data_2P2J
# 
_entry.id   2P2J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2P2J         pdb_00002p2j 10.2210/pdb2p2j/pdb 
RCSB  RCSB041885   ?            ?                   
WWPDB D_1000041885 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P20 . unspecified 
PDB 2P2B . unspecified 
PDB 2P2F . unspecified 
PDB 2P2M . unspecified 
PDB 2P2Q . unspecified 
# 
_pdbx_database_status.entry_id                        2P2J 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reger, A.S.'  1 ? 
primary 'Carney, J.M.' 2 ? 
primary 'Gulick, A.M.' 3 ? 
# 
_cell.entry_id           2P2J 
_cell.length_a           91.675 
_cell.length_b           94.500 
_cell.length_c           167.506 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P2J 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase'            72178.375 2   6.2.1.1 K609A ? ? 
2 non-polymer syn 'COENZYME A'                              767.534   2   ?       ?     ? ? 
3 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
4 water       nat water                                     18.015    379 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGAIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGAIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ARG n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 ALA n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'according to Biochemistry, 41, 2379' 
3 1 sample ? ? ? ? ? 'Sigma, C-4780'                       
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P2J A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P2J B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P2J ALA A 609 ? UNP Q8ZKF6 LYS 609 'engineered mutation' 609 1 
2 2P2J ALA B 609 ? UNP Q8ZKF6 LYS 609 'engineered mutation' 609 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'                              ?                              'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'          115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P'     389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'         117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P2J 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.51 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   51.03 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Propyl-AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2005-07-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97930 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97930 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
# 
_reflns.entry_id                     2P2J 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   62317 
_reflns.pdbx_Rmerge_I_obs            0.085 
_reflns.pdbx_netI_over_sigmaI        8.800 
_reflns.pdbx_chi_squared             1.006 
_reflns.pdbx_redundancy              3.300 
_reflns.percent_possible_obs         95.200 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.403 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.819 
_reflns_shell.pdbx_redundancy        2.10 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5054 
_reflns_shell.percent_possible_all   78.50 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P2J 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             35.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.290 
_refine.ls_number_reflns_obs                     62243 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.188 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3146 
_refine.B_iso_mean                               24.192 
_refine.aniso_B[1][1]                            -0.900 
_refine.aniso_B[2][2]                            -0.150 
_refine.aniso_B[3][3]                            1.050 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.pdbx_overall_ESU_R                       0.338 
_refine.pdbx_overall_ESU_R_Free                  0.234 
_refine.overall_SU_ML                            0.164 
_refine.overall_SU_B                             13.243 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry 1PG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9836 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         148 
_refine_hist.number_atoms_solvent             379 
_refine_hist.number_atoms_total               10363 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        35.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10256 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      14006 1.332  1.959  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1263  6.313  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   449   36.534 23.942 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1572  15.026 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   58    19.785 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1518  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7848  0.005  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4835  0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6882  0.304  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    612   0.138  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   31    0.196  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 8     0.073  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6449  0.568  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10140 0.959  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4445  1.569  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3866  2.499  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               76.840 
_refine_ls_shell.number_reflns_R_work             3470 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.235 
_refine_ls_shell.R_factor_R_free                  0.275 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             169 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3639 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P2J 
_struct.title                     'Acetyl-CoA Synthetase, K609A mutation' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P2J 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? CYS A 17  ? PRO A 10  CYS A 17  1 ? 8  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? LEU A 127 ? TYR A 110 LEU A 127 1 ? 18 
HELX_P HELX_P8  8  VAL A 142 ? ILE A 155 ? VAL A 142 ILE A 155 1 ? 14 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 PRO A 197 ? LEU A 206 ? PRO A 197 LEU A 206 1 ? 10 
HELX_P HELX_P11 11 TRP A 237 ? LYS A 243 ? TRP A 237 LYS A 243 1 ? 7  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? TYR A 315 ? TRP A 309 TYR A 315 1 ? 7  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? ALA A 366 ? ALA A 357 ALA A 366 1 ? 10 
HELX_P HELX_P17 17 GLU A 367 ? ILE A 372 ? GLU A 367 ILE A 372 5 ? 6  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? PHE A 489 ? ASP A 480 PHE A 489 1 ? 10 
HELX_P HELX_P21 21 THR A 529 ? ALA A 538 ? THR A 529 ALA A 538 1 ? 10 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? ALA A 620 ? MET A 611 ALA A 620 1 ? 10 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 PRO B 197 ? LEU B 206 ? PRO B 197 LEU B 206 1 ? 10 
HELX_P HELX_P36 36 TRP B 237 ? ALA B 244 ? TRP B 237 ALA B 244 1 ? 8  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? TYR B 315 ? TRP B 309 TYR B 315 1 ? 7  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? GLN B 350 ? ALA B 340 GLN B 350 1 ? 11 
HELX_P HELX_P41 41 ALA B 357 ? GLU B 367 ? ALA B 357 GLU B 367 1 ? 11 
HELX_P HELX_P42 42 GLY B 368 ? ILE B 372 ? GLY B 368 ILE B 372 5 ? 5  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? ALA B 538 ? THR B 529 ALA B 538 1 ? 10 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? ALA B 620 ? MET B 611 ALA B 620 1 ? 10 
HELX_P HELX_P50 50 GLY B 636 ? ALA B 647 ? GLY B 636 ALA B 647 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 1.56 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 3.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 8 ? 
M ? 2 ? 
N ? 4 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLY A 189 ? ARG A 191 ? GLY A 189 ARG A 191 
E 2 ARG A 194 ? ILE A 196 ? ARG A 194 ILE A 196 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? VAL B 386 ? ILE B 382 VAL B 386 
K 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
L 1 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
L 2 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 5 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 6 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
L 7 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
L 8 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
M 1 GLY B 189 ? ARG B 191 ? GLY B 189 ARG B 191 
M 2 ARG B 194 ? ILE B 196 ? ARG B 194 ILE B 196 
N 1 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
N 2 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
N 3 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
N 4 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
O 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
O 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
P 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
P 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
P 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 61  ? N ALA A 61  O ASN A 64  ? O ASN A 64  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O LEU A 328 ? O LEU A 328 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O TYR A 355 ? O TYR A 355 
C 5 6 N LEU A 354 ? N LEU A 354 O ILE A 382 ? O ILE A 382 
C 6 7 N SER A 385 ? N SER A 385 O THR A 412 ? O THR A 412 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N THR A 185 ? N THR A 185 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 259 ? N LEU A 259 O HIS A 276 ? O HIS A 276 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N GLY A 189 ? N GLY A 189 O ILE A 196 ? O ILE A 196 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N LEU A 464 ? N LEU A 464 O ASP A 500 ? O ASP A 500 
F 3 4 N GLY A 501 ? N GLY A 501 O GLY A 514 ? O GLY A 514 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N ALA A 546 ? N ALA A 546 O TYR A 562 ? O TYR A 562 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N SER B 59  ? N SER B 59  O SER B 66  ? O SER B 66  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O ILE B 108 ? O ILE B 108 N ALA B 94  ? N ALA B 94  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O TYR B 355 ? O TYR B 355 
K 5 6 N LEU B 354 ? N LEU B 354 O ILE B 382 ? O ILE B 382 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O LEU B 235 ? O LEU B 235 N VAL B 219 ? N VAL B 219 
L 2 3 O ILE B 218 ? O ILE B 218 N THR B 185 ? N THR B 185 
L 3 4 O ILE B 184 ? O ILE B 184 N TYR B 138 ? N TYR B 138 
L 4 5 N VAL B 135 ? N VAL B 135 O SER B 160 ? O SER B 160 
L 5 6 N HIS B 159 ? N HIS B 159 O ILE B 261 ? O ILE B 261 
L 6 7 N LEU B 259 ? N LEU B 259 O HIS B 276 ? O HIS B 276 
L 7 8 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
M 1 2 N GLY B 189 ? N GLY B 189 O ILE B 196 ? O ILE B 196 
N 1 2 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
N 2 3 N ILE B 466 ? N ILE B 466 O TYR B 496 ? O TYR B 496 
N 3 4 N GLY B 501 ? N GLY B 501 O GLY B 514 ? O GLY B 514 
O 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
P 1 2 N ALA B 546 ? N ALA B 546 O TYR B 562 ? O TYR B 562 
P 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A COA 990 ? 16 'BINDING SITE FOR RESIDUE COA A 990' 
AC2 Software B COA 991 ? 15 'BINDING SITE FOR RESIDUE COA B 991' 
AC3 Software A PRX 999 ? 17 'BINDING SITE FOR RESIDUE PRX A 999' 
AC4 Software B PRX 998 ? 17 'BINDING SITE FOR RESIDUE PRX B 998' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 PHE A 163 ? PHE A 163  . ? 1_555 ? 
