO B 1 209 ? -35.787 57.365  -9.590  1.00 23.61 ? 209  PRO B N     1 
ATOM   6514  C CA    . PRO B 1 209 ? -36.557 57.931  -10.721 1.00 23.62 ? 209  PRO B CA    1 
ATOM   6515  C C     . PRO B 1 209 ? -37.511 59.019  -10.248 1.00 23.20 ? 209  PRO B C     1 
ATOM   6516  O O     . PRO B 1 209 ? -37.803 59.934  -11.002 1.00 22.99 ? 209  PRO B O     1 
ATOM   6517  C CB    . PRO B 1 209 ? -37.371 56.735  -11.247 1.00 23.31 ? 209  PRO B CB    1 
ATOM   6518  C CG    . PRO B 1 209 ? -37.300 55.678  -10.109 1.00 24.26 ? 209  PRO B CG    1 
ATOM   6519  C CD    . PRO B 1 209 ? -35.928 55.899  -9.500  1.00 23.97 ? 209  PRO B CD    1 
ATOM   6520  N N     . ASN B 1 210 ? -37.959 58.925  -8.997  1.00 22.88 ? 210  ASN B N     1 
ATOM   6521  C CA    . ASN B 1 210 ? -38.890 59.906  -8.430  1.00 22.90 ? 210  ASN B CA    1 
ATOM   6522  C C     . ASN B 1 210 ? -38.305 61.245  -8.065  1.00 22.47 ? 210  ASN B C     1 
ATOM   6523  O O     . ASN B 1 210 ? -39.056 62.207  -7.910  1.00 22.00 ? 210  ASN B O     1 
ATOM   6524  C CB    . ASN B 1 210 ? -39.625 59.340  -7.217  1.00 23.35 ? 210  ASN B CB    1 
ATOM   6525  C CG    . ASN B 1 210 ? -40.641 58.327  -7.609  1.00 24.43 ? 210  ASN B CG    1 
ATOM   6526  O OD1   . ASN B 1 210 ? -41.627 58.645  -8.277  1.00 26.22 ? 210  ASN B OD1   1 
ATOM   6527  N ND2   . ASN B 1 210 ? -40.395 57.084  -7.245  1.00 25.83 ? 210  ASN B ND2   1 
ATOM   6528  N N     . VAL B 1 211 ? -36.982 61.310  -7.904  1.00 22.01 ? 211  VAL B N     1 
ATOM   6529  C CA    . VAL B 1 211 ? -36.328 62.604  -7.765  1.00 21.95 ? 211  VAL B CA    1 
ATOM   6530  C C     . VAL B 1 211 ? -36.266 63.288  -9.116  1.00 21.79 ? 211  VAL B C     1 
ATOM   6531  O O     . VAL B 1 211 ? -35.566 62.821  -9.996  1.00 22.04 ? 211  VAL B O     1 
ATOM   6532  C CB    . VAL B 1 211 ? -34.909 62.476  -7.214  1.00 22.29 ? 211  VAL B CB    1 
ATOM   6533  C CG1   . VAL B 1 211 ? -34.280 63.859  -7.040  1.00 19.87 ? 211  VAL B CG1   1 
ATOM   6534  C CG2   . VAL B 1 211 ? -34.938 61.707  -5.890  1.00 22.67 ? 211  VAL B CG2   1 
ATOM   6535  N N     . THR B 1 212 ? -37.006 64.387  -9.263  1.00 21.87 ? 212  THR B N     1 
ATOM   6536  C CA    . THR B 1 212 ? -37.082 65.130  -10.528 1.00 21.82 ? 212  THR B CA    1 
ATOM   6537  C C     . THR B 1 212 ? -36.854 66.641  -10.391 1.00 22.09 ? 212  THR B C     1 
ATOM   6538  O O     . THR B 1 212 ? -36.813 67.353  -11.396 1.00 22.35 ? 212  THR B O     1 
ATOM   6539  C CB    . THR B 1 212 ? -38.467 64.983  -11.193 1.00 21.83 ? 212  THR B CB    1 
ATOM   6540  O OG1   . THR B 1 212 ? -39.380 65.872  -10.555 1.00 19.75 ? 212  THR B OG1   1 
ATOM   6541  C CG2   . THR B 1 212 ? -38.992 63.550  -11.083 1.00 21.82 ? 212  THR B CG2   1 
ATOM   6542  N N     . SER B 1 213 ? -36.745 67.140  -9.162  1.00 22.13 ? 213  SER B N     1 
ATOM   6543  C CA    . SER B 1 213 ? -36.628 68.580  -8.959  1.00 22.06 ? 213  SER B CA    1 
ATOM   6544  C C     . SER B 1 213 ? -35.180 69.079  -8.924  1.00 22.14 ? 213  SER B C     1 
ATOM   6545  O O     . SER B 1 213 ? -34.949 70.283  -8.880  1.00 22.65 ? 213  SER B O     1 
ATOM   6546  C CB    . SER B 1 213 ? -37.356 68.999  -7.689  1.00 22.16 ? 213  SER B CB    1 
ATOM   6547  O OG    . SER B 1 213 ? -36.772 68.391  -6.556  1.00 22.85 ? 213  SER B OG    1 
ATOM   6548  N N     . VAL B 1 214 ? -34.206 68.170  -8.959  1.00 21.72 ? 214  VAL B N     1 
ATOM   6549  C CA    . VAL B 1 214 ? -32.800 68.569  -8.776  1.00 20.70 ? 214  VAL B CA    1 
ATOM   6550  C C     . VAL B 1 214 ? -32.094 68.970  -10.090 1.00 20.70 ? 214  VAL B C     1 
ATOM   6551  O O     . VAL B 1 214 ? -31.968 68.160  -11.026 1.00 20.03 ? 214  VAL B O     1 
ATOM   6552  C CB    . VAL B 1 214 ? -31.979 67.490  -7.998  1.00 20.28 ? 214  VAL B CB    1 
ATOM   6553  C CG1   . VAL B 1 214 ? -30.492 67.808  -8.042  1.00 19.35 ? 214  VAL B CG1   1 
ATOM   6554  C CG2   . VAL B 1 214 ? -32.451 67.399  -6.560  1.00 19.52 ? 214  VAL B CG2   1 
ATOM   6555  N N     . GLU B 1 215 ? -31.620 70.220  -10.123 1.00 19.99 ? 215  GLU B N     1 
ATOM   6556  C CA    . GLU B 1 215 ? -30.915 70.775  -11.286 1.00 19.41 ? 215  GLU B CA    1 
ATOM   6557  C C     . GLU B 1 215 ? -29.412 70.647  -11.097 1.00 18.31 ? 215  GLU B C     1 
ATOM   6558  O O     . GLU B 1 215 ? -28.700 70.218  -12.001 1.00 18.33 ? 215  GLU B O     1 
ATOM   6559  C CB    . GLU B 1 215 ? -31.327 72.241  -11.531 1.00 19.58 ? 215  GLU B CB    1 
ATOM   6560  C CG    . GLU B 1 215 ? -32.686 72.346  -12.261 1.00 23.36 ? 215  GLU B CG    1 
ATOM   6561  C CD    . GLU B 1 215 ? -33.529 73.562  -11.864 1.00 27.89 ? 215  GLU B CD    1 
ATOM   6562  O OE1   . GLU B 1 215 ? -34.688 73.358  -11.410 1.00 29.64 ? 215  GLU B OE1   1 
ATOM   6563  O OE2   . GLU B 1 215 ? -33.045 74.713  -12.013 1.00 28.63 ? 215  GLU B OE2   1 
ATOM   6564  N N     . HIS B 1 216 ? -28.918 70.989  -9.915  1.00 16.68 ? 216  HIS B N     1 
ATOM   6565  C CA    . HIS B 1 216 ? -27.496 70.903  -9.691  1.00 15.48 ? 216  HIS B CA    1 
ATOM   6566  C C     . HIS B 1 216 ? -27.206 70.340  -8.333  1.00 14.42 ? 216  HIS B C     1 
ATOM   6567  O O     . HIS B 1 216 ? -28.062 70.377  -7.469  1.00 14.57 ? 216  HIS B O     1 
ATOM   6568  C CB    . HIS B 1 216 ? -26.829 72.274  -9.840  1.00 15.61 ? 216  HIS B CB    1 
ATOM   6569  C CG    . HIS B 1 216 ? -27.028 72.889  -11.186 1.00 16.56 ? 216  HIS B CG    1 
ATOM   6570  N ND1   . HIS B 1 216 ? -26.400 72.414  -12.323 1.00 16.68 ? 216  HIS B ND1   1 
ATOM   6571  C CD2   . HIS B 1 216 ? -27.814 73.917  -11.586 1.00 15.80 ? 216  HIS B CD2   1 
ATOM   6572  C CE1   . HIS B 1 216 ? -26.790 73.127  -13.363 1.00 16.24 ? 216  HIS B CE1   1 
ATOM   6573  N NE2   . HIS B 1 216 ? -27.645 74.047  -12.942 1.00 17.19 ? 216  HIS B NE2   1 
ATOM   6574  N N     . VAL B 1 217 ? -25.996 69.804  -8.180  1.00 13.44 ? 217  VAL B N     1 
ATOM   6575  C CA    . VAL B 1 217 ? -25.402 69.441  -6.898  1.00 12.87 ? 217  VAL B CA    1 
ATOM   6576  C C     . VAL B 1 217 ? -24.099 70.252  -6.721  1.00 12.77 ? 217  VAL B C     1 
ATOM   6577  O O     . VAL B 1 217 ? -23.178 70.153  -7.549  1.00 12.79 ? 217  VAL B O     1 
ATOM   6578  C CB    . VAL B 1 217 ? -25.070 67.924  -6.820  1.00 12.97 ? 217  VAL B CB    1 
ATOM   6579  C CG1   . VAL B 1 217 ? -24.445 67.589  -5.460  1.00 12.07 ? 217  VAL B CG1   1 
ATOM   6580  C CG2   . VAL B 1 217 ? -26.309 67.078  -7.096  1.00 11.55 ? 217  VAL B CG2   1 
ATOM   6581  N N     . ILE B 1 218 ? -24.019 71.064  -5.669  1.00 12.56 ? 218  ILE B N     1 
ATOM   6582  C CA    . ILE B 1 218 ? -22.754 71.725  -5.322  1.00 12.15 ? 218  ILE B CA    1 
ATOM   6583  C C     . ILE B 1 218 ? -21.954 70.828  -4.354  1.00 12.15 ? 218  ILE B C     1 
ATOM   6584  O O     . ILE B 1 218 ? -22.498 70.340  -3.346  1.00 11.25 ? 218  ILE B O     1 
ATOM   6585  C CB    . ILE B 1 218 ? -22.970 73.130  -4.741  1.00 12.69 ? 218  ILE B CB    1 
ATOM   6586  C CG1   . ILE B 1 218 ? -23.739 74.013  -5.746  1.00 12.12 ? 218  ILE B CG1   1 
ATOM   6587  C CG2   . ILE B 1 218 ? -21.589 73.762  -4.326  1.00 14.65 ? 218  ILE B CG2   1 
ATOM   6588  C CD1   . ILE B 1 218 ? -24.269 75.337  -5.173  1.00 11.29 ? 218  ILE B CD1   1 
ATOM   6589  N N     . VAL B 1 219 ? -20.679 70.594  -4.694  1.00 12.00 ? 219  VAL B N     1 
ATOM   6590  C CA    . VAL B 1 219 ? -19.808 69.682  -3.952  1.00 11.77 ? 219  VAL B CA    1 
ATOM   6591  C C     . VAL B 1 219 ? -18.587 70.418  -3.410  1.00 12.50 ? 219  VAL B C     1 
ATOM   6592  O O     . VAL B 1 219 ? -17.812 71.009  -4.174  1.00 12.68 ? 219  VAL B O     1 
ATOM   6593  C CB    . VAL B 1 219 ? -19.317 68.508  -4.836  1.00 11.26 ? 219  VAL B CB    1 
ATOM   6594  C CG1   . VAL B 1 219 ? -18.693 67.440  -4.000  1.00 8.99  ? 219  VAL B CG1   1 
ATOM   6595  C CG2   . VAL B 1 219 ? -20.466 67.933  -5.648  1.00 11.70 ? 219  VAL B CG2   1 
ATOM   6596  N N     . LEU B 1 220 ? -18.403 70.355  -2.097  1.00 13.06 ? 220  LEU B N     1 
ATOM   6597  C CA    . LEU B 1 220 ? -17.181 70.840  -1.477  1.00 13.63 ? 220  LEU B CA    1 
ATOM   6598  C C     . LEU B 1 220 ? -16.105 69.784  -1.593  1.00 14.19 ? 220  LEU B C     1 
ATOM   6599  O O     . LEU B 1 220 ? -16.363 68.610  -1.266  1.00 14.81 ? 220  LEU B O     1 
ATOM   6600  C CB    . LEU B 1 220 ? -17.429 71.089  -0.002  1.00 13.48 ? 220  LEU B CB    1 
ATOM   6601  C CG    . LEU B 1 220 ? -16.208 71.631  0.750   1.00 14.61 ? 220  LEU B CG    1 
ATOM   6602  C CD1   . LEU B 1 220 ? -15.835 73.025  0.261   1.00 12.92 ? 220  LEU B CD1   1 
ATOM   6603  C CD2   . LEU B 1 220 ? -16.497 71.625  2.259   1.00 13.84 ? 220  LEU B CD2   1 
ATOM   6604  N N     . LYS B 1 221 ? -14.914 70.187  -2.033  1.00 14.45 ? 221  LYS B N     1 
ATOM   6605  C CA    . LYS B 1 221 ? -13.776 69.286  -2.048  1.00 15.48 ? 221  LYS B CA    1 
ATOM   6606  C C     . LYS B 1 221 ? -13.127 69.288  -0.673  1.00 15.94 ? 221  LYS B C     1 
ATOM   6607  O O     . LYS B 1 221 ? -12.192 70.048  -0.421  1.00 16.37 ? 221  LYS B O     1 
ATOM   6608  C CB    . LYS B 1 221 ? -12.739 69.636  -3.132  1.00 15.39 ? 221  LYS B CB    1 
ATOM   6609  C CG    . LYS B 1 221 ? -11.618 68.575  -3.228  1.00 16.66 ? 221  LYS B CG    1 
ATOM   6610  C CD    . LYS B 1 221 ? -10.749 68.611  -4.480  1.00 16.56 ? 221  LYS B CD    1 
ATOM   6611  C CE    . LYS B 1 221 ? -11.518 68.203  -5.770  1.00 18.56 ? 221  LYS B CE    1 
ATOM   6612  N NZ    . LYS B 1 221 ? -11.732 66.741  -6.014  1.00 18.21 ? 221  LYS B NZ    1 
ATOM   6613  N N     . ARG B 1 222 ? -13.617 68.414  0.205   1.00 16.15 ? 222  ARG B N     1 
ATOM   6614  C CA    . ARG B 1 222 ? -13.086 68.290  1.557   1.00 15.82 ? 222  ARG B CA    1 
ATOM   6615  C C     . ARG B 1 222 ? -11.935 67.299  1.669   1.00 15.67 ? 222  ARG B C     1 
ATOM   6616  O O     . ARG B 1 222 ? -10.917 67.614  2.276   1.00 15.64 ? 222  ARG B O     1 
ATOM   6617  C CB    . ARG B 1 222 ? -14.215 67.925  2.532   1.00 16.15 ? 222  ARG B CB    1 
ATOM   6618  C CG    . ARG B 1 222 ? -13.769 67.448  3.914   1.00 14.52 ? 222  ARG B CG    1 
ATOM   6619  C CD    . ARG B 1 222 ? -13.191 68.558  4.737   1.00 14.29 ? 222  ARG B CD    1 
ATOM   6620  N NE    . ARG B 1 222 ? -12.767 68.057  6.046   1.00 14.88 ? 222  ARG B NE    1 
ATOM   6621  C CZ    . ARG B 1 222 ? -11.539 67.610  6.313   1.00 14.62 ? 222  ARG B CZ    1 
ATOM   6622  N NH1   . ARG B 1 222 ? -10.599 67.618  5.363   1.00 13.37 ? 222  ARG B NH1   1 
ATOM   6623  N NH2   . ARG B 1 222 ? -11.256 67.148  7.522   1.00 12.12 ? 222  ARG B NH2   1 
ATOM   6624  N N     . THR B 1 223 ? -12.097 66.102  1.117   1.00 15.25 ? 223  THR B N     1 
ATOM   6625  C CA    . THR B 1 223 ? -11.038 65.088  1.208   1.00 15.03 ? 223  THR B CA    1 
ATOM   6626  C C     . THR B 1 223 ? -10.237 64.946  -0.083  1.00 15.00 ? 223  THR B C     1 
ATOM   6627  O O     . THR B 1 223 ? -9.150  64.370  -0.093  1.00 14.96 ? 223  THR B O     1 
ATOM   6628  C CB    . THR B 1 223 ? -11.600 63.663  1.581   1.00 15.34 ? 223  THR B CB    1 
ATOM   6629  O OG1   . THR B 1 223 ? -12.426 63.141  0.518   1.00 14.38 ? 223  THR B OG1   1 
ATOM   6630  C CG2   . THR B 1 223 ? -12.396 63.686  2.890   1.00 14.35 ? 223  THR B CG2   1 
ATOM   6631  N N     . GLY B 1 224 ? -10.809 65.412  -1.185  1.00 15.20 ? 224  GLY B N     1 
ATOM   6632  C CA    . GLY B 1 224 ? -10.236 65.195  -2.510  1.00 15.11 ? 224  GLY B CA    1 
ATOM   6633  C C     . GLY B 1 224 ? -10.233 63.755  -3.005  1.00 15.34 ? 224  GLY B C     1 
ATOM   6634  O O     . GLY B 1 224 ? -9.523  63.447  -3.951  1.00 14.89 ? 224  GLY B O     1 
ATOM   6635  N N     . SER B 1 225 ? -11.038 62.880  -2.392  1.00 16.07 ? 225  SER B N     1 
ATOM   6636  C CA    . SER B 1 225 ? -11.157 61.471  -2.824  1.00 16.92 ? 225  SER B CA    1 
ATOM   6637  C C     . SER B 1 225 ? -11.725 61.356  -4.214  1.00 17.07 ? 225  SER B C     1 
ATOM   6638  O O     . SER B 1 225 ? -12.350 62.286  -4.697  1.00 18.08 ? 225  SER B O     1 
ATOM   6639  C CB    . SER B 1 225 ? -12.063 60.686  -1.887  1.00 16.90 ? 225  SER B CB    1 
ATOM   6640  O OG    . SER B 1 225 ? -13.409 61.074  -2.097  1.00 18.06 ? 225  SER B OG    1 
ATOM   6641  N N     . ASP B 1 226 ? -11.534 60.212  -4.855  1.00 17.84 ? 226  ASP B N     1 
ATOM   6642  C CA    . ASP B 1 226 ? -12.083 60.021  -6.196  1.00 18.15 ? 226  ASP B CA    1 
ATOM   6643  C C     . ASP B 1 226 ? -13.606 59.969  -6.128  1.00 18.24 ? 226  ASP B C     1 
ATOM   6644  O O     . ASP B 1 226 ? -14.171 59.375  -5.202  1.00 18.77 ? 226  ASP B O     1 
ATOM   6645  C CB    . ASP B 1 226 ? -11.548 58.731  -6.835  1.00 18.67 ? 226  ASP B CB    1 
ATOM   6646  C CG    . ASP B 1 226 ? -10.019 58.684  -6.893  1.00 20.09 ? 226  ASP B CG    1 
ATOM   6647  O OD1   . ASP B 1 226 ? -9.390  59.753  -6.984  1.00 20.81 ? 226  ASP B OD1   1 
ATOM   6648  O OD2   . ASP B 1 226 ? -9.447  57.568  -6.857  1.00 21.80 ? 226  ASP B OD2   1 
ATOM   6649  N N     . ILE B 1 227 ? -14.272 60.596  -7.092  1.00 17.94 ? 227  ILE B N     1 
ATOM   6650  C CA    . ILE B 1 227 ? -15.711 60.469  -7.207  1.00 18.13 ? 227  ILE B CA    1 
ATOM   6651  C C     . ILE B 1 227 ? -16.178 60.406  -8.642  1.00 17.78 ? 227  ILE B C     1 
ATOM   6652  O O     . ILE B 1 227 ? -15.398 60.563  -9.577  1.00 17.57 ? 227  ILE B O     1 
ATOM   6653  C CB    . ILE B 1 227 ? -16.507 61.593  -6.443  1.00 19.51 ? 227  ILE B CB    1 
ATOM   6654  C CG1   . ILE B 1 227 ? -15.892 62.984  -6.641  1.00 18.74 ? 227  ILE B CG1   1 
ATOM   6655  C CG2   . ILE B 1 227 ? -16.757 61.188  -4.899  1.00 20.67 ? 227  ILE B CG2   1 
ATOM   6656  C CD1   . ILE B 1 227 ? -16.747 64.083  -5.999  1.00 18.45 ? 227  ILE B CD1   1 
ATOM   6657  N N     . ASP B 1 228 ? -17.461 60.132  -8.813  1.00 17.16 ? 228  ASP B N     1 
ATOM   6658  C CA    . ASP B 1 228 ? -18.044 60.170  -10.124 1.00 16.36 ? 228  ASP B CA    1 
ATOM   6659  C C     . ASP B 1 228 ? -18.505 61.598  -10.299 1.00 16.34 ? 228  ASP B C     1 
ATOM   6660  O O     . ASP B 1 228 ? -18.898 62.247  -9.334  1.00 16.97 ? 228  ASP B O     1 
ATOM   6661  C CB    . ASP B 1 228 ? -19.204 59.191  -10.182 1.00 16.47 ? 228  ASP B CB    1 
ATOM   6662  C CG    . ASP B 1 228 ? -18.802 57.793  -9.759  1.00 15.99 ? 228  ASP B CG    1 
ATOM   6663  O OD1   . ASP B 1 228 ? -19.580 57.117  -9.052  1.00 16.46 ? 228  ASP B OD1   1 
ATOM   6664  O OD2   . ASP B 1 228 ? -17.693 57.376  -10.131 1.00 17.40 ? 228  ASP B OD2   1 
ATOM   6665  N N     . TRP B 1 229 ? -18.420 62.121  -11.512 1.00 15.67 ? 229  TRP B N     1 
ATOM   6666  C CA    . TRP B 1 229 ? -18.807 63.495  -11.735 1.00 14.70 ? 229  TRP B CA    1 
ATOM   6667  C C     . TRP B 1 229 ? -19.835 63.481  -12.837 1.00 15.37 ? 229  TRP B C     1 
ATOM   6668  O O     . TRP B 1 229 ? -19.607 62.879  -13.884 1.00 14.82 ? 229  TRP B O     1 
ATOM   6669  C CB    . TRP B 1 229 ? -17.590 64.309  -12.164 1.00 13.69 ? 229  TRP B CB    1 
ATOM   6670  C CG    . TRP B 1 229 ? -17.736 65.802  -12.004 1.00 12.87 ? 229  TRP B CG    1 
ATOM   6671  C CD1   . TRP B 1 229 ? -17.736 66.748  -12.999 1.00 11.12 ? 229  TRP B CD1   1 
ATOM   6672  C CD2   . TRP B 1 229 ? -17.886 66.519  -10.769 1.00 11.56 ? 229  TRP B CD2   1 
ATOM   6673  N NE1   . TRP B 1 229 ? -17.871 68.009  -12.453 1.00 10.75 ? 229  TRP B NE1   1 
ATOM   6674  C CE2   . TRP B 1 229 ? -17.981 67.899  -11.093 1.00 8.41  ? 229  TRP B CE2   1 
ATOM   6675  C CE3   . TRP B 1 229 ? -17.953 66.128  -9.418  1.00 12.02 ? 229  TRP B CE3   1 
ATOM   6676  C CZ2   . TRP B 1 229 ? -18.138 68.891  -10.123 1.00 10.61 ? 229  TRP B CZ2   1 
ATOM   6677  C CZ3   . TRP B 1 229 ? -18.117 67.139  -8.428  1.00 12.86 ? 229  TRP B CZ3   1 
ATOM   6678  C CH2   . TRP B 1 229 ? -18.196 68.505  -8.797  1.00 11.95 ? 229  TRP B CH2   1 
ATOM   6679  N N     . GLN B 1 230 ? -20.972 64.126  -12.611 1.00 16.32 ? 230  GLN B N     1 
ATOM   6680  C CA    . GLN B 1 230 ? -21.884 64.353  -13.713 1.00 17.90 ? 230  GLN B CA    1 
ATOM   6681  C C     . GLN B 1 230 ? -21.749 65.763  -14.306 1.00 18.12 ? 230  GLN B C     1 
ATOM   6682  O O     . GLN B 1 230 ? -22.272 66.728  -13.745 1.00 18.60 ? 230  GLN B O     1 
ATOM   6683  C CB    . GLN B 1 230 ? -23.328 64.036  -13.321 1.00 18.43 ? 230  GLN B CB    1 
ATOM   6684  C CG    . GLN B 1 230 ? -24.175 63.616  -14.522 1.00 19.98 ? 230  GLN B CG    1 
ATOM   6685  C CD    . GLN B 1 230 ? -25.624 63.358  -14.148 1.00 23.16 ? 230  GLN B CD    1 
ATOM   6686  O OE1   . GLN B 1 230 ? -25.957 62.324  -13.545 1.00 22.02 ? 230  GLN B OE1   1 
ATOM   6687  N NE2   . GLN B 1 230 ? -26.502 64.295  -14.515 1.00 23.32 ? 230  GLN B NE2   1 
ATOM   6688  N N     . GLU B 1 231 ? -21.034 65.867  -15.427 1.00 18.36 ? 231  GLU B N     1 
ATOM   6689  C CA    . GLU B 1 231 ? -20.919 67.099  -16.194 1.00 19.17 ? 231  GLU B CA    1 
ATOM   6690  C C     . GLU B 1 231 ? -22.282 67.792  -16.273 1.00 18.62 ? 231  GLU B C     1 
ATOM   6691  O O     . GLU B 1 231 ? -23.288 67.128  -16.518 1.00 18.06 ? 231  GLU B O     1 
ATOM   6692  C CB    . GLU B 1 231 ? -20.469 66.767  -17.630 1.00 20.37 ? 231  GLU B CB    1 
ATOM   6693  C CG    . GLU B 1 231 ? -19.419 67.709  -18.218 1.00 24.22 ? 231  GLU B CG    1 
ATOM   6694  C CD    . GLU B 1 231 ? -18.230 67.795  -17.269 1.00 33.05 ? 231  GLU B CD    1 
ATOM   6695  O OE1   . GLU B 1 231 ? -17.518 66.747  -17.078 1.00 34.26 ? 231  GLU B OE1   1 
ATOM   6696  O OE2   . GLU B 1 231 ? -18.048 68.896  -16.670 1.00 34.68 ? 231  GLU B OE2   1 
ATOM   6697  N N     . GLY B 1 232 ? -22.317 69.108  -16.092 1.00 17.82 ? 232  GLY B N     1 
ATOM   6698  C CA    . GLY B 1 232 ? -23.557 69.848  -16.230 1.00 18.13 ? 232  GLY B CA    1 
ATOM   6699  C C     . GLY B 1 232 ? -24.313 69.956  -14.908 1.00 18.78 ? 232  GLY B C     1 
ATOM   6700  O O     . GLY B 1 232 ? -24.810 71.032  -14.554 1.00 19.70 ? 232  GLY B O     1 
ATOM   6701  N N     . ARG B 1 233 ? -24.421 68.846  -14.175 1.00 17.98 ? 233  ARG B N     1 
ATOM   6702  C CA    . ARG B 1 233 ? -25.143 68.837  -12.907 1.00 17.00 ? 233  ARG B CA    1 
ATOM   6703  C C     . ARG B 1 233 ? -24.212 69.192  -11.732 1.00 16.47 ? 233  ARG B C     1 
ATOM   6704  O O     . ARG B 1 233 ? -24.565 69.973  -10.856 1.00 15.71 ? 233  ARG B O     1 
ATOM   6705  C CB    . ARG B 1 233 ? -25.811 67.475  -12.690 1.00 17.04 ? 233  ARG B CB    1 
ATOM   6706  C CG    . ARG B 1 233 ? -26.675 67.380  -11.435 1.00 14.66 ? 233  ARG B CG    1 
ATOM   6707  C CD    . ARG B 1 233 ? -26.953 65.928  -11.086 1.00 13.10 ? 233  ARG B CD    1 
ATOM   6708  N NE    . ARG B 1 233 ? -25.834 65.315  -10.378 1.00 13.40 ? 233  ARG B NE    1 
ATOM   6709  C CZ    . ARG B 1 233 ? -25.747 64.014  -10.104 1.00 16.08 ? 233  ARG B CZ    1 
ATOM   6710  N NH1   . ARG B 1 233 ? -26.731 63.192  -10.466 1.00 15.95 ? 233  ARG B NH1   1 
ATOM   6711  N NH2   . ARG B 1 233 ? -24.686 63.523  -9.454  1.00 15.03 ? 233  ARG B NH2   1 
ATOM   6712  N N     . ASP B 1 234 ? -23.014 68.623  -11.749 1.00 15.99 ? 234  ASP B N     1 
ATOM   6713  C CA    . ASP B 1 234 ? -22.094 68.738  -10.634 1.00 15.86 ? 234  ASP B CA    1 
ATOM   6714  C C     . ASP B 1 234 ? -21.168 69.942  -10.746 1.00 15.51 ? 234  ASP B C     1 
ATOM   6715  O O     . ASP B 1 234 ? -20.544 70.169  -11.763 1.00 16.01 ? 234  ASP B O     1 
ATOM   6716  C CB    . ASP B 1 234 ? -21.320 67.424  -10.462 1.00 15.65 ? 234  ASP B CB    1 
ATOM   6717  C CG    . ASP B 1 234 ? -22.224 66.259  -10.072 1.00 15.40 ? 234  ASP B CG    1 
ATOM   6718  O OD1   . ASP B 1 234 ? -23.365 66.487  -9.618  1.00 14.37 ? 234  ASP B OD1   1 
ATOM   6719  O OD2   . ASP B 1 234 ? -21.792 65.104  -10.227 1.00 17.17 ? 234  ASP B OD2   1 
ATOM   6720  N N     . LEU B 1 235 ? -21.100 70.721  -9.679  1.00 15.60 ? 235  LEU B N     1 
ATOM   6721  C CA    . LEU B 1 235 ? -20.276 71.924  -9.635  1.00 15.52 ? 235  LEU B CA    1 
ATOM   6722  C C     . LEU B 1 235 ? -19.407 71.900  -8.384  1.00 15.78 ? 235  LEU B C     1 
ATOM   6723  O O     . LEU B 1 235 ? -19.877 71.601  -7.278  1.00 16.62 ? 235  LEU B O     1 
ATOM   6724  C CB    . LEU B 1 235 ? -21.166 73.174  -9.635  1.00 15.14 ? 235  LEU B CB    1 
ATOM   6725  C CG    . LEU B 1 235 ? -22.191 73.285  -10.777 1.00 14.40 ? 235  LEU B CG    1 
ATOM   6726  C CD1   . LEU B 1 235 ? -23.088 74.501  -10.567 1.00 12.58 ? 235  LEU B CD1   1 
ATOM   6727  C CD2   . LEU B 1 235 ? -21.493 73.311  -12.161 1.00 10.85 ? 235  LEU B CD2   1 
ATOM   6728  N N     . TRP B 1 236 ? -18.125 72.176  -8.545  1.00 15.91 ? 236  TRP B N     1 
ATOM   6729  C CA    . TRP B 1 236 ? -17.277 72.302  -7.379  1.00 15.43 ? 236  TRP B CA    1 
ATOM   6730  C C     . TRP B 1 236 ? -17.625 73.576  -6.634  1.00 15.34 ? 236  TRP B C     1 
ATOM   6731  O O     . TRP B 1 236 ? -17.812 74.637  -7.245  1.00 15.36 ? 236  TRP B O     1 
ATOM   6732  C CB    . TRP B 1 236 ? -15.826 72.245  -7.791  1.00 15.01 ? 236  TRP B CB    1 
ATOM   6733  C CG    . TRP B 1 236 ? -15.446 70.875  -8.240  1.00 15.28 ? 236  TRP B CG    1 
ATOM   6734  C CD1   . TRP B 1 236 ? -15.141 70.479  -9.509  1.00 14.30 ? 236  TRP B CD1   1 
ATOM   6735  C CD2   . TRP B 1 236 ? -15.325 69.699  -7.410  1.00 16.21 ? 236  TRP B CD2   1 
ATOM   6736  N NE1   . TRP B 1 236 ? -14.820 69.136  -9.524  1.00 14.25 ? 236  TRP B NE1   1 
ATOM   6737  C CE2   . TRP B 1 236 ? -14.939 68.629  -8.257  1.00 14.03 ? 236  TRP B CE2   1 
ATOM   6738  C CE3   . TRP B 1 236 ? -15.509 69.449  -6.033  1.00 15.09 ? 236  TRP B CE3   1 
ATOM   6739  C CZ2   . TRP B 1 236 ? -14.727 67.327  -7.779  1.00 14.78 ? 236  TRP B CZ2   1 
ATOM   6740  C CZ3   . TRP B 1 236 ? -15.295 68.143  -5.555  1.00 15.03 ? 236  TRP B CZ3   1 
ATOM   6741  C CH2   . TRP B 1 236 ? -14.911 67.098  -6.435  1.00 15.09 ? 236  TRP B CH2   1 
ATOM   6742  N N     . TRP B 1 237 ? -17.785 73.437  -5.317  1.00 15.71 ? 237  TRP B N     1 
ATOM   6743  C CA    . TRP B 1 237 ? -17.947 74.561  -4.390  1.00 15.48 ? 237  TRP B CA    1 
ATOM   6744  C C     . TRP B 1 237 ? -16.985 75.720  -4.746  1.00 15.98 ? 237  TRP B C     1 
ATOM   6745  O O     . TRP B 1 237 ? -17.417 76.837  -5.000  1.00 14.68 ? 237  TRP B O     1 
ATOM   6746  C CB    . TRP B 1 237 ? -17.727 74.090  -2.952  1.00 14.78 ? 237  TRP B CB    1 
ATOM   6747  C CG    . TRP B 1 237 ? -17.836 75.196  -1.933  1.00 16.17 ? 237  TRP B CG    1 
ATOM   6748  C CD1   . TRP B 1 237 ? -16.909 76.196  -1.683  1.00 17.12 ? 237  TRP B CD1   1 
ATOM   6749  C CD2   . TRP B 1 237 ? -18.917 75.424  -1.013  1.00 15.35 ? 237  TRP B CD2   1 
ATOM   6750  N NE1   . TRP B 1 237 ? -17.365 77.024  -0.680  1.00 17.45 ? 237  TRP B NE1   1 
ATOM   6751  C CE2   . TRP B 1 237 ? -18.586 76.570  -0.250  1.00 16.89 ? 237  TRP B CE2   1 
ATOM   6752  C CE3   . TRP B 1 237 ? -20.115 74.760  -0.746  1.00 14.95 ? 237  TRP B CE3   1 
ATOM   6753  C CZ2   . TRP B 1 237 ? -19.422 77.068  0.752   1.00 17.06 ? 237  TRP B CZ2   1 
ATOM   6754  C CZ3   . TRP B 1 237 ? -20.952 75.261  0.230   1.00 16.16 ? 237  TRP B CZ3   1 
ATOM   6755  C CH2   . TRP B 1 237 ? -20.604 76.408  0.967   1.00 16.90 ? 237  TRP B CH2   1 
ATOM   6756  N N     . ARG B 1 238 ? -15.690 75.416  -4.798  1.00 17.09 ? 238  ARG B N     1 
ATOM   6757  C CA    . ARG B 1 238 ? -14.649 76.421  -4.902  1.00 18.55 ? 238  ARG B CA    1 
ATOM   6758  C C     . ARG B 1 238 ? -14.604 77.127  -6.273  1.00 19.58 ? 238  ARG B C     1 
ATOM   6759  O O     . ARG B 1 238 ? -14.264 78.297  -6.332  1.00 19.28 ? 238  ARG B O     1 
ATOM   6760  C CB    . ARG B 1 238 ? -13.302 75.791  -4.535  1.00 18.45 ? 238  ARG B CB    1 
ATOM   6761  C CG    . ARG B 1 238 ? -12.110 76.712  -4.510  1.00 18.58 ? 238  ARG B CG    1 
ATOM   6762  C CD    . ARG B 1 238 ? -10.868 75.890  -4.256  1.00 20.11 ? 238  ARG B CD    1 
ATOM   6763  N NE    . ARG B 1 238 ? -9.642  76.635  -4.505  1.00 19.86 ? 238  ARG B NE    1 
ATOM   6764  C CZ    . ARG B 1 238 ? -8.438  76.091  -4.691  1.00 20.54 ? 238  ARG B CZ    1 
ATOM   6765  N NH1   . ARG B 1 238 ? -8.266  74.779  -4.663  1.00 19.23 ? 238  ARG B NH1   1 
ATOM   6766  N NH2   . ARG B 1 238 ? -7.388  76.875  -4.912  1.00 21.01 ? 238  ARG B NH2   1 
ATOM   6767  N N     . ASP B 1 239 ? -14.946 76.440  -7.363  1.00 20.93 ? 239  ASP B N     1 
ATOM   6768  C CA    . ASP B 1 239 ? -15.058 77.133  -8.655  1.00 22.45 ? 239  ASP B CA    1 
ATOM   6769  C C     . ASP B 1 239 ? -16.142 78.198  -8.607  1.00 22.22 ? 239  ASP B C     1 
ATOM   6770  O O     . ASP B 1 239 ? -15.962 79.310  -9.119  1.00 22.57 ? 239  ASP B O     1 
ATOM   6771  C CB    . ASP B 1 239 ? -15.333 76.173  -9.829  1.00 23.40 ? 239  ASP B CB    1 
ATOM   6772  C CG    . ASP B 1 239 ? -14.088 75.394  -10.252 1.00 27.26 ? 239  ASP B CG    1 
ATOM   6773  O OD1   . ASP B 1 239 ? -13.005 76.036  -10.417 1.00 30.28 ? 239  ASP B OD1   1 
ATOM   6774  O OD2   . ASP B 1 239 ? -14.195 74.139  -10.414 1.00 30.12 ? 239  ASP B OD2   1 
ATOM   6775  N N     . LEU B 1 240 ? -17.266 77.860  -7.992  1.00 21.64 ? 240  LEU B N     1 
ATOM   6776  C CA    . LEU B 1 240 ? -18.380 78.776  -7.965  1.00 21.29 ? 240  LEU B CA    1 
ATOM   6777  C C     . LEU B 1 240 ? -18.070 79.941  -7.080  1.00 21.90 ? 240  LEU B C     1 
ATOM   6778  O O     . LEU B 1 240 ? -18.315 81.080  -7.468  1.00 22.89 ? 240  LEU B O     1 
ATOM   6779  C CB    . LEU B 1 240 ? -19.657 78.100  -7.488  1.00 20.78 ? 240  LEU B CB    1 
ATOM   6780  C CG    . LEU B 1 240 ? -20.304 77.069  -8.409  1.00 19.64 ? 240  LEU B CG    1 
ATOM   6781  C CD1   . LEU B 1 240 ? -21.411 76.393  -7.658  1.00 15.67 ? 240  LEU B CD1   1 
ATOM   6782  C CD2   . LEU B 1 240 ? -20.797 77.726  -9.714  1.00 16.72 ? 240  LEU B CD2   1 
ATOM   6783  N N     . ILE B 1 241 ? -17.521 79.676  -5.902  1.00 22.28 ? 241  ILE B N     1 
ATOM   6784  C CA    . ILE B 1 241 ? -17.449 80.710  -4.895  1.00 23.21 ? 241  ILE B CA    1 
ATOM   6785  C C     . ILE B 1 241 ? -16.442 81.792  -5.315  1.00 24.46 ? 241  ILE B C     1 
ATOM   6786  O O     . ILE B 1 241 ? -16.649 82.977  -5.023  1.00 25.18 ? 241  ILE B O     1 
ATOM   6787  C CB    . ILE B 1 241 ? -17.241 80.156  -3.424  1.00 22.97 ? 241  ILE B CB    1 
ATOM   6788  C CG1   . ILE B 1 241 ? -17.937 81.090  -2.419  1.00 23.43 ? 241  ILE B CG1   1 
ATOM   6789  C CG2   . ILE B 1 241 ? -15.750 79.885  -3.096  1.00 20.93 ? 241  ILE B CG2   1 
ATOM   6790  C CD1   . ILE B 1 241 ? -17.435 81.044  -0.954  1.00 23.75 ? 241  ILE B CD1   1 
ATOM   6791  N N     . GLU B 1 242 ? -15.392 81.393  -6.039  1.00 25.18 ? 242  GLU B N     1 
ATOM   6792  C CA    . GLU B 1 242 ? -14.361 82.327  -6.516  1.00 26.10 ? 242  GLU B CA    1 
ATOM   6793  C C     . GLU B 1 242 ? -14.776 83.120  -7.776  1.00 25.89 ? 242  GLU B C     1 
ATOM   6794  O O     . GLU B 1 242 ? -14.231 84.185  -8.032  1.00 25.93 ? 242  GLU B O     1 
ATOM   6795  C CB    . GLU B 1 242 ? -12.993 81.608  -6.677  1.00 26.14 ? 242  GLU B CB    1 
ATOM   6796  C CG    . GLU B 1 242 ? -12.370 81.168  -5.308  1.00 26.62 ? 242  GLU B CG    1 
ATOM   6797  C CD    . GLU B 1 242 ? -11.068 80.319  -5.386  1.00 27.66 ? 242  GLU B CD    1 
ATOM   6798  O OE1   . GLU B 1 242 ? -10.605 79.920  -6.490  1.00 28.15 ? 242  GLU B OE1   1 
ATOM   6799  O OE2   . GLU B 1 242 ? -10.498 80.039  -4.302  1.00 30.99 ? 242  GLU B OE2   1 
ATOM   6800  N N     . LYS B 1 243 ? -15.736 82.598  -8.546  1.00 26.07 ? 243  LYS B N     1 
ATOM   6801  C CA    . LYS B 1 243 ? -16.350 83.315  -9.693  1.00 25.95 ? 243  LYS B CA    1 
ATOM   6802  C C     . LYS B 1 243 ? -17.284 84.451  -9.262  1.00 25.94 ? 243  LYS B C     1 
ATOM   6803  O O     . LYS B 1 243 ? -17.594 85.321  -10.057 1.00 26.10 ? 243  LYS B O     1 
ATOM   6804  C CB    . LYS B 1 243 ? -17.174 82.358  -10.573 1.00 25.60 ? 243  LYS B CB    1 
ATOM   6805  C CG    . LYS B 1 243 ? -16.435 81.751  -11.746 1.00 26.41 ? 243  LYS B CG    1 
ATOM   6806  C CD    . LYS B 1 243 ? -17.342 80.820  -12.570 1.00 26.28 ? 243  LYS B CD    1 
ATOM   6807  N N     . ALA B 1 244 ? -17.755 84.423  -8.019  1.00 25.95 ? 244  ALA B N     1 
ATOM   6808  C CA    . ALA B 1 244 ? -18.864 85.274  -7.593  1.00 25.80 ? 244  ALA B CA    1 
ATOM   6809  C C     . ALA B 1 244 ? -18.412 86.491  -6.805  1.00 25.67 ? 244  ALA B C     1 
ATOM   6810  O O     . ALA B 1 244 ? -17.440 86.414  -6.048  1.00 25.66 ? 244  ALA B O     1 
ATOM   6811  C CB    . ALA B 1 244 ? -19.848 84.462  -6.771  1.00 25.53 ? 244  ALA B CB    1 
ATOM   6812  N N     . SER B 1 245 ? -19.150 87.593  -6.960  1.00 25.46 ? 245  SER B N     1 
ATOM   6813  C CA    . SER B 1 245 ? -18.850 88.845  -6.268  1.00 25.64 ? 245  SER B CA    1 
ATOM   6814  C C     . SER B 1 245 ? -18.994 88.739  -4.759  1.00 25.58 ? 245  SER B C     1 
ATOM   6815  O O     . SER B 1 245 ? -19.955 88.149  -4.259  1.00 25.60 ? 245  SER B O     1 
ATOM   6816  C CB    . SER B 1 245 ? -19.726 90.001  -6.774  1.00 26.10 ? 245  SER B CB    1 
ATOM   6817  O OG    . SER B 1 245 ? -19.652 91.117  -5.879  1.00 26.58 ? 245  SER B OG    1 
ATOM   6818  N N     . PRO B 1 246 ? -18.029 89.307  -4.023  1.00 25.58 ? 246  PRO B N     1 
ATOM   6819  C CA    . PRO B 1 246 ? -18.175 89.306  -2.562  1.00 25.33 ? 246  PRO B CA    1 
ATOM   6820  C C     . PRO B 1 246 ? -19.138 90.354  -2.017  1.00 25.24 ? 246  PRO B C     1 
ATOM   6821  O O     . PRO B 1 246 ? -19.283 90.428  -0.807  1.00 25.44 ? 246  PRO B O     1 
ATOM   6822  C CB    . PRO B 1 246 ? -16.750 89.556  -2.050  1.00 25.63 ? 246  PRO B CB    1 
ATOM   6823  C CG    . PRO B 1 246 ? -15.889 89.883  -3.294  1.00 25.54 ? 246  PRO B CG    1 
ATOM   6824  C CD    . PRO B 1 246 ? -16.777 89.939  -4.486  1.00 25.31 ? 246  PRO B CD    1 
ATOM   6825  N N     . GLU B 1 247 ? -19.773 91.158  -2.878  1.00 25.23 ? 247  GLU B N     1 
ATOM   6826  C CA    . GLU B 1 247 ? -20.770 92.149  -2.428  1.00 25.77 ? 247  GLU B CA    1 
ATOM   6827  C C     . GLU B 1 247 ? -22.155 91.574  -2.590  1.00 25.59 ? 247  GLU B C     1 
ATOM   6828  O O     . GLU B 1 247 ? -22.516 91.134  -3.678  1.00 25.57 ? 247  GLU B O     1 
ATOM   6829  C CB    . GLU B 1 247 ? -20.753 93.459  -3.243  1.00 26.17 ? 247  GLU B CB    1 
ATOM   6830  C CG    . GLU B 1 247 ? -19.401 94.119  -3.500  1.00 28.88 ? 247  GLU B CG    1 
ATOM   6831  C CD    . GLU B 1 247 ? -18.591 94.313  -2.241  1.00 31.82 ? 247  GLU B CD    1 
ATOM   6832  O OE1   . GLU B 1 247 ? -19.177 94.328  -1.130  1.00 33.72 ? 247  GLU B OE1   1 
ATOM   6833  O OE2   . GLU B 1 247 ? -17.360 94.443  -2.367  1.00 33.30 ? 247  GLU B OE2   1 
ATOM   6834  N N     . HIS B 1 248 ? -22.938 91.585  -1.523  1.00 25.26 ? 248  HIS B N     1 
ATOM   6835  C CA    . HIS B 1 248 ? -24.338 91.236  -1.647  1.00 25.17 ? 248  HIS B CA    1 
ATOM   6836  C C     . HIS B 1 248 ? -25.216 92.131  -0.789  1.00 25.49 ? 248  HIS B C     1 
ATOM   6837  O O     . HIS B 1 248 ? -24.882 92.451  0.346   1.00 25.59 ? 248  HIS B O     1 
ATOM   6838  C CB    . HIS B 1 248 ? -24.600 89.758  -1.330  1.00 24.77 ? 248  HIS B CB    1 
ATOM   6839  C CG    . HIS B 1 248 ? -26.011 89.354  -1.590  1.00 24.40 ? 248  HIS B CG    1 
ATOM   6840  N ND1   . HIS B 1 248 ? -26.944 89.225  -0.587  1.00 24.98 ? 248  HIS B ND1   1 
ATOM   6841  C CD2   . HIS B 1 248 ? -26.673 89.130  -2.749  1.00 24.01 ? 248  HIS B CD2   1 
ATOM   6842  C CE1   . HIS B 1 248 ? -28.113 88.903  -1.110  1.00 24.80 ? 248  HIS B CE1   1 
ATOM   6843  N NE2   . HIS B 1 248 ? -27.976 88.844  -2.421  1.00 25.21 ? 248  HIS B NE2   1 
ATOM   6844  N N     . GLN B 1 249 ? -26.352 92.508  -1.349  1.00 26.20 ? 249  GLN B N     1 
ATOM   6845  C CA    . GLN B 1 249 ? -27.266 93.461  -0.744  1.00 27.34 ? 249  GLN B CA    1 
ATOM   6846  C C     . GLN B 1 249 ? -28.446 92.666  -0.190  1.00 26.89 ? 249  GLN B C     1 
ATOM   6847  O O     . GLN B 1 249 ? -29.251 92.139  -0.961  1.00 27.00 ? 249  GLN B O     1 
ATOM   6848  C CB    . GLN B 1 249 ? -27.680 94.502  -1.813  1.00 28.19 ? 249  GLN B CB    1 
ATOM   6849  C CG    . GLN B 1 249 ? -28.943 95.368  -1.553  1.00 31.50 ? 249  GLN B CG    1 
ATOM   6850  C CD    . GLN B 1 249 ? -28.822 96.275  -0.338  1.00 35.29 ? 249  GLN B CD    1 
ATOM   6851  O OE1   . GLN B 1 249 ? -29.649 96.203  0.570   1.00 34.94 ? 249  GLN B OE1   1 
ATOM   6852  N NE2   . GLN B 1 249 ? -27.788 97.134  -0.315  1.00 37.26 ? 249  GLN B NE2   1 
ATOM   6853  N N     . PRO B 1 250 ? -28.544 92.558  1.151   1.00 26.58 ? 250  PRO B N     1 
ATOM   6854  C CA    . PRO B 1 250 ? -29.622 91.740  1.736   1.00 26.30 ? 250  PRO B CA    1 
ATOM   6855  C C     . PRO B 1 250 ? -30.980 92.458  1.646   1.00 26.44 ? 250  PRO B C     1 
ATOM   6856  O O     . PRO B 1 250 ? -31.094 93.604  2.092   1.00 26.52 ? 250  PRO B O     1 
ATOM   6857  C CB    . PRO B 1 250 ? -29.186 91.572  3.189   1.00 26.05 ? 250  PRO B CB    1 
ATOM   6858  C CG    . PRO B 1 250 ? -28.298 92.773  3.474   1.00 26.36 ? 250  PRO B CG    1 
ATOM   6859  C CD    . PRO B 1 250 ? -27.699 93.216  2.171   1.00 26.22 ? 250  PRO B CD    1 
ATOM   6860  N N     . GLU B 1 251 ? -31.988 91.821  1.050   1.00 26.40 ? 251  GLU B N     1 
ATOM   6861  C CA    . GLU B 1 251 ? -33.339 92.420  1.001   1.00 26.50 ? 251  GLU B CA    1 
ATOM   6862  C C     . GLU B 1 251 ? -34.062 92.126  2.304   1.00 25.51 ? 251  GLU B C     1 
ATOM   6863  O O     . GLU B 1 251 ? -33.666 91.224  3.049   1.00 25.61 ? 251  GLU B O     1 
ATOM   6864  C CB    . GLU B 1 251 ? -34.219 91.878  -0.145  1.00 27.29 ? 251  GLU B CB    1 
ATOM   6865  C CG    . GLU B 1 251 ? -33.501 91.302  -1.383  1.00 29.54 ? 251  GLU B CG    1 
ATOM   6866  C CD    . GLU B 1 251 ? -33.086 92.361  -2.351  1.00 29.76 ? 251  GLU B CD    1 
ATOM   6867  O OE1   . GLU B 1 251 ? -33.911 93.257  -2.608  1.00 31.07 ? 251  GLU B OE1   1 
ATOM   6868  O OE2   . GLU B 1 251 ? -31.944 92.288  -2.852  1.00 30.69 ? 251  GLU B OE2   1 
ATOM   6869  N N     . ALA B 1 252 ? -35.133 92.874  2.562   1.00 24.08 ? 252  ALA B N     1 
ATOM   6870  C CA    . ALA B 1 252 ? -36.009 92.581  3.673   1.00 22.30 ? 252  ALA B CA    1 
ATOM   6871  C C     . ALA B 1 252 ? -36.807 91.289  3.417   1.00 21.51 ? 252  ALA B C     1 
ATOM   6872  O O     . ALA B 1 252 ? -37.241 91.018  2.308   1.00 20.97 ? 252  ALA B O     1 
ATOM   6873  C CB    . ALA B 1 252 ? -36.924 93.742  3.919   1.00 21.98 ? 252  ALA B CB    1 
ATOM   6874  N N     . MET B 1 253 ? -36.971 90.482  4.454   1.00 20.82 ? 253  MET B N     1 
ATOM   6875  C CA    . MET B 1 253 ? -37.868 89.341  4.404   1.00 20.32 ? 253  MET B CA    1 
ATOM   6876  C C     . MET B 1 253 ? -38.923 89.656  5.445   1.00 20.00 ? 253  MET B C     1 
ATOM   6877  O O     . MET B 1 253 ? -38.601 90.303  6.449   1.00 19.74 ? 253  MET B O     1 
ATOM   6878  C CB    . MET B 1 253 ? -37.107 88.058  4.762   1.00 20.80 ? 253  MET B CB    1 
ATOM   6879  C CG    . MET B 1 253 ? -35.808 87.822  3.933   1.00 21.20 ? 253  MET B CG    1 
ATOM   6880  S SD    . MET B 1 253 ? -36.171 87.471  2.186   1.00 23.44 ? 253  MET B SD    1 
ATOM   6881  C CE    . MET B 1 253 ? -34.788 88.202  1.285   1.00 21.03 ? 253  MET B CE    1 
ATOM   6882  N N     . ASN B 1 254 ? -40.174 89.257  5.195   1.00 19.31 ? 254  ASN B N     1 
ATOM   6883  C CA    . ASN B 1 254 ? -41.253 89.388  6.173   1.00 19.08 ? 254  ASN B CA    1 
ATOM   6884  C C     . ASN B 1 254 ? -40.980 88.457  7.359   1.00 18.28 ? 254  ASN B C     1 
ATOM   6885  O O     . ASN B 1 254 ? -40.585 87.314  7.161   1.00 17.97 ? 254  ASN B O     1 
ATOM   6886  C CB    . ASN B 1 254 ? -42.602 88.995  5.556   1.00 19.76 ? 254  ASN B CB    1 
ATOM   6887  C CG    . ASN B 1 254 ? -43.094 89.986  4.497   1.00 22.34 ? 254  ASN B CG    1 
ATOM   6888  O OD1   . ASN B 1 254 ? -43.368 91.152  4.797   1.00 25.09 ? 254  ASN B OD1   1 
ATOM   6889  N ND2   . ASN B 1 254 ? -43.255 89.506  3.256   1.00 23.10 ? 254  ASN B ND2   1 
ATOM   6890  N N     . ALA B 1 255 ? -41.186 88.945  8.582   1.00 17.17 ? 255  ALA B N     1 
ATOM   6891  C CA    . ALA B 1 255 ? -41.066 88.123  9.790   1.00 16.63 ? 255  ALA B CA    1 
ATOM   6892  C C     . ALA B 1 255 ? -41.627 86.698  9.632   1.00 16.60 ? 255  ALA B C     1 
ATOM   6893  O O     . ALA B 1 255 ? -41.052 85.735  10.153  1.00 16.27 ? 255  ALA B O     1 
ATOM   6894  C CB    . ALA B 1 255 ? -41.727 88.814  10.960  1.00 16.31 ? 255  ALA B CB    1 
ATOM   6895  N N     . GLU B 1 256 ? -42.743 86.584  8.910   1.00 16.50 ? 256  GLU B N     1 
ATOM   6896  C CA    . GLU B 1 256 ? -43.417 85.311  8.706   1.00 16.39 ? 256  GLU B CA    1 
ATOM   6897  C C     . GLU B 1 256 ? -43.038 84.574  7.425   1.00 16.69 ? 256  GLU B C     1 
ATOM   6898  O O     . GLU B 1 256 ? -43.645 83.558  7.131   1.00 16.98 ? 256  GLU B O     1 
ATOM   6899  C CB    . GLU B 1 256 ? -44.942 85.465  8.795   1.00 15.64 ? 256  GLU B CB    1 
ATOM   6900  C CG    . GLU B 1 256 ? -45.476 85.592  10.250  1.00 15.14 ? 256  GLU B CG    1 
ATOM   6901  C CD    . GLU B 1 256 ? -44.908 84.530  11.247  1.00 14.72 ? 256  GLU B CD    1 
ATOM   6902  O OE1   . GLU B 1 256 ? -44.720 83.346  10.871  1.00 13.60 ? 256  GLU B OE1   1 
ATOM   6903  O OE2   . GLU B 1 256 ? -44.662 84.882  12.419  1.00 13.01 ? 256  GLU B OE2   1 
ATOM   6904  N N     . ASP B 1 257 ? -42.050 85.072  6.679   1.00 16.33 ? 257  ASP B N     1 
ATOM   6905  C CA    . ASP B 1 257 ? -41.471 84.332  5.555   1.00 16.24 ? 257  ASP B CA    1 
ATOM   6906  C C     . ASP B 1 257 ? -40.738 83.103  6.074   1.00 16.40 ? 257  ASP B C     1 
ATOM   6907  O O     . ASP B 1 257 ? -39.991 83.210  7.057   1.00 16.32 ? 257  ASP B O     1 
ATOM   6908  C CB    . ASP B 1 257 ? -40.469 85.199  4.788   1.00 16.28 ? 257  ASP B CB    1 
ATOM   6909  C CG    . ASP B 1 257 ? -41.148 86.212  3.867   1.00 16.68 ? 257  ASP B CG    1 
ATOM   6910  O OD1   . ASP B 1 257 ? -42.328 85.987  3.506   1.00 21.25 ? 257  ASP B OD1   1 
ATOM   6911  O OD2   . ASP B 1 257 ? -40.503 87.205  3.479   1.00 14.10 ? 257  ASP B OD2   1 
ATOM   6912  N N     . PRO B 1 258 ? -40.913 81.940  5.399   1.00 16.27 ? 258  PRO B N     1 
ATOM   6913  C CA    . PRO B 1 258 ? -40.311 80.681  5.879   1.00 15.63 ? 258  PRO B CA    1 
ATOM   6914  C C     . PRO B 1 258 ? -38.775 80.738  5.835   1.00 15.24 ? 258  PRO B C     1 
ATOM   6915  O O     . PRO B 1 258 ? -38.203 81.349  4.934   1.00 15.04 ? 258  PRO B O     1 
ATOM   6916  C CB    . PRO B 1 258 ? -40.862 79.626  4.909   1.00 15.99 ? 258  PRO B CB    1 
ATOM   6917  C CG    . PRO B 1 258 ? -41.246 80.391  3.675   1.00 15.98 ? 258  PRO B CG    1 
ATOM   6918  C CD    . PRO B 1 258 ? -41.669 81.756  4.144   1.00 15.71 ? 258  PRO B CD    1 
ATOM   6919  N N     . LEU B 1 259 ? -38.119 80.132  6.825   1.00 14.64 ? 259  LEU B N     1 
ATOM   6920  C CA    . LEU B 1 259 ? -36.669 80.231  6.954   1.00 13.54 ? 259  LEU B CA    1 
ATOM   6921  C C     . LEU B 1 259 ? -36.074 78.891  6.647   1.00 13.34 ? 259  LEU B C     1 
ATOM   6922  O O     . LEU B 1 259 ? -35.200 78.782  5.800   1.00 13.47 ? 259  LEU B O     1 
ATOM   6923  C CB    . LEU B 1 259 ? -36.288 80.711  8.356   1.00 13.13 ? 259  LEU B CB    1 
ATOM   6924  C CG    . LEU B 1 259 ? -34.805 80.827  8.703   1.00 12.61 ? 259  LEU B CG    1 
ATOM   6925  C CD1   . LEU B 1 259 ? -34.086 81.966  7.957   1.00 7.93  ? 259  LEU B CD1   1 
ATOM   6926  C CD2   . LEU B 1 259 ? -34.663 80.962  10.212  1.00 10.20 ? 259  LEU B CD2   1 
ATOM   6927  N N     . PHE B 1 260 ? -36.574 77.857  7.316   1.00 13.50 ? 260  PHE B N     1 
ATOM   6928  C CA    . PHE B 1 260 ? -36.115 76.489  7.050   1.00 13.42 ? 260  PHE B CA    1 
ATOM   6929  C C     . PHE B 1 260 ? -37.143 75.419  7.331   1.00 13.76 ? 260  PHE B C     1 
ATOM   6930  O O     . PHE B 1 260 ? -38.167 75.653  7.979   1.00 13.50 ? 260  PHE B O     1 
ATOM   6931  C CB    . PHE B 1 260 ? -34.805 76.166  7.785   1.00 13.17 ? 260  PHE B CB    1 
ATOM   6932  C CG    . PHE B 1 260 ? -34.947 76.042  9.274   1.00 12.58 ? 260  PHE B CG    1 
ATOM   6933  C CD1   . PHE B 1 260 ? -35.392 74.862  9.847   1.00 12.39 ? 260  PHE B CD1   1 
ATOM   6934  C CD2   . PHE B 1 260 ? -34.620 77.107  10.103  1.00 12.80 ? 260  PHE B CD2   1 
ATOM   6935  C CE1   . PHE B 1 260 ? -35.505 74.746  11.234  1.00 14.33 ? 260  PHE B CE1   1 
ATOM   6936  C CE2   . PHE B 1 260 ? -34.735 77.006  11.500  1.00 13.78 ? 260  PHE B CE2   1 
ATOM   6937  C CZ    . PHE B 1 260 ? -35.178 75.819  12.065  1.00 13.66 ? 260  PHE B CZ    1 
ATOM   6938  N N     . ILE B 1 261 ? -36.832 74.237  6.823   1.00 14.68 ? 261  ILE B N     1 
ATOM   6939  C CA    . ILE B 1 261 ? -37.622 73.047  7.016   1.00 16.03 ? 261  ILE B CA    1 
ATOM   6940  C C     . ILE B 1 261 ? -36.671 72.009  7.600   1.00 16.14 ? 261  ILE B C     1 
ATOM   6941  O O     . ILE B 1 261 ? -35.530 71.914  7.167   1.00 15.83 ? 261  ILE B O     1 
ATOM   6942  C CB    . ILE B 1 261 ? -38.159 72.531  5.686   1.00 16.44 ? 261  ILE B CB    1 
ATOM   6943  C CG1   . ILE B 1 261 ? -39.156 73.515  5.075   1.00 17.27 ? 261  ILE B CG1   1 
ATOM   6944  C CG2   . ILE B 1 261 ? -38.856 71.204  5.879   1.00 18.61 ? 261  ILE B CG2   1 
ATOM   6945  C CD1   . ILE B 1 261 ? -39.531 73.149  3.658   1.00 17.73 ? 261  ILE B CD1   1 
ATOM   6946  N N     . LEU B 1 262 ? -37.146 71.263  8.599   1.00 16.69 ? 262  LEU B N     1 
ATOM   6947  C CA    . LEU B 1 262 ? -36.385 70.170  9.217   1.00 16.96 ? 262  LEU B CA    1 
ATOM   6948  C C     . LEU B 1 262 ? -37.286 68.961  9.339   1.00 17.26 ? 262  LEU B C     1 
ATOM   6949  O O     . LEU B 1 262 ? -38.304 68.997  10.023  1.00 16.97 ? 262  LEU B O     1 
ATOM   6950  C CB    . LEU B 1 262 ? -35.888 70.541  10.618  1.00 17.05 ? 262  LEU B CB    1 
ATOM   6951  C CG    . LEU B 1 262 ? -34.425 70.870  10.886  1.00 17.81 ? 262  LEU B CG    1 
ATOM   6952  C CD1   . LEU B 1 262 ? -34.204 70.966  12.376  1.00 15.26 ? 262  LEU B CD1   1 
ATOM   6953  C CD2   . LEU B 1 262 ? -33.519 69.812  10.280  1.00 18.11 ? 262  LEU B CD2   1 
ATOM   6954  N N     . TYR B 1 263 ? -36.908 67.884  8.673   1.00 17.91 ? 263  TYR B N     1 
ATOM   6955  C CA    . TYR B 1 263 ? -37.691 66.667  8.713   1.00 18.36 ? 263  TYR B CA    1 
ATOM   6956  C C     . TYR B 1 263 ? -37.486 66.051  10.076  1.00 19.19 ? 263  TYR B C     1 
ATOM   6957  O O     . TYR B 1 263 ? -36.370 65.967  10.561  1.00 19.00 ? 263  TYR B O     1 
ATOM   6958  C CB    . TYR B 1 263 ? -37.317 65.746  7.541   1.00 17.75 ? 263  TYR B CB    1 
ATOM   6959  C CG    . TYR B 1 263 ? -37.950 66.260  6.275   1.00 17.22 ? 263  TYR B CG    1 
ATOM   6960  C CD1   . TYR B 1 263 ? -37.313 67.262  5.500   1.00 17.74 ? 263  TYR B CD1   1 
ATOM   6961  C CD2   . TYR B 1 263 ? -39.235 65.817  5.881   1.00 14.92 ? 263  TYR B CD2   1 
ATOM   6962  C CE1   . TYR B 1 263 ? -37.934 67.787  4.355   1.00 16.12 ? 263  TYR B CE1   1 
ATOM   6963  C CE2   . TYR B 1 263 ? -39.852 66.322  4.745   1.00 13.30 ? 263  TYR B CE2   1 
ATOM   6964  C CZ    . TYR B 1 263 ? -39.207 67.310  3.997   1.00 15.09 ? 263  TYR B CZ    1 
ATOM   6965  O OH    . TYR B 1 263 ? -39.813 67.800  2.882   1.00 15.37 ? 263  TYR B OH    1 
ATOM   6966  N N     . THR B 1 264 ? -38.591 65.693  10.713  1.00 20.36 ? 264  THR B N     1 
ATOM   6967  C CA    . THR B 1 264 ? -38.593 65.284  12.107  1.00 21.19 ? 264  THR B CA    1 
ATOM   6968  C C     . THR B 1 264 ? -39.498 64.079  12.216  1.00 21.81 ? 264  THR B C     1 
ATOM   6969  O O     . THR B 1 264 ? -40.586 64.067  11.656  1.00 21.49 ? 264  THR B O     1 
ATOM   6970  C CB    . THR B 1 264 ? -39.116 66.426  12.998  1.00 21.40 ? 264  THR B CB    1 
ATOM   6971  O OG1   . THR B 1 264 ? -38.410 67.623  12.654  1.00 23.17 ? 264  THR B OG1   1 
ATOM   6972  C CG2   . THR B 1 264 ? -38.908 66.128  14.505  1.00 19.49 ? 264  THR B CG2   1 
ATOM   6973  N N     . SER B 1 265 ? -39.023 63.058  12.909  1.00 22.82 ? 265  SER B N     1 
ATOM   6974  C CA    . SER B 1 265 ? -39.768 61.825  13.040  1.00 23.98 ? 265  SER B CA    1 
ATOM   6975  C C     . SER B 1 265 ? -40.959 62.110  13.930  1.00 25.02 ? 265  SER B C     1 
ATOM   6976  O O     . SER B 1 265 ? -40.853 62.933  14.850  1.00 25.76 ? 265  SER B O     1 
ATOM   6977  C CB    . SER B 1 265 ? -38.894 60.742  13.664  1.00 23.37 ? 265  SER B CB    1 
ATOM   6978  O OG    . SER B 1 265 ? -37.914 60.310  12.746  1.00 22.43 ? 265  SER B OG    1 
ATOM   6979  N N     . GLY B 1 266 ? -42.083 61.454  13.667  1.00 25.42 ? 266  GLY B N     1 
ATOM   6980  C CA    . GLY B 1 266 ? -43.228 61.564  14.571  1.00 26.87 ? 266  GLY B CA    1 
ATOM   6981  C C     . GLY B 1 266 ? -43.845 60.234  14.976  1.00 27.80 ? 266  GLY B C     1 
ATOM   6982  O O     . GLY B 1 266 ? -43.298 59.146  14.701  1.00 27.61 ? 266  GLY B O     1 
ATOM   6983  N N     . SER B 1 267 ? -45.008 60.327  15.607  1.00 29.07 ? 267  SER B N     1 
ATOM   6984  C CA    . SER B 1 267 ? -45.707 59.140  16.085  1.00 30.65 ? 267  SER B CA    1 
ATOM   6985  C C     . SER B 1 267 ? -46.226 58.203  14.990  1.00 31.39 ? 267  SER B C     1 
ATOM   6986  O O     . SER B 1 267 ? -46.133 56.973  15.130  1.00 32.20 ? 267  SER B O     1 
ATOM   6987  C CB    . SER B 1 267 ? -46.806 59.500  17.075  1.00 30.62 ? 267  SER B CB    1 
ATOM   6988  O OG    . SER B 1 267 ? -46.983 58.393  17.944  1.00 32.11 ? 267  SER B OG    1 
ATOM   6989  N N     . THR B 1 268 ? -46.769 58.763  13.910  1.00 32.15 ? 268  THR B N     1 
ATOM   6990  C CA    . THR B 1 268 ? -47.105 57.959  12.738  1.00 32.40 ? 268  THR B CA    1 
ATOM   6991  C C     . THR B 1 268 ? -46.434 58.521  11.512  1.00 32.22 ? 268  THR B C     1 
ATOM   6992  O O     . THR B 1 268 ? -45.962 59.669  11.525  1.00 31.72 ? 268  THR B O     1 
ATOM   6993  C CB    . THR B 1 268 ? -48.639 57.832  12.469  1.00 33.27 ? 268  THR B CB    1 
ATOM   6994  O OG1   . THR B 1 268 ? -49.363 58.853  13.168  1.00 32.96 ? 268  THR B OG1   1 
ATOM   6995  C CG2   . THR B 1 268 ? -49.171 56.405  12.858  1.00 34.08 ? 268  THR B CG2   1 
ATOM   6996  N N     . GLY B 1 269 ? -46.360 57.676  10.478  1.00 31.98 ? 269  GLY B N     1 
ATOM   6997  C CA    . GLY B 1 269 ? -45.877 58.062  9.160   1.00 31.98 ? 269  GLY B CA    1 
ATOM   6998  C C     . GLY B 1 269 ? -44.387 58.316  9.065   1.00 31.96 ? 269  GLY B C     1 
ATOM   6999  O O     . GLY B 1 269 ? -43.648 58.143  10.019  1.00 32.35 ? 269  GLY B O     1 
ATOM   7000  N N     . LYS B 1 270 ? -43.946 58.729  7.888   1.00 31.83 ? 270  LYS B N     1 
ATOM   7001  C CA    . LYS B 1 270 ? -42.563 59.094  7.673   1.00 31.69 ? 270  LYS B CA    1 
ATOM   7002  C C     . LYS B 1 270 ? -42.317 60.477  8.304   1.00 30.31 ? 270  LYS B C     1 
ATOM   7003  O O     . LYS B 1 270 ? -43.278 61.156  8.677   1.00 30.44 ? 270  LYS B O     1 
ATOM   7004  C CB    . LYS B 1 270 ? -42.257 59.055  6.172   1.00 31.96 ? 270  LYS B CB    1 
ATOM   7005  C CG    . LYS B 1 270 ? -41.962 57.614  5.662   1.00 33.25 ? 270  LYS B CG    1 
ATOM   7006  C CD    . LYS B 1 270 ? -41.623 57.583  4.155   1.00 33.70 ? 270  LYS B CD    1 
ATOM   7007  C CE    . LYS B 1 270 ? -41.229 56.175  3.662   1.00 35.04 ? 270  LYS B CE    1 
ATOM   7008  N NZ    . LYS B 1 270 ? -39.758 55.914  3.781   1.00 35.35 ? 270  LYS B NZ    1 
ATOM   7009  N N     . PRO B 1 271 ? -41.039 60.873  8.490   1.00 28.75 ? 271  PRO B N     1 
ATOM   7010  C CA    . PRO B 1 271 ? -40.752 62.222  9.002   1.00 27.61 ? 271  PRO B CA    1 
ATOM   7011  C C     . PRO B 1 271 ? -41.409 63.347  8.184   1.00 26.25 ? 271  PRO B C     1 
ATOM   7012  O O     . PRO B 1 271 ? -41.479 63.242  6.973   1.00 25.63 ? 271  PRO B O     1 
ATOM   7013  C CB    . PRO B 1 271 ? -39.218 62.308  8.915   1.00 27.51 ? 271  PRO B CB    1 
ATOM   7014  C CG    . PRO B 1 271 ? -38.760 60.893  9.069   1.00 28.06 ? 271  PRO B CG    1 
ATOM   7015  C CD    . PRO B 1 271 ? -39.802 60.089  8.306   1.00 28.89 ? 271  PRO B CD    1 
ATOM   7016  N N     . LYS B 1 272 ? -41.898 64.403  8.836   1.00 24.77 ? 272  LYS B N     1 
ATOM   7017  C CA    . LYS B 1 272 ? -42.447 65.531  8.083   1.00 23.73 ? 272  LYS B CA    1 
ATOM   7018  C C     . LYS B 1 272 ? -41.607 66.769  8.323   1.00 21.98 ? 272  LYS B C     1 
ATOM   7019  O O     . LYS B 1 272 ? -40.857 66.841  9.301   1.00 21.83 ? 272  LYS B O     1 
ATOM   7020  C CB    . LYS B 1 272 ? -43.917 65.821  8.406   1.00 24.23 ? 272  LYS B CB    1 
ATOM   7021  C CG    . LYS B 1 272 ? -44.763 64.629  8.809   1.00 27.48 ? 272  LYS B CG    1 
ATOM   7022  C CD    . LYS B 1 272 ? -45.431 63.885  7.635   1.00 32.35 ? 272  LYS B CD    1 
ATOM   7023  C CE    . LYS B 1 272 ? -46.540 62.956  8.204   1.00 34.39 ? 272  LYS B CE    1 
ATOM   7024  N NZ    . LYS B 1 272 ? -46.495 61.584  7.625   1.00 36.33 ? 272  LYS B NZ    1 
ATOM   7025  N N     . GLY B 1 273 ? -41.715 67.725  7.404   1.00 19.94 ? 273  GLY B N     1 
ATOM   7026  C CA    . GLY B 1 273 ? -40.892 68.919  7.430   1.00 17.57 ? 273  GLY B CA    1 
ATOM   7027  C C     . GLY B 1 273 ? -41.441 69.990  8.358   1.00 16.38 ? 273  GLY B C     1 
ATOM   7028  O O     . GLY B 1 273 ? -42.403 70.683  8.003   1.00 15.72 ? 273  GLY B O     1 
ATOM   7029  N N     . VAL B 1 274 ? -40.828 70.121  9.540   1.00 14.87 ? 274  VAL B N     1 
ATOM   7030  C CA    . VAL B 1 274 ? -41.189 71.156  10.497  1.00 14.13 ? 274  VAL B CA    1 
ATOM   7031  C C     . VAL B 1 274 ? -40.673 72.494  9.991   1.00 14.09 ? 274  VAL B C     1 
ATOM   7032  O O     . VAL B 1 274 ? -39.450 72.680  9.821   1.00 14.78 ? 274  VAL B O     1 
ATOM   7033  C CB    . VAL B 1 274 ? -40.650 70.872  11.930  1.00 13.90 ? 274  VAL B CB    1 
ATOM   7034  C CG1   . VAL B 1 274 ? -41.065 71.982  12.892  1.00 13.99 ? 274  VAL B CG1   1 
ATOM   7035  C CG2   . VAL B 1 274 ? -41.147 69.548  12.433  1.00 13.36 ? 274  VAL B CG2   1 
ATOM   7036  N N     . LEU B 1 275 ? -41.597 73.418  9.742   1.00 12.94 ? 275  LEU B N     1 
ATOM   7037  C CA    . LEU B 1 275 ? -41.240 74.710  9.172   1.00 12.64 ? 275  LEU B CA    1 
ATOM   7038  C C     . LEU B 1 275 ? -41.156 75.843  10.216  1.00 12.72 ? 275  LEU B C     1 
ATOM   7039  O O     . LEU B 1 275 ? -42.043 76.031  11.050  1.00 12.93 ? 275  LEU B O     1 
ATOM   7040  C CB    . LEU B 1 275 ? -42.205 75.055  8.028   1.00 12.28 ? 275  LEU B CB    1 
ATOM   7041  C CG    . LEU B 1 275 ? -42.091 76.355  7.214   1.00 12.01 ? 275  LEU B CG    1 
ATOM   7042  C CD1   . LEU B 1 275 ? -42.619 76.174  5.793   1.00 9.20  ? 275  LEU B CD1   1 
ATOM   7043  C CD2   . LEU B 1 275 ? -42.870 77.476  7.903   1.00 10.04 ? 275  LEU B CD2   1 
ATOM   7044  N N     . HIS B 1 276 ? -40.068 76.595  10.155  1.00 12.80 ? 276  HIS B N     1 
ATOM   7045  C CA    . HIS B 1 276 ? -39.913 77.800  10.945  1.00 12.44 ? 276  HIS B CA    1 
ATOM   7046  C C     . HIS B 1 276 ? -39.812 79.011  10.051  1.00 12.69 ? 276  HIS B C     1 
ATOM   7047  O O     . HIS B 1 276 ? -39.185 78.969  8.986   1.00 13.08 ? 276  HIS B O     1 
ATOM   7048  C CB    . HIS B 1 276 ? -38.662 77.717  11.793  1.00 11.98 ? 276  HIS B CB    1 
ATOM   7049  C CG    . HIS B 1 276 ? -38.835 76.889  13.017  1.00 11.70 ? 276  HIS B CG    1 
ATOM   7050  N ND1   . HIS B 1 276 ? -39.511 77.343  14.131  1.00 11.26 ? 276  HIS B ND1   1 
ATOM   7051  C CD2   . HIS B 1 276 ? -38.452 75.623  13.295  1.00 9.81  ? 276  HIS B CD2   1 
ATOM   7052  C CE1   . HIS B 1 276 ? -39.510 76.398  15.053  1.00 10.68 ? 276  HIS B CE1   1 
ATOM   7053  N NE2   . HIS B 1 276 ? -38.871 75.347  14.573  1.00 10.06 ? 276  HIS B NE2   1 
ATOM   7054  N N     . THR B 1 277 ? -40.423 80.095  10.496  1.00 12.63 ? 277  THR B N     1 
ATOM   7055  C CA    . THR B 1 277 ? -40.302 81.364  9.804   1.00 12.45 ? 277  THR B CA    1 
ATOM   7056  C C     . THR B 1 277 ? -39.167 82.175  10.413  1.00 12.33 ? 277  THR B C     1 
ATOM   7057  O O     . THR B 1 277 ? -38.336 81.634  11.175  1.00 12.07 ? 277  THR B O     1 
ATOM   7058  C CB    . THR B 1 277 ? -41.619 82.129  9.791   1.00 12.85 ? 277  THR B CB    1 
ATOM   7059  O OG1   . THR B 1 277 ? -42.071 82.334  11.134  1.00 14.23 ? 277  THR B OG1   1 
ATOM   7060  C CG2   . THR B 1 277 ? -42.669 81.335  9.015   1.00 12.17 ? 277  THR B CG2   1 
ATOM   7061  N N     . THR B 1 278 ? -39.102 83.458  10.085  1.00 11.68 ? 278  THR B N     1 
ATOM   7062  C CA    . THR B 1 278 ? -37.857 84.176  10.320  1.00 11.71 ? 278  THR B CA    1 
ATOM   7063  C C     . THR B 1 278 ? -37.770 84.951  11.631  1.00 12.00 ? 278  THR B C     1 
ATOM   7064  O O     . THR B 1 278 ? -36.816 84.738  12.370  1.00 12.37 ? 278  THR B O     1 
ATOM   7065  C CB    . THR B 1 278 ? -37.489 85.073  9.123   1.00 11.72 ? 278  THR B CB    1 
ATOM   7066  O OG1   . THR B 1 278 ? -37.434 84.268  7.931   1.00 13.13 ? 278  THR B OG1   1 
ATOM   7067  C CG2   . THR B 1 278 ? -36.146 85.780  9.348   1.00 10.08 ? 278  THR B CG2   1 
ATOM   7068  N N     . GLY B 1 279 ? -38.733 85.841  11.907  1.00 11.46 ? 279  GLY B N     1 
ATOM   7069  C CA    . GLY B 1 279 ? -38.609 86.790  13.017  1.00 11.38 ? 279  GLY B CA    1 
ATOM   7070  C C     . GLY B 1 279 ? -38.704 86.214  14.431  1.00 10.93 ? 279  GLY B C     1 
ATOM   7071  O O     . GLY B 1 279 ? -37.752 86.281  15.208  1.00 10.00 ? 279  GLY B O     1 
ATOM   7072  N N     . GLY B 1 280 ? -39.879 85.684  14.756  1.00 11.28 ? 280  GLY B N     1 
ATOM   7073  C CA    . GLY B 1 280 ? -40.126 84.974  15.997  1.00 11.84 ? 280  GLY B CA    1 
ATOM   7074  C C     . GLY B 1 280 ? -39.022 83.991  16.312  1.00 12.36 ? 280  GLY B C     1 
ATOM   7075  O O     . GLY B 1 280 ? -38.452 84.048  17.403  1.00 13.36 ? 280  GLY B O     1 
ATOM   7076  N N     . TYR B 1 281 ? -38.717 83.111  15.358  1.00 12.29 ? 281  TYR B N     1 
ATOM   7077  C CA    . TYR B 1 281 ? -37.663 82.116  15.505  1.00 12.46 ? 281  TYR B CA    1 
ATOM   7078  C C     . TYR B 1 281 ? -36.316 82.729  15.912  1.00 12.77 ? 281  TYR B C     1 
ATOM   7079  O O     . TYR B 1 281 ? -35.707 82.298  16.916  1.00 12.64 ? 281  TYR B O     1 
ATOM   7080  C CB    . TYR B 1 281 ? -37.486 81.233  14.239  1.00 12.35 ? 281  TYR B CB    1 
ATOM   7081  C CG    . TYR B 1 281 ? -36.215 80.383  14.305  1.00 12.49 ? 281  TYR B CG    1 
ATOM   7082  C CD1   . TYR B 1 281 ? -36.170 79.218  15.087  1.00 14.22 ? 281  TYR B CD1   1 
ATOM   7083  C CD2   . TYR B 1 281 ? -35.045 80.774  13.649  1.00 10.69 ? 281  TYR B CD2   1 
ATOM   7084  C CE1   . TYR B 1 281 ? -35.004 78.444  15.184  1.00 12.67 ? 281  TYR B CE1   1 
ATOM   7085  C CE2   . TYR B 1 281 ? -33.879 80.020  13.752  1.00 12.03 ? 281  TYR B CE2   1 
ATOM   7086  C CZ    . TYR B 1 281 ? -33.865 78.856  14.524  1.00 12.78 ? 281  TYR B CZ    1 
ATOM   7087  O OH    . TYR B 1 281 ? -32.717 78.100  14.623  1.00 12.83 ? 281  TYR B OH    1 
ATOM   7088  N N     . LEU B 1 282 ? -35.837 83.701  15.134  1.00 12.69 ? 282  LEU B N     1 
ATOM   7089  C CA    . LEU B 1 282 ? -34.545 84.331  15.445  1.00 13.04 ? 282  LEU B CA    1 
ATOM   7090  C C     . LEU B 1 282 ? -34.582 85.062  16.787  1.00 13.10 ? 282  LEU B C     1 
ATOM   7091  O O     . LEU B 1 282 ? -33.653 84.952  17.576  1.00 13.36 ? 282  LEU B O     1 
ATOM   7092  C CB    . LEU B 1 282 ? -34.063 85.254  14.317  1.00 12.94 ? 282  LEU B CB    1 
ATOM   7093  C CG    . LEU B 1 282 ? -32.621 85.779  14.364  1.00 12.94 ? 282  LEU B CG    1 
ATOM   7094  C CD1   . LEU B 1 282 ? -31.597 84.685  14.608  1.00 12.59 ? 282  LEU B CD1   1 
ATOM   7095  C CD2   . LEU B 1 282 ? -32.270 86.519  13.072  1.00 12.77 ? 282  LEU B CD2   1 
ATOM   7096  N N     . VAL B 1 283 ? -35.667 85.783  17.060  1.00 13.28 ? 283  VAL B N     1 
ATOM   7097  C CA    . VAL B 1 283 ? -35.771 86.509  18.314  1.00 12.76 ? 283  VAL B CA    1 
ATOM   7098  C C     . VAL B 1 283 ? -35.684 85.479  19.421  1.00 13.42 ? 283  VAL B C     1 
ATOM   7099  O O     . VAL B 1 283 ? -34.919 85.648  20.381  1.00 14.65 ? 283  VAL B O     1 
ATOM   7100  C CB    . VAL B 1 283 ? -37.087 87.301  18.440  1.00 12.63 ? 283  VAL B CB    1 
ATOM   7101  C CG1   . VAL B 1 283 ? -37.314 87.726  19.872  1.00 11.45 ? 283  VAL B CG1   1 
ATOM   7102  C CG2   . VAL B 1 283 ? -37.061 88.516  17.541  1.00 11.92 ? 283  VAL B CG2   1 
ATOM   7103  N N     . TYR B 1 284 ? -36.438 84.393  19.280  1.00 12.95 ? 284  TYR B N     1 
ATOM   7104  C CA    . TYR B 1 284 ? -36.473 83.384  20.322  1.00 12.52 ? 284  TYR B CA    1 
ATOM   7105  C C     . TYR B 1 284 ? -35.103 82.705  20.488  1.00 12.45 ? 284  TYR B C     1 
ATOM   7106  O O     . TYR B 1 284 ? -34.639 82.491  21.600  1.00 12.81 ? 284  TYR B O     1 
ATOM   7107  C CB    . TYR B 1 284 ? -37.607 82.375  20.074  1.00 12.66 ? 284  TYR B CB    1 
ATOM   7108  C CG    . TYR B 1 284 ? -38.022 81.663  21.351  1.00 11.44 ? 284  TYR B CG    1 
ATOM   7109  C CD1   . TYR B 1 284 ? -37.705 80.325  21.555  1.00 9.70  ? 284  TYR B CD1   1 
ATOM   7110  C CD2   . TYR B 1 284 ? -38.692 82.358  22.361  1.00 10.22 ? 284  TYR B CD2   1 
ATOM   7111  C CE1   . TYR B 1 284 ? -38.061 79.673  22.728  1.00 12.11 ? 284  TYR B CE1   1 
ATOM   7112  C CE2   . TYR B 1 284 ? -39.057 81.737  23.553  1.00 11.67 ? 284  TYR B CE2   1 
ATOM   7113  C CZ    . TYR B 1 284 ? -38.735 80.391  23.734  1.00 13.43 ? 284  TYR B CZ    1 
ATOM   7114  O OH    . TYR B 1 284 ? -39.088 79.774  24.904  1.00 12.19 ? 284  TYR B OH    1 
ATOM   7115  N N     . ALA B 1 285 ? -34.436 82.423  19.378  1.00 12.17 ? 285  ALA B N     1 
ATOM   7116  C CA    . ALA B 1 285 ? -33.145 81.740  19.414  1.00 11.99 ? 285  ALA B CA    1 
ATOM   7117  C C     . ALA B 1 285 ? -32.037 82.594  20.089  1.00 12.16 ? 285  ALA B C     1 
ATOM   7118  O O     . ALA B 1 285 ? -31.322 82.116  20.976  1.00 11.03 ? 285  ALA B O     1 
ATOM   7119  C CB    . ALA B 1 285 ? -32.729 81.308  17.982  1.00 11.52 ? 285  ALA B CB    1 
ATOM   7120  N N     . ALA B 1 286 ? -31.892 83.847  19.650  1.00 12.25 ? 286  ALA B N     1 
ATOM   7121  C CA    . ALA B 1 286 ? -30.940 84.768  20.280  1.00 12.69 ? 286  ALA B CA    1 
ATOM   7122  C C     . ALA B 1 286 ? -31.213 84.934  21.783  1.00 13.02 ? 286  ALA B C     1 
ATOM   7123  O O     . ALA B 1 286 ? -30.300 84.762  22.591  1.00 13.26 ? 286  ALA B O     1 
ATOM   7124  C CB    . ALA B 1 286 ? -30.953 86.111  19.589  1.00 12.75 ? 286  ALA B CB    1 
ATOM   7125  N N     . THR B 1 287 ? -32.478 85.202  22.142  1.00 13.44 ? 287  THR B N     1 
ATOM   7126  C CA    . THR B 1 287 ? -32.884 85.483  23.519  1.00 12.94 ? 287  THR B CA    1 
ATOM   7127  C C     . THR B 1 287 ? -32.585 84.302  24.446  1.00 13.95 ? 287  THR B C     1 
ATOM   7128  O O     . THR B 1 287 ? -31.953 84.471  25.513  1.00 13.48 ? 287  THR B O     1 
ATOM   7129  C CB    . THR B 1 287 ? -34.366 85.831  23.592  1.00 12.57 ? 287  THR B CB    1 
ATOM   7130  O OG1   . THR B 1 287 ? -34.640 86.977  22.784  1.00 11.51 ? 287  THR B OG1   1 
ATOM   7131  C CG2   . THR B 1 287 ? -34.773 86.136  25.017  1.00 12.47 ? 287  THR B CG2   1 
ATOM   7132  N N     . THR B 1 288 ? -33.027 83.107  24.043  1.00 14.43 ? 288  THR B N     1 
ATOM   7133  C CA    . THR B 1 288 ? -32.798 81.918  24.865  1.00 14.92 ? 288  THR B CA    1 
ATOM   7134  C C     . THR B 1 288 ? -31.307 81.647  24.930  1.00 15.37 ? 288  THR B C     1 
ATOM   7135  O O     . THR B 1 288 ? -30.793 81.296  25.997  1.00 16.59 ? 288  THR B O     1 
ATOM   7136  C CB    . THR B 1 288 ? -33.530 80.668  24.346  1.00 15.02 ? 288  THR B CB    1 
ATOM   7137  O OG1   . THR B 1 288 ? -33.182 80.430  22.969  1.00 14.16 ? 288  THR B OG1   1 
ATOM   7138  C CG2   . THR B 1 288 ? -35.045 80.838  24.488  1.00 14.22 ? 288  THR B CG2   1 
ATOM   7139  N N     . PHE B 1 289 ? -30.607 81.850  23.810  1.00 14.82 ? 289  PHE B N     1 
ATOM   7140  C CA    . PHE B 1 289 ? -29.151 81.692  23.801  1.00 14.44 ? 289  PHE B CA    1 
ATOM   7141  C C     . PHE B 1 289 ? -28.465 82.580  24.840  1.00 14.43 ? 289  PHE B C     1 
ATOM   7142  O O     . PHE B 1 289 ? -27.729 82.092  25.683  1.00 13.95 ? 289  PHE B O     1 
ATOM   7143  C CB    . PHE B 1 289 ? -28.507 81.938  22.415  1.00 13.63 ? 289  PHE B CB    1 
ATOM   7144  C CG    . PHE B 1 289 ? -27.000 81.924  22.461  1.00 13.05 ? 289  PHE B CG    1 
ATOM   7145  C CD1   . PHE B 1 289 ? -26.301 80.722  22.509  1.00 11.97 ? 289  PHE B CD1   1 
ATOM   7146  C CD2   . PHE B 1 289 ? -26.277 83.122  22.551  1.00 12.93 ? 289  PHE B CD2   1 
ATOM   7147  C CE1   . PHE B 1 289 ? -24.910 80.723  22.590  1.00 10.65 ? 289  PHE B CE1   1 
ATOM   7148  C CE2   . PHE B 1 289 ? -24.893 83.131  22.645  1.00 8.27  ? 289  PHE B CE2   1 
ATOM   7149  C CZ    . PHE B 1 289 ? -24.217 81.933  22.655  1.00 11.00 ? 289  PHE B CZ    1 
ATOM   7150  N N     . LYS B 1 290 ? -28.698 83.883  24.729  1.00 15.25 ? 290  LYS B N     1 
ATOM   7151  C CA    . LYS B 1 290 ? -28.090 84.897  25.594  1.00 15.92 ? 290  LYS B CA    1 
ATOM   7152  C C     . LYS B 1 290 ? -28.372 84.639  27.059  1.00 16.42 ? 290  LYS B C     1 
ATOM   7153  O O     . LYS B 1 290 ? -27.463 84.690  27.888  1.00 17.40 ? 290  LYS B O     1 
ATOM   7154  C CB    . LYS B 1 290 ? -28.629 86.258  25.224  1.00 15.43 ? 290  LYS B CB    1 
ATOM   7155  C CG    . LYS B 1 290 ? -27.999 87.413  25.931  1.00 17.23 ? 290  LYS B CG    1 
ATOM   7156  C CD    . LYS B 1 290 ? -28.539 88.694  25.284  1.00 17.89 ? 290  LYS B CD    1 
ATOM   7157  C CE    . LYS B 1 290 ? -27.969 89.924  25.889  1.00 17.62 ? 290  LYS B CE    1 
ATOM   7158  N NZ    . LYS B 1 290 ? -28.649 91.079  25.272  1.00 19.22 ? 290  LYS B NZ    1 
ATOM   7159  N N     . TYR B 1 291 ? -29.610 84.321  27.392  1.00 16.02 ? 291  TYR B N     1 
ATOM   7160  C CA    . TYR B 1 291 ? -29.949 84.305  28.781  1.00 15.95 ? 291  TYR B CA    1 
ATOM   7161  C C     . TYR B 1 291 ? -29.673 82.996  29.430  1.00 16.19 ? 291  TYR B C     1 
ATOM   7162  O O     . TYR B 1 291 ? -29.152 82.948  30.551  1.00 16.36 ? 291  TYR B O     1 
ATOM   7163  C CB    . TYR B 1 291 ? -31.377 84.781  28.986  1.00 16.06 ? 291  TYR B CB    1 
ATOM   7164  C CG    . TYR B 1 291 ? -31.502 86.273  28.750  1.00 16.44 ? 291  TYR B CG    1 
ATOM   7165  C CD1   . TYR B 1 291 ? -32.506 86.792  27.939  1.00 16.93 ? 291  TYR B CD1   1 
ATOM   7166  C CD2   . TYR B 1 291 ? -30.593 87.171  29.329  1.00 15.67 ? 291  TYR B CD2   1 
ATOM   7167  C CE1   . TYR B 1 291 ? -32.625 88.180  27.725  1.00 16.66 ? 291  TYR B CE1   1 
ATOM   7168  C CE2   . TYR B 1 291 ? -30.701 88.546  29.117  1.00 15.18 ? 291  TYR B CE2   1 
ATOM   7169  C CZ    . TYR B 1 291 ? -31.716 89.037  28.313  1.00 16.44 ? 291  TYR B CZ    1 
ATOM   7170  O OH    . TYR B 1 291 ? -31.827 90.393  28.107  1.00 17.45 ? 291  TYR B OH    1 
ATOM   7171  N N     . VAL B 1 292 ? -29.973 81.909  28.731  1.00 16.62 ? 292  VAL B N     1 
ATOM   7172  C CA    . VAL B 1 292 ? -29.722 80.590  29.333  1.00 16.78 ? 292  VAL B CA    1 
ATOM   7173  C C     . VAL B 1 292 ? -28.215 80.268  29.467  1.00 16.53 ? 292  VAL B C     1 
ATOM   7174  O O     . VAL B 1 292 ? -27.815 79.558  30.369  1.00 16.47 ? 292  VAL B O     1 
ATOM   7175  C CB    . VAL B 1 292 ? -30.509 79.452  28.639  1.00 16.91 ? 292  VAL B CB    1 
ATOM   7176  C CG1   . VAL B 1 292 ? -30.206 78.112  29.304  1.00 16.12 ? 292  VAL B CG1   1 
ATOM   7177  C CG2   . VAL B 1 292 ? -31.991 79.752  28.691  1.00 16.40 ? 292  VAL B CG2   1 
ATOM   7178  N N     . PHE B 1 293 ? -27.389 80.811  28.589  1.00 16.32 ? 293  PHE B N     1 
ATOM   7179  C CA    . PHE B 1 293 ? -25.965 80.540  28.667  1.00 16.83 ? 293  PHE B CA    1 
ATOM   7180  C C     . PHE B 1 293 ? -25.221 81.687  29.343  1.00 17.34 ? 293  PHE B C     1 
ATOM   7181  O O     . PHE B 1 293 ? -23.989 81.648  29.491  1.00 17.23 ? 293  PHE B O     1 
ATOM   7182  C CB    . PHE B 1 293 ? -25.378 80.229  27.284  1.00 16.10 ? 293  PHE B CB    1 
ATOM   7183  C CG    . PHE B 1 293 ? -25.844 78.927  26.712  1.00 16.00 ? 293  PHE B CG    1 
ATOM   7184  C CD1   . PHE B 1 293 ? -26.517 78.886  25.496  1.00 15.08 ? 293  PHE B CD1   1 
ATOM   7185  C CD2   . PHE B 1 293 ? -25.624 77.732  27.390  1.00 14.74 ? 293  PHE B CD2   1 
ATOM   7186  C CE1   . PHE B 1 293 ? -26.955 77.668  24.972  1.00 14.20 ? 293  PHE B CE1   1 
ATOM   7187  C CE2   . PHE B 1 293 ? -26.054 76.507  26.855  1.00 11.92 ? 293  PHE B CE2   1 
ATOM   7188  C CZ    . PHE B 1 293 ? -26.714 76.485  25.656  1.00 12.98 ? 293  PHE B CZ    1 
ATOM   7189  N N     . ASP B 1 294 ? -25.976 82.708  29.746  1.00 17.87 ? 294  ASP B N     1 
ATOM   7190  C CA    . ASP B 1 294 ? -25.408 83.886  30.383  1.00 18.17 ? 294  ASP B CA    1 
ATOM   7191  C C     . ASP B 1 294 ? -24.244 84.382  29.533  1.00 18.27 ? 294  ASP B C     1 
ATOM   7192  O O     . ASP B 1 294 ? -23.167 84.711  30.062  1.00 17.68 ? 294  ASP B O     1 
ATOM   7193  C CB    . ASP B 1 294 ? -24.951 83.525  31.805  1.00 18.54 ? 294  ASP B CB    1 
ATOM   7194  C CG    . ASP B 1 294 ? -24.726 84.738  32.684  1.00 19.86 ? 294  ASP B CG    1 
ATOM   7195  O OD1   . ASP B 1 294 ? -23.553 84.930  33.097  1.00 22.09 ? 294  ASP B OD1   1 
ATOM   7196  O OD2   . ASP B 1 294 ? -25.699 85.493  32.945  1.00 18.21 ? 294  ASP B OD2   1 
ATOM   7197  N N     . TYR B 1 295 ? -24.462 84.408  28.208  1.00 18.92 ? 295  TYR B N     1 
ATOM   7198  C CA    . TYR B 1 295 ? -23.424 84.807  27.251  1.00 19.07 ? 295  TYR B CA    1 
ATOM   7199  C C     . TYR B 1 295 ? -22.984 86.222  27.538  1.00 19.37 ? 295  TYR B C     1 
ATOM   7200  O O     . TYR B 1 295 ? -23.805 87.134  27.541  1.00 19.80 ? 295  TYR B O     1 
ATOM   7201  C CB    . TYR B 1 295 ? -23.845 84.698  25.771  1.00 19.17 ? 295  TYR B CB    1 
ATOM   7202  C CG    . TYR B 1 295 ? -22.664 85.010  24.884  1.00 19.76 ? 295  TYR B CG    1 
ATOM   7203  C CD1   . TYR B 1 295 ? -21.704 84.030  24.645  1.00 19.92 ? 295  TYR B CD1   1 
ATOM   7204  C CD2   . TYR B 1 295 ? -22.444 86.305  24.351  1.00 19.65 ? 295  TYR B CD2   1 
ATOM   7205  C CE1   . TYR B 1 295 ? -20.566 84.283  23.895  1.00 20.96 ? 295  TYR B CE1   1 
ATOM   7206  C CE2   . TYR B 1 295 ? -21.277 86.584  23.569  1.00 20.03 ? 295  TYR B CE2   1 
ATOM   7207  C CZ    . TYR B 1 295 ? -20.339 85.546  23.360  1.00 21.88 ? 295  TYR B CZ    1 
ATOM   7208  O OH    . TYR B 1 295 ? -19.173 85.689  22.606  1.00 22.50 ? 295  TYR B OH    1 
ATOM   7209  N N     . HIS B 1 296 ? -21.691 86.377  27.819  1.00 19.91 ? 296  HIS B N     1 
ATOM   7210  C CA    . HIS B 1 296 ? -21.030 87.676  27.874  1.00 20.53 ? 296  HIS B CA    1 
ATOM   7211  C C     . HIS B 1 296 ? -20.137 87.850  26.643  1.00 20.26 ? 296  HIS B C     1 
ATOM   7212  O O     . HIS B 1 296 ? -19.535 86.887  26.151  1.00 20.05 ? 296  HIS B O     1 
ATOM   7213  C CB    . HIS B 1 296 ? -20.173 87.768  29.122  1.00 20.80 ? 296  HIS B CB    1 
ATOM   7214  C CG    . HIS B 1 296 ? -20.953 88.028  30.366  1.00 23.76 ? 296  HIS B CG    1 
ATOM   7215  N ND1   . HIS B 1 296 ? -21.836 87.111  30.898  1.00 26.32 ? 296  HIS B ND1   1 
ATOM   7216  C CD2   . HIS B 1 296 ? -20.975 89.100  31.196  1.00 25.49 ? 296  HIS B CD2   1 
ATOM   7217  C CE1   . HIS B 1 296 ? -22.375 87.612  31.997  1.00 27.28 ? 296  HIS B CE1   1 
ATOM   7218  N NE2   . HIS B 1 296 ? -21.864 88.815  32.203  1.00 27.21 ? 296  HIS B NE2   1 
ATOM   7219  N N     . PRO B 1 297 ? -20.019 89.083  26.143  1.00 20.03 ? 297  PRO B N     1 
ATOM   7220  C CA    . PRO B 1 297 ? -19.083 89.209  25.024  1.00 19.88 ? 297  PRO B CA    1 
ATOM   7221  C C     . PRO B 1 297 ? -17.703 88.673  25.452  1.00 19.51 ? 297  PRO B C     1 
ATOM   7222  O O     . PRO B 1 297 ? -17.254 88.930  26.578  1.00 19.35 ? 297  PRO B O     1 
ATOM   7223  C CB    . PRO B 1 297 ? -19.027 90.724  24.780  1.00 19.66 ? 297  PRO B CB    1 
ATOM   7224  C CG    . PRO B 1 297 ? -20.319 91.261  25.389  1.00 19.62 ? 297  PRO B CG    1 
ATOM   7225  C CD    . PRO B 1 297 ? -20.620 90.371  26.543  1.00 19.90 ? 297  PRO B CD    1 
ATOM   7226  N N     . GLY B 1 298 ? -17.052 87.911  24.578  1.00 18.84 ? 298  GLY B N     1 
ATOM   7227  C CA    . GLY B 1 298 ? -15.769 87.307  24.936  1.00 18.35 ? 298  GLY B CA    1 
ATOM   7228  C C     . GLY B 1 298 ? -15.813 85.813  25.186  1.00 17.96 ? 298  GLY B C     1 
ATOM   7229  O O     . GLY B 1 298 ? -14.814 85.138  24.972  1.00 18.20 ? 298  GLY B O     1 
ATOM   7230  N N     . ASP B 1 299 ? -16.966 85.301  25.630  1.00 17.49 ? 299  ASP B N     1 
ATOM   7231  C CA    . ASP B 1 299 ? -17.129 83.877  25.944  1.00 16.89 ? 299  ASP B CA    1 
ATOM   7232  C C     . ASP B 1 299 ? -16.995 83.012  24.697  1.00 16.55 ? 299  ASP B C     1 
ATOM   7233  O O     . ASP B 1 299 ? -17.658 83.262  23.671  1.00 16.66 ? 299  ASP B O     1 
ATOM   7234  C CB    . ASP B 1 299 ? -18.485 83.578  26.627  1.00 16.98 ? 299  ASP B CB    1 
ATOM   7235  C CG    . ASP B 1 299 ? -18.692 84.356  27.915  1.00 17.04 ? 299  ASP B CG    1 
ATOM   7236  O OD1   . ASP B 1 299 ? -17.699 84.793  28.529  1.00 18.58 ? 299  ASP B OD1   1 
ATOM   7237  O OD2   . ASP B 1 299 ? -19.858 84.547  28.315  1.00 16.81 ? 299  ASP B OD2   1 
ATOM   7238  N N     . ILE B 1 300 ? -16.123 82.008  24.800  1.00 15.71 ? 300  ILE B N     1 
ATOM   7239  C CA    . ILE B 1 300 ? -15.982 81.003  23.774  1.00 14.65 ? 300  ILE B CA    1 
ATOM   7240  C C     . ILE B 1 300 ? -17.068 80.001  24.075  1.00 14.59 ? 300  ILE B C     1 
ATOM   7241  O O     . ILE B 1 300 ? -17.170 79.498  25.202  1.00 15.73 ? 300  ILE B O     1 
ATOM   7242  C CB    . ILE B 1 300 ? -14.601 80.317  23.799  1.00 14.42 ? 300  ILE B CB    1 
ATOM   7243  C CG1   . ILE B 1 300 ? -13.445 81.339  23.821  1.00 12.90 ? 300  ILE B CG1   1 
ATOM   7244  C CG2   . ILE B 1 300 ? -14.465 79.353  22.613  1.00 14.01 ? 300  ILE B CG2   1 
ATOM   7245  C CD1   . ILE B 1 300 ? -13.400 82.295  22.677  1.00 10.18 ? 300  ILE B CD1   1 
ATOM   7246  N N     . TYR B 1 301 ? -17.913 79.740  23.093  1.00 13.78 ? 301  TYR B N     1 
ATOM   7247  C CA    . TYR B 1 301 ? -19.087 78.916  23.323  1.00 13.36 ? 301  TYR B CA    1 
ATOM   7248  C C     . TYR B 1 301 ? -19.011 77.676  22.444  1.00 13.41 ? 301  TYR B C     1 
ATOM   7249  O O     . TYR B 1 301 ? -18.638 77.752  21.281  1.00 14.03 ? 301  TYR B O     1 
ATOM   7250  C CB    . TYR B 1 301 ? -20.346 79.723  23.014  1.00 13.03 ? 301  TYR B CB    1 
ATOM   7251  C CG    . TYR B 1 301 ? -21.578 78.875  22.824  1.00 12.36 ? 301  TYR B CG    1 
ATOM   7252  C CD1   . TYR B 1 301 ? -21.976 78.472  21.547  1.00 10.84 ? 301  TYR B CD1   1 
ATOM   7253  C CD2   . TYR B 1 301 ? -22.351 78.478  23.922  1.00 11.39 ? 301  TYR B CD2   1 
ATOM   7254  C CE1   . TYR B 1 301 ? -23.122 77.694  21.378  1.00 13.35 ? 301  TYR B CE1   1 
ATOM   7255  C CE2   . TYR B 1 301 ? -23.499 77.692  23.770  1.00 11.11 ? 301  TYR B CE2   1 
ATOM   7256  C CZ    . TYR B 1 301 ? -23.877 77.302  22.495  1.00 12.94 ? 301  TYR B CZ    1 
ATOM   7257  O OH    . TYR B 1 301 ? -24.993 76.541  22.320  1.00 11.62 ? 301  TYR B OH    1 
ATOM   7258  N N     . TRP B 1 302 ? -19.355 76.524  22.996  1.00 13.33 ? 302  TRP B N     1 
ATOM   7259  C CA    . TRP B 1 302 ? -19.312 75.313  22.211  1.00 12.75 ? 302  TRP B CA    1 
ATOM   7260  C C     . TRP B 1 302 ? -20.517 74.441  22.449  1.00 13.36 ? 302  TRP B C     1 
ATOM   7261  O O     . TRP B 1 302 ? -20.708 73.889  23.549  1.00 12.91 ? 302  TRP B O     1 
ATOM   7262  C CB    . TRP B 1 302 ? -18.036 74.535  22.469  1.00 11.83 ? 302  TRP B CB    1 
ATOM   7263  C CG    . TRP B 1 302 ? -17.944 73.287  21.631  1.00 11.77 ? 302  TRP B CG    1 
ATOM   7264  C CD1   . TRP B 1 302 ? -18.571 73.039  20.426  1.00 10.18 ? 302  TRP B CD1   1 
ATOM   7265  C CD2   . TRP B 1 302 ? -17.167 72.117  21.924  1.00 10.92 ? 302  TRP B CD2   1 
ATOM   7266  N NE1   . TRP B 1 302 ? -18.229 71.790  19.968  1.00 9.46  ? 302  TRP B NE1   1 
ATOM   7267  C CE2   . TRP B 1 302 ? -17.365 71.207  20.861  1.00 10.11 ? 302  TRP B CE2   1 
ATOM   7268  C CE3   . TRP B 1 302 ? -16.326 71.746  22.990  1.00 10.57 ? 302  TRP B CE3   1 
ATOM   7269  C CZ2   . TRP B 1 302 ? -16.755 69.951  20.836  1.00 11.21 ? 302  TRP B CZ2   1 
ATOM   7270  C CZ3   . TRP B 1 302 ? -15.717 70.501  22.965  1.00 10.15 ? 302  TRP B CZ3   1 
ATOM   7271  C CH2   . TRP B 1 302 ? -15.932 69.617  21.900  1.00 10.79 ? 302  TRP B CH2   1 
ATOM   7272  N N     . CYS B 1 303 ? -21.313 74.330  21.383  1.00 13.92 ? 303  CYS B N     1 
ATOM   7273  C CA    . CYS B 1 303 ? -22.409 73.380  21.264  1.00 13.76 ? 303  CYS B CA    1 
ATOM   7274  C C     . CYS B 1 303 ? -21.987 72.167  20.442  1.00 13.40 ? 303  CYS B C     1 
ATOM   7275  O O     . CYS B 1 303 ? -21.516 72.343  19.326  1.00 14.13 ? 303  CYS B O     1 
ATOM   7276  C CB    . CYS B 1 303 ? -23.534 74.077  20.543  1.00 14.01 ? 303  CYS B CB    1 
ATOM   7277  S SG    . CYS B 1 303 ? -24.879 72.970  20.119  1.00 14.90 ? 303  CYS B SG    1 
ATOM   7278  N N     . THR B 1 304 ? -22.146 70.947  20.947  1.00 13.13 ? 304  THR B N     1 
ATOM   7279  C CA    . THR B 1 304 ? -21.654 69.772  20.184  1.00 14.32 ? 304  THR B CA    1 
ATOM   7280  C C     . THR B 1 304 ? -22.639 69.163  19.164  1.00 14.96 ? 304  THR B C     1 
ATOM   7281  O O     . THR B 1 304 ? -22.257 68.309  18.362  1.00 15.03 ? 304  THR B O     1 
ATOM   7282  C CB    . THR B 1 304 ? -21.169 68.577  21.074  1.00 14.77 ? 304  THR B CB    1 
ATOM   7283  O OG1   . THR B 1 304 ? -22.269 68.091  21.865  1.00 14.37 ? 304  THR B OG1   1 
ATOM   7284  C CG2   . THR B 1 304 ? -19.976 68.972  21.968  1.00 14.26 ? 304  THR B CG2   1 
ATOM   7285  N N     . ALA B 1 305 ? -23.900 69.581  19.202  1.00 15.65 ? 305  ALA B N     1 
ATOM   7286  C CA    . ALA B 1 305 ? -24.906 68.984  18.337  1.00 15.57 ? 305  ALA B CA    1 
ATOM   7287  C C     . ALA B 1 305 ? -24.615 69.268  16.858  1.00 15.49 ? 305  ALA B C     1 
ATOM   7288  O O     . ALA B 1 305 ? -24.131 70.354  16.495  1.00 15.69 ? 305  ALA B O     1 
ATOM   7289  C CB    . ALA B 1 305 ? -26.258 69.476  18.709  1.00 15.53 ? 305  ALA B CB    1 
ATOM   7290  N N     . ASP B 1 306 ? -24.937 68.281  16.019  1.00 14.83 ? 306  ASP B N     1 
ATOM   7291  C CA    . ASP B 1 306 ? -24.724 68.351  14.585  1.00 13.58 ? 306  ASP B CA    1 
ATOM   7292  C C     . ASP B 1 306 ? -25.598 69.422  13.918  1.00 13.64 ? 306  ASP B C     1 
ATOM   7293  O O     . ASP B 1 306 ? -26.773 69.624  14.255  1.00 13.58 ? 306  ASP B O     1 
ATOM   7294  C CB    . ASP B 1 306 ? -24.947 66.968  13.968  1.00 13.12 ? 306  ASP B CB    1 
ATOM   7295  C CG    . ASP B 1 306 ? -24.412 66.869  12.535  1.00 14.66 ? 306  ASP B CG    1 
ATOM   7296  O OD1   . ASP B 1 306 ? -25.065 67.402  11.607  1.00 16.48 ? 306  ASP B OD1   1 
ATOM   7297  O OD2   . ASP B 1 306 ? -23.336 66.265  12.314  1.00 15.60 ? 306  ASP B OD2   1 
ATOM   7298  N N     . VAL B 1 307 ? -25.015 70.115  12.957  1.00 13.49 ? 307  VAL B N     1 
ATOM   7299  C CA    . VAL B 1 307 ? -25.742 71.102  12.183  1.00 13.46 ? 307  VAL B CA    1 
ATOM   7300  C C     . VAL B 1 307 ? -26.997 70.491  11.553  1.00 14.39 ? 307  VAL B C     1 
ATOM   7301  O O     . VAL B 1 307 ? -27.913 71.214  11.204  1.00 14.98 ? 307  VAL B O     1 
ATOM   7302  C CB    . VAL B 1 307 ? -24.814 71.781  11.128  1.00 13.03 ? 307  VAL B CB    1 
ATOM   7303  C CG1   . VAL B 1 307 ? -24.374 70.788  10.035  1.00 14.37 ? 307  VAL B CG1   1 
ATOM   7304  C CG2   . VAL B 1 307 ? -25.477 72.974  10.525  1.00 11.51 ? 307  VAL B CG2   1 
ATOM   7305  N N     . GLY B 1 308 ? -27.056 69.157  11.449  1.00 14.84 ? 308  GLY B N     1 
ATOM   7306  C CA    . GLY B 1 308 ? -28.230 68.447  10.892  1.00 14.73 ? 308  GLY B CA    1 
ATOM   7307  C C     . GLY B 1 308 ? -29.497 68.382  11.733  1.00 15.10 ? 308  GLY B C     1 
ATOM   7308  O O     . GLY B 1 308 ? -30.558 67.967  11.250  1.00 15.00 ? 308  GLY B O     1 
ATOM   7309  N N     . TRP B 1 309 ? -29.385 68.748  13.007  1.00 15.36 ? 309  TRP B N     1 
ATOM   7310  C CA    . TRP B 1 309 ? -30.522 68.779  13.917  1.00 14.94 ? 309  TRP B CA    1 
ATOM   7311  C C     . TRP B 1 309 ? -30.814 70.213  14.325  1.00 15.35 ? 309  TRP B C     1 
ATOM   7312  O O     . TRP B 1 309 ? -29.971 71.113  14.179  1.00 15.32 ? 309  TRP B O     1 
ATOM   7313  C CB    . TRP B 1 309 ? -30.232 67.953  15.153  1.00 14.55 ? 309  TRP B CB    1 
ATOM   7314  C CG    . TRP B 1 309 ? -29.724 66.607  14.810  1.00 16.08 ? 309  TRP B CG    1 
ATOM   7315  C CD1   . TRP B 1 309 ? -28.494 66.100  15.104  1.00 17.00 ? 309  TRP B CD1   1 
ATOM   7316  C CD2   . TRP B 1 309 ? -30.405 65.590  14.064  1.00 16.36 ? 309  TRP B CD2   1 
ATOM   7317  N NE1   . TRP B 1 309 ? -28.366 64.828  14.598  1.00 16.84 ? 309  TRP B NE1   1 
ATOM   7318  C CE2   . TRP B 1 309 ? -29.522 64.492  13.952  1.00 15.66 ? 309  TRP B CE2   1 
ATOM   7319  C CE3   . TRP B 1 309 ? -31.683 65.491  13.494  1.00 17.52 ? 309  TRP B CE3   1 
ATOM   7320  C CZ2   . TRP B 1 309 ? -29.874 63.307  13.314  1.00 15.38 ? 309  TRP B CZ2   1 
ATOM   7321  C CZ3   . TRP B 1 309 ? -32.030 64.311  12.837  1.00 17.27 ? 309  TRP B CZ3   1 
ATOM   7322  C CH2   . TRP B 1 309 ? -31.120 63.236  12.750  1.00 16.22 ? 309  TRP B CH2   1 
ATOM   7323  N N     . VAL B 1 310 ? -32.010 70.411  14.862  1.00 15.47 ? 310  VAL B N     1 
ATOM   7324  C CA    . VAL B 1 310 ? -32.442 71.718  15.322  1.00 15.11 ? 310  VAL B CA    1 
ATOM   7325  C C     . VAL B 1 310 ? -31.484 72.353  16.349  1.00 15.05 ? 310  VAL B C     1 
ATOM   7326  O O     . VAL B 1 310 ? -31.271 73.562  16.313  1.00 14.86 ? 310  VAL B O     1 
ATOM   7327  C CB    . VAL B 1 310 ? -33.889 71.654  15.847  1.00 15.05 ? 310  VAL B CB    1 
ATOM   7328  C CG1   . VAL B 1 310 ? -33.971 70.820  17.156  1.00 15.13 ? 310  VAL B CG1   1 
ATOM   7329  C CG2   . VAL B 1 310 ? -34.477 73.063  15.987  1.00 14.87 ? 310  VAL B CG2   1 
ATOM   7330  N N     . THR B 1 311 ? -30.891 71.545  17.231  1.00 15.22 ? 311  THR B N     1 
ATOM   7331  C CA    . THR B 1 311 ? -29.985 72.082  18.234  1.00 15.15 ? 311  THR B CA    1 
ATOM   7332  C C     . THR B 1 311 ? -28.860 72.773  17.517  1.00 15.49 ? 311  THR B C     1 
ATOM   7333  O O     . THR B 1 311 ? -28.353 73.814  17.978  1.00 14.65 ? 311  THR B O     1 
ATOM   7334  C CB    . THR B 1 311 ? -29.394 71.001  19.124  1.00 15.86 ? 311  THR B CB    1 
ATOM   7335  O OG1   . THR B 1 311 ? -30.460 70.277  19.756  1.00 15.06 ? 311  THR B OG1   1 
ATOM   7336  C CG2   . THR B 1 311 ? -28.466 71.629  20.195  1.00 14.88 ? 311  THR B CG2   1 
ATOM   7337  N N     . GLY B 1 312 ? -28.519 72.206  16.356  1.00 15.53 ? 312  GLY B N     1 
ATOM   7338  C CA    . GLY B 1 312 ? -27.463 72.732  15.505  1.00 15.84 ? 312  GLY B CA    1 
ATOM   7339  C C     . GLY B 1 312 ? -27.850 74.029  14.816  1.00 16.27 ? 312  GLY B C     1 
ATOM   7340  O O     . GLY B 1 312 ? -27.037 74.970  14.772  1.00 17.15 ? 312  GLY B O     1 
ATOM   7341  N N     . HIS B 1 313 ? -29.079 74.089  14.286  1.00 15.32 ? 313  HIS B N     1 
ATOM   7342  C CA    . HIS B 1 313 ? -29.587 75.313  13.681  1.00 14.86 ? 313  HIS B CA    1 
ATOM   7343  C C     . HIS B 1 313 ? -29.641 76.393  14.747  1.00 14.67 ? 313  HIS B C     1 
ATOM   7344  O O     . HIS B 1 313 ? -28.995 77.430  14.606  1.00 14.96 ? 313  HIS B O     1 
ATOM   7345  C CB    . HIS B 1 313 ? -30.979 75.130  13.077  1.00 14.52 ? 313  HIS B CB    1 
ATOM   7346  C CG    . HIS B 1 313 ? -31.038 74.202  11.899  1.00 14.33 ? 313  HIS B CG    1 
ATOM   7347  N ND1   . HIS B 1 313 ? -30.277 73.058  11.800  1.00 12.55 ? 313  HIS B ND1   1 
ATOM   7348  C CD2   . HIS B 1 313 ? -31.838 74.212  10.804  1.00 15.28 ? 313  HIS B CD2   1 
ATOM   7349  C CE1   . HIS B 1 313 ? -30.582 72.422  10.684  1.00 13.49 ? 313  HIS B CE1   1 
ATOM   7350  N NE2   . HIS B 1 313 ? -31.525 73.101  10.059  1.00 13.95 ? 313  HIS B NE2   1 
ATOM   7351  N N     . SER B 1 314 ? -30.363 76.124  15.834  1.00 14.10 ? 314  SER B N     1 
ATOM   7352  C CA    . SER B 1 314 ? -30.638 77.157  16.842  1.00 13.75 ? 314  SER B CA    1 
ATOM   7353  C C     . SER B 1 314 ? -29.442 77.589  17.675  1.00 13.84 ? 314  SER B C     1 
ATOM   7354  O O     . SER B 1 314 ? -29.230 78.786  17.834  1.00 13.32 ? 314  SER B O     1 
ATOM   7355  C CB    . SER B 1 314 ? -31.790 76.746  17.755  1.00 13.12 ? 314  SER B CB    1 
ATOM   7356  O OG    . SER B 1 314 ? -32.966 76.602  16.988  1.00 12.07 ? 314  SER B OG    1 
ATOM   7357  N N     . TYR B 1 315 ? -28.662 76.613  18.173  1.00 13.77 ? 315  TYR B N     1 
ATOM   7358  C CA    . TYR B 1 315 ? -27.621 76.869  19.175  1.00 13.25 ? 315  TYR B CA    1 
ATOM   7359  C C     . TYR B 1 315 ? -26.161 76.554  18.791  1.00 14.21 ? 315  TYR B C     1 
ATOM   7360  O O     . TYR B 1 315 ? -25.239 76.982  19.482  1.00 14.37 ? 315  TYR B O     1 
ATOM   7361  C CB    . TYR B 1 315 ? -28.002 76.226  20.511  1.00 12.38 ? 315  TYR B CB    1 
ATOM   7362  C CG    . TYR B 1 315 ? -29.352 76.698  20.987  1.00 11.65 ? 315  TYR B CG    1 
ATOM   7363  C CD1   . TYR B 1 315 ? -30.463 75.847  20.953  1.00 9.58  ? 315  TYR B CD1   1 
ATOM   7364  C CD2   . TYR B 1 315 ? -29.530 78.015  21.450  1.00 9.70  ? 315  TYR B CD2   1 
ATOM   7365  C CE1   . TYR B 1 315 ? -31.707 76.288  21.366  1.00 10.16 ? 315  TYR B CE1   1 
ATOM   7366  C CE2   . TYR B 1 315 ? -30.760 78.464  21.856  1.00 9.24  ? 315  TYR B CE2   1 
ATOM   7367  C CZ    . TYR B 1 315 ? -31.849 77.599  21.809  1.00 10.97 ? 315  TYR B CZ    1 
ATOM   7368  O OH    . TYR B 1 315 ? -33.074 78.037  22.230  1.00 11.48 ? 315  TYR B OH    1 
ATOM   7369  N N     . LEU B 1 316 ? -25.929 75.841  17.697  1.00 15.27 ? 316  LEU B N     1 
ATOM   7370  C CA    . LEU B 1 316 ? -24.589 75.888  17.105  1.00 16.22 ? 316  LEU B CA    1 
ATOM   7371  C C     . LEU B 1 316 ? -24.405 77.246  16.409  1.00 16.32 ? 316  LEU B C     1 
ATOM   7372  O O     . LEU B 1 316 ? -23.393 77.921  16.578  1.00 16.15 ? 316  LEU B O     1 
ATOM   7373  C CB    . LEU B 1 316 ? -24.337 74.739  16.117  1.00 15.67 ? 316  LEU B CB    1 
ATOM   7374  C CG    . LEU B 1 316 ? -22.955 74.668  15.455  1.00 15.71 ? 316  LEU B CG    1 
ATOM   7375  C CD1   . LEU B 1 316 ? -21.981 74.052  16.423  1.00 17.15 ? 316  LEU B CD1   1 
ATOM   7376  C CD2   . LEU B 1 316 ? -23.002 73.799  14.167  1.00 16.86 ? 316  LEU B CD2   1 
ATOM   7377  N N     . LEU B 1 317 ? -25.441 77.653  15.692  1.00 16.75 ? 317  LEU B N     1 
ATOM   7378  C CA    . LEU B 1 317 ? -25.312 78.642  14.651  1.00 17.13 ? 317  LEU B CA    1 
ATOM   7379  C C     . LEU B 1 317 ? -26.149 79.914  14.830  1.00 16.25 ? 317  LEU B C     1 
ATOM   7380  O O     . LEU B 1 317 ? -25.601 80.981  15.098  1.00 16.57 ? 317  LEU B O     1 
ATOM   7381  C CB    . LEU B 1 317 ? -25.655 77.969  13.321  1.00 17.91 ? 317  LEU B CB    1 
ATOM   7382  C CG    . LEU B 1 317 ? -24.638 78.239  12.229  1.00 20.50 ? 317  LEU B CG    1 
ATOM   7383  C CD1   . LEU B 1 317 ? -23.404 77.345  12.417  1.00 21.82 ? 317  LEU B CD1   1 
ATOM   7384  C CD2   . LEU B 1 317 ? -25.291 78.015  10.901  1.00 23.18 ? 317  LEU B CD2   1 
ATOM   7385  N N     . TYR B 1 318 ? -27.462 79.822  14.663  1.00 15.43 ? 318  TYR B N     1 
ATOM   7386  C CA    . TYR B 1 318 ? -28.286 81.051  14.578  1.00 14.87 ? 318  TYR B CA    1 
ATOM   7387  C C     . TYR B 1 318 ? -28.286 81.939  15.828  1.00 15.18 ? 318  TYR B C     1 
ATOM   7388  O O     . TYR B 1 318 ? -27.954 83.136  15.749  1.00 14.99 ? 318  TYR B O     1 
ATOM   7389  C CB    . TYR B 1 318 ? -29.692 80.759  14.074  1.00 13.56 ? 318  TYR B CB    1 
ATOM   7390  C CG    . TYR B 1 318 ? -29.682 80.310  12.638  1.00 12.74 ? 318  TYR B CG    1 
ATOM   7391  C CD1   . TYR B 1 318 ? -28.858 80.924  11.705  1.00 12.13 ? 318  TYR B CD1   1 
ATOM   7392  C CD2   . TYR B 1 318 ? -30.488 79.262  12.208  1.00 10.95 ? 318  TYR B CD2   1 
ATOM   7393  C CE1   . TYR B 1 318 ? -28.853 80.501  10.362  1.00 11.49 ? 318  TYR B CE1   1 
ATOM   7394  C CE2   . TYR B 1 318 ? -30.495 78.848  10.895  1.00 8.31  ? 318  TYR B CE2   1 
ATOM   7395  C CZ    . TYR B 1 318 ? -29.678 79.467  9.974   1.00 11.09 ? 318  TYR B CZ    1 
ATOM   7396  O OH    . TYR B 1 318 ? -29.691 79.049  8.652   1.00 12.22 ? 318  TYR B OH    1 
ATOM   7397  N N     . GLY B 1 319 ? -28.621 81.344  16.970  1.00 15.24 ? 319  GLY B N     1 
ATOM   7398  C CA    . GLY B 1 319 ? -28.559 82.025  18.255  1.00 15.36 ? 319  GLY B CA    1 
ATOM   7399  C C     . GLY B 1 319 ? -27.253 82.729  18.600  1.00 15.86 ? 319  GLY B C     1 
ATOM   7400  O O     . GLY B 1 319 ? -27.269 83.955  18.825  1.00 16.79 ? 319  GLY B O     1 
ATOM   7401  N N     . PRO B 1 320 ? -26.137 81.968  18.738  1.00 15.41 ? 320  PRO B N     1 
ATOM   7402  C CA    . PRO B 1 320 ? -24.820 82.585  18.916  1.00 14.94 ? 320  PRO B CA    1 
ATOM   7403  C C     . PRO B 1 320 ? -24.496 83.699  17.925  1.00 14.72 ? 320  PRO B C     1 
ATOM   7404  O O     . PRO B 1 320 ? -24.156 84.796  18.353  1.00 15.00 ? 320  PRO B O     1 
ATOM   7405  C CB    . PRO B 1 320 ? -23.826 81.421  18.770  1.00 14.35 ? 320  PRO B CB    1 
ATOM   7406  C CG    . PRO B 1 320 ? -24.623 80.191  18.592  1.00 14.95 ? 320  PRO B CG    1 
ATOM   7407  C CD    . PRO B 1 320 ? -26.068 80.499  18.852  1.00 15.56 ? 320  PRO B CD    1 
ATOM   7408  N N     . LEU B 1 321 ? -24.610 83.449  16.626  1.00 14.75 ? 321  LEU B N     1 
ATOM   7409  C CA    . LEU B 1 321 ? -24.132 84.435  15.643  1.00 14.86 ? 321  LEU B CA    1 
ATOM   7410  C C     . LEU B 1 321 ? -24.976 85.699  15.720  1.00 15.34 ? 321  LEU B C     1 
ATOM   7411  O O     . LEU B 1 321 ? -24.451 86.820  15.661  1.00 15.78 ? 321  LEU B O     1 
ATOM   7412  C CB    . LEU B 1 321 ? -24.097 83.861  14.223  1.00 14.75 ? 321  LEU B CB    1 
ATOM   7413  C CG    . LEU B 1 321 ? -23.095 82.728  13.976  1.00 15.87 ? 321  LEU B CG    1 
ATOM   7414  C CD1   . LEU B 1 321 ? -23.183 82.091  12.571  1.00 13.79 ? 321  LEU B CD1   1 
ATOM   7415  C CD2   . LEU B 1 321 ? -21.667 83.215  14.267  1.00 16.79 ? 321  LEU B CD2   1 
ATOM   7416  N N     . ALA B 1 322 ? -26.279 85.515  15.912  1.00 15.50 ? 322  ALA B N     1 
ATOM   7417  C CA    . ALA B 1 322 ? -27.181 86.623  16.188  1.00 15.66 ? 322  ALA B CA    1 
ATOM   7418  C C     . ALA B 1 322 ? -26.719 87.450  17.375  1.00 15.96 ? 322  ALA B C     1 
ATOM   7419  O O     . ALA B 1 322 ? -26.984 88.654  17.408  1.00 15.88 ? 322  ALA B O     1 
ATOM   7420  C CB    . ALA B 1 322 ? -28.573 86.118  16.445  1.00 15.99 ? 322  ALA B CB    1 
ATOM   7421  N N     . CYS B 1 323 ? -26.062 86.816  18.355  1.00 15.51 ? 323  CYS B N     1 
ATOM   7422  C CA    . CYS B 1 323 ? -25.644 87.538  19.553  1.00 16.00 ? 323  CYS B CA    1 
ATOM   7423  C C     . CYS B 1 323 ? -24.205 88.015  19.478  1.00 15.76 ? 323  CYS B C     1 
ATOM   7424  O O     . CYS B 1 323 ? -23.643 88.464  20.477  1.00 16.53 ? 323  CYS B O     1 
ATOM   7425  C CB    . CYS B 1 323 ? -25.861 86.708  20.829  1.00 16.23 ? 323  CYS B CB    1 
ATOM   7426  S SG    . CYS B 1 323 ? -27.613 86.531  21.369  1.00 18.37 ? 323  CYS B SG    1 
ATOM   7427  N N     . GLY B 1 324 ? -23.604 87.930  18.300  1.00 15.39 ? 324  GLY B N     1 
ATOM   7428  C CA    . GLY B 1 324 ? -22.207 88.308  18.155  1.00 14.46 ? 324  GLY B CA    1 
ATOM   7429  C C     . GLY B 1 324 ? -21.217 87.391  18.850  1.00 14.05 ? 324  GLY B C     1 
ATOM   7430  O O     . GLY B 1 324 ? -20.098 87.801  19.088  1.00 14.73 ? 324  GLY B O     1 
ATOM   7431  N N     . ALA B 1 325 ? -21.606 86.154  19.164  1.00 13.47 ? 325  ALA B N     1 
ATOM   7432  C CA    . ALA B 1 325 ? -20.734 85.206  19.879  1.00 13.15 ? 325  ALA B CA    1 
ATOM   7433  C C     . ALA B 1 325 ? -19.667 84.541  19.022  1.00 13.29 ? 325  ALA B C     1 
ATOM   7434  O O     . ALA B 1 325 ? -19.722 84.600  17.781  1.00 13.40 ? 325  ALA B O     1 
ATOM   7435  C CB    . ALA B 1 325 ? -21.572 84.131  20.554  1.00 13.13 ? 325  ALA B CB    1 
ATOM   7436  N N     . THR B 1 326 ? -18.692 83.911  19.694  1.00 13.58 ? 326  THR B N     1 
ATOM   7437  C CA    . THR B 1 326 ? -17.752 82.985  19.041  1.00 12.90 ? 326  THR B CA    1 
ATOM   7438  C C     . THR B 1 326 ? -18.282 81.601  19.337  1.00 13.09 ? 326  THR B C     1 
ATOM   7439  O O     . THR B 1 326 ? -18.339 81.193  20.506  1.00 12.72 ? 326  THR B O     1 
ATOM   7440  C CB    . THR B 1 326 ? -16.306 83.128  19.563  1.00 12.86 ? 326  THR B CB    1 
ATOM   7441  O OG1   . THR B 1 326 ? -15.842 84.445  19.285  1.00 11.56 ? 326  THR B OG1   1 
ATOM   7442  C CG2   . THR B 1 326 ? -15.340 82.117  18.880  1.00 11.87 ? 326  THR B CG2   1 
ATOM   7443  N N     . THR B 1 327 ? -18.716 80.916  18.281  1.00 12.92 ? 327  THR B N     1 
ATOM   7444  C CA    . THR B 1 327 ? -19.265 79.586  18.412  1.00 13.42 ? 327  THR B CA    1 
ATOM   7445  C C     . THR B 1 327 ? -18.275 78.563  17.851  1.00 13.86 ? 327  THR B C     1 
ATOM   7446  O O     . THR B 1 327 ? -17.610 78.834  16.826  1.00 13.46 ? 327  THR B O     1 
ATOM   7447  C CB    . THR B 1 327 ? -20.660 79.470  17.745  1.00 13.36 ? 327  THR B CB    1 
ATOM   7448  O OG1   . THR B 1 327 ? -21.267 78.244  18.144  1.00 14.18 ? 327  THR B OG1   1 
ATOM   7449  C CG2   . THR B 1 327 ? -20.589 79.498  16.215  1.00 12.34 ? 327  THR B CG2   1 
ATOM   7450  N N     . LEU B 1 328 ? -18.174 77.400  18.508  1.00 13.94 ? 328  LEU B N     1 
ATOM   7451  C CA    . LEU B 1 328 ? -17.197 76.388  18.092  1.00 14.76 ? 328  LEU B CA    1 
ATOM   7452  C C     . LEU B 1 328 ? -17.842 75.276  17.272  1.00 15.91 ? 328  LEU B C     1 
ATOM   7453  O O     . LEU B 1 328 ? -18.838 74.705  17.702  1.00 16.73 ? 328  LEU B O     1 
ATOM   7454  C CB    . LEU B 1 328 ? -16.460 75.798  19.293  1.00 14.13 ? 328  LEU B CB    1 
ATOM   7455  C CG    . LEU B 1 328 ? -15.131 75.074  18.980  1.00 13.96 ? 328  LEU B CG    1 
ATOM   7456  C CD1   . LEU B 1 328 ? -14.252 75.010  20.223  1.00 11.61 ? 328  LEU B CD1   1 
ATOM   7457  C CD2   . LEU B 1 328 ? -15.296 73.671  18.366  1.00 9.89  ? 328  LEU B CD2   1 
ATOM   7458  N N     . MET B 1 329 ? -17.279 74.972  16.099  1.00 16.71 ? 329  MET B N     1 
ATOM   7459  C CA    . MET B 1 329 ? -17.761 73.874  15.263  1.00 17.84 ? 329  MET B CA    1 
ATOM   7460  C C     . MET B 1 329 ? -16.731 72.758  15.183  1.00 17.46 ? 329  MET B C     1 
ATOM   7461  O O     . MET B 1 329 ? -15.635 72.950  14.637  1.00 17.71 ? 329  MET B O     1 
ATOM   7462  C CB    . MET B 1 329 ? -18.121 74.347  13.842  1.00 17.82 ? 329  MET B CB    1 
ATOM   7463  C CG    . MET B 1 329 ? -18.632 73.185  12.989  1.00 18.66 ? 329  MET B CG    1 
ATOM   7464  S SD    . MET B 1 329 ? -19.222 73.486  11.306  1.00 21.34 ? 329  MET B SD    1 
ATOM   7465  C CE    . MET B 1 329 ? -20.701 74.458  11.552  1.00 17.25 ? 329  MET B CE    1 
ATOM   7466  N N     . PHE B 1 330 ? -17.092 71.595  15.724  1.00 16.91 ? 330  PHE B N     1 
ATOM   7467  C CA    . PHE B 1 330 ? -16.182 70.457  15.826  1.00 16.07 ? 330  PHE B CA    1 
ATOM   7468  C C     . PHE B 1 330 ? -16.571 69.425  14.799  1.00 16.43 ? 330  PHE B C     1 
ATOM   7469  O O     . PHE B 1 330 ? -17.726 69.000  14.742  1.00 15.94 ? 330  PHE B O     1 
ATOM   7470  C CB    . PHE B 1 330 ? -16.295 69.842  17.222  1.00 15.85 ? 330  PHE B CB    1 
ATOM   7471  C CG    . PHE B 1 330 ? -15.469 68.595  17.435  1.00 14.85 ? 330  PHE B CG    1 
ATOM   7472  C CD1   . PHE B 1 330 ? -14.117 68.540  17.054  1.00 15.33 ? 330  PHE B CD1   1 
ATOM   7473  C CD2   . PHE B 1 330 ? -16.022 67.493  18.079  1.00 12.89 ? 330  PHE B CD2   1 
ATOM   7474  C CE1   . PHE B 1 330 ? -13.334 67.381  17.290  1.00 14.28 ? 330  PHE B CE1   1 
ATOM   7475  C CE2   . PHE B 1 330 ? -15.253 66.346  18.341  1.00 12.96 ? 330  PHE B CE2   1 
ATOM   7476  C CZ    . PHE B 1 330 ? -13.909 66.280  17.934  1.00 14.45 ? 330  PHE B CZ    1 
ATOM   7477  N N     . GLU B 1 331 ? -15.593 69.007  13.998  1.00 16.95 ? 331  GLU B N     1 
ATOM   7478  C CA    . GLU B 1 331 ? -15.817 68.074  12.898  1.00 16.70 ? 331  GLU B CA    1 
ATOM   7479  C C     . GLU B 1 331 ? -16.068 66.634  13.361  1.00 16.55 ? 331  GLU B C     1 
ATOM   7480  O O     . GLU B 1 331 ? -16.688 65.864  12.637  1.00 16.61 ? 331  GLU B O     1 
ATOM   7481  C CB    . GLU B 1 331 ? -14.617 68.104  11.964  1.00 16.66 ? 331  GLU B CB    1 