2  AC1 16 GLY A 164 ? GLY A 164  . ? 1_555 ? 
3  AC1 16 GLY A 165 ? GLY A 165  . ? 1_555 ? 
4  AC1 16 ARG A 191 ? ARG A 191  . ? 1_555 ? 
5  AC1 16 ARG A 194 ? ARG A 194  . ? 1_555 ? 
6  AC1 16 ILE A 196 ? ILE A 196  . ? 1_555 ? 
7  AC1 16 ASP A 306 ? ASP A 306  . ? 1_555 ? 
8  AC1 16 TRP A 309 ? TRP A 309  . ? 1_555 ? 
9  AC1 16 THR A 311 ? THR A 311  . ? 1_555 ? 
10 AC1 16 ALA A 357 ? ALA A 357  . ? 1_555 ? 
11 AC1 16 THR A 359 ? THR A 359  . ? 1_555 ? 
12 AC1 16 SER A 523 ? SER A 523  . ? 1_555 ? 
13 AC1 16 GLY A 524 ? GLY A 524  . ? 1_555 ? 
14 AC1 16 ARG A 584 ? ARG A 584  . ? 1_555 ? 
15 AC1 16 HOH G .   ? HOH A 1037 . ? 1_555 ? 
16 AC1 16 HOH G .   ? HOH A 1205 . ? 1_555 ? 
17 AC2 15 PHE B 163 ? PHE B 163  . ? 1_555 ? 
18 AC2 15 GLY B 164 ? GLY B 164  . ? 1_555 ? 
19 AC2 15 GLY B 165 ? GLY B 165  . ? 1_555 ? 
20 AC2 15 ARG B 191 ? ARG B 191  . ? 1_555 ? 
21 AC2 15 ARG B 194 ? ARG B 194  . ? 1_555 ? 
22 AC2 15 ASP B 306 ? ASP B 306  . ? 1_555 ? 
23 AC2 15 THR B 311 ? THR B 311  . ? 1_555 ? 
24 AC2 15 PRO B 334 ? PRO B 334  . ? 1_555 ? 
25 AC2 15 THR B 359 ? THR B 359  . ? 1_555 ? 
26 AC2 15 VAL B 386 ? VAL B 386  . ? 1_555 ? 
27 AC2 15 SER B 523 ? SER B 523  . ? 1_555 ? 
28 AC2 15 ARG B 584 ? ARG B 584  . ? 1_555 ? 
29 AC2 15 PRO B 589 ? PRO B 589  . ? 1_555 ? 
30 AC2 15 HOH H .   ? HOH B 1036 . ? 1_555 ? 
31 AC2 15 HOH H .   ? HOH B 1042 . ? 1_555 ? 
32 AC3 17 THR A 311 ? THR A 311  . ? 1_555 ? 
33 AC3 17 VAL A 386 ? VAL A 386  . ? 1_555 ? 
34 AC3 17 GLY A 387 ? GLY A 387  . ? 1_555 ? 
35 AC3 17 GLU A 388 ? GLU A 388  . ? 1_555 ? 
36 AC3 17 PRO A 389 ? PRO A 389  . ? 1_555 ? 
37 AC3 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
38 AC3 17 THR A 412 ? THR A 412  . ? 1_555 ? 
39 AC3 17 TRP A 413 ? TRP A 413  . ? 1_555 ? 
40 AC3 17 TRP A 414 ? TRP A 414  . ? 1_555 ? 
41 AC3 17 GLN A 415 ? GLN A 415  . ? 1_555 ? 
42 AC3 17 THR A 416 ? THR A 416  . ? 1_555 ? 
43 AC3 17 ASP A 500 ? ASP A 500  . ? 1_555 ? 
44 AC3 17 ILE A 512 ? ILE A 512  . ? 1_555 ? 
45 AC3 17 ARG A 515 ? ARG A 515  . ? 1_555 ? 
46 AC3 17 ARG A 526 ? ARG A 526  . ? 1_555 ? 
47 AC3 17 HOH G .   ? HOH A 1123 . ? 1_555 ? 
48 AC3 17 HOH G .   ? HOH A 1137 . ? 1_555 ? 
49 AC4 17 VAL B 310 ? VAL B 310  . ? 1_555 ? 
50 AC4 17 THR B 311 ? THR B 311  . ? 1_555 ? 
51 AC4 17 GLY B 387 ? GLY B 387  . ? 1_555 ? 
52 AC4 17 GLU B 388 ? GLU B 388  . ? 1_555 ? 
53 AC4 17 PRO B 389 ? PRO B 389  . ? 1_555 ? 
54 AC4 17 ASP B 411 ? ASP B 411  . ? 1_555 ? 
55 AC4 17 THR B 412 ? THR B 412  . ? 1_555 ? 
56 AC4 17 TRP B 413 ? TRP B 413  . ? 1_555 ? 
57 AC4 17 TRP B 414 ? TRP B 414  . ? 1_555 ? 
58 AC4 17 GLN B 415 ? GLN B 415  . ? 1_555 ? 
59 AC4 17 THR B 416 ? THR B 416  . ? 1_555 ? 
60 AC4 17 ASP B 500 ? ASP B 500  . ? 1_555 ? 
61 AC4 17 ILE B 512 ? ILE B 512  . ? 1_555 ? 
62 AC4 17 ARG B 515 ? ARG B 515  . ? 1_555 ? 
63 AC4 17 ARG B 526 ? ARG B 526  . ? 1_555 ? 
64 AC4 17 HOH H .   ? HOH B 1110 . ? 1_555 ? 
65 AC4 17 HOH H .   ? HOH B 1123 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P2J 
_atom_sites.fract_transf_matrix[1][1]   0.010908 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010582 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005970 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . HIS A 1 5   ? -24.690 17.287  8.042   1.00 39.26  ? 5    HIS A N     1 
ATOM   2     C CA    . HIS A 1 5   ? -23.818 16.092  7.861   1.00 39.30  ? 5    HIS A CA    1 
ATOM   3     C C     . HIS A 1 5   ? -22.363 16.454  7.482   1.00 37.71  ? 5    HIS A C     1 
ATOM   4     O O     . HIS A 1 5   ? -21.937 17.598  7.637   1.00 37.94  ? 5    HIS A O     1 
ATOM   5     C CB    . HIS A 1 5   ? -24.460 15.130  6.841   1.00 40.54  ? 5    HIS A CB    1 
ATOM   6     C CG    . HIS A 1 5   ? -25.195 13.980  7.469   1.00 44.32  ? 5    HIS A CG    1 
ATOM   7     N ND1   . HIS A 1 5   ? -24.826 12.662  7.273   1.00 47.67  ? 5    HIS A ND1   1 
ATOM   8     C CD2   . HIS A 1 5   ? -26.268 13.949  8.299   1.00 47.46  ? 5    HIS A CD2   1 
ATOM   9     C CE1   . HIS A 1 5   ? -25.644 11.870  7.946   1.00 48.19  ? 5    HIS A CE1   1 
ATOM   10    N NE2   . HIS A 1 5   ? -26.528 12.625  8.578   1.00 49.06  ? 5    HIS A NE2   1 
ATOM   11    N N     . LYS A 1 6   ? -21.606 15.468  7.009   1.00 35.80  ? 6    LYS A N     1 
ATOM   12    C CA    . LYS A 1 6   ? -20.202 15.644  6.637   1.00 34.03  ? 6    LYS A CA    1 
ATOM   13    C C     . LYS A 1 6   ? -20.016 16.518  5.378   1.00 32.63  ? 6    LYS A C     1 
ATOM   14    O O     . LYS A 1 6   ? -20.867 16.520  4.490   1.00 33.17  ? 6    LYS A O     1 
ATOM   15    C CB    . LYS A 1 6   ? -19.547 14.269  6.434   1.00 33.91  ? 6    LYS A CB    1 
ATOM   16    C CG    . LYS A 1 6   ? -19.369 13.431  7.717   1.00 33.87  ? 6    LYS A CG    1 
ATOM   17    C CD    . LYS A 1 6   ? -18.886 11.978  7.411   1.00 34.53  ? 6    LYS A CD    1 
ATOM   18    C CE    . LYS A 1 6   ? -18.017 11.382  8.570   1.00 33.80  ? 6    LYS A CE    1 
ATOM   19    N NZ    . LYS A 1 6   ? -17.196 10.148  8.256   1.00 32.81  ? 6    LYS A NZ    1 
ATOM   20    N N     . HIS A 1 7   ? -18.919 17.276  5.327   1.00 30.60  ? 7    HIS A N     1 
ATOM   21    C CA    . HIS A 1 7   ? -18.461 17.933  4.097   1.00 28.43  ? 7    HIS A CA    1 
ATOM   22    C C     . HIS A 1 7   ? -17.365 17.090  3.457   1.00 27.51  ? 7    HIS A C     1 
ATOM   23    O O     . HIS A 1 7   ? -16.304 16.860  4.061   1.00 26.62  ? 7    HIS A O     1 
ATOM   24    C CB    . HIS A 1 7   ? -17.895 19.319  4.372   1.00 28.15  ? 7    HIS A CB    1 
ATOM   25    C CG    . HIS A 1 7   ? -18.923 20.333  4.740   1.00 28.44  ? 7    HIS A CG    1 
ATOM   26    N ND1   . HIS A 1 7   ? -19.584 21.096  3.800   1.00 27.98  ? 7    HIS A ND1   1 
ATOM   27    C CD2   . HIS A 1 7   ? -19.409 20.712  5.945   1.00 27.52  ? 7    HIS A CD2   1 
ATOM   28    C CE1   . HIS A 1 7   ? -20.437 21.898  4.411   1.00 27.56  ? 7    HIS A CE1   1 
ATOM   29    N NE2   . HIS A 1 7   ? -20.350 21.686  5.712   1.00 28.34  ? 7    HIS A NE2   1 
ATOM   30    N N     . ALA A 1 8   ? -17.628 16.648  2.232   1.00 26.02  ? 8    ALA A N     1 
ATOM   31    C CA    . ALA A 1 8   ? -16.700 15.829  1.491   1.00 25.62  ? 8    ALA A CA    1 
ATOM   32    C C     . ALA A 1 8   ? -15.485 16.641  1.055   1.00 25.38  ? 8    ALA A C     1 
ATOM   33    O O     . ALA A 1 8   ? -15.548 17.871  0.934   1.00 25.24  ? 8    ALA A O     1 
ATOM   34    C CB    . ALA A 1 8   ? -17.388 15.206  0.276   1.00 25.93  ? 8    ALA A CB    1 
ATOM   35    N N     . ILE A 1 9   ? -14.376 15.936  0.837   1.00 24.64  ? 9    ILE A N     1 
ATOM   36    C CA    . ILE A 1 9   ? -13.157 16.543  0.340   1.00 24.02  ? 9    ILE A CA    1 
ATOM   37    C C     . ILE A 1 9   ? -13.373 16.990  -1.128  1.00 23.89  ? 9    ILE A C     1 
ATOM   38    O O     . ILE A 1 9   ? -13.760 16.177  -1.957  1.00 24.16  ? 9    ILE A O     1 
ATOM   39    C CB    . ILE A 1 9   ? -11.993 15.552  0.490   1.00 23.64  ? 9    ILE A CB    1 
ATOM   40    C CG1   . ILE A 1 9   ? -11.835 15.195  1.970   1.00 23.69  ? 9    ILE A CG1   1 
ATOM   41    C CG2   . ILE A 1 9   ? -10.707 16.129  -0.100  1.00 21.99  ? 9    ILE A CG2   1 
ATOM   42    C CD1   . ILE A 1 9   ? -11.159 13.853  2.240   1.00 25.00  ? 9    ILE A CD1   1 
ATOM   43    N N     . PRO A 1 10  ? -13.172 18.287  -1.438  1.00 23.63  ? 10   PRO A N     1 
ATOM   44    C CA    . PRO A 1 10  ? -13.399 18.682  -2.836  1.00 23.87  ? 10   PRO A CA    1 
ATOM   45    C C     . PRO A 1 10  ? -12.263 18.214  -3.753  1.00 24.00  ? 10   PRO A C     1 
ATOM   46    O O     . PRO A 1 10  ? -11.132 17.993  -3.286  1.00 24.17  ? 10   PRO A O     1 
ATOM   47    C CB    . PRO A 1 10  ? -13.465 20.219  -2.780  1.00 24.14  ? 10   PRO A CB    1 
ATOM   48    C CG    . PRO A 1 10  ? -12.644 20.603  -1.580  1.00 23.33  ? 10   PRO A CG    1 
ATOM   49    C CD    . PRO A 1 10  ? -12.764 19.429  -0.593  1.00 23.69  ? 10   PRO A CD    1 
ATOM   50    N N     . ALA A 1 11  ? -12.585 18.058  -5.037  1.00 23.50  ? 11   ALA A N     1 
ATOM   51    C CA    . ALA A 1 11  ? -11.673 17.514  -6.042  1.00 23.00  ? 11   ALA A CA    1 
ATOM   52    C C     . ALA A 1 11  ? -10.353 18.271  -6.148  1.00 22.43  ? 11   ALA A C     1 
ATOM   53    O O     . ALA A 1 11  ? -9.299  17.646  -6.211  1.00 22.21  ? 11   ALA A O     1 
ATOM   54    C CB    . ALA A 1 11  ? -12.377 17.437  -7.420  1.00 23.24  ? 11   ALA A CB    1 
ATOM   55    N N     . ASN A 1 12  ? -10.401 19.606  -6.153  1.00 22.40  ? 12   ASN A N     1 
ATOM   56    C CA    . ASN A 1 12  ? -9.160  20.401  -6.239  1.00 22.60  ? 12   ASN A CA    1 
ATOM   57    C C     . ASN A 1 12  ? -8.206  20.079  -5.097  1.00 22.54  ? 12   ASN A C     1 
ATOM   58    O O     . ASN A 1 12  ? -6.986  20.021  -5.300  1.00 22.70  ? 12   ASN A O     1 
ATOM   59    C CB    . ASN A 1 12  ? -9.416  21.921  -6.347  1.00 22.36  ? 12   ASN A CB    1 
ATOM   60    C CG    . ASN A 1 12  ? -9.890  22.542  -5.039  1.00 23.23  ? 12   ASN A CG    1 
ATOM   61    O OD1   . ASN A 1 12  ? -10.897 22.124  -4.474  1.00 23.58  ? 12   ASN A OD1   1 
ATOM   62    N ND2   . ASN A 1 12  ? -9.163  23.559  -4.557  1.00 24.16  ? 12   ASN A ND2   1 
ATOM   63    N N     . ILE A 1 13  ? -8.768  19.854  -3.904  1.00 22.28  ? 13   ILE A N     1 
ATOM   64    C CA    . ILE A 1 13  ? -7.968  19.432  -2.763  1.00 22.10  ? 13   ILE A CA    1 
ATOM   65    C C     . ILE A 1 13  ? -7.496  17.994  -2.961  1.00 22.12  ? 13   ILE A C     1 
ATOM   66    O O     . ILE A 1 13  ? -6.313  17.712  -2.812  1.00 22.15  ? 13   ILE A O     1 
ATOM   67    C CB    . ILE A 1 13  ? -8.682  19.647  -1.377  1.00 21.91  ? 13   ILE A CB    1 
ATOM   68    C CG1   . ILE A 1 13  ? -9.027  21.113  -1.151  1.00 20.58  ? 13   ILE A CG1   1 
ATOM   69    C CG2   . ILE A 1 13  ? -7.784  19.204  -0.226  1.00 21.88  ? 13   ILE A CG2   1 
ATOM   70    C CD1   . ILE A 1 13  ? -7.839  22.048  -1.117  1.00 21.70  ? 13   ILE A CD1   1 
ATOM   71    N N     . ALA A 1 14  ? -8.410  17.092  -3.313  1.00 22.32  ? 14   ALA A N     1 
ATOM   72    C CA    . ALA A 1 14  ? -8.025  15.714  -3.643  1.00 22.41  ? 14   ALA A CA    1 
ATOM   73    C C     . ALA A 1 14  ? -6.859  15.617  -4.631  1.00 22.37  ? 14   ALA A C     1 
ATOM   74    O O     . ALA A 1 14  ? -5.971  14.775  -4.453  1.00 21.93  ? 14   ALA A O     1 
ATOM   75    C CB    . ALA A 1 14  ? -9.221  14.905  -4.146  1.00 22.69  ? 14   ALA A CB    1 
ATOM   76    N N     . ASP A 1 15  ? -6.852  16.481  -5.649  1.00 22.46  ? 15   ASP A N     1 
ATOM   77    C CA    . ASP A 1 15  ? -5.800  16.448  -6.679  1.00 23.22  ? 15   ASP A CA    1 
ATOM   78    C C     . ASP A 1 15  ? -4.439  16.969  -6.185  1.00 23.59  ? 15   ASP A C     1 
ATOM   79    O O     . ASP A 1 15  ? -3.402  16.703  -6.808  1.00 23.88  ? 15   ASP A O     1 
ATOM   80    C CB    . ASP A 1 15  ? -6.236  17.210  -7.943  1.00 23.13  ? 15   ASP A CB    1 
ATOM   81    C CG    . ASP A 1 15  ? -7.495  16.622  -8.580  1.00 24.63  ? 15   ASP A CG    1 
ATOM   82    O OD1   . ASP A 1 15  ? -7.796  15.431  -8.308  1.00 25.09  ? 15   ASP A OD1   1 
ATOM   83    O OD2   . ASP A 1 15  ? -8.185  17.346  -9.343  1.00 23.48  ? 15   ASP A OD2   1 
ATOM   84    N N     . ARG A 1 16  ? -4.434  17.710  -5.077  1.00 23.19  ? 16   ARG A N     1 
ATOM   85    C CA    . ARG A 1 16  ? -3.189  18.325  -4.614  1.00 23.23  ? 16   ARG A CA    1 
ATOM   86    C C     . ARG A 1 16  ? -2.696  17.911  -3.231  1.00 21.92  ? 16   ARG A C     1 
ATOM   87    O O     . ARG A 1 16  ? -1.500  18.019  -2.955  1.00 21.12  ? 16   ARG A O     1 
ATOM   88    C CB    . ARG A 1 16  ? -3.249  19.857  -4.739  1.00 23.22  ? 16   ARG A CB    1 
ATOM   89    C CG    . ARG A 1 16  ? -4.187  20.562  -3.779  1.00 25.10  ? 16   ARG A CG    1 
ATOM   90    C CD    . ARG A 1 16  ? -4.341  22.067  -4.168  1.00 25.71  ? 16   ARG A CD    1 
ATOM   91    N NE    . ARG A 1 16  ? -3.315  22.903  -3.541  1.00 30.02  ? 16   ARG A NE    1 
ATOM   92    C CZ    . ARG A 1 16  ? -2.394  23.616  -4.194  1.00 32.86  ? 16   ARG A CZ    1 
ATOM   93    N NH1   . ARG A 1 16  ? -2.334  23.627  -5.531  1.00 31.96  ? 16   ARG A NH1   1 
ATOM   94    N NH2   . ARG A 1 16  ? -1.518  24.330  -3.497  1.00 33.52  ? 16   ARG A NH2   1 
ATOM   95    N N     . CYS A 1 17  ? -3.610  17.442  -2.377  1.00 21.65  ? 17   CYS A N     1 
ATOM   96    C CA    . CYS A 1 17  ? -3.313  17.181  -0.960  1.00 21.58  ? 17   CYS A CA    1 
ATOM   97    C C     . CYS A 1 17  ? -2.072  16.311  -0.776  1.00 21.42  ? 17   CYS A C     1 
ATOM   98    O O     . CYS A 1 17  ? -1.873  15.303  -1.495  1.00 21.65  ? 17   CYS A O     1 
ATOM   99    C CB    . CYS A 1 17  ? -4.504  16.534  -0.246  1.00 21.31  ? 17   CYS A CB    1 
ATOM   100   S SG    . CYS A 1 17  ? -4.932  14.836  -0.833  1.00 23.05  ? 17   CYS A SG    1 
ATOM   101   N N     . LEU A 1 18  ? -1.244  16.707  0.185   1.00 20.81  ? 18   LEU A N     1 
ATOM   102   C CA    . LEU A 1 18  ? -0.073  15.935  0.573   1.00 20.29  ? 18   LEU A CA    1 
ATOM   103   C C     . LEU A 1 18  ? -0.520  14.645  1.265   1.00 20.44  ? 18   LEU A C     1 
ATOM   104   O O     . LEU A 1 18  ? 0.105   13.604  1.097   1.00 20.60  ? 18   LEU A O     1 
ATOM   105   C CB    . LEU A 1 18  ? 0.862   16.765  1.479   1.00 19.44  ? 18   LEU A CB    1 
ATOM   106   C CG    . LEU A 1 18  ? 1.370   18.099  0.888   1.00 20.41  ? 18   LEU A CG    1 
ATOM   107   C CD1   . LEU A 1 18  ? 2.020   19.016  1.937   1.00 16.87  ? 18   LEU A CD1   1 
ATOM   108   C CD2   . LEU A 1 18  ? 2.321   17.895  -0.310  1.00 18.66  ? 18   LEU A CD2   1 
ATOM   109   N N     . ILE A 1 19  ? -1.603  14.718  2.038   1.00 20.05  ? 19   ILE A N     1 
ATOM   110   C CA    . ILE A 1 19  ? -2.061  13.572  2.793   1.00 20.20  ? 19   ILE A CA    1 
ATOM   111   C C     . ILE A 1 19  ? -3.511  13.263  2.420   1.00 20.52  ? 19   ILE A C     1 
ATOM   112   O O     . ILE A 1 19  ? -4.412  14.036  2.718   1.00 20.66  ? 19   ILE A O     1 
ATOM   113   C CB    . ILE A 1 19  ? -1.914  13.770  4.336   1.00 20.48  ? 19   ILE A CB    1 
ATOM   114   C CG1   . ILE A 1 19  ? -0.460  14.074  4.761   1.00 20.36  ? 19   ILE A CG1   1 
ATOM   115   C CG2   . ILE A 1 19  ? -2.476  12.557  5.123   1.00 19.45  ? 19   ILE A CG2   1 
ATOM   116   C CD1   . ILE A 1 19  ? 0.590   12.958  4.439   1.00 18.46  ? 19   ILE A CD1   1 
ATOM   117   N N     . ASN A 1 20  ? -3.714  12.127  1.759   1.00 20.81  ? 20   ASN A N     1 
ATOM   118   C CA    . ASN A 1 20  ? -5.047  11.632  1.433   1.00 21.09  ? 20   ASN A CA    1 
ATOM   119   C C     . ASN A 1 20  ? -5.550  10.697  2.554   1.00 21.19  ? 20   ASN A C     1 
ATOM   120   O O     . ASN A 1 20  ? -4.818  10.464  3.512   1.00 20.80  ? 20   ASN A O     1 
ATOM   121   C CB    . ASN A 1 20  ? -5.064  10.982  0.037   1.00 20.74  ? 20   ASN A CB    1 
ATOM   122   C CG    . ASN A 1 20  ? -4.359  9.634   -0.010  1.00 20.93  ? 20   ASN A CG    1 