ATOM   7482  C CG    . GLU B 1 331 ? -14.834 67.369  10.647  1.00 17.74 ? 331  GLU B CG    1 
ATOM   7483  C CD    . GLU B 1 331 ? -13.584 67.304  9.791   1.00 17.39 ? 331  GLU B CD    1 
ATOM   7484  O OE1   . GLU B 1 331 ? -12.474 67.245  10.366  1.00 17.35 ? 331  GLU B OE1   1 
ATOM   7485  O OE2   . GLU B 1 331 ? -13.714 67.292  8.545   1.00 17.88 ? 331  GLU B OE2   1 
ATOM   7486  N N     . GLY B 1 332 ? -15.587 66.281  14.556  1.00 16.34 ? 332  GLY B N     1 
ATOM   7487  C CA    . GLY B 1 332 ? -15.479 64.884  14.966  1.00 15.70 ? 332  GLY B CA    1 
ATOM   7488  C C     . GLY B 1 332 ? -16.386 64.415  16.070  1.00 15.69 ? 332  GLY B C     1 
ATOM   7489  O O     . GLY B 1 332 ? -17.486 64.913  16.217  1.00 16.27 ? 332  GLY B O     1 
ATOM   7490  N N     . VAL B 1 333 ? -15.930 63.436  16.843  1.00 16.10 ? 333  VAL B N     1 
ATOM   7491  C CA    . VAL B 1 333 ? -16.730 62.868  17.943  1.00 16.33 ? 333  VAL B CA    1 
ATOM   7492  C C     . VAL B 1 333 ? -16.070 63.172  19.300  1.00 16.38 ? 333  VAL B C     1 
ATOM   7493  O O     . VAL B 1 333 ? -14.836 63.254  19.392  1.00 16.63 ? 333  VAL B O     1 
ATOM   7494  C CB    . VAL B 1 333 ? -16.929 61.349  17.766  1.00 16.78 ? 333  VAL B CB    1 
ATOM   7495  C CG1   . VAL B 1 333 ? -17.309 61.038  16.359  1.00 18.22 ? 333  VAL B CG1   1 
ATOM   7496  C CG2   . VAL B 1 333 ? -15.656 60.614  18.045  1.00 16.39 ? 333  VAL B CG2   1 
ATOM   7497  N N     . PRO B 1 334 ? -16.868 63.350  20.362  1.00 16.07 ? 334  PRO B N     1 
ATOM   7498  C CA    . PRO B 1 334 ? -16.261 63.740  21.648  1.00 16.12 ? 334  PRO B CA    1 
ATOM   7499  C C     . PRO B 1 334 ? -15.219 62.788  22.218  1.00 15.52 ? 334  PRO B C     1 
ATOM   7500  O O     . PRO B 1 334 ? -14.539 63.148  23.172  1.00 15.53 ? 334  PRO B O     1 
ATOM   7501  C CB    . PRO B 1 334 ? -17.456 63.805  22.604  1.00 16.62 ? 334  PRO B CB    1 
ATOM   7502  C CG    . PRO B 1 334 ? -18.498 62.959  21.965  1.00 16.93 ? 334  PRO B CG    1 
ATOM   7503  C CD    . PRO B 1 334 ? -18.320 63.226  20.479  1.00 16.35 ? 334  PRO B CD    1 
ATOM   7504  N N     . ASN B 1 335 ? -15.076 61.595  21.644  1.00 15.07 ? 335  ASN B N     1 
ATOM   7505  C CA    . ASN B 1 335 ? -14.182 60.607  22.251  1.00 14.92 ? 335  ASN B CA    1 
ATOM   7506  C C     . ASN B 1 335 ? -13.200 59.925  21.310  1.00 14.30 ? 335  ASN B C     1 
ATOM   7507  O O     . ASN B 1 335 ? -12.854 58.774  21.508  1.00 14.12 ? 335  ASN B O     1 
ATOM   7508  C CB    . ASN B 1 335 ? -14.972 59.570  23.060  1.00 14.83 ? 335  ASN B CB    1 
ATOM   7509  C CG    . ASN B 1 335 ? -15.846 58.671  22.190  1.00 16.24 ? 335  ASN B CG    1 
ATOM   7510  O OD1   . ASN B 1 335 ? -16.398 57.686  22.680  1.00 19.94 ? 335  ASN B OD1   1 
ATOM   7511  N ND2   . ASN B 1 335 ? -16.006 59.015  20.920  1.00 16.13 ? 335  ASN B ND2   1 
ATOM   7512  N N     . TRP B 1 336 ? -12.758 60.646  20.290  1.00 13.77 ? 336  TRP B N     1 
ATOM   7513  C CA    . TRP B 1 336 ? -11.814 60.105  19.347  1.00 13.25 ? 336  TRP B CA    1 
ATOM   7514  C C     . TRP B 1 336 ? -10.757 61.170  19.138  1.00 13.25 ? 336  TRP B C     1 
ATOM   7515  O O     . TRP B 1 336 ? -11.100 62.331  18.876  1.00 13.50 ? 336  TRP B O     1 
ATOM   7516  C CB    . TRP B 1 336 ? -12.491 59.718  18.022  1.00 12.66 ? 336  TRP B CB    1 
ATOM   7517  C CG    . TRP B 1 336 ? -11.602 58.792  17.198  1.00 13.67 ? 336  TRP B CG    1 
ATOM   7518  C CD1   . TRP B 1 336 ? -11.563 57.403  17.244  1.00 12.34 ? 336  TRP B CD1   1 
ATOM   7519  C CD2   . TRP B 1 336 ? -10.595 59.188  16.268  1.00 11.96 ? 336  TRP B CD2   1 
ATOM   7520  N NE1   . TRP B 1 336 ? -10.616 56.932  16.379  1.00 12.98 ? 336  TRP B NE1   1 
ATOM   7521  C CE2   . TRP B 1 336 ? -10.005 57.996  15.759  1.00 13.48 ? 336  TRP B CE2   1 
ATOM   7522  C CE3   . TRP B 1 336 ? -10.154 60.431  15.782  1.00 11.32 ? 336  TRP B CE3   1 
ATOM   7523  C CZ2   . TRP B 1 336 ? -8.968  58.012  14.795  1.00 12.46 ? 336  TRP B CZ2   1 
ATOM   7524  C CZ3   . TRP B 1 336 ? -9.129  60.451  14.813  1.00 13.11 ? 336  TRP B CZ3   1 
ATOM   7525  C CH2   . TRP B 1 336 ? -8.535  59.241  14.345  1.00 12.39 ? 336  TRP B CH2   1 
ATOM   7526  N N     . PRO B 1 337 ? -9.477  60.789  19.208  1.00 12.66 ? 337  PRO B N     1 
ATOM   7527  C CA    . PRO B 1 337 ? -8.979  59.412  19.313  1.00 13.12 ? 337  PRO B CA    1 
ATOM   7528  C C     . PRO B 1 337 ? -9.042  58.772  20.690  1.00 13.30 ? 337  PRO B C     1 
ATOM   7529  O O     . PRO B 1 337 ? -8.774  57.576  20.789  1.00 12.97 ? 337  PRO B O     1 
ATOM   7530  C CB    . PRO B 1 337 ? -7.505  59.503  18.846  1.00 12.54 ? 337  PRO B CB    1 
ATOM   7531  C CG    . PRO B 1 337 ? -7.220  60.964  18.567  1.00 12.85 ? 337  PRO B CG    1 
ATOM   7532  C CD    . PRO B 1 337 ? -8.387  61.776  19.126  1.00 13.22 ? 337  PRO B CD    1 
ATOM   7533  N N     . THR B 1 338 ? -9.366  59.559  21.726  1.00 13.73 ? 338  THR B N     1 
ATOM   7534  C CA    . THR B 1 338 ? -9.434  59.082  23.122  1.00 13.67 ? 338  THR B CA    1 
ATOM   7535  C C     . THR B 1 338 ? -10.661 59.641  23.877  1.00 13.76 ? 338  THR B C     1 
ATOM   7536  O O     . THR B 1 338 ? -11.271 60.632  23.467  1.00 13.60 ? 338  THR B O     1 
ATOM   7537  C CB    . THR B 1 338 ? -8.133  59.420  23.976  1.00 14.31 ? 338  THR B CB    1 
ATOM   7538  O OG1   . THR B 1 338 ? -8.086  60.821  24.300  1.00 14.51 ? 338  THR B OG1   1 
ATOM   7539  C CG2   . THR B 1 338 ? -6.802  58.933  23.305  1.00 13.39 ? 338  THR B CG2   1 
ATOM   7540  N N     . PRO B 1 339 ? -11.047 58.987  24.982  1.00 13.39 ? 339  PRO B N     1 
ATOM   7541  C CA    . PRO B 1 339 ? -12.090 59.594  25.805  1.00 13.10 ? 339  PRO B CA    1 
ATOM   7542  C C     . PRO B 1 339 ? -11.871 61.074  26.201  1.00 12.71 ? 339  PRO B C     1 
ATOM   7543  O O     . PRO B 1 339 ? -12.860 61.794  26.438  1.00 12.81 ? 339  PRO B O     1 
ATOM   7544  C CB    . PRO B 1 339 ? -12.144 58.675  27.030  1.00 12.69 ? 339  PRO B CB    1 
ATOM   7545  C CG    . PRO B 1 339 ? -11.645 57.352  26.502  1.00 12.54 ? 339  PRO B CG    1 
ATOM   7546  C CD    . PRO B 1 339 ? -10.630 57.656  25.478  1.00 12.72 ? 339  PRO B CD    1 
ATOM   7547  N N     . ALA B 1 340 ? -10.621 61.541  26.250  1.00 12.47 ? 340  ALA B N     1 
ATOM   7548  C CA    . ALA B 1 340 ? -10.345 62.908  26.771  1.00 11.61 ? 340  ALA B CA    1 
ATOM   7549  C C     . ALA B 1 340 ? -10.569 64.020  25.728  1.00 11.19 ? 340  ALA B C     1 
ATOM   7550  O O     . ALA B 1 340 ? -10.508 65.214  26.047  1.00 11.07 ? 340  ALA B O     1 
ATOM   7551  C CB    . ALA B 1 340 ? -8.946  62.986  27.372  1.00 10.62 ? 340  ALA B CB    1 
ATOM   7552  N N     . ARG B 1 341 ? -10.869 63.623  24.500  1.00 10.76 ? 341  ARG B N     1 
ATOM   7553  C CA    . ARG B 1 341 ? -10.889 64.534  23.388  1.00 11.13 ? 341  ARG B CA    1 
ATOM   7554  C C     . ARG B 1 341 ? -11.787 65.749  23.595  1.00 11.95 ? 341  ARG B C     1 
ATOM   7555  O O     . ARG B 1 341 ? -11.344 66.896  23.437  1.00 12.56 ? 341  ARG B O     1 
ATOM   7556  C CB    . ARG B 1 341 ? -11.228 63.831  22.068  1.00 10.73 ? 341  ARG B CB    1 
ATOM   7557  C CG    . ARG B 1 341 ? -11.230 64.800  20.848  1.00 9.26  ? 341  ARG B CG    1 
ATOM   7558  C CD    . ARG B 1 341 ? -9.822  65.303  20.519  1.00 8.92  ? 341  ARG B CD    1 
ATOM   7559  N NE    . ARG B 1 341 ? -9.767  66.240  19.393  1.00 9.54  ? 341  ARG B NE    1 
ATOM   7560  C CZ    . ARG B 1 341 ? -10.015 65.919  18.117  1.00 9.16  ? 341  ARG B CZ    1 
ATOM   7561  N NH1   . ARG B 1 341 ? -10.357 64.682  17.768  1.00 8.75  ? 341  ARG B NH1   1 
ATOM   7562  N NH2   . ARG B 1 341 ? -9.923  66.838  17.175  1.00 9.04  ? 341  ARG B NH2   1 
ATOM   7563  N N     . MET B 1 342 ? -13.042 65.530  23.948  1.00 12.41 ? 342  MET B N     1 
ATOM   7564  C CA    . MET B 1 342 ? -13.901 66.678  24.212  1.00 12.52 ? 342  MET B CA    1 
ATOM   7565  C C     . MET B 1 342 ? -13.181 67.718  25.105  1.00 12.55 ? 342  MET B C     1 
ATOM   7566  O O     . MET B 1 342 ? -13.147 68.904  24.786  1.00 13.01 ? 342  MET B O     1 
ATOM   7567  C CB    . MET B 1 342 ? -15.213 66.244  24.856  1.00 12.20 ? 342  MET B CB    1 
ATOM   7568  C CG    . MET B 1 342 ? -16.080 67.412  25.213  1.00 11.39 ? 342  MET B CG    1 
ATOM   7569  S SD    . MET B 1 342 ? -17.639 66.922  25.893  1.00 13.72 ? 342  MET B SD    1 
ATOM   7570  C CE    . MET B 1 342 ? -17.258 66.610  27.633  1.00 11.83 ? 342  MET B CE    1 
ATOM   7571  N N     . CYS B 1 343 ? -12.610 67.272  26.219  1.00 12.04 ? 343  CYS B N     1 
ATOM   7572  C CA    . CYS B 1 343 ? -11.949 68.201  27.123  1.00 12.22 ? 343  CYS B CA    1 
ATOM   7573  C C     . CYS B 1 343 ? -10.653 68.788  26.550  1.00 11.56 ? 343  CYS B C     1 
ATOM   7574  O O     . CYS B 1 343 ? -10.301 69.933  26.870  1.00 11.09 ? 343  CYS B O     1 
ATOM   7575  C CB    . CYS B 1 343 ? -11.711 67.548  28.484  1.00 12.28 ? 343  CYS B CB    1 
ATOM   7576  S SG    . CYS B 1 343 ? -13.284 67.159  29.289  1.00 14.57 ? 343  CYS B SG    1 
ATOM   7577  N N     . GLN B 1 344 ? -9.968  68.026  25.693  1.00 10.69 ? 344  GLN B N     1 
ATOM   7578  C CA    . GLN B 1 344 ? -8.796  68.546  24.990  1.00 10.20 ? 344  GLN B CA    1 
ATOM   7579  C C     . GLN B 1 344 ? -9.170  69.710  24.091  1.00 10.35 ? 344  GLN B C     1 
ATOM   7580  O O     . GLN B 1 344 ? -8.429  70.716  24.045  1.00 10.66 ? 344  GLN B O     1 
ATOM   7581  C CB    . GLN B 1 344 ? -8.098  67.475  24.175  1.00 10.48 ? 344  GLN B CB    1 
ATOM   7582  C CG    . GLN B 1 344 ? -7.104  66.613  24.918  1.00 9.33  ? 344  GLN B CG    1 
ATOM   7583  C CD    . GLN B 1 344 ? -6.877  65.286  24.187  1.00 11.46 ? 344  GLN B CD    1 
ATOM   7584  O OE1   . GLN B 1 344 ? -6.247  64.369  24.714  1.00 11.00 ? 344  GLN B OE1   1 
ATOM   7585  N NE2   . GLN B 1 344 ? -7.412  65.177  22.977  1.00 9.95  ? 344  GLN B NE2   1 
ATOM   7586  N N     . VAL B 1 345 ? -10.326 69.599  23.415  1.00 10.23 ? 345  VAL B N     1 
ATOM   7587  C CA    . VAL B 1 345 ? -10.863 70.707  22.598  1.00 10.00 ? 345  VAL B CA    1 
ATOM   7588  C C     . VAL B 1 345 ? -11.162 71.908  23.497  1.00 10.81 ? 345  VAL B C     1 
ATOM   7589  O O     . VAL B 1 345 ? -10.922 73.081  23.114  1.00 10.34 ? 345  VAL B O     1 
ATOM   7590  C CB    . VAL B 1 345 ? -12.145 70.334  21.777  1.00 9.97  ? 345  VAL B CB    1 
ATOM   7591  C CG1   . VAL B 1 345 ? -12.706 71.566  21.057  1.00 10.08 ? 345  VAL B CG1   1 
ATOM   7592  C CG2   . VAL B 1 345 ? -11.896 69.202  20.739  1.00 7.82  ? 345  VAL B CG2   1 
ATOM   7593  N N     . VAL B 1 346 ? -11.673 71.600  24.697  1.00 11.39 ? 346  VAL B N     1 
ATOM   7594  C CA    . VAL B 1 346 ? -12.032 72.614  25.675  1.00 11.57 ? 346  VAL B CA    1 
ATOM   7595  C C     . VAL B 1 346 ? -10.807 73.417  26.075  1.00 12.05 ? 346  VAL B C     1 
ATOM   7596  O O     . VAL B 1 346 ? -10.883 74.633  26.092  1.00 12.26 ? 346  VAL B O     1 
ATOM   7597  C CB    . VAL B 1 346 ? -12.794 72.021  26.901  1.00 12.17 ? 346  VAL B CB    1 
ATOM   7598  C CG1   . VAL B 1 346 ? -12.761 72.967  28.124  1.00 8.93  ? 346  VAL B CG1   1 
ATOM   7599  C CG2   . VAL B 1 346 ? -14.243 71.641  26.510  1.00 11.73 ? 346  VAL B CG2   1 
ATOM   7600  N N     . ASP B 1 347 ? -9.676  72.758  26.334  1.00 12.80 ? 347  ASP B N     1 
ATOM   7601  C CA    . ASP B 1 347 ? -8.434  73.477  26.679  1.00 13.76 ? 347  ASP B CA    1 
ATOM   7602  C C     . ASP B 1 347 ? -7.894  74.240  25.479  1.00 14.34 ? 347  ASP B C     1 
ATOM   7603  O O     . ASP B 1 347 ? -7.591  75.419  25.575  1.00 14.92 ? 347  ASP B O     1 
ATOM   7604  C CB    . ASP B 1 347 ? -7.335  72.517  27.127  1.00 13.54 ? 347  ASP B CB    1 
ATOM   7605  C CG    . ASP B 1 347 ? -7.660  71.789  28.429  1.00 15.32 ? 347  ASP B CG    1 
ATOM   7606  O OD1   . ASP B 1 347 ? -8.473  72.280  29.273  1.00 11.31 ? 347  ASP B OD1   1 
ATOM   7607  O OD2   . ASP B 1 347 ? -7.067  70.687  28.592  1.00 19.39 ? 347  ASP B OD2   1 
ATOM   7608  N N     . LYS B 1 348 ? -7.788  73.547  24.348  1.00 14.92 ? 348  LYS B N     1 
ATOM   7609  C CA    . LYS B 1 348 ? -7.124  74.053  23.156  1.00 15.20 ? 348  LYS B CA    1 
ATOM   7610  C C     . LYS B 1 348 ? -7.705  75.406  22.791  1.00 15.46 ? 348  LYS B C     1 
ATOM   7611  O O     . LYS B 1 348 ? -6.969  76.322  22.410  1.00 15.85 ? 348  LYS B O     1 
ATOM   7612  C CB    . LYS B 1 348 ? -7.274  73.029  22.014  1.00 14.87 ? 348  LYS B CB    1 
ATOM   7613  C CG    . LYS B 1 348 ? -6.612  73.380  20.686  1.00 15.04 ? 348  LYS B CG    1 
ATOM   7614  C CD    . LYS B 1 348 ? -6.513  72.137  19.792  1.00 15.64 ? 348  LYS B CD    1 
ATOM   7615  C CE    . LYS B 1 348 ? -5.614  72.320  18.566  1.00 17.27 ? 348  LYS B CE    1 
ATOM   7616  N NZ    . LYS B 1 348 ? -6.358  72.706  17.328  1.00 15.88 ? 348  LYS B NZ    1 
ATOM   7617  N N     . HIS B 1 349 ? -9.021  75.541  22.959  1.00 15.29 ? 349  HIS B N     1 
ATOM   7618  C CA    . HIS B 1 349 ? -9.732  76.734  22.503  1.00 14.91 ? 349  HIS B CA    1 
ATOM   7619  C C     . HIS B 1 349 ? -10.291 77.570  23.636  1.00 14.48 ? 349  HIS B C     1 
ATOM   7620  O O     . HIS B 1 349 ? -10.942 78.609  23.396  1.00 15.00 ? 349  HIS B O     1 
ATOM   7621  C CB    . HIS B 1 349 ? -10.832 76.357  21.517  1.00 14.60 ? 349  HIS B CB    1 
ATOM   7622  C CG    . HIS B 1 349 ? -10.316 75.698  20.272  1.00 15.74 ? 349  HIS B CG    1 
ATOM   7623  N ND1   . HIS B 1 349 ? -9.367  76.283  19.461  1.00 15.43 ? 349  HIS B ND1   1 
ATOM   7624  C CD2   . HIS B 1 349 ? -10.633 74.516  19.688  1.00 16.00 ? 349  HIS B CD2   1 
ATOM   7625  C CE1   . HIS B 1 349 ? -9.108  75.484  18.441  1.00 15.92 ? 349  HIS B CE1   1 
ATOM   7626  N NE2   . HIS B 1 349 ? -9.866  74.406  18.553  1.00 16.31 ? 349  HIS B NE2   1 
ATOM   7627  N N     . GLN B 1 350 ? -10.034 77.124  24.865  1.00 13.17 ? 350  GLN B N     1 
ATOM   7628  C CA    . GLN B 1 350 ? -10.343 77.924  26.046  1.00 12.67 ? 350  GLN B CA    1 
ATOM   7629  C C     . GLN B 1 350 ? -11.845 78.167  26.117  1.00 12.45 ? 350  GLN B C     1 
ATOM   7630  O O     . GLN B 1 350 ? -12.309 79.250  26.498  1.00 12.87 ? 350  GLN B O     1 
ATOM   7631  C CB    . GLN B 1 350 ? -9.534  79.248  26.064  1.00 12.62 ? 350  GLN B CB    1 
ATOM   7632  C CG    . GLN B 1 350 ? -8.021  79.090  26.411  1.00 12.60 ? 350  GLN B CG    1 
ATOM   7633  C CD    . GLN B 1 350 ? -7.784  78.579  27.868  1.00 16.09 ? 350  GLN B CD    1 
ATOM   7634  O OE1   . GLN B 1 350 ? -7.480  77.402  28.066  1.00 15.29 ? 350  GLN B OE1   1 
ATOM   7635  N NE2   . GLN B 1 350 ? -7.960  79.469  28.880  1.00 13.42 ? 350  GLN B NE2   1 
ATOM   7636  N N     . VAL B 1 351 ? -12.590 77.123  25.763  1.00 11.75 ? 351  VAL B N     1 
ATOM   7637  C CA    . VAL B 1 351 ? -14.050 77.082  25.854  1.00 11.07 ? 351  VAL B CA    1 
ATOM   7638  C C     . VAL B 1 351 ? -14.587 77.498  27.223  1.00 10.71 ? 351  VAL B C     1 
ATOM   7639  O O     . VAL B 1 351 ? -14.096 77.045  28.247  1.00 10.88 ? 351  VAL B O     1 
ATOM   7640  C CB    . VAL B 1 351 ? -14.537 75.669  25.437  1.00 10.81 ? 351  VAL B CB    1 
ATOM   7641  C CG1   . VAL B 1 351 ? -16.017 75.423  25.790  1.00 10.33 ? 351  VAL B CG1   1 
ATOM   7642  C CG2   . VAL B 1 351 ? -14.293 75.485  23.974  1.00 9.88  ? 351  VAL B CG2   1 
ATOM   7643  N N     . ASN B 1 352 ? -15.591 78.364  27.229  1.00 11.04 ? 352  ASN B N     1 
ATOM   7644  C CA    . ASN B 1 352 ? -16.230 78.801  28.471  1.00 11.61 ? 352  ASN B CA    1 
ATOM   7645  C C     . ASN B 1 352 ? -17.618 78.213  28.728  1.00 12.17 ? 352  ASN B C     1 
ATOM   7646  O O     . ASN B 1 352 ? -18.025 78.080  29.890  1.00 13.22 ? 352  ASN B O     1 
ATOM   7647  C CB    . ASN B 1 352 ? -16.349 80.324  28.505  1.00 11.67 ? 352  ASN B CB    1 
ATOM   7648  C CG    . ASN B 1 352 ? -15.020 81.010  28.388  1.00 12.32 ? 352  ASN B CG    1 
ATOM   7649  O OD1   . ASN B 1 352 ? -14.813 81.803  27.476  1.00 14.77 ? 352  ASN B OD1   1 
ATOM   7650  N ND2   . ASN B 1 352 ? -14.089 80.680  29.279  1.00 12.03 ? 352  ASN B ND2   1 
ATOM   7651  N N     . ILE B 1 353 ? -18.351 77.912  27.655  1.00 12.01 ? 353  ILE B N     1 
ATOM   7652  C CA    . ILE B 1 353 ? -19.703 77.358  27.733  1.00 12.09 ? 353  ILE B CA    1 
ATOM   7653  C C     . ILE B 1 353 ? -19.714 76.088  26.895  1.00 12.96 ? 353  ILE B C     1 
ATOM   7654  O O     . ILE B 1 353 ? -19.405 76.123  25.707  1.00 14.03 ? 353  ILE B O     1 
ATOM   7655  C CB    . ILE B 1 353 ? -20.780 78.324  27.168  1.00 11.72 ? 353  ILE B CB    1 
ATOM   7656  C CG1   . ILE B 1 353 ? -20.699 79.705  27.828  1.00 11.81 ? 353  ILE B CG1   1 
ATOM   7657  C CG2   . ILE B 1 353 ? -22.142 77.778  27.393  1.00 11.58 ? 353  ILE B CG2   1 
ATOM   7658  C CD1   . ILE B 1 353 ? -21.268 80.800  26.993  1.00 9.10  ? 353  ILE B CD1   1 
ATOM   7659  N N     . LEU B 1 354 ? -20.048 74.969  27.524  1.00 12.77 ? 354  LEU B N     1 
ATOM   7660  C CA    . LEU B 1 354 ? -20.119 73.710  26.857  1.00 12.46 ? 354  LEU B CA    1 
ATOM   7661  C C     . LEU B 1 354 ? -21.559 73.197  26.945  1.00 12.91 ? 354  LEU B C     1 
ATOM   7662  O O     . LEU B 1 354 ? -22.116 73.043  28.025  1.00 13.49 ? 354  LEU B O     1 
ATOM   7663  C CB    . LEU B 1 354 ? -19.149 72.707  27.478  1.00 12.46 ? 354  LEU B CB    1 
ATOM   7664  C CG    . LEU B 1 354 ? -19.199 71.281  26.897  1.00 11.72 ? 354  LEU B CG    1 
ATOM   7665  C CD1   . LEU B 1 354 ? -18.824 71.295  25.437  1.00 10.00 ? 354  LEU B CD1   1 
ATOM   7666  C CD2   . LEU B 1 354 ? -18.257 70.345  27.668  1.00 12.27 ? 354  LEU B CD2   1 
ATOM   7667  N N     . TYR B 1 355 ? -22.133 72.945  25.781  1.00 12.37 ? 355  TYR B N     1 
ATOM   7668  C CA    . TYR B 1 355 ? -23.486 72.508  25.629  1.00 12.22 ? 355  TYR B CA    1 
ATOM   7669  C C     . TYR B 1 355 ? -23.442 71.173  24.849  1.00 12.23 ? 355  TYR B C     1 
ATOM   7670  O O     . TYR B 1 355 ? -23.104 71.148  23.675  1.00 12.76 ? 355  TYR B O     1 
ATOM   7671  C CB    . TYR B 1 355 ? -24.230 73.566  24.820  1.00 11.27 ? 355  TYR B CB    1 
ATOM   7672  C CG    . TYR B 1 355 ? -25.713 73.325  24.702  1.00 10.82 ? 355  TYR B CG    1 
ATOM   7673  C CD1   . TYR B 1 355 ? -26.421 72.725  25.741  1.00 8.05  ? 355  TYR B CD1   1 
ATOM   7674  C CD2   . TYR B 1 355 ? -26.426 73.756  23.572  1.00 9.76  ? 355  TYR B CD2   1 
ATOM   7675  C CE1   . TYR B 1 355 ? -27.767 72.521  25.637  1.00 6.71  ? 355  TYR B CE1   1 
ATOM   7676  C CE2   . TYR B 1 355 ? -27.783 73.565  23.482  1.00 6.22  ? 355  TYR B CE2   1 
ATOM   7677  C CZ    . TYR B 1 355 ? -28.433 72.945  24.517  1.00 6.46  ? 355  TYR B CZ    1 
ATOM   7678  O OH    . TYR B 1 355 ? -29.781 72.752  24.458  1.00 9.77  ? 355  TYR B OH    1 
ATOM   7679  N N     . THR B 1 356 ? -23.747 70.073  25.518  1.00 12.04 ? 356  THR B N     1 
ATOM   7680  C CA    . THR B 1 356 ? -23.603 68.751  24.932  1.00 12.23 ? 356  THR B CA    1 
ATOM   7681  C C     . THR B 1 356 ? -24.738 67.815  25.353  1.00 12.10 ? 356  THR B C     1 
ATOM   7682  O O     . THR B 1 356 ? -25.716 68.251  25.962  1.00 11.87 ? 356  THR B O     1 
ATOM   7683  C CB    . THR B 1 356 ? -22.173 68.143  25.178  1.00 12.05 ? 356  THR B CB    1 
ATOM   7684  O OG1   . THR B 1 356 ? -21.958 67.071  24.261  1.00 12.34 ? 356  THR B OG1   1 
ATOM   7685  C CG2   . THR B 1 356 ? -21.991 67.632  26.577  1.00 10.80 ? 356  THR B CG2   1 
ATOM   7686  N N     . ALA B 1 357 ? -24.615 66.535  25.008  1.00 12.37 ? 357  ALA B N     1 
ATOM   7687  C CA    . ALA B 1 357 ? -25.745 65.601  25.128  1.00 12.15 ? 357  ALA B CA    1 
ATOM   7688  C C     . ALA B 1 357 ? -25.518 64.488  26.154  1.00 12.04 ? 357  ALA B C     1 
ATOM   7689  O O     . ALA B 1 357 ? -24.409 63.919  26.239  1.00 11.65 ? 357  ALA B O     1 
ATOM   7690  C CB    . ALA B 1 357 ? -26.065 64.990  23.739  1.00 12.41 ? 357  ALA B CB    1 
ATOM   7691  N N     . PRO B 1 358 ? -26.571 64.159  26.934  1.00 12.08 ? 358  PRO B N     1 
ATOM   7692  C CA    . PRO B 1 358 ? -26.493 63.049  27.896  1.00 12.10 ? 358  PRO B CA    1 
ATOM   7693  C C     . PRO B 1 358 ? -25.837 61.776  27.348  1.00 12.08 ? 358  PRO B C     1 
ATOM   7694  O O     . PRO B 1 358 ? -25.087 61.116  28.062  1.00 12.34 ? 358  PRO B O     1 
ATOM   7695  C CB    . PRO B 1 358 ? -27.956 62.824  28.264  1.00 12.21 ? 358  PRO B CB    1 
ATOM   7696  C CG    . PRO B 1 358 ? -28.514 64.236  28.208  1.00 11.44 ? 358  PRO B CG    1 
ATOM   7697  C CD    . PRO B 1 358 ? -27.876 64.836  27.005  1.00 11.55 ? 358  PRO B CD    1 
ATOM   7698  N N     . THR B 1 359 ? -26.075 61.450  26.092  1.00 12.28 ? 359  THR B N     1 
ATOM   7699  C CA    . THR B 1 359 ? -25.510 60.222  25.521  1.00 12.46 ? 359  THR B CA    1 
ATOM   7700  C C     . THR B 1 359 ? -24.006 60.315  25.466  1.00 12.34 ? 359  THR B C     1 
ATOM   7701  O O     . THR B 1 359 ? -23.305 59.387  25.868  1.00 13.00 ? 359  THR B O     1 
ATOM   7702  C CB    . THR B 1 359 ? -26.113 59.888  24.117  1.00 12.65 ? 359  THR B CB    1 
ATOM   7703  O OG1   . THR B 1 359 ? -27.452 59.381  24.291  1.00 11.80 ? 359  THR B OG1   1 
ATOM   7704  C CG2   . THR B 1 359 ? -25.280 58.834  23.433  1.00 12.90 ? 359  THR B CG2   1 
ATOM   7705  N N     . ALA B 1 360 ? -23.509 61.460  25.004  1.00 12.00 ? 360  ALA B N     1 
ATOM   7706  C CA    . ALA B 1 360 ? -22.087 61.745  25.043  1.00 11.29 ? 360  ALA B CA    1 
ATOM   7707  C C     . ALA B 1 360 ? -21.561 61.694  26.489  1.00 11.36 ? 360  ALA B C     1 
ATOM   7708  O O     . ALA B 1 360 ? -20.482 61.105  26.760  1.00 11.05 ? 360  ALA B O     1 
ATOM   7709  C CB    . ALA B 1 360 ? -21.785 63.107  24.389  1.00 10.90 ? 360  ALA B CB    1 
ATOM   7710  N N     . ILE B 1 361 ? -22.299 62.321  27.413  1.00 10.61 ? 361  ILE B N     1 
ATOM   7711  C CA    . ILE B 1 361 ? -21.845 62.363  28.795  1.00 10.41 ? 361  ILE B CA    1 
ATOM   7712  C C     . ILE B 1 361 ? -21.685 60.928  29.350  1.00 10.73 ? 361  ILE B C     1 
ATOM   7713  O O     . ILE B 1 361 ? -20.624 60.598  29.914  1.00 10.49 ? 361  ILE B O     1 
ATOM   7714  C CB    . ILE B 1 361 ? -22.747 63.231  29.663  1.00 10.49 ? 361  ILE B CB    1 
ATOM   7715  C CG1   . ILE B 1 361 ? -22.586 64.703  29.278  1.00 11.69 ? 361  ILE B CG1   1 
ATOM   7716  C CG2   . ILE B 1 361 ? -22.471 63.014  31.135  1.00 8.86  ? 361  ILE B CG2   1 
ATOM   7717  C CD1   . ILE B 1 361 ? -23.815 65.552  29.674  1.00 11.90 ? 361  ILE B CD1   1 
ATOM   7718  N N     . ARG B 1 362 ? -22.695 60.076  29.139  1.00 10.15 ? 362  ARG B N     1 
ATOM   7719  C CA    . ARG B 1 362 ? -22.633 58.683  29.596  1.00 10.39 ? 362  ARG B CA    1 
ATOM   7720  C C     . ARG B 1 362 ? -21.496 57.872  28.964  1.00 10.78 ? 362  ARG B C     1 
ATOM   7721  O O     . ARG B 1 362 ? -20.880 57.044  29.655  1.00 10.67 ? 362  ARG B O     1 
ATOM   7722  C CB    . ARG B 1 362 ? -23.970 57.962  29.427  1.00 10.47 ? 362  ARG B CB    1 
ATOM   7723  C CG    . ARG B 1 362 ? -25.132 58.611  30.216  1.00 11.10 ? 362  ARG B CG    1 
ATOM   7724  C CD    . ARG B 1 362 ? -26.418 57.788  30.172  1.00 10.58 ? 362  ARG B CD    1 
ATOM   7725  N NE    . ARG B 1 362 ? -26.966 57.780  28.831  1.00 13.21 ? 362  ARG B NE    1 
ATOM   7726  C CZ    . ARG B 1 362 ? -27.915 58.604  28.395  1.00 16.48 ? 362  ARG B CZ    1 
ATOM   7727  N NH1   . ARG B 1 362 ? -28.445 59.506  29.222  1.00 16.60 ? 362  ARG B NH1   1 
ATOM   7728  N NH2   . ARG B 1 362 ? -28.328 58.524  27.122  1.00 18.18 ? 362  ARG B NH2   1 
ATOM   7729  N N     . ALA B 1 363 ? -21.196 58.130  27.680  1.00 10.77 ? 363  ALA B N     1 
ATOM   7730  C CA    . ALA B 1 363 ? -20.110 57.430  26.986  1.00 10.58 ? 363  ALA B CA    1 
ATOM   7731  C C     . ALA B 1 363 ? -18.727 57.813  27.580  1.00 11.42 ? 363  ALA B C     1 
ATOM   7732  O O     . ALA B 1 363 ? -17.860 56.931  27.795  1.00 11.71 ? 363  ALA B O     1 
ATOM   7733  C CB    . ALA B 1 363 ? -20.172 57.678  25.480  1.00 9.71  ? 363  ALA B CB    1 
ATOM   7734  N N     . LEU B 1 364 ? -18.538 59.102  27.876  1.00 11.43 ? 364  LEU B N     1 
ATOM   7735  C CA    . LEU B 1 364 ? -17.358 59.550  28.630  1.00 12.26 ? 364  LEU B CA    1 
ATOM   7736  C C     . LEU B 1 364 ? -17.347 59.028  30.096  1.00 13.35 ? 364  LEU B C     1 
ATOM   7737  O O     . LEU B 1 364 ? -16.301 58.547  30.579  1.00 13.18 ? 364  LEU B O     1 
ATOM   7738  C CB    . LEU B 1 364 ? -17.220 61.080  28.588  1.00 11.88 ? 364  LEU B CB    1 
ATOM   7739  C CG    . LEU B 1 364 ? -17.295 61.729  27.198  1.00 11.41 ? 364  LEU B CG    1 
ATOM   7740  C CD1   . LEU B 1 364 ? -17.190 63.194  27.356  1.00 9.68  ? 364  LEU B CD1   1 
ATOM   7741  C CD2   . LEU B 1 364 ? -16.174 61.230  26.298  1.00 12.01 ? 364  LEU B CD2   1 
ATOM   7742  N N     . MET B 1 365 ? -18.504 59.105  30.774  1.00 13.70 ? 365  MET B N     1 
ATOM   7743  C CA    . MET B 1 365 ? -18.680 58.573  32.130  1.00 15.19 ? 365  MET B CA    1 
ATOM   7744  C C     . MET B 1 365 ? -18.292 57.083  32.254  1.00 14.61 ? 365  MET B C     1 
ATOM   7745  O O     . MET B 1 365 ? -17.671 56.683  33.231  1.00 14.00 ? 365  MET B O     1 
ATOM   7746  C CB    . MET B 1 365 ? -20.122 58.794  32.605  1.00 14.88 ? 365  MET B CB    1 
ATOM   7747  C CG    . MET B 1 365 ? -20.452 58.185  33.944  1.00 16.14 ? 365  MET B CG    1 
ATOM   7748  S SD    . MET B 1 365 ? -21.900 58.915  34.750  1.00 19.46 ? 365  MET B SD    1 
ATOM   7749  C CE    . MET B 1 365 ? -23.254 57.807  34.253  1.00 24.50 ? 365  MET B CE    1 
ATOM   7750  N N     . ALA B 1 366 ? -18.648 56.270  31.261  1.00 14.65 ? 366  ALA B N     1 
ATOM   7751  C CA    . ALA B 1 366 ? -18.269 54.838  31.264  1.00 14.97 ? 366  ALA B CA    1 
ATOM   7752  C C     . ALA B 1 366 ? -16.742 54.640  31.283  1.00 14.81 ? 366  ALA B C     1 
ATOM   7753  O O     . ALA B 1 366 ? -16.249 53.592  31.677  1.00 14.69 ? 366  ALA B O     1 
ATOM   7754  C CB    . ALA B 1 366 ? -18.922 54.084  30.061  1.00 14.23 ? 366  ALA B CB    1 
ATOM   7755  N N     . GLU B 1 367 ? -16.015 55.673  30.865  1.00 14.93 ? 367  GLU B N     1 
ATOM   7756  C CA    . GLU B 1 367 ? -14.577 55.633  30.767  1.00 15.20 ? 367  GLU B CA    1 
ATOM   7757  C C     . GLU B 1 367 ? -13.927 56.237  31.998  1.00 15.03 ? 367  GLU B C     1 
ATOM   7758  O O     . GLU B 1 367 ? -12.712 56.270  32.100  1.00 14.98 ? 367  GLU B O     1 
ATOM   7759  C CB    . GLU B 1 367 ? -14.127 56.394  29.521  1.00 15.69 ? 367  GLU B CB    1 
ATOM   7760  C CG    . GLU B 1 367 ? -14.531 55.756  28.198  1.00 17.66 ? 367  GLU B CG    1 
ATOM   7761  C CD    . GLU B 1 367 ? -14.087 54.302  28.051  1.00 21.95 ? 367  GLU B CD    1 
ATOM   7762  O OE1   . GLU B 1 367 ? -13.110 53.883  28.715  1.00 24.01 ? 367  GLU B OE1   1 
ATOM   7763  O OE2   . GLU B 1 367 ? -14.728 53.571  27.267  1.00 23.98 ? 367  GLU B OE2   1 
ATOM   7764  N N     . GLY B 1 368 ? -14.750 56.720  32.926  1.00 15.29 ? 368  GLY B N     1 
ATOM   7765  C CA    . GLY B 1 368 ? -14.283 57.289  34.188  1.00 15.37 ? 368  GLY B CA    1 
ATOM   7766  C C     . GLY B 1 368 ? -13.343 58.463  33.985  1.00 16.12 ? 368  GLY B C     1 
ATOM   7767  O O     . GLY B 1 368 ? -13.550 59.291  33.070  1.00 15.96 ? 368  GLY B O     1 
ATOM   7768  N N     . ASP B 1 369 ? -12.301 58.525  34.816  1.00 15.76 ? 369  ASP B N     1 
ATOM   7769  C CA    . ASP B 1 369 ? -11.312 59.601  34.723  1.00 16.05 ? 369  ASP B CA    1 
ATOM   7770  C C     . ASP B 1 369 ? -10.527 59.665  33.404  1.00 15.52 ? 369  ASP B C     1 
ATOM   7771  O O     . ASP B 1 369 ? -9.935  60.696  33.118  1.00 15.81 ? 369  ASP B O     1 
ATOM   7772  C CB    . ASP B 1 369 ? -10.371 59.605  35.943  1.00 16.27 ? 369  ASP B CB    1 
ATOM   7773  C CG    . ASP B 1 369 ? -11.115 59.926  37.266  1.00 18.23 ? 369  ASP B CG    1 
ATOM   7774  O OD1   . ASP B 1 369 ? -12.174 60.618  37.265  1.00 16.63 ? 369  ASP B OD1   1 
ATOM   7775  O OD2   . ASP B 1 369 ? -10.630 59.469  38.318  1.00 19.38 ? 369  ASP B OD2   1 
ATOM   7776  N N     . LYS B 1 370 ? -10.568 58.613  32.580  1.00 15.09 ? 370  LYS B N     1 
ATOM   7777  C CA    . LYS B 1 370 ? -9.936  58.655  31.250  1.00 15.13 ? 370  LYS B CA    1 
ATOM   7778  C C     . LYS B 1 370 ? -10.490 59.794  30.387  1.00 15.01 ? 370  LYS B C     1 
ATOM   7779  O O     . LYS B 1 370 ? -9.814  60.312  29.501  1.00 15.59 ? 370  LYS B O     1 
ATOM   7780  C CB    . LYS B 1 370 ? -10.110 57.332  30.495  1.00 15.17 ? 370  LYS B CB    1 
ATOM   7781  C CG    . LYS B 1 370 ? -9.426  56.144  31.120  1.00 16.14 ? 370  LYS B CG    1 
ATOM   7782  C CD    . LYS B 1 370 ? -7.945  56.139  30.825  1.00 21.28 ? 370  LYS B CD    1 
ATOM   7783  C CE    . LYS B 1 370 ? -7.120  55.737  32.085  1.00 23.99 ? 370  LYS B CE    1 
ATOM   7784  N NZ    . LYS B 1 370 ? -5.637  55.593  31.838  1.00 23.29 ? 370  LYS B NZ    1 
ATOM   7785  N N     . ALA B 1 371 ? -11.737 60.151  30.648  1.00 14.73 ? 371  ALA B N     1 
ATOM   7786  C CA    . ALA B 1 371 ? -12.389 61.303  30.039  1.00 14.54 ? 371  ALA B CA    1 
ATOM   7787  C C     . ALA B 1 371 ? -11.784 62.658  30.391  1.00 14.28 ? 371  ALA B C     1 
ATOM   7788  O O     . ALA B 1 371 ? -11.996 63.612  29.636  1.00 14.21 ? 371  ALA B O     1 
ATOM   7789  C CB    . ALA B 1 371 ? -13.894 61.306  30.398  1.00 14.51 ? 371  ALA B CB    1 
ATOM   7790  N N     . ILE B 1 372 ? -11.061 62.752  31.518  1.00 13.87 ? 372  ILE B N     1 
ATOM   7791  C CA    . ILE B 1 372 ? -10.419 64.025  31.920  1.00 14.07 ? 372  ILE B CA    1 
ATOM   7792  C C     . ILE B 1 372 ? -8.878  64.015  32.049  1.00 14.01 ? 372  ILE B C     1 
ATOM   7793  O O     . ILE B 1 372 ? -8.229  65.063  32.129  1.00 13.29 ? 372  ILE B O     1 
ATOM   7794  C CB    . ILE B 1 372 ? -11.019 64.604  33.217  1.00 13.92 ? 372  ILE B CB    1 
ATOM   7795  C CG1   . ILE B 1 372 ? -10.771 63.649  34.386  1.00 13.18 ? 372  ILE B CG1   1 
ATOM   7796  C CG2   . ILE B 1 372 ? -12.466 64.963  33.012  1.00 12.92 ? 372  ILE B CG2   1 
ATOM   7797  C CD1   . ILE B 1 372 ? -10.997 64.256  35.734  1.00 11.37 ? 372  ILE B CD1   1 
ATOM   7798  N N     . GLU B 1 373 ? -8.306  62.827  32.033  1.00 14.66 ? 373  GLU B N     1 
ATOM   7799  C CA    . GLU B 1 373 ? -6.859  62.652  32.212  1.00 15.42 ? 373  GLU B CA    1 
ATOM   7800  C C     . GLU B 1 373 ? -6.029  63.492  31.271  1.00 14.44 ? 373  GLU B C     1 
ATOM   7801  O O     . GLU B 1 373 ? -6.222  63.480  30.042  1.00 14.25 ? 373  GLU B O     1 
ATOM   7802  C CB    . GLU B 1 373 ? -6.485  61.198  32.021  1.00 15.88 ? 373  GLU B CB    1 
ATOM   7803  C CG    . GLU B 1 373 ? -5.131  60.806  32.595  1.00 21.24 ? 373  GLU B CG    1 
ATOM   7804  C CD    . GLU B 1 373 ? -4.702  59.465  32.038  1.00 27.80 ? 373  GLU B CD    1 
ATOM   7805  O OE1   . GLU B 1 373 ? -5.448  58.487  32.286  1.00 32.06 ? 373  GLU B OE1   1 
ATOM   7806  O OE2   . GLU B 1 373 ? -3.666  59.388  31.327  1.00 28.69 ? 373  GLU B OE2   1 
ATOM   7807  N N     . GLY B 1 374 ? -5.105  64.221  31.880  1.00 13.69 ? 374  GLY B N     1 
ATOM   7808  C CA    . GLY B 1 374 ? -4.190  65.087  31.177  1.00 12.87 ? 374  GLY B CA    1 
ATOM   7809  C C     . GLY B 1 374 ? -4.830  66.399  30.770  1.00 13.20 ? 374  GLY B C     1 
ATOM   7810  O O     . GLY B 1 374 ? -4.225  67.164  30.011  1.00 13.16 ? 374  GLY B O     1 
ATOM   7811  N N     . THR B 1 375 ? -6.042  66.684  31.246  1.00 12.56 ? 375  THR B N     1 
ATOM   7812  C CA    . THR B 1 375 ? -6.708  67.904  30.802  1.00 12.72 ? 375  THR B CA    1 
ATOM   7813  C C     . THR B 1 375 ? -7.028  68.855  31.952  1.00 13.17 ? 375  THR B C     1 
ATOM   7814  O O     . THR B 1 375 ? -7.222  68.434  33.109  1.00 12.26 ? 375  THR B O     1 
ATOM   7815  C CB    . THR B 1 375 ? -8.000  67.616  30.028  1.00 12.79 ? 375  THR B CB    1 
ATOM   7816  O OG1   . THR B 1 375 ? -9.011  67.166  30.940  1.00 13.79 ? 375  THR B OG1   1 
ATOM   7817  C CG2   . THR B 1 375 ? -7.780  66.559  28.962  1.00 11.66 ? 375  THR B CG2   1 
ATOM   7818  N N     . ASP B 1 376 ? -7.125  70.138  31.605  1.00 13.07 ? 376  ASP B N     1 
ATOM   7819  C CA    . ASP B 1 376 ? -7.352  71.185  32.585  1.00 13.22 ? 376  ASP B CA    1 
ATOM   7820  C C     . ASP B 1 376 ? -8.849  71.575  32.849  1.00 13.35 ? 376  ASP B C     1 
ATOM   7821  O O     . ASP B 1 376 ? -9.330  71.434  33.990  1.00 13.57 ? 376  ASP B O     1 
ATOM   7822  C CB    . ASP B 1 376 ? -6.458  72.385  32.254  1.00 13.77 ? 376  ASP B CB    1 
ATOM   7823  C CG    . ASP B 1 376 ? -6.538  73.462  33.294  1.00 16.69 ? 376  ASP B CG    1 
ATOM   7824  O OD1   . ASP B 1 376 ? -7.633  74.045  33.479  1.00 21.04 ? 376  ASP B OD1   1 
ATOM   7825  O OD2   . ASP B 1 376 ? -5.520  73.737  33.940  1.00 19.30 ? 376  ASP B OD2   1 
ATOM   7826  N N     . ARG B 1 377 ? -9.578  72.060  31.835  1.00 12.79 ? 377  ARG B N     1 
ATOM   7827  C CA    . ARG B 1 377 ? -11.022 72.374  31.962  1.00 12.43 ? 377  ARG B CA    1 
ATOM   7828  C C     . ARG B 1 377 ? -11.342 73.637  32.763  1.00 13.09 ? 377  ARG B C     1 
ATOM   7829  O O     . ARG B 1 377 ? -12.529 73.963  32.979  1.00 13.37 ? 377  ARG B O     1 
ATOM   7830  C CB    . ARG B 1 377 ? -11.815 71.205  32.568  1.00 11.92 ? 377  ARG B CB    1 
ATOM   7831  C CG    . ARG B 1 377 ? -12.120 70.029  31.638  1.00 9.94  ? 377  ARG B CG    1 
ATOM   7832  C CD    . ARG B 1 377 ? -12.117 68.690  32.402  1.00 7.87  ? 377  ARG B CD    1 
ATOM   7833  N NE    . ARG B 1 377 ? -10.822 68.438  33.025  1.00 5.25  ? 377  ARG B NE    1 
ATOM   7834  C CZ    . ARG B 1 377 ? -10.597 68.155  34.308  1.00 4.23  ? 377  ARG B CZ    1 
ATOM   7835  N NH1   . ARG B 1 377 ? -11.600 68.003  35.172  1.00 4.05  ? 377  ARG B NH1   1 
ATOM   7836  N NH2   . ARG B 1 377 ? -9.339  67.987  34.721  1.00 2.00  ? 377  ARG B NH2   1 
ATOM   7837  N N     . SER B 1 378 ? -10.309 74.358  33.204  1.00 13.17 ? 378  SER B N     1 
ATOM   7838  C CA    . SER B 1 378 ? -10.518 75.576  34.039  1.00 13.31 ? 378  SER B CA    1 
ATOM   7839  C C     . SER B 1 378 ? -11.238 76.735  33.377  1.00 12.75 ? 378  SER B C     1 
ATOM   7840  O O     . SER B 1 378 ? -11.729 77.622  34.068  1.00 12.43 ? 378  SER B O     1 
ATOM   7841  C CB    . SER B 1 378 ? -9.190  76.115  34.568  1.00 13.17 ? 378  SER B CB    1 
ATOM   7842  O OG    . SER B 1 378 ? -8.797  75.332  35.661  1.00 14.81 ? 378  SER B OG    1 
ATOM   7843  N N     . SER B 1 379 ? -11.260 76.745  32.048  1.00 12.44 ? 379  SER B N     1 
ATOM   7844  C CA    . SER B 1 379 ? -11.830 77.859  31.315  1.00 12.74 ? 379  SER B CA    1 
ATOM   7845  C C     . SER B 1 379 ? -13.361 77.866  31.402  1.00 12.85 ? 379  SER B C     1 
ATOM   7846  O O     . SER B 1 379 ? -13.973 78.930  31.263  1.00 12.32 ? 379  SER B O     1 
ATOM   7847  C CB    . SER B 1 379 ? -11.355 77.832  29.858  1.00 13.06 ? 379  SER B CB    1 
ATOM   7848  O OG    . SER B 1 379 ? -11.456 76.526  29.281  1.00 13.13 ? 379  SER B OG    1 
ATOM   7849  N N     . LEU B 1 380 ? -13.954 76.685  31.641  1.00 12.98 ? 380  LEU B N     1 
ATOM   7850  C CA    . LEU B 1 380 ? -15.412 76.505  31.669  1.00 13.31 ? 380  LEU B CA    1 
ATOM   7851  C C     . LEU B 1 380 ? -16.048 77.242  32.815  1.00 14.75 ? 380  LEU B C     1 
ATOM   7852  O O     . LEU B 1 380 ? -15.509 77.233  33.926  1.00 14.98 ? 380  LEU B O     1 
ATOM   7853  C CB    . LEU B 1 380 ? -15.747 75.036  31.832  1.00 12.51 ? 380  LEU B CB    1 
ATOM   7854  C CG    . LEU B 1 380 ? -15.393 74.158  30.630  1.00 10.80 ? 380  LEU B CG    1 
ATOM   7855  C CD1   . LEU B 1 380 ? -15.500 72.706  31.004  1.00 3.73  ? 380  LEU B CD1   1 
ATOM   7856  C CD2   . LEU B 1 380 ? -16.288 74.500  29.403  1.00 9.83  ? 380  LEU B CD2   1 
ATOM   7857  N N     . ARG B 1 381 ? -17.192 77.871  32.546  1.00 15.93 ? 381  ARG B N     1 
ATOM   7858  C CA    . ARG B 1 381 ? -18.002 78.556  33.571  1.00 17.28 ? 381  ARG B CA    1 
ATOM   7859  C C     . ARG B 1 381 ? -19.410 77.993  33.578  1.00 16.46 ? 381  ARG B C     1 
ATOM   7860  O O     . ARG B 1 381 ? -20.072 78.009  34.613  1.00 17.00 ? 381  ARG B O     1 
ATOM   7861  C CB    . ARG B 1 381 ? -18.127 80.051  33.271  1.00 17.40 ? 381  ARG B CB    1 
ATOM   7862  C CG    . ARG B 1 381 ? -17.070 80.948  33.889  1.00 19.78 ? 381  ARG B CG    1 
ATOM   7863  C CD    . ARG B 1 381 ? -17.459 82.439  33.673  1.00 21.37 ? 381  ARG B CD    1 
ATOM   7864  N NE    . ARG B 1 381 ? -17.311 82.850  32.260  1.00 28.21 ? 381  ARG B NE    1 
ATOM   7865  C CZ    . ARG B 1 381 ? -16.151 83.206  31.660  1.00 30.22 ? 381  ARG B CZ    1 
ATOM   7866  N NH1   . ARG B 1 381 ? -14.991 83.221  32.327  1.00 27.67 ? 381  ARG B NH1   1 
ATOM   7867  N NH2   . ARG B 1 381 ? -16.140 83.533  30.359  1.00 29.45 ? 381  ARG B NH2   1 
ATOM   7868  N N     . ILE B 1 382 ? -19.872 77.530  32.407  1.00 15.42 ? 382  ILE B N     1 
ATOM   7869  C CA    . ILE B 1 382 ? -21.245 77.105  32.216  1.00 14.00 ? 382  ILE B CA    1 
ATOM   7870  C C     . ILE B 1 382 ? -21.302 75.836  31.417  1.00 14.40 ? 382  ILE B C     1 
ATOM   7871  O O     . ILE B 1 382 ? -20.635 75.717  30.390  1.00 14.64 ? 382  ILE B O     1 
ATOM   7872  C CB    . ILE B 1 382 ? -22.074 78.153  31.440  1.00 14.12 ? 382  ILE B CB    1 
ATOM   7873  C CG1   . ILE B 1 382 ? -22.004 79.540  32.104  1.00 12.62 ? 382  ILE B CG1   1 
ATOM   7874  C CG2   . ILE B 1 382 ? -23.532 77.677  31.294  1.00 12.49 ? 382  ILE B CG2   1 
ATOM   7875  C CD1   . ILE B 1 382 ? -22.928 79.706  33.322  1.00 10.14 ? 382  ILE B CD1   1 
ATOM   7876  N N     . LEU B 1 383 ? -22.119 74.896  31.877  1.00 14.06 ? 383  LEU B N     1 
ATOM   7877  C CA    . LEU B 1 383 ? -22.357 73.669  31.152  1.00 14.17 ? 383  LEU B CA    1 
ATOM   7878  C C     . LEU B 1 383 ? -23.831 73.560  30.783  1.00 15.06 ? 383  LEU B C     1 
ATOM   7879  O O     . LEU B 1 383 ? -24.714 74.059  31.501  1.00 15.46 ? 383  LEU B O     1 
ATOM   7880  C CB    . LEU B 1 383 ? -21.988 72.444  31.994  1.00 13.76 ? 383  LEU B CB    1 
ATOM   7881  C CG    . LEU B 1 383 ? -20.556 72.229  32.472  1.00 12.48 ? 383  LEU B CG    1 
ATOM   7882  C CD1   . LEU B 1 383 ? -20.489 71.071  33.474  1.00 8.61  ? 383  LEU B CD1   1 
ATOM   7883  C CD2   . LEU B 1 383 ? -19.591 72.012  31.306  1.00 9.68  ? 383  LEU B CD2   1 
ATOM   7884  N N     . GLY B 1 384 ? -24.090 72.871  29.679  1.00 15.18 ? 384  GLY B N     1 
ATOM   7885  C CA    . GLY B 1 384 ? -25.441 72.592  29.242  1.00 15.25 ? 384  GLY B CA    1 
ATOM   7886  C C     . GLY B 1 384 ? -25.586 71.149  28.827  1.00 15.21 ? 384  GLY B C     1 
ATOM   7887  O O     . GLY B 1 384 ? -24.618 70.481  28.459  1.00 14.60 ? 384  GLY B O     1 
ATOM   7888  N N     . SER B 1 385 ? -26.814 70.671  28.943  1.00 15.86 ? 385  SER B N     1 
ATOM   7889  C CA    . SER B 1 385 ? -27.198 69.316  28.566  1.00 16.57 ? 385  SER B CA    1 
ATOM   7890  C C     . SER B 1 385 ? -28.479 69.422  27.743  1.00 17.65 ? 385  SER B C     1 
ATOM   7891  O O     . SER B 1 385 ? -29.377 70.231  28.073  1.00 18.07 ? 385  SER B O     1 
ATOM   7892  C CB    . SER B 1 385 ? -27.461 68.475  29.813  1.00 15.72 ? 385  SER B CB    1 
ATOM   7893  O OG    . SER B 1 385 ? -27.654 67.131  29.448  1.00 14.81 ? 385  SER B OG    1 
ATOM   7894  N N     . VAL B 1 386 ? -28.589 68.609  26.695  1.00 18.34 ? 386  VAL B N     1 
ATOM   7895  C CA    . VAL B 1 386 ? -29.752 68.699  25.815  1.00 18.73 ? 386  VAL B CA    1 
ATOM   7896  C C     . VAL B 1 386 ? -30.122 67.399  25.140  1.00 19.09 ? 386  VAL B C     1 
ATOM   7897  O O     . VAL B 1 386 ? -29.261 66.579  24.863  1.00 19.33 ? 386  VAL B O     1 
ATOM   7898  C CB    . VAL B 1 386 ? -29.527 69.737  24.704  1.00 18.70 ? 386  VAL B CB    1 
ATOM   7899  C CG1   . VAL B 1 386 ? -28.255 69.411  23.916  1.00 17.99 ? 386  VAL B CG1   1 
ATOM   7900  C CG2   . VAL B 1 386 ? -30.771 69.840  23.778  1.00 18.00 ? 386  VAL B CG2   1 
ATOM   7901  N N     . GLY B 1 387 ? -31.416 67.226  24.875  1.00 19.37 ? 387  GLY B N     1 
ATOM   7902  C CA    . GLY B 1 387 ? -31.847 66.291  23.873  1.00 19.41 ? 387  GLY B CA    1 
ATOM   7903  C C     . GLY B 1 387 ? -32.472 65.033  24.364  1.00 20.09 ? 387  GLY B C     1 
ATOM   7904  O O     . GLY B 1 387 ? -33.033 64.267  23.560  1.00 20.73 ? 387  GLY B O     1 
ATOM   7905  N N     . GLU B 1 388 ? -32.375 64.801  25.670  1.00 20.13 ? 388  GLU B N     1 
ATOM   7906  C CA    . GLU B 1 388 ? -32.913 63.587  26.295  1.00 20.60 ? 388  GLU B CA    1 
ATOM   7907  C C     . GLU B 1 388 ? -32.803 63.749  27.807  1.00 20.98 ? 388  GLU B C     1 
ATOM   7908  O O     . GLU B 1 388 ? -32.084 64.645  28.273  1.00 20.75 ? 388  GLU B O     1 
ATOM   7909  C CB    . GLU B 1 388 ? -32.150 62.340  25.836  1.00 20.18 ? 388  GLU B CB    1 
ATOM   7910  C CG    . GLU B 1 388 ? -30.688 62.610  25.727  1.00 20.94 ? 388  GLU B CG    1 
ATOM   7911  C CD    . GLU B 1 388 ? -29.864 61.428  25.315  1.00 20.64 ? 388  GLU B CD    1 
ATOM   7912  O OE1   . GLU B 1 388 ? -30.176 60.293  25.749  1.00 18.24 ? 388  GLU B OE1   1 
ATOM   7913  O OE2   . GLU B 1 388 ? -28.868 61.679  24.591  1.00 21.31 ? 388  GLU B OE2   1 
ATOM   7914  N N     . PRO B 1 389 ? -33.514 62.890  28.576  1.00 21.27 ? 389  PRO B N     1 
ATOM   7915  C CA    . PRO B 1 389 ? -33.436 63.032  30.029  1.00 21.23 ? 389  PRO B CA    1 
ATOM   7916  C C     . PRO B 1 389 ? -32.014 62.756  30.448  1.00 21.41 ? 389  PRO B C     1 
ATOM   7917  O O     . PRO B 1 389 ? -31.337 61.937  29.829  1.00 21.03 ? 389  PRO B O     1 
ATOM   7918  C CB    . PRO B 1 389 ? -34.351 61.927  30.566  1.00 21.28 ? 389  PRO B CB    1 
ATOM   7919  C CG    . PRO B 1 389 ? -35.141 61.441  29.376  1.00 21.85 ? 389  PRO B CG    1 
ATOM   7920  C CD    . PRO B 1 389 ? -34.368 61.757  28.155  1.00 21.02 ? 389  PRO B CD    1 
ATOM   7921  N N     . ILE B 1 390 ? -31.555 63.487  31.455  1.00 21.50 ? 390  ILE B N     1 
ATOM   7922  C CA    . ILE B 1 390 ? -30.330 63.155  32.111  1.00 21.12 ? 390  ILE B CA    1 
ATOM   7923  C C     . ILE B 1 390 ? -30.695 62.631  33.482  1.00 21.19 ? 390  ILE B C     1 
ATOM   7924  O O     . ILE B 1 390 ? -31.546 63.180  34.186  1.00 21.34 ? 390  ILE B O     1 
ATOM   7925  C CB    . ILE B 1 390 ? -29.342 64.357  32.216  1.00 21.63 ? 390  ILE B CB    1 
ATOM   7926  C CG1   . ILE B 1 390 ? -27.943 63.860  32.637  1.00 20.17 ? 390  ILE B CG1   1 
ATOM   7927  C CG2   . ILE B 1 390 ? -29.858 65.421  33.196  1.00 20.61 ? 390  ILE B CG2   1 
ATOM   7928  C CD1   . ILE B 1 390 ? -26.839 64.760  32.239  1.00 18.44 ? 390  ILE B CD1   1 
ATOM   7929  N N     . ASN B 1 391 ? -30.022 61.560  33.840  1.00 20.81 ? 391  ASN B N     1 
ATOM   7930  C CA    . ASN B 1 391 ? -30.187 60.911  35.101  1.00 21.20 ? 391  ASN B CA    1 
ATOM   7931  C C     . ASN B 1 391 ? -29.313 61.651  36.160  1.00 20.90 ? 391  ASN B C     1 
ATOM   7932  O O     . ASN B 1 391 ? -28.233 62.149  35.841  1.00 20.53 ? 391  ASN B O     1 
ATOM   7933  C CB    . ASN B 1 391 ? -29.890 59.417  34.812  1.00 21.98 ? 391  ASN B CB    1 
ATOM   7934  C CG    . ASN B 1 391 ? -29.004 58.723  35.823  1.00 23.66 ? 391  ASN B CG    1 
ATOM   7935  O OD1   . ASN B 1 391 ? -28.136 59.309  36.476  1.00 25.93 ? 391  ASN B OD1   1 
ATOM   7936  N ND2   . ASN B 1 391 ? -29.189 57.417  35.905  1.00 26.34 ? 391  ASN B ND2   1 
ATOM   7937  N N     . PRO B 1 392 ? -29.792 61.746  37.418  1.00 20.65 ? 392  PRO B N     1 
ATOM   7938  C CA    . PRO B 1 392 ? -29.030 62.465  38.434  1.00 20.15 ? 392  PRO B CA    1 
ATOM   7939  C C     . PRO B 1 392 ? -27.542 62.087  38.461  1.00 20.29 ? 392  PRO B C     1 
ATOM   7940  O O     . PRO B 1 392 ? -26.668 62.962  38.526  1.00 20.33 ? 392  PRO B O     1 
ATOM   7941  C CB    . PRO B 1 392 ? -29.715 62.033  39.738  1.00 20.05 ? 392  PRO B CB    1 
ATOM   7942  C CG    . PRO B 1 392 ? -31.146 61.789  39.332  1.00 19.31 ? 392  PRO B CG    1 
ATOM   7943  C CD    . PRO B 1 392 ? -31.039 61.162  37.975  1.00 20.38 ? 392  PRO B CD    1 
ATOM   7944  N N     . GLU B 1 393 ? -27.253 60.796  38.393  1.00 20.13 ? 393  GLU B N     1 
ATOM   7945  C CA    . GLU B 1 393 ? -25.890 60.309  38.547  1.00 20.36 ? 393  GLU B CA    1 
ATOM   7946  C C     . GLU B 1 393 ? -24.985 60.764  37.412  1.00 18.92 ? 393  GLU B C     1 
ATOM   7947  O O     . GLU B 1 393 ? -23.820 61.061  37.657  1.00 18.82 ? 393  GLU B O     1 
ATOM   7948  C CB    . GLU B 1 393 ? -25.881 58.792  38.641  1.00 20.22 ? 393  GLU B CB    1 
ATOM   7949  C CG    . GLU B 1 393 ? -26.679 58.230  39.844  1.00 22.97 ? 393  GLU B CG    1 
ATOM   7950  C CD    . GLU B 1 393 ? -26.864 56.686  39.764  1.00 23.92 ? 393  GLU B CD    1 
ATOM   7951  O OE1   . GLU B 1 393 ? -27.341 56.173  38.690  1.00 26.01 ? 393  GLU B OE1   1 
ATOM   7952  O OE2   . GLU B 1 393 ? -26.509 56.012  40.772  1.00 24.89 ? 393  GLU B OE2   1 
ATOM   7953  N N     . ALA B 1 394 ? -25.525 60.814  36.190  1.00 17.18 ? 394  ALA B N     1 
ATOM   7954  C CA    . ALA B 1 394 ? -24.834 61.388  35.043  1.00 16.25 ? 394  ALA B CA    1 
ATOM   7955  C C     . ALA B 1 394 ? -24.747 62.938  35.099  1.00 16.04 ? 394  ALA B C     1 
ATOM   7956  O O     . ALA B 1 394 ? -23.745 63.542  34.676  1.00 15.94 ? 394  ALA B O     1 
ATOM   7957  C CB    . ALA B 1 394 ? -25.478 60.941  33.758  1.00 15.74 ? 394  ALA B CB    1 
ATOM   7958  N N     . TRP B 1 395 ? -25.792 63.572  35.617  1.00 15.26 ? 395  TRP B N     1 
ATOM   7959  C CA    . TRP B 1 395 ? -25.771 64.998  35.887  1.00 14.52 ? 395  TRP B CA    1 
ATOM   7960  C C     . TRP B 1 395 ? -24.645 65.322  36.885  1.00 14.27 ? 395  TRP B C     1 
ATOM   7961  O O     . TRP B 1 395 ? -23.827 66.230  36.627  1.00 14.00 ? 395  TRP B O     1 
ATOM   7962  C CB    . TRP B 1 395 ? -27.139 65.438  36.433  1.00 14.24 ? 395  TRP B CB    1 
ATOM   7963  C CG    . TRP B 1 395 ? -27.360 66.924  36.432  1.00 14.21 ? 395  TRP B CG    1 
ATOM   7964  C CD1   . TRP B 1 395 ? -28.105 67.644  35.525  1.00 14.34 ? 395  TRP B CD1   1 
ATOM   7965  C CD2   . TRP B 1 395 ? -26.845 67.882  37.375  1.00 12.71 ? 395  TRP B CD2   1 
ATOM   7966  N NE1   . TRP B 1 395 ? -28.093 68.973  35.864  1.00 14.29 ? 395  TRP B NE1   1 
ATOM   7967  C CE2   . TRP B 1 395 ? -27.328 69.147  36.990  1.00 12.95 ? 395  TRP B CE2   1 
ATOM   7968  C CE3   . TRP B 1 395 ? -26.040 67.791  38.513  1.00 14.12 ? 395  TRP B CE3   1 
ATOM   7969  C CZ2   . TRP B 1 395 ? -27.020 70.316  37.699  1.00 13.42 ? 395  TRP B CZ2   1 
ATOM   7970  C CZ3   . TRP B 1 395 ? -25.729 68.975  39.219  1.00 14.04 ? 395  TRP B CZ3   1 
ATOM   7971  C CH2   . TRP B 1 395 ? -26.218 70.206  38.803  1.00 12.59 ? 395  TRP B CH2   1 
ATOM   7972  N N     . GLU B 1 396 ? -24.611 64.588  38.006  1.00 13.23 ? 396  GLU B N     1 
ATOM   7973  C CA    . GLU B 1 396 ? -23.603 64.785  39.060  1.00 13.18 ? 396  GLU B CA    1 
ATOM   7974  C C     . GLU B 1 396 ? -22.183 64.589  38.567  1.00 12.95 ? 396  GLU B C     1 
ATOM   7975  O O     . GLU B 1 396 ? -21.303 65.386  38.925  1.00 13.03 ? 396  GLU B O     1 
ATOM   7976  C CB    . GLU B 1 396 ? -23.839 63.892  40.295  1.00 13.16 ? 396  GLU B CB    1 
ATOM   7977  C CG    . GLU B 1 396 ? -24.978 64.349  41.244  1.00 15.21 ? 396  GLU B CG    1 
ATOM   7978  C CD    . GLU B 1 396 ? -24.764 65.749  41.875  1.00 19.48 ? 396  GLU B CD    1 
ATOM   7979  O OE1   . GLU B 1 396 ? -23.593 66.174  42.049  1.00 20.93 ? 396  GLU B OE1   1 
ATOM   7980  O OE2   . GLU B 1 396 ? -25.778 66.419  42.223  1.00 21.73 ? 396  GLU B OE2   1 
ATOM   7981  N N     . TRP B 1 397 ? -21.962 63.553  37.748  1.00 12.18 ? 397  TRP B N     1 
ATOM   7982  C CA    . TRP B 1 397 ? -20.642 63.276  37.146  1.00 11.81 ? 397  TRP B CA    1 
ATOM   7983  C C     . TRP B 1 397 ? -20.148 64.416  36.204  1.00 11.89 ? 397  TRP B C     1 
ATOM   7984  O O     . TRP B 1 397 ? -18.985 64.830  36.249  1.00 12.26 ? 397  TRP B O     1 
ATOM   7985  C CB    . TRP B 1 397 ? -20.659 61.907  36.428  1.00 11.09 ? 397  TRP B CB    1 
ATOM   7986  C CG    . TRP B 1 397 ? -19.316 61.466  35.896  1.00 11.54 ? 397  TRP B CG    1 
ATOM   7987  C CD1   . TRP B 1 397 ? -18.409 60.645  36.526  1.00 10.33 ? 397  TRP B CD1   1 
ATOM   7988  C CD2   . TRP B 1 397 ? -18.718 61.821  34.629  1.00 10.37 ? 397  TRP B CD2   1 
ATOM   7989  N NE1   . TRP B 1 397 ? -17.282 60.480  35.728  1.00 9.99  ? 397  TRP B NE1   1 
ATOM   7990  C CE2   . TRP B 1 397 ? -17.451 61.187  34.565  1.00 11.40 ? 397  TRP B CE2   1 
ATOM   7991  C CE3   . TRP B 1 397 ? -19.126 62.600  33.553  1.00 10.48 ? 397  TRP B CE3   1 
ATOM   7992  C CZ2   . TRP B 1 397 ? -16.598 61.322  33.461  1.00 11.26 ? 397  TRP B CZ2   1 
ATOM   7993  C CZ3   . TRP B 1 397 ? -18.269 62.734  32.452  1.00 10.63 ? 397  TRP B CZ3   1 
ATOM   7994  C CH2   . TRP B 1 397 ? -17.024 62.098  32.418  1.00 9.93  ? 397  TRP B CH2   1 
ATOM   7995  N N     . TYR B 1 398 ? -21.046 64.914  35.364  1.00 11.57 ? 398  TYR B N     1 
ATOM   7996  C CA    . TYR B 1 398 ? -20.772 66.007  34.449  1.00 11.92 ? 398  TYR B CA    1 
ATOM   7997  C C     . TYR B 1 398 ? -20.386 67.260  35.233  1.00 12.62 ? 398  TYR B C     1 
ATOM   7998  O O     . TYR B 1 398 ? -19.384 67.938  34.953  1.00 12.25 ? 398  TYR B O     1 
ATOM   7999  C CB    . TYR B 1 398 ? -22.075 66.289  33.732  1.00 11.69 ? 398  TYR B CB    1 
ATOM   8000  C CG    . TYR B 1 398 ? -22.059 67.252  32.596  1.00 12.20 ? 398  TYR B CG    1 
ATOM   8001  C CD1   . TYR B 1 398 ? -21.020 67.273  31.645  1.00 13.47 ? 398  TYR B CD1   1 
ATOM   8002  C CD2   . TYR B 1 398 ? -23.135 68.100  32.403  1.00 12.41 ? 398  TYR B CD2   1 
ATOM   8003  C CE1   . TYR B 1 398 ? -21.076 68.152  30.552  1.00 13.43 ? 398  TYR B CE1   1 
ATOM   8004  C CE2   . TYR B 1 398 ? -23.190 68.960  31.317  1.00 11.87 ? 398  TYR B CE2   1 
ATOM   8005  C CZ    . TYR B 1 398 ? -22.175 68.991  30.415  1.00 12.30 ? 398  TYR B CZ    1 
ATOM   8006  O OH    . TYR B 1 398 ? -22.298 69.862  29.365  1.00 13.22 ? 398  TYR B OH    1 
ATOM   8007  N N     . TRP B 1 399 ? -21.216 67.533  36.232  1.00 12.98 ? 399  TRP B N     1 
ATOM   8008  C CA    . TRP B 1 399 ? -21.119 68.703  37.050  1.00 13.35 ? 399  TRP B CA    1 
ATOM   8009  C C     . TRP B 1 399 ? -19.782 68.713  37.748  1.00 13.23 ? 399  TRP B C     1 
ATOM   8010  O O     . TRP B 1 399 ? -19.134 69.770  37.858  1.00 13.42 ? 399  TRP B O     1 
ATOM   8011  C CB    . TRP B 1 399 ? -22.277 68.708  38.064  1.00 13.66 ? 399  TRP B CB    1 
ATOM   8012  C CG    . TRP B 1 399 ? -22.250 69.882  38.970  1.00 14.06 ? 399  TRP B CG    1 
ATOM   8013  C CD1   . TRP B 1 399 ? -22.635 71.161  38.673  1.00 13.93 ? 399  TRP B CD1   1 
ATOM   8014  C CD2   . TRP B 1 399 ? -21.792 69.903  40.323  1.00 13.18 ? 399  TRP B CD2   1 
ATOM   8015  N NE1   . TRP B 1 399 ? -22.454 71.968  39.763  1.00 13.12 ? 399  TRP B NE1   1 
ATOM   8016  C CE2   . TRP B 1 399 ? -21.939 71.225  40.790  1.00 13.10 ? 399  TRP B CE2   1 
ATOM   8017  C CE3   . TRP B 1 399 ? -21.290 68.922  41.196  1.00 13.21 ? 399  TRP B CE3   1 
ATOM   8018  C CZ2   . TRP B 1 399 ? -21.583 71.607  42.100  1.00 15.34 ? 399  TRP B CZ2   1 
ATOM   8019  C CZ3   . TRP B 1 399 ? -20.950 69.287  42.497  1.00 13.78 ? 399  TRP B CZ3   1 
ATOM   8020  C CH2   . TRP B 1 399 ? -21.089 70.622  42.938  1.00 14.53 ? 399  TRP B CH2   1 
ATOM   8021  N N     . LYS B 1 400 ? -19.364 67.526  38.186  1.00 13.52 ? 400  LYS B N     1 
ATOM   8022  C CA    . LYS B 1 400 ? -18.148 67.367  38.968  1.00 13.77 ? 400  LYS B CA    1 
ATOM   8023  C C     . LYS B 1 400 ? -16.934 67.215  38.089  1.00 13.32 ? 400  LYS B C     1 
ATOM   8024  O O     . LYS B 1 400 ? -15.975 67.976  38.222  1.00 13.29 ? 400  LYS B O     1 
ATOM   8025  C CB    . LYS B 1 400 ? -18.247 66.175  39.914  1.00 13.62 ? 400  LYS B CB    1 
ATOM   8026  C CG    . LYS B 1 400 ? -16.977 65.929  40.728  1.00 15.10 ? 400  LYS B CG    1 
ATOM   8027  C CD    . LYS B 1 400 ? -17.054 64.612  41.516  1.00 15.22 ? 400  LYS B CD    1 
ATOM   8028  C CE    . LYS B 1 400 ? -15.987 64.584  42.632  1.00 17.77 ? 400  LYS B CE    1 
ATOM   8029  N NZ    . LYS B 1 400 ? -15.647 63.184  43.051  1.00 18.16 ? 400  LYS B NZ    1 
ATOM   8030  N N     . LYS B 1 401 ? -16.960 66.230  37.198  1.00 13.31 ? 401  LYS B N     1 
ATOM   8031  C CA    . LYS B 1 401 ? -15.748 65.878  36.474  1.00 13.18 ? 401  LYS B CA    1 
ATOM   8032  C C     . LYS B 1 401 ? -15.484 66.890  35.388  1.00 13.41 ? 401  LYS B C     1 
ATOM   8033  O O     . LYS B 1 401 ? -14.341 67.323  35.213  1.00 13.37 ? 401  LYS B O     1 
ATOM   8034  C CB    . LYS B 1 401 ? -15.843 64.480  35.881  1.00 13.53 ? 401  LYS B CB    1 
ATOM   8035  C CG    . LYS B 1 401 ? -15.946 63.379  36.930  1.00 13.89 ? 401  LYS B CG    1 
ATOM   8036  C CD    . LYS B 1 401 ? -14.600 63.085  37.524  1.00 13.84 ? 401  LYS B CD    1 
ATOM   8037  C CE    . LYS B 1 401 ? -14.712 62.151  38.727  1.00 13.68 ? 401  LYS B CE    1 
ATOM   8038  N NZ    . LYS B 1 401 ? -13.356 61.744  39.174  1.00 14.12 ? 401  LYS B NZ    1 
ATOM   8039  N N     . ILE B 1 402 ? -16.529 67.289  34.661  1.00 12.66 ? 402  ILE B N     1 
ATOM   8040  C CA    . ILE B 1 402 ? -16.287 68.228  33.585  1.00 11.91 ? 402  ILE B CA    1 
ATOM   8041  C C     . ILE B 1 402 ? -16.270 69.681  34.061  1.00 12.34 ? 402  ILE B C     1 
ATOM   8042  O O     . ILE B 1 402 ? -15.388 70.444  33.664  1.00 12.60 ? 402  ILE B O     1 
ATOM   8043  C CB    . ILE B 1 402 ? -17.236 68.008  32.388  1.00 11.75 ? 402  ILE B CB    1 
ATOM   8044  C CG1   . ILE B 1 402 ? -17.288 66.510  32.031  1.00 11.11 ? 402  ILE B CG1   1 
ATOM   8045  C CG2   . ILE B 1 402 ? -16.851 68.913  31.228  1.00 8.31  ? 402  ILE B CG2   1 
ATOM   8046  C CD1   . ILE B 1 402 ? -16.063 65.936  31.293  1.00 13.22 ? 402  ILE B CD1   1 
ATOM   8047  N N     . GLY B 1 403 ? -17.214 70.058  34.919  1.00 12.22 ? 403  GLY B N     1 
ATOM   8048  C CA    . GLY B 1 403 ? -17.335 71.445  35.356  1.00 12.76 ? 403  GLY B CA    1 
ATOM   8049  C C     . GLY B 1 403 ? -16.637 71.725  36.665  1.00 13.78 ? 403  GLY B C     1 
ATOM   8050  O O     . GLY B 1 403 ? -16.768 72.814  37.220  1.00 13.75 ? 403  GLY B O     1 
ATOM   8051  N N     . LYS B 1 404 ? -15.906 70.733  37.172  1.00 15.07 ? 404  LYS B N     1 
ATOM   8052  C CA    . LYS B 1 404 ? -15.108 70.863  38.407  1.00 15.98 ? 404  LYS B CA    1 
ATOM   8053  C C     . LYS B 1 404 ? -15.884 71.516  39.560  1.00 16.91 ? 404  LYS B C     1 
ATOM   8054  O O     . LYS B 1 404 ? -15.336 72.352  40.291  1.00 16.42 ? 404  LYS B O     1 
ATOM   8055  C CB    . LYS B 1 404 ? -13.830 71.639  38.131  1.00 15.53 ? 404  LYS B CB    1 
ATOM   8056  C CG    . LYS B 1 404 ? -13.019 71.098  36.967  1.00 16.77 ? 404  LYS B CG    1 
ATOM   8057  C CD    . LYS B 1 404 ? -11.812 72.008  36.674  1.00 17.34 ? 404  LYS B CD    1 
ATOM   8058  C CE    . LYS B 1 404 ? -10.595 71.675  37.536  1.00 16.39 ? 404  LYS B CE    1 
ATOM   8059  N NZ    . LYS B 1 404 ? -9.460  72.424  36.976  1.00 15.45 ? 404  LYS B NZ    1 
ATOM   8060  N N     . GLU B 1 405 ? -17.161 71.144  39.690  1.00 17.62 ? 405  GLU B N     1 
ATOM   8061  C CA    . GLU B 1 405 ? -18.053 71.663  40.740  1.00 19.33 ? 405  GLU B CA    1 
ATOM   8062  C C     . GLU B 1 405 ? -18.249 73.175  40.698  1.00 19.39 ? 405  GLU B C     1 
ATOM   8063  O O     . GLU B 1 405 ? -18.957 73.720  41.533  1.00 19.48 ? 405  GLU B O     1 
ATOM   8064  C CB    . GLU B 1 405 ? -17.617 71.229  42.146  1.00 19.18 ? 405  GLU B CB    1 
ATOM   8065  C CG    . GLU B 1 405 ? -17.352 69.715  42.299  1.00 21.50 ? 405  GLU B CG    1 
ATOM   8066  C CD    . GLU B 1 405 ? -17.005 69.289  43.727  1.00 20.93 ? 405  GLU B CD    1 
ATOM   8067  O OE1   . GLU B 1 405 ? -16.586 68.137  43.903  1.00 22.28 ? 405  GLU B OE1   1 
ATOM   8068  O OE2   . GLU B 1 405 ? -17.177 70.086  44.681  1.00 25.10 ? 405  GLU B OE2   1 
ATOM   8069  N N     . LYS B 1 406 ? -17.667 73.841  39.702  1.00 19.63 ? 406  LYS B N     1 
ATOM   8070  C CA    . LYS B 1 406 ? -17.765 75.290  39.599  1.00 19.71 ? 406  LYS B CA    1 
ATOM   8071  C C     . LYS B 1 406 ? -18.854 75.776  38.661  1.00 19.14 ? 406  LYS B C     1 
ATOM   8072  O O     . LYS B 1 406 ? -19.139 76.965  38.645  1.00 20.30 ? 406  LYS B O     1 
ATOM   8073  C CB    . LYS B 1 406 ? -16.424 75.878  39.151  1.00 19.43 ? 406  LYS B CB    1 
ATOM   8074  C CG    . LYS B 1 406 ? -15.389 76.076  40.291  1.00 21.29 ? 406  LYS B CG    1 
ATOM   8075  C CD    . LYS B 1 406 ? -13.936 76.155  39.743  1.00 21.73 ? 406  LYS B CD    1 
ATOM   8076  C CE    . LYS B 1 406 ? -13.626 77.504  39.027  1.00 22.95 ? 406  LYS B CE    1 
ATOM   8077  N NZ    . LYS B 1 406 ? -12.640 78.220  39.877  1.00 27.27 ? 406  LYS B NZ    1 
ATOM   8078  N N     . CYS B 1 407 ? -19.460 74.902  37.855  1.00 18.27 ? 407  CYS B N     1 
ATOM   8079  C CA    . CYS B 1 407 ? -20.356 75.403  36.784  1.00 16.90 ? 407  CYS B CA    1 
ATOM   8080  C C     . CYS B 1 407 ? -21.808 75.032  36.915  1.00 16.67 ? 407  CYS B C     1 
ATOM   8081  O O     . CYS B 1 407 ? -22.124 73.866  37.067  1.00 17.31 ? 407  CYS B O     1 
ATOM   8082  C CB    . CYS B 1 407 ? -19.920 74.904  35.424  1.00 16.35 ? 407  CYS B CB    1 
ATOM   8083  S SG    . CYS B 1 407 ? -18.303 75.361  35.002  1.00 13.74 ? 407  CYS B SG    1 
ATOM   8084  N N     . PRO B 1 408 ? -22.707 76.015  36.822  1.00 16.02 ? 408  PRO B N     1 
ATOM   8085  C CA    . PRO B 1 408 ? -24.099 75.627  36.654  1.00 15.33 ? 408  PRO B CA    1 
ATOM   8086  C C     . PRO B 1 408 ? -24.340 74.794  35.368  1.00 15.40 ? 408  PRO B C     1 
ATOM   8087  O O     . PRO B 1 408 ? -23.764 75.072  34.304  1.00 15.16 ? 408  PRO B O     1 
ATOM   8088  C CB    . PRO B 1 408 ? -24.829 76.968  36.580  1.00 15.51 ? 408  PRO B CB    1 
ATOM   8089  C CG    . PRO B 1 408 ? -23.904 77.954  37.228  1.00 15.83 ? 408  PRO B CG    1 
ATOM   8090  C CD    . PRO B 1 408 ? -22.528 77.473  36.910  1.00 15.94 ? 408  PRO B CD    1 
ATOM   8091  N N     . VAL B 1 409 ? -25.200 73.779  35.492  1.00 14.73 ? 409  VAL B N     1 
ATOM   8092  C CA    . VAL B 1 409 ? -25.608 72.937  34.389  1.00 13.81 ? 409  VAL B CA    1 
ATOM   8093  C C     . VAL B 1 409 ? -27.012 73.333  33.945  1.00 13.96 ? 409  VAL B C     1 
ATOM   8094  O O     . VAL B 1 409 ? -27.956 73.337  34.768  1.00 14.63 ? 409  VAL B O     1 
ATOM   8095  C CB    . VAL B 1 409 ? -25.589 71.417  34.759  1.00 13.40 ? 409  VAL B CB    1 
ATOM   8096  C CG1   . VAL B 1 409 ? -26.122 70.608  33.592  1.00 12.76 ? 409  VAL B CG1   1 
ATOM   8097  C CG2   . VAL B 1 409 ? -24.188 70.962  35.101  1.00 11.88 ? 409  VAL B CG2   1 
ATOM   8098  N N     . VAL B 1 410 ? -27.153 73.658  32.657  1.00 12.77 ? 410  VAL B N     1 
ATOM   8099  C CA    . VAL B 1 410 ? -28.463 73.956  32.097  1.00 12.07 ? 410  VAL B CA    1 
ATOM   8100  C C     . VAL B 1 410 ? -29.013 72.808  31.229  1.00 12.56 ? 410  VAL B C     1 
ATOM   8101  O O     . VAL B 1 410 ? -28.545 72.519  30.096  1.00 12.84 ? 410  VAL B O     1 
ATOM   8102  C CB    . VAL B 1 410 ? -28.552 75.368  31.438  1.00 12.08 ? 410  VAL B CB    1 
ATOM   8103  C CG1   . VAL B 1 410 ? -28.280 76.424  32.497  1.00 12.70 ? 410  VAL B CG1   1 
ATOM   8104  C CG2   . VAL B 1 410 ? -27.571 75.560  30.265  1.00 11.06 ? 410  VAL B CG2   1 
ATOM   8105  N N     . ASP B 1 411 ? -29.993 72.130  31.810  1.00 12.13 ? 411  ASP B N     1 
ATOM   8106  C CA    . ASP B 1 411 ? -30.676 71.012  31.201  1.00 11.76 ? 411  ASP B CA    1 
ATOM   8107  C C     . ASP B 1 411 ? -31.866 71.641  30.497  1.00 12.00 ? 411  ASP B C     1 
ATOM   8108  O O     . ASP B 1 411 ? -32.811 72.075  31.143  1.00 11.79 ? 411  ASP B O     1 
ATOM   8109  C CB    . ASP B 1 411 ? -31.117 70.056  32.304  1.00 11.00 ? 411  ASP B CB    1 
ATOM   8110  C CG    . ASP B 1 411 ? -31.924 68.914  31.804  1.00 10.97 ? 411  ASP B CG    1 
ATOM   8111  O OD1   . ASP B 1 411 ? -32.215 68.833  30.595  1.00 9.27  ? 411  ASP B OD1   1 
ATOM   8112  O OD2   . ASP B 1 411 ? -32.273 68.071  32.653  1.00 14.31 ? 411  ASP B OD2   1 
ATOM   8113  N N     . THR B 1 412 ? -31.798 71.711  29.173  1.00 12.13 ? 412  THR B N     1 
ATOM   8114  C CA    . THR B 1 412 ? -32.768 72.455  28.410  1.00 12.52 ? 412  THR B CA    1 
ATOM   8115  C C     . THR B 1 412 ? -33.722 71.525  27.703  1.00 12.44 ? 412  THR B C     1 
ATOM   8116  O O     . THR B 1 412 ? -33.315 70.785  26.796  1.00 12.03 ? 412  THR B O     1 
ATOM   8117  C CB    . THR B 1 412 ? -32.080 73.316  27.340  1.00 13.24 ? 412  THR B CB    1 
ATOM   8118  O OG1   . THR B 1 412 ? -31.368 72.459  26.433  1.00 14.76 ? 412  THR B OG1   1 
ATOM   8119  C CG2   . THR B 1 412 ? -31.114 74.310  27.966  1.00 13.04 ? 412  THR B CG2   1 
ATOM   8120  N N     . TRP B 1 413 ? -34.994 71.560  28.115  1.00 12.59 ? 413  TRP B N     1 
ATOM   8121  C CA    . TRP B 1 413 ? -36.029 70.790  27.433  1.00 12.65 ? 413  TRP B CA    1 
ATOM   8122  C C     . TRP B 1 413 ? -36.708 71.634  26.358  1.00 12.91 ? 413  TRP B C     1 
ATOM   8123  O O     . TRP B 1 413 ? -37.139 72.770  26.621  1.00 13.03 ? 413  TRP B O     1 
ATOM   8124  C CB    . TRP B 1 413 ? -37.088 70.257  28.398  1.00 12.82 ? 413  TRP B CB    1 
ATOM   8125  C CG    . TRP B 1 413 ? -38.165 69.588  27.641  1.00 12.32 ? 413  TRP B CG    1 
ATOM   8126  C CD1   . TRP B 1 413 ? -38.158 68.306  27.191  1.00 13.28 ? 413  TRP B CD1   1 
ATOM   8127  C CD2   . TRP B 1 413 ? -39.365 70.178  27.148  1.00 13.24 ? 413  TRP B CD2   1 
ATOM   8128  N NE1   . TRP B 1 413 ? -39.294 68.035  26.487  1.00 12.65 ? 413  TRP B NE1   1 
ATOM   8129  C CE2   . TRP B 1 413 ? -40.057 69.168  26.430  1.00 12.01 ? 413  TRP B CE2   1 
ATOM   8130  C CE3   . TRP B 1 413 ? -39.942 71.451  27.262  1.00 14.03 ? 413  TRP B CE3   1 
ATOM   8131  C CZ2   . TRP B 1 413 ? -41.294 69.380  25.829  1.00 11.13 ? 413  TRP B CZ2   1 
ATOM   8132  C CZ3   . TRP B 1 413 ? -41.184 71.668  26.655  1.00 13.77 ? 413  TRP B CZ3   1 
ATOM   8133  C CH2   . TRP B 1 413 ? -41.843 70.626  25.940  1.00 12.81 ? 413  TRP B CH2   1 
ATOM   8134  N N     . TRP B 1 414 ? -36.814 71.071  25.157  1.00 12.83 ? 414  TRP B N     1 
ATOM   8135  C CA    . TRP B 1 414 ? -37.468 71.738  24.033  1.00 12.74 ? 414  TRP B CA    1 
ATOM   8136  C C     . TRP B 1 414 ? -37.483 70.758  22.890  1.00 12.98 ? 414  TRP B C     1 
ATOM   8137  O O     . TRP B 1 414 ? -37.067 69.629  23.074  1.00 13.21 ? 414  TRP B O     1 
ATOM   8138  C CB    . TRP B 1 414 ? -36.753 73.034  23.653  1.00 12.56 ? 414  TRP B CB    1 
ATOM   8139  C CG    . TRP B 1 414 ? -35.364 72.875  23.162  1.00 12.68 ? 414  TRP B CG    1 
ATOM   8140  C CD1   . TRP B 1 414 ? -34.298 72.429  23.871  1.00 13.76 ? 414  TRP B CD1   1 
ATOM   8141  C CD2   . TRP B 1 414 ? -34.867 73.206  21.858  1.00 13.35 ? 414  TRP B CD2   1 
ATOM   8142  N NE1   . TRP B 1 414 ? -33.159 72.446  23.097  1.00 13.35 ? 414  TRP B NE1   1 
ATOM   8143  C CE2   . TRP B 1 414 ? -33.480 72.918  21.852  1.00 13.86 ? 414  TRP B CE2   1 
ATOM   8144  C CE3   . TRP B 1 414 ? -35.455 73.720  20.693  1.00 13.61 ? 414  TRP B CE3   1 
ATOM   8145  C CZ2   . TRP B 1 414 ? -32.665 73.109  20.706  1.00 13.49 ? 414  TRP B CZ2   1 
ATOM   8146  C CZ3   . TRP B 1 414 ? -34.635 73.926  19.550  1.00 13.52 ? 414  TRP B CZ3   1 
ATOM   8147  C CH2   . TRP B 1 414 ? -33.261 73.610  19.569  1.00 12.64 ? 414  TRP B CH2   1 
ATOM   8148  N N     . GLN B 1 415 ? -37.950 71.169  21.712  1.00 13.08 ? 415  GLN B N     1 
ATOM   8149  C CA    . GLN B 1 415 ? -38.126 70.233  20.592  1.00 13.03 ? 415  GLN B CA    1 
ATOM   8150  C C     . GLN B 1 415 ? -37.970 70.999  19.304  1.00 13.09 ? 415  GLN B C     1 
ATOM   8151  O O     . GLN B 1 415 ? -38.074 72.223  19.301  1.00 13.31 ? 415  GLN B O     1 
ATOM   8152  C CB    . GLN B 1 415 ? -39.534 69.630  20.579  1.00 12.90 ? 415  GLN B CB    1 
ATOM   8153  C CG    . GLN B 1 415 ? -40.247 69.564  21.890  1.00 12.51 ? 415  GLN B CG    1 
ATOM   8154  C CD    . GLN B 1 415 ? -41.614 68.952  21.729  1.00 14.43 ? 415  GLN B CD    1 
ATOM   8155  O OE1   . GLN B 1 415 ? -42.586 69.664  21.479  1.00 15.36 ? 415  GLN B OE1   1 
ATOM   8156  N NE2   . GLN B 1 415 ? -41.701 67.616  21.844  1.00 12.50 ? 415  GLN B NE2   1 
ATOM   8157  N N     . THR B 1 416 ? -37.766 70.274  18.210  1.00 12.63 ? 416  THR B N     1 
ATOM   8158  C CA    . THR B 1 416 ? -37.673 70.883  16.891  1.00 12.25 ? 416  THR B CA    1 
ATOM   8159  C C     . THR B 1 416 ? -38.841 71.836  16.667  1.00 12.90 ? 416  THR B C     1 
ATOM   8160  O O     . THR B 1 416 ? -38.657 72.938  16.122  1.00 13.16 ? 416  THR B O     1 
ATOM   8161  C CB    . THR B 1 416 ? -37.689 69.805  15.783  1.00 12.04 ? 416  THR B CB    1 
ATOM   8162  O OG1   . THR B 1 416 ? -36.624 68.874  16.004  1.00 10.00 ? 416  THR B OG1   1 
ATOM   8163  C CG2   . THR B 1 416 ? -37.548 70.430  14.423  1.00 11.22 ? 416  THR B CG2   1 
ATOM   8164  N N     . GLU B 1 417 ? -40.030 71.418  17.111  1.00 12.81 ? 417  GLU B N     1 
ATOM   8165  C CA    . GLU B 1 417 ? -41.259 72.147  16.849  1.00 12.80 ? 417  GLU B CA    1 
ATOM   8166  C C     . GLU B 1 417 ? -41.395 73.379  17.717  1.00 13.45 ? 417  GLU B C     1 
ATOM   8167  O O     . GLU B 1 417 ? -42.336 74.164  17.519  1.00 13.99 ? 417  GLU B O     1 
ATOM   8168  C CB    . GLU B 1 417 ? -42.481 71.264  17.059  1.00 12.86 ? 417  GLU B CB    1 
ATOM   8169  C CG    . GLU B 1 417 ? -42.572 70.074  16.122  1.00 13.09 ? 417  GLU B CG    1 
ATOM   8170  C CD    . GLU B 1 417 ? -42.033 68.796  16.763  1.00 13.99 ? 417  GLU B CD    1 
ATOM   8171  O OE1   . GLU B 1 417 ? -41.283 68.897  17.747  1.00 12.73 ? 417  GLU B OE1   1 
ATOM   8172  O OE2   . GLU B 1 417 ? -42.364 67.685  16.289  1.00 14.43 ? 417  GLU B OE2   1 
ATOM   8173  N N     . THR B 1 418 ? -40.461 73.569  18.660  1.00 13.26 ? 418  THR B N     1 
ATOM   8174  C CA    . THR B 1 418 ? -40.539 74.709  19.570  1.00 13.06 ? 418  THR B CA    1 
ATOM   8175  C C     . THR B 1 418 ? -39.523 75.806  19.253  1.00 13.89 ? 418  THR B C     1 
ATOM   8176  O O     . THR B 1 418 ? -39.565 76.867  19.878  1.00 14.65 ? 418  THR B O     1 
ATOM   8177  C CB    . THR B 1 418 ? -40.468 74.308  21.090  1.00 12.66 ? 418  THR B CB    1 
ATOM   8178  O OG1   . THR B 1 418 ? -39.111 74.074  21.493  1.00 13.23 ? 418  THR B OG1   1 
ATOM   8179  C CG2   . THR B 1 418 ? -41.292 73.082  21.398  1.00 11.13 ? 418  THR B CG2   1 
ATOM   8180  N N     . GLY B 1 419 ? -38.618 75.570  18.302  1.00 13.72 ? 419  GLY B N     1 
ATOM   8181  C CA    . GLY B 1 419 ? -37.650 76.594  17.886  1.00 13.86 ? 419  GLY B CA    1 
ATOM   8182  C C     . GLY B 1 419 ? -36.483 76.873  18.840  1.00 14.45 ? 419  GLY B C     1 
ATOM   8183  O O     . GLY B 1 419 ? -35.330 77.098  18.412  1.00 13.54 ? 419  GLY B O     1 
ATOM   8184  N N     . GLY B 1 420 ? -36.781 76.901  20.138  1.00 14.76 ? 420  GLY B N     1 
ATOM   8185  C CA    . GLY B 1 420 ? -35.770 77.206  21.143  1.00 14.76 ? 420  GLY B CA    1 
ATOM   8186  C C     . GLY B 1 420 ? -36.146 76.671  22.510  1.00 14.85 ? 420  GLY B C     1 
ATOM   8187  O O     . GLY B 1 420 ? -37.169 76.002  22.648  1.00 15.23 ? 420  GLY B O     1 
ATOM   8188  N N     . PHE B 1 421 ? -35.327 76.982  23.520  1.00 14.21 ? 421  PHE B N     1 
ATOM   8189  C CA    . PHE B 1 421 ? -35.473 76.439  24.853  1.00 13.40 ? 421  PHE B CA    1 
ATOM   8190  C C     . PHE B 1 421 ? -36.868 76.701  25.400  1.00 13.08 ? 421  PHE B C     1 
ATOM   8191  O O     . PHE B 1 421 ? -37.427 77.752  25.147  1.00 13.40 ? 421  PHE B O     1 
ATOM   8192  C CB    . PHE B 1 421 ? -34.433 77.070  25.794  1.00 13.44 ? 421  PHE B CB    1 
ATOM   8193  C CG    . PHE B 1 421 ? -32.995 76.798  25.422  1.00 13.55 ? 421  PHE B CG    1 
ATOM   8194  C CD1   . PHE B 1 421 ? -31.994 77.701  25.794  1.00 13.67 ? 421  PHE B CD1   1 
ATOM   8195  C CD2   . PHE B 1 421 ? -32.623 75.644  24.741  1.00 13.90 ? 421  PHE B CD2   1 
ATOM   8196  C CE1   . PHE B 1 421 ? -30.648 77.450  25.477  1.00 13.79 ? 421  PHE B CE1   1 
ATOM   8197  C CE2   . PHE B 1 421 ? -31.262 75.385  24.413  1.00 11.89 ? 421  PHE B CE2   1 
ATOM   8198  C CZ    . PHE B 1 421 ? -30.286 76.290  24.764  1.00 11.55 ? 421  PHE B CZ    1 
ATOM   8199  N N     . MET B 1 422 ? -37.415 75.767  26.169  1.00 13.04 ? 422  MET B N     1 
ATOM   8200  C CA    . MET B 1 422 ? -38.777 75.908  26.690  1.00 13.63 ? 422  MET B CA    1 
ATOM   8201  C C     . MET B 1 422 ? -38.830 75.846  28.216  1.00 14.12 ? 422  MET B C     1 
ATOM   8202  O O     . MET B 1 422 ? -39.458 76.698  28.874  1.00 13.64 ? 422  MET B O     1 
ATOM   8203  C CB    . MET B 1 422 ? -39.695 74.833  26.103  1.00 13.91 ? 422  MET B CB    1 
ATOM   8204  C CG    . MET B 1 422 ? -39.890 74.943  24.591  1.00 14.19 ? 422  MET B CG    1 
ATOM   8205  S SD    . MET B 1 422 ? -40.738 76.459  24.094  1.00 18.32 ? 422  MET B SD    1 
ATOM   8206  C CE    . MET B 1 422 ? -42.412 76.144  24.662  1.00 16.68 ? 422  MET B CE    1 
ATOM   8207  N N     . ILE B 1 423 ? -38.178 74.819  28.769  1.00 14.03 ? 423  ILE B N     1 
ATOM   8208  C CA    . ILE B 1 423 ? -38.068 74.643  30.207  1.00 13.46 ? 423  ILE B CA    1 
ATOM   8209  C C     . ILE B 1 423 ? -36.593 74.369  30.431  1.00 14.02 ? 423  ILE B C     1 
ATOM   8210  O O     . ILE B 1 423 ? -36.017 73.447  29.813  1.00 14.15 ? 423  ILE B O     1 
ATOM   8211  C CB    . ILE B 1 423 ? -38.899 73.486  30.712  1.00 12.99 ? 423  ILE B CB    1 
ATOM   8212  C CG1   . ILE B 1 423 ? -40.377 73.685  30.380  1.00 13.37 ? 423  ILE B CG1   1 
ATOM   8213  C CG2   . ILE B 1 423 ? -38.740 73.351  32.199  1.00 13.66 ? 423  ILE B CG2   1 
ATOM   8214  C CD1   . ILE B 1 423 ? -41.255 72.456  30.677  1.00 14.58 ? 423  ILE B CD1   1 
ATOM   8215  N N     . THR B 1 424 ? -35.993 75.182  31.300  1.00 13.65 ? 424  THR B N     1 
ATOM   8216  C CA    . THR B 1 424 ? -34.546 75.299  31.409  1.00 13.76 ? 424  THR B CA    1 
ATOM   8217  C C     . THR B 1 424 ? -34.176 76.143  32.629  1.00 14.29 ? 424  THR B C     1 
ATOM   8218  O O     . THR B 1 424 ? -34.921 77.039  33.007  1.00 13.66 ? 424  THR B O     1 
ATOM   8219  C CB    . THR B 1 424 ? -33.920 75.980  30.157  1.00 14.24 ? 424  THR B CB    1 
ATOM   8220  O OG1   . THR B 1 424 ? -32.515 76.093  30.339  1.00 11.90 ? 424  THR B OG1   1 
ATOM   8221  C CG2   . THR B 1 424 ? -34.505 77.410  29.898  1.00 12.71 ? 424  THR B CG2   1 
ATOM   8222  N N     . PRO B 1 425 ? -33.039 75.839  33.271  1.00 14.63 ? 425  PRO B N     1 
ATOM   8223  C CA    . PRO B 1 425 ? -32.600 76.811  34.261  1.00 15.27 ? 425  PRO B CA    1 
ATOM   8224  C C     . PRO B 1 425 ? -31.955 78.007  33.566  1.00 15.70 ? 425  PRO B C     1 
ATOM   8225  O O     . PRO B 1 425 ? -31.668 77.929  32.370  1.00 16.67 ? 425  PRO B O     1 
ATOM   8226  C CB    . PRO B 1 425 ? -31.558 76.037  35.085  1.00 15.18 ? 425  PRO B CB    1 
ATOM   8227  C CG    . PRO B 1 425 ? -31.623 74.608  34.602  1.00 15.17 ? 425  PRO B CG    1 
ATOM   8228  C CD    . PRO B 1 425 ? -32.154 74.664  33.215  1.00 14.37 ? 425  PRO B CD    1 
ATOM   8229  N N     . LEU B 1 426 ? -31.796 79.113  34.287  1.00 15.53 ? 426  LEU B N     1 
ATOM   8230  C CA    . LEU B 1 426 ? -30.881 80.187  33.901  1.00 15.31 ? 426  LEU B CA    1 
ATOM   8231  C C     . LEU B 1 426 ? -29.837 80.217  34.991  1.00 15.93 ? 426  LEU B C     1 
ATOM   8232  O O     . LEU B 1 426 ? -30.174 80.271  36.183  1.00 16.97 ? 426  LEU B O     1 
ATOM   8233  C CB    . LEU B 1 426 ? -31.588 81.535  33.811  1.00 14.83 ? 426  LEU B CB    1 
ATOM   8234  C CG    . LEU B 1 426 ? -32.417 81.803  32.555  1.00 15.36 ? 426  LEU B CG    1 
ATOM   8235  C CD1   . LEU B 1 426 ? -33.653 80.942  32.471  1.00 14.89 ? 426  LEU B CD1   1 
ATOM   8236  C CD2   . LEU B 1 426 ? -32.810 83.257  32.533  1.00 17.78 ? 426  LEU B CD2   1 
ATOM   8237  N N     . PRO B 1 427 ? -28.561 80.240  34.614  1.00 16.32 ? 427  PRO B N     1 
ATOM   8238  C CA    . PRO B 1 427 ? -27.525 79.852  35.581  1.00 16.30 ? 427  PRO B CA    1 
ATOM   8239  C C     . PRO B 1 427 ? -27.518 80.715  36.859  1.00 16.44 ? 427  PRO B C     1 
ATOM   8240  O O     . PRO B 1 427 ? -27.172 80.221  37.945  1.00 16.82 ? 427  PRO B O     1 
ATOM   8241  C CB    . PRO B 1 427 ? -26.224 80.079  34.814  1.00 16.60 ? 427  PRO B CB    1 
ATOM   8242  C CG    . PRO B 1 427 ? -26.628 80.263  33.383  1.00 16.93 ? 427  PRO B CG    1 
ATOM   8243  C CD    . PRO B 1 427 ? -28.009 80.750  33.348  1.00 15.72 ? 427  PRO B CD    1 
ATOM   8244  N N     . GLY B 1 428 ? -27.899 81.982  36.732  1.00 15.89 ? 428  GLY B N     1 
ATOM   8245  C CA    . GLY B 1 428 ? -27.821 82.898  37.855  1.00 15.84 ? 428  GLY B CA    1 
ATOM   8246  C C     . GLY B 1 428 ? -29.173 83.259  38.436  1.00 16.27 ? 428  GLY B C     1 
ATOM   8247  O O     . GLY B 1 428 ? -29.276 84.256  39.152  1.00 16.46 ? 428  GLY B O     1 
ATOM   8248  N N     . ALA B 1 429 ? -30.213 82.471  38.136  1.00 15.86 ? 429  ALA B N     1 
ATOM   8249  C CA    . ALA B 1 429 ? -31.552 82.759  38.653  1.00 15.77 ? 429  ALA B CA    1 
ATOM   8250  C C     . ALA B 1 429 ? -32.211 81.555  39.312  1.00 16.35 ? 429  ALA B C     1 
ATOM   8251  O O     . ALA B 1 429 ? -33.000 81.699  40.207  1.00 16.98 ? 429  ALA B O     1 
ATOM   8252  C CB    . ALA B 1 429 ? -32.432 83.302  37.569  1.00 15.24 ? 429  ALA B CB    1 
ATOM   8253  N N     . ILE B 1 430 ? -31.871 80.354  38.877  1.00 17.00 ? 430  ILE B N     1 
ATOM   8254  C CA    . ILE B 1 430 ? -32.588 79.174  39.309  1.00 16.74 ? 430  ILE B CA    1 
ATOM   8255  C C     . ILE B 1 430 ? -31.604 78.191  39.966  1.00 17.45 ? 430  ILE B C     1 
ATOM   8256  O O     . ILE B 1 430 ? -30.529 77.851  39.395  1.00 17.34 ? 430  ILE B O     1 
ATOM   8257  C CB    . ILE B 1 430 ? -33.355 78.515  38.094  1.00 16.71 ? 430  ILE B CB    1 
ATOM   8258  C CG1   . ILE B 1 430 ? -34.467 79.433  37.591  1.00 16.64 ? 430  ILE B CG1   1 
ATOM   8259  C CG2   . ILE B 1 430 ? -33.961 77.191  38.466  1.00 14.94 ? 430  ILE B CG2   1 
ATOM   8260  C CD1   . ILE B 1 430 ? -34.996 79.074  36.214  1.00 16.60 ? 430  ILE B CD1   1 
ATOM   8261  N N     . GLU B 1 431 ? -31.974 77.736  41.163  1.00 17.65 ? 431  GLU B N     1 
ATOM   8262  C CA    . GLU B 1 431 ? -31.197 76.722  41.871  1.00 18.25 ? 431  GLU B CA    1 
ATOM   8263  C C     . GLU B 1 431 ? -31.451 75.378  41.198  1.00 18.41 ? 431  GLU B C     1 
ATOM   8264  O O     . GLU B 1 431 ? -32.582 75.099  40.752  1.00 18.69 ? 431  GLU B O     1 
ATOM   8265  C CB    . GLU B 1 431 ? -31.519 76.728  43.360  1.00 18.23 ? 431  GLU B CB    1 
ATOM   8266  C CG    . GLU B 1 431 ? -31.152 78.069  44.015  1.00 19.31 ? 431  GLU B CG    1 
ATOM   8267  C CD    . GLU B 1 431 ? -31.091 77.998  45.527  1.00 21.99 ? 431  GLU B CD    1 
ATOM   8268  O OE1   . GLU B 1 431 ? -32.029 77.420  46.121  1.00 24.66 ? 431  GLU B OE1   1 
ATOM   8269  O OE2   . GLU B 1 431 ? -30.102 78.509  46.114  1.00 21.32 ? 431  GLU B OE2   1 
ATOM   8270  N N     . LEU B 1 432 ? -30.389 74.584  41.044  1.00 17.90 ? 432  LEU B N     1 
ATOM   8271  C CA    . LEU B 1 432 ? -30.479 73.403  40.194  1.00 17.01 ? 432  LEU B CA    1 
ATOM   8272  C C     . LEU B 1 432 ? -30.776 72.185  41.000  1.00 17.05 ? 432  LEU B C     1 
ATOM   8273  O O     . LEU B 1 432 ? -30.317 72.057  42.138  1.00 17.57 ? 432  LEU B O     1 
ATOM   8274  C CB    . LEU B 1 432 ? -29.182 73.179  39.433  1.00 17.01 ? 432  LEU B CB    1 
ATOM   8275  C CG    . LEU B 1 432 ? -28.529 74.383  38.761  1.00 16.09 ? 432  LEU B CG    1 
ATOM   8276  C CD1   . LEU B 1 432 ? -27.136 74.011  38.274  1.00 14.25 ? 432  LEU B CD1   1 
ATOM   8277  C CD2   . LEU B 1 432 ? -29.409 74.899  37.638  1.00 14.32 ? 432  LEU B CD2   1 
ATOM   8278  N N     . LYS B 1 433 ? -31.563 71.293  40.416  1.00 16.95 ? 433  LYS B N     1 
ATOM   8279  C CA    . LYS B 1 433 ? -31.764 69.957  40.976  1.00 16.49 ? 433  LYS B CA    1 
ATOM   8280  C C     . LYS B 1 433 ? -31.261 68.969  39.945  1.00 16.31 ? 433  LYS B C     1 
ATOM   8281  O O     . LYS B 1 433 ? -31.671 69.032  38.776  1.00 16.78 ? 433  LYS B O     1 
ATOM   8282  C CB    . LYS B 1 433 ? -33.255 69.706  41.280  1.00 17.31 ? 433  LYS B CB    1 
ATOM   8283  C CG    . LYS B 1 433 ? -33.933 70.649  42.343  1.00 16.07 ? 433  LYS B CG    1 
ATOM   8284  C CD    . LYS B 1 433 ? -35.316 70.096  42.773  1.00 16.03 ? 433  LYS B CD    1 
ATOM   8285  C CE    . LYS B 1 433 ? -36.191 71.148  43.475  1.00 16.79 ? 433  LYS B CE    1 
ATOM   8286  N NZ    . LYS B 1 433 ? -37.376 70.596  44.218  1.00 14.51 ? 433  LYS B NZ    1 
ATOM   8287  N N     . ALA B 1 434 ? -30.366 68.070  40.344  1.00 15.90 ? 434  ALA B N     1 
ATOM   8288  C CA    . ALA B 1 434 ? -29.758 67.137  39.371  1.00 15.53 ? 434  ALA B CA    1 
ATOM   8289  C C     . ALA B 1 434 ? -30.809 66.336  38.622  1.00 15.22 ? 434  ALA B C     1 
ATOM   8290  O O     . ALA B 1 434 ? -31.549 65.569  39.234  1.00 15.96 ? 434  ALA B O     1 
ATOM   8291  C CB    . ALA B 1 434 ? -28.758 66.194  40.063  1.00 15.35 ? 434  ALA B CB    1 
ATOM   8292  N N     . GLY B 1 435 ? -30.882 66.526  37.306  1.00 15.27 ? 435  GLY B N     1 
ATOM   8293  C CA    . GLY B 1 435 ? -31.890 65.858  36.456  1.00 14.77 ? 435  GLY B CA    1 
ATOM   8294  C C     . GLY B 1 435 ? -33.172 66.609  36.065  1.00 15.08 ? 435  GLY B C     1 
ATOM   8295  O O     . GLY B 1 435 ? -33.980 66.083  35.285  1.00 14.21 ? 435  GLY B O     1 
ATOM   8296  N N     . SER B 1 436 ? -33.370 67.829  36.597  1.00 15.30 ? 436  SER B N     1 
ATOM   8297  C CA    . SER B 1 436 ? -34.601 68.595  36.375  1.00 14.85 ? 436  SER B CA    1 
ATOM   8298  C C     . SER B 1 436 ? -34.382 69.682  35.298  1.00 14.80 ? 436  SER B C     1 
ATOM   8299  O O     . SER B 1 436 ? -33.352 70.366  35.313  1.00 15.60 ? 436  SER B O     1 
ATOM   8300  C CB    . SER B 1 436 ? -35.088 69.190  37.715  1.00 14.85 ? 436  SER B CB    1 
ATOM   8301  O OG    . SER B 1 436 ? -36.132 70.161  37.564  1.00 14.50 ? 436  SER B OG    1 
ATOM   8302  N N     . ALA B 1 437 ? -35.318 69.840  34.363  1.00 13.53 ? 437  ALA B N     1 
ATOM   8303  C CA    . ALA B 1 437 ? -35.242 70.980  33.448  1.00 13.64 ? 437  ALA B CA    1 
ATOM   8304  C C     . ALA B 1 437 ? -35.522 72.281  34.204  1.00 13.76 ? 437  ALA B C     1 
ATOM   8305  O O     . ALA B 1 437 ? -35.119 73.350  33.768  1.00 13.03 ? 437  ALA B O     1 
ATOM   8306  C CB    . ALA B 1 437 ? -36.178 70.824  32.239  1.00 13.08 ? 437  ALA B CB    1 
ATOM   8307  N N     . THR B 1 438 ? -36.167 72.149  35.361  1.00 14.05 ? 438  THR B N     1 
ATOM   8308  C CA    . THR B 1 438 ? -36.548 73.264  36.230  1.00 15.02 ? 438  THR B CA    1 
ATOM   8309  C C     . THR B 1 438 ? -37.771 74.067  35.728  1.00 15.08 ? 438  THR B C     1 
ATOM   8310  O O     . THR B 1 438 ? -38.850 73.506  35.582  1.00 15.21 ? 438  THR B O     1 
ATOM   8311  C CB    . THR B 1 438 ? -35.340 74.194  36.640  1.00 15.17 ? 438  THR B CB    1 
ATOM   8312  O OG1   . THR B 1 438 ? -34.990 75.064  35.553  1.00 16.24 ? 438  THR B OG1   1 
ATOM   8313  C CG2   . THR B 1 438 ? -34.112 73.369  37.054  1.00 15.21 ? 438  THR B CG2   1 
ATOM   8314  N N     . ARG B 1 439 ? -37.595 75.363  35.480  1.00 15.03 ? 439  ARG B N     1 
ATOM   8315  C CA    . ARG B 1 439 ? -38.708 76.301  35.279  1.00 15.62 ? 439  ARG B CA    1 
ATOM   8316  C C     . ARG B 1 439 ? -38.964 76.659  33.809  1.00 15.37 ? 439  ARG B C     1 
ATOM   8317  O O     . ARG B 1 439 ? -38.043 76.612  32.996  1.00 15.96 ? 439  ARG B O     1 
ATOM   8318  C CB    . ARG B 1 439 ? -38.448 77.591  36.078  1.00 15.22 ? 439  ARG B CB    1 
ATOM   8319  C CG    . ARG B 1 439 ? -38.648 77.416  37.586  1.00 16.40 ? 439  ARG B CG    1 
ATOM   8320  C CD    . ARG B 1 439 ? -38.838 78.746  38.349  1.00 17.15 ? 439  ARG B CD    1 
ATOM   8321  N NE    . ARG B 1 439 ? -38.860 78.528  39.797  1.00 20.41 ? 439  ARG B NE    1 
ATOM   8322  C CZ    . ARG B 1 439 ? -39.797 77.806  40.418  1.00 22.57 ? 439  ARG B CZ    1 
ATOM   8323  N NH1   . ARG B 1 439 ? -40.775 77.249  39.702  1.00 21.58 ? 439  ARG B NH1   1 
ATOM   8324  N NH2   . ARG B 1 439 ? -39.756 77.624  41.746  1.00 22.76 ? 439  ARG B NH2   1 
ATOM   8325  N N     . PRO B 1 440 ? -40.214 77.037  33.459  1.00 15.09 ? 440  PRO B N     1 
ATOM   8326  C CA    . PRO B 1 440 ? -40.379 77.452  32.059  1.00 14.50 ? 440  PRO B CA    1 
ATOM   8327  C C     . PRO B 1 440 ? -39.610 78.749  31.737  1.00 14.01 ? 440  PRO B C     1 
ATOM   8328  O O     . PRO B 1 440 ? -39.398 79.587  32.607  1.00 13.37 ? 440  PRO B O     1 
ATOM   8329  C CB    . PRO B 1 440 ? -41.885 77.681  31.921  1.00 14.30 ? 440  PRO B CB    1 
ATOM   8330  C CG    . PRO B 1 440 ? -42.379 77.892  33.351  1.00 15.36 ? 440  PRO B CG    1 
ATOM   8331  C CD    . PRO B 1 440 ? -41.473 77.105  34.239  1.00 14.61 ? 440  PRO B CD    1 
ATOM   8332  N N     . PHE B 1 441 ? -39.215 78.898  30.483  1.00 13.40 ? 441  PHE B N     1 
ATOM   8333  C CA    . PHE B 1 441 ? -38.578 80.106  30.033  1.00 13.65 ? 441  PHE B CA    1 
ATOM   8334  C C     . PHE B 1 441 ? -39.620 81.209  29.805  1.00 14.28 ? 441  PHE B C     1 
ATOM   8335  O O     . PHE B 1 441 ? -40.843 80.968  29.787  1.00 14.60 ? 441  PHE B O     1 
ATOM   8336  C CB    . PHE B 1 441 ? -37.767 79.805  28.766  1.00 13.21 ? 441  PHE B CB    1 
ATOM   8337  C CG    . PHE B 1 441 ? -36.928 80.945  28.312  1.00 13.55 ? 441  PHE B CG    1 
ATOM   8338  C CD1   . PHE B 1 441 ? -35.680 81.177  28.884  1.00 12.67 ? 441  PHE B CD1   1 
ATOM   8339  C CD2   . PHE B 1 441 ? -37.383 81.815  27.313  1.00 11.52 ? 441  PHE B CD2   1 
ATOM   8340  C CE1   . PHE B 1 441 ? -34.901 82.262  28.462  1.00 11.77 ? 441  PHE B CE1   1 
ATOM   8341  C CE2   . PHE B 1 441 ? -36.604 82.880  26.899  1.00 10.52 ? 441  PHE B CE2   1 
ATOM   8342  C CZ    . PHE B 1 441 ? -35.368 83.110  27.479  1.00 10.78 ? 441  PHE B CZ    1 
ATOM   8343  N N     . PHE B 1 442 ? -39.144 82.434  29.645  1.00 14.82 ? 442  PHE B N     1 
ATOM   8344  C CA    . PHE B 1 442 ? -40.033 83.567  29.372  1.00 14.82 ? 442  PHE B CA    1 
ATOM   8345  C C     . PHE B 1 442 ? -41.036 83.259  28.266  1.00 15.16 ? 442  PHE B C     1 
ATOM   8346  O O     . PHE B 1 442 ? -40.652 82.828  27.181  1.00 15.47 ? 442  PHE B O     1 
ATOM   8347  C CB    . PHE B 1 442 ? -39.217 84.798  29.003  1.00 14.42 ? 442  PHE B CB    1 
ATOM   8348  C CG    . PHE B 1 442 ? -38.169 85.152  30.010  1.00 14.63 ? 442  PHE B CG    1 
ATOM   8349  C CD1   . PHE B 1 442 ? -36.916 85.564  29.604  1.00 16.72 ? 442  PHE B CD1   1 
ATOM   8350  C CD2   . PHE B 1 442 ? -38.427 85.069  31.368  1.00 15.67 ? 442  PHE B CD2   1 
ATOM   8351  C CE1   . PHE B 1 442 ? -35.932 85.923  30.540  1.00 17.50 ? 442  PHE B CE1   1 
ATOM   8352  C CE2   . PHE B 1 442 ? -37.442 85.398  32.314  1.00 16.50 ? 442  PHE B CE2   1 
ATOM   8353  C CZ    . PHE B 1 442 ? -36.198 85.827  31.897  1.00 15.84 ? 442  PHE B CZ    1 
ATOM   8354  N N     . GLY B 1 443 ? -42.322 83.451  28.553  1.00 15.02 ? 443  GLY B N     1 
ATOM   8355  C CA    . GLY B 1 443 ? -43.350 83.405  27.520  1.00 14.77 ? 443  GLY B CA    1 
ATOM   8356  C C     . GLY B 1 443 ? -43.887 82.022  27.253  1.00 14.84 ? 443  GLY B C     1 
ATOM   8357  O O     . GLY B 1 443 ? -44.728 81.852  26.376  1.00 14.21 ? 443  GLY B O     1 
ATOM   8358  N N     . VAL B 1 444 ? -43.384 81.046  28.017  1.00 15.01 ? 444  VAL B N     1 
ATOM   8359  C CA    . VAL B 1 444 ? -43.805 79.651  27.943  1.00 15.13 ? 444  VAL B CA    1 
ATOM   8360  C C     . VAL B 1 444 ? -44.736 79.321  29.101  1.00 15.93 ? 444  VAL B C     1 
ATOM   8361  O O     . VAL B 1 444 ? -44.386 79.567  30.252  1.00 16.12 ? 444  VAL B O     1 
ATOM   8362  C CB    . VAL B 1 444 ? -42.599 78.678  28.045  1.00 15.32 ? 444  VAL B CB    1 
ATOM   8363  C CG1   . VAL B 1 444 ? -43.062 77.209  27.902  1.00 13.61 ? 444  VAL B CG1   1 
ATOM   8364  C CG2   . VAL B 1 444 ? -41.513 79.019  27.029  1.00 14.47 ? 444  VAL B CG2   1 
ATOM   8365  N N     . GLN B 1 445 ? -45.902 78.740  28.810  1.00 16.67 ? 445  GLN B N     1 
ATOM   8366  C CA    . GLN B 1 445 ? -46.832 78.324  29.866  1.00 17.52 ? 445  GLN B CA    1 
ATOM   8367  C C     . GLN B 1 445 ? -47.022 76.811  29.816  1.00 17.39 ? 445  GLN B C     1 
ATOM   8368  O O     . GLN B 1 445 ? -47.883 76.316  29.095  1.00 18.20 ? 445  GLN B O     1 
ATOM   8369  C CB    . GLN B 1 445 ? -48.179 79.047  29.746  1.00 16.95 ? 445  GLN B CB    1 
ATOM   8370  C CG    . GLN B 1 445 ? -48.053 80.557  29.773  1.00 18.51 ? 445  GLN B CG    1 
ATOM   8371  C CD    . GLN B 1 445 ? -49.382 81.301  29.513  1.00 19.60 ? 445  GLN B CD    1 
ATOM   8372  O OE1   . GLN B 1 445 ? -50.444 80.925  30.012  1.00 21.90 ? 445  GLN B OE1   1 
ATOM   8373  N NE2   . GLN B 1 445 ? -49.308 82.370  28.734  1.00 21.25 ? 445  GLN B NE2   1 
ATOM   8374  N N     . PRO B 1 446 ? -46.211 76.060  30.569  1.00 17.47 ? 446  PRO B N     1 
ATOM   8375  C CA    . PRO B 1 446 ? -46.402 74.606  30.557  1.00 17.58 ? 446  PRO B CA    1 
ATOM   8376  C C     . PRO B 1 446 ? -47.603 74.184  31.395  1.00 17.55 ? 446  PRO B C     1 
ATOM   8377  O O     . PRO B 1 446 ? -48.037 74.934  32.249  1.00 18.01 ? 446  PRO B O     1 
ATOM   8378  C CB    . PRO B 1 446 ? -45.108 74.070  31.182  1.00 17.20 ? 446  PRO B CB    1 
ATOM   8379  C CG    . PRO B 1 446 ? -44.581 75.192  32.000  1.00 17.43 ? 446  PRO B CG    1 
ATOM   8380  C CD    . PRO B 1 446 ? -45.120 76.481  31.468  1.00 17.07 ? 446  PRO B CD    1 
ATOM   8381  N N     . ALA B 1 447 ? -48.146 73.005  31.121  1.00 17.76 ? 447  ALA B N     1 
ATOM   8382  C CA    . ALA B 1 447 ? -49.168 72.377  31.974  1.00 17.95 ? 447  ALA B CA    1 
ATOM   8383  C C     . ALA B 1 447 ? -49.140 70.852  31.813  1.00 17.98 ? 447  ALA B C     1 
ATOM   8384  O O     . ALA B 1 447 ? -48.701 70.324  30.775  1.00 18.49 ? 447  ALA B O     1 
ATOM   8385  C CB    . ALA B 1 447 ? -50.572 72.944  31.682  1.00 17.37 ? 447  ALA B CB    1 
ATOM   8386  N N     . LEU B 1 448 ? -49.585 70.150  32.843  1.00 18.01 ? 448  LEU B N     1 
ATOM   8387  C CA    . LEU B 1 448 ? -49.670 68.701  32.791  1.00 18.51 ? 448  LEU B CA    1 
ATOM   8388  C C     . LEU B 1 448 ? -51.145 68.339  32.785  1.00 19.04 ? 448  LEU B C     1 
ATOM   8389  O O     . LEU B 1 448 ? -51.929 68.929  33.524  1.00 19.58 ? 448  LEU B O     1 
ATOM   8390  C CB    . LEU B 1 448 ? -49.003 68.069  34.011  1.00 18.41 ? 448  LEU B CB    1 
ATOM   8391  C CG    . LEU B 1 448 ? -47.536 68.355  34.358  1.00 19.21 ? 448  LEU B CG    1 
ATOM   8392  C CD1   . LEU B 1 448 ? -47.183 67.610  35.647  1.00 20.22 ? 448  LEU B CD1   1 
ATOM   8393  C CD2   . LEU B 1 448 ? -46.604 67.943  33.211  1.00 18.94 ? 448  LEU B CD2   1 
ATOM   8394  N N     . VAL B 1 449 ? -51.529 67.372  31.964  1.00 18.67 ? 449  VAL B N     1 
ATOM   8395  C CA    . VAL B 1 449 ? -52.913 66.951  31.895  1.00 18.55 ? 449  VAL B CA    1 
ATOM   8396  C C     . VAL B 1 449 ? -52.967 65.441  31.946  1.00 18.77 ? 449  VAL B C     1 
ATOM   8397  O O     . VAL B 1 449 ? -52.009 64.783  31.579  1.00 19.35 ? 449  VAL B O     1 
ATOM   8398  C CB    . VAL B 1 449 ? -53.587 67.442  30.579  1.00 18.52 ? 449  VAL B CB    1 
ATOM   8399  C CG1   . VAL B 1 449 ? -53.647 68.945  30.545  1.00 18.14 ? 449  VAL B CG1   1 
ATOM   8400  C CG2   . VAL B 1 449 ? -52.890 66.857  29.297  1.00 17.75 ? 449  VAL B CG2   1 
ATOM   8401  N N     . ASP B 1 450 ? -54.072 64.857  32.364  1.00 19.07 ? 450  ASP B N     1 
ATOM   8402  C CA    . ASP B 1 450 ? -54.143 63.401  32.260  1.00 19.86 ? 450  ASP B CA    1 
ATOM   8403  C C     . ASP B 1 450 ? -54.499 62.999  30.836  1.00 19.90 ? 450  ASP B C     1 
ATOM   8404  O O     . ASP B 1 450 ? -54.431 63.808  29.908  1.00 19.73 ? 450  ASP B O     1 
ATOM   8405  C CB    . ASP B 1 450 ? -55.142 62.809  33.247  1.00 20.24 ? 450  ASP B CB    1 
ATOM   8406  C CG    . ASP B 1 450 ? -56.545 63.331  33.040  1.00 21.40 ? 450  ASP B CG    1 
ATOM   8407  O OD1   . ASP B 1 450 ? -56.846 63.897  31.955  1.00 23.28 ? 450  ASP B OD1   1 
ATOM   8408  O OD2   . ASP B 1 450 ? -57.344 63.181  33.986  1.00 24.15 ? 450  ASP B OD2   1 
ATOM   8409  N N     . ASN B 1 451 ? -54.906 61.756  30.675  1.00 20.01 ? 451  ASN B N     1 
ATOM   8410  C CA    . ASN B 1 451 ? -55.232 61.268  29.361  1.00 21.05 ? 451  ASN B CA    1 
ATOM   8411  C C     . ASN B 1 451 ? -56.499 61.827  28.741  1.00 21.81 ? 451  ASN B C     1 
ATOM   8412  O O     . ASN B 1 451 ? -56.623 61.792  27.514  1.00 21.68 ? 451  ASN B O     1 
ATOM   8413  C CB    . ASN B 1 451 ? -55.235 59.749  29.343  1.00 20.75 ? 451  ASN B CB    1 
ATOM   8414  C CG    . ASN B 1 451 ? -53.852 59.194  29.341  1.00 20.04 ? 451  ASN B CG    1 
ATOM   8415  O OD1   . ASN B 1 451 ? -52.910 59.825  28.836  1.00 17.43 ? 451  ASN B OD1   1 
ATOM   8416  N ND2   . ASN B 1 451 ? -53.699 58.015  29.916  1.00 19.64 ? 451  ASN B ND2   1 
ATOM   8417  N N     . GLU B 1 452 ? -57.429 62.314  29.569  1.00 22.71 ? 452  GLU B N     1 
ATOM   8418  C CA    . GLU B 1 452 ? -58.676 62.912  29.056  1.00 23.93 ? 452  GLU B CA    1 
ATOM   8419  C C     . GLU B 1 452 ? -58.592 64.440  29.003  1.00 23.59 ? 452  GLU B C     1 
ATOM   8420  O O     . GLU B 1 452 ? -59.603 65.131  28.839  1.00 23.65 ? 452  GLU B O     1 
ATOM   8421  C CB    . GLU B 1 452 ? -59.906 62.446  29.849  1.00 24.29 ? 452  GLU B CB    1 
ATOM   8422  C CG    . GLU B 1 452 ? -60.173 60.933  29.790  1.00 28.80 ? 452  GLU B CG    1 
ATOM   8423  C CD    . GLU B 1 452 ? -59.313 60.139  30.791  1.00 34.72 ? 452  GLU B CD    1 
ATOM   8424  O OE1   . GLU B 1 452 ? -59.429 60.414  32.016  1.00 37.73 ? 452  GLU B OE1   1 
ATOM   8425  O OE2   . GLU B 1 452 ? -58.521 59.256  30.356  1.00 34.52 ? 452  GLU B OE2   1 
ATOM   8426  N N     . GLY B 1 453 ? -57.378 64.961  29.151  1.00 23.44 ? 453  GLY B N     1 
ATOM   8427  C CA    . GLY B 1 453 ? -57.141 66.392  29.027  1.00 23.31 ? 453  GLY B CA    1 
ATOM   8428  C C     . GLY B 1 453 ? -57.369 67.208  30.281  1.00 23.29 ? 453  GLY B C     1 
ATOM   8429  O O     . GLY B 1 453 ? -57.284 68.435  30.222  1.00 22.90 ? 453  GLY B O     1 
ATOM   8430  N N     . HIS B 1 454 ? -57.648 66.534  31.406  1.00 23.55 ? 454  HIS B N     1 
ATOM   8431  C CA    . HIS B 1 454 ? -57.874 67.206  32.692  1.00 23.59 ? 454  HIS B CA    1 
ATOM   8432  C C     . HIS B 1 454 ? -56.549 67.752  33.224  1.00 23.88 ? 454  HIS B C     1 
ATOM   8433  O O     . HIS B 1 454 ? -55.621 66.979  33.491  1.00 23.55 ? 454  HIS B O     1 
ATOM   8434  C CB    . HIS B 1 454 ? -58.472 66.253  33.741  1.00 23.67 ? 454  HIS B CB    1 
ATOM   8435  C CG    . HIS B 1 454 ? -59.795 65.653  33.365  1.00 24.89 ? 454  HIS B CG    1 
ATOM   8436  N ND1   . HIS B 1 454 ? -60.006 64.290  33.325  1.00 25.82 ? 454  HIS B ND1   1 
ATOM   8437  C CD2   . HIS B 1 454 ? -60.984 66.223  33.049  1.00 25.56 ? 454  HIS B CD2   1 
ATOM   8438  C CE1   . HIS B 1 454 ? -61.256 64.046  32.968  1.00 25.31 ? 454  HIS B CE1   1 
ATOM   8439  N NE2   . HIS B 1 454 ? -61.871 65.202  32.796  1.00 24.97 ? 454  HIS B NE2   1 
ATOM   8440  N N     . PRO B 1 455 ? -56.445 69.088  33.388  1.00 24.44 ? 455  PRO B N     1 
ATOM   8441  C CA    . PRO B 1 455 ? -55.230 69.647  34.007  1.00 24.50 ? 455  PRO B CA    1 
ATOM   8442  C C     . PRO B 1 455 ? -54.933 69.059  35.384  1.00 24.69 ? 455  PRO B C     1 
ATOM   8443  O O     . PRO B 1 455 ? -55.854 68.829  36.188  1.00 24.75 ? 455  PRO B O     1 
ATOM   8444  C CB    . PRO B 1 455 ? -55.555 71.143  34.129  1.00 24.14 ? 455  PRO B CB    1 
ATOM   8445  C CG    . PRO B 1 455 ? -56.516 71.391  32.986  1.00 24.45 ? 455  PRO B CG    1 
ATOM   8446  C CD    . PRO B 1 455 ? -57.395 70.157  33.009  1.00 24.52 ? 455  PRO B CD    1 
ATOM   8447  N N     . GLN B 1 456 ? -53.652 68.810  35.645  1.00 24.95 ? 456  GLN B N     1 
ATOM   8448  C CA    . GLN B 1 456 ? -53.208 68.324  36.955  1.00 24.91 ? 456  GLN B CA    1 
ATOM   8449  C C     . GLN B 1 456 ? -52.463 69.430  37.702  1.00 24.76 ? 456  GLN B C     1 
ATOM   8450  O O     . GLN B 1 456 ? -51.602 70.101  37.154  1.00 24.62 ? 456  GLN B O     1 
ATOM   8451  C CB    . GLN B 1 456 ? -52.360 67.048  36.809  1.00 25.28 ? 456  GLN B CB    1 