ATOM   123   O OD1   . ASN A 1 20  ? -4.157  8.975   1.011   1.00 19.17  ? 20   ASN A OD1   1 
ATOM   124   N ND2   . ASN A 1 20  ? -3.992  9.209   -1.222  1.00 19.62  ? 20   ASN A ND2   1 
ATOM   125   N N     . PRO A 1 21  ? -6.797  10.183  2.454   1.00 21.61  ? 21   PRO A N     1 
ATOM   126   C CA    . PRO A 1 21  ? -7.330  9.436   3.603   1.00 21.79  ? 21   PRO A CA    1 
ATOM   127   C C     . PRO A 1 21  ? -6.551  8.170   3.943   1.00 22.02  ? 21   PRO A C     1 
ATOM   128   O O     . PRO A 1 21  ? -6.417  7.837   5.122   1.00 21.99  ? 21   PRO A O     1 
ATOM   129   C CB    . PRO A 1 21  ? -8.769  9.100   3.179   1.00 21.77  ? 21   PRO A CB    1 
ATOM   130   C CG    . PRO A 1 21  ? -9.089  10.106  2.087   1.00 22.01  ? 21   PRO A CG    1 
ATOM   131   C CD    . PRO A 1 21  ? -7.776  10.246  1.353   1.00 21.44  ? 21   PRO A CD    1 
ATOM   132   N N     . GLU A 1 22  ? -6.037  7.482   2.928   1.00 22.44  ? 22   GLU A N     1 
ATOM   133   C CA    . GLU A 1 22  ? -5.246  6.256   3.137   1.00 23.64  ? 22   GLU A CA    1 
ATOM   134   C C     . GLU A 1 22  ? -3.882  6.582   3.779   1.00 22.92  ? 22   GLU A C     1 
ATOM   135   O O     . GLU A 1 22  ? -3.419  5.894   4.701   1.00 22.36  ? 22   GLU A O     1 
ATOM   136   C CB    . GLU A 1 22  ? -5.078  5.477   1.815   1.00 24.06  ? 22   GLU A CB    1 
ATOM   137   C CG    . GLU A 1 22  ? -6.423  4.910   1.202   1.00 28.91  ? 22   GLU A CG    1 
ATOM   138   C CD    . GLU A 1 22  ? -7.482  5.997   0.742   1.00 34.19  ? 22   GLU A CD    1 
ATOM   139   O OE1   . GLU A 1 22  ? -8.711  5.736   0.950   1.00 35.07  ? 22   GLU A OE1   1 
ATOM   140   O OE2   . GLU A 1 22  ? -7.100  7.080   0.177   1.00 32.90  ? 22   GLU A OE2   1 
ATOM   141   N N     . GLN A 1 23  ? -3.259  7.650   3.299   1.00 22.32  ? 23   GLN A N     1 
ATOM   142   C CA    . GLN A 1 23  ? -2.000  8.107   3.863   1.00 22.26  ? 23   GLN A CA    1 
ATOM   143   C C     . GLN A 1 23  ? -2.164  8.551   5.318   1.00 22.31  ? 23   GLN A C     1 
ATOM   144   O O     . GLN A 1 23  ? -1.280  8.296   6.144   1.00 21.46  ? 23   GLN A O     1 
ATOM   145   C CB    . GLN A 1 23  ? -1.413  9.239   3.027   1.00 22.35  ? 23   GLN A CB    1 
ATOM   146   C CG    . GLN A 1 23  ? -1.023  8.812   1.630   1.00 21.70  ? 23   GLN A CG    1 
ATOM   147   C CD    . GLN A 1 23  ? -0.729  9.996   0.755   1.00 22.82  ? 23   GLN A CD    1 
ATOM   148   O OE1   . GLN A 1 23  ? -1.490  10.980  0.723   1.00 20.81  ? 23   GLN A OE1   1 
ATOM   149   N NE2   . GLN A 1 23  ? 0.392   9.928   0.046   1.00 22.10  ? 23   GLN A NE2   1 
ATOM   150   N N     . TYR A 1 24  ? -3.288  9.207   5.631   1.00 22.26  ? 24   TYR A N     1 
ATOM   151   C CA    . TYR A 1 24  ? -3.536  9.572   7.011   1.00 22.44  ? 24   TYR A CA    1 
ATOM   152   C C     . TYR A 1 24  ? -3.533  8.313   7.879   1.00 22.79  ? 24   TYR A C     1 
ATOM   153   O O     . TYR A 1 24  ? -2.830  8.275   8.891   1.00 23.19  ? 24   TYR A O     1 
ATOM   154   C CB    . TYR A 1 24  ? -4.855  10.348  7.218   1.00 22.10  ? 24   TYR A CB    1 
ATOM   155   C CG    . TYR A 1 24  ? -5.208  10.412  8.712   1.00 22.01  ? 24   TYR A CG    1 
ATOM   156   C CD1   . TYR A 1 24  ? -4.608  11.358  9.556   1.00 21.69  ? 24   TYR A CD1   1 
ATOM   157   C CD2   . TYR A 1 24  ? -6.066  9.472   9.291   1.00 21.86  ? 24   TYR A CD2   1 
ATOM   158   C CE1   . TYR A 1 24  ? -4.886  11.397  10.928  1.00 22.55  ? 24   TYR A CE1   1 
ATOM   159   C CE2   . TYR A 1 24  ? -6.359  9.502   10.676  1.00 21.99  ? 24   TYR A CE2   1 
ATOM   160   C CZ    . TYR A 1 24  ? -5.767  10.468  11.483  1.00 22.02  ? 24   TYR A CZ    1 
ATOM   161   O OH    . TYR A 1 24  ? -6.043  10.503  12.829  1.00 19.53  ? 24   TYR A OH    1 
ATOM   162   N N     . GLU A 1 25  ? -4.331  7.305   7.496   1.00 23.19  ? 25   GLU A N     1 
ATOM   163   C CA    . GLU A 1 25  ? -4.510  6.083   8.316   1.00 23.51  ? 25   GLU A CA    1 
ATOM   164   C C     . GLU A 1 25  ? -3.199  5.323   8.499   1.00 22.70  ? 25   GLU A C     1 
ATOM   165   O O     . GLU A 1 25  ? -2.899  4.851   9.602   1.00 22.36  ? 25   GLU A O     1 
ATOM   166   C CB    . GLU A 1 25  ? -5.574  5.135   7.733   1.00 23.91  ? 25   GLU A CB    1 
ATOM   167   C CG    . GLU A 1 25  ? -7.044  5.595   7.884   1.00 28.00  ? 25   GLU A CG    1 
ATOM   168   C CD    . GLU A 1 25  ? -7.519  5.764   9.361   1.00 32.08  ? 25   GLU A CD    1 
ATOM   169   O OE1   . GLU A 1 25  ? -6.980  5.094   10.279  1.00 32.53  ? 25   GLU A OE1   1 
ATOM   170   O OE2   . GLU A 1 25  ? -8.452  6.576   9.589   1.00 35.02  ? 25   GLU A OE2   1 
ATOM   171   N N     . THR A 1 26  ? -2.440  5.204   7.410   1.00 21.75  ? 26   THR A N     1 
ATOM   172   C CA    . THR A 1 26  ? -1.141  4.535   7.418   1.00 21.48  ? 26   THR A CA    1 
ATOM   173   C C     . THR A 1 26  ? -0.153  5.267   8.344   1.00 21.63  ? 26   THR A C     1 
ATOM   174   O O     . THR A 1 26  ? 0.441   4.655   9.246   1.00 21.88  ? 26   THR A O     1 
ATOM   175   C CB    . THR A 1 26  ? -0.572  4.455   5.989   1.00 21.45  ? 26   THR A CB    1 
ATOM   176   O OG1   . THR A 1 26  ? -1.483  3.721   5.171   1.00 20.70  ? 26   THR A OG1   1 
ATOM   177   C CG2   . THR A 1 26  ? 0.814   3.796   5.941   1.00 21.30  ? 26   THR A CG2   1 
ATOM   178   N N     . LYS A 1 27  ? 0.001   6.575   8.132   1.00 20.83  ? 27   LYS A N     1 
ATOM   179   C CA    . LYS A 1 27  ? 0.955   7.351   8.910   1.00 20.44  ? 27   LYS A CA    1 
ATOM   180   C C     . LYS A 1 27  ? 0.589   7.356   10.385  1.00 20.25  ? 27   LYS A C     1 
ATOM   181   O O     . LYS A 1 27  ? 1.461   7.173   11.224  1.00 20.10  ? 27   LYS A O     1 
ATOM   182   C CB    . LYS A 1 27  ? 1.098   8.790   8.378   1.00 20.51  ? 27   LYS A CB    1 
ATOM   183   C CG    . LYS A 1 27  ? 1.889   8.895   7.059   1.00 19.51  ? 27   LYS A CG    1 
ATOM   184   C CD    . LYS A 1 27  ? 2.203   10.351  6.680   1.00 20.09  ? 27   LYS A CD    1 
ATOM   185   C CE    . LYS A 1 27  ? 3.055   10.433  5.410   1.00 20.56  ? 27   LYS A CE    1 
ATOM   186   N NZ    . LYS A 1 27  ? 4.477   9.929   5.564   1.00 21.87  ? 27   LYS A NZ    1 
ATOM   187   N N     . TYR A 1 28  ? -0.697  7.543   10.688  1.00 20.12  ? 28   TYR A N     1 
ATOM   188   C CA    . TYR A 1 28  ? -1.141  7.605   12.067  1.00 20.37  ? 28   TYR A CA    1 
ATOM   189   C C     . TYR A 1 28  ? -0.819  6.313   12.812  1.00 20.96  ? 28   TYR A C     1 
ATOM   190   O O     . TYR A 1 28  ? -0.243  6.339   13.923  1.00 21.10  ? 28   TYR A O     1 
ATOM   191   C CB    . TYR A 1 28  ? -2.640  7.940   12.212  1.00 19.75  ? 28   TYR A CB    1 
ATOM   192   C CG    . TYR A 1 28  ? -3.034  8.009   13.678  1.00 19.27  ? 28   TYR A CG    1 
ATOM   193   C CD1   . TYR A 1 28  ? -2.860  9.195   14.429  1.00 18.17  ? 28   TYR A CD1   1 
ATOM   194   C CD2   . TYR A 1 28  ? -3.529  6.882   14.336  1.00 19.20  ? 28   TYR A CD2   1 
ATOM   195   C CE1   . TYR A 1 28  ? -3.194  9.244   15.781  1.00 16.75  ? 28   TYR A CE1   1 
ATOM   196   C CE2   . TYR A 1 28  ? -3.863  6.921   15.685  1.00 19.20  ? 28   TYR A CE2   1 
ATOM   197   C CZ    . TYR A 1 28  ? -3.690  8.100   16.400  1.00 19.14  ? 28   TYR A CZ    1 
ATOM   198   O OH    . TYR A 1 28  ? -4.033  8.108   17.729  1.00 19.47  ? 28   TYR A OH    1 
ATOM   199   N N     . LYS A 1 29  ? -1.207  5.193   12.213  1.00 20.91  ? 29   LYS A N     1 