ATOM   8452  C CG    . GLN B 1 456 ? -53.029 65.872  36.051  1.00 25.19 ? 456  GLN B CG    1 
ATOM   8453  C CD    . GLN B 1 456 ? -54.306 65.361  36.733  1.00 26.18 ? 456  GLN B CD    1 
ATOM   8454  O OE1   . GLN B 1 456 ? -55.418 65.591  36.243  1.00 26.68 ? 456  GLN B OE1   1 
ATOM   8455  N NE2   . GLN B 1 456 ? -54.147 64.673  37.866  1.00 24.60 ? 456  GLN B NE2   1 
ATOM   8456  N N     . GLU B 1 457 ? -52.822 69.619  38.960  1.00 25.24 ? 457  GLU B N     1 
ATOM   8457  C CA    . GLU B 1 457 ? -52.375 70.762  39.750  1.00 25.50 ? 457  GLU B CA    1 
ATOM   8458  C C     . GLU B 1 457 ? -51.490 70.268  40.875  1.00 24.44 ? 457  GLU B C     1 
ATOM   8459  O O     . GLU B 1 457 ? -51.541 69.091  41.236  1.00 24.02 ? 457  GLU B O     1 
ATOM   8460  C CB    . GLU B 1 457 ? -53.589 71.517  40.294  1.00 25.52 ? 457  GLU B CB    1 
ATOM   8461  C CG    . GLU B 1 457 ? -54.465 72.115  39.173  1.00 27.92 ? 457  GLU B CG    1 
ATOM   8462  C CD    . GLU B 1 457 ? -55.957 72.313  39.539  1.00 28.25 ? 457  GLU B CD    1 
ATOM   8463  O OE1   . GLU B 1 457 ? -56.486 71.639  40.463  1.00 33.75 ? 457  GLU B OE1   1 
ATOM   8464  O OE2   . GLU B 1 457 ? -56.614 73.145  38.869  1.00 31.17 ? 457  GLU B OE2   1 
ATOM   8465  N N     . GLY B 1 458 ? -50.657 71.167  41.396  1.00 24.21 ? 458  GLY B N     1 
ATOM   8466  C CA    . GLY B 1 458 ? -49.681 70.848  42.441  1.00 23.62 ? 458  GLY B CA    1 
ATOM   8467  C C     . GLY B 1 458 ? -48.577 69.924  41.980  1.00 23.45 ? 458  GLY B C     1 
ATOM   8468  O O     . GLY B 1 458 ? -48.315 69.816  40.780  1.00 23.80 ? 458  GLY B O     1 
ATOM   8469  N N     . ALA B 1 459 ? -47.921 69.274  42.940  1.00 23.21 ? 459  ALA B N     1 
ATOM   8470  C CA    . ALA B 1 459 ? -46.952 68.206  42.672  1.00 23.07 ? 459  ALA B CA    1 
ATOM   8471  C C     . ALA B 1 459 ? -47.664 67.004  42.095  1.00 23.27 ? 459  ALA B C     1 
ATOM   8472  O O     . ALA B 1 459 ? -48.386 66.293  42.812  1.00 23.29 ? 459  ALA B O     1 
ATOM   8473  C CB    . ALA B 1 459 ? -46.216 67.802  43.944  1.00 22.53 ? 459  ALA B CB    1 
ATOM   8474  N N     . THR B 1 460 ? -47.455 66.771  40.802  1.00 23.38 ? 460  THR B N     1 
ATOM   8475  C CA    . THR B 1 460 ? -48.165 65.708  40.084  1.00 23.70 ? 460  THR B CA    1 
ATOM   8476  C C     . THR B 1 460 ? -47.362 65.228  38.859  1.00 23.69 ? 460  THR B C     1 
ATOM   8477  O O     . THR B 1 460 ? -46.232 65.661  38.661  1.00 23.64 ? 460  THR B O     1 
ATOM   8478  C CB    . THR B 1 460 ? -49.567 66.201  39.660  1.00 23.59 ? 460  THR B CB    1 
ATOM   8479  O OG1   . THR B 1 460 ? -50.283 65.131  39.059  1.00 25.36 ? 460  THR B OG1   1 
ATOM   8480  C CG2   . THR B 1 460 ? -49.484 67.342  38.652  1.00 23.63 ? 460  THR B CG2   1 
ATOM   8481  N N     . GLU B 1 461 ? -47.942 64.339  38.054  1.00 23.30 ? 461  GLU B N     1 
ATOM   8482  C CA    . GLU B 1 461 ? -47.381 63.987  36.745  1.00 23.89 ? 461  GLU B CA    1 
ATOM   8483  C C     . GLU B 1 461 ? -48.480 63.958  35.690  1.00 22.56 ? 461  GLU B C     1 
ATOM   8484  O O     . GLU B 1 461 ? -49.653 63.912  36.039  1.00 23.51 ? 461  GLU B O     1 
ATOM   8485  C CB    . GLU B 1 461 ? -46.665 62.630  36.791  1.00 23.87 ? 461  GLU B CB    1 
ATOM   8486  C CG    . GLU B 1 461 ? -47.575 61.427  37.083  1.00 26.22 ? 461  GLU B CG    1 
ATOM   8487  C CD    . GLU B 1 461 ? -46.781 60.183  37.452  1.00 26.82 ? 461  GLU B CD    1 
ATOM   8488  O OE1   . GLU B 1 461 ? -47.382 59.071  37.501  1.00 29.56 ? 461  GLU B OE1   1 
ATOM   8489  O OE2   . GLU B 1 461 ? -45.551 60.328  37.686  1.00 29.54 ? 461  GLU B OE2   1 
ATOM   8490  N N     . GLY B 1 462 ? -48.112 63.989  34.411  1.00 21.05 ? 462  GLY B N     1 
ATOM   8491  C CA    . GLY B 1 462 ? -49.062 63.783  33.317  1.00 18.65 ? 462  GLY B CA    1 
ATOM   8492  C C     . GLY B 1 462 ? -48.444 64.153  31.987  1.00 17.44 ? 462  GLY B C     1 
ATOM   8493  O O     . GLY B 1 462 ? -47.241 64.342  31.890  1.00 16.70 ? 462  GLY B O     1 
ATOM   8494  N N     . ASN B 1 463 ? -49.276 64.249  30.956  1.00 16.89 ? 463  ASN B N     1 
ATOM   8495  C CA    . ASN B 1 463 ? -48.863 64.703  29.622  1.00 15.98 ? 463  ASN B CA    1 
ATOM   8496  C C     . ASN B 1 463 ? -48.541 66.203  29.595  1.00 16.26 ? 463  ASN B C     1 
ATOM   8497  O O     . ASN B 1 463 ? -49.343 67.041  30.045  1.00 16.68 ? 463  ASN B O     1 
ATOM   8498  C CB    . ASN B 1 463 ? -49.961 64.410  28.609  1.00 15.69 ? 463  ASN B CB    1 
ATOM   8499  C CG    . ASN B 1 463 ? -50.356 62.944  28.570  1.00 15.78 ? 463  ASN B CG    1 
ATOM   8500  O OD1   . ASN B 1 463 ? -49.552 62.089  28.193  1.00 18.08 ? 463  ASN B OD1   1 
ATOM   8501  N ND2   . ASN B 1 463 ? -51.604 62.646  28.933  1.00 13.62 ? 463  ASN B ND2   1 
ATOM   8502  N N     . LEU B 1 464 ? -47.372 66.534  29.048  1.00 15.90 ? 464  LEU B N     1 
ATOM   8503  C CA    . LEU B 1 464 ? -46.865 67.898  29.021  1.00 15.27 ? 464  LEU B CA    1 
ATOM   8504  C C     . LEU B 1 464 ? -47.356 68.674  27.803  1.00 15.40 ? 464  LEU B C     1 
ATOM   8505  O O     . LEU B 1 464 ? -47.057 68.319  26.645  1.00 15.48 ? 464  LEU B O     1 
ATOM   8506  C CB    . LEU B 1 464 ? -45.331 67.881  29.061  1.00 15.32 ? 464  LEU B CB    1 
ATOM   8507  C CG    . LEU B 1 464 ? -44.507 69.158  28.849  1.00 14.32 ? 464  LEU B CG    1 
ATOM   8508  C CD1   . LEU B 1 464 ? -44.944 70.317  29.752  1.00 12.60 ? 464  LEU B CD1   1 
ATOM   8509  C CD2   . LEU B 1 464 ? -43.051 68.824  29.082  1.00 14.84 ? 464  LEU B CD2   1 
ATOM   8510  N N     . VAL B 1 465 ? -48.083 69.754  28.068  1.00 14.78 ? 465  VAL B N     1 
ATOM   8511  C CA    . VAL B 1 465 ? -48.609 70.595  26.993  1.00 14.05 ? 465  VAL B CA    1 
ATOM   8512  C C     . VAL B 1 465 ? -48.216 72.035  27.253  1.00 14.44 ? 465  VAL B C     1 
ATOM   8513  O O     . VAL B 1 465 ? -47.902 72.389  28.383  1.00 13.81 ? 465  VAL B O     1 
ATOM   8514  C CB    . VAL B 1 465 ? -50.171 70.497  26.870  1.00 14.20 ? 465  VAL B CB    1 
ATOM   8515  C CG1   . VAL B 1 465 ? -50.585 69.151  26.287  1.00 13.07 ? 465  VAL B CG1   1 
ATOM   8516  C CG2   . VAL B 1 465 ? -50.872 70.754  28.225  1.00 12.12 ? 465  VAL B CG2   1 
ATOM   8517  N N     . ILE B 1 466 ? -48.240 72.854  26.203  1.00 14.86 ? 466  ILE B N     1 
ATOM   8518  C CA    . ILE B 1 466 ? -47.987 74.294  26.313  1.00 15.56 ? 466  ILE B CA    1 
ATOM   8519  C C     . ILE B 1 466 ? -49.301 75.008  25.891  1.00 16.11 ? 466  ILE B C     1 
ATOM   8520  O O     . ILE B 1 466 ? -49.865 74.708  24.825  1.00 16.57 ? 466  ILE B O     1 
ATOM   8521  C CB    . ILE B 1 466 ? -46.773 74.742  25.441  1.00 15.37 ? 466  ILE B CB    1 
ATOM   8522  C CG1   . ILE B 1 466 ? -45.559 73.811  25.606  1.00 15.11 ? 466  ILE B CG1   1 
ATOM   8523  C CG2   . ILE B 1 466 ? -46.379 76.158  25.766  1.00 16.22 ? 466  ILE B CG2   1 
ATOM   8524  C CD1   . ILE B 1 466 ? -44.698 74.066  26.864  1.00 14.27 ? 466  ILE B CD1   1 
ATOM   8525  N N     . THR B 1 467 ? -49.800 75.923  26.722  1.00 15.47 ? 467  THR B N     1 
ATOM   8526  C CA    . THR B 1 467 ? -51.210 76.348  26.606  1.00 14.91 ? 467  THR B CA    1 
ATOM   8527  C C     . THR B 1 467 ? -51.408 77.644  25.811  1.00 15.01 ? 467  THR B C     1 
ATOM   8528  O O     . THR B 1 467 ? -52.539 78.073  25.569  1.00 15.27 ? 467  THR B O     1 
ATOM   8529  C CB    . THR B 1 467 ? -51.900 76.448  27.999  1.00 14.52 ? 467  THR B CB    1 
ATOM   8530  O OG1   . THR B 1 467 ? -51.237 77.439  28.777  1.00 14.53 ? 467  THR B OG1   1 
ATOM   8531  C CG2   . THR B 1 467 ? -51.810 75.133  28.754  1.00 13.31 ? 467  THR B CG2   1 
ATOM   8532  N N     . ASP B 1 468 ? -50.302 78.251  25.398  1.00 15.20 ? 468  ASP B N     1 
ATOM   8533  C CA    . ASP B 1 468 ? -50.311 79.420  24.516  1.00 14.92 ? 468  ASP B CA    1 
ATOM   8534  C C     . ASP B 1 468 ? -48.978 79.465  23.751  1.00 14.61 ? 468  ASP B C     1 
ATOM   8535  O O     . ASP B 1 468 ? -47.993 78.829  24.158  1.00 14.22 ? 468  ASP B O     1 
ATOM   8536  C CB    . ASP B 1 468 ? -50.501 80.693  25.350  1.00 15.21 ? 468  ASP B CB    1 
ATOM   8537  C CG    . ASP B 1 468 ? -51.079 81.877  24.554  1.00 16.08 ? 468  ASP B CG    1 
ATOM   8538  O OD1   . ASP B 1 468 ? -51.229 81.826  23.316  1.00 15.52 ? 468  ASP B OD1   1 
ATOM   8539  O OD2   . ASP B 1 468 ? -51.402 82.895  25.208  1.00 19.55 ? 468  ASP B OD2   1 
ATOM   8540  N N     . SER B 1 469 ? -48.957 80.223  22.658  1.00 14.26 ? 469  SER B N     1 
ATOM   8541  C CA    . SER B 1 469 ? -47.785 80.386  21.799  1.00 13.97 ? 469  SER B CA    1 
ATOM   8542  C C     . SER B 1 469 ? -46.586 81.126  22.425  1.00 13.67 ? 469  SER B C     1 
ATOM   8543  O O     . SER B 1 469 ? -46.682 81.722  23.482  1.00 13.35 ? 469  SER B O     1 
ATOM   8544  C CB    . SER B 1 469 ? -48.210 81.091  20.510  1.00 14.02 ? 469  SER B CB    1 
ATOM   8545  O OG    . SER B 1 469 ? -47.162 81.088  19.555  1.00 14.00 ? 469  SER B OG    1 
ATOM   8546  N N     . TRP B 1 470 ? -45.455 81.071  21.731  1.00 13.67 ? 470  TRP B N     1 
ATOM   8547  C CA    . TRP B 1 470 ? -44.216 81.738  22.129  1.00 13.51 ? 470  TRP B CA    1 
ATOM   8548  C C     . TRP B 1 470 ? -43.495 82.041  20.819  1.00 13.45 ? 470  TRP B C     1 
ATOM   8549  O O     . TRP B 1 470 ? -43.702 81.318  19.846  1.00 13.35 ? 470  TRP B O     1 
ATOM   8550  C CB    . TRP B 1 470 ? -43.390 80.813  23.013  1.00 13.09 ? 470  TRP B CB    1 
ATOM   8551  C CG    . TRP B 1 470 ? -43.024 79.532  22.319  1.00 14.14 ? 470  TRP B CG    1 
ATOM   8552  C CD1   . TRP B 1 470 ? -41.838 79.254  21.699  1.00 13.48 ? 470  TRP B CD1   1 
ATOM   8553  C CD2   . TRP B 1 470 ? -43.849 78.364  22.145  1.00 14.45 ? 470  TRP B CD2   1 
ATOM   8554  N NE1   . TRP B 1 470 ? -41.866 77.995  21.167  1.00 14.12 ? 470  TRP B NE1   1 
ATOM   8555  C CE2   . TRP B 1 470 ? -43.087 77.421  21.426  1.00 15.54 ? 470  TRP B CE2   1 
ATOM   8556  C CE3   . TRP B 1 470 ? -45.149 78.014  22.543  1.00 15.02 ? 470  TRP B CE3   1 
ATOM   8557  C CZ2   . TRP B 1 470 ? -43.589 76.135  21.090  1.00 14.34 ? 470  TRP B CZ2   1 
ATOM   8558  C CZ3   . TRP B 1 470 ? -45.644 76.739  22.204  1.00 13.97 ? 470  TRP B CZ3   1 
ATOM   8559  C CH2   . TRP B 1 470 ? -44.862 75.821  21.489  1.00 13.40 ? 470  TRP B CH2   1 
ATOM   8560  N N     . PRO B 1 471 ? -42.666 83.105  20.767  1.00 13.85 ? 471  PRO B N     1 
ATOM   8561  C CA    . PRO B 1 471 ? -42.153 83.559  19.448  1.00 14.10 ? 471  PRO B CA    1 
ATOM   8562  C C     . PRO B 1 471 ? -41.526 82.484  18.552  1.00 14.14 ? 471  PRO B C     1 
ATOM   8563  O O     . PRO B 1 471 ? -41.663 82.549  17.336  1.00 13.84 ? 471  PRO B O     1 
ATOM   8564  C CB    . PRO B 1 471 ? -41.104 84.622  19.817  1.00 14.09 ? 471  PRO B CB    1 
ATOM   8565  C CG    . PRO B 1 471 ? -41.615 85.197  21.110  1.00 14.16 ? 471  PRO B CG    1 
ATOM   8566  C CD    . PRO B 1 471 ? -42.186 83.976  21.859  1.00 13.95 ? 471  PRO B CD    1 
ATOM   8567  N N     . GLY B 1 472 ? -40.843 81.511  19.137  1.00 14.33 ? 472  GLY B N     1 
ATOM   8568  C CA    . GLY B 1 472 ? -40.106 80.555  18.327  1.00 14.53 ? 472  GLY B CA    1 
ATOM   8569  C C     . GLY B 1 472 ? -40.856 79.336  17.823  1.00 14.95 ? 472  GLY B C     1 
ATOM   8570  O O     . GLY B 1 472 ? -40.222 78.401  17.347  1.00 15.74 ? 472  GLY B O     1 
ATOM   8571  N N     . GLN B 1 473 ? -42.187 79.343  17.906  1.00 15.11 ? 473  GLN B N     1 
ATOM   8572  C CA    . GLN B 1 473 ? -43.011 78.176  17.559  1.00 15.42 ? 473  GLN B CA    1 
ATOM   8573  C C     . GLN B 1 473 ? -42.951 77.758  16.095  1.00 15.82 ? 473  GLN B C     1 
ATOM   8574  O O     . GLN B 1 473 ? -43.078 78.611  15.196  1.00 16.78 ? 473  GLN B O     1 
ATOM   8575  C CB    . GLN B 1 473 ? -44.476 78.419  17.945  1.00 15.09 ? 473  GLN B CB    1 
ATOM   8576  C CG    . GLN B 1 473 ? -45.282 77.133  18.050  1.00 14.36 ? 473  GLN B CG    1 
ATOM   8577  C CD    . GLN B 1 473 ? -46.583 77.276  18.814  1.00 13.83 ? 473  GLN B CD    1 
ATOM   8578  O OE1   . GLN B 1 473 ? -47.072 78.387  19.047  1.00 13.94 ? 473  GLN B OE1   1 
ATOM   8579  N NE2   . GLN B 1 473 ? -47.173 76.136  19.188  1.00 12.99 ? 473  GLN B NE2   1 
ATOM   8580  N N     . ALA B 1 474 ? -42.789 76.458  15.829  1.00 15.55 ? 474  ALA B N     1 
ATOM   8581  C CA    . ALA B 1 474 ? -42.848 76.017  14.423  1.00 15.72 ? 474  ALA B CA    1 
ATOM   8582  C C     . ALA B 1 474 ? -44.214 76.479  13.890  1.00 15.75 ? 474  ALA B C     1 
ATOM   8583  O O     . ALA B 1 474 ? -45.220 76.419  14.613  1.00 15.64 ? 474  ALA B O     1 
ATOM   8584  C CB    . ALA B 1 474 ? -42.679 74.526  14.293  1.00 14.50 ? 474  ALA B CB    1 
ATOM   8585  N N     . ARG B 1 475 ? -44.245 76.986  12.664  1.00 15.84 ? 475  ARG B N     1 
ATOM   8586  C CA    . ARG B 1 475 ? -45.484 77.607  12.163  1.00 16.76 ? 475  ARG B CA    1 
ATOM   8587  C C     . ARG B 1 475 ? -46.409 76.644  11.434  1.00 16.71 ? 475  ARG B C     1 
ATOM   8588  O O     . ARG B 1 475 ? -47.588 76.940  11.321  1.00 16.82 ? 475  ARG B O     1 
ATOM   8589  C CB    . ARG B 1 475 ? -45.225 78.859  11.299  1.00 16.60 ? 475  ARG B CB    1 
ATOM   8590  C CG    . ARG B 1 475 ? -44.409 79.964  11.991  1.00 17.06 ? 475  ARG B CG    1 
ATOM   8591  C CD    . ARG B 1 475 ? -45.109 80.544  13.219  1.00 16.38 ? 475  ARG B CD    1 
ATOM   8592  N NE    . ARG B 1 475 ? -44.656 81.916  13.453  1.00 16.81 ? 475  ARG B NE    1 
ATOM   8593  C CZ    . ARG B 1 475 ? -43.869 82.298  14.461  1.00 18.35 ? 475  ARG B CZ    1 
ATOM   8594  N NH1   . ARG B 1 475 ? -43.468 81.414  15.377  1.00 16.73 ? 475  ARG B NH1   1 
ATOM   8595  N NH2   . ARG B 1 475 ? -43.500 83.577  14.569  1.00 17.14 ? 475  ARG B NH2   1 
ATOM   8596  N N     . THR B 1 476 ? -45.885 75.496  10.983  1.00 16.62 ? 476  THR B N     1 
ATOM   8597  C CA    . THR B 1 476 ? -46.657 74.525  10.190  1.00 16.17 ? 476  THR B CA    1 
ATOM   8598  C C     . THR B 1 476 ? -45.836 73.270  9.863   1.00 16.16 ? 476  THR B C     1 
ATOM   8599  O O     . THR B 1 476 ? -44.652 73.178  10.187  1.00 15.18 ? 476  THR B O     1 
ATOM   8600  C CB    . THR B 1 476 ? -47.209 75.164  8.856   1.00 16.15 ? 476  THR B CB    1 
ATOM   8601  O OG1   . THR B 1 476 ? -48.132 74.274  8.224   1.00 16.95 ? 476  THR B OG1   1 
ATOM   8602  C CG2   . THR B 1 476 ? -46.101 75.442  7.877   1.00 14.95 ? 476  THR B CG2   1 
ATOM   8603  N N     . LEU B 1 477 ? -46.486 72.296  9.227   1.00 16.63 ? 477  LEU B N     1 
ATOM   8604  C CA    . LEU B 1 477 ? -45.778 71.213  8.545   1.00 17.05 ? 477  LEU B CA    1 
ATOM   8605  C C     . LEU B 1 477 ? -45.728 71.595  7.067   1.00 17.80 ? 477  LEU B C     1 
ATOM   8606  O O     . LEU B 1 477 ? -46.713 72.100  6.543   1.00 18.05 ? 477  LEU B O     1 
ATOM   8607  C CB    . LEU B 1 477 ? -46.467 69.873  8.769   1.00 15.91 ? 477  LEU B CB    1 
ATOM   8608  C CG    . LEU B 1 477 ? -46.286 69.306  10.181  1.00 15.64 ? 477  LEU B CG    1 
ATOM   8609  C CD1   . LEU B 1 477 ? -46.770 67.866  10.234  1.00 13.39 ? 477  LEU B CD1   1 
ATOM   8610  C CD2   . LEU B 1 477 ? -44.821 69.376  10.654  1.00 15.97 ? 477  LEU B CD2   1 
ATOM   8611  N N     . PHE B 1 478 ? -44.575 71.389  6.415   1.00 18.85 ? 478  PHE B N     1 
ATOM   8612  C CA    . PHE B 1 478 ? -44.350 71.879  5.053   1.00 19.34 ? 478  PHE B CA    1 
ATOM   8613  C C     . PHE B 1 478 ? -45.345 71.269  4.091   1.00 19.15 ? 478  PHE B C     1 
ATOM   8614  O O     . PHE B 1 478 ? -45.453 70.049  4.018   1.00 18.61 ? 478  PHE B O     1 
ATOM   8615  C CB    . PHE B 1 478 ? -42.939 71.578  4.537   1.00 19.95 ? 478  PHE B CB    1 
ATOM   8616  C CG    . PHE B 1 478 ? -42.763 71.921  3.058   1.00 21.76 ? 478  PHE B CG    1 
ATOM   8617  C CD1   . PHE B 1 478 ? -42.922 73.253  2.603   1.00 23.60 ? 478  PHE B CD1   1 
ATOM   8618  C CD2   . PHE B 1 478 ? -42.486 70.932  2.124   1.00 21.16 ? 478  PHE B CD2   1 
ATOM   8619  C CE1   . PHE B 1 478 ? -42.777 73.585  1.243   1.00 23.35 ? 478  PHE B CE1   1 
ATOM   8620  C CE2   . PHE B 1 478 ? -42.349 71.256  0.759   1.00 21.77 ? 478  PHE B CE2   1 
ATOM   8621  C CZ    . PHE B 1 478 ? -42.491 72.581  0.322   1.00 21.81 ? 478  PHE B CZ    1 
ATOM   8622  N N     . GLY B 1 479 ? -46.063 72.129  3.368   1.00 19.18 ? 479  GLY B N     1 
ATOM   8623  C CA    . GLY B 1 479 ? -47.151 71.706  2.468   1.00 19.29 ? 479  GLY B CA    1 
ATOM   8624  C C     . GLY B 1 479 ? -48.311 70.934  3.097   1.00 19.52 ? 479  GLY B C     1 
ATOM   8625  O O     . GLY B 1 479 ? -49.012 70.189  2.405   1.00 19.44 ? 479  GLY B O     1 
ATOM   8626  N N     . ASP B 1 480 ? -48.515 71.088  4.407   1.00 19.73 ? 480  ASP B N     1 
ATOM   8627  C CA    . ASP B 1 480 ? -49.581 70.350  5.083   1.00 19.91 ? 480  ASP B CA    1 
ATOM   8628  C C     . ASP B 1 480 ? -49.967 70.915  6.439   1.00 19.73 ? 480  ASP B C     1 
ATOM   8629  O O     . ASP B 1 480 ? -49.646 70.362  7.483   1.00 19.64 ? 480  ASP B O     1 
ATOM   8630  C CB    . ASP B 1 480 ? -49.229 68.871  5.200   1.00 19.63 ? 480  ASP B CB    1 
ATOM   8631  C CG    . ASP B 1 480 ? -50.433 68.013  5.472   1.00 20.52 ? 480  ASP B CG    1 
ATOM   8632  O OD1   . ASP B 1 480 ? -51.532 68.556  5.719   1.00 22.59 ? 480  ASP B OD1   1 
ATOM   8633  O OD2   . ASP B 1 480 ? -50.279 66.784  5.454   1.00 21.59 ? 480  ASP B OD2   1 
ATOM   8634  N N     . HIS B 1 481 ? -50.712 72.001  6.411   1.00 20.08 ? 481  HIS B N     1 
ATOM   8635  C CA    . HIS B 1 481 ? -51.177 72.603  7.647   1.00 20.27 ? 481  HIS B CA    1 
ATOM   8636  C C     . HIS B 1 481 ? -52.212 71.754  8.413   1.00 20.07 ? 481  HIS B C     1 
ATOM   8637  O O     . HIS B 1 481 ? -52.292 71.852  9.617   1.00 20.42 ? 481  HIS B O     1 
ATOM   8638  C CB    . HIS B 1 481 ? -51.702 74.020  7.384   1.00 20.41 ? 481  HIS B CB    1 
ATOM   8639  C CG    . HIS B 1 481 ? -51.891 74.824  8.628   1.00 20.85 ? 481  HIS B CG    1 
ATOM   8640  N ND1   . HIS B 1 481 ? -50.832 75.342  9.345   1.00 21.79 ? 481  HIS B ND1   1 
ATOM   8641  C CD2   . HIS B 1 481 ? -53.011 75.167  9.307   1.00 20.19 ? 481  HIS B CD2   1 
ATOM   8642  C CE1   . HIS B 1 481 ? -51.296 75.990  10.401  1.00 19.85 ? 481  HIS B CE1   1 
ATOM   8643  N NE2   . HIS B 1 481 ? -52.612 75.893  10.403  1.00 20.04 ? 481  HIS B NE2   1 
ATOM   8644  N N     . GLU B 1 482 ? -52.990 70.918  7.734   1.00 20.20 ? 482  GLU B N     1 
ATOM   8645  C CA    . GLU B 1 482 ? -53.956 70.051  8.431   1.00 20.43 ? 482  GLU B CA    1 
ATOM   8646  C C     . GLU B 1 482 ? -53.279 68.998  9.319   1.00 20.00 ? 482  GLU B C     1 
ATOM   8647  O O     . GLU B 1 482 ? -53.746 68.760  10.442  1.00 20.15 ? 482  GLU B O     1 
ATOM   8648  C CB    . GLU B 1 482 ? -54.970 69.391  7.458   1.00 20.50 ? 482  GLU B CB    1 
ATOM   8649  C CG    . GLU B 1 482 ? -56.220 70.237  7.186   1.00 22.47 ? 482  GLU B CG    1 
ATOM   8650  C CD    . GLU B 1 482 ? -56.785 70.084  5.759   1.00 24.43 ? 482  GLU B CD    1 
ATOM   8651  O OE1   . GLU B 1 482 ? -58.039 70.146  5.600   1.00 22.33 ? 482  GLU B OE1   1 
ATOM   8652  O OE2   . GLU B 1 482 ? -55.976 69.916  4.802   1.00 23.72 ? 482  GLU B OE2   1 
ATOM   8653  N N     . ARG B 1 483 ? -52.202 68.377  8.821   1.00 19.25 ? 483  ARG B N     1 
ATOM   8654  C CA    . ARG B 1 483 ? -51.482 67.361  9.576   1.00 18.74 ? 483  ARG B CA    1 
ATOM   8655  C C     . ARG B 1 483 ? -50.812 68.008  10.775  1.00 19.02 ? 483  ARG B C     1 
ATOM   8656  O O     . ARG B 1 483 ? -50.782 67.423  11.871  1.00 19.35 ? 483  ARG B O     1 
ATOM   8657  C CB    . ARG B 1 483 ? -50.447 66.604  8.709   1.00 19.34 ? 483  ARG B CB    1 
ATOM   8658  C CG    . ARG B 1 483 ? -50.039 65.195  9.230   1.00 17.36 ? 483  ARG B CG    1 
ATOM   8659  N N     . PHE B 1 484 ? -50.289 69.213  10.579  1.00 18.23 ? 484  PHE B N     1 
ATOM   8660  C CA    . PHE B 1 484 ? -49.745 69.989  11.677  1.00 18.50 ? 484  PHE B CA    1 
ATOM   8661  C C     . PHE B 1 484 ? -50.755 70.168  12.810  1.00 19.40 ? 484  PHE B C     1 
ATOM   8662  O O     . PHE B 1 484 ? -50.449 69.875  13.978  1.00 19.43 ? 484  PHE B O     1 
ATOM   8663  C CB    . PHE B 1 484 ? -49.309 71.334  11.135  1.00 18.68 ? 484  PHE B CB    1 
ATOM   8664  C CG    . PHE B 1 484 ? -48.785 72.290  12.162  1.00 17.36 ? 484  PHE B CG    1 
ATOM   8665  C CD1   . PHE B 1 484 ? -47.529 72.111  12.722  1.00 16.17 ? 484  PHE B CD1   1 
ATOM   8666  C CD2   . PHE B 1 484 ? -49.516 73.423  12.493  1.00 17.51 ? 484  PHE B CD2   1 
ATOM   8667  C CE1   . PHE B 1 484 ? -47.017 73.023  13.625  1.00 16.97 ? 484  PHE B CE1   1 
ATOM   8668  C CE2   . PHE B 1 484 ? -49.018 74.357  13.402  1.00 18.28 ? 484  PHE B CE2   1 
ATOM   8669  C CZ    . PHE B 1 484 ? -47.766 74.150  13.978  1.00 19.27 ? 484  PHE B CZ    1 
ATOM   8670  N N     . GLU B 1 485 ? -51.950 70.648  12.463  1.00 20.15 ? 485  GLU B N     1 
ATOM   8671  C CA    . GLU B 1 485 ? -53.050 70.834  13.426  1.00 21.55 ? 485  GLU B CA    1 
ATOM   8672  C C     . GLU B 1 485 ? -53.401 69.497  14.059  1.00 21.35 ? 485  GLU B C     1 
ATOM   8673  O O     . GLU B 1 485 ? -53.470 69.362  15.281  1.00 21.04 ? 485  GLU B O     1 
ATOM   8674  C CB    . GLU B 1 485 ? -54.290 71.472  12.740  1.00 21.62 ? 485  GLU B CB    1 
ATOM   8675  C CG    . GLU B 1 485 ? -54.039 72.883  12.157  1.00 22.74 ? 485  GLU B CG    1 
ATOM   8676  C CD    . GLU B 1 485 ? -55.244 73.529  11.441  1.00 23.15 ? 485  GLU B CD    1 
ATOM   8677  O OE1   . GLU B 1 485 ? -55.656 73.036  10.348  1.00 26.62 ? 485  GLU B OE1   1 
ATOM   8678  O OE2   . GLU B 1 485 ? -55.740 74.571  11.955  1.00 23.16 ? 485  GLU B OE2   1 
ATOM   8679  N N     . GLN B 1 486 ? -53.596 68.515  13.192  1.00 21.99 ? 486  GLN B N     1 
ATOM   8680  C CA    . GLN B 1 486 ? -53.877 67.142  13.563  1.00 23.02 ? 486  GLN B CA    1 
ATOM   8681  C C     . GLN B 1 486 ? -52.847 66.561  14.567  1.00 22.62 ? 486  GLN B C     1 
ATOM   8682  O O     . GLN B 1 486 ? -53.210 65.974  15.593  1.00 23.20 ? 486  GLN B O     1 
ATOM   8683  C CB    . GLN B 1 486 ? -53.937 66.310  12.278  1.00 23.39 ? 486  GLN B CB    1 
ATOM   8684  C CG    . GLN B 1 486 ? -54.927 65.163  12.288  1.00 27.98 ? 486  GLN B CG    1 
ATOM   8685  C CD    . GLN B 1 486 ? -54.365 63.895  12.948  1.00 33.19 ? 486  GLN B CD    1 
ATOM   8686  O OE1   . GLN B 1 486 ? -55.110 63.143  13.593  1.00 34.19 ? 486  GLN B OE1   1 
ATOM   8687  N NE2   . GLN B 1 486 ? -53.044 63.654  12.788  1.00 34.96 ? 486  GLN B NE2   1 
ATOM   8688  N N     . THR B 1 487 ? -51.567 66.754  14.300  1.00 21.60 ? 487  THR B N     1 
ATOM   8689  C CA    . THR B 1 487 ? -50.526 66.113  15.103  1.00 20.83 ? 487  THR B CA    1 
ATOM   8690  C C     . THR B 1 487 ? -50.340 66.719  16.502  1.00 20.17 ? 487  THR B C     1 
ATOM   8691  O O     . THR B 1 487 ? -50.037 66.005  17.454  1.00 19.50 ? 487  THR B O     1 
ATOM   8692  C CB    . THR B 1 487 ? -49.186 66.123  14.312  1.00 20.92 ? 487  THR B CB    1 
ATOM   8693  O OG1   . THR B 1 487 ? -49.420 65.531  13.026  1.00 22.46 ? 487  THR B OG1   1 
ATOM   8694  C CG2   . THR B 1 487 ? -48.036 65.384  15.036  1.00 20.07 ? 487  THR B CG2   1 
ATOM   8695  N N     . TYR B 1 488 ? -50.511 68.034  16.614  1.00 19.65 ? 488  TYR B N     1 
ATOM   8696  C CA    . TYR B 1 488 ? -50.090 68.743  17.812  1.00 19.18 ? 488  TYR B CA    1 
ATOM   8697  C C     . TYR B 1 488 ? -51.219 69.433  18.561  1.00 19.40 ? 488  TYR B C     1 
ATOM   8698  O O     . TYR B 1 488 ? -51.042 69.820  19.721  1.00 20.00 ? 488  TYR B O     1 
ATOM   8699  C CB    . TYR B 1 488 ? -49.009 69.785  17.476  1.00 19.08 ? 488  TYR B CB    1 
ATOM   8700  C CG    . TYR B 1 488 ? -47.766 69.248  16.772  1.00 18.57 ? 488  TYR B CG    1 
ATOM   8701  C CD1   . TYR B 1 488 ? -47.543 69.513  15.418  1.00 17.38 ? 488  TYR B CD1   1 
ATOM   8702  C CD2   . TYR B 1 488 ? -46.824 68.476  17.454  1.00 17.33 ? 488  TYR B CD2   1 
ATOM   8703  C CE1   . TYR B 1 488 ? -46.430 69.031  14.766  1.00 16.40 ? 488  TYR B CE1   1 
ATOM   8704  C CE2   . TYR B 1 488 ? -45.703 67.976  16.801  1.00 16.10 ? 488  TYR B CE2   1 
ATOM   8705  C CZ    . TYR B 1 488 ? -45.523 68.264  15.463  1.00 18.10 ? 488  TYR B CZ    1 
ATOM   8706  O OH    . TYR B 1 488 ? -44.427 67.793  14.808  1.00 19.10 ? 488  TYR B OH    1 
ATOM   8707  N N     . PHE B 1 489 ? -52.371 69.601  17.918  1.00 19.20 ? 489  PHE B N     1 
ATOM   8708  C CA    . PHE B 1 489 ? -53.402 70.459  18.479  1.00 19.18 ? 489  PHE B CA    1 
ATOM   8709  C C     . PHE B 1 489 ? -54.768 69.821  18.518  1.00 19.57 ? 489  PHE B C     1 
ATOM   8710  O O     . PHE B 1 489 ? -55.767 70.526  18.712  1.00 19.28 ? 489  PHE B O     1 
ATOM   8711  C CB    . PHE B 1 489 ? -53.492 71.766  17.691  1.00 19.11 ? 489  PHE B CB    1 
ATOM   8712  C CG    . PHE B 1 489 ? -52.292 72.623  17.821  1.00 18.08 ? 489  PHE B CG    1 
ATOM   8713  C CD1   . PHE B 1 489 ? -51.360 72.674  16.802  1.00 18.02 ? 489  PHE B CD1   1 
ATOM   8714  C CD2   . PHE B 1 489 ? -52.094 73.381  18.966  1.00 16.86 ? 489  PHE B CD2   1 
ATOM   8715  C CE1   . PHE B 1 489 ? -50.249 73.486  16.908  1.00 20.22 ? 489  PHE B CE1   1 
ATOM   8716  C CE2   . PHE B 1 489 ? -50.989 74.187  19.105  1.00 17.32 ? 489  PHE B CE2   1 
ATOM   8717  C CZ    . PHE B 1 489 ? -50.052 74.247  18.077  1.00 19.81 ? 489  PHE B CZ    1 
ATOM   8718  N N     . SER B 1 490 ? -54.816 68.506  18.337  1.00 19.77 ? 490  SER B N     1 
ATOM   8719  C CA    . SER B 1 490 ? -56.093 67.817  18.320  1.00 20.56 ? 490  SER B CA    1 
ATOM   8720  C C     . SER B 1 490 ? -56.303 66.862  19.486  1.00 20.42 ? 490  SER B C     1 
ATOM   8721  O O     . SER B 1 490 ? -57.445 66.503  19.755  1.00 21.61 ? 490  SER B O     1 
ATOM   8722  C CB    . SER B 1 490 ? -56.327 67.076  16.999  1.00 20.39 ? 490  SER B CB    1 
ATOM   8723  O OG    . SER B 1 490 ? -55.861 65.731  17.093  1.00 21.78 ? 490  SER B OG    1 
ATOM   8724  N N     . THR B 1 491 ? -55.240 66.424  20.155  1.00 20.00 ? 491  THR B N     1 
ATOM   8725  C CA    . THR B 1 491 ? -55.389 65.504  21.309  1.00 19.49 ? 491  THR B CA    1 
ATOM   8726  C C     . THR B 1 491 ? -56.005 66.232  22.501  1.00 19.09 ? 491  THR B C     1 
ATOM   8727  O O     . THR B 1 491 ? -56.874 65.716  23.174  1.00 19.33 ? 491  THR B O     1 
ATOM   8728  C CB    . THR B 1 491 ? -54.043 64.871  21.738  1.00 19.46 ? 491  THR B CB    1 
ATOM   8729  O OG1   . THR B 1 491 ? -53.543 64.058  20.674  1.00 20.02 ? 491  THR B OG1   1 
ATOM   8730  C CG2   . THR B 1 491 ? -54.206 63.985  22.993  1.00 18.52 ? 491  THR B CG2   1 
ATOM   8731  N N     . PHE B 1 492 ? -55.537 67.442  22.733  1.00 18.74 ? 492  PHE B N     1 
ATOM   8732  C CA    . PHE B 1 492 ? -55.964 68.247  23.832  1.00 18.69 ? 492  PHE B CA    1 
ATOM   8733  C C     . PHE B 1 492 ? -56.362 69.599  23.255  1.00 18.64 ? 492  PHE B C     1 
ATOM   8734  O O     . PHE B 1 492 ? -55.509 70.382  22.843  1.00 17.92 ? 492  PHE B O     1 
ATOM   8735  C CB    . PHE B 1 492 ? -54.825 68.362  24.857  1.00 18.53 ? 492  PHE B CB    1 
ATOM   8736  C CG    . PHE B 1 492 ? -54.355 67.029  25.400  1.00 18.88 ? 492  PHE B CG    1 
ATOM   8737  C CD1   . PHE B 1 492 ? -53.017 66.658  25.319  1.00 17.12 ? 492  PHE B CD1   1 
ATOM   8738  C CD2   . PHE B 1 492 ? -55.266 66.132  26.003  1.00 18.70 ? 492  PHE B CD2   1 
ATOM   8739  C CE1   . PHE B 1 492 ? -52.585 65.413  25.837  1.00 15.54 ? 492  PHE B CE1   1 
ATOM   8740  C CE2   . PHE B 1 492 ? -54.838 64.902  26.518  1.00 15.00 ? 492  PHE B CE2   1 
ATOM   8741  C CZ    . PHE B 1 492 ? -53.507 64.543  26.423  1.00 15.97 ? 492  PHE B CZ    1 
ATOM   8742  N N     . LYS B 1 493 ? -57.666 69.852  23.210  1.00 19.38 ? 493  LYS B N     1 
ATOM   8743  C CA    . LYS B 1 493 ? -58.195 71.002  22.477  1.00 20.35 ? 493  LYS B CA    1 
ATOM   8744  C C     . LYS B 1 493 ? -57.663 72.322  23.049  1.00 20.27 ? 493  LYS B C     1 
ATOM   8745  O O     . LYS B 1 493 ? -57.607 72.513  24.267  1.00 20.24 ? 493  LYS B O     1 
ATOM   8746  C CB    . LYS B 1 493 ? -59.736 70.977  22.432  1.00 20.57 ? 493  LYS B CB    1 
ATOM   8747  C CG    . LYS B 1 493 ? -60.327 70.051  21.337  1.00 22.00 ? 493  LYS B CG    1 
ATOM   8748  N N     . ASN B 1 494 ? -57.231 73.204  22.156  1.00 20.16 ? 494  ASN B N     1 
ATOM   8749  C CA    . ASN B 1 494 ? -56.714 74.529  22.538  1.00 20.41 ? 494  ASN B CA    1 
ATOM   8750  C C     . ASN B 1 494 ? -55.313 74.512  23.134  1.00 19.82 ? 494  ASN B C     1 
ATOM   8751  O O     . ASN B 1 494 ? -54.874 75.468  23.760  1.00 18.64 ? 494  ASN B O     1 
ATOM   8752  C CB    . ASN B 1 494 ? -57.720 75.293  23.419  1.00 20.84 ? 494  ASN B CB    1 
ATOM   8753  C CG    . ASN B 1 494 ? -58.862 75.854  22.607  1.00 22.22 ? 494  ASN B CG    1 
ATOM   8754  O OD1   . ASN B 1 494 ? -58.700 76.850  21.883  1.00 24.06 ? 494  ASN B OD1   1 
ATOM   8755  N ND2   . ASN B 1 494 ? -60.005 75.191  22.670  1.00 22.77 ? 494  ASN B ND2   1 
ATOM   8756  N N     . MET B 1 495 ? -54.610 73.411  22.888  1.00 20.11 ? 495  MET B N     1 
ATOM   8757  C CA    . MET B 1 495 ? -53.288 73.227  23.427  1.00 21.05 ? 495  MET B CA    1 
ATOM   8758  C C     . MET B 1 495 ? -52.293 72.521  22.528  1.00 19.35 ? 495  MET B C     1 
ATOM   8759  O O     . MET B 1 495 ? -52.658 71.663  21.708  1.00 19.47 ? 495  MET B O     1 
ATOM   8760  C CB    . MET B 1 495 ? -53.390 72.530  24.777  1.00 21.47 ? 495  MET B CB    1 
ATOM   8761  C CG    . MET B 1 495 ? -53.650 73.527  25.858  1.00 22.97 ? 495  MET B CG    1 
ATOM   8762  S SD    . MET B 1 495 ? -54.448 72.719  27.180  1.00 26.11 ? 495  MET B SD    1 
ATOM   8763  C CE    . MET B 1 495 ? -55.712 73.958  27.599  1.00 24.44 ? 495  MET B CE    1 
ATOM   8764  N N     . TYR B 1 496 ? -51.032 72.920  22.689  1.00 17.97 ? 496  TYR B N     1 
ATOM   8765  C CA    . TYR B 1 496 ? -49.901 72.283  22.027  1.00 16.71 ? 496  TYR B CA    1 
ATOM   8766  C C     . TYR B 1 496 ? -49.469 71.055  22.815  1.00 16.69 ? 496  TYR B C     1 
ATOM   8767  O O     . TYR B 1 496 ? -49.018 71.179  23.963  1.00 16.38 ? 496  TYR B O     1 
ATOM   8768  C CB    . TYR B 1 496 ? -48.717 73.259  21.873  1.00 15.89 ? 496  TYR B CB    1 
ATOM   8769  C CG    . TYR B 1 496 ? -47.480 72.570  21.356  1.00 14.45 ? 496  TYR B CG    1 
ATOM   8770  C CD1   . TYR B 1 496 ? -47.313 72.327  19.983  1.00 13.61 ? 496  TYR B CD1   1 
ATOM   8771  C CD2   . TYR B 1 496 ? -46.495 72.102  22.241  1.00 13.29 ? 496  TYR B CD2   1 
ATOM   8772  C CE1   . TYR B 1 496 ? -46.190 71.655  19.494  1.00 12.04 ? 496  TYR B CE1   1 
ATOM   8773  C CE2   . TYR B 1 496 ? -45.363 71.436  21.768  1.00 13.57 ? 496  TYR B CE2   1 
ATOM   8774  C CZ    . TYR B 1 496 ? -45.229 71.215  20.398  1.00 14.70 ? 496  TYR B CZ    1 
ATOM   8775  O OH    . TYR B 1 496 ? -44.138 70.554  19.944  1.00 14.92 ? 496  TYR B OH    1 
ATOM   8776  N N     . PHE B 1 497 ? -49.596 69.877  22.203  1.00 16.33 ? 497  PHE B N     1 
ATOM   8777  C CA    . PHE B 1 497 ? -49.163 68.642  22.847  1.00 16.42 ? 497  PHE B CA    1 
ATOM   8778  C C     . PHE B 1 497 ? -47.724 68.279  22.405  1.00 16.94 ? 497  PHE B C     1 
ATOM   8779  O O     . PHE B 1 497 ? -47.423 68.187  21.190  1.00 17.87 ? 497  PHE B O     1 
ATOM   8780  C CB    . PHE B 1 497 ? -50.182 67.513  22.620  1.00 15.93 ? 497  PHE B CB    1 
ATOM   8781  C CG    . PHE B 1 497 ? -49.782 66.186  23.238  1.00 18.33 ? 497  PHE B CG    1 
ATOM   8782  C CD1   . PHE B 1 497 ? -49.106 66.128  24.485  1.00 19.77 ? 497  PHE B CD1   1 
ATOM   8783  C CD2   . PHE B 1 497 ? -50.072 64.981  22.587  1.00 17.78 ? 497  PHE B CD2   1 
ATOM   8784  C CE1   . PHE B 1 497 ? -48.729 64.897  25.051  1.00 18.06 ? 497  PHE B CE1   1 
ATOM   8785  C CE2   . PHE B 1 497 ? -49.697 63.745  23.156  1.00 17.04 ? 497  PHE B CE2   1 
ATOM   8786  C CZ    . PHE B 1 497 ? -49.037 63.702  24.376  1.00 17.24 ? 497  PHE B CZ    1 
ATOM   8787  N N     . SER B 1 498 ? -46.824 68.117  23.374  1.00 16.46 ? 498  SER B N     1 
ATOM   8788  C CA    . SER B 1 498 ? -45.426 67.854  23.050  1.00 16.80 ? 498  SER B CA    1 
ATOM   8789  C C     . SER B 1 498 ? -45.170 66.393  22.728  1.00 16.92 ? 498  SER B C     1 
ATOM   8790  O O     . SER B 1 498 ? -44.215 66.083  22.074  1.00 16.78 ? 498  SER B O     1 
ATOM   8791  C CB    . SER B 1 498 ? -44.516 68.269  24.194  1.00 16.79 ? 498  SER B CB    1 
ATOM   8792  O OG    . SER B 1 498 ? -44.704 67.430  25.327  1.00 17.74 ? 498  SER B OG    1 
ATOM   8793  N N     . GLY B 1 499 ? -46.042 65.493  23.168  1.00 17.77 ? 499  GLY B N     1 
ATOM   8794  C CA    . GLY B 1 499 ? -45.717 64.069  23.141  1.00 17.98 ? 499  GLY B CA    1 
ATOM   8795  C C     . GLY B 1 499 ? -44.785 63.629  24.273  1.00 18.64 ? 499  GLY B C     1 
ATOM   8796  O O     . GLY B 1 499 ? -44.291 62.484  24.269  1.00 19.89 ? 499  GLY B O     1 
ATOM   8797  N N     . ASP B 1 500 ? -44.535 64.515  25.243  1.00 17.77 ? 500  ASP B N     1 
ATOM   8798  C CA    . ASP B 1 500 ? -43.732 64.169  26.414  1.00 17.39 ? 500  ASP B CA    1 
ATOM   8799  C C     . ASP B 1 500 ? -44.585 64.032  27.653  1.00 17.35 ? 500  ASP B C     1 
ATOM   8800  O O     . ASP B 1 500 ? -45.619 64.672  27.772  1.00 17.71 ? 500  ASP B O     1 
ATOM   8801  C CB    . ASP B 1 500 ? -42.677 65.241  26.687  1.00 17.19 ? 500  ASP B CB    1 
ATOM   8802  C CG    . ASP B 1 500 ? -41.464 65.092  25.822  1.00 16.78 ? 500  ASP B CG    1 
ATOM   8803  O OD1   . ASP B 1 500 ? -40.964 63.951  25.682  1.00 19.33 ? 500  ASP B OD1   1 
ATOM   8804  O OD2   . ASP B 1 500 ? -41.008 66.113  25.293  1.00 13.89 ? 500  ASP B OD2   1 
ATOM   8805  N N     . GLY B 1 501 ? -44.126 63.214  28.592  1.00 17.55 ? 501  GLY B N     1 
ATOM   8806  C CA    . GLY B 1 501 ? -44.735 63.128  29.928  1.00 16.95 ? 501  GLY B CA    1 
ATOM   8807  C C     . GLY B 1 501 ? -43.788 63.797  30.891  1.00 16.47 ? 501  GLY B C     1 
ATOM   8808  O O     . GLY B 1 501 ? -42.587 63.850  30.623  1.00 16.84 ? 501  GLY B O     1 
ATOM   8809  N N     . ALA B 1 502 ? -44.313 64.334  31.988  1.00 16.03 ? 502  ALA B N     1 
ATOM   8810  C CA    . ALA B 1 502 ? -43.469 64.964  32.990  1.00 16.03 ? 502  ALA B CA    1 
ATOM   8811  C C     . ALA B 1 502 ? -44.084 64.939  34.373  1.00 16.88 ? 502  ALA B C     1 
ATOM   8812  O O     . ALA B 1 502 ? -45.311 64.815  34.529  1.00 16.73 ? 502  ALA B O     1 
ATOM   8813  C CB    . ALA B 1 502 ? -43.145 66.382  32.597  1.00 15.18 ? 502  ALA B CB    1 
ATOM   8814  N N     . ARG B 1 503 ? -43.227 65.064  35.380  1.00 17.68 ? 503  ARG B N     1 
ATOM   8815  C CA    . ARG B 1 503 ? -43.704 65.345  36.723  1.00 19.13 ? 503  ARG B CA    1 
ATOM   8816  C C     . ARG B 1 503 ? -43.276 66.747  37.161  1.00 18.73 ? 503  ARG B C     1 
ATOM   8817  O O     . ARG B 1 503 ? -42.234 67.263  36.729  1.00 18.53 ? 503  ARG B O     1 
ATOM   8818  C CB    . ARG B 1 503 ? -43.342 64.226  37.742  1.00 19.07 ? 503  ARG B CB    1 
ATOM   8819  C CG    . ARG B 1 503 ? -41.980 64.312  38.410  1.00 20.67 ? 503  ARG B CG    1 
ATOM   8820  C CD    . ARG B 1 503 ? -41.684 63.143  39.422  1.00 21.17 ? 503  ARG B CD    1 
ATOM   8821  N NE    . ARG B 1 503 ? -40.901 63.663  40.566  1.00 26.46 ? 503  ARG B NE    1 
ATOM   8822  C CZ    . ARG B 1 503 ? -39.570 63.826  40.595  1.00 28.01 ? 503  ARG B CZ    1 
ATOM   8823  N NH1   . ARG B 1 503 ? -38.800 63.467  39.559  1.00 27.99 ? 503  ARG B NH1   1 
ATOM   8824  N NH2   . ARG B 1 503 ? -38.996 64.334  41.682  1.00 29.06 ? 503  ARG B NH2   1 
ATOM   8825  N N     . ARG B 1 504 ? -44.130 67.370  37.970  1.00 18.79 ? 504  ARG B N     1 
ATOM   8826  C CA    . ARG B 1 504 ? -43.850 68.665  38.587  1.00 19.34 ? 504  ARG B CA    1 
ATOM   8827  C C     . ARG B 1 504 ? -43.721 68.450  40.100  1.00 19.30 ? 504  ARG B C     1 
ATOM   8828  O O     . ARG B 1 504 ? -44.588 67.828  40.702  1.00 19.26 ? 504  ARG B O     1 
ATOM   8829  C CB    . ARG B 1 504 ? -44.946 69.694  38.250  1.00 18.70 ? 504  ARG B CB    1 
ATOM   8830  C CG    . ARG B 1 504 ? -44.560 71.131  38.599  1.00 20.09 ? 504  ARG B CG    1 
ATOM   8831  C CD    . ARG B 1 504 ? -45.626 72.180  38.273  1.00 19.44 ? 504  ARG B CD    1 
ATOM   8832  N NE    . ARG B 1 504 ? -46.922 71.666  38.662  1.00 19.63 ? 504  ARG B NE    1 
ATOM   8833  C CZ    . ARG B 1 504 ? -47.920 71.466  37.820  1.00 19.66 ? 504  ARG B CZ    1 
ATOM   8834  N NH1   . ARG B 1 504 ? -47.780 71.808  36.542  1.00 18.50 ? 504  ARG B NH1   1 
ATOM   8835  N NH2   . ARG B 1 504 ? -49.060 70.943  38.267  1.00 18.71 ? 504  ARG B NH2   1 
ATOM   8836  N N     . ASP B 1 505 ? -42.638 68.930  40.708  1.00 19.64 ? 505  ASP B N     1 
ATOM   8837  C CA    . ASP B 1 505 ? -42.465 68.720  42.147  1.00 20.22 ? 505  ASP B CA    1 
ATOM   8838  C C     . ASP B 1 505 ? -43.040 69.859  42.929  1.00 20.60 ? 505  ASP B C     1 
ATOM   8839  O O     . ASP B 1 505 ? -43.540 70.813  42.350  1.00 21.13 ? 505  ASP B O     1 
ATOM   8840  C CB    . ASP B 1 505 ? -41.004 68.459  42.550  1.00 20.19 ? 505  ASP B CB    1 
ATOM   8841  C CG    . ASP B 1 505 ? -40.073 69.666  42.317  1.00 20.82 ? 505  ASP B CG    1 
ATOM   8842  O OD1   . ASP B 1 505 ? -40.533 70.843  42.223  1.00 21.36 ? 505  ASP B OD1   1 
ATOM   8843  O OD2   . ASP B 1 505 ? -38.848 69.413  42.243  1.00 19.16 ? 505  ASP B OD2   1 
ATOM   8844  N N     . GLU B 1 506 ? -42.945 69.750  44.250  1.00 21.39 ? 506  GLU B N     1 
ATOM   8845  C CA    . GLU B 1 506 ? -43.486 70.741  45.195  1.00 21.09 ? 506  GLU B CA    1 
ATOM   8846  C C     . GLU B 1 506 ? -43.022 72.189  44.932  1.00 20.63 ? 506  GLU B C     1 
ATOM   8847  O O     . GLU B 1 506 ? -43.702 73.120  45.318  1.00 20.60 ? 506  GLU B O     1 
ATOM   8848  C CB    . GLU B 1 506 ? -43.188 70.307  46.650  1.00 20.79 ? 506  GLU B CB    1 
ATOM   8849  N N     . ASP B 1 507 ? -41.877 72.377  44.276  1.00 20.37 ? 507  ASP B N     1 
ATOM   8850  C CA    . ASP B 1 507 ? -41.368 73.732  43.991  1.00 19.66 ? 507  ASP B CA    1 
ATOM   8851  C C     . ASP B 1 507 ? -41.737 74.240  42.606  1.00 19.16 ? 507  ASP B C     1 
ATOM   8852  O O     . ASP B 1 507 ? -41.312 75.344  42.224  1.00 19.39 ? 507  ASP B O     1 
ATOM   8853  C CB    . ASP B 1 507 ? -39.845 73.784  44.137  1.00 19.97 ? 507  ASP B CB    1 
ATOM   8854  C CG    . ASP B 1 507 ? -39.386 73.503  45.550  1.00 20.00 ? 507  ASP B CG    1 
ATOM   8855  O OD1   . ASP B 1 507 ? -39.905 74.151  46.481  1.00 20.79 ? 507  ASP B OD1   1 
ATOM   8856  O OD2   . ASP B 1 507 ? -38.503 72.639  45.730  1.00 19.68 ? 507  ASP B OD2   1 
ATOM   8857  N N     . GLY B 1 508 ? -42.491 73.424  41.858  1.00 17.99 ? 508  GLY B N     1 
ATOM   8858  C CA    . GLY B 1 508 ? -42.879 73.721  40.485  1.00 16.72 ? 508  GLY B CA    1 
ATOM   8859  C C     . GLY B 1 508 ? -41.821 73.377  39.436  1.00 16.45 ? 508  GLY B C     1 
ATOM   8860  O O     . GLY B 1 508 ? -41.888 73.866  38.284  1.00 16.77 ? 508  GLY B O     1 
ATOM   8861  N N     . TYR B 1 509 ? -40.847 72.550  39.821  1.00 14.99 ? 509  TYR B N     1 
ATOM   8862  C CA    . TYR B 1 509 ? -39.777 72.157  38.933  1.00 14.45 ? 509  TYR B CA    1 
ATOM   8863  C C     . TYR B 1 509 ? -40.263 70.984  38.116  1.00 14.33 ? 509  TYR B C     1 
ATOM   8864  O O     . TYR B 1 509 ? -40.918 70.073  38.654  1.00 14.90 ? 509  TYR B O     1 
ATOM   8865  C CB    . TYR B 1 509 ? -38.546 71.733  39.736  1.00 14.63 ? 509  TYR B CB    1 
ATOM   8866  C CG    . TYR B 1 509 ? -37.645 72.866  40.222  1.00 14.50 ? 509  TYR B CG    1 
ATOM   8867  C CD1   . TYR B 1 509 ? -38.181 74.061  40.758  1.00 15.77 ? 509  TYR B CD1   1 
ATOM   8868  C CD2   . TYR B 1 509 ? -36.259 72.730  40.185  1.00 12.62 ? 509  TYR B CD2   1 
ATOM   8869  C CE1   . TYR B 1 509 ? -37.329 75.099  41.229  1.00 15.76 ? 509  TYR B CE1   1 
ATOM   8870  C CE2   . TYR B 1 509 ? -35.414 73.742  40.641  1.00 14.20 ? 509  TYR B CE2   1 
ATOM   8871  C CZ    . TYR B 1 509 ? -35.946 74.925  41.163  1.00 14.49 ? 509  TYR B CZ    1 
ATOM   8872  O OH    . TYR B 1 509 ? -35.103 75.920  41.591  1.00 13.34 ? 509  TYR B OH    1 
ATOM   8873  N N     . TYR B 1 510 ? -39.943 71.005  36.823  1.00 13.39 ? 510  TYR B N     1 
ATOM   8874  C CA    . TYR B 1 510 ? -40.340 69.950  35.907  1.00 12.70 ? 510  TYR B CA    1 
ATOM   8875  C C     . TYR B 1 510 ? -39.223 68.930  35.736  1.00 13.44 ? 510  TYR B C     1 
ATOM   8876  O O     . TYR B 1 510 ? -38.049 69.285  35.716  1.00 13.69 ? 510  TYR B O     1 
ATOM   8877  C CB    . TYR B 1 510 ? -40.754 70.536  34.557  1.00 11.43 ? 510  TYR B CB    1 
ATOM   8878  C CG    . TYR B 1 510 ? -42.077 71.284  34.617  1.00 10.24 ? 510  TYR B CG    1 
ATOM   8879  C CD1   . TYR B 1 510 ? -42.132 72.610  35.020  1.00 8.28  ? 510  TYR B CD1   1 
ATOM   8880  C CD2   . TYR B 1 510 ? -43.276 70.653  34.318  1.00 9.04  ? 510  TYR B CD2   1 
ATOM   8881  C CE1   . TYR B 1 510 ? -43.323 73.285  35.060  1.00 8.34  ? 510  TYR B CE1   1 
ATOM   8882  C CE2   . TYR B 1 510 ? -44.486 71.336  34.380  1.00 6.90  ? 510  TYR B CE2   1 
ATOM   8883  C CZ    . TYR B 1 510 ? -44.496 72.638  34.755  1.00 7.42  ? 510  TYR B CZ    1 
ATOM   8884  O OH    . TYR B 1 510 ? -45.673 73.329  34.832  1.00 8.73  ? 510  TYR B OH    1 
ATOM   8885  N N     . TRP B 1 511 ? -39.611 67.659  35.651  1.00 13.96 ? 511  TRP B N     1 
ATOM   8886  C CA    . TRP B 1 511 ? -38.709 66.538  35.409  1.00 13.86 ? 511  TRP B CA    1 
ATOM   8887  C C     . TRP B 1 511 ? -39.287 65.870  34.194  1.00 14.95 ? 511  TRP B C     1 
ATOM   8888  O O     . TRP B 1 511 ? -40.359 65.281  34.283  1.00 15.05 ? 511  TRP B O     1 
ATOM   8889  C CB    . TRP B 1 511 ? -38.729 65.561  36.593  1.00 13.06 ? 511  TRP B CB    1 
ATOM   8890  C CG    . TRP B 1 511 ? -38.329 66.212  37.892  1.00 12.76 ? 511  TRP B CG    1 
ATOM   8891  C CD1   . TRP B 1 511 ? -39.079 67.090  38.658  1.00 10.92 ? 511  TRP B CD1   1 
ATOM   8892  C CD2   . TRP B 1 511 ? -37.064 66.082  38.556  1.00 12.28 ? 511  TRP B CD2   1 
ATOM   8893  N NE1   . TRP B 1 511 ? -38.354 67.492  39.757  1.00 10.72 ? 511  TRP B NE1   1 
ATOM   8894  C CE2   . TRP B 1 511 ? -37.115 66.902  39.722  1.00 11.41 ? 511  TRP B CE2   1 
ATOM   8895  C CE3   . TRP B 1 511 ? -35.890 65.358  38.283  1.00 8.76  ? 511  TRP B CE3   1 
ATOM   8896  C CZ2   . TRP B 1 511 ? -36.035 66.992  40.630  1.00 12.65 ? 511  TRP B CZ2   1 
ATOM   8897  C CZ3   . TRP B 1 511 ? -34.810 65.454  39.189  1.00 10.54 ? 511  TRP B CZ3   1 
ATOM   8898  C CH2   . TRP B 1 511 ? -34.897 66.267  40.348  1.00 11.54 ? 511  TRP B CH2   1 
ATOM   8899  N N     . ILE B 1 512 ? -38.618 65.975  33.045  1.00 16.48 ? 512  ILE B N     1 
ATOM   8900  C CA    . ILE B 1 512 ? -39.141 65.317  31.855  1.00 17.74 ? 512  ILE B CA    1 
ATOM   8901  C C     . ILE B 1 512 ? -38.842 63.836  31.916  1.00 18.64 ? 512  ILE B C     1 
ATOM   8902  O O     . ILE B 1 512 ? -37.697 63.445  32.083  1.00 19.09 ? 512  ILE B O     1 
ATOM   8903  C CB    . ILE B 1 512 ? -38.648 65.939  30.554  1.00 18.11 ? 512  ILE B CB    1 
ATOM   8904  C CG1   . ILE B 1 512 ? -39.430 67.226  30.308  1.00 18.75 ? 512  ILE B CG1   1 
ATOM   8905  C CG2   . ILE B 1 512 ? -38.905 64.994  29.358  1.00 16.79 ? 512  ILE B CG2   1 
ATOM   8906  C CD1   . ILE B 1 512 ? -38.843 68.393  30.988  1.00 21.11 ? 512  ILE B CD1   1 
ATOM   8907  N N     . THR B 1 513 ? -39.891 63.034  31.805  1.00 19.22 ? 513  THR B N     1 
ATOM   8908  C CA    . THR B 1 513 ? -39.772 61.605  31.909  1.00 20.16 ? 513  THR B CA    1 
ATOM   8909  C C     . THR B 1 513 ? -39.567 60.947  30.538  1.00 20.33 ? 513  THR B C     1 
ATOM   8910  O O     . THR B 1 513 ? -39.099 59.807  30.471  1.00 21.20 ? 513  THR B O     1 
ATOM   8911  C CB    . THR B 1 513 ? -40.979 60.950  32.680  1.00 20.79 ? 513  THR B CB    1 
ATOM   8912  O OG1   . THR B 1 513 ? -42.232 61.395  32.138  1.00 20.29 ? 513  THR B OG1   1 
ATOM   8913  C CG2   . THR B 1 513 ? -40.918 61.292  34.168  1.00 21.18 ? 513  THR B CG2   1 
ATOM   8914  N N     . GLY B 1 514 ? -39.882 61.654  29.456  1.00 19.48 ? 514  GLY B N     1 
ATOM   8915  C CA    . GLY B 1 514 ? -39.653 61.126  28.098  1.00 18.95 ? 514  GLY B CA    1 
ATOM   8916  C C     . GLY B 1 514 ? -40.908 61.079  27.239  1.00 18.71 ? 514  GLY B C     1 
ATOM   8917  O O     . GLY B 1 514 ? -41.989 61.437  27.708  1.00 19.21 ? 514  GLY B O     1 
ATOM   8918  N N     . ARG B 1 515 ? -40.783 60.642  25.988  1.00 18.04 ? 515  ARG B N     1 
ATOM   8919  C CA    . ARG B 1 515 ? -41.947 60.564  25.090  1.00 17.68 ? 515  ARG B CA    1 
ATOM   8920  C C     . ARG B 1 515 ? -42.966 59.595  25.639  1.00 17.88 ? 515  ARG B C     1 
ATOM   8921  O O     . ARG B 1 515 ? -42.568 58.519  26.141  1.00 17.95 ? 515  ARG B O     1 
ATOM   8922  C CB    . ARG B 1 515 ? -41.575 60.095  23.674  1.00 16.97 ? 515  ARG B CB    1 
ATOM   8923  C CG    . ARG B 1 515 ? -40.568 60.950  22.946  1.00 16.90 ? 515  ARG B CG    1 
ATOM   8924  C CD    . ARG B 1 515 ? -41.073 62.362  22.619  1.00 17.13 ? 515  ARG B CD    1 
ATOM   8925  N NE    . ARG B 1 515 ? -42.126 62.369  21.617  1.00 19.77 ? 515  ARG B NE    1 
ATOM   8926  C CZ    . ARG B 1 515 ? -42.380 63.383  20.781  1.00 21.05 ? 515  ARG B CZ    1 
ATOM   8927  N NH1   . ARG B 1 515 ? -41.661 64.498  20.804  1.00 20.00 ? 515  ARG B NH1   1 
ATOM   8928  N NH2   . ARG B 1 515 ? -43.371 63.288  19.918  1.00 21.03 ? 515  ARG B NH2   1 
ATOM   8929  N N     . VAL B 1 516 ? -44.255 59.979  25.538  1.00 17.54 ? 516  VAL B N     1 
ATOM   8930  C CA    . VAL B 1 516 ? -45.416 59.082  25.785  1.00 17.04 ? 516  VAL B CA    1 
ATOM   8931  C C     . VAL B 1 516 ? -46.112 58.602  24.510  1.00 17.22 ? 516  VAL B C     1 
ATOM   8932  O O     . VAL B 1 516 ? -47.102 57.877  24.587  1.00 17.22 ? 516  VAL B O     1 
ATOM   8933  C CB    . VAL B 1 516 ? -46.557 59.762  26.607  1.00 16.97 ? 516  VAL B CB    1 
ATOM   8934  C CG1   . VAL B 1 516 ? -46.127 59.995  28.036  1.00 15.39 ? 516  VAL B CG1   1 
ATOM   8935  C CG2   . VAL B 1 516 ? -47.056 61.056  25.894  1.00 15.03 ? 516  VAL B CG2   1 
ATOM   8936  N N     . ASP B 1 517 ? -45.668 59.062  23.347  1.00 17.24 ? 517  ASP B N     1 
ATOM   8937  C CA    . ASP B 1 517 ? -46.232 58.559  22.099  1.00 17.36 ? 517  ASP B CA    1 
ATOM   8938  C C     . ASP B 1 517 ? -45.289 57.445  21.569  1.00 17.56 ? 517  ASP B C     1 
ATOM   8939  O O     . ASP B 1 517 ? -44.492 56.895  22.343  1.00 16.77 ? 517  ASP B O     1 
ATOM   8940  C CB    . ASP B 1 517 ? -46.535 59.704  21.104  1.00 16.76 ? 517  ASP B CB    1 
ATOM   8941  C CG    . ASP B 1 517 ? -45.316 60.610  20.813  1.00 18.69 ? 517  ASP B CG    1 
ATOM   8942  O OD1   . ASP B 1 517 ? -45.464 61.542  19.954  1.00 16.45 ? 517  ASP B OD1   1 
ATOM   8943  O OD2   . ASP B 1 517 ? -44.219 60.385  21.419  1.00 17.29 ? 517  ASP B OD2   1 
ATOM   8944  N N     . ASP B 1 518 ? -45.386 57.098  20.288  1.00 18.08 ? 518  ASP B N     1 
ATOM   8945  C CA    . ASP B 1 518 ? -44.582 56.004  19.754  1.00 19.16 ? 518  ASP B CA    1 
ATOM   8946  C C     . ASP B 1 518 ? -43.261 56.483  19.155  1.00 19.43 ? 518  ASP B C     1 
ATOM   8947  O O     . ASP B 1 518 ? -42.879 56.089  18.058  1.00 19.92 ? 518  ASP B O     1 
ATOM   8948  C CB    . ASP B 1 518 ? -45.406 55.184  18.767  1.00 19.67 ? 518  ASP B CB    1 
ATOM   8949  C CG    . ASP B 1 518 ? -46.510 54.430  19.448  1.00 21.66 ? 518  ASP B CG    1 
ATOM   8950  O OD1   . ASP B 1 518 ? -46.214 53.788  20.476  1.00 24.84 ? 518  ASP B OD1   1 
ATOM   8951  O OD2   . ASP B 1 518 ? -47.673 54.490  18.991  1.00 24.33 ? 518  ASP B OD2   1 
ATOM   8952  N N     . VAL B 1 519 ? -42.575 57.339  19.911  1.00 20.05 ? 519  VAL B N     1 
ATOM   8953  C CA    . VAL B 1 519 ? -41.315 57.962  19.524  1.00 20.23 ? 519  VAL B CA    1 
ATOM   8954  C C     . VAL B 1 519 ? -40.171 57.485  20.433  1.00 20.60 ? 519  VAL B C     1 
ATOM   8955  O O     . VAL B 1 519 ? -40.326 57.382  21.647  1.00 21.11 ? 519  VAL B O     1 
ATOM   8956  C CB    . VAL B 1 519 ? -41.457 59.498  19.542  1.00 20.04 ? 519  VAL B CB    1 
ATOM   8957  C CG1   . VAL B 1 519 ? -40.115 60.195  19.599  1.00 19.63 ? 519  VAL B CG1   1 
ATOM   8958  C CG2   . VAL B 1 519 ? -42.239 59.949  18.323  1.00 21.27 ? 519  VAL B CG2   1 
ATOM   8959  N N     . LEU B 1 520 ? -39.029 57.173  19.834  1.00 20.53 ? 520  LEU B N     1 
ATOM   8960  C CA    . LEU B 1 520 ? -37.901 56.672  20.584  1.00 20.34 ? 520  LEU B CA    1 
ATOM   8961  C C     . LEU B 1 520 ? -36.860 57.766  20.662  1.00 20.14 ? 520  LEU B C     1 
ATOM   8962  O O     . LEU B 1 520 ? -36.774 58.593  19.750  1.00 19.44 ? 520  LEU B O     1 
ATOM   8963  C CB    . LEU B 1 520 ? -37.306 55.421  19.916  1.00 20.46 ? 520  LEU B CB    1 
ATOM   8964  C CG    . LEU B 1 520 ? -38.213 54.186  19.748  1.00 20.85 ? 520  LEU B CG    1 
ATOM   8965  C CD1   . LEU B 1 520 ? -37.417 52.946  19.398  1.00 18.41 ? 520  LEU B CD1   1 
ATOM   8966  C CD2   . LEU B 1 520 ? -39.062 53.929  21.020  1.00 22.02 ? 520  LEU B CD2   1 
ATOM   8967  N N     . ASN B 1 521 ? -36.098 57.778  21.761  1.00 19.68 ? 521  ASN B N     1 
ATOM   8968  C CA    . ASN B 1 521 ? -34.881 58.552  21.834  1.00 19.72 ? 521  ASN B CA    1 
ATOM   8969  C C     . ASN B 1 521 ? -33.730 57.578  21.862  1.00 19.06 ? 521  ASN B C     1 
ATOM   8970  O O     . ASN B 1 521 ? -33.518 56.874  22.836  1.00 18.72 ? 521  ASN B O     1 
ATOM   8971  C CB    . ASN B 1 521 ? -34.857 59.495  23.051  1.00 21.02 ? 521  ASN B CB    1 
ATOM   8972  N N     . VAL B 1 522 ? -33.019 57.498  20.755  1.00 18.52 ? 522  VAL B N     1 
ATOM   8973  C CA    . VAL B 1 522 ? -31.861 56.623  20.673  1.00 18.27 ? 522  VAL B CA    1 
ATOM   8974  C C     . VAL B 1 522 ? -30.615 57.468  20.454  1.00 17.87 ? 522  VAL B C     1 
ATOM   8975  O O     . VAL B 1 522 ? -30.515 58.175  19.438  1.00 17.56 ? 522  VAL B O     1 
ATOM   8976  C CB    . VAL B 1 522 ? -32.027 55.599  19.536  1.00 18.56 ? 522  VAL B CB    1 
ATOM   8977  C CG1   . VAL B 1 522 ? -30.759 54.739  19.412  1.00 18.39 ? 522  VAL B CG1   1 
ATOM   8978  C CG2   . VAL B 1 522 ? -33.283 54.726  19.792  1.00 17.08 ? 522  VAL B CG2   1 
ATOM   8979  N N     . SER B 1 523 ? -29.688 57.414  21.419  1.00 17.43 ? 523  SER B N     1 
ATOM   8980  C CA    . SER B 1 523 ? -28.523 58.323  21.482  1.00 16.97 ? 523  SER B CA    1 
ATOM   8981  C C     . SER B 1 523 ? -28.924 59.798  21.396  1.00 17.49 ? 523  SER B C     1 
ATOM   8982  O O     . SER B 1 523 ? -28.159 60.628  20.900  1.00 17.07 ? 523  SER B O     1 
ATOM   8983  C CB    . SER B 1 523 ? -27.535 58.023  20.371  1.00 16.15 ? 523  SER B CB    1 
ATOM   8984  O OG    . SER B 1 523 ? -27.176 56.686  20.445  1.00 15.77 ? 523  SER B OG    1 
ATOM   8985  N N     . GLY B 1 524 ? -30.127 60.118  21.864  1.00 17.79 ? 524  GLY B N     1 
ATOM   8986  C CA    . GLY B 1 524 ? -30.643 61.471  21.706  1.00 18.75 ? 524  GLY B CA    1 
ATOM   8987  C C     . GLY B 1 524 ? -31.147 61.837  20.313  1.00 19.06 ? 524  GLY B C     1 
ATOM   8988  O O     . GLY B 1 524 ? -31.402 63.012  20.046  1.00 19.86 ? 524  GLY B O     1 
ATOM   8989  N N     . HIS B 1 525 ? -31.279 60.857  19.424  1.00 18.83 ? 525  HIS B N     1 
ATOM   8990  C CA    . HIS B 1 525 ? -31.896 61.097  18.127  1.00 19.13 ? 525  HIS B CA    1 
ATOM   8991  C C     . HIS B 1 525 ? -33.351 60.659  18.201  1.00 18.67 ? 525  HIS B C     1 
ATOM   8992  O O     . HIS B 1 525 ? -33.675 59.630  18.786  1.00 18.85 ? 525  HIS B O     1 
ATOM   8993  C CB    . HIS B 1 525 ? -31.164 60.356  16.992  1.00 19.40 ? 525  HIS B CB    1 
ATOM   8994  C CG    . HIS B 1 525 ? -29.704 60.695  16.884  1.00 22.26 ? 525  HIS B CG    1 
ATOM   8995  N ND1   . HIS B 1 525 ? -28.703 59.759  17.053  1.00 25.38 ? 525  HIS B ND1   1 
ATOM   8996  C CD2   . HIS B 1 525 ? -29.077 61.869  16.634  1.00 24.62 ? 525  HIS B CD2   1 
ATOM   8997  C CE1   . HIS B 1 525 ? -27.525 60.339  16.909  1.00 25.16 ? 525  HIS B CE1   1 
ATOM   8998  N NE2   . HIS B 1 525 ? -27.724 61.619  16.652  1.00 26.25 ? 525  HIS B NE2   1 
ATOM   8999  N N     . ARG B 1 526 ? -34.233 61.440  17.601  1.00 18.35 ? 526  ARG B N     1 
ATOM   9000  C CA    . ARG B 1 526 ? -35.648 61.153  17.662  1.00 18.10 ? 526  ARG B CA    1 
ATOM   9001  C C     . ARG B 1 526 ? -36.090 60.314  16.456  1.00 18.55 ? 526  ARG B C     1 
ATOM   9002  O O     . ARG B 1 526 ? -35.885 60.701  15.316  1.00 18.69 ? 526  ARG B O     1 
ATOM   9003  C CB    . ARG B 1 526 ? -36.401 62.475  17.784  1.00 17.91 ? 526  ARG B CB    1 
ATOM   9004  C CG    . ARG B 1 526 ? -37.877 62.470  17.454  1.00 16.71 ? 526  ARG B CG    1 
ATOM   9005  C CD    . ARG B 1 526 ? -38.388 63.893  17.656  1.00 15.59 ? 526  ARG B CD    1 
ATOM   9006  N NE    . ARG B 1 526 ? -39.726 64.107  17.112  1.00 14.53 ? 526  ARG B NE    1 
ATOM   9007  C CZ    . ARG B 1 526 ? -40.422 65.242  17.240  1.00 13.95 ? 526  ARG B CZ    1 
ATOM   9008  N NH1   . ARG B 1 526 ? -39.917 66.296  17.916  1.00 8.59  ? 526  ARG B NH1   1 
ATOM   9009  N NH2   . ARG B 1 526 ? -41.637 65.313  16.691  1.00 10.93 ? 526  ARG B NH2   1 
ATOM   9010  N N     . LEU B 1 527 ? -36.671 59.147  16.724  1.00 19.33 ? 527  LEU B N     1 
ATOM   9011  C CA    . LEU B 1 527 ? -37.101 58.219  15.673  1.00 20.17 ? 527  LEU B CA    1 
ATOM   9012  C C     . LEU B 1 527 ? -38.472 57.639  15.969  1.00 20.62 ? 527  LEU B C     1 
ATOM   9013  O O     . LEU B 1 527 ? -38.790 57.318  17.123  1.00 21.46 ? 527  LEU B O     1 
ATOM   9014  C CB    . LEU B 1 527 ? -36.111 57.072  15.521  1.00 20.65 ? 527  LEU B CB    1 
ATOM   9015  C CG    . LEU B 1 527 ? -34.823 57.415  14.788  1.00 21.01 ? 527  LEU B CG    1 
ATOM   9016  C CD1   . LEU B 1 527 ? -33.782 56.389  15.166  1.00 22.33 ? 527  LEU B CD1   1 
ATOM   9017  C CD2   . LEU B 1 527 ? -35.077 57.430  13.285  1.00 22.31 ? 527  LEU B CD2   1 
ATOM   9018  N N     . GLY B 1 528 ? -39.298 57.520  14.936  1.00 20.47 ? 528  GLY B N     1 
ATOM   9019  C CA    . GLY B 1 528 ? -40.628 56.992  15.125  1.00 20.67 ? 528  GLY B CA    1 
ATOM   9020  C C     . GLY B 1 528 ? -40.561 55.486  15.053  1.00 21.09 ? 528  GLY B C     1 
ATOM   9021  O O     . GLY B 1 528 ? -39.766 54.929  14.273  1.00 21.32 ? 528  GLY B O     1 
ATOM   9022  N N     . THR B 1 529 ? -41.385 54.814  15.854  1.00 21.10 ? 529  THR B N     1 
ATOM   9023  C CA    . THR B 1 529 ? -41.517 53.367  15.713  1.00 20.75 ? 529  THR B CA    1 
ATOM   9024  C C     . THR B 1 529 ? -42.123 52.992  14.341  1.00 21.04 ? 529  THR B C     1 
ATOM   9025  O O     . THR B 1 529 ? -41.623 52.079  13.664  1.00 21.79 ? 529  THR B O     1 
ATOM   9026  C CB    . THR B 1 529 ? -42.229 52.689  16.927  1.00 20.24 ? 529  THR B CB    1 
ATOM   9027  O OG1   . THR B 1 529 ? -43.548 53.200  17.090  1.00 19.86 ? 529  THR B OG1   1 
ATOM   9028  C CG2   . THR B 1 529 ? -41.454 52.934  18.196  1.00 19.89 ? 529  THR B CG2   1 
ATOM   9029  N N     . ALA B 1 530 ? -43.145 53.722  13.893  1.00 21.22 ? 530  ALA B N     1 
ATOM   9030  C CA    . ALA B 1 530 ? -43.835 53.337  12.638  1.00 21.08 ? 530  ALA B CA    1 
ATOM   9031  C C     . ALA B 1 530 ? -42.943 53.351  11.378  1.00 20.64 ? 530  ALA B C     1 
ATOM   9032  O O     . ALA B 1 530 ? -43.139 52.516  10.506  1.00 20.71 ? 530  ALA B O     1 
ATOM   9033  C CB    . ALA B 1 530 ? -45.175 54.107  12.423  1.00 20.00 ? 530  ALA B CB    1 
ATOM   9034  N N     . GLU B 1 531 ? -41.967 54.269  11.304  1.00 20.43 ? 531  GLU B N     1 
ATOM   9035  C CA    . GLU B 1 531 ? -41.076 54.395  10.124  1.00 20.20 ? 531  GLU B CA    1 
ATOM   9036  C C     . GLU B 1 531 ? -40.012 53.305  10.042  1.00 19.65 ? 531  GLU B C     1 
ATOM   9037  O O     . GLU B 1 531 ? -39.644 52.903  8.928   1.00 19.91 ? 531  GLU B O     1 
ATOM   9038  C CB    . GLU B 1 531 ? -40.393 55.753  10.078  1.00 21.04 ? 531  GLU B CB    1 
ATOM   9039  C CG    . GLU B 1 531 ? -39.409 55.961  11.209  1.00 23.50 ? 531  GLU B CG    1 
ATOM   9040  C CD    . GLU B 1 531 ? -38.828 57.341  11.223  1.00 27.15 ? 531  GLU B CD    1 
ATOM   9041  O OE1   . GLU B 1 531 ? -37.951 57.618  10.373  1.00 30.81 ? 531  GLU B OE1   1 
ATOM   9042  O OE2   . GLU B 1 531 ? -39.243 58.137  12.091  1.00 27.34 ? 531  GLU B OE2   1 
ATOM   9043  N N     . ILE B 1 532 ? -39.530 52.844  11.206  1.00 17.96 ? 532  ILE B N     1 
ATOM   9044  C CA    . ILE B 1 532 ? -38.688 51.655  11.305  1.00 17.45 ? 532  ILE B CA    1 
ATOM   9045  C C     . ILE B 1 532 ? -39.477 50.401  10.917  1.00 17.61 ? 532  ILE B C     1 
ATOM   9046  O O     . ILE B 1 532 ? -38.994 49.569  10.156  1.00 17.62 ? 532  ILE B O     1 
ATOM   9047  C CB    . ILE B 1 532 ? -38.073 51.481  12.720  1.00 17.60 ? 532  ILE B CB    1 
ATOM   9048  C CG1   . ILE B 1 532 ? -37.154 52.659  13.047  1.00 17.70 ? 532  ILE B CG1   1 
ATOM   9049  C CG2   . ILE B 1 532 ? -37.240 50.224  12.799  1.00 16.44 ? 532  ILE B CG2   1 
ATOM   9050  C CD1   . ILE B 1 532 ? -36.683 52.680  14.461  1.00 18.68 ? 532  ILE B CD1   1 
ATOM   9051  N N     . GLU B 1 533 ? -40.695 50.277  11.426  1.00 17.29 ? 533  GLU B N     1 
ATOM   9052  C CA    . GLU B 1 533 ? -41.586 49.219  11.002  1.00 17.26 ? 533  GLU B CA    1 
ATOM   9053  C C     . GLU B 1 533 ? -41.797 49.148  9.476   1.00 17.71 ? 533  GLU B C     1 
ATOM   9054  O O     . GLU B 1 533 ? -41.657 48.063  8.862   1.00 17.01 ? 533  GLU B O     1 
ATOM   9055  C CB    . GLU B 1 533 ? -42.911 49.352  11.726  1.00 16.94 ? 533  GLU B CB    1 
ATOM   9056  C CG    . GLU B 1 533 ? -42.855 48.853  13.156  1.00 16.61 ? 533  GLU B CG    1 
ATOM   9057  C CD    . GLU B 1 533 ? -44.053 49.276  13.986  1.00 16.82 ? 533  GLU B CD    1 
ATOM   9058  O OE1   . GLU B 1 533 ? -44.990 49.905  13.429  1.00 16.59 ? 533  GLU B OE1   1 
ATOM   9059  O OE2   . GLU B 1 533 ? -44.050 48.979  15.206  1.00 18.53 ? 533  GLU B OE2   1 
ATOM   9060  N N     . SER B 1 534 ? -42.116 50.295  8.869   1.00 18.04 ? 534  SER B N     1 
ATOM   9061  C CA    . SER B 1 534 ? -42.283 50.374  7.409   1.00 18.71 ? 534  SER B CA    1 
ATOM   9062  C C     . SER B 1 534 ? -40.966 50.051  6.673   1.00 18.19 ? 534  SER B C     1 
ATOM   9063  O O     . SER B 1 534 ? -40.962 49.334  5.669   1.00 18.02 ? 534  SER B O     1 
ATOM   9064  C CB    . SER B 1 534 ? -42.897 51.719  6.956   1.00 18.86 ? 534  SER B CB    1 
ATOM   9065  O OG    . SER B 1 534 ? -42.329 52.823  7.641   1.00 21.26 ? 534  SER B OG    1 
ATOM   9066  N N     . ALA B 1 535 ? -39.855 50.554  7.197   1.00 17.76 ? 535  ALA B N     1 
ATOM   9067  C CA    . ALA B 1 535 ? -38.560 50.178  6.670   1.00 17.68 ? 535  ALA B CA    1 
ATOM   9068  C C     . ALA B 1 535 ? -38.378 48.663  6.729   1.00 17.50 ? 535  ALA B C     1 
ATOM   9069  O O     . ALA B 1 535 ? -37.924 48.042  5.758   1.00 17.70 ? 535  ALA B O     1 
ATOM   9070  C CB    . ALA B 1 535 ? -37.448 50.867  7.439   1.00 18.06 ? 535  ALA B CB    1 
ATOM   9071  N N     . LEU B 1 536 ? -38.724 48.062  7.858   1.00 16.83 ? 536  LEU B N     1 
ATOM   9072  C CA    . LEU B 1 536 ? -38.576 46.614  8.006   1.00 16.64 ? 536  LEU B CA    1 
ATOM   9073  C C     . LEU B 1 536 ? -39.454 45.863  7.033   1.00 17.05 ? 536  LEU B C     1 
ATOM   9074  O O     . LEU B 1 536 ? -39.001 44.907  6.403   1.00 17.57 ? 536  LEU B O     1 
ATOM   9075  C CB    . LEU B 1 536 ? -38.891 46.157  9.432   1.00 15.65 ? 536  LEU B CB    1 
ATOM   9076  C CG    . LEU B 1 536 ? -37.747 46.374  10.423  1.00 15.93 ? 536  LEU B CG    1 
ATOM   9077  C CD1   . LEU B 1 536 ? -38.227 46.319  11.856  1.00 14.27 ? 536  LEU B CD1   1 
ATOM   9078  C CD2   . LEU B 1 536 ? -36.592 45.390  10.187  1.00 14.55 ? 536  LEU B CD2   1 
ATOM   9079  N N     . VAL B 1 537 ? -40.702 46.308  6.902   1.00 17.39 ? 537  VAL B N     1 
ATOM   9080  C CA    . VAL B 1 537 ? -41.728 45.530  6.207   1.00 17.70 ? 537  VAL B CA    1 
ATOM   9081  C C     . VAL B 1 537 ? -41.506 45.542  4.698   1.00 17.94 ? 537  VAL B C     1 
ATOM   9082  O O     . VAL B 1 537 ? -41.943 44.624  3.964   1.00 18.24 ? 537  VAL B O     1 
ATOM   9083  C CB    . VAL B 1 537 ? -43.162 45.991  6.620   1.00 17.88 ? 537  VAL B CB    1 
ATOM   9084  C CG1   . VAL B 1 537 ? -44.224 45.537  5.630   1.00 17.09 ? 537  VAL B CG1   1 
ATOM   9085  C CG2   . VAL B 1 537 ? -43.485 45.477  8.020   1.00 17.76 ? 537  VAL B CG2   1 
ATOM   9086  N N     . ALA B 1 538 ? -40.799 46.568  4.245   1.00 17.79 ? 538  ALA B N     1 
ATOM   9087  C CA    . ALA B 1 538 ? -40.488 46.700  2.831   1.00 18.33 ? 538  ALA B CA    1 
ATOM   9088  C C     . ALA B 1 538 ? -39.401 45.710  2.410   1.00 18.28 ? 538  ALA B C     1 
ATOM   9089  O O     . ALA B 1 538 ? -39.132 45.539  1.236   1.00 18.88 ? 538  ALA B O     1 
ATOM   9090  C CB    . ALA B 1 538 ? -40.091 48.167  2.490   1.00 17.73 ? 538  ALA B CB    1 
ATOM   9091  N N     . HIS B 1 539 ? -38.760 45.061  3.366   1.00 18.65 ? 539  HIS B N     1 
ATOM   9092  C CA    . HIS B 1 539 ? -37.822 44.008  3.012   1.00 19.45 ? 539  HIS B CA    1 
ATOM   9093  C C     . HIS B 1 539 ? -38.631 42.850  2.423   1.00 19.39 ? 539  HIS B C     1 
ATOM   9094  O O     . HIS B 1 539 ? -39.681 42.499  2.959   1.00 19.60 ? 539  HIS B O     1 
ATOM   9095  C CB    . HIS B 1 539 ? -37.006 43.576  4.236   1.00 19.45 ? 539  HIS B CB    1 
ATOM   9096  C CG    . HIS B 1 539 ? -36.006 42.502  3.942   1.00 21.49 ? 539  HIS B CG    1 
ATOM   9097  N ND1   . HIS B 1 539 ? -36.369 41.187  3.729   1.00 22.85 ? 539  HIS B ND1   1 
ATOM   9098  C CD2   . HIS B 1 539 ? -34.657 42.550  3.802   1.00 21.46 ? 539  HIS B CD2   1 
ATOM   9099  C CE1   . HIS B 1 539 ? -35.286 40.474  3.466   1.00 22.90 ? 539  HIS B CE1   1 
ATOM   9100  N NE2   . HIS B 1 539 ? -34.235 41.275  3.512   1.00 21.86 ? 539  HIS B NE2   1 
ATOM   9101  N N     . PRO B 1 540 ? -38.170 42.262  1.304   1.00 19.81 ? 540  PRO B N     1 
ATOM   9102  C CA    . PRO B 1 540 ? -38.960 41.175  0.652   1.00 19.38 ? 540  PRO B CA    1 
ATOM   9103  C C     . PRO B 1 540 ? -39.317 39.961  1.544   1.00 19.17 ? 540  PRO B C     1 
ATOM   9104  O O     . PRO B 1 540 ? -40.355 39.361  1.334   1.00 19.84 ? 540  PRO B O     1 
ATOM   9105  C CB    . PRO B 1 540 ? -38.065 40.731  -0.512  1.00 19.05 ? 540  PRO B CB    1 
ATOM   9106  C CG    . PRO B 1 540 ? -37.158 41.894  -0.787  1.00 19.47 ? 540  PRO B CG    1 
ATOM   9107  C CD    . PRO B 1 540 ? -36.910 42.531  0.583   1.00 19.99 ? 540  PRO B CD    1 
ATOM   9108  N N     . LYS B 1 541 ? -38.494 39.613  2.536   1.00 19.13 ? 541  LYS B N     1 
ATOM   9109  C CA    . LYS B 1 541 ? -38.734 38.415  3.372   1.00 18.54 ? 541  LYS B CA    1 
ATOM   9110  C C     . LYS B 1 541 ? -39.564 38.629  4.657   1.00 18.34 ? 541  LYS B C     1 
ATOM   9111  O O     . LYS B 1 541 ? -39.898 37.647  5.356   1.00 18.49 ? 541  LYS B O     1 
ATOM   9112  C CB    . LYS B 1 541 ? -37.413 37.737  3.740   1.00 18.90 ? 541  LYS B CB    1 
ATOM   9113  C CG    . LYS B 1 541 ? -36.589 37.191  2.566   1.00 19.81 ? 541  LYS B CG    1 
ATOM   9114  C CD    . LYS B 1 541 ? -35.680 36.063  3.021   1.00 21.90 ? 541  LYS B CD    1 
ATOM   9115  C CE    . LYS B 1 541 ? -34.857 35.494  1.873   1.00 24.29 ? 541  LYS B CE    1 
ATOM   9116  N NZ    . LYS B 1 541 ? -33.552 36.237  1.797   1.00 26.43 ? 541  LYS B NZ    1 
ATOM   9117  N N     . ILE B 1 542 ? -39.905 39.888  4.952   1.00 16.90 ? 542  ILE B N     1 
ATOM   9118  C CA    . ILE B 1 542 ? -40.662 40.253  6.147   1.00 16.45 ? 542  ILE B CA    1 
ATOM   9119  C C     . ILE B 1 542 ? -42.169 40.531  5.900   1.00 16.66 ? 542  ILE B C     1 
ATOM   9120  O O     . ILE B 1 542 ? -42.551 41.319  5.028   1.00 15.53 ? 542  ILE B O     1 
ATOM   9121  C CB    . ILE B 1 542 ? -39.999 41.459  6.879   1.00 16.45 ? 542  ILE B CB    1 
ATOM   9122  C CG1   . ILE B 1 542 ? -38.627 41.051  7.454   1.00 17.03 ? 542  ILE B CG1   1 
ATOM   9123  C CG2   . ILE B 1 542 ? -40.904 41.999  7.972   1.00 15.71 ? 542  ILE B CG2   1 
ATOM   9124  C CD1   . ILE B 1 542 ? -37.588 42.187  7.568   1.00 16.25 ? 542  ILE B CD1   1 
ATOM   9125  N N     . ALA B 1 543 ? -43.000 39.871  6.706   1.00 17.38 ? 543  ALA B N     1 
ATOM   9126  C CA    . ALA B 1 543 ? -44.457 39.956  6.615   1.00 18.55 ? 543  ALA B CA    1 
ATOM   9127  C C     . ALA B 1 543 ? -44.946 41.123  7.440   1.00 19.55 ? 543  ALA B C     1 
ATOM   9128  O O     . ALA B 1 543 ? -45.726 41.954  6.952   1.00 19.20 ? 543  ALA B O     1 
ATOM   9129  C CB    . ALA B 1 543 ? -45.107 38.662  7.112   1.00 18.17 ? 543  ALA B CB    1 
ATOM   9130  N N     . GLU B 1 544 ? -44.475 41.164  8.693   1.00 20.36 ? 544  GLU B N     1 
ATOM   9131  C CA    . GLU B 1 544 ? -44.788 42.238  9.611   1.00 21.68 ? 544  GLU B CA    1 
ATOM   9132  C C     . GLU B 1 544 ? -43.738 42.450  10.711  1.00 21.35 ? 544  GLU B C     1 
ATOM   9133  O O     . GLU B 1 544 ? -42.942 41.561  11.017  1.00 21.79 ? 544  GLU B O     1 
ATOM   9134  C CB    . GLU B 1 544 ? -46.202 42.093  10.177  1.00 21.43 ? 544  GLU B CB    1 
ATOM   9135  C CG    . GLU B 1 544 ? -46.551 40.752  10.762  1.00 23.78 ? 544  GLU B CG    1 
ATOM   9136  C CD    . GLU B 1 544 ? -48.074 40.525  10.900  1.00 24.52 ? 544  GLU B CD    1 
ATOM   9137  O OE1   . GLU B 1 544 ? -48.873 41.449  10.558  1.00 26.76 ? 544  GLU B OE1   1 
ATOM   9138  O OE2   . GLU B 1 544 ? -48.463 39.411  11.359  1.00 27.11 ? 544  GLU B OE2   1 
ATOM   9139  N N     . ALA B 1 545 ? -43.735 43.642  11.294  1.00 20.96 ? 545  ALA B N     1 
ATOM   9140  C CA    . ALA B 1 545 ? -42.763 43.979  12.313  1.00 20.50 ? 545  ALA B CA    1 
ATOM   9141  C C     . ALA B 1 545 ? -43.358 44.934  13.321  1.00 20.33 ? 545  ALA B C     1 
ATOM   9142  O O     . ALA B 1 545 ? -44.184 45.769  12.962  1.00 19.98 ? 545  ALA B O     1 
ATOM   9143  C CB    . ALA B 1 545 ? -41.553 44.603  11.686  1.00 20.32 ? 545  ALA B CB    1 
ATOM   9144  N N     . ALA B 1 546 ? -42.931 44.808  14.579  1.00 19.83 ? 546  ALA B N     1 
ATOM   9145  C CA    . ALA B 1 546 ? -43.243 45.818  15.586  1.00 19.52 ? 546  ALA B CA    1 
ATOM   9146  C C     . ALA B 1 546 ? -41.994 46.203  16.354  1.00 19.14 ? 546  ALA B C     1 
ATOM   9147  O O     . ALA B 1 546 ? -41.210 45.345  16.783  1.00 19.16 ? 546  ALA B O     1 
ATOM   9148  C CB    . ALA B 1 546 ? -44.327 45.365  16.525  1.00 19.80 ? 546  ALA B CB    1 
ATOM   9149  N N     . VAL B 1 547 ? -41.829 47.508  16.529  1.00 18.36 ? 547  VAL B N     1 
ATOM   9150  C CA    . VAL B 1 547 ? -40.617 48.054  17.093  1.00 17.53 ? 547  VAL B CA    1 
ATOM   9151  C C     . VAL B 1 547 ? -40.966 48.751  18.401  1.00 17.71 ? 547  VAL B C     1 
ATOM   9152  O O     . VAL B 1 547 ? -41.970 49.504  18.461  1.00 17.06 ? 547  VAL B O     1 
ATOM   9153  C CB    . VAL B 1 547 ? -39.970 49.066  16.119  1.00 17.49 ? 547  VAL B CB    1 
ATOM   9154  C CG1   . VAL B 1 547 ? -38.856 49.862  16.809  1.00 16.04 ? 547  VAL B CG1   1 
ATOM   9155  C CG2   . VAL B 1 547 ? -39.496 48.369  14.841  1.00 16.07 ? 547  VAL B CG2   1 
ATOM   9156  N N     . VAL B 1 548 ? -40.153 48.492  19.435  1.00 17.08 ? 548  VAL B N     1 
ATOM   9157  C CA    . VAL B 1 548 ? -40.272 49.220  20.682  1.00 17.00 ? 548  VAL B CA    1 
ATOM   9158  C C     . VAL B 1 548 ? -38.905 49.633  21.188  1.00 17.97 ? 548  VAL B C     1 
ATOM   9159  O O     . VAL B 1 548 ? -37.852 49.189  20.656  1.00 17.93 ? 548  VAL B O     1 
ATOM   9160  C CB    . VAL B 1 548 ? -41.087 48.471  21.789  1.00 16.87 ? 548  VAL B CB    1 
ATOM   9161  C CG1   . VAL B 1 548 ? -42.424 47.977  21.234  1.00 16.80 ? 548  VAL B CG1   1 
ATOM   9162  C CG2   . VAL B 1 548 ? -40.300 47.326  22.439  1.00 15.36 ? 548  VAL B CG2   1 
ATOM   9163  N N     . GLY B 1 549 ? -38.944 50.505  22.200  1.00 18.04 ? 549  GLY B N     1 
ATOM   9164  C CA    . GLY B 1 549 ? -37.764 50.949  22.899  1.00 18.21 ? 549  GLY B CA    1 
ATOM   9165  C C     . GLY B 1 549 ? -37.555 50.085  24.118  1.00 18.59 ? 549  GLY B C     1 
ATOM   9166  O O     . GLY B 1 549 ? -38.529 49.625  24.744  1.00 18.84 ? 549  GLY B O     1 
ATOM   9167  N N     . ILE B 1 550 ? -36.275 49.818  24.406  1.00 18.73 ? 550  ILE B N     1 
ATOM   9168  C CA    . ILE B 1 550 ? -35.839 49.259  25.694  1.00 18.22 ? 550  ILE B CA    1 
ATOM   9169  C C     . ILE B 1 550 ? -34.742 50.168  26.272  1.00 18.10 ? 550  ILE B C     1 
ATOM   9170  O O     . ILE B 1 550 ? -33.997 50.814  25.516  1.00 17.77 ? 550  ILE B O     1 
ATOM   9171  C CB    . ILE B 1 550 ? -35.359 47.764  25.601  1.00 18.08 ? 550  ILE B CB    1 
ATOM   9172  C CG1   . ILE B 1 550 ? -34.108 47.622  24.729  1.00 18.58 ? 550  ILE B CG1   1 
ATOM   9173  C CG2   . ILE B 1 550 ? -36.492 46.842  25.120  1.00 17.18 ? 550  ILE B CG2   1 
ATOM   9174  C CD1   . ILE B 1 550 ? -33.209 46.438  25.116  1.00 17.96 ? 550  ILE B CD1   1 
ATOM   9175  N N     . PRO B 1 551 ? -34.666 50.255  27.610  1.00 17.95 ? 551  PRO B N     1 
ATOM   9176  C CA    . PRO B 1 551 ? -33.576 51.024  28.214  1.00 17.79 ? 551  PRO B CA    1 
ATOM   9177  C C     . PRO B 1 551 ? -32.208 50.507  27.776  1.00 17.72 ? 551  PRO B C     1 
ATOM   9178  O O     . PRO B 1 551 ? -32.018 49.307  27.611  1.00 17.31 ? 551  PRO B O     1 
ATOM   9179  C CB    . PRO B 1 551 ? -33.792 50.843  29.730  1.00 17.22 ? 551  PRO B CB    1 
ATOM   9180  C CG    . PRO B 1 551 ? -34.733 49.685  29.861  1.00 17.76 ? 551  PRO B CG    1 
ATOM   9181  C CD    . PRO B 1 551 ? -35.573 49.685  28.625  1.00 18.03 ? 551  PRO B CD    1 
ATOM   9182  N N     . HIS B 1 552 ? -31.296 51.445  27.530  1.00 18.11 ? 552  HIS B N     1 
ATOM   9183  C CA    . HIS B 1 552 ? -29.896 51.178  27.239  1.00 17.87 ? 552  HIS B CA    1 
ATOM   9184  C C     . HIS B 1 552 ? -29.082 52.162  28.087  1.00 17.54 ? 552  HIS B C     1 
ATOM   9185  O O     . HIS B 1 552 ? -29.400 53.343  28.144  1.00 17.16 ? 552  HIS B O     1 
ATOM   9186  C CB    . HIS B 1 552 ? -29.607 51.364  25.740  1.00 17.97 ? 552  HIS B CB    1 
ATOM   9187  C CG    . HIS B 1 552 ? -28.205 51.005  25.349  1.00 19.30 ? 552  HIS B CG    1 
ATOM   9188  N ND1   . HIS B 1 552 ? -27.881 49.800  24.760  1.00 18.65 ? 552  HIS B ND1   1 
ATOM   9189  C CD2   . HIS B 1 552 ? -27.038 51.685  25.486  1.00 19.66 ? 552  HIS B CD2   1 
ATOM   9190  C CE1   . HIS B 1 552 ? -26.578 49.757  24.539  1.00 20.35 ? 552  HIS B CE1   1 
ATOM   9191  N NE2   . HIS B 1 552 ? -26.043 50.888  24.974  1.00 21.11 ? 552  HIS B NE2   1 
ATOM   9192  N N     . ALA B 1 553 ? -28.038 51.674  28.749  1.00 17.31 ? 553  ALA B N     1 
ATOM   9193  C CA    . ALA B 1 553 ? -27.283 52.492  29.699  1.00 17.04 ? 553  ALA B CA    1 
ATOM   9194  C C     . ALA B 1 553 ? -26.553 53.704  29.091  1.00 17.15 ? 553  ALA B C     1 
ATOM   9195  O O     . ALA B 1 553 ? -26.296 54.688  29.802  1.00 16.73 ? 553  ALA B O     1 
ATOM   9196  C CB    . ALA B 1 553 ? -26.319 51.630  30.486  1.00 16.52 ? 553  ALA B CB    1 
ATOM   9197  N N     . ILE B 1 554 ? -26.209 53.633  27.802  1.00 17.34 ? 554  ILE B N     1 
ATOM   9198  C CA    . ILE B 1 554 ? -25.474 54.723  27.137  1.00 17.89 ? 554  ILE B CA    1 
ATOM   9199  C C     . ILE B 1 554 ? -26.408 55.490  26.245  1.00 18.57 ? 554  ILE B C     1 
ATOM   9200  O O     . ILE B 1 554 ? -26.533 56.704  26.375  1.00 18.50 ? 554  ILE B O     1 
ATOM   9201  C CB    . ILE B 1 554 ? -24.274 54.225  26.251  1.00 17.82 ? 554  ILE B CB    1 
ATOM   9202  C CG1   . ILE B 1 554 ? -23.340 53.264  27.017  1.00 18.27 ? 554  ILE B CG1   1 
ATOM   9203  C CG2   . ILE B 1 554 ? -23.510 55.407  25.653  1.00 16.67 ? 554  ILE B CG2   1 
ATOM   9204  C CD1   . ILE B 1 554 ? -22.859 53.758  28.428  1.00 17.03 ? 554  ILE B CD1   1 
ATOM   9205  N N     . LYS B 1 555 ? -27.056 54.760  25.331  1.00 19.66 ? 555  LYS B N     1 
ATOM   9206  C CA    . LYS B 1 555 ? -27.889 55.351  24.288  1.00 20.42 ? 555  LYS B CA    1 
ATOM   9207  C C     . LYS B 1 555 ? -29.247 55.890  24.788  1.00 20.09 ? 555  LYS B C     1 
ATOM   9208  O O     . LYS B 1 555 ? -29.934 56.595  24.050  1.00 20.34 ? 555  LYS B O     1 
ATOM   9209  C CB    . LYS B 1 555 ? -28.137 54.342  23.175  1.00 21.38 ? 555  LYS B CB    1 
ATOM   9210  C CG    . LYS B 1 555 ? -26.918 53.826  22.391  1.00 24.03 ? 555  LYS B CG    1 
ATOM   9211  C CD    . LYS B 1 555 ? -27.427 52.693  21.483  1.00 29.52 ? 555  LYS B CD    1 
ATOM   9212  C CE    . LYS B 1 555 ? -26.371 52.117  20.552  1.00 32.11 ? 555  LYS B CE    1 
ATOM   9213  N NZ    . LYS B 1 555 ? -27.062 51.203  19.580  1.00 32.07 ? 555  LYS B NZ    1 
ATOM   9214  N N     . GLY B 1 556 ? -29.627 55.575  26.027  1.00 19.31 ? 556  GLY B N     1 
ATOM   9215  C CA    . GLY B 1 556 ? -30.956 55.939  26.541  1.00 17.93 ? 556  GLY B CA    1 
ATOM   9216  C C     . GLY B 1 556 ? -31.974 54.845  26.254  1.00 17.29 ? 556  GLY B C     1 
ATOM   9217  O O     . GLY B 1 556 ? -32.489 54.173  27.174  1.00 17.33 ? 556  GLY B O     1 
ATOM   9218  N N     . GLN B 1 557 ? -32.279 54.669  24.976  1.00 16.06 ? 557  GLN B N     1 
ATOM   9219  C CA    . GLN B 1 557 ? -33.131 53.570  24.542  1.00 16.07 ? 557  GLN B CA    1 
ATOM   9220  C C     . GLN B 1 557 ? -32.384 52.850  23.441  1.00 15.58 ? 557  GLN B C     1 
ATOM   9221  O O     . GLN B 1 557 ? -31.568 53.451  22.735  1.00 15.28 ? 557  GLN B O     1 
ATOM   9222  C CB    . GLN B 1 557 ? -34.494 54.044  23.985  1.00 15.60 ? 557  GLN B CB    1 
ATOM   9223  C CG    . GLN B 1 557 ? -35.385 54.810  24.931  1.00 16.00 ? 557  GLN B CG    1 
ATOM   9224  C CD    . GLN B 1 557 ? -36.799 54.991  24.375  1.00 16.46 ? 557  GLN B CD    1 
ATOM   9225  O OE1   . GLN B 1 557 ? -37.018 55.779  23.446  1.00 16.16 ? 557  GLN B OE1   1 
ATOM   9226  N NE2   . GLN B 1 557 ? -37.766 54.253  24.945  1.00 15.55 ? 557  GLN B NE2   1 
ATOM   9227  N N     . ALA B 1 558 ? -32.667 51.567  23.293  1.00 15.34 ? 558  ALA B N     1 
ATOM   9228  C CA    . ALA B 1 558 ? -32.174 50.816  22.155  1.00 15.42 ? 558  ALA B CA    1 
ATOM   9229  C C     . ALA B 1 558 ? -33.387 50.349  21.337  1.00 15.54 ? 558  ALA B C     1 
ATOM   9230  O O     . ALA B 1 558 ? -34.501 50.264  21.853  1.00 14.97 ? 558  ALA B O     1 
ATOM   9231  C CB    . ALA B 1 558 ? -31.287 49.628  22.607  1.00 14.70 ? 558  ALA B CB    1 
ATOM   9232  N N     . ILE B 1 559 ? -33.154 50.074  20.055  1.00 16.38 ? 559  ILE B N     1 
ATOM   9233  C CA    . ILE B 1 559 ? -34.213 49.630  19.164  1.00 16.45 ? 559  ILE B CA    1 
ATOM   9234  C C     . ILE B 1 559 ? -34.327 48.103  19.178  1.00 16.42 ? 559  ILE B C     1 
ATOM   9235  O O     . ILE B 1 559 ? -33.356 47.403  18.884  1.00 15.60 ? 559  ILE B O     1 
ATOM   9236  C CB    . ILE B 1 559 ? -33.983 50.131  17.750  1.00 16.47 ? 559  ILE B CB    1 
ATOM   9237  C CG1   . ILE B 1 559 ? -33.844 51.652  17.746  1.00 15.57 ? 559  ILE B CG1   1 
ATOM   9238  C CG2   . ILE B 1 559 ? -35.107 49.658  16.860  1.00 16.76 ? 559  ILE B CG2   1 
ATOM   9239  C CD1   . ILE B 1 559 ? -33.223 52.163  16.482  1.00 15.95 ? 559  ILE B CD1   1 
ATOM   9240  N N     . TYR B 1 560 ? -35.523 47.630  19.552  1.00 16.76 ? 560  TYR B N     1 
ATOM   9241  C CA    . TYR B 1 560 ? -35.846 46.206  19.732  1.00 17.17 ? 560  TYR B CA    1 
ATOM   9242  C C     . TYR B 1 560 ? -37.034 45.934  18.814  1.00 17.16 ? 560  TYR B C     1 
ATOM   9243  O O     . TYR B 1 560 ? -38.146 46.449  19.042  1.00 17.35 ? 560  TYR B O     1 
ATOM   9244  C CB    . TYR B 1 560 ? -36.195 45.909  21.207  1.00 16.98 ? 560  TYR B CB    1 
ATOM   9245  C CG    . TYR B 1 560 ? -36.488 44.450  21.557  1.00 18.02 ? 560  TYR B CG    1 
ATOM   9246  C CD1   . TYR B 1 560 ? -37.645 43.811  21.094  1.00 19.50 ? 560  TYR B CD1   1 
ATOM   9247  C CD2   . TYR B 1 560 ? -35.626 43.714  22.390  1.00 17.70 ? 560  TYR B CD2   1 
ATOM   9248  C CE1   . TYR B 1 560 ? -37.917 42.473  21.424  1.00 19.02 ? 560  TYR B CE1   1 
ATOM   9249  C CE2   . TYR B 1 560 ? -35.890 42.378  22.725  1.00 15.54 ? 560  TYR B CE2   1 
ATOM   9250  C CZ    . TYR B 1 560 ? -37.030 41.767  22.233  1.00 17.97 ? 560  TYR B CZ    1 
ATOM   9251  O OH    . TYR B 1 560 ? -37.320 40.461  22.551  1.00 18.74 ? 560  TYR B OH    1 
ATOM   9252  N N     . ALA B 1 561 ? -36.777 45.155  17.767  1.00 16.93 ? 561  ALA B N     1 
ATOM   9253  C CA    . ALA B 1 561 ? -37.765 44.900  16.712  1.00 16.79 ? 561  ALA B CA    1 
ATOM   9254  C C     . ALA B 1 561 ? -38.210 43.434  16.671  1.00 16.95 ? 561  ALA B C     1 
ATOM   9255  O O     . ALA B 1 561 ? -37.395 42.487  16.582  1.00 15.78 ? 561  ALA B O     1 
ATOM   9256  C CB    . ALA B 1 561 ? -37.211 45.315  15.375  1.00 16.21 ? 561  ALA B CB    1 
ATOM   9257  N N     . TYR B 1 562 ? -39.519 43.262  16.783  1.00 17.61 ? 562  TYR B N     1 
ATOM   9258  C CA    . TYR B 1 562 ? -40.144 41.962  16.582  1.00 18.68 ? 562  TYR B CA    1 
ATOM   9259  C C     . TYR B 1 562 ? -40.432 41.820  15.078  1.00 18.82 ? 562  TYR B C     1 
ATOM   9260  O O     . TYR B 1 562 ? -41.100 42.682  14.481  1.00 18.81 ? 562  TYR B O     1 
ATOM   9261  C CB    . TYR B 1 562 ? -41.454 41.862  17.356  1.00 18.82 ? 562  TYR B CB    1 
ATOM   9262  C CG    . TYR B 1 562 ? -41.376 41.952  18.867  1.00 19.57 ? 562  TYR B CG    1 
ATOM   9263  C CD1   . TYR B 1 562 ? -41.408 43.196  19.520  1.00 21.16 ? 562  TYR B CD1   1 
ATOM   9264  C CD2   . TYR B 1 562 ? -41.359 40.803  19.648  1.00 19.06 ? 562  TYR B CD2   1 
ATOM   9265  C CE1   . TYR B 1 562 ? -41.381 43.291  20.913  1.00 20.80 ? 562  TYR B CE1   1 
ATOM   9266  C CE2   . TYR B 1 562 ? -41.332 40.880  21.037  1.00 20.44 ? 562  TYR B CE2   1 
ATOM   9267  C CZ    . TYR B 1 562 ? -41.345 42.119  21.661  1.00 21.11 ? 562  TYR B CZ    1 
ATOM   9268  O OH    . TYR B 1 562 ? -41.331 42.172  23.031  1.00 20.24 ? 562  TYR B OH    1 
ATOM   9269  N N     . VAL B 1 563 ? -39.908 40.757  14.471  1.00 18.61 ? 563  VAL B N     1 
ATOM   9270  C CA    . VAL B 1 563 ? -40.053 40.551  13.044  1.00 18.26 ? 563  VAL B CA    1 
ATOM   9271  C C     . VAL B 1 563 ? -40.729 39.213  12.771  1.00 18.72 ? 563  VAL B C     1 
ATOM   9272  O O     . VAL B 1 563 ? -40.336 38.164  13.339  1.00 18.46 ? 563  VAL B O     1 
ATOM   9273  C CB    . VAL B 1 563 ? -38.708 40.588  12.325  1.00 18.48 ? 563  VAL B CB    1 
ATOM   9274  C CG1   . VAL B 1 563 ? -38.915 40.361  10.819  1.00 18.08 ? 563  VAL B CG1   1 
ATOM   9275  C CG2   . VAL B 1 563 ? -37.975 41.925  12.590  1.00 18.22 ? 563  VAL B CG2   1 
ATOM   9276  N N     . THR B 1 564 ? -41.763 39.267  11.928  1.00 18.40 ? 564  THR B N     1 
ATOM   9277  C CA    . THR B 1 564 ? -42.452 38.078  11.458  1.00 18.18 ? 564  THR B CA    1 
ATOM   9278  C C     . THR B 1 564 ? -42.054 37.853  10.003  1.00 18.20 ? 564  THR B C     1 
ATOM   9279  O O     . THR B 1 564 ? -42.230 38.740  9.153   1.00 17.74 ? 564  THR B O     1 
ATOM   9280  C CB    . THR B 1 564 ? -43.991 38.206  11.592  1.00 18.17 ? 564  THR B CB    1 
ATOM   9281  O OG1   . THR B 1 564 ? -44.343 38.343  12.978  1.00 18.99 ? 564  THR B OG1   1 
ATOM   9282  C CG2   . THR B 1 564 ? -44.695 36.961  11.025  1.00 17.26 ? 564  THR B CG2   1 
ATOM   9283  N N     . LEU B 1 565 ? -41.513 36.671  9.713   1.00 17.94 ? 565  LEU B N     1 
ATOM   9284  C CA    . LEU B 1 565 ? -41.116 36.385  8.342   1.00 18.17 ? 565  LEU B CA    1 
ATOM   9285  C C     . LEU B 1 565 ? -42.321 36.011  7.495   1.00 17.75 ? 565  LEU B C     1 
ATOM   9286  O O     . LEU B 1 565 ? -43.393 35.698  8.023   1.00 17.49 ? 565  LEU B O     1 
ATOM   9287  C CB    . LEU B 1 565 ? -40.004 35.325  8.282   1.00 18.50 ? 565  LEU B CB    1 
ATOM   9288  C CG    . LEU B 1 565 ? -38.681 35.740  8.962   1.00 18.92 ? 565  LEU B CG    1 
ATOM   9289  C CD1   . LEU B 1 565 ? -37.637 34.605  8.962   1.00 17.78 ? 565  LEU B CD1   1 
ATOM   9290  C CD2   . LEU B 1 565 ? -38.121 37.037  8.361   1.00 16.27 ? 565  LEU B CD2   1 
ATOM   9291  N N     . ASN B 1 566 ? -42.160 36.121  6.180   1.00 17.72 ? 566  ASN B N     1 
ATOM   9292  C CA    . ASN B 1 566 ? -43.121 35.532  5.243   1.00 17.35 ? 566  ASN B CA    1 
ATOM   9293  C C     . ASN B 1 566 ? -43.084 34.015  5.345   1.00 17.27 ? 566  ASN B C     1 
ATOM   9294  O O     . ASN B 1 566 ? -42.021 33.427  5.627   1.00 17.22 ? 566  ASN B O     1 
ATOM   9295  C CB    . ASN B 1 566 ? -42.804 35.951  3.811   1.00 17.08 ? 566  ASN B CB    1 
ATOM   9296  C CG    . ASN B 1 566 ? -43.253 37.371  3.507   1.00 17.70 ? 566  ASN B CG    1 
ATOM   9297  O OD1   . ASN B 1 566 ? -44.238 37.861  4.085   1.00 18.75 ? 566  ASN B OD1   1 
ATOM   9298  N ND2   . ASN B 1 566 ? -42.539 38.043  2.595   1.00 15.09 ? 566  ASN B ND2   1 
ATOM   9299  N N     . HIS B 1 567 ? -44.235 33.389  5.107   1.00 17.02 ? 567  HIS B N     1 
ATOM   9300  C CA    . HIS B 1 567 ? -44.330 31.935  5.095   1.00 17.14 ? 567  HIS B CA    1 
ATOM   9301  C C     . HIS B 1 567 ? -43.210 31.304  4.282   1.00 16.89 ? 567  HIS B C     1 
ATOM   9302  O O     . HIS B 1 567 ? -42.834 31.800  3.218   1.00 16.16 ? 567  HIS B O     1 
ATOM   9303  C CB    . HIS B 1 567 ? -45.701 31.470  4.594   1.00 17.73 ? 567  HIS B CB    1 
ATOM   9304  C CG    . HIS B 1 567 ? -46.856 32.080  5.335   1.00 18.63 ? 567  HIS B CG    1 
ATOM   9305  N ND1   . HIS B 1 567 ? -48.102 32.247  4.765   1.00 18.82 ? 567  HIS B ND1   1 
ATOM   9306  C CD2   . HIS B 1 567 ? -46.951 32.566  6.598   1.00 18.97 ? 567  HIS B CD2   1 
ATOM   9307  C CE1   . HIS B 1 567 ? -48.914 32.812  5.642   1.00 19.71 ? 567  HIS B CE1   1 
ATOM   9308  N NE2   . HIS B 1 567 ? -48.237 33.026  6.760   1.00 20.98 ? 567  HIS B NE2   1 
ATOM   9309  N N     . GLY B 1 568 ? -42.651 30.225  4.819   1.00 17.27 ? 568  GLY B N     1 
ATOM   9310  C CA    . GLY B 1 568 ? -41.564 29.515  4.155   1.00 17.45 ? 568  GLY B CA    1 
ATOM   9311  C C     . GLY B 1 568 ? -40.210 30.195  4.210   1.00 17.82 ? 568  GLY B C     1 
ATOM   9312  O O     . GLY B 1 568 ? -39.241 29.673  3.660   1.00 17.56 ? 568  GLY B O     1 
ATOM   9313  N N     . GLU B 1 569 ? -40.120 31.361  4.855   1.00 18.23 ? 569  GLU B N     1 
ATOM   9314  C CA    . GLU B 1 569 ? -38.805 31.956  5.099   1.00 18.70 ? 569  GLU B CA    1 
ATOM   9315  C C     . GLU B 1 569 ? -38.350 31.554  6.496   1.00 18.74 ? 569  GLU B C     1 
ATOM   9316  O O     . GLU B 1 569 ? -39.170 31.411  7.387   1.00 18.19 ? 569  GLU B O     1 
ATOM   9317  C CB    . GLU B 1 569 ? -38.807 33.490  4.964   1.00 18.93 ? 569  GLU B CB    1 
ATOM   9318  C CG    . GLU B 1 569 ? -39.083 34.068  3.563   1.00 19.67 ? 569  GLU B CG    1 
ATOM   9319  C CD    . GLU B 1 569 ? -38.070 33.671  2.482   1.00 21.04 ? 569  GLU B CD    1 
ATOM   9320  O OE1   . GLU B 1 569 ? -36.971 33.150  2.816   1.00 22.14 ? 569  GLU B OE1   1 
ATOM   9321  O OE2   . GLU B 1 569 ? -38.388 33.889  1.281   1.00 20.72 ? 569  GLU B OE2   1 
ATOM   9322  N N     . GLU B 1 570 ? -37.042 31.412  6.673   1.00 19.25 ? 570  GLU B N     1 
ATOM   9323  C CA    . GLU B 1 570 ? -36.473 30.897  7.902   1.00 20.32 ? 570  GLU B CA    1 
ATOM   9324  C C     . GLU B 1 570 ? -35.341 31.788  8.438   1.00 20.64 ? 570  GLU B C     1 
ATOM   9325  O O     . GLU B 1 570 ? -34.464 32.229  7.681   1.00 21.13 ? 570  GLU B O     1 
ATOM   9326  C CB    . GLU B 1 570 ? -35.957 29.462  7.683   1.00 20.82 ? 570  GLU B CB    1 
ATOM   9327  N N     . PRO B 1 571 ? -35.326 32.019  9.763   1.00 20.68 ? 571  PRO B N     1 
ATOM   9328  C CA    . PRO B 1 571 ? -34.296 32.888  10.335  1.00 19.98 ? 571  PRO B CA    1 
ATOM   9329  C C     . PRO B 1 571 ? -32.933 32.228  10.239  1.00 19.92 ? 571  PRO B C     1 
ATOM   9330  O O     . PRO B 1 571 ? -32.839 31.016  10.246  1.00 20.10 ? 571  PRO B O     1 
ATOM   9331  C CB    . PRO B 1 571 ? -34.693 32.998  11.811  1.00 20.11 ? 571  PRO B CB    1 
ATOM   9332  C CG    . PRO B 1 571 ? -36.086 32.394  11.918  1.00 20.83 ? 571  PRO B CG    1 
ATOM   9333  C CD    . PRO B 1 571 ? -36.222 31.440  10.787  1.00 20.16 ? 571  PRO B CD    1 
ATOM   9334  N N     . SER B 1 572 ? -31.882 33.033  10.137  1.00 19.93 ? 572  SER B N     1 
ATOM   9335  C CA    . SER B 1 572 ? -30.501 32.565  10.189  1.00 19.04 ? 572  SER B CA    1 
ATOM   9336  C C     . SER B 1 572 ? -29.713 33.765  10.663  1.00 19.42 ? 572  SER B C     1 
ATOM   9337  O O     . SER B 1 572 ? -30.193 34.883  10.540  1.00 19.81 ? 572  SER B O     1 
ATOM   9338  C CB    . SER B 1 572 ? -30.019 32.150  8.808   1.00 18.70 ? 572  SER B CB    1 
ATOM   9339  O OG    . SER B 1 572 ? -29.959 33.266  7.942   1.00 17.01 ? 572  SER B OG    1 
ATOM   9340  N N     . PRO B 1 573 ? -28.512 33.556  11.232  1.00 19.53 ? 573  PRO B N     1 
ATOM   9341  C CA    . PRO B 1 573 ? -27.673 34.738  11.511  1.00 18.98 ? 573  PRO B CA    1 
ATOM   9342  C C     . PRO B 1 573 ? -27.359 35.546  10.254  1.00 18.47 ? 573  PRO B C     1 
ATOM   9343  O O     . PRO B 1 573 ? -27.129 36.746  10.334  1.00 19.04 ? 573  PRO B O     1 
ATOM   9344  C CB    . PRO B 1 573 ? -26.393 34.144  12.100  1.00 19.39 ? 573  PRO B CB    1 
ATOM   9345  C CG    . PRO B 1 573 ? -26.430 32.663  11.745  1.00 19.95 ? 573  PRO B CG    1 
ATOM   9346  C CD    . PRO B 1 573 ? -27.884 32.295  11.670  1.00 19.40 ? 573  PRO B CD    1 
ATOM   9347  N N     . GLU B 1 574 ? -27.372 34.917  9.089   1.00 17.93 ? 574  GLU B N     1 
ATOM   9348  C CA    . GLU B 1 574 ? -27.162 35.668  7.854   1.00 17.15 ? 574  GLU B CA    1 
ATOM   9349  C C     . GLU B 1 574 ? -28.320 36.641  7.588   1.00 16.85 ? 574  GLU B C     1 
ATOM   9350  O O     . GLU B 1 574 ? -28.111 37.807  7.261   1.00 17.22 ? 574  GLU B O     1 
ATOM   9351  C CB    . GLU B 1 574 ? -26.962 34.715  6.681   1.00 17.12 ? 574  GLU B CB    1 
ATOM   9352  C CG    . GLU B 1 574 ? -27.239 35.331  5.325   1.00 15.37 ? 574  GLU B CG    1 
ATOM   9353  C CD    . GLU B 1 574 ? -26.734 34.474  4.185   1.00 15.84 ? 574  GLU B CD    1 
ATOM   9354  O OE1   . GLU B 1 574 ? -26.194 33.350  4.445   1.00 13.18 ? 574  GLU B OE1   1 
ATOM   9355  O OE2   . GLU B 1 574 ? -26.862 34.957  3.026   1.00 14.07 ? 574  GLU B OE2   1 
ATOM   9356  N N     . LEU B 1 575 ? -29.541 36.151  7.745   1.00 16.10 ? 575  LEU B N     1 
ATOM   9357  C CA    . LEU B 1 575 ? -30.718 36.956  7.507   1.00 15.47 ? 575  LEU B CA    1 
ATOM   9358  C C     . LEU B 1 575 ? -30.822 38.079  8.530   1.00 15.01 ? 575  LEU B C     1 
ATOM   9359  O O     . LEU B 1 575 ? -31.253 39.198  8.210   1.00 15.45 ? 575  LEU B O     1 
ATOM   9360  C CB    . LEU B 1 575 ? -31.973 36.083  7.530   1.00 15.13 ? 575  LEU B CB    1 
ATOM   9361  C CG    . LEU B 1 575 ? -33.275 36.838  7.274   1.00 14.48 ? 575  LEU B CG    1 
ATOM   9362  C CD1   . LEU B 1 575 ? -33.217 37.559  5.931   1.00 14.54 ? 575  LEU B CD1   1 
ATOM   9363  C CD2   . LEU B 1 575 ? -34.412 35.873  7.298   1.00 14.19 ? 575  LEU B CD2   1 
ATOM   9364  N N     . TYR B 1 576 ? -30.416 37.768  9.747   1.00 14.17 ? 576  TYR B N     1 
ATOM   9365  C CA    . TYR B 1 576 ? -30.327 38.732  10.830  1.00 14.63 ? 576  TYR B CA    1 
ATOM   9366  C C     . TYR B 1 576 ? -29.515 39.995  10.450  1.00 14.34 ? 576  TYR B C     1 
ATOM   9367  O O     . TYR B 1 576 ? -30.004 41.112  10.539  1.00 14.65 ? 576  TYR B O     1 
ATOM   9368  C CB    . TYR B 1 576 ? -29.701 38.027  12.033  1.00 14.79 ? 576  TYR B CB    1 
ATOM   9369  C CG    . TYR B 1 576 ? -29.891 38.729  13.341  1.00 15.81 ? 576  TYR B CG    1 
ATOM   9370  C CD1   . TYR B 1 576 ? -30.851 38.286  14.243  1.00 16.42 ? 576  TYR B CD1   1 
ATOM   9371  C CD2   . TYR B 1 576 ? -29.082 39.818  13.710  1.00 16.41 ? 576  TYR B CD2   1 
ATOM   9372  C CE1   . TYR B 1 576 ? -31.012 38.913  15.479  1.00 16.44 ? 576  TYR B CE1   1 
ATOM   9373  C CE2   . TYR B 1 576 ? -29.252 40.460  14.933  1.00 15.53 ? 576  TYR B CE2   1 
ATOM   9374  C CZ    . TYR B 1 576 ? -30.213 39.992  15.812  1.00 15.59 ? 576  TYR B CZ    1 
ATOM   9375  O OH    . TYR B 1 576 ? -30.403 40.590  17.026  1.00 16.44 ? 576  TYR B OH    1 
ATOM   9376  N N     . ALA B 1 577 ? -28.270 39.801  10.030  1.00 14.31 ? 577  ALA B N     1 
ATOM   9377  C CA    . ALA B 1 577 ? -27.411 40.889  9.610   1.00 13.90 ? 577  ALA B CA    1 
ATOM   9378  C C     . ALA B 1 577 ? -27.984 41.555  8.371   1.00 14.45 ? 577  ALA B C     1 
ATOM   9379  O O     . ALA B 1 577 ? -27.839 42.780  8.172   1.00 13.70 ? 577  ALA B O     1 
ATOM   9380  C CB    . ALA B 1 577 ? -26.032 40.367  9.327   1.00 13.87 ? 577  ALA B CB    1 
ATOM   9381  N N     . GLU B 1 578 ? -28.640 40.760  7.528   1.00 14.69 ? 578  GLU B N     1 
ATOM   9382  C CA    . GLU B 1 578 ? -29.197 41.321  6.311   1.00 15.43 ? 578  GLU B CA    1 
ATOM   9383  C C     . GLU B 1 578 ? -30.371 42.265  6.619   1.00 15.71 ? 578  GLU B C     1 
ATOM   9384  O O     . GLU B 1 578 ? -30.483 43.334  6.014   1.00 15.93 ? 578  GLU B O     1 
ATOM   9385  C CB    . GLU B 1 578 ? -29.638 40.230  5.357   1.00 15.49 ? 578  GLU B CB    1 
ATOM   9386  C CG    . GLU B 1 578 ? -30.018 40.763  3.977   1.00 17.27 ? 578  GLU B CG    1 
ATOM   9387  C CD    . GLU B 1 578 ? -30.788 39.751  3.149   1.00 19.25 ? 578  GLU B CD    1 
ATOM   9388  O OE1   . GLU B 1 578 ? -30.303 38.614  2.959   1.00 21.68 ? 578  GLU B OE1   1 
ATOM   9389  O OE2   . GLU B 1 578 ? -31.892 40.095  2.696   1.00 19.87 ? 578  GLU B OE2   1 
ATOM   9390  N N     . VAL B 1 579 ? -31.231 41.868  7.561   1.00 15.21 ? 579  VAL B N     1 
ATOM   9391  C CA    . VAL B 1 579 ? -32.360 42.704  7.942   1.00 14.61 ? 579  VAL B CA    1 
ATOM   9392  C C     . VAL B 1 579 ? -31.865 43.963  8.641   1.00 14.44 ? 579  VAL B C     1 
ATOM   9393  O O     . VAL B 1 579 ? -32.414 45.041  8.423   1.00 14.03 ? 579  VAL B O     1 
ATOM   9394  C CB    . VAL B 1 579 ? -33.378 41.932  8.821   1.00 14.98 ? 579  VAL B CB    1 
ATOM   9395  C CG1   . VAL B 1 579 ? -34.313 42.881  9.560   1.00 14.46 ? 579  VAL B CG1   1 
ATOM   9396  C CG2   . VAL B 1 579 ? -34.164 40.958  7.984   1.00 12.46 ? 579  VAL B CG2   1 
ATOM   9397  N N     . ARG B 1 580 ? -30.826 43.828  9.473   1.00 14.37 ? 580  ARG B N     1 
ATOM   9398  C CA    . ARG B 1 580 ? -30.258 44.993  10.171  1.00 14.51 ? 580  ARG B CA    1 
ATOM   9399  C C     . ARG B 1 580 ? -29.677 45.987  9.178   1.00 14.40 ? 580  ARG B C     1 
ATOM   9400  O O     . ARG B 1 580 ? -29.964 47.173  9.264   1.00 15.33 ? 580  ARG B O     1 
ATOM   9401  C CB    . ARG B 1 580 ? -29.225 44.599  11.218  1.00 14.37 ? 580  ARG B CB    1 
ATOM   9402  C CG    . ARG B 1 580 ? -29.830 44.070  12.518  1.00 16.25 ? 580  ARG B CG    1 
ATOM   9403  C CD    . ARG B 1 580 ? -28.941 44.345  13.738  1.00 18.62 ? 580  ARG B CD    1 
ATOM   9404  N NE    . ARG B 1 580 ? -27.585 44.659  13.325  1.00 23.30 ? 580  ARG B NE    1 
ATOM   9405  C CZ    . ARG B 1 580 ? -26.736 45.440  13.981  1.00 26.07 ? 580  ARG B CZ    1 
ATOM   9406  N NH1   . ARG B 1 580 ? -27.085 46.006  15.119  1.00 26.53 ? 580  ARG B NH1   1 
ATOM   9407  N NH2   . ARG B 1 580 ? -25.521 45.661  13.479  1.00 29.08 ? 580  ARG B NH2   1 
ATOM   9408  N N     . ASN B 1 581 ? -28.886 45.494  8.232   1.00 14.12 ? 581  ASN B N     1 
ATOM   9409  C CA    . ASN B 1 581 ? -28.359 46.280  7.108   1.00 13.62 ? 581  ASN B CA    1 
ATOM   9410  C C     . ASN B 1 581 ? -29.424 46.875  6.213   1.00 13.83 ? 581  ASN B C     1 
ATOM   9411  O O     . ASN B 1 581 ? -29.184 47.895  5.537   1.00 14.03 ? 581  ASN B O     1 
ATOM   9412  C CB    . ASN B 1 581 ? -27.439 45.416  6.240   1.00 12.96 ? 581  ASN B CB    1 
ATOM   9413  C CG    . ASN B 1 581 ? -26.047 45.312  6.818   1.00 12.88 ? 581  ASN B CG    1 
ATOM   9414  O OD1   . ASN B 1 581 ? -25.560 46.263  7.436   1.00 13.76 ? 581  ASN B OD1   1 
ATOM   9415  N ND2   . ASN B 1 581 ? -25.394 44.162  6.631   1.00 10.67 ? 581  ASN B ND2   1 
ATOM   9416  N N     . TRP B 1 582 ? -30.589 46.235  6.178   1.00 13.66 ? 582  TRP B N     1 
ATOM   9417  C CA    . TRP B 1 582 ? -31.651 46.721  5.313   1.00 13.91 ? 582  TRP B CA    1 
ATOM   9418  C C     . TRP B 1 582 ? -32.179 48.054  5.877   1.00 14.04 ? 582  TRP B C     1 
ATOM   9419  O O     . TRP B 1 582 ? -32.416 49.011  5.135   1.00 13.41 ? 582  TRP B O     1 
ATOM   9420  C CB    . TRP B 1 582 ? -32.735 45.665  5.156   1.00 14.47 ? 582  TRP B CB    1 