ATOM   200   C CA    . LYS A 1 29  ? -0.957  3.885   12.800  1.00 21.65  ? 29   LYS A CA    1 
ATOM   201   C C     . LYS A 1 29  ? 0.541   3.611   13.016  1.00 21.48  ? 29   LYS A C     1 
ATOM   202   O O     . LYS A 1 29  ? 0.921   3.075   14.065  1.00 21.98  ? 29   LYS A O     1 
ATOM   203   C CB    . LYS A 1 29  ? -1.627  2.803   11.964  1.00 21.95  ? 29   LYS A CB    1 
ATOM   204   C CG    . LYS A 1 29  ? -1.539  1.418   12.536  1.00 25.81  ? 29   LYS A CG    1 
ATOM   205   C CD    . LYS A 1 29  ? -1.886  0.384   11.470  1.00 28.61  ? 29   LYS A CD    1 
ATOM   206   C CE    . LYS A 1 29  ? -1.817  -1.030  12.034  1.00 31.23  ? 29   LYS A CE    1 
ATOM   207   N NZ    . LYS A 1 29  ? -1.733  -2.025  10.915  1.00 32.49  ? 29   LYS A NZ    1 
ATOM   208   N N     . GLN A 1 30  ? 1.394   3.988   12.061  1.00 21.29  ? 30   GLN A N     1 
ATOM   209   C CA    . GLN A 1 30  ? 2.850   3.899   12.278  1.00 21.34  ? 30   GLN A CA    1 
ATOM   210   C C     . GLN A 1 30  ? 3.298   4.872   13.375  1.00 21.61  ? 30   GLN A C     1 
ATOM   211   O O     . GLN A 1 30  ? 4.208   4.564   14.155  1.00 21.46  ? 30   GLN A O     1 
ATOM   212   C CB    . GLN A 1 30  ? 3.671   4.150   10.989  1.00 21.48  ? 30   GLN A CB    1 
ATOM   213   C CG    . GLN A 1 30  ? 5.173   3.811   11.146  1.00 20.40  ? 30   GLN A CG    1 
ATOM   214   C CD    . GLN A 1 30  ? 6.058   4.208   9.946   1.00 21.60  ? 30   GLN A CD    1 
ATOM   215   O OE1   . GLN A 1 30  ? 5.910   5.289   9.364   1.00 21.35  ? 30   GLN A OE1   1 
ATOM   216   N NE2   . GLN A 1 30  ? 7.017   3.340   9.608   1.00 19.02  ? 30   GLN A NE2   1 
ATOM   217   N N     . SER A 1 31  ? 2.674   6.047   13.432  1.00 21.83  ? 31   SER A N     1 
ATOM   218   C CA    . SER A 1 31  ? 3.089   7.048   14.417  1.00 22.53  ? 31   SER A CA    1 
ATOM   219   C C     . SER A 1 31  ? 2.893   6.504   15.832  1.00 22.99  ? 31   SER A C     1 
ATOM   220   O O     . SER A 1 31  ? 3.691   6.768   16.697  1.00 23.29  ? 31   SER A O     1 
ATOM   221   C CB    . SER A 1 31  ? 2.371   8.387   14.208  1.00 21.99  ? 31   SER A CB    1 
ATOM   222   O OG    . SER A 1 31  ? 1.021   8.341   14.644  1.00 22.48  ? 31   SER A OG    1 
ATOM   223   N N     . ILE A 1 32  ? 1.856   5.694   16.027  1.00 24.11  ? 32   ILE A N     1 
ATOM   224   C CA    . ILE A 1 32  ? 1.549   5.094   17.320  1.00 25.37  ? 32   ILE A CA    1 
ATOM   225   C C     . ILE A 1 32  ? 2.292   3.769   17.569  1.00 26.37  ? 32   ILE A C     1 
ATOM   226   O O     . ILE A 1 32  ? 2.792   3.529   18.682  1.00 26.95  ? 32   ILE A O     1 
ATOM   227   C CB    . ILE A 1 32  ? 0.016   4.846   17.496  1.00 25.08  ? 32   ILE A CB    1 
ATOM   228   C CG1   . ILE A 1 32  ? -0.793  6.123   17.301  1.00 24.09  ? 32   ILE A CG1   1 
ATOM   229   C CG2   . ILE A 1 32  ? -0.290  4.240   18.865  1.00 27.12  ? 32   ILE A CG2   1 
ATOM   230   C CD1   . ILE A 1 32  ? -0.259  7.358   17.961  1.00 21.66  ? 32   ILE A CD1   1 
ATOM   231   N N     . ASN A 1 33  ? 2.346   2.913   16.551  1.00 26.90  ? 33   ASN A N     1 
ATOM   232   C CA    . ASN A 1 33  ? 2.957   1.594   16.690  1.00 27.85  ? 33   ASN A CA    1 
ATOM   233   C C     . ASN A 1 33  ? 4.480   1.650   16.729  1.00 27.68  ? 33   ASN A C     1 
ATOM   234   O O     . ASN A 1 33  ? 5.134   0.848   17.411  1.00 27.30  ? 33   ASN A O     1 
ATOM   235   C CB    . ASN A 1 33  ? 2.536   0.693   15.532  1.00 28.33  ? 33   ASN A CB    1 
ATOM   236   C CG    . ASN A 1 33  ? 1.063   0.339   15.570  1.00 31.66  ? 33   ASN A CG    1 
ATOM   237   O OD1   . ASN A 1 33  ? 0.382   0.506   16.596  1.00 32.08  ? 33   ASN A OD1   1 
ATOM   238   N ND2   . ASN A 1 33  ? 0.553   -0.163  14.434  1.00 35.68  ? 33   ASN A ND2   1 
ATOM   239   N N     . ASP A 1 34  ? 5.040   2.582   15.965  1.00 27.25  ? 34   ASP A N     1 
ATOM   240   C CA    . ASP A 1 34  ? 6.481   2.657   15.811  1.00 26.85  ? 34   ASP A CA    1 
ATOM   241   C C     . ASP A 1 34  ? 6.895   4.125   15.665  1.00 25.87  ? 34   ASP A C     1 
ATOM   242   O O     . ASP A 1 34  ? 7.267   4.566   14.584  1.00 25.89  ? 34   ASP A O     1 
ATOM   243   C CB    . ASP A 1 34  ? 6.904   1.796   14.609  1.00 26.92  ? 34   ASP A CB    1 
ATOM   244   C CG    . ASP A 1 34  ? 8.393   1.529   14.567  1.00 27.73  ? 34   ASP A CG    1 
ATOM   245   O OD1   . ASP A 1 34  ? 9.131   1.957   15.493  1.00 28.63  ? 34   ASP A OD1   1 
ATOM   246   O OD2   . ASP A 1 34  ? 8.817   0.888   13.584  1.00 26.69  ? 34   ASP A OD2   1 
ATOM   247   N N     . PRO A 1 35  ? 6.804   4.890   16.767  1.00 25.33  ? 35   PRO A N     1 
ATOM   248   C CA    . PRO A 1 35  ? 7.104   6.327   16.762  1.00 24.58  ? 35   PRO A CA    1 
ATOM   249   C C     . PRO A 1 35  ? 8.558   6.647   16.449  1.00 23.96  ? 35   PRO A C     1 
ATOM   250   O O     . PRO A 1 35  ? 8.835   7.668   15.820  1.00 23.93  ? 35   PRO A O     1 
ATOM   251   C CB    . PRO A 1 35  ? 6.723   6.774   18.184  1.00 24.82  ? 35   PRO A CB    1 
ATOM   252   C CG    . PRO A 1 35  ? 6.763   5.543   19.012  1.00 24.83  ? 35   PRO A CG    1 
ATOM   253   C CD    . PRO A 1 35  ? 6.359   4.424   18.095  1.00 25.42  ? 35   PRO A CD    1 
ATOM   254   N N     . ASP A 1 36  ? 9.472   5.774   16.875  1.00 23.81  ? 36   ASP A N     1 
ATOM   255   C CA    . ASP A 1 36  ? 10.906  5.890   16.536  1.00 23.52  ? 36   ASP A CA    1 
ATOM   256   C C     . ASP A 1 36  ? 11.207  5.859   15.034  1.00 22.81  ? 36   ASP A C     1 
ATOM   257   O O     . ASP A 1 36  ? 11.954  6.698   14.544  1.00 22.15  ? 36   ASP A O     1 
ATOM   258   C CB    . ASP A 1 36  ? 11.742  4.838   17.282  1.00 23.98  ? 36   ASP A CB    1 
ATOM   259   C CG    . ASP A 1 36  ? 11.975  5.211   18.744  1.00 25.18  ? 36   ASP A CG    1 
ATOM   260   O OD1   . ASP A 1 36  ? 12.669  4.459   19.446  1.00 28.34  ? 36   ASP A OD1   1 
ATOM   261   O OD2   . ASP A 1 36  ? 11.474  6.256   19.197  1.00 24.35  ? 36   ASP A OD2   1 
ATOM   262   N N     . THR A 1 37  ? 10.635  4.895   14.308  1.00 22.42  ? 37   THR A N     1 
ATOM   263   C CA    . THR A 1 37  ? 10.725  4.920   12.842  1.00 21.89  ? 37   THR A CA    1 
ATOM   264   C C     . THR A 1 37  ? 9.984   6.148   12.318  1.00 21.59  ? 37   THR A C     1 
ATOM   265   O O     . THR A 1 37  ? 10.564  6.952   11.575  1.00 20.80  ? 37   THR A O     1 
ATOM   266   C CB    . THR A 1 37  ? 10.157  3.632   12.167  1.00 22.29  ? 37   THR A CB    1 
ATOM   267   O OG1   . THR A 1 37  ? 10.716  2.478   12.803  1.00 21.41  ? 37   THR A OG1   1 
ATOM   268   C CG2   . THR A 1 37  ? 10.499  3.598   10.689  1.00 20.64  ? 37   THR A CG2   1 
ATOM   269   N N     . PHE A 1 38  ? 8.724   6.310   12.740  1.00 20.75  ? 38   PHE A N     1 
ATOM   270   C CA    . PHE A 1 38  ? 7.916   7.390   12.204  1.00 20.21  ? 38   PHE A CA    1 
ATOM   271   C C     . PHE A 1 38  ? 8.543   8.777   12.405  1.00 20.42  ? 38   PHE A C     1 
ATOM   272   O O     . PHE A 1 38  ? 8.708   9.508   11.428  1.00 20.16  ? 38   PHE A O     1 
ATOM   273   C CB    . PHE A 1 38  ? 6.476   7.378   12.722  1.00 20.02  ? 38   PHE A CB    1 
ATOM   274   C CG    . PHE A 1 38  ? 5.646   8.497   12.148  1.00 19.40  ? 38   PHE A CG    1 
ATOM   275   C CD1   . PHE A 1 38  ? 5.038   8.357   10.900  1.00 19.04  ? 38   PHE A CD1   1 
ATOM   276   C CD2   . PHE A 1 38  ? 5.525   9.705   12.826  1.00 17.66  ? 38   PHE A CD2   1 
ATOM   277   C CE1   . PHE A 1 38  ? 4.287   9.388   10.351  1.00 20.15  ? 38   PHE A CE1   1 
ATOM   278   C CE2   . PHE A 1 38  ? 4.791   10.758  12.289  1.00 19.47  ? 38   PHE A CE2   1 
ATOM   279   C CZ    . PHE A 1 38  ? 4.157   10.603  11.050  1.00 19.58  ? 38   PHE A CZ    1 
ATOM   280   N N     . TRP A 1 39  ? 8.881   9.127   13.650  1.00 20.13  ? 39   TRP A N     1 
ATOM   281   C CA    . TRP A 1 39  ? 9.512   10.416  13.933  1.00 20.60  ? 39   TRP A CA    1 
ATOM   282   C C     . TRP A 1 39  ? 10.988  10.475  13.589  1.00 20.72  ? 39   TRP A C     1 
ATOM   283   O O     . TRP A 1 39  ? 11.531  11.563  13.378  1.00 20.64  ? 39   TRP A O     1 
ATOM   284   C CB    . TRP A 1 39  ? 9.283   10.857  15.390  1.00 20.20  ? 39   TRP A CB    1 
ATOM   285   C CG    . TRP A 1 39  ? 7.857   11.148  15.658  1.00 19.52  ? 39   TRP A CG    1 
ATOM   286   C CD1   . TRP A 1 39  ? 7.006   10.435  16.456  1.00 18.74  ? 39   TRP A CD1   1 
ATOM   287   C CD2   . TRP A 1 39  ? 7.081   12.207  15.077  1.00 19.45  ? 39   TRP A CD2   1 
ATOM   288   N NE1   . TRP A 1 39  ? 5.745   11.007  16.429  1.00 19.58  ? 39   TRP A NE1   1 
ATOM   289   C CE2   . TRP A 1 39  ? 5.767   12.096  15.595  1.00 19.83  ? 39   TRP A CE2   1 
ATOM   290   C CE3   . TRP A 1 39  ? 7.374   13.257  14.185  1.00 19.74  ? 39   TRP A CE3   1 
ATOM   291   C CZ2   . TRP A 1 39  ? 4.746   12.979  15.235  1.00 19.88  ? 39   TRP A CZ2   1 
ATOM   292   C CZ3   . TRP A 1 39  ? 6.360   14.159  13.848  1.00 19.02  ? 39   TRP A CZ3   1 
ATOM   293   C CH2   . TRP A 1 39  ? 5.064   14.007  14.370  1.00 19.67  ? 39   TRP A CH2   1 
ATOM   294   N N     . GLY A 1 40  ? 11.638  9.313   13.547  1.00 21.44  ? 40   GLY A N     1 
ATOM   295   C CA    . GLY A 1 40  ? 13.017  9.223   13.069  1.00 22.16  ? 40   GLY A CA    1 
ATOM   296   C C     . GLY A 1 40  ? 13.098  9.710   11.624  1.00 22.98  ? 40   GLY A C     1 
ATOM   297   O O     . GLY A 1 40  ? 13.936  10.553  11.309  1.00 22.88  ? 40   GLY A O     1 
ATOM   298   N N     . GLU A 1 41  ? 12.216  9.178   10.769  1.00 22.93  ? 41   GLU A N     1 
ATOM   299   C CA    . GLU A 1 41  ? 12.071  9.598   9.369   1.00 24.15  ? 41   GLU A CA    1 
ATOM   300   C C     . GLU A 1 41  ? 11.485  11.020  9.276   1.00 23.16  ? 41   GLU A C     1 
ATOM   301   O O     . GLU A 1 41  ? 11.947  11.843  8.493   1.00 23.43  ? 41   GLU A O     1 
ATOM   302   C CB    . GLU A 1 41  ? 11.213  8.567   8.581   1.00 23.85  ? 41   GLU A CB    1 
ATOM   303   C CG    . GLU A 1 41  ? 12.074  7.439   7.889   1.00 27.66  ? 41   GLU A CG    1 
ATOM   304   C CD    . GLU A 1 41  ? 11.377  6.040   7.731   1.00 27.36  ? 41   GLU A CD    1 
ATOM   305   O OE1   . GLU A 1 41  ? 12.094  5.003   7.818   1.00 29.46  ? 41   GLU A OE1   1 
ATOM   306   O OE2   . GLU A 1 41  ? 10.136  5.972   7.512   1.00 30.96  ? 41   GLU A OE2   1 
ATOM   307   N N     . GLN A 1 42  ? 10.496  11.327  10.102  1.00 22.19  ? 42   GLN A N     1 
ATOM   308   C CA    . GLN A 1 42  ? 9.818   12.603  9.973   1.00 22.02  ? 42   GLN A CA    1 
ATOM   309   C C     . GLN A 1 42  ? 10.650  13.788  10.485  1.00 21.85  ? 42   GLN A C     1 
ATOM   310   O O     . GLN A 1 42  ? 10.510  14.921  9.980   1.00 21.28  ? 42   GLN A O     1 
ATOM   311   C CB    . GLN A 1 42  ? 8.401   12.563  10.559  1.00 21.60  ? 42   GLN A CB    1 
ATOM   312   C CG    . GLN A 1 42  ? 7.587   13.838  10.331  1.00 22.22  ? 42   GLN A CG    1 
ATOM   313   C CD    . GLN A 1 42  ? 7.519   14.300  8.866   1.00 23.61  ? 42   GLN A CD    1 
ATOM   314   O OE1   . GLN A 1 42  ? 7.642   15.501  8.580   1.00 24.33  ? 42   GLN A OE1   1 
ATOM   315   N NE2   . GLN A 1 42  ? 7.284   13.364  7.943   1.00 21.30  ? 42   GLN A NE2   1 
ATOM   316   N N     . GLY A 1 43  ? 11.542  13.511  11.437  1.00 21.60  ? 43   GLY A N     1 
ATOM   317   C CA    . GLY A 1 43  ? 12.505  14.506  11.933  1.00 21.40  ? 43   GLY A CA    1 
ATOM   318   C C     . GLY A 1 43  ? 13.391  15.094  10.844  1.00 21.57  ? 43   GLY A C     1 
ATOM   319   O O     . GLY A 1 43  ? 13.962  16.169  11.003  1.00 21.27  ? 43   GLY A O     1 
ATOM   320   N N     . LYS A 1 44  ? 13.490  14.397  9.718   1.00 21.53  ? 44   LYS A N     1 
ATOM   321   C CA    . LYS A 1 44  ? 14.303  14.866  8.599   1.00 21.60  ? 44   LYS A CA    1 
ATOM   322   C C     . LYS A 1 44  ? 13.690  16.095  7.886   1.00 21.21  ? 44   LYS A C     1 
ATOM   323   O O     . LYS A 1 44  ? 14.277  16.649  6.935   1.00 20.38  ? 44   LYS A O     1 
ATOM   324   C CB    . LYS A 1 44  ? 14.544  13.721  7.605   1.00 21.87  ? 44   LYS A CB    1 
ATOM   325   C CG    . LYS A 1 44  ? 15.037  12.401  8.224   1.00 23.44  ? 44   LYS A CG    1 
ATOM   326   C CD    . LYS A 1 44  ? 16.384  12.529  8.913   1.00 26.35  ? 44   LYS A CD    1 
ATOM   327   C CE    . LYS A 1 44  ? 17.013  11.146  9.140   1.00 30.58  ? 44   LYS A CE    1 
ATOM   328   N NZ    . LYS A 1 44  ? 16.800  10.184  7.974   1.00 31.27  ? 44   LYS A NZ    1 
ATOM   329   N N     . ILE A 1 45  ? 12.508  16.516  8.343   1.00 20.86  ? 45   ILE A N     1 
ATOM   330   C CA    . ILE A 1 45  ? 11.947  17.787  7.882   1.00 20.50  ? 45   ILE A CA    1 
ATOM   331   C C     . ILE A 1 45  ? 12.921  18.947  8.238   1.00 20.35  ? 45   ILE A C     1 
ATOM   332   O O     . ILE A 1 45  ? 12.866  20.020  7.651   1.00 20.44  ? 45   ILE A O     1 
ATOM   333   C CB    . ILE A 1 45  ? 10.470  18.011  8.385   1.00 20.63  ? 45   ILE A CB    1 
ATOM   334   C CG1   . ILE A 1 45  ? 9.750   19.078  7.522   1.00 20.55  ? 45   ILE A CG1   1 
ATOM   335   C CG2   . ILE A 1 45  ? 10.424  18.318  9.906   1.00 18.47  ? 45   ILE A CG2   1 
ATOM   336   C CD1   . ILE A 1 45  ? 8.227   19.108  7.713   1.00 19.58  ? 45   ILE A CD1   1 
ATOM   337   N N     . LEU A 1 46  ? 13.844  18.701  9.162   1.00 20.10  ? 46   LEU A N     1 
ATOM   338   C CA    . LEU A 1 46  ? 14.836  19.723  9.520   1.00 20.57  ? 46   LEU A CA    1 
ATOM   339   C C     . LEU A 1 46  ? 16.272  19.357  9.136   1.00 20.82  ? 46   LEU A C     1 
ATOM   340   O O     . LEU A 1 46  ? 16.588  18.199  8.826   1.00 20.63  ? 46   LEU A O     1 
ATOM   341   C CB    . LEU A 1 46  ? 14.786  20.032  11.029  1.00 20.42  ? 46   LEU A CB    1 
ATOM   342   C CG    . LEU A 1 46  ? 13.457  20.284  11.743  1.00 19.45  ? 46   LEU A CG    1 
ATOM   343   C CD1   . LEU A 1 46  ? 13.789  20.624  13.195  1.00 17.27  ? 46   LEU A CD1   1 
ATOM   344   C CD2   . LEU A 1 46  ? 12.603  21.410  11.056  1.00 18.67  ? 46   LEU A CD2   1 
ATOM   345   N N     . ASP A 1 47  ? 17.135  20.365  9.174   1.00 21.11  ? 47   ASP A N     1 
ATOM   346   C CA    . ASP A 1 47  ? 18.565  20.171  9.035   1.00 21.76  ? 47   ASP A CA    1 
ATOM   347   C C     . ASP A 1 47  ? 19.142  20.004  10.420  1.00 21.66  ? 47   ASP A C     1 
ATOM   348   O O     . ASP A 1 47  ? 18.925  20.849  11.288  1.00 21.55  ? 47   ASP A O     1 
ATOM   349   C CB    . ASP A 1 47  ? 19.219  21.381  8.357   1.00 21.69  ? 47   ASP A CB    1 
ATOM   350   C CG    . ASP A 1 47  ? 18.945  21.433  6.868   1.00 22.87  ? 47   ASP A CG    1 
ATOM   351   O OD1   . ASP A 1 47  ? 19.676  22.164  6.167   1.00 24.21  ? 47   ASP A OD1   1 
ATOM   352   O OD2   . ASP A 1 47  ? 18.007  20.755  6.387   1.00 25.09  ? 47   ASP A OD2   1 
ATOM   353   N N     . TRP A 1 48  ? 19.884  18.921  10.615  1.00 21.88  ? 48   TRP A N     1 
ATOM   354   C CA    . TRP A 1 48  ? 20.556  18.687  11.871  1.00 22.49  ? 48   TRP A CA    1 
ATOM   355   C C     . TRP A 1 48  ? 22.059  18.830  11.683  1.00 23.51  ? 48   TRP A C     1 