ATOM   9421  C CG    . TRP B 1 582 ? -33.911 46.141  4.381   1.00 17.35 ? 582  TRP B CG    1 
ATOM   9422  C CD1   . TRP B 1 582 ? -35.046 46.709  4.891   1.00 17.85 ? 582  TRP B CD1   1 
ATOM   9423  C CD2   . TRP B 1 582 ? -34.091 46.099  2.951   1.00 17.46 ? 582  TRP B CD2   1 
ATOM   9424  N NE1   . TRP B 1 582 ? -35.909 47.022  3.876   1.00 18.04 ? 582  TRP B NE1   1 
ATOM   9425  C CE2   . TRP B 1 582 ? -35.355 46.660  2.677   1.00 17.37 ? 582  TRP B CE2   1 
ATOM   9426  C CE3   . TRP B 1 582 ? -33.311 45.629  1.881   1.00 18.41 ? 582  TRP B CE3   1 
ATOM   9427  C CZ2   . TRP B 1 582 ? -35.875 46.776  1.362   1.00 17.55 ? 582  TRP B CZ2   1 
ATOM   9428  C CZ3   . TRP B 1 582 ? -33.827 45.747  0.562   1.00 18.81 ? 582  TRP B CZ3   1 
ATOM   9429  C CH2   . TRP B 1 582 ? -35.098 46.328  0.325   1.00 17.32 ? 582  TRP B CH2   1 
ATOM   9430  N N     . VAL B 1 583 ? -32.309 48.126  7.202   1.00 13.91 ? 583  VAL B N     1 
ATOM   9431  C CA    . VAL B 1 583 ? -32.770 49.332  7.848   1.00 13.85 ? 583  VAL B CA    1 
ATOM   9432  C C     . VAL B 1 583 ? -31.710 50.415  7.690   1.00 14.91 ? 583  VAL B C     1 
ATOM   9433  O O     . VAL B 1 583 ? -32.031 51.591  7.430   1.00 14.39 ? 583  VAL B O     1 
ATOM   9434  C CB    . VAL B 1 583 ? -33.135 49.064  9.319   1.00 13.60 ? 583  VAL B CB    1 
ATOM   9435  C CG1   . VAL B 1 583 ? -33.640 50.327  10.007  1.00 11.41 ? 583  VAL B CG1   1 
ATOM   9436  C CG2   . VAL B 1 583 ? -34.185 47.971  9.389   1.00 12.75 ? 583  VAL B CG2   1 
ATOM   9437  N N     . ARG B 1 584 ? -30.449 49.992  7.769   1.00 16.03 ? 584  ARG B N     1 
ATOM   9438  C CA    . ARG B 1 584 ? -29.303 50.876  7.531   1.00 18.16 ? 584  ARG B CA    1 
ATOM   9439  C C     . ARG B 1 584 ? -29.415 51.592  6.181   1.00 17.44 ? 584  ARG B C     1 
ATOM   9440  O O     . ARG B 1 584 ? -29.170 52.785  6.080   1.00 17.58 ? 584  ARG B O     1 
ATOM   9441  C CB    . ARG B 1 584 ? -27.982 50.088  7.648   1.00 17.80 ? 584  ARG B CB    1 
ATOM   9442  C CG    . ARG B 1 584 ? -26.712 50.939  7.579   1.00 20.89 ? 584  ARG B CG    1 
ATOM   9443  C CD    . ARG B 1 584 ? -25.388 50.120  7.327   1.00 21.95 ? 584  ARG B CD    1 
ATOM   9444  N NE    . ARG B 1 584 ? -24.299 50.687  8.120   1.00 26.62 ? 584  ARG B NE    1 
ATOM   9445  C CZ    . ARG B 1 584 ? -24.136 50.448  9.425   1.00 30.04 ? 584  ARG B CZ    1 
ATOM   9446  N NH1   . ARG B 1 584 ? -23.144 51.038  10.064  1.00 31.06 ? 584  ARG B NH1   1 
ATOM   9447  N NH2   . ARG B 1 584 ? -24.966 49.633  10.106  1.00 30.33 ? 584  ARG B NH2   1 
ATOM   9448  N N     . LYS B 1 585 ? -29.810 50.857  5.151   1.00 17.89 ? 585  LYS B N     1 
ATOM   9449  C CA    . LYS B 1 585 ? -29.878 51.399  3.805   1.00 18.17 ? 585  LYS B CA    1 
ATOM   9450  C C     . LYS B 1 585 ? -31.150 52.231  3.610   1.00 17.98 ? 585  LYS B C     1 
ATOM   9451  O O     . LYS B 1 585 ? -31.167 53.144  2.790   1.00 17.52 ? 585  LYS B O     1 
ATOM   9452  C CB    . LYS B 1 585 ? -29.799 50.249  2.797   1.00 18.25 ? 585  LYS B CB    1 
ATOM   9453  C CG    . LYS B 1 585 ? -29.897 50.637  1.346   1.00 20.13 ? 585  LYS B CG    1 
ATOM   9454  C CD    . LYS B 1 585 ? -30.652 49.558  0.538   1.00 24.96 ? 585  LYS B CD    1 
ATOM   9455  C CE    . LYS B 1 585 ? -32.156 49.505  0.942   1.00 26.45 ? 585  LYS B CE    1 
ATOM   9456  N NZ    . LYS B 1 585 ? -33.037 48.862  -0.099  1.00 28.35 ? 585  LYS B NZ    1 
ATOM   9457  N N     . GLU B 1 586 ? -32.201 51.907  4.367   1.00 18.03 ? 586  GLU B N     1 
ATOM   9458  C CA    . GLU B 1 586 ? -33.498 52.607  4.266   1.00 18.53 ? 586  GLU B CA    1 
ATOM   9459  C C     . GLU B 1 586 ? -33.494 53.960  4.967   1.00 17.88 ? 586  GLU B C     1 
ATOM   9460  O O     . GLU B 1 586 ? -34.158 54.897  4.512   1.00 18.24 ? 586  GLU B O     1 
ATOM   9461  C CB    . GLU B 1 586 ? -34.658 51.768  4.846   1.00 18.73 ? 586  GLU B CB    1 
ATOM   9462  C CG    . GLU B 1 586 ? -35.039 50.554  4.038   1.00 21.34 ? 586  GLU B CG    1 
ATOM   9463  C CD    . GLU B 1 586 ? -35.696 50.924  2.723   1.00 26.21 ? 586  GLU B CD    1 
ATOM   9464  O OE1   . GLU B 1 586 ? -36.929 51.158  2.744   1.00 27.07 ? 586  GLU B OE1   1 
ATOM   9465  O OE2   . GLU B 1 586 ? -34.983 50.978  1.678   1.00 27.55 ? 586  GLU B OE2   1 
ATOM   9466  N N     . ILE B 1 587 ? -32.776 54.044  6.088   1.00 16.86 ? 587  ILE B N     1 
ATOM   9467  C CA    . ILE B 1 587 ? -32.821 55.216  6.950   1.00 15.94 ? 587  ILE B CA    1 
ATOM   9468  C C     . ILE B 1 587 ? -31.401 55.689  7.299   1.00 15.99 ? 587  ILE B C     1 
ATOM   9469  O O     . ILE B 1 587 ? -30.994 56.811  6.966   1.00 15.76 ? 587  ILE B O     1 
ATOM   9470  C CB    . ILE B 1 587 ? -33.677 54.943  8.215   1.00 15.69 ? 587  ILE B CB    1 
ATOM   9471  C CG1   . ILE B 1 587 ? -35.130 54.616  7.808   1.00 15.45 ? 587  ILE B CG1   1 
ATOM   9472  C CG2   . ILE B 1 587 ? -33.637 56.141  9.149   1.00 14.39 ? 587  ILE B CG2   1 
ATOM   9473  C CD1   . ILE B 1 587 ? -35.972 54.038  8.884   1.00 14.28 ? 587  ILE B CD1   1 
ATOM   9474  N N     . GLY B 1 588 ? -30.646 54.818  7.958   1.00 15.74 ? 588  GLY B N     1 
ATOM   9475  C CA    . GLY B 1 588 ? -29.241 55.069  8.256   1.00 14.98 ? 588  GLY B CA    1 
ATOM   9476  C C     . GLY B 1 588 ? -28.927 54.274  9.497   1.00 14.60 ? 588  GLY B C     1 
ATOM   9477  O O     . GLY B 1 588 ? -29.839 53.746  10.124  1.00 13.94 ? 588  GLY B O     1 
ATOM   9478  N N     . PRO B 1 589 ? -27.632 54.179  9.849   1.00 14.92 ? 589  PRO B N     1 
ATOM   9479  C CA    . PRO B 1 589 ? -27.151 53.509  11.063  1.00 14.95 ? 589  PRO B CA    1 
ATOM   9480  C C     . PRO B 1 589 ? -27.892 53.930  12.342  1.00 15.68 ? 589  PRO B C     1 
ATOM   9481  O O     . PRO B 1 589 ? -28.169 53.068  13.191  1.00 15.77 ? 589  PRO B O     1 
ATOM   9482  C CB    . PRO B 1 589 ? -25.680 53.909  11.133  1.00 14.95 ? 589  PRO B CB    1 
ATOM   9483  C CG    . PRO B 1 589 ? -25.321 54.394  9.778   1.00 14.22 ? 589  PRO B CG    1 
ATOM   9484  C CD    . PRO B 1 589 ? -26.533 54.719  9.022   1.00 14.39 ? 589  PRO B CD    1 
ATOM   9485  N N     . LEU B 1 590 ? -28.232 55.218  12.473  1.00 16.08 ? 590  LEU B N     1 
ATOM   9486  C CA    . LEU B 1 590 ? -28.925 55.706  13.678  1.00 17.05 ? 590  LEU B CA    1 
ATOM   9487  C C     . LEU B 1 590 ? -30.197 54.941  13.979  1.00 17.72 ? 590  LEU B C     1 
ATOM   9488  O O     . LEU B 1 590 ? -30.685 55.004  15.101  1.00 19.26 ? 590  LEU B O     1 
ATOM   9489  C CB    . LEU B 1 590 ? -29.233 57.225  13.618  1.00 17.06 ? 590  LEU B CB    1 
ATOM   9490  C CG    . LEU B 1 590 ? -30.378 57.883  12.788  1.00 18.36 ? 590  LEU B CG    1 
ATOM   9491  C CD1   . LEU B 1 590 ? -30.313 59.433  12.858  1.00 17.29 ? 590  LEU B CD1   1 
ATOM   9492  C CD2   . LEU B 1 590 ? -30.472 57.443  11.287  1.00 15.10 ? 590  LEU B CD2   1 
ATOM   9493  N N     . ALA B 1 591 ? -30.750 54.213  13.008  1.00 18.01 ? 591  ALA B N     1 
ATOM   9494  C CA    . ALA B 1 591 ? -32.038 53.546  13.237  1.00 18.38 ? 591  ALA B CA    1 
ATOM   9495  C C     . ALA B 1 591 ? -31.949 52.047  13.112  1.00 18.84 ? 591  ALA B C     1 
ATOM   9496  O O     . ALA B 1 591 ? -32.954 51.382  13.012  1.00 19.13 ? 591  ALA B O     1 
ATOM   9497  C CB    . ALA B 1 591 ? -33.113 54.089  12.322  1.00 17.70 ? 591  ALA B CB    1 
ATOM   9498  N N     . THR B 1 592 ? -30.741 51.517  13.116  1.00 19.64 ? 592  THR B N     1 
ATOM   9499  C CA    . THR B 1 592 ? -30.532 50.083  13.016  1.00 21.07 ? 592  THR B CA    1 
ATOM   9500  C C     . THR B 1 592 ? -30.968 49.471  14.323  1.00 20.86 ? 592  THR B C     1 
ATOM   9501  O O     . THR B 1 592 ? -30.581 49.947  15.364  1.00 20.62 ? 592  THR B O     1 
ATOM   9502  C CB    . THR B 1 592 ? -29.022 49.787  12.752  1.00 22.03 ? 592  THR B CB    1 
ATOM   9503  O OG1   . THR B 1 592 ? -28.711 50.140  11.390  1.00 24.75 ? 592  THR B OG1   1 
ATOM   9504  C CG2   . THR B 1 592 ? -28.640 48.300  13.020  1.00 21.11 ? 592  THR B CG2   1 
ATOM   9505  N N     . PRO B 1 593 ? -31.840 48.462  14.276  1.00 21.05 ? 593  PRO B N     1 
ATOM   9506  C CA    . PRO B 1 593 ? -32.211 47.697  15.465  1.00 20.91 ? 593  PRO B CA    1 
ATOM   9507  C C     . PRO B 1 593 ? -31.032 47.011  16.119  1.00 20.88 ? 593  PRO B C     1 
ATOM   9508  O O     . PRO B 1 593 ? -30.164 46.486  15.434  1.00 20.89 ? 593  PRO B O     1 
ATOM   9509  C CB    . PRO B 1 593 ? -33.183 46.650  14.910  1.00 20.39 ? 593  PRO B CB    1 
ATOM   9510  C CG    . PRO B 1 593 ? -33.798 47.320  13.769  1.00 20.59 ? 593  PRO B CG    1 
ATOM   9511  C CD    . PRO B 1 593 ? -32.645 48.059  13.116  1.00 21.24 ? 593  PRO B CD    1 
ATOM   9512  N N     . ASP B 1 594 ? -31.017 47.021  17.442  1.00 20.89 ? 594  ASP B N     1 
ATOM   9513  C CA    . ASP B 1 594 ? -29.976 46.372  18.213  1.00 20.98 ? 594  ASP B CA    1 
ATOM   9514  C C     . ASP B 1 594 ? -30.360 44.921  18.433  1.00 20.86 ? 594  ASP B C     1 
ATOM   9515  O O     . ASP B 1 594 ? -29.484 44.079  18.626  1.00 21.41 ? 594  ASP B O     1 
ATOM   9516  C CB    . ASP B 1 594 ? -29.833 47.054  19.568  1.00 21.57 ? 594  ASP B CB    1 
ATOM   9517  C CG    . ASP B 1 594 ? -29.360 48.489  19.455  1.00 22.72 ? 594  ASP B CG    1 
ATOM   9518  O OD1   . ASP B 1 594 ? -28.159 48.680  19.674  1.00 24.38 ? 594  ASP B OD1   1 
ATOM   9519  O OD2   . ASP B 1 594 ? -30.176 49.415  19.166  1.00 25.08 ? 594  ASP B OD2   1 
ATOM   9520  N N     . VAL B 1 595 ? -31.668 44.641  18.401  1.00 20.03 ? 595  VAL B N     1 
ATOM   9521  C CA    . VAL B 1 595 ? -32.210 43.288  18.573  1.00 19.53 ? 595  VAL B CA    1 
ATOM   9522  C C     . VAL B 1 595 ? -33.261 42.992  17.532  1.00 18.98 ? 595  VAL B C     1 
ATOM   9523  O O     . VAL B 1 595 ? -34.196 43.788  17.338  1.00 19.60 ? 595  VAL B O     1 
ATOM   9524  C CB    . VAL B 1 595 ? -32.912 43.086  19.954  1.00 20.02 ? 595  VAL B CB    1 
ATOM   9525  C CG1   . VAL B 1 595 ? -33.568 41.745  20.012  1.00 19.38 ? 595  VAL B CG1   1 
ATOM   9526  C CG2   . VAL B 1 595 ? -31.907 43.168  21.111  1.00 21.28 ? 595  VAL B CG2   1 
ATOM   9527  N N     . LEU B 1 596 ? -33.126 41.858  16.854  1.00 17.60 ? 596  LEU B N     1 
ATOM   9528  C CA    . LEU B 1 596 ? -34.270 41.327  16.145  1.00 17.01 ? 596  LEU B CA    1 
ATOM   9529  C C     . LEU B 1 596 ? -34.788 40.132  16.917  1.00 17.37 ? 596  LEU B C     1 
ATOM   9530  O O     . LEU B 1 596 ? -34.014 39.274  17.382  1.00 17.83 ? 596  LEU B O     1 
ATOM   9531  C CB    . LEU B 1 596 ? -33.921 40.930  14.729  1.00 16.22 ? 596  LEU B CB    1 
ATOM   9532  C CG    . LEU B 1 596 ? -33.176 42.014  14.008  1.00 14.87 ? 596  LEU B CG    1 
ATOM   9533  C CD1   . LEU B 1 596 ? -32.605 41.396  12.778  1.00 17.02 ? 596  LEU B CD1   1 
ATOM   9534  C CD2   . LEU B 1 596 ? -34.137 43.113  13.677  1.00 13.15 ? 596  LEU B CD2   1 
ATOM   9535  N N     . HIS B 1 597 ? -36.100 40.092  17.077  1.00 17.49 ? 597  HIS B N     1 
ATOM   9536  C CA    . HIS B 1 597 ? -36.771 39.022  17.800  1.00 17.11 ? 597  HIS B CA    1 
ATOM   9537  C C     . HIS B 1 597 ? -37.680 38.370  16.778  1.00 16.66 ? 597  HIS B C     1 
ATOM   9538  O O     . HIS B 1 597 ? -38.733 38.942  16.435  1.00 16.90 ? 597  HIS B O     1 
ATOM   9539  C CB    . HIS B 1 597 ? -37.576 39.652  18.941  1.00 17.39 ? 597  HIS B CB    1 
ATOM   9540  C CG    . HIS B 1 597 ? -38.457 38.702  19.686  1.00 19.93 ? 597  HIS B CG    1 
ATOM   9541  N ND1   . HIS B 1 597 ? -38.870 38.943  20.978  1.00 23.32 ? 597  HIS B ND1   1 
ATOM   9542  C CD2   . HIS B 1 597 ? -39.009 37.519  19.332  1.00 21.84 ? 597  HIS B CD2   1 
ATOM   9543  C CE1   . HIS B 1 597 ? -39.633 37.948  21.389  1.00 22.46 ? 597  HIS B CE1   1 
ATOM   9544  N NE2   . HIS B 1 597 ? -39.740 37.075  20.405  1.00 22.73 ? 597  HIS B NE2   1 
ATOM   9545  N N     . TRP B 1 598 ? -37.269 37.220  16.253  1.00 15.91 ? 598  TRP B N     1 
ATOM   9546  C CA    . TRP B 1 598 ? -38.100 36.496  15.299  1.00 17.19 ? 598  TRP B CA    1 
ATOM   9547  C C     . TRP B 1 598 ? -39.298 35.898  15.993  1.00 17.66 ? 598  TRP B C     1 
ATOM   9548  O O     . TRP B 1 598 ? -39.155 35.232  17.013  1.00 18.14 ? 598  TRP B O     1 
ATOM   9549  C CB    . TRP B 1 598 ? -37.348 35.342  14.646  1.00 17.20 ? 598  TRP B CB    1 
ATOM   9550  C CG    . TRP B 1 598 ? -36.002 35.678  14.085  1.00 17.91 ? 598  TRP B CG    1 
ATOM   9551  C CD1   . TRP B 1 598 ? -34.790 35.189  14.515  1.00 15.80 ? 598  TRP B CD1   1 
ATOM   9552  C CD2   . TRP B 1 598 ? -35.722 36.546  12.974  1.00 17.57 ? 598  TRP B CD2   1 
ATOM   9553  N NE1   . TRP B 1 598 ? -33.782 35.704  13.740  1.00 17.69 ? 598  TRP B NE1   1 
ATOM   9554  C CE2   . TRP B 1 598 ? -34.313 36.539  12.789  1.00 17.91 ? 598  TRP B CE2   1 
ATOM   9555  C CE3   . TRP B 1 598 ? -36.516 37.320  12.116  1.00 16.18 ? 598  TRP B CE3   1 
ATOM   9556  C CZ2   . TRP B 1 598 ? -33.677 37.297  11.784  1.00 16.90 ? 598  TRP B CZ2   1 
ATOM   9557  C CZ3   . TRP B 1 598 ? -35.877 38.070  11.097  1.00 16.58 ? 598  TRP B CZ3   1 
ATOM   9558  C CH2   . TRP B 1 598 ? -34.478 38.049  10.948  1.00 16.12 ? 598  TRP B CH2   1 
ATOM   9559  N N     . THR B 1 599 ? -40.478 36.107  15.442  1.00 18.26 ? 599  THR B N     1 
ATOM   9560  C CA    . THR B 1 599 ? -41.672 35.549  16.068  1.00 19.57 ? 599  THR B CA    1 
ATOM   9561  C C     . THR B 1 599 ? -42.773 35.384  15.048  1.00 21.00 ? 599  THR B C     1 
ATOM   9562  O O     . THR B 1 599 ? -42.833 36.151  14.086  1.00 21.81 ? 599  THR B O     1 
ATOM   9563  C CB    . THR B 1 599 ? -42.167 36.440  17.269  1.00 19.06 ? 599  THR B CB    1 
ATOM   9564  O OG1   . THR B 1 599 ? -43.185 35.756  17.991  1.00 17.63 ? 599  THR B OG1   1 
ATOM   9565  C CG2   . THR B 1 599 ? -42.707 37.767  16.803  1.00 18.27 ? 599  THR B CG2   1 
ATOM   9566  N N     . ASP B 1 600 ? -43.639 34.394  15.247  1.00 22.96 ? 600  ASP B N     1 
ATOM   9567  C CA    . ASP B 1 600 ? -44.816 34.231  14.393  1.00 24.86 ? 600  ASP B CA    1 
ATOM   9568  C C     . ASP B 1 600 ? -46.015 34.728  15.154  1.00 25.42 ? 600  ASP B C     1 
ATOM   9569  O O     . ASP B 1 600 ? -47.154 34.589  14.707  1.00 25.48 ? 600  ASP B O     1 
ATOM   9570  C CB    . ASP B 1 600 ? -44.983 32.769  13.993  1.00 25.52 ? 600  ASP B CB    1 
ATOM   9571  C CG    . ASP B 1 600 ? -43.937 32.324  12.953  1.00 28.94 ? 600  ASP B CG    1 
ATOM   9572  O OD1   . ASP B 1 600 ? -43.655 33.093  11.989  1.00 30.04 ? 600  ASP B OD1   1 
ATOM   9573  O OD2   . ASP B 1 600 ? -43.385 31.205  13.107  1.00 32.36 ? 600  ASP B OD2   1 
ATOM   9574  N N     . SER B 1 601 ? -45.721 35.366  16.289  1.00 26.32 ? 601  SER B N     1 
ATOM   9575  C CA    . SER B 1 601 ? -46.682 35.596  17.375  1.00 26.91 ? 601  SER B CA    1 
ATOM   9576  C C     . SER B 1 601 ? -46.963 37.071  17.755  1.00 27.19 ? 601  SER B C     1 
ATOM   9577  O O     . SER B 1 601 ? -47.089 37.395  18.944  1.00 27.11 ? 601  SER B O     1 
ATOM   9578  C CB    . SER B 1 601 ? -46.216 34.829  18.627  1.00 27.01 ? 601  SER B CB    1 
ATOM   9579  O OG    . SER B 1 601 ? -46.336 33.422  18.475  1.00 26.52 ? 601  SER B OG    1 
ATOM   9580  N N     . LEU B 1 602 ? -47.095 37.953  16.767  1.00 27.57 ? 602  LEU B N     1 
ATOM   9581  C CA    . LEU B 1 602 ? -47.439 39.346  17.066  1.00 28.47 ? 602  LEU B CA    1 
ATOM   9582  C C     . LEU B 1 602 ? -48.849 39.481  17.650  1.00 29.25 ? 602  LEU B C     1 
ATOM   9583  O O     . LEU B 1 602 ? -49.782 38.811  17.187  1.00 29.46 ? 602  LEU B O     1 
ATOM   9584  C CB    . LEU B 1 602 ? -47.306 40.227  15.828  1.00 28.12 ? 602  LEU B CB    1 
ATOM   9585  C CG    . LEU B 1 602 ? -45.876 40.514  15.347  1.00 28.28 ? 602  LEU B CG    1 
ATOM   9586  C CD1   . LEU B 1 602 ? -45.935 41.600  14.286  1.00 28.75 ? 602  LEU B CD1   1 
ATOM   9587  C CD2   . LEU B 1 602 ? -44.961 40.921  16.489  1.00 25.97 ? 602  LEU B CD2   1 
ATOM   9588  N N     . PRO B 1 603 ? -49.018 40.344  18.672  1.00 29.98 ? 603  PRO B N     1 
ATOM   9589  C CA    . PRO B 1 603 ? -50.367 40.472  19.241  1.00 30.66 ? 603  PRO B CA    1 
ATOM   9590  C C     . PRO B 1 603 ? -51.172 41.603  18.570  1.00 31.31 ? 603  PRO B C     1 
ATOM   9591  O O     . PRO B 1 603 ? -50.791 42.787  18.633  1.00 31.71 ? 603  PRO B O     1 
ATOM   9592  C CB    . PRO B 1 603 ? -50.094 40.745  20.726  1.00 30.35 ? 603  PRO B CB    1 
ATOM   9593  C CG    . PRO B 1 603 ? -48.652 41.334  20.756  1.00 30.22 ? 603  PRO B CG    1 
ATOM   9594  C CD    . PRO B 1 603 ? -48.059 41.223  19.363  1.00 29.77 ? 603  PRO B CD    1 
ATOM   9595  N N     . LYS B 1 604 ? -52.260 41.228  17.908  1.00 31.99 ? 604  LYS B N     1 
ATOM   9596  C CA    . LYS B 1 604 ? -53.082 42.193  17.192  1.00 32.87 ? 604  LYS B CA    1 
ATOM   9597  C C     . LYS B 1 604 ? -54.550 42.136  17.628  1.00 33.10 ? 604  LYS B C     1 
ATOM   9598  O O     . LYS B 1 604 ? -55.051 41.078  18.017  1.00 33.07 ? 604  LYS B O     1 
ATOM   9599  C CB    . LYS B 1 604 ? -52.962 41.988  15.671  1.00 32.87 ? 604  LYS B CB    1 
ATOM   9600  C CG    . LYS B 1 604 ? -51.543 41.702  15.149  1.00 32.92 ? 604  LYS B CG    1 
ATOM   9601  C CD    . LYS B 1 604 ? -51.610 41.230  13.692  1.00 33.49 ? 604  LYS B CD    1 
ATOM   9602  C CE    . LYS B 1 604 ? -50.813 39.964  13.468  1.00 33.03 ? 604  LYS B CE    1 
ATOM   9603  N NZ    . LYS B 1 604 ? -51.523 39.105  12.479  1.00 34.56 ? 604  LYS B NZ    1 
ATOM   9604  N N     . THR B 1 605 ? -55.226 43.284  17.580  1.00 33.70 ? 605  THR B N     1 
ATOM   9605  C CA    . THR B 1 605 ? -56.677 43.319  17.708  1.00 34.24 ? 605  THR B CA    1 
ATOM   9606  C C     . THR B 1 605 ? -57.269 42.655  16.489  1.00 34.69 ? 605  THR B C     1 
ATOM   9607  O O     . THR B 1 605 ? -56.541 42.323  15.539  1.00 34.44 ? 605  THR B O     1 
ATOM   9608  C CB    . THR B 1 605 ? -57.257 44.740  17.800  1.00 34.25 ? 605  THR B CB    1 
ATOM   9609  O OG1   . THR B 1 605 ? -56.396 45.670  17.128  1.00 34.09 ? 605  THR B OG1   1 
ATOM   9610  C CG2   . THR B 1 605 ? -57.451 45.146  19.263  1.00 34.99 ? 605  THR B CG2   1 
ATOM   9611  N N     . ARG B 1 606 ? -58.588 42.473  16.521  1.00 34.98 ? 606  ARG B N     1 
ATOM   9612  C CA    . ARG B 1 606 ? -59.302 41.798  15.455  1.00 35.52 ? 606  ARG B CA    1 
ATOM   9613  C C     . ARG B 1 606 ? -59.426 42.649  14.199  1.00 36.17 ? 606  ARG B C     1 
ATOM   9614  O O     . ARG B 1 606 ? -59.869 42.169  13.160  1.00 36.43 ? 606  ARG B O     1 
ATOM   9615  C CB    . ARG B 1 606 ? -60.648 41.319  15.963  1.00 35.44 ? 606  ARG B CB    1 
ATOM   9616  C CG    . ARG B 1 606 ? -60.474 40.582  17.260  1.00 35.51 ? 606  ARG B CG    1 
ATOM   9617  C CD    . ARG B 1 606 ? -61.580 39.602  17.550  1.00 35.69 ? 606  ARG B CD    1 
ATOM   9618  N NE    . ARG B 1 606 ? -61.169 38.666  18.599  1.00 35.65 ? 606  ARG B NE    1 
ATOM   9619  C CZ    . ARG B 1 606 ? -60.971 38.987  19.882  1.00 35.31 ? 606  ARG B CZ    1 
ATOM   9620  N NH1   . ARG B 1 606 ? -61.138 40.237  20.316  1.00 33.66 ? 606  ARG B NH1   1 
ATOM   9621  N NH2   . ARG B 1 606 ? -60.599 38.044  20.739  1.00 35.47 ? 606  ARG B NH2   1 
ATOM   9622  N N     . SER B 1 607 ? -59.008 43.906  14.298  1.00 37.04 ? 607  SER B N     1 
ATOM   9623  C CA    . SER B 1 607 ? -58.864 44.760  13.126  1.00 38.11 ? 607  SER B CA    1 
ATOM   9624  C C     . SER B 1 607 ? -57.445 44.698  12.541  1.00 39.01 ? 607  SER B C     1 
ATOM   9625  O O     . SER B 1 607 ? -57.221 45.115  11.408  1.00 39.19 ? 607  SER B O     1 
ATOM   9626  C CB    . SER B 1 607 ? -59.264 46.205  13.444  1.00 38.12 ? 607  SER B CB    1 
ATOM   9627  O OG    . SER B 1 607 ? -60.666 46.369  13.346  1.00 37.10 ? 607  SER B OG    1 
ATOM   9628  N N     . GLY B 1 608 ? -56.492 44.173  13.303  1.00 39.85 ? 608  GLY B N     1 
ATOM   9629  C CA    . GLY B 1 608 ? -55.127 44.032  12.808  1.00 41.06 ? 608  GLY B CA    1 
ATOM   9630  C C     . GLY B 1 608 ? -54.146 45.083  13.320  1.00 41.91 ? 608  GLY B C     1 
ATOM   9631  O O     . GLY B 1 608 ? -53.008 45.142  12.856  1.00 41.84 ? 608  GLY B O     1 
ATOM   9632  N N     . LYS B 1 609 ? -54.585 45.916  14.266  1.00 42.68 ? 609  LYS B N     1 
ATOM   9633  C CA    . LYS B 1 609 ? -53.678 46.811  14.990  1.00 43.40 ? 609  LYS B CA    1 
ATOM   9634  C C     . LYS B 1 609 ? -52.750 46.006  15.930  1.00 43.84 ? 609  LYS B C     1 
ATOM   9635  O O     . LYS B 1 609 ? -53.229 45.223  16.765  1.00 43.43 ? 609  LYS B O     1 
ATOM   9636  C CB    . LYS B 1 609 ? -54.466 47.877  15.772  1.00 43.03 ? 609  LYS B CB    1 
ATOM   9637  N N     . ILE B 1 610 ? -51.433 46.201  15.770  1.00 44.62 ? 610  ILE B N     1 
ATOM   9638  C CA    . ILE B 1 610 ? -50.402 45.626  16.664  1.00 45.46 ? 610  ILE B CA    1 
ATOM   9639  C C     . ILE B 1 610 ? -50.488 46.257  18.064  1.00 45.97 ? 610  ILE B C     1 
ATOM   9640  O O     . ILE B 1 610 ? -50.637 47.465  18.187  1.00 45.87 ? 610  ILE B O     1 
ATOM   9641  C CB    . ILE B 1 610 ? -48.971 45.793  16.075  1.00 45.25 ? 610  ILE B CB    1 
ATOM   9642  N N     . MET B 1 611 ? -50.415 45.443  19.111  1.00 46.80 ? 611  MET B N     1 
ATOM   9643  C CA    . MET B 1 611 ? -50.661 45.941  20.474  1.00 48.19 ? 611  MET B CA    1 
ATOM   9644  C C     . MET B 1 611 ? -49.371 46.302  21.210  1.00 48.13 ? 611  MET B C     1 
ATOM   9645  O O     . MET B 1 611 ? -48.781 45.480  21.922  1.00 48.45 ? 611  MET B O     1 
ATOM   9646  C CB    . MET B 1 611 ? -51.453 44.922  21.278  1.00 47.80 ? 611  MET B CB    1 
ATOM   9647  C CG    . MET B 1 611 ? -52.753 44.545  20.631  1.00 49.12 ? 611  MET B CG    1 
ATOM   9648  S SD    . MET B 1 611 ? -53.953 43.992  21.859  1.00 50.71 ? 611  MET B SD    1 
ATOM   9649  C CE    . MET B 1 611 ? -54.330 45.545  22.726  1.00 49.75 ? 611  MET B CE    1 
ATOM   9650  N N     . ARG B 1 612 ? -48.950 47.549  21.051  1.00 48.17 ? 612  ARG B N     1 
ATOM   9651  C CA    . ARG B 1 612 ? -47.622 47.975  21.484  1.00 47.99 ? 612  ARG B CA    1 
ATOM   9652  C C     . ARG B 1 612 ? -47.339 47.852  22.999  1.00 47.33 ? 612  ARG B C     1 
ATOM   9653  O O     . ARG B 1 612 ? -46.228 47.483  23.386  1.00 47.38 ? 612  ARG B O     1 
ATOM   9654  C CB    . ARG B 1 612 ? -47.337 49.382  20.946  1.00 48.49 ? 612  ARG B CB    1 
ATOM   9655  C CG    . ARG B 1 612 ? -46.910 49.376  19.476  1.00 50.41 ? 612  ARG B CG    1 
ATOM   9656  C CD    . ARG B 1 612 ? -47.575 50.491  18.680  1.00 52.77 ? 612  ARG B CD    1 
ATOM   9657  N NE    . ARG B 1 612 ? -46.934 50.672  17.371  1.00 55.29 ? 612  ARG B NE    1 
ATOM   9658  C CZ    . ARG B 1 612 ? -47.496 50.395  16.192  1.00 55.24 ? 612  ARG B CZ    1 
ATOM   9659  N NH1   . ARG B 1 612 ? -48.733 49.911  16.112  1.00 55.04 ? 612  ARG B NH1   1 
ATOM   9660  N NH2   . ARG B 1 612 ? -46.815 50.620  15.083  1.00 55.22 ? 612  ARG B NH2   1 
ATOM   9661  N N     . ARG B 1 613 ? -48.336 48.126  23.842  1.00 46.45 ? 613  ARG B N     1 
ATOM   9662  C CA    . ARG B 1 613 ? -48.139 48.129  25.303  1.00 45.52 ? 613  ARG B CA    1 
ATOM   9663  C C     . ARG B 1 613 ? -47.511 46.819  25.812  1.00 44.58 ? 613  ARG B C     1 
ATOM   9664  O O     . ARG B 1 613 ? -46.529 46.836  26.561  1.00 44.33 ? 613  ARG B O     1 
ATOM   9665  C CB    . ARG B 1 613 ? -49.452 48.457  26.059  1.00 45.50 ? 613  ARG B CB    1 
ATOM   9666  N N     . ILE B 1 614 ? -48.069 45.693  25.384  1.00 43.40 ? 614  ILE B N     1 
ATOM   9667  C CA    . ILE B 1 614 ? -47.642 44.396  25.890  1.00 42.34 ? 614  ILE B CA    1 
ATOM   9668  C C     . ILE B 1 614 ? -46.249 44.006  25.384  1.00 41.37 ? 614  ILE B C     1 
ATOM   9669  O O     . ILE B 1 614 ? -45.461 43.395  26.104  1.00 41.19 ? 614  ILE B O     1 
ATOM   9670  C CB    . ILE B 1 614 ? -48.692 43.297  25.593  1.00 42.47 ? 614  ILE B CB    1 
ATOM   9671  C CG1   . ILE B 1 614 ? -48.231 41.950  26.149  1.00 43.45 ? 614  ILE B CG1   1 
ATOM   9672  C CG2   . ILE B 1 614 ? -48.994 43.200  24.112  1.00 42.23 ? 614  ILE B CG2   1 
ATOM   9673  C CD1   . ILE B 1 614 ? -48.263 41.872  27.696  1.00 45.60 ? 614  ILE B CD1   1 
ATOM   9674  N N     . LEU B 1 615 ? -45.944 44.386  24.153  1.00 40.08 ? 615  LEU B N     1 
ATOM   9675  C CA    . LEU B 1 615 ? -44.640 44.100  23.570  1.00 39.02 ? 615  LEU B CA    1 
ATOM   9676  C C     . LEU B 1 615 ? -43.510 44.909  24.203  1.00 38.75 ? 615  LEU B C     1 
ATOM   9677  O O     . LEU B 1 615 ? -42.355 44.468  24.220  1.00 38.34 ? 615  LEU B O     1 
ATOM   9678  C CB    . LEU B 1 615 ? -44.671 44.355  22.063  1.00 38.87 ? 615  LEU B CB    1 
ATOM   9679  C CG    . LEU B 1 615 ? -45.405 43.356  21.171  1.00 37.84 ? 615  LEU B CG    1 
ATOM   9680  C CD1   . LEU B 1 615 ? -45.126 43.721  19.724  1.00 36.56 ? 615  LEU B CD1   1 
ATOM   9681  C CD2   . LEU B 1 615 ? -45.014 41.893  21.476  1.00 34.94 ? 615  LEU B CD2   1 
ATOM   9682  N N     . ARG B 1 616 ? -43.853 46.099  24.697  1.00 38.22 ? 616  ARG B N     1 
ATOM   9683  C CA    . ARG B 1 616 ? -42.905 46.997  25.330  1.00 38.05 ? 616  ARG B CA    1 
ATOM   9684  C C     . ARG B 1 616 ? -42.452 46.427  26.669  1.00 37.63 ? 616  ARG B C     1 
ATOM   9685  O O     . ARG B 1 616 ? -41.253 46.424  26.985  1.00 37.79 ? 616  ARG B O     1 
ATOM   9686  C CB    . ARG B 1 616 ? -43.554 48.357  25.524  1.00 38.13 ? 616  ARG B CB    1 
ATOM   9687  C CG    . ARG B 1 616 ? -42.583 49.472  25.782  1.00 40.76 ? 616  ARG B CG    1 
ATOM   9688  C CD    . ARG B 1 616 ? -43.285 50.829  25.823  1.00 44.41 ? 616  ARG B CD    1 
ATOM   9689  N NE    . ARG B 1 616 ? -44.051 51.126  24.599  1.00 46.37 ? 616  ARG B NE    1 
ATOM   9690  C CZ    . ARG B 1 616 ? -45.347 51.466  24.566  1.00 46.95 ? 616  ARG B CZ    1 
ATOM   9691  N NH1   . ARG B 1 616 ? -46.056 51.558  25.689  1.00 47.22 ? 616  ARG B NH1   1 
ATOM   9692  N NH2   . ARG B 1 616 ? -45.941 51.719  23.402  1.00 46.33 ? 616  ARG B NH2   1 
ATOM   9693  N N     . LYS B 1 617 ? -43.417 45.929  27.443  1.00 37.21 ? 617  LYS B N     1 
ATOM   9694  C CA    . LYS B 1 617 ? -43.142 45.332  28.747  1.00 36.79 ? 617  LYS B CA    1 
ATOM   9695  C C     . LYS B 1 617 ? -42.370 44.006  28.626  1.00 36.51 ? 617  LYS B C     1 
ATOM   9696  O O     . LYS B 1 617 ? -41.467 43.759  29.429  1.00 36.61 ? 617  LYS B O     1 
ATOM   9697  C CB    . LYS B 1 617 ? -44.428 45.183  29.577  1.00 36.57 ? 617  LYS B CB    1 
ATOM   9698  N N     . ILE B 1 618 ? -42.694 43.178  27.624  1.00 35.93 ? 618  ILE B N     1 
ATOM   9699  C CA    . ILE B 1 618 ? -41.989 41.897  27.423  1.00 35.69 ? 618  ILE B CA    1 
ATOM   9700  C C     . ILE B 1 618 ? -40.520 42.086  27.083  1.00 35.52 ? 618  ILE B C     1 
ATOM   9701  O O     . ILE B 1 618 ? -39.657 41.378  27.609  1.00 35.28 ? 618  ILE B O     1 
ATOM   9702  C CB    . ILE B 1 618 ? -42.603 41.015  26.301  1.00 35.78 ? 618  ILE B CB    1 
ATOM   9703  C CG1   . ILE B 1 618 ? -44.029 40.571  26.645  1.00 36.41 ? 618  ILE B CG1   1 
ATOM   9704  C CG2   . ILE B 1 618 ? -41.741 39.776  26.080  1.00 35.21 ? 618  ILE B CG2   1 
ATOM   9705  C CD1   . ILE B 1 618 ? -44.783 39.945  25.472  1.00 35.37 ? 618  ILE B CD1   1 
ATOM   9706  N N     . ALA B 1 619 ? -40.259 43.021  26.173  1.00 35.67 ? 619  ALA B N     1 
ATOM   9707  C CA    . ALA B 1 619 ? -38.908 43.326  25.707  1.00 36.08 ? 619  ALA B CA    1 
ATOM   9708  C C     . ALA B 1 619 ? -38.057 43.961  26.813  1.00 36.69 ? 619  ALA B C     1 
ATOM   9709  O O     . ALA B 1 619 ? -36.863 43.659  26.936  1.00 36.48 ? 619  ALA B O     1 
ATOM   9710  C CB    . ALA B 1 619 ? -38.970 44.231  24.507  1.00 35.93 ? 619  ALA B CB    1 
ATOM   9711  N N     . ALA B 1 620 ? -38.675 44.827  27.620  1.00 37.18 ? 620  ALA B N     1 
ATOM   9712  C CA    . ALA B 1 620 ? -37.995 45.393  28.786  1.00 38.13 ? 620  ALA B CA    1 
ATOM   9713  C C     . ALA B 1 620 ? -37.587 44.350  29.879  1.00 38.63 ? 620  ALA B C     1 
ATOM   9714  O O     . ALA B 1 620 ? -36.554 44.519  30.528  1.00 38.92 ? 620  ALA B O     1 
ATOM   9715  C CB    . ALA B 1 620 ? -38.810 46.564  29.382  1.00 37.98 ? 620  ALA B CB    1 
ATOM   9716  N N     . GLY B 1 621 ? -38.372 43.279  30.060  1.00 38.78 ? 621  GLY B N     1 
ATOM   9717  C CA    . GLY B 1 621 ? -38.044 42.219  31.028  1.00 39.03 ? 621  GLY B CA    1 
ATOM   9718  C C     . GLY B 1 621 ? -39.207 41.676  31.861  1.00 39.39 ? 621  GLY B C     1 
ATOM   9719  O O     . GLY B 1 621 ? -39.132 40.555  32.368  1.00 39.31 ? 621  GLY B O     1 
ATOM   9720  N N     . ASP B 1 622 ? -40.274 42.471  32.000  1.00 39.52 ? 622  ASP B N     1 
ATOM   9721  C CA    . ASP B 1 622 ? -41.502 42.081  32.723  1.00 39.70 ? 622  ASP B CA    1 
ATOM   9722  C C     . ASP B 1 622 ? -42.131 40.755  32.212  1.00 39.74 ? 622  ASP B C     1 
ATOM   9723  O O     . ASP B 1 622 ? -42.238 39.751  32.946  1.00 39.64 ? 622  ASP B O     1 
ATOM   9724  C CB    . ASP B 1 622 ? -42.526 43.234  32.680  1.00 39.21 ? 622  ASP B CB    1 
ATOM   9725  N N     . ASP B 1 634 ? -56.635 35.991  19.945  1.00 52.16 ? 634  ASP B N     1 
ATOM   9726  C CA    . ASP B 1 634 ? -56.451 35.068  21.066  1.00 52.42 ? 634  ASP B CA    1 
ATOM   9727  C C     . ASP B 1 634 ? -55.260 35.517  21.922  1.00 52.41 ? 634  ASP B C     1 
ATOM   9728  O O     . ASP B 1 634 ? -54.150 35.720  21.384  1.00 52.58 ? 634  ASP B O     1 
ATOM   9729  C CB    . ASP B 1 634 ? -56.208 33.631  20.562  1.00 52.53 ? 634  ASP B CB    1 
ATOM   9730  C CG    . ASP B 1 634 ? -54.709 33.309  20.369  1.00 53.01 ? 634  ASP B CG    1 
ATOM   9731  O OD1   . ASP B 1 634 ? -54.168 32.495  21.146  1.00 53.92 ? 634  ASP B OD1   1 
ATOM   9732  O OD2   . ASP B 1 634 ? -54.057 33.887  19.468  1.00 52.44 ? 634  ASP B OD2   1 
ATOM   9733  N N     . PRO B 1 635 ? -55.471 35.693  23.248  1.00 52.04 ? 635  PRO B N     1 
ATOM   9734  C CA    . PRO B 1 635 ? -54.308 35.931  24.136  1.00 51.58 ? 635  PRO B CA    1 
ATOM   9735  C C     . PRO B 1 635 ? -53.240 34.779  24.290  1.00 50.79 ? 635  PRO B C     1 
ATOM   9736  O O     . PRO B 1 635 ? -52.332 34.907  25.118  1.00 50.72 ? 635  PRO B O     1 
ATOM   9737  C CB    . PRO B 1 635 ? -54.966 36.316  25.488  1.00 51.80 ? 635  PRO B CB    1 
ATOM   9738  C CG    . PRO B 1 635 ? -56.399 36.724  25.133  1.00 51.89 ? 635  PRO B CG    1 
ATOM   9739  C CD    . PRO B 1 635 ? -56.743 35.782  23.992  1.00 52.06 ? 635  PRO B CD    1 
ATOM   9740  N N     . GLY B 1 636 ? -53.315 33.703  23.498  1.00 49.47 ? 636  GLY B N     1 
ATOM   9741  C CA    . GLY B 1 636 ? -52.337 32.613  23.601  1.00 48.18 ? 636  GLY B CA    1 
ATOM   9742  C C     . GLY B 1 636 ? -50.889 33.020  23.343  1.00 47.57 ? 636  GLY B C     1 
ATOM   9743  O O     . GLY B 1 636 ? -49.962 32.448  23.935  1.00 47.50 ? 636  GLY B O     1 
ATOM   9744  N N     . VAL B 1 637 ? -50.706 34.025  22.477  1.00 46.74 ? 637  VAL B N     1 
ATOM   9745  C CA    . VAL B 1 637 ? -49.387 34.495  21.999  1.00 45.62 ? 637  VAL B CA    1 
ATOM   9746  C C     . VAL B 1 637 ? -48.427 35.010  23.065  1.00 44.88 ? 637  VAL B C     1 
ATOM   9747  O O     . VAL B 1 637 ? -47.235 35.104  22.813  1.00 44.87 ? 637  VAL B O     1 
ATOM   9748  C CB    . VAL B 1 637 ? -49.487 35.600  20.871  1.00 45.94 ? 637  VAL B CB    1 
ATOM   9749  C CG1   . VAL B 1 637 ? -50.511 35.220  19.783  1.00 45.61 ? 637  VAL B CG1   1 
ATOM   9750  C CG2   . VAL B 1 637 ? -49.773 37.000  21.453  1.00 45.23 ? 637  VAL B CG2   1 
ATOM   9751  N N     . VAL B 1 638 ? -48.941 35.357  24.235  1.00 44.06 ? 638  VAL B N     1 
ATOM   9752  C CA    . VAL B 1 638 ? -48.114 35.935  25.292  1.00 43.51 ? 638  VAL B CA    1 
ATOM   9753  C C     . VAL B 1 638 ? -47.161 34.910  25.911  1.00 43.43 ? 638  VAL B C     1 
ATOM   9754  O O     . VAL B 1 638 ? -45.996 35.214  26.173  1.00 43.14 ? 638  VAL B O     1 
ATOM   9755  C CB    . VAL B 1 638 ? -48.969 36.626  26.382  1.00 43.30 ? 638  VAL B CB    1 
ATOM   9756  C CG1   . VAL B 1 638 ? -48.092 37.152  27.500  1.00 43.12 ? 638  VAL B CG1   1 
ATOM   9757  C CG2   . VAL B 1 638 ? -49.777 37.762  25.781  1.00 42.69 ? 638  VAL B CG2   1 
ATOM   9758  N N     . GLU B 1 639 ? -47.668 33.704  26.154  1.00 43.44 ? 639  GLU B N     1 
ATOM   9759  C CA    . GLU B 1 639 ? -46.832 32.588  26.604  1.00 43.39 ? 639  GLU B CA    1 
ATOM   9760  C C     . GLU B 1 639 ? -45.680 32.410  25.613  1.00 42.57 ? 639  GLU B C     1 
ATOM   9761  O O     . GLU B 1 639 ? -44.507 32.398  26.003  1.00 42.12 ? 639  GLU B O     1 
ATOM   9762  C CB    . GLU B 1 639 ? -47.667 31.297  26.698  1.00 43.18 ? 639  GLU B CB    1 
ATOM   9763  C CG    . GLU B 1 639 ? -47.067 30.198  27.573  1.00 43.60 ? 639  GLU B CG    1 
ATOM   9764  C CD    . GLU B 1 639 ? -47.809 28.861  27.432  1.00 44.29 ? 639  GLU B CD    1 
ATOM   9765  O OE1   . GLU B 1 639 ? -48.406 28.392  28.432  1.00 45.38 ? 639  GLU B OE1   1 
ATOM   9766  O OE2   . GLU B 1 639 ? -47.809 28.278  26.321  1.00 45.06 ? 639  GLU B OE2   1 
ATOM   9767  N N     . LYS B 1 640 ? -46.035 32.302  24.332  1.00 42.03 ? 640  LYS B N     1 
ATOM   9768  C CA    . LYS B 1 640 ? -45.063 32.032  23.280  1.00 41.84 ? 640  LYS B CA    1 
ATOM   9769  C C     . LYS B 1 640 ? -43.996 33.119  23.298  1.00 41.61 ? 640  LYS B C     1 
ATOM   9770  O O     . LYS B 1 640 ? -42.812 32.811  23.437  1.00 42.00 ? 640  LYS B O     1 
ATOM   9771  C CB    . LYS B 1 640 ? -45.730 31.890  21.897  1.00 41.48 ? 640  LYS B CB    1 
ATOM   9772  N N     . LEU B 1 641 ? -44.426 34.381  23.214  1.00 41.16 ? 641  LEU B N     1 
ATOM   9773  C CA    . LEU B 1 641 ? -43.531 35.547  23.193  1.00 40.55 ? 641  LEU B CA    1 
ATOM   9774  C C     . LEU B 1 641 ? -42.540 35.572  24.332  1.00 40.92 ? 641  LEU B C     1 
ATOM   9775  O O     . LEU B 1 641 ? -41.453 36.129  24.195  1.00 40.84 ? 641  LEU B O     1 
ATOM   9776  C CB    . LEU B 1 641 ? -44.325 36.855  23.228  1.00 40.06 ? 641  LEU B CB    1 
ATOM   9777  C CG    . LEU B 1 641 ? -44.939 37.368  21.928  1.00 39.34 ? 641  LEU B CG    1 
ATOM   9778  C CD1   . LEU B 1 641 ? -46.072 38.350  22.213  1.00 38.98 ? 641  LEU B CD1   1 
ATOM   9779  C CD2   . LEU B 1 641 ? -43.895 37.973  21.007  1.00 36.18 ? 641  LEU B CD2   1 
ATOM   9780  N N     . LEU B 1 642 ? -42.916 34.985  25.464  1.00 41.51 ? 642  LEU B N     1 
ATOM   9781  C CA    . LEU B 1 642 ? -42.054 35.010  26.637  1.00 42.08 ? 642  LEU B CA    1 
ATOM   9782  C C     . LEU B 1 642 ? -40.948 33.971  26.554  1.00 42.47 ? 642  LEU B C     1 
ATOM   9783  O O     . LEU B 1 642 ? -39.815 34.258  26.933  1.00 42.34 ? 642  LEU B O     1 
ATOM   9784  C CB    . LEU B 1 642 ? -42.866 34.882  27.926  1.00 42.24 ? 642  LEU B CB    1 
ATOM   9785  C CG    . LEU B 1 642 ? -43.442 36.201  28.457  1.00 42.39 ? 642  LEU B CG    1 
ATOM   9786  C CD1   . LEU B 1 642 ? -44.668 35.944  29.329  1.00 42.18 ? 642  LEU B CD1   1 
ATOM   9787  C CD2   . LEU B 1 642 ? -42.388 37.030  29.212  1.00 42.91 ? 642  LEU B CD2   1 
ATOM   9788  N N     . GLU B 1 643 ? -41.278 32.777  26.050  1.00 43.27 ? 643  GLU B N     1 
ATOM   9789  C CA    . GLU B 1 643 ? -40.276 31.737  25.772  1.00 44.11 ? 643  GLU B CA    1 
ATOM   9790  C C     . GLU B 1 643 ? -39.147 32.280  24.886  1.00 44.15 ? 643  GLU B C     1 
ATOM   9791  O O     . GLU B 1 643 ? -37.964 32.094  25.186  1.00 44.54 ? 643  GLU B O     1 
ATOM   9792  C CB    . GLU B 1 643 ? -40.895 30.542  25.047  1.00 44.06 ? 643  GLU B CB    1 
ATOM   9793  C CG    . GLU B 1 643 ? -41.775 29.619  25.848  1.00 44.67 ? 643  GLU B CG    1 
ATOM   9794  C CD    . GLU B 1 643 ? -42.434 28.589  24.939  1.00 44.97 ? 643  GLU B CD    1 
ATOM   9795  O OE1   . GLU B 1 643 ? -43.322 27.834  25.406  1.00 45.70 ? 643  GLU B OE1   1 
ATOM   9796  O OE2   . GLU B 1 643 ? -42.059 28.547  23.741  1.00 45.73 ? 643  GLU B OE2   1 
ATOM   9797  N N     . GLU B 1 644 ? -39.530 32.938  23.790  1.00 43.98 ? 644  GLU B N     1 
ATOM   9798  C CA    . GLU B 1 644 ? -38.579 33.414  22.783  1.00 43.59 ? 644  GLU B CA    1 
ATOM   9799  C C     . GLU B 1 644 ? -37.646 34.499  23.342  1.00 44.35 ? 644  GLU B C     1 
ATOM   9800  O O     . GLU B 1 644 ? -36.459 34.525  22.994  1.00 44.15 ? 644  GLU B O     1 
ATOM   9801  C CB    . GLU B 1 644 ? -39.311 33.933  21.534  1.00 43.35 ? 644  GLU B CB    1 
ATOM   9802  C CG    . GLU B 1 644 ? -40.168 32.918  20.779  1.00 41.87 ? 644  GLU B CG    1 
ATOM   9803  C CD    . GLU B 1 644 ? -41.208 33.579  19.882  1.00 41.97 ? 644  GLU B CD    1 
ATOM   9804  O OE1   . GLU B 1 644 ? -41.488 34.774  20.069  1.00 40.95 ? 644  GLU B OE1   1 
ATOM   9805  O OE2   . GLU B 1 644 ? -41.763 32.914  18.991  1.00 39.65 ? 644  GLU B OE2   1 
ATOM   9806  N N     . LYS B 1 645 ? -38.185 35.373  24.204  1.00 44.80 ? 645  LYS B N     1 
ATOM   9807  C CA    . LYS B 1 645 ? -37.433 36.497  24.773  1.00 45.42 ? 645  LYS B CA    1 
ATOM   9808  C C     . LYS B 1 645 ? -36.222 36.025  25.554  1.00 46.01 ? 645  LYS B C     1 
ATOM   9809  O O     . LYS B 1 645 ? -35.117 36.541  25.359  1.00 46.07 ? 645  LYS B O     1 
ATOM   9810  C CB    . LYS B 1 645 ? -38.312 37.355  25.688  1.00 45.35 ? 645  LYS B CB    1 
ATOM   9811  C CG    . LYS B 1 645 ? -37.885 38.834  25.788  1.00 45.44 ? 645  LYS B CG    1 
ATOM   9812  C CD    . LYS B 1 645 ? -36.702 39.068  26.722  1.00 45.29 ? 645  LYS B CD    1 
ATOM   9813  C CE    . LYS B 1 645 ? -36.048 40.412  26.451  1.00 44.57 ? 645  LYS B CE    1 
ATOM   9814  N NZ    . LYS B 1 645 ? -34.780 40.572  27.219  1.00 43.08 ? 645  LYS B NZ    1 
ATOM   9815  N N     . GLN B 1 646 ? -36.430 35.041  26.429  1.00 46.62 ? 646  GLN B N     1 
ATOM   9816  C CA    . GLN B 1 646 ? -35.343 34.525  27.261  1.00 47.42 ? 646  GLN B CA    1 
ATOM   9817  C C     . GLN B 1 646 ? -34.270 33.748  26.458  1.00 47.35 ? 646  GLN B C     1 
ATOM   9818  O O     . GLN B 1 646 ? -33.166 33.527  26.966  1.00 47.59 ? 646  GLN B O     1 
ATOM   9819  C CB    . GLN B 1 646 ? -35.888 33.708  28.455  1.00 47.73 ? 646  GLN B CB    1 
ATOM   9820  C CG    . GLN B 1 646 ? -35.347 34.169  29.849  1.00 49.00 ? 646  GLN B CG    1 
ATOM   9821  C CD    . GLN B 1 646 ? -34.117 33.376  30.368  1.00 50.53 ? 646  GLN B CD    1 
ATOM   9822  O OE1   . GLN B 1 646 ? -34.065 32.143  30.286  1.00 50.42 ? 646  GLN B OE1   1 
ATOM   9823  N NE2   . GLN B 1 646 ? -33.148 34.092  30.933  1.00 50.09 ? 646  GLN B NE2   1 
ATOM   9824  N N     . ALA B 1 647 ? -34.585 33.370  25.211  1.00 47.18 ? 647  ALA B N     1 
ATOM   9825  C CA    . ALA B 1 647 ? -33.640 32.660  24.312  1.00 46.90 ? 647  ALA B CA    1 
ATOM   9826  C C     . ALA B 1 647 ? -32.555 33.542  23.641  1.00 46.55 ? 647  ALA B C     1 
ATOM   9827  O O     . ALA B 1 647 ? -32.719 34.754  23.444  1.00 46.22 ? 647  ALA B O     1 
ATOM   9828  C CB    . ALA B 1 647 ? -34.410 31.824  23.255  1.00 46.50 ? 647  ALA B CB    1 
HETATM 9829  C C     . ACT C 2 .   ? -4.799  29.178  20.781  1.00 48.79 ? 653  ACT A C     1 
HETATM 9830  O O     . ACT C 2 .   ? -3.806  28.621  21.305  1.00 48.84 ? 653  ACT A O     1 
HETATM 9831  O OXT   . ACT C 2 .   ? -5.109  28.694  19.676  1.00 49.08 ? 653  ACT A OXT   1 
HETATM 9832  C CH3   . ACT C 2 .   ? -5.556  30.320  21.410  1.00 48.60 ? 653  ACT A CH3   1 
HETATM 9833  N N1A   . COA D 3 .   ? -2.080  46.101  21.038  1.00 28.32 ? 990  COA A N1A   1 
HETATM 9834  C C2A   . COA D 3 .   ? -2.551  47.118  21.843  1.00 28.48 ? 990  COA A C2A   1 
HETATM 9835  N N3A   . COA D 3 .   ? -3.883  47.119  22.205  1.00 28.78 ? 990  COA A N3A   1 
HETATM 9836  C C4A   . COA D 3 .   ? -4.709  46.145  21.770  1.00 28.43 ? 990  COA A C4A   1 
HETATM 9837  C C5A   . COA D 3 .   ? -4.249  45.113  20.962  1.00 27.94 ? 990  COA A C5A   1 
HETATM 9838  C C6A   . COA D 3 .   ? -2.914  45.099  20.592  1.00 26.48 ? 990  COA A C6A   1 
HETATM 9839  N N6A   . COA D 3 .   ? -2.472  44.241  19.683  1.00 25.69 ? 990  COA A N6A   1 
HETATM 9840  N N7A   . COA D 3 .   ? -5.293  44.281  20.706  1.00 29.24 ? 990  COA A N7A   1 
HETATM 9841  C C8A   . COA D 3 .   ? -6.397  44.769  21.325  1.00 29.10 ? 990  COA A C8A   1 
HETATM 9842  N N9A   . COA D 3 .   ? -6.031  45.924  21.988  1.00 30.05 ? 990  COA A N9A   1 
HETATM 9843  C C1B   . COA D 3 .   ? -6.917  46.885  22.627  1.00 32.36 ? 990  COA A C1B   1 
HETATM 9844  C C2B   . COA D 3 .   ? -7.853  47.508  21.598  1.00 33.54 ? 990  COA A C2B   1 
HETATM 9845  O O2B   . COA D 3 .   ? -7.284  48.546  20.828  1.00 32.63 ? 990  COA A O2B   1 
HETATM 9846  C C3B   . COA D 3 .   ? -8.950  47.972  22.521  1.00 34.22 ? 990  COA A C3B   1 
HETATM 9847  O O3B   . COA D 3 .   ? -8.452  49.084  23.226  1.00 32.00 ? 990  COA A O3B   1 
HETATM 9848  P P3B   . COA D 3 .   ? -9.427  50.018  24.090  1.00 31.39 ? 990  COA A P3B   1 
HETATM 9849  O O7A   . COA D 3 .   ? -8.595  51.141  24.657  1.00 30.91 ? 990  COA A O7A   1 
HETATM 9850  O O8A   . COA D 3 .   ? -10.507 50.611  23.196  1.00 30.13 ? 990  COA A O8A   1 
HETATM 9851  O O9A   . COA D 3 .   ? -9.996  49.104  25.156  1.00 29.65 ? 990  COA A O9A   1 
HETATM 9852  C C4B   . COA D 3 .   ? -9.064  46.822  23.505  1.00 36.48 ? 990  COA A C4B   1 
HETATM 9853  O O4B   . COA D 3 .   ? -7.786  46.198  23.511  1.00 35.10 ? 990  COA A O4B   1 
HETATM 9854  C C5B   . COA D 3 .   ? -10.193 45.854  23.138  1.00 41.18 ? 990  COA A C5B   1 
HETATM 9855  O O5B   . COA D 3 .   ? -9.690  44.667  22.549  1.00 46.75 ? 990  COA A O5B   1 
HETATM 9856  P P1A   . COA D 3 .   ? -10.581 43.726  21.560  1.00 49.90 ? 990  COA A P1A   1 
HETATM 9857  O O1A   . COA D 3 .   ? -11.699 43.016  22.307  1.00 48.22 ? 990  COA A O1A   1 
HETATM 9858  O O2A   . COA D 3 .   ? -9.715  42.727  20.809  1.00 47.88 ? 990  COA A O2A   1 
HETATM 9859  O O3A   . COA D 3 .   ? -11.189 44.853  20.565  1.00 50.63 ? 990  COA A O3A   1 
HETATM 9860  P P2A   . COA D 3 .   ? -10.611 45.008  19.075  1.00 51.80 ? 990  COA A P2A   1 
HETATM 9861  O O4A   . COA D 3 .   ? -9.367  45.873  19.075  1.00 51.44 ? 990  COA A O4A   1 
HETATM 9862  O O5A   . COA D 3 .   ? -11.690 45.522  18.137  1.00 51.91 ? 990  COA A O5A   1 
HETATM 9863  O O6A   . COA D 3 .   ? -10.249 43.482  18.696  1.00 51.39 ? 990  COA A O6A   1 
HETATM 9864  C CBP   . COA D 3 .   ? -10.704 41.520  17.316  1.00 53.14 ? 990  COA A CBP   1 
HETATM 9865  C CCP   . COA D 3 .   ? -11.252 42.745  18.033  1.00 52.46 ? 990  COA A CCP   1 
HETATM 9866  C CDP   . COA D 3 .   ? -9.944  41.967  16.071  1.00 53.33 ? 990  COA A CDP   1 
HETATM 9867  C CEP   . COA D 3 .   ? -11.977 40.803  16.878  1.00 53.28 ? 990  COA A CEP   1 
HETATM 9868  C CAP   . COA D 3 .   ? -9.741  40.699  18.215  1.00 53.22 ? 990  COA A CAP   1 
HETATM 9869  O OAP   . COA D 3 .   ? -9.938  40.903  19.599  1.00 52.79 ? 990  COA A OAP   1 
HETATM 9870  C C9P   . COA D 3 .   ? -9.448  39.254  17.856  1.00 51.94 ? 990  COA A C9P   1 
HETATM 9871  O O9P   . COA D 3 .   ? -9.880  38.729  16.632  1.00 52.97 ? 990  COA A O9P   1 
HETATM 9872  N N8P   . COA D 3 .   ? -8.756  38.500  18.713  1.00 51.18 ? 990  COA A N8P   1 
HETATM 9873  C C7P   . COA D 3 .   ? -8.630  37.056  18.553  1.00 50.70 ? 990  COA A C7P   1 
HETATM 9874  C C6P   . COA D 3 .   ? -7.436  36.426  19.279  1.00 51.52 ? 990  COA A C6P   1 
HETATM 9875  C C5P   . COA D 3 .   ? -6.759  35.346  18.450  1.00 52.44 ? 990  COA A C5P   1 
HETATM 9876  O O5P   . COA D 3 .   ? -6.486  35.533  17.251  1.00 52.53 ? 990  COA A O5P   1 
HETATM 9877  N N4P   . COA D 3 .   ? -6.465  34.200  19.070  1.00 53.10 ? 990  COA A N4P   1 
HETATM 9878  C C3P   . COA D 3 .   ? -5.329  33.375  18.688  1.00 52.82 ? 990  COA A C3P   1 
HETATM 9879  C C2P   . COA D 3 .   ? -4.076  33.698  19.497  1.00 53.25 ? 990  COA A C2P   1 
HETATM 9880  S S1P   . COA D 3 .   ? -3.405  32.270  20.402  1.00 55.55 ? 990  COA A S1P   1 
HETATM 9881  P P     . AMP E 4 .   ? -3.763  29.431  24.508  1.00 22.26 ? 999  AMP A P     1 
HETATM 9882  O O1P   . AMP E 4 .   ? -2.924  28.487  25.345  1.00 22.16 ? 999  AMP A O1P   1 
HETATM 9883  O O2P   . AMP E 4 .   ? -3.796  30.874  24.986  1.00 24.29 ? 999  AMP A O2P   1 
HETATM 9884  O O3P   . AMP E 4 .   ? -3.456  29.316  23.056  1.00 21.02 ? 999  AMP A O3P   1 
HETATM 9885  O "O5'" . AMP E 4 .   ? -5.263  28.873  24.628  1.00 19.20 ? 999  AMP A "O5'" 1 
HETATM 9886  C "C5'" . AMP E 4 .   ? -5.563  27.527  24.239  1.00 15.68 ? 999  AMP A "C5'" 1 
HETATM 9887  C "C4'" . AMP E 4 .   ? -6.994  27.262  24.678  1.00 13.00 ? 999  AMP A "C4'" 1 
HETATM 9888  O "O4'" . AMP E 4 .   ? -7.892  27.991  23.837  1.00 10.59 ? 999  AMP A "O4'" 1 
HETATM 9889  C "C3'" . AMP E 4 .   ? -7.411  25.807  24.594  1.00 11.21 ? 999  AMP A "C3'" 1 
HETATM 9890  O "O3'" . AMP E 4 .   ? -7.175  25.101  25.810  1.00 10.52 ? 999  AMP A "O3'" 1 
HETATM 9891  C "C2'" . AMP E 4 .   ? -8.896  25.922  24.326  1.00 11.11 ? 999  AMP A "C2'" 1 
HETATM 9892  O "O2'" . AMP E 4 .   ? -9.691  26.203  25.495  1.00 11.07 ? 999  AMP A "O2'" 1 
HETATM 9893  C "C1'" . AMP E 4 .   ? -8.979  27.155  23.473  1.00 10.45 ? 999  AMP A "C1'" 1 
HETATM 9894  N N9    . AMP E 4 .   ? -8.944  26.763  22.045  1.00 10.24 ? 999  AMP A N9    1 
HETATM 9895  C C8    . AMP E 4 .   ? -7.913  26.970  21.215  1.00 9.78  ? 999  AMP A C8    1 
HETATM 9896  N N7    . AMP E 4 .   ? -8.216  26.510  19.977  1.00 10.26 ? 999  AMP A N7    1 
HETATM 9897  C C5    . AMP E 4 .   ? -9.450  26.003  20.016  1.00 8.95  ? 999  AMP A C5    1 
HETATM 9898  C C6    . AMP E 4 .   ? -10.337 25.375  19.024  1.00 10.26 ? 999  AMP A C6    1 
HETATM 9899  N N6    . AMP E 4 .   ? -9.848  25.245  17.760  1.00 10.14 ? 999  AMP A N6    1 
HETATM 9900  N N1    . AMP E 4 .   ? -11.576 24.962  19.424  1.00 9.16  ? 999  AMP A N1    1 
HETATM 9901  C C2    . AMP E 4 .   ? -11.982 25.138  20.706  1.00 9.99  ? 999  AMP A C2    1 
HETATM 9902  N N3    . AMP E 4 .   ? -11.218 25.718  21.672  1.00 10.27 ? 999  AMP A N3    1 
HETATM 9903  C C4    . AMP E 4 .   ? -9.947  26.160  21.382  1.00 9.85  ? 999  AMP A C4    1 
HETATM 9904  C C     . ACT F 2 .   ? -32.949 68.094  20.565  1.00 59.27 ? 653  ACT B C     1 
HETATM 9905  O O     . ACT F 2 .   ? -33.699 68.853  21.238  1.00 58.97 ? 653  ACT B O     1 
HETATM 9906  O OXT   . ACT F 2 .   ? -32.407 68.547  19.517  1.00 59.71 ? 653  ACT B OXT   1 
HETATM 9907  C CH3   . ACT F 2 .   ? -32.707 66.679  20.972  1.00 59.10 ? 653  ACT B CH3   1 
HETATM 9908  N N1A   . COA G 3 .   ? -22.332 61.701  9.626   1.00 24.06 ? 991  COA B N1A   1 
HETATM 9909  C C2A   . COA G 3 .   ? -22.261 60.412  9.110   1.00 24.46 ? 991  COA B C2A   1 
HETATM 9910  N N3A   . COA G 3 .   ? -22.416 59.304  9.924   1.00 23.27 ? 991  COA B N3A   1 
HETATM 9911  C C4A   . COA G 3 .   ? -22.632 59.490  11.236  1.00 23.26 ? 991  COA B C4A   1 
HETATM 9912  C C5A   . COA G 3 .   ? -22.693 60.767  11.771  1.00 22.20 ? 991  COA B C5A   1 
HETATM 9913  C C6A   . COA G 3 .   ? -22.545 61.871  10.973  1.00 22.17 ? 991  COA B C6A   1 
HETATM 9914  N N6A   . COA G 3 .   ? -22.417 63.069  11.525  1.00 22.78 ? 991  COA B N6A   1 
HETATM 9915  N N7A   . COA G 3 .   ? -22.916 60.654  13.087  1.00 24.05 ? 991  COA B N7A   1 
HETATM 9916  C C8A   . COA G 3 .   ? -22.997 59.347  13.411  1.00 24.27 ? 991  COA B C8A   1 
HETATM 9917  N N9A   . COA G 3 .   ? -22.815 58.611  12.266  1.00 25.80 ? 991  COA B N9A   1 
HETATM 9918  C C1B   . COA G 3 .   ? -22.961 57.159  12.139  1.00 28.84 ? 991  COA B C1B   1 
HETATM 9919  C C2B   . COA G 3 .   ? -21.673 56.523  12.602  1.00 30.93 ? 991  COA B C2B   1 
HETATM 9920  O O2B   . COA G 3 .   ? -20.809 56.413  11.499  1.00 32.57 ? 991  COA B O2B   1 
HETATM 9921  C C3B   . COA G 3 .   ? -22.113 55.186  13.164  1.00 31.98 ? 991  COA B C3B   1 
HETATM 9922  O O3B   . COA G 3 .   ? -22.221 54.276  12.105  1.00 30.87 ? 991  COA B O3B   1 
HETATM 9923  P P3B   . COA G 3 .   ? -21.225 53.048  11.825  1.00 27.71 ? 991  COA B P3B   1 
HETATM 9924  O O7A   . COA G 3 .   ? -21.875 51.853  12.468  1.00 26.59 ? 991  COA B O7A   1 
HETATM 9925  O O8A   . COA G 3 .   ? -19.828 53.308  12.355  1.00 26.23 ? 991  COA B O8A   1 
HETATM 9926  O O9A   . COA G 3 .   ? -21.194 52.868  10.328  1.00 27.24 ? 991  COA B O9A   1 
HETATM 9927  C C4B   . COA G 3 .   ? -23.556 55.412  13.567  1.00 33.28 ? 991  COA B C4B   1 
HETATM 9928  O O4B   . COA G 3 .   ? -23.955 56.666  13.018  1.00 31.17 ? 991  COA B O4B   1 
HETATM 9929  C C5B   . COA G 3 .   ? -23.743 55.320  15.076  1.00 36.00 ? 991  COA B C5B   1 
HETATM 9930  O O5B   . COA G 3 .   ? -23.761 56.624  15.617  1.00 39.41 ? 991  COA B O5B   1 
HETATM 9931  P P1A   . COA G 3 .   ? -23.468 56.925  17.179  1.00 40.50 ? 991  COA B P1A   1 
HETATM 9932  O O1A   . COA G 3 .   ? -24.302 56.095  18.113  1.00 39.34 ? 991  COA B O1A   1 
HETATM 9933  O O2A   . COA G 3 .   ? -23.621 58.411  17.447  1.00 37.14 ? 991  COA B O2A   1 
HETATM 9934  O O3A   . COA G 3 .   ? -22.007 56.285  17.299  1.00 44.04 ? 991  COA B O3A   1 
HETATM 9935  P P2A   . COA G 3 .   ? -20.790 57.234  16.909  1.00 48.49 ? 991  COA B P2A   1 
HETATM 9936  O O4A   . COA G 3 .   ? -21.120 57.897  15.593  1.00 47.77 ? 991  COA B O4A   1 
HETATM 9937  O O5A   . COA G 3 .   ? -19.505 56.443  16.829  1.00 48.70 ? 991  COA B O5A   1 
HETATM 9938  O O6A   . COA G 3 .   ? -20.779 58.256  18.163  1.00 49.76 ? 991  COA B O6A   1 
HETATM 9939  C CBP   . COA G 3 .   ? -21.051 58.624  20.547  1.00 53.27 ? 991  COA B CBP   1 
HETATM 9940  C CCP   . COA G 3 .   ? -20.421 57.769  19.451  1.00 51.86 ? 991  COA B CCP   1 
HETATM 9941  C CDP   . COA G 3 .   ? -19.928 59.496  21.106  1.00 52.53 ? 991  COA B CDP   1 
HETATM 9942  C CEP   . COA G 3 .   ? -21.532 57.663  21.639  1.00 52.25 ? 991  COA B CEP   1 
HETATM 9943  C CAP   . COA G 3 .   ? -22.197 59.438  19.887  1.00 54.34 ? 991  COA B CAP   1 
HETATM 9944  O OAP   . COA G 3 .   ? -23.313 58.660  19.514  1.00 54.75 ? 991  COA B OAP   1 
HETATM 9945  C C9P   . COA G 3 .   ? -22.662 60.786  20.396  1.00 55.86 ? 991  COA B C9P   1 
HETATM 9946  O O9P   . COA G 3 .   ? -21.753 61.732  20.931  1.00 54.56 ? 991  COA B O9P   1 
HETATM 9947  N N8P   . COA G 3 .   ? -23.985 61.013  20.254  1.00 56.45 ? 991  COA B N8P   1 
HETATM 9948  C C7P   . COA G 3 .   ? -24.600 62.321  20.416  1.00 57.61 ? 991  COA B C7P   1 
HETATM 9949  C C6P   . COA G 3 .   ? -25.708 62.588  19.400  1.00 58.63 ? 991  COA B C6P   1 
HETATM 9950  C C5P   . COA G 3 .   ? -26.068 64.067  19.348  1.00 58.83 ? 991  COA B C5P   1 
HETATM 9951  O O5P   . COA G 3 .   ? -25.571 64.815  18.472  1.00 58.87 ? 991  COA B O5P   1 
HETATM 9952  N N4P   . COA G 3 .   ? -26.934 64.497  20.268  1.00 57.59 ? 991  COA B N4P   1 
HETATM 9953  C C3P   . COA G 3 .   ? -27.094 65.911  20.562  1.00 58.05 ? 991  COA B C3P   1 
HETATM 9954  C C2P   . COA G 3 .   ? -28.560 66.293  20.739  1.00 58.49 ? 991  COA B C2P   1 
HETATM 9955  S S1P   . COA G 3 .   ? -29.464 66.366  19.167  1.00 58.17 ? 991  COA B S1P   1 
HETATM 9956  P P     . AMP H 4 .   ? -36.043 66.930  18.664  1.00 20.51 ? 998  AMP B P     1 
HETATM 9957  O O1P   . AMP H 4 .   ? -37.291 67.542  18.033  1.00 20.12 ? 998  AMP B O1P   1 
HETATM 9958  O O2P   . AMP H 4 .   ? -35.324 65.914  17.776  1.00 20.26 ? 998  AMP B O2P   1 
HETATM 9959  O O3P   . AMP H 4 .   ? -35.173 68.022  19.222  1.00 20.12 ? 998  AMP B O3P   1 
HETATM 9960  O "O5'" . AMP H 4 .   ? -36.547 66.039  19.925  1.00 17.26 ? 998  AMP B "O5'" 1 
HETATM 9961  C "C5'" . AMP H 4 .   ? -37.262 66.598  21.033  1.00 17.06 ? 998  AMP B "C5'" 1 
HETATM 9962  C "C4'" . AMP H 4 .   ? -37.517 65.520  22.089  1.00 16.76 ? 998  AMP B "C4'" 1 
HETATM 9963  O "O4'" . AMP H 4 .   ? -36.307 65.068  22.720  1.00 14.42 ? 998  AMP B "O4'" 1 
HETATM 9964  C "C3'" . AMP H 4 .   ? -38.403 65.985  23.247  1.00 17.30 ? 998  AMP B "C3'" 1 
HETATM 9965  O "O3'" . AMP H 4 .   ? -39.813 65.879  22.977  1.00 20.84 ? 998  AMP B "O3'" 1 
HETATM 9966  C "C2'" . AMP H 4 .   ? -37.982 65.055  24.381  1.00 16.06 ? 998  AMP B "C2'" 1 
HETATM 9967  O "O2'" . AMP H 4 .   ? -38.517 63.737  24.246  1.00 17.62 ? 998  AMP B "O2'" 1 
HETATM 9968  C "C1'" . AMP H 4 .   ? -36.509 64.873  24.145  1.00 13.26 ? 998  AMP B "C1'" 1 
HETATM 9969  N N9    . AMP H 4 .   ? -35.783 65.879  24.954  1.00 11.89 ? 998  AMP B N9    1 
HETATM 9970  C C8    . AMP H 4 .   ? -35.209 66.979  24.437  1.00 12.49 ? 998  AMP B C8    1 
HETATM 9971  N N7    . AMP H 4 .   ? -34.599 67.722  25.406  1.00 12.30 ? 998  AMP B N7    1 
HETATM 9972  C C5    . AMP H 4 .   ? -34.778 67.102  26.576  1.00 10.43 ? 998  AMP B C5    1 
HETATM 9973  C C6    . AMP H 4 .   ? -34.373 67.365  27.966  1.00 10.68 ? 998  AMP B C6    1 
HETATM 9974  N N6    . AMP H 4 .   ? -33.658 68.451  28.336  1.00 11.82 ? 998  AMP B N6    1 
HETATM 9975  N N1    . AMP H 4 .   ? -34.753 66.484  28.888  1.00 12.36 ? 998  AMP B N1    1 
HETATM 9976  C C2    . AMP H 4 .   ? -35.473 65.400  28.551  1.00 13.43 ? 998  AMP B C2    1 
HETATM 9977  N N3    . AMP H 4 .   ? -35.856 65.079  27.300  1.00 13.40 ? 998  AMP B N3    1 
HETATM 9978  C C4    . AMP H 4 .   ? -35.557 65.892  26.269  1.00 11.53 ? 998  AMP B C4    1 
HETATM 9979  O O     . HOH I 5 .   ? -14.978 13.783  0.347   1.00 17.66 ? 1000 HOH A O     1 
HETATM 9980  O O     . HOH I 5 .   ? -13.618 24.410  -4.320  1.00 7.48  ? 1001 HOH A O     1 
HETATM 9981  O O     . HOH I 5 .   ? -3.981  23.734  -1.700  1.00 3.35  ? 1002 HOH A O     1 
HETATM 9982  O O     . HOH I 5 .   ? -5.060  12.660  -3.540  1.00 15.01 ? 1003 HOH A O     1 
HETATM 9983  O O     . HOH I 5 .   ? 9.376   3.981   17.807  1.00 19.78 ? 1004 HOH A O     1 
HETATM 9984  O O     . HOH I 5 .   ? 27.116  20.329  16.433  1.00 22.27 ? 1005 HOH A O     1 
HETATM 9985  O O     . HOH I 5 .   ? 9.716   7.784   24.977  1.00 14.36 ? 1006 HOH A O     1 
HETATM 9986  O O     . HOH I 5 .   ? 15.504  12.569  21.721  1.00 6.84  ? 1007 HOH A O     1 
HETATM 9987  O O     . HOH I 5 .   ? 20.213  23.902  11.551  1.00 5.79  ? 1008 HOH A O     1 
HETATM 9988  O O     . HOH I 5 .   ? 15.227  24.355  1.642   1.00 12.83 ? 1009 HOH A O     1 
HETATM 9989  O O     . HOH I 5 .   ? 5.054   42.117  21.429  1.00 7.02  ? 1010 HOH A O     1 
HETATM 9990  O O     . HOH I 5 .   ? 0.144   46.735  15.512  1.00 19.91 ? 1011 HOH A O     1 
HETATM 9991  O O     . HOH I 5 .   ? 1.799   49.324  14.903  1.00 7.63  ? 1012 HOH A O     1 
HETATM 9992  O O     . HOH I 5 .   ? 18.138  28.446  16.931  1.00 5.09  ? 1013 HOH A O     1 
HETATM 9993  O O     . HOH I 5 .   ? 8.134   34.168  23.228  1.00 6.62  ? 1014 HOH A O     1 
HETATM 9994  O O     . HOH I 5 .   ? 6.030   35.914  27.185  1.00 14.86 ? 1015 HOH A O     1 
HETATM 9995  O O     . HOH I 5 .   ? 4.325   48.467  37.806  1.00 22.08 ? 1016 HOH A O     1 
HETATM 9996  O O     . HOH I 5 .   ? 16.580  46.703  35.534  1.00 11.99 ? 1017 HOH A O     1 
HETATM 9997  O O     . HOH I 5 .   ? 14.442  53.279  15.377  1.00 2.00  ? 1018 HOH A O     1 
HETATM 9998  O O     . HOH I 5 .   ? 13.810  18.835  20.599  1.00 8.05  ? 1019 HOH A O     1 
HETATM 9999  O O     . HOH I 5 .   ? 3.430   36.314  36.021  1.00 20.75 ? 1020 HOH A O     1 
HETATM 10000 O O     . HOH I 5 .   ? 8.879   22.462  22.751  1.00 2.00  ? 1021 HOH A O     1 
HETATM 10001 O O     . HOH I 5 .   ? 10.829  21.436  21.170  1.00 4.43  ? 1022 HOH A O     1 
HETATM 10002 O O     . HOH I 5 .   ? 5.269   23.056  17.348  1.00 12.35 ? 1023 HOH A O     1 
HETATM 10003 O O     . HOH I 5 .   ? -4.981  17.132  3.233   1.00 11.63 ? 1024 HOH A O     1 
HETATM 10004 O O     . HOH I 5 .   ? 0.445   35.363  8.242   1.00 3.40  ? 1025 HOH A O     1 
HETATM 10005 O O     . HOH I 5 .   ? -1.731  39.372  10.385  1.00 14.78 ? 1026 HOH A O     1 
HETATM 10006 O O     . HOH I 5 .   ? -13.552 41.407  5.528   1.00 13.29 ? 1027 HOH A O     1 
HETATM 10007 O O     . HOH I 5 .   ? -11.058 44.290  -2.869  1.00 16.76 ? 1028 HOH A O     1 
HETATM 10008 O O     . HOH I 5 .   ? -10.117 33.223  18.891  1.00 29.01 ? 1029 HOH A O     1 
HETATM 10009 O O     . HOH I 5 .   ? -22.102 37.708  14.712  1.00 10.55 ? 1030 HOH A O     1 
HETATM 10010 O O     . HOH I 5 .   ? -25.243 31.754  15.510  1.00 19.00 ? 1031 HOH A O     1 
HETATM 10011 O O     . HOH I 5 .   ? -13.164 32.763  -1.556  1.00 11.45 ? 1032 HOH A O     1 
HETATM 10012 O O     . HOH I 5 .   ? -15.199 22.537  1.716   1.00 6.23  ? 1033 HOH A O     1 
HETATM 10013 O O     . HOH I 5 .   ? -22.479 14.310  11.908  1.00 27.43 ? 1034 HOH A O     1 
HETATM 10014 O O     . HOH I 5 .   ? -5.218  15.638  11.983  1.00 7.08  ? 1035 HOH A O     1 
HETATM 10015 O O     . HOH I 5 .   ? -7.409  8.842   13.502  1.00 16.05 ? 1036 HOH A O     1 
HETATM 10016 O O     . HOH I 5 .   ? -16.628 15.553  31.555  1.00 20.09 ? 1037 HOH A O     1 
HETATM 10017 O O     . HOH I 5 .   ? -2.858  14.955  34.173  1.00 5.32  ? 1038 HOH A O     1 
HETATM 10018 O O     . HOH I 5 .   ? -14.519 21.159  18.060  1.00 6.58  ? 1039 HOH A O     1 
HETATM 10019 O O     . HOH I 5 .   ? -11.014 31.360  40.556  1.00 25.13 ? 1040 HOH A O     1 
HETATM 10020 O O     . HOH I 5 .   ? -3.292  32.982  28.743  1.00 5.41  ? 1041 HOH A O     1 
HETATM 10021 O O     . HOH I 5 .   ? -12.945 54.980  20.765  1.00 25.00 ? 1042 HOH A O     1 
HETATM 10022 O O     . HOH I 5 .   ? 20.003  27.915  26.737  1.00 9.61  ? 1043 HOH A O     1 
HETATM 10023 O O     . HOH I 5 .   ? 18.915  28.384  24.314  1.00 7.16  ? 1044 HOH A O     1 
HETATM 10024 O O     . HOH I 5 .   ? -2.673  26.633  36.737  1.00 22.26 ? 1045 HOH A O     1 
HETATM 10025 O O     . HOH I 5 .   ? -5.030  22.321  33.923  1.00 14.39 ? 1046 HOH A O     1 
HETATM 10026 O O     . HOH I 5 .   ? -3.481  40.552  12.025  1.00 12.68 ? 1047 HOH A O     1 
HETATM 10027 O O     . HOH I 5 .   ? -6.165  46.240  2.807   1.00 18.72 ? 1048 HOH A O     1 
HETATM 10028 O O     . HOH I 5 .   ? -8.961  37.140  -3.655  1.00 14.42 ? 1049 HOH A O     1 
HETATM 10029 O O     . HOH I 5 .   ? -6.493  32.092  -8.017  1.00 15.92 ? 1050 HOH A O     1 
HETATM 10030 O O     . HOH I 5 .   ? -11.731 27.439  15.940  1.00 9.36  ? 1051 HOH A O     1 
HETATM 10031 O O     . HOH I 5 .   ? -19.571 30.959  17.037  1.00 21.81 ? 1052 HOH A O     1 
HETATM 10032 O O     . HOH I 5 .   ? -21.641 33.237  16.221  1.00 28.23 ? 1053 HOH A O     1 
HETATM 10033 O O     . HOH I 5 .   ? -23.922 22.196  9.197   1.00 15.29 ? 1054 HOH A O     1 
HETATM 10034 O O     . HOH I 5 .   ? -23.993 37.916  5.364   1.00 18.56 ? 1055 HOH A O     1 
HETATM 10035 O O     . HOH I 5 .   ? -14.700 20.403  10.906  1.00 8.01  ? 1056 HOH A O     1 
HETATM 10036 O O     . HOH I 5 .   ? -12.207 11.472  4.273   1.00 13.85 ? 1057 HOH A O     1 
HETATM 10037 O O     . HOH I 5 .   ? 0.430   11.901  21.567  1.00 14.50 ? 1058 HOH A O     1 
HETATM 10038 O O     . HOH I 5 .   ? -16.902 12.673  35.846  1.00 20.75 ? 1059 HOH A O     1 
HETATM 10039 O O     . HOH I 5 .   ? -0.626  6.086   24.811  1.00 15.02 ? 1060 HOH A O     1 
HETATM 10040 O O     . HOH I 5 .   ? 12.396  24.079  34.286  1.00 11.36 ? 1061 HOH A O     1 
HETATM 10041 O O     . HOH I 5 .   ? 10.968  22.952  39.985  1.00 17.43 ? 1062 HOH A O     1 
HETATM 10042 O O     . HOH I 5 .   ? -13.562 29.037  29.527  1.00 11.99 ? 1063 HOH A O     1 
HETATM 10043 O O     . HOH I 5 .   ? -13.648 32.526  23.467  1.00 28.02 ? 1064 HOH A O     1 
HETATM 10044 O O     . HOH I 5 .   ? -4.578  34.849  22.638  1.00 18.57 ? 1065 HOH A O     1 
HETATM 10045 O O     . HOH I 5 .   ? -6.306  46.641  48.205  1.00 20.17 ? 1066 HOH A O     1 
HETATM 10046 O O     . HOH I 5 .   ? -8.416  45.050  48.736  1.00 5.74  ? 1067 HOH A O     1 
HETATM 10047 O O     . HOH I 5 .   ? -8.588  43.018  50.375  1.00 17.79 ? 1068 HOH A O     1 
HETATM 10048 O O     . HOH I 5 .   ? 9.889   58.619  18.540  1.00 23.99 ? 1069 HOH A O     1 
HETATM 10049 O O     . HOH I 5 .   ? -14.541 20.405  2.687   1.00 14.90 ? 1070 HOH A O     1 
HETATM 10050 O O     . HOH I 5 .   ? -9.398  9.113   7.292   1.00 15.18 ? 1071 HOH A O     1 
HETATM 10051 O O     . HOH I 5 .   ? 20.109  25.265  6.987   1.00 22.07 ? 1072 HOH A O     1 
HETATM 10052 O O     . HOH I 5 .   ? 23.294  26.618  10.019  1.00 9.21  ? 1073 HOH A O     1 
HETATM 10053 O O     . HOH I 5 .   ? 4.134   8.041   29.157  1.00 27.23 ? 1074 HOH A O     1 
HETATM 10054 O O     . HOH I 5 .   ? 17.576  27.927  -1.045  1.00 7.88  ? 1075 HOH A O     1 
HETATM 10055 O O     . HOH I 5 .   ? 7.769   36.301  -4.084  1.00 14.56 ? 1076 HOH A O     1 
HETATM 10056 O O     . HOH I 5 .   ? -6.160  51.835  5.946   1.00 14.91 ? 1077 HOH A O     1 
HETATM 10057 O O     . HOH I 5 .   ? 1.877   46.043  -0.875  1.00 12.75 ? 1078 HOH A O     1 
HETATM 10058 O O     . HOH I 5 .   ? 24.515  46.799  19.656  1.00 22.06 ? 1079 HOH A O     1 
HETATM 10059 O O     . HOH I 5 .   ? 7.353   49.144  10.566  1.00 22.76 ? 1080 HOH A O     1 
HETATM 10060 O O     . HOH I 5 .   ? 17.601  27.832  19.525  1.00 8.69  ? 1081 HOH A O     1 
HETATM 10061 O O     . HOH I 5 .   ? 17.242  29.774  21.605  1.00 5.33  ? 1082 HOH A O     1 
HETATM 10062 O O     . HOH I 5 .   ? -6.888  48.221  10.665  1.00 10.11 ? 1083 HOH A O     1 
HETATM 10063 O O     . HOH I 5 .   ? 4.928   55.581  24.445  1.00 17.01 ? 1084 HOH A O     1 
HETATM 10064 O O     . HOH I 5 .   ? 11.559  53.752  33.516  1.00 19.26 ? 1085 HOH A O     1 
HETATM 10065 O O     . HOH J 5 .   ? -23.100 73.107  44.384  1.00 17.92 ? 999  HOH B O     1 
HETATM 10066 O O     . HOH J 5 .   ? -17.944 81.622  43.012  1.00 19.54 ? 1000 HOH B O     1 
HETATM 10067 O O     . HOH J 5 .   ? -50.183 91.327  25.146  1.00 15.96 ? 1001 HOH B O     1 
HETATM 10068 O O     . HOH J 5 .   ? -33.124 93.814  24.147  1.00 12.76 ? 1002 HOH B O     1 
HETATM 10069 O O     . HOH J 5 .   ? -53.211 86.111  19.902  1.00 14.65 ? 1003 HOH B O     1 
HETATM 10070 O O     . HOH J 5 .   ? -56.931 73.033  19.424  1.00 16.03 ? 1004 HOH B O     1 
HETATM 10071 O O     . HOH J 5 .   ? -57.162 71.412  14.183  1.00 27.14 ? 1005 HOH B O     1 
HETATM 10072 O O     . HOH J 5 .   ? -48.080 88.872  14.340  1.00 14.56 ? 1006 HOH B O     1 
HETATM 10073 O O     . HOH J 5 .   ? -22.066 96.565  10.959  1.00 24.93 ? 1007 HOH B O     1 
HETATM 10074 O O     . HOH J 5 .   ? -11.953 86.865  18.448  1.00 12.10 ? 1008 HOH B O     1 
HETATM 10075 O O     . HOH J 5 .   ? -4.536  73.316  14.898  1.00 12.81 ? 1009 HOH B O     1 
HETATM 10076 O O     . HOH J 5 .   ? -14.216 84.870  2.705   1.00 29.85 ? 1010 HOH B O     1 
HETATM 10077 O O     . HOH J 5 .   ? -12.662 72.747  6.289   1.00 23.07 ? 1011 HOH B O     1 
HETATM 10078 O O     . HOH J 5 .   ? -33.026 79.476  4.563   1.00 13.07 ? 1012 HOH B O     1 
HETATM 10079 O O     . HOH J 5 .   ? -32.939 72.870  7.666   1.00 14.21 ? 1013 HOH B O     1 
HETATM 10080 O O     . HOH J 5 .   ? -33.952 65.666  8.341   1.00 9.88  ? 1014 HOH B O     1 
HETATM 10081 O O     . HOH J 5 .   ? -30.394 54.039  0.723   1.00 13.44 ? 1015 HOH B O     1 
HETATM 10082 O O     . HOH J 5 .   ? -16.039 66.119  7.909   1.00 8.42  ? 1016 HOH B O     1 
HETATM 10083 O O     . HOH J 5 .   ? -18.287 65.860  10.126  1.00 16.02 ? 1017 HOH B O     1 
HETATM 10084 O O     . HOH J 5 .   ? -9.621  55.632  7.243   1.00 18.44 ? 1018 HOH B O     1 
HETATM 10085 O O     . HOH J 5 .   ? -24.697 95.597  -1.639  1.00 14.81 ? 1019 HOH B O     1 
HETATM 10086 O O     . HOH J 5 .   ? -41.464 60.029  11.607  1.00 18.97 ? 1020 HOH B O     1 
HETATM 10087 O O     . HOH J 5 .   ? -40.947 79.975  13.502  1.00 4.92  ? 1021 HOH B O     1 
HETATM 10088 O O     . HOH J 5 .   ? -40.686 82.384  13.535  1.00 3.01  ? 1022 HOH B O     1 
HETATM 10089 O O     . HOH J 5 .   ? -36.274 79.895  18.370  1.00 21.16 ? 1023 HOH B O     1 
HETATM 10090 O O     . HOH J 5 .   ? -19.303 71.111  17.556  1.00 9.66  ? 1024 HOH B O     1 
HETATM 10091 O O     . HOH J 5 .   ? -21.662 65.802  14.375  1.00 13.22 ? 1025 HOH B O     1 
HETATM 10092 O O     . HOH J 5 .   ? -7.608  62.259  22.223  1.00 8.43  ? 1026 HOH B O     1 
HETATM 10093 O O     . HOH J 5 .   ? -13.306 64.502  27.426  1.00 2.74  ? 1027 HOH B O     1 
HETATM 10094 O O     . HOH J 5 .   ? -8.716  68.865  19.923  1.00 17.45 ? 1028 HOH B O     1 
HETATM 10095 O O     . HOH J 5 .   ? -14.919 59.553  36.855  1.00 6.15  ? 1029 HOH B O     1 
HETATM 10096 O O     . HOH J 5 .   ? -12.095 56.300  36.483  1.00 10.99 ? 1030 HOH B O     1 
HETATM 10097 O O     . HOH J 5 .   ? -5.007  64.577  34.544  1.00 26.34 ? 1031 HOH B O     1 
HETATM 10098 O O     . HOH J 5 .   ? -14.511 75.718  36.091  1.00 9.78  ? 1032 HOH B O     1 
HETATM 10099 O O     . HOH J 5 .   ? -46.454 79.404  26.427  1.00 11.31 ? 1033 HOH B O     1 
HETATM 10100 O O     . HOH J 5 .   ? -49.748 60.470  32.626  1.00 24.92 ? 1034 HOH B O     1 
HETATM 10101 O O     . HOH J 5 .   ? -59.118 68.133  24.427  1.00 18.09 ? 1035 HOH B O     1 
HETATM 10102 O O     . HOH J 5 .   ? -42.214 42.436  2.848   1.00 2.00  ? 1036 HOH B O     1 
HETATM 10103 O O     . HOH J 5 .   ? -46.132 45.105  10.410  1.00 18.14 ? 1037 HOH B O     1 
HETATM 10104 O O     . HOH J 5 .   ? -48.532 43.867  11.385  1.00 14.94 ? 1038 HOH B O     1 
HETATM 10105 O O     . HOH J 5 .   ? -41.414 34.492  11.479  1.00 11.75 ? 1039 HOH B O     1 
HETATM 10106 O O     . HOH J 5 .   ? -46.109 35.112  4.342   1.00 8.97  ? 1040 HOH B O     1 
HETATM 10107 O O     . HOH J 5 .   ? -31.533 31.771  13.761  1.00 11.67 ? 1041 HOH B O     1 
HETATM 10108 O O     . HOH J 5 .   ? -26.551 38.837  5.335   1.00 15.95 ? 1042 HOH B O     1 
HETATM 10109 O O     . HOH J 5 .   ? -23.975 44.464  16.007  1.00 18.56 ? 1043 HOH B O     1 
HETATM 10110 O O     . HOH J 5 .   ? -54.898 79.848  21.962  1.00 18.07 ? 1044 HOH B O     1 
HETATM 10111 O O     . HOH J 5 .   ? -17.872 70.300  -14.173 1.00 15.93 ? 1045 HOH B O     1 
HETATM 10112 O O     . HOH J 5 .   ? -8.858  62.458  10.814  1.00 14.93 ? 1046 HOH B O     1 
HETATM 10113 O O     . HOH J 5 .   ? -15.372 78.879  4.803   1.00 17.08 ? 1047 HOH B O     1 
HETATM 10114 O O     . HOH J 5 .   ? -26.003 68.324  6.891   1.00 5.70  ? 1048 HOH B O     1 
HETATM 10115 O O     . HOH J 5 .   ? -12.469 71.537  2.557   1.00 21.00 ? 1049 HOH B O     1 
HETATM 10116 O O     . HOH J 5 .   ? -31.502 66.624  9.231   1.00 16.26 ? 1050 HOH B O     1 
HETATM 10117 O O     . HOH J 5 .   ? -23.929 58.086  5.806   1.00 15.22 ? 1051 HOH B O     1 
HETATM 10118 O O     . HOH J 5 .   ? -27.447 57.657  10.882  1.00 36.40 ? 1052 HOH B O     1 
HETATM 10119 O O     . HOH J 5 .   ? -36.192 58.634  7.008   1.00 18.13 ? 1053 HOH B O     1 
HETATM 10120 O O     . HOH J 5 .   ? -38.934 61.311  4.072   1.00 15.99 ? 1054 HOH B O     1 
HETATM 10121 O O     . HOH J 5 .   ? -26.952 53.288  -2.532  1.00 14.13 ? 1055 HOH B O     1 
HETATM 10122 O O     . HOH J 5 .   ? -33.663 65.806  -10.409 1.00 17.25 ? 1056 HOH B O     1 
HETATM 10123 O O     . HOH J 5 .   ? -31.648 89.320  0.146   1.00 19.62 ? 1057 HOH B O     1 
HETATM 10124 O O     . HOH J 5 .   ? -42.071 85.607  13.008  1.00 6.10  ? 1058 HOH B O     1 
HETATM 10125 O O     . HOH J 5 .   ? -20.808 75.854  19.345  1.00 17.91 ? 1059 HOH B O     1 
HETATM 10126 O O     . HOH J 5 .   ? -13.251 62.893  16.816  1.00 10.70 ? 1060 HOH B O     1 
HETATM 10127 O O     . HOH J 5 .   ? -5.141  62.038  21.357  1.00 9.31  ? 1061 HOH B O     1 
HETATM 10128 O O     . HOH J 5 .   ? -21.198 83.613  32.738  1.00 5.18  ? 1062 HOH B O     1 
HETATM 10129 O O     . HOH J 5 .   ? -30.804 66.979  29.053  1.00 11.27 ? 1063 HOH B O     1 
HETATM 10130 O O     . HOH J 5 .   ? -33.804 64.354  21.057  1.00 10.15 ? 1064 HOH B O     1 
HETATM 10131 O O     . HOH J 5 .   ? -28.704 59.627  31.932  1.00 22.60 ? 1065 HOH B O     1 
HETATM 10132 O O     . HOH J 5 .   ? -22.167 60.464  39.584  1.00 15.76 ? 1066 HOH B O     1 
HETATM 10133 O O     . HOH J 5 .   ? -7.179  72.042  38.328  1.00 14.21 ? 1067 HOH B O     1 
HETATM 10134 O O     . HOH J 5 .   ? -36.280 67.121  33.704  1.00 2.00  ? 1068 HOH B O     1 
HETATM 10135 O O     . HOH J 5 .   ? -50.251 73.178  4.008   1.00 17.03 ? 1069 HOH B O     1 
HETATM 10136 O O     . HOH J 5 .   ? -53.529 70.919  4.939   1.00 14.40 ? 1070 HOH B O     1 
HETATM 10137 O O     . HOH J 5 .   ? -41.409 52.004  22.504  1.00 18.38 ? 1071 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PRO 197 197 197 PRO PRO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 TYR 284 284 284 TYR TYR A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 THR 287 287 287 THR THR A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 TYR 291 291 291 TYR TYR A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 ASP 294 294 294 ASP ASP A . n 
A 1 295 TYR 295 295 295 TYR TYR A . n 
A 1 296 HIS 296 296 296 HIS HIS A . n 
A 1 297 PRO 297 297 297 PRO PRO A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ILE 300 300 300 ILE ILE A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 TRP 302 302 302 TRP TRP A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 THR 304 304 304 THR THR A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 HIS 313 313 313 HIS HIS A . n 
A 1 314 SER 314 314 314 SER SER A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ALA 322 322 322 ALA ALA A . n 
A 1 323 CYS 323 323 323 CYS CYS A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 ALA 325 325 325 ALA ALA A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 MET 329 329 329 MET MET A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 VAL 333 333 333 VAL VAL A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 TRP 336 336 336 TRP TRP A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 MET 342 342 342 MET MET A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 GLN 344 344 344 GLN GLN A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 ASP 347 347 347 ASP ASP A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 HIS 349 349 349 HIS HIS A . n 
A 1 350 GLN 350 350 350 GLN GLN A . n 
A 1 351 VAL 351 351 351 VAL VAL A . n 
A 1 352 ASN 352 352 352 ASN ASN A . n 
A 1 353 ILE 353 353 353 ILE ILE A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 PRO 358 358 358 PRO PRO A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 ARG 362 362 362 ARG ARG A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 MET 365 365 365 MET MET A . n 
A 1 366 ALA 366 366 366 ALA ALA A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 LYS 370 370 370 LYS LYS A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 THR 375 375 375 THR THR A . n 
A 1 376 ASP 376 376 376 ASP ASP A . n 
A 1 377 ARG 377 377 377 ARG ARG A . n 
A 1 378 SER 378 378 378 SER SER A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ARG 381 381 381 ARG ARG A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 LEU 383 383 383 LEU LEU A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 VAL 386 386 386 VAL VAL A . n 
A 1 387 GLY 387 387 387 GLY GLY A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ILE 390 390 390 ILE ILE A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 TRP 395 395 395 TRP TRP A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 TRP 397 397 397 TRP TRP A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 TRP 399 399 399 TRP TRP A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 LYS 404 404 404 LYS LYS A . n 
A 1 405 GLU 405 405 405 GLU GLU A . n 
A 1 406 LYS 406 406 406 LYS LYS A . n 
A 1 407 CYS 407 407 407 CYS CYS A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 TRP 413 413 413 TRP TRP A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 THR 416 416 416 THR THR A . n 
A 1 417 GLU 417 417 417 GLU GLU A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 GLY 419 419 419 GLY GLY A . n 
A 1 420 GLY 420 420 420 GLY GLY A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 MET 422 422 422 MET MET A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 THR 424 424 424 THR THR A . n 
A 1 425 PRO 425 425 425 PRO PRO A . n 
A 1 426 LEU 426 426 426 LEU LEU A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 ALA 429 429 429 ALA ALA A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 LEU 432 432 432 LEU LEU A . n 
A 1 433 LYS 433 433 433 LYS LYS A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 SER 436 436 436 SER SER A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 ARG 439 439 439 ARG ARG A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 PHE 441 441 441 PHE PHE A . n 
A 1 442 PHE 442 442 442 PHE PHE A . n 
A 1 443 GLY 443 443 443 GLY GLY A . n 
A 1 444 VAL 444 444 444 VAL VAL A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASN 451 451 451 ASN ASN A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 HIS 454 454 454 HIS HIS A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 GLN 456 456 456 GLN GLN A . n 
A 1 457 GLU 457 457 457 GLU GLU A . n 
A 1 458 GLY 458 458 458 GLY GLY A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ASN 463 463 463 ASN ASN A . n 
A 1 464 LEU 464 464 464 LEU LEU A . n 
A 1 465 VAL 465 465 465 VAL VAL A . n 
A 1 466 ILE 466 466 466 ILE ILE A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 SER 469 469 469 SER SER A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 PRO 471 471 471 PRO PRO A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 GLN 473 473 473 GLN GLN A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 GLY 479 479 479 GLY GLY A . n 
A 1 480 ASP 480 480 480 ASP ASP A . n 
A 1 481 HIS 481 481 481 HIS HIS A . n 
A 1 482 GLU 482 482 482 GLU GLU A . n 
A 1 483 ARG 483 483 483 ARG ARG A . n 
A 1 484 PHE 484 484 484 PHE PHE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 GLN 486 486 486 GLN GLN A . n 
A 1 487 THR 487 487 487 THR THR A . n 
A 1 488 TYR 488 488 488 TYR TYR A . n 
A 1 489 PHE 489 489 489 PHE PHE A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 THR 491 491 491 THR THR A . n 
A 1 492 PHE 492 492 492 PHE PHE A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 MET 495 495 495 MET MET A . n 
A 1 496 TYR 496 496 496 TYR TYR A . n 
A 1 497 PHE 497 497 497 PHE PHE A . n 
A 1 498 SER 498 498 498 SER SER A . n 
A 1 499 GLY 499 499 499 GLY GLY A . n 
A 1 500 ASP 500 500 500 ASP ASP A . n 
A 1 501 GLY 501 501 501 GLY GLY A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 ARG 504 504 504 ARG ARG A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 GLU 506 506 506 GLU GLU A . n 
A 1 507 ASP 507 507 507 ASP ASP A . n 
A 1 508 GLY 508 508 508 GLY GLY A . n 
A 1 509 TYR 509 509 509 TYR TYR A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 TRP 511 511 511 TRP TRP A . n 
A 1 512 ILE 512 512 512 ILE ILE A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ASP 517 517 517 ASP ASP A . n 
A 1 518 ASP 518 518 518 ASP ASP A . n 
A 1 519 VAL 519 519 519 VAL VAL A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 SER 523 523 523 SER SER A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 HIS 525 525 525 HIS HIS A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 LEU 527 527 527 LEU LEU A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 THR 529 529 529 THR THR A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 GLU 531 531 531 GLU GLU A . n 
A 1 532 ILE 532 532 532 ILE ILE A . n 
A 1 533 GLU 533 533 533 GLU GLU A . n 
A 1 534 SER 534 534 534 SER SER A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 VAL 537 537 537 VAL VAL A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 PRO 540 540 540 PRO PRO A . n 
A 1 541 LYS 541 541 541 LYS LYS A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 GLU 544 544 544 GLU GLU A . n 
A 1 545 ALA 545 545 545 ALA ALA A . n 
A 1 546 ALA 546 546 546 ALA ALA A . n 
A 1 547 VAL 547 547 547 VAL VAL A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 ILE 550 550 550 ILE ILE A . n 
A 1 551 PRO 551 551 551 PRO PRO A . n 
A 1 552 HIS 552 552 552 HIS HIS A . n 
A 1 553 ALA 553 553 553 ALA ALA A . n 
A 1 554 ILE 554 554 554 ILE ILE A . n 
A 1 555 LYS 555 555 555 LYS LYS A . n 
A 1 556 GLY 556 556 556 GLY GLY A . n 
A 1 557 GLN 557 557 557 GLN GLN A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 TYR 560 560 560 TYR TYR A . n 
A 1 561 ALA 561 561 561 ALA ALA A . n 
A 1 562 TYR 562 562 562 TYR TYR A . n 
A 1 563 VAL 563 563 563 VAL VAL A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 ASN 566 566 566 ASN ASN A . n 
A 1 567 HIS 567 567 567 HIS HIS A . n 
A 1 568 GLY 568 568 568 GLY GLY A . n 
A 1 569 GLU 569 569 569 GLU GLU A . n 
A 1 570 GLU 570 570 570 GLU GLU A . n 
A 1 571 PRO 571 571 571 PRO PRO A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 PRO 573 573 573 PRO PRO A . n 
A 1 574 GLU 574 574 574 GLU GLU A . n 
A 1 575 LEU 575 575 575 LEU LEU A . n 
A 1 576 TYR 576 576 576 TYR TYR A . n 
A 1 577 ALA 577 577 577 ALA ALA A . n 
A 1 578 GLU 578 578 578 GLU GLU A . n 
A 1 579 VAL 579 579 579 VAL VAL A . n 
A 1 580 ARG 580 580 580 ARG ARG A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 TRP 582 582 582 TRP TRP A . n 
A 1 583 VAL 583 583 583 VAL VAL A . n 
A 1 584 ARG 584 584 584 ARG ARG A . n 
A 1 585 LYS 585 585 585 LYS LYS A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 ILE 587 587 587 ILE ILE A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 ALA 591 591 591 ALA ALA A . n 
A 1 592 THR 592 592 592 THR THR A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 ASP 594 594 594 ASP ASP A . n 
A 1 595 VAL 595 595 595 VAL VAL A . n 
A 1 596 LEU 596 596 596 LEU LEU A . n 
A 1 597 HIS 597 597 597 HIS HIS A . n 
A 1 598 TRP 598 598 598 TRP TRP A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASP 600 600 600 ASP ASP A . n 
A 1 601 SER 601 601 601 SER SER A . n 
A 1 602 LEU 602 602 602 LEU LEU A . n 
A 1 603 PRO 603 603 603 PRO PRO A . n 
A 1 604 LYS 604 604 604 LYS LYS A . n 
A 1 605 THR 605 605 605 THR THR A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 SER 607 607 607 SER SER A . n 
A 1 608 GLY 608 608 608 GLY GLY A . n 
A 1 609 LYS 609 609 609 LYS LYS A . n 
A 1 610 ILE 610 610 610 ILE ILE A . n 
A 1 611 MET 611 611 611 MET MET A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 ARG 613 613 613 ARG ARG A . n 
A 1 614 ILE 614 614 614 ILE ILE A . n 
A 1 615 LEU 615 615 615 LEU LEU A . n 
A 1 616 ARG 616 616 616 ARG ARG A . n 
A 1 617 LYS 617 617 617 LYS LYS A . n 
A 1 618 ILE 618 618 618 ILE ILE A . n 
A 1 619 ALA 619 619 619 ALA ALA A . n 
A 1 620 ALA 620 620 620 ALA ALA A . n 
A 1 621 GLY 621 621 621 GLY GLY A . n 
A 1 622 ASP 622 622 622 ASP ASP A . n 
A 1 623 THR 623 623 623 THR THR A . n 
A 1 624 SER 624 624 624 SER SER A . n 
A 1 625 ASN 625 625 ?   ?   ?   A . n 
A 1 626 LEU 626 626 ?   ?   ?   A . n 
A 1 627 GLY 627 627 ?   ?   ?   A . n 
A 1 628 ASP 628 628 ?   ?   ?   A . n 
A 1 629 THR 629 629 ?   ?   ?   A . n 
A 1 630 SER 630 630 630 SER SER A . n 
A 1 631 THR 631 631 631 THR THR A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 ALA 633 633 633 ALA ALA A . n 
A 1 634 ASP 634 634 634 ASP ASP A . n 
A 1 635 PRO 635 635 635 PRO PRO A . n 
A 1 636 GLY 636 636 636 GLY GLY A . n 
A 1 637 VAL 637 637 637 VAL VAL A . n 
A 1 638 VAL 638 638 638 VAL VAL A . n 
A 1 639 GLU 639 639 639 GLU GLU A . n 
A 1 640 LYS 640 640 640 LYS LYS A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 LEU 642 642 642 LEU LEU A . n 
A 1 643 GLU 643 643 643 GLU GLU A . n 
A 1 644 GLU 644 644 644 GLU GLU A . n 
A 1 645 LYS 645 645 645 LYS LYS A . n 
A 1 646 GLN 646 646 646 GLN GLN A . n 
A 1 647 ALA 647 647 647 ALA ALA A . n 
A 1 648 ILE 648 648 ?   ?   ?   A . n 
A 1 649 ALA 649 649 ?   ?   ?   A . n 
A 1 650 MET 650 650 ?   ?   ?   A . n 
A 1 651 PRO 651 651 ?   ?   ?   A . n 
A 1 652 SER 652 652 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   GLN 3   3   ?   ?   ?   B . n 
B 1 4   THR 4   4   ?   ?   ?   B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   HIS 7   7   7   HIS HIS B . n 
B 1 8   ALA 8   8   8   ALA ALA B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  PRO 10  10  10  PRO PRO B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  ASN 12  12  12  ASN ASN B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  ASP 15  15  15  ASP ASP B . n 
B 1 16  ARG 16  16  16  ARG ARG B . n 
B 1 17  CYS 17  17  17  CYS CYS B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  GLN 23  23  23  GLN GLN B . n 
B 1 24  TYR 24  24  24  TYR TYR B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  SER 31  31  31  SER SER B . n 
B 1 32  ILE 32  32  32  ILE ILE B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  ASP 34  34  34  ASP ASP B . n 
B 1 35  PRO 35  35  35  PRO PRO B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  PHE 38  38  38  PHE PHE B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  GLN 42  42  42  GLN GLN B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ASP 47  47  47  ASP ASP B . n 
B 1 48  TRP 48  48  48  TRP TRP B . n 
B 1 49  ILE 49  49  49  ILE ILE B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  PRO 51  51  51  PRO PRO B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  GLN 53  53  53  GLN GLN B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  LYS 56  56  56  LYS LYS B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  THR 58  58  58  THR THR B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  PHE 60  60  60  PHE PHE B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  TRP 69  69  69  TRP TRP B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  THR 74  74  74  THR THR B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  LEU 82  82  82  LEU LEU B . n 
B 1 83  ASP 83  83  83  ASP ASP B . n 
B 1 84  ARG 84  84  84  ARG ARG B . n 
B 1 85  HIS 85  85  85  HIS HIS B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  GLU 88  88  88  GLU GLU B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  THR 93  93  93  THR THR B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ILE 95  95  95  ILE ILE B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  TRP 97  97  97  TRP TRP B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 THR 102 102 102 THR THR B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 HIS 107 107 107 HIS HIS B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 HIS 114 114 114 HIS HIS B . n 
B 1 115 ARG 115 115 115 ARG ARG B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 CYS 118 118 118 CYS CYS B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASP 126 126 126 ASP ASP B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 ILE 137 137 137 ILE ILE B . n 
B 1 138 TYR 138 138 138 TYR TYR B . n 
B 1 139 MET 139 139 139 MET MET B . n 
B 1 140 PRO 140 140 140 PRO PRO B . n 
B 1 141 MET 141 141 141 MET MET B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 ALA 146 146 146 ALA ALA B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 CYS 152 152 152 CYS CYS B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 ILE 155 155 155 ILE ILE B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 SER 160 160 160 SER SER B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 ILE 162 162 162 ILE ILE B . n 
B 1 163 PHE 163 163 163 PHE PHE B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 PHE 166 166 166 PHE PHE B . n 
B 1 167 SER 167 167 167 SER SER B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLU 169 169 169 GLU GLU B . n 
B 1 170 ALA 170 170 170 ALA ALA B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 ARG 174 174 174 ARG ARG B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 ASP 177 177 177 ASP ASP B . n 
B 1 178 SER 178 178 178 SER SER B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 ILE 184 184 184 ILE ILE B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 ASP 187 187 187 ASP ASP B . n 
B 1 188 GLU 188 188 188 GLU GLU B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 PRO 197 197 197 PRO PRO B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 LYS 199 199 199 LYS LYS B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 ASN 201 201 201 ASN ASN B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ALA 205 205 205 ALA ALA B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 ASN 208 208 208 ASN ASN B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 ASN 210 210 210 ASN ASN B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 THR 212 212 212 THR THR B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 GLU 215 215 215 GLU GLU B . n 
B 1 216 HIS 216 216 216 HIS HIS B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 VAL 219 219 219 VAL VAL B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 LYS 221 221 221 LYS LYS B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 SER 225 225 225 SER SER B . n 
B 1 226 ASP 226 226 226 ASP ASP B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 ASP 228 228 228 ASP ASP B . n 
B 1 229 TRP 229 229 229 TRP TRP B . n 
B 1 230 GLN 230 230 230 GLN GLN B . n 
B 1 231 GLU 231 231 231 GLU GLU B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 LEU 235 235 235 LEU LEU B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 TRP 237 237 237 TRP TRP B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 LEU 240 240 240 LEU LEU B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 GLU 242 242 242 GLU GLU B . n 
B 1 243 LYS 243 243 243 LYS LYS B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 SER 245 245 245 SER SER B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 GLN 249 249 249 GLN GLN B . n 
B 1 250 PRO 250 250 250 PRO PRO B . n 
B 1 251 GLU 251 251 251 GLU GLU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 MET 253 253 253 MET MET B . n 
B 1 254 ASN 254 254 254 ASN ASN B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 ASP 257 257 257 ASP ASP B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 LEU 259 259 259 LEU LEU B . n 
B 1 260 PHE 260 260 260 PHE PHE B . n 
B 1 261 ILE 261 261 261 ILE ILE B . n 
B 1 262 LEU 262 262 262 LEU LEU B . n 
B 1 263 TYR 263 263 263 TYR TYR B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 SER 265 265 265 SER SER B . n 
B 1 266 GLY 266 266 266 GLY GLY B . n 
B 1 267 SER 267 267 267 SER SER B . n 
B 1 268 THR 268 268 268 THR THR B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 LYS 270 270 270 LYS LYS B . n 
B 1 271 PRO 271 271 271 PRO PRO B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 GLY 273 273 273 GLY GLY B . n 
B 1 274 VAL 274 274 274 VAL VAL B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 HIS 276 276 276 HIS HIS B . n 
B 1 277 THR 277 277 277 THR THR B . n 
B 1 278 THR 278 278 278 THR THR B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 TYR 281 281 281 TYR TYR B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 VAL 283 283 283 VAL VAL B . n 
B 1 284 TYR 284 284 284 TYR TYR B . n 
B 1 285 ALA 285 285 285 ALA ALA B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 THR 287 287 287 THR THR B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 PHE 289 289 289 PHE PHE B . n 
B 1 290 LYS 290 290 290 LYS LYS B . n 
B 1 291 TYR 291 291 291 TYR TYR B . n 
B 1 292 VAL 292 292 292 VAL VAL B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 ASP 294 294 294 ASP ASP B . n 
B 1 295 TYR 295 295 295 TYR TYR B . n 
B 1 296 HIS 296 296 296 HIS HIS B . n 
B 1 297 PRO 297 297 297 PRO PRO B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 ASP 299 299 299 ASP ASP B . n 
B 1 300 ILE 300 300 300 ILE ILE B . n 
B 1 301 TYR 301 301 301 TYR TYR B . n 
B 1 302 TRP 302 302 302 TRP TRP B . n 
B 1 303 CYS 303 303 303 CYS CYS B . n 
B 1 304 THR 304 304 304 THR THR B . n 
B 1 305 ALA 305 305 305 ALA ALA B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 VAL 307 307 307 VAL VAL B . n 
B 1 308 GLY 308 308 308 GLY GLY B . n 
B 1 309 TRP 309 309 309 TRP TRP B . n 
B 1 310 VAL 310 310 310 VAL VAL B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 GLY 312 312 312 GLY GLY B . n 
B 1 313 HIS 313 313 313 HIS HIS B . n 
B 1 314 SER 314 314 314 SER SER B . n 
B 1 315 TYR 315 315 315 TYR TYR B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 LEU 317 317 317 LEU LEU B . n 
B 1 318 TYR 318 318 318 TYR TYR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 ALA 322 322 322 ALA ALA B . n 
B 1 323 CYS 323 323 323 CYS CYS B . n 
B 1 324 GLY 324 324 324 GLY GLY B . n 
B 1 325 ALA 325 325 325 ALA ALA B . n 
B 1 326 THR 326 326 326 THR THR B . n 
B 1 327 THR 327 327 327 THR THR B . n 
B 1 328 LEU 328 328 328 LEU LEU B . n 
B 1 329 MET 329 329 329 MET MET B . n 
B 1 330 PHE 330 330 330 PHE PHE B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 VAL 333 333 333 VAL VAL B . n 
B 1 334 PRO 334 334 334 PRO PRO B . n 
B 1 335 ASN 335 335 335 ASN ASN B . n 
B 1 336 TRP 336 336 336 TRP TRP B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 THR 338 338 338 THR THR B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 ALA 340 340 340 ALA ALA B . n 
B 1 341 ARG 341 341 341 ARG ARG B . n 
B 1 342 MET 342 342 342 MET MET B . n 
B 1 343 CYS 343 343 343 CYS CYS B . n 
B 1 344 GLN 344 344 344 GLN GLN B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 VAL 346 346 346 VAL VAL B . n 
B 1 347 ASP 347 347 347 ASP ASP B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 HIS 349 349 349 HIS HIS B . n 
B 1 350 GLN 350 350 350 GLN GLN B . n 
B 1 351 VAL 351 351 351 VAL VAL B . n 
B 1 352 ASN 352 352 352 ASN ASN B . n 
B 1 353 ILE 353 353 353 ILE ILE B . n 
B 1 354 LEU 354 354 354 LEU LEU B . n 
B 1 355 TYR 355 355 355 TYR TYR B . n 
B 1 356 THR 356 356 356 THR THR B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 PRO 358 358 358 PRO PRO B . n 
B 1 359 THR 359 359 359 THR THR B . n 
B 1 360 ALA 360 360 360 ALA ALA B . n 
B 1 361 ILE 361 361 361 ILE ILE B . n 
B 1 362 ARG 362 362 362 ARG ARG B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 LEU 364 364 364 LEU LEU B . n 
B 1 365 MET 365 365 365 MET MET B . n 
B 1 366 ALA 366 366 366 ALA ALA B . n 
B 1 367 GLU 367 367 367 GLU GLU B . n 
B 1 368 GLY 368 368 368 GLY GLY B . n 
B 1 369 ASP 369 369 369 ASP ASP B . n 
B 1 370 LYS 370 370 370 LYS LYS B . n 
B 1 371 ALA 371 371 371 ALA ALA B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 GLU 373 373 373 GLU GLU B . n 
B 1 374 GLY 374 374 374 GLY GLY B . n 
B 1 375 THR 375 375 375 THR THR B . n 
B 1 376 ASP 376 376 376 ASP ASP B . n 
B 1 377 ARG 377 377 377 ARG ARG B . n 
B 1 378 SER 378 378 378 SER SER B . n 
B 1 379 SER 379 379 379 SER SER B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 ARG 381 381 381 ARG ARG B . n 
B 1 382 ILE 382 382 382 ILE ILE B . n 
B 1 383 LEU 383 383 383 LEU LEU B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 SER 385 385 385 SER SER B . n 
B 1 386 VAL 386 386 386 VAL VAL B . n 
B 1 387 GLY 387 387 387 GLY GLY B . n 
B 1 388 GLU 388 388 388 GLU GLU B . n 
B 1 389 PRO 389 389 389 PRO PRO B . n 
B 1 390 ILE 390 390 390 ILE ILE B . n 
B 1 391 ASN 391 391 391 ASN ASN B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 GLU 393 393 393 GLU GLU B . n 
B 1 394 ALA 394 394 394 ALA ALA B . n 
B 1 395 TRP 395 395 395 TRP TRP B . n 
B 1 396 GLU 396 396 396 GLU GLU B . n 
B 1 397 TRP 397 397 397 TRP TRP B . n 
B 1 398 TYR 398 398 398 TYR TYR B . n 
B 1 399 TRP 399 399 399 TRP TRP B . n 
B 1 400 LYS 400 400 400 LYS LYS B . n 
B 1 401 LYS 401 401 401 LYS LYS B . n 
B 1 402 ILE 402 402 402 ILE ILE B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 LYS 404 404 404 LYS LYS B . n 
B 1 405 GLU 405 405 405 GLU GLU B . n 
B 1 406 LYS 406 406 406 LYS LYS B . n 
B 1 407 CYS 407 407 407 CYS CYS B . n 
B 1 408 PRO 408 408 408 PRO PRO B . n 
B 1 409 VAL 409 409 409 VAL VAL B . n 
B 1 410 VAL 410 410 410 VAL VAL B . n 
B 1 411 ASP 411 411 411 ASP ASP B . n 
B 1 412 THR 412 412 412 THR THR B . n 
B 1 413 TRP 413 413 413 TRP TRP B . n 
B 1 414 TRP 414 414 414 TRP TRP B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 THR 416 416 416 THR THR B . n 
B 1 417 GLU 417 417 417 GLU GLU B . n 
B 1 418 THR 418 418 418 THR THR B . n 
B 1 419 GLY 419 419 419 GLY GLY B . n 
B 1 420 GLY 420 420 420 GLY GLY B . n 
B 1 421 PHE 421 421 421 PHE PHE B . n 
B 1 422 MET 422 422 422 MET MET B . n 
B 1 423 ILE 423 423 423 ILE ILE B . n 
B 1 424 THR 424 424 424 THR THR B . n 
B 1 425 PRO 425 425 425 PRO PRO B . n 
B 1 426 LEU 426 426 426 LEU LEU B . n 
B 1 427 PRO 427 427 427 PRO PRO B . n 
B 1 428 GLY 428 428 428 GLY GLY B . n 
B 1