ATOM   356   O O     . TRP A 1 48  ? 22.604  18.406  10.664  1.00 23.15  ? 48   TRP A O     1 
ATOM   357   C CB    . TRP A 1 48  ? 20.204  17.308  12.423  1.00 22.09  ? 48   TRP A CB    1 
ATOM   358   C CG    . TRP A 1 48  ? 18.735  17.174  12.728  1.00 22.04  ? 48   TRP A CG    1 
ATOM   359   C CD1   . TRP A 1 48  ? 17.729  16.953  11.830  1.00 20.86  ? 48   TRP A CD1   1 
ATOM   360   C CD2   . TRP A 1 48  ? 18.111  17.258  14.022  1.00 21.14  ? 48   TRP A CD2   1 
ATOM   361   N NE1   . TRP A 1 48  ? 16.518  16.912  12.478  1.00 22.75  ? 48   TRP A NE1   1 
ATOM   362   C CE2   . TRP A 1 48  ? 16.722  17.094  13.825  1.00 21.97  ? 48   TRP A CE2   1 
ATOM   363   C CE3   . TRP A 1 48  ? 18.591  17.480  15.323  1.00 20.89  ? 48   TRP A CE3   1 
ATOM   364   C CZ2   . TRP A 1 48  ? 15.805  17.122  14.883  1.00 20.94  ? 48   TRP A CZ2   1 
ATOM   365   C CZ3   . TRP A 1 48  ? 17.688  17.500  16.376  1.00 20.86  ? 48   TRP A CZ3   1 
ATOM   366   C CH2   . TRP A 1 48  ? 16.303  17.324  16.148  1.00 21.65  ? 48   TRP A CH2   1 
ATOM   367   N N     . ILE A 1 49  ? 22.727  19.442  12.667  1.00 24.56  ? 49   ILE A N     1 
ATOM   368   C CA    . ILE A 1 49  ? 24.174  19.620  12.587  1.00 24.86  ? 49   ILE A CA    1 
ATOM   369   C C     . ILE A 1 49  ? 24.882  18.292  12.919  1.00 25.50  ? 49   ILE A C     1 
ATOM   370   O O     . ILE A 1 49  ? 25.678  17.793  12.128  1.00 26.04  ? 49   ILE A O     1 
ATOM   371   C CB    . ILE A 1 49  ? 24.649  20.831  13.411  1.00 24.97  ? 49   ILE A CB    1 
ATOM   372   C CG1   . ILE A 1 49  ? 23.915  22.093  12.923  1.00 23.26  ? 49   ILE A CG1   1 
ATOM   373   C CG2   . ILE A 1 49  ? 26.178  20.999  13.263  1.00 25.57  ? 49   ILE A CG2   1 
ATOM   374   C CD1   . ILE A 1 49  ? 24.001  23.292  13.811  1.00 21.02  ? 49   ILE A CD1   1 
ATOM   375   N N     . THR A 1 50  ? 24.572  17.708  14.068  1.00 25.51  ? 50   THR A N     1 
ATOM   376   C CA    . THR A 1 50  ? 24.882  16.301  14.292  1.00 25.50  ? 50   THR A CA    1 
ATOM   377   C C     . THR A 1 50  ? 23.543  15.528  14.421  1.00 25.48  ? 50   THR A C     1 
ATOM   378   O O     . THR A 1 50  ? 22.637  15.959  15.146  1.00 24.98  ? 50   THR A O     1 
ATOM   379   C CB    . THR A 1 50  ? 25.845  16.081  15.487  1.00 25.62  ? 50   THR A CB    1 
ATOM   380   O OG1   . THR A 1 50  ? 25.120  15.952  16.704  1.00 26.61  ? 50   THR A OG1   1 
ATOM   381   C CG2   . THR A 1 50  ? 26.807  17.246  15.636  1.00 26.48  ? 50   THR A CG2   1 
ATOM   382   N N     . PRO A 1 51  ? 23.405  14.403  13.687  1.00 25.64  ? 51   PRO A N     1 
ATOM   383   C CA    . PRO A 1 51  ? 22.130  13.706  13.630  1.00 25.38  ? 51   PRO A CA    1 
ATOM   384   C C     . PRO A 1 51  ? 21.829  13.042  14.963  1.00 24.93  ? 51   PRO A C     1 
ATOM   385   O O     . PRO A 1 51  ? 22.743  12.676  15.679  1.00 25.55  ? 51   PRO A O     1 
ATOM   386   C CB    . PRO A 1 51  ? 22.365  12.620  12.562  1.00 25.67  ? 51   PRO A CB    1 
ATOM   387   C CG    . PRO A 1 51  ? 23.642  12.971  11.894  1.00 25.62  ? 51   PRO A CG    1 
ATOM   388   C CD    . PRO A 1 51  ? 24.440  13.695  12.909  1.00 25.61  ? 51   PRO A CD    1 
ATOM   389   N N     . TYR A 1 52  ? 20.554  12.919  15.293  1.00 24.20  ? 52   TYR A N     1 
ATOM   390   C CA    . TYR A 1 52  ? 20.123  12.169  16.448  1.00 23.20  ? 52   TYR A CA    1 
ATOM   391   C C     . TYR A 1 52  ? 20.212  10.685  16.138  1.00 24.06  ? 52   TYR A C     1 
ATOM   392   O O     . TYR A 1 52  ? 20.285  10.278  14.969  1.00 22.93  ? 52   TYR A O     1 
ATOM   393   C CB    . TYR A 1 52  ? 18.683  12.533  16.811  1.00 22.58  ? 52   TYR A CB    1 
ATOM   394   C CG    . TYR A 1 52  ? 17.724  12.517  15.636  1.00 21.28  ? 52   TYR A CG    1 
ATOM   395   C CD1   . TYR A 1 52  ? 17.157  11.314  15.166  1.00 19.36  ? 52   TYR A CD1   1 
ATOM   396   C CD2   . TYR A 1 52  ? 17.385  13.702  14.986  1.00 20.64  ? 52   TYR A CD2   1 
ATOM   397   C CE1   . TYR A 1 52  ? 16.284  11.305  14.062  1.00 19.12  ? 52   TYR A CE1   1 
ATOM   398   C CE2   . TYR A 1 52  ? 16.509  13.705  13.894  1.00 21.01  ? 52   TYR A CE2   1 
ATOM   399   C CZ    . TYR A 1 52  ? 15.963  12.508  13.433  1.00 21.24  ? 52   TYR A CZ    1 
ATOM   400   O OH    . TYR A 1 52  ? 15.099  12.548  12.347  1.00 21.09  ? 52   TYR A OH    1 
ATOM   401   N N     . GLN A 1 53  ? 20.223  9.885   17.201  1.00 25.09  ? 53   GLN A N     1 
ATOM   402   C CA    . GLN A 1 53  ? 20.105  8.436   17.084  1.00 26.57  ? 53   GLN A CA    1 
ATOM   403   C C     . GLN A 1 53  ? 18.909  7.992   17.909  1.00 25.74  ? 53   GLN A C     1 
ATOM   404   O O     . GLN A 1 53  ? 18.086  7.216   17.440  1.00 25.46  ? 53   GLN A O     1 
ATOM   405   C CB    . GLN A 1 53  ? 21.389  7.708   17.524  1.00 27.01  ? 53   GLN A CB    1 
ATOM   406   C CG    . GLN A 1 53  ? 22.584  7.896   16.555  1.00 32.48  ? 53   GLN A CG    1 
ATOM   407   C CD    . GLN A 1 53  ? 23.687  8.806   17.128  1.00 38.47  ? 53   GLN A CD    1 
ATOM   408   O OE1   . GLN A 1 53  ? 24.383  8.424   18.080  1.00 40.72  ? 53   GLN A OE1   1 
ATOM   409   N NE2   . GLN A 1 53  ? 23.860  10.002  16.538  1.00 39.53  ? 53   GLN A NE2   1 
ATOM   410   N N     . LYS A 1 54  ? 18.814  8.500   19.137  1.00 25.48  ? 54   LYS A N     1 
ATOM   411   C CA    . LYS A 1 54  ? 17.596  8.332   19.925  1.00 24.78  ? 54   LYS A CA    1 
ATOM   412   C C     . LYS A 1 54  ? 16.511  9.236   19.354  1.00 24.09  ? 54   LYS A C     1 
ATOM   413   O O     . LYS A 1 54  ? 16.787  10.364  18.901  1.00 23.86  ? 54   LYS A O     1 
ATOM   414   C CB    . LYS A 1 54  ? 17.837  8.600   21.416  1.00 25.43  ? 54   LYS A CB    1 
ATOM   415   N N     . VAL A 1 55  ? 15.293  8.703   19.318  1.00 23.26  ? 55   VAL A N     1 
ATOM   416   C CA    . VAL A 1 55  ? 14.126  9.459   18.896  1.00 22.65  ? 55   VAL A CA    1 
ATOM   417   C C     . VAL A 1 55  ? 13.230  9.704   20.115  1.00 23.05  ? 55   VAL A C     1 
ATOM   418   O O     . VAL A 1 55  ? 13.382  10.736  20.773  1.00 23.90  ? 55   VAL A O     1 
ATOM   419   C CB    . VAL A 1 55  ? 13.378  8.797   17.681  1.00 23.13  ? 55   VAL A CB    1 
ATOM   420   C CG1   . VAL A 1 55  ? 12.158  9.629   17.263  1.00 21.17  ? 55   VAL A CG1   1 
ATOM   421   C CG2   . VAL A 1 55  ? 14.334  8.574   16.497  1.00 19.46  ? 55   VAL A CG2   1 
ATOM   422   N N     . LYS A 1 56  ? 12.336  8.767   20.441  1.00 22.42  ? 56   LYS A N     1 
ATOM   423   C CA    . LYS A 1 56  ? 11.406  8.945   21.561  1.00 21.55  ? 56   LYS A CA    1 
ATOM   424   C C     . LYS A 1 56  ? 11.995  8.454   22.888  1.00 21.92  ? 56   LYS A C     1 
ATOM   425   O O     . LYS A 1 56  ? 12.434  7.304   22.993  1.00 21.19  ? 56   LYS A O     1 
ATOM   426   C CB    . LYS A 1 56  ? 10.079  8.219   21.286  1.00 21.67  ? 56   LYS A CB    1 
ATOM   427   C CG    . LYS A 1 56  ? 9.002   8.439   22.354  1.00 19.89  ? 56   LYS A CG    1 
ATOM   428   C CD    . LYS A 1 56  ? 7.825   7.536   22.099  1.00 20.51  ? 56   LYS A CD    1 
ATOM   429   C CE    . LYS A 1 56  ? 6.570   7.994   22.803  1.00 20.86  ? 56   LYS A CE    1 
ATOM   430   N NZ    . LYS A 1 56  ? 6.643   7.968   24.311  1.00 20.92  ? 56   LYS A NZ    1 
ATOM   431   N N     . ASN A 1 57  ? 11.973  9.320   23.900  1.00 21.44  ? 57   ASN A N     1 
ATOM   432   C CA    . ASN A 1 57  ? 12.495  8.983   25.230  1.00 21.29  ? 57   ASN A CA    1 
ATOM   433   C C     . ASN A 1 57  ? 11.752  9.745   26.332  1.00 20.84  ? 57   ASN A C     1 
ATOM   434   O O     . ASN A 1 57  ? 12.257  10.694  26.946  1.00 20.63  ? 57   ASN A O     1 
ATOM   435   C CB    . ASN A 1 57  ? 14.006  9.227   25.334  1.00 21.32  ? 57   ASN A CB    1 
ATOM   436   C CG    . ASN A 1 57  ? 14.598  8.632   26.607  1.00 23.28  ? 57   ASN A CG    1 
ATOM   437   O OD1   . ASN A 1 57  ? 13.940  7.850   27.290  1.00 24.03  ? 57   ASN A OD1   1 
ATOM   438   N ND2   . ASN A 1 57  ? 15.838  9.000   26.931  1.00 23.58  ? 57   ASN A ND2   1 
ATOM   439   N N     . THR A 1 58  ? 10.544  9.279   26.594  1.00 20.40  ? 58   THR A N     1 
ATOM   440   C CA    . THR A 1 58  ? 9.594   10.012  27.404  1.00 19.39  ? 58   THR A CA    1 
ATOM   441   C C     . THR A 1 58  ? 9.048   9.095   28.506  1.00 19.35  ? 58   THR A C     1 
ATOM   442   O O     . THR A 1 58  ? 9.067   7.870   28.372  1.00 17.89  ? 58   THR A O     1 
ATOM   443   C CB    . THR A 1 58  ? 8.453   10.530  26.495  1.00 19.13  ? 58   THR A CB    1 
ATOM   444   O OG1   . THR A 1 58  ? 7.714   9.421   25.966  1.00 16.81  ? 58   THR A OG1   1 
ATOM   445   C CG2   . THR A 1 58  ? 9.030   11.344  25.302  1.00 18.31  ? 58   THR A CG2   1 
ATOM   446   N N     . SER A 1 59  ? 8.569   9.709   29.589  1.00 19.41  ? 59   SER A N     1 
ATOM   447   C CA    . SER A 1 59  ? 7.810   9.015   30.632  1.00 19.55  ? 59   SER A CA    1 
ATOM   448   C C     . SER A 1 59  ? 6.827   10.000  31.228  1.00 19.22  ? 59   SER A C     1 
ATOM   449   O O     . SER A 1 59  ? 7.164   11.153  31.395  1.00 20.27  ? 59   SER A O     1 
ATOM   450   C CB    . SER A 1 59  ? 8.748   8.485   31.730  1.00 19.93  ? 59   SER A CB    1 
ATOM   451   O OG    . SER A 1 59  ? 8.018   7.948   32.829  1.00 19.98  ? 59   SER A OG    1 
ATOM   452   N N     . PHE A 1 60  ? 5.625   9.540   31.553  1.00 19.04  ? 60   PHE A N     1 
ATOM   453   C CA    . PHE A 1 60  ? 4.619   10.345  32.245  1.00 18.86  ? 60   PHE A CA    1 
ATOM   454   C C     . PHE A 1 60  ? 4.458   9.859   33.692  1.00 19.27  ? 60   PHE A C     1 
ATOM   455   O O     . PHE A 1 60  ? 3.578   10.316  34.419  1.00 18.77  ? 60   PHE A O     1 
ATOM   456   C CB    . PHE A 1 60  ? 3.258   10.237  31.535  1.00 18.62  ? 60   PHE A CB    1 
ATOM   457   C CG    . PHE A 1 60  ? 3.151   11.012  30.238  1.00 19.31  ? 60   PHE A CG    1 
ATOM   458   C CD1   . PHE A 1 60  ? 2.003   10.871  29.427  1.00 18.88  ? 60   PHE A CD1   1 
ATOM   459   C CD2   . PHE A 1 60  ? 4.182   11.868  29.801  1.00 17.54  ? 60   PHE A CD2   1 
ATOM   460   C CE1   . PHE A 1 60  ? 1.875   11.603  28.213  1.00 17.53  ? 60   PHE A CE1   1 
ATOM   461   C CE2   . PHE A 1 60  ? 4.066   12.583  28.596  1.00 16.04  ? 60   PHE A CE2   1 
ATOM   462   C CZ    . PHE A 1 60  ? 2.914   12.455  27.803  1.00 16.50  ? 60   PHE A CZ    1 
ATOM   463   N N     . ALA A 1 61  ? 5.300   8.909   34.098  1.00 20.18  ? 61   ALA A N     1 
ATOM   464   C CA    . ALA A 1 61  ? 5.163   8.226   35.394  1.00 20.90  ? 61   ALA A CA    1 
ATOM   465   C C     . ALA A 1 61  ? 5.341   9.146   36.623  1.00 21.75  ? 61   ALA A C     1 
ATOM   466   O O     . ALA A 1 61  ? 6.222   10.015  36.615  1.00 21.63  ? 61   ALA A O     1 
ATOM   467   C CB    . ALA A 1 61  ? 6.141   7.045   35.463  1.00 20.32  ? 61   ALA A CB    1 
ATOM   468   N N     . PRO A 1 62  ? 4.519   8.938   37.689  1.00 22.44  ? 62   PRO A N     1 
ATOM   469   C CA    . PRO A 1 62  ? 4.639   9.710   38.933  1.00 22.83  ? 62   PRO A CA    1 
ATOM   470   C C     . PRO A 1 62  ? 6.079   9.765   39.442  1.00 23.35  ? 62   PRO A C     1 
ATOM   471   O O     . PRO A 1 62  ? 6.777   8.733   39.457  1.00 23.12  ? 62   PRO A O     1 
ATOM   472   C CB    . PRO A 1 62  ? 3.753   8.939   39.912  1.00 22.82  ? 62   PRO A CB    1 
ATOM   473   C CG    . PRO A 1 62  ? 2.694   8.323   39.038  1.00 23.15  ? 62   PRO A CG    1 
ATOM   474   C CD    . PRO A 1 62  ? 3.426   7.937   37.771  1.00 22.78  ? 62   PRO A CD    1 
ATOM   475   N N     . GLY A 1 63  ? 6.522   10.969  39.810  1.00 23.36  ? 63   GLY A N     1 
ATOM   476   C CA    . GLY A 1 63  ? 7.910   11.222  40.238  1.00 24.34  ? 63   GLY A CA    1 
ATOM   477   C C     . GLY A 1 63  ? 8.987   11.078  39.162  1.00 25.09  ? 63   GLY A C     1 
ATOM   478   O O     . GLY A 1 63  ? 10.184  11.225  39.444  1.00 25.32  ? 63   GLY A O     1 
ATOM   479   N N     . ASN A 1 64  ? 8.574   10.772  37.934  1.00 25.31  ? 64   ASN A N     1 
ATOM   480   C CA    . ASN A 1 64  ? 9.512   10.596  36.817  1.00 25.83  ? 64   ASN A CA    1 
ATOM   481   C C     . ASN A 1 64  ? 8.966   11.108  35.489  1.00 24.62  ? 64   ASN A C     1 
ATOM   482   O O     . ASN A 1 64  ? 9.059   10.425  34.473  1.00 24.72  ? 64   ASN A O     1 
ATOM   483   C CB    . ASN A 1 64  ? 9.883   9.121   36.663  1.00 26.80  ? 64   ASN A CB    1 
ATOM   484   C CG    . ASN A 1 64  ? 11.230  8.797   37.266  1.00 31.07  ? 64   ASN A CG    1 
ATOM   485   O OD1   . ASN A 1 64  ? 12.267  9.326   36.829  1.00 35.69  ? 64   ASN A OD1   1 
ATOM   486   N ND2   . ASN A 1 64  ? 11.231  7.925   38.279  1.00 32.95  ? 64   ASN A ND2   1 
ATOM   487   N N     . VAL A 1 65  ? 8.387   12.301  35.506  1.00 23.20  ? 65   VAL A N     1 
ATOM   488   C CA    . VAL A 1 65  ? 7.880   12.913  34.296  1.00 22.21  ? 65   VAL A CA    1 
ATOM   489   C C     . VAL A 1 65  ? 9.085   13.457  33.541  1.00 21.52  ? 65   VAL A C     1 
ATOM   490   O O     . VAL A 1 65  ? 9.782   14.351  34.005  1.00 21.74  ? 65   VAL A O     1 
ATOM   491   C CB    . VAL A 1 65  ? 6.819   14.013  34.610  1.00 22.11  ? 65   VAL A CB    1 
ATOM   492   C CG1   . VAL A 1 65  ? 6.344   14.664  33.343  1.00 22.24  ? 65   VAL A CG1   1 
ATOM   493   C CG2   . VAL A 1 65  ? 5.633   13.411  35.372  1.00 21.42  ? 65   VAL A CG2   1 
ATOM   494   N N     . SER A 1 66  ? 9.348   12.891  32.380  1.00 20.84  ? 66   SER A N     1 
ATOM   495   C CA    . SER A 1 66  ? 10.562  13.211  31.652  1.00 20.40  ? 66   SER A CA    1 
ATOM   496   C C     . SER A 1 66  ? 10.334  13.027  30.160  1.00 19.66  ? 66   SER A C     1 
ATOM   497   O O     . SER A 1 66  ? 9.960   11.942  29.702  1.00 19.44  ? 66   SER A O     1 
ATOM   498   C CB    . SER A 1 66  ? 11.717  12.332  32.145  1.00 20.61  ? 66   SER A CB    1 
ATOM   499   O OG    . SER A 1 66  ? 12.934  12.748  31.561  1.00 22.27  ? 66   SER A OG    1 
ATOM   500   N N     . ILE A 1 67  ? 10.568  14.093  29.404  1.00 18.74  ? 67   ILE A N     1 
ATOM   501   C CA    . ILE A 1 67  ? 10.189  14.123  27.992  1.00 18.20  ? 67   ILE A CA    1 
ATOM   502   C C     . ILE A 1 67  ? 11.381  14.534  27.133  1.00 18.27  ? 67   ILE A C     1 
ATOM   503   O O     . ILE A 1 67  ? 11.887  15.662  27.230  1.00 18.26  ? 67   ILE A O     1 
ATOM   504   C CB    . ILE A 1 67  ? 8.963   15.063  27.735  1.00 17.58  ? 67   ILE A CB    1 
ATOM   505   C CG1   . ILE A 1 67  ? 7.757   14.636  28.594  1.00 17.37  ? 67   ILE A CG1   1 
ATOM   506   C CG2   . ILE A 1 67  ? 8.620   15.123  26.248  1.00 16.80  ? 67   ILE A CG2   1 
ATOM   507   C CD1   . ILE A 1 67  ? 6.907   15.817  29.132  1.00 14.28  ? 67   ILE A CD1   1 
ATOM   508   N N     . LYS A 1 68  ? 11.823  13.611  26.286  1.00 18.00  ? 68   LYS A N     1 
ATOM   509   C CA    . LYS A 1 68  ? 12.943  13.887  25.426  1.00 17.90  ? 68   LYS A CA    1 
ATOM   510   C C     . LYS A 1 68  ? 12.720  13.342  24.032  1.00 17.99  ? 68   LYS A C     1 
ATOM   511   O O     . LYS A 1 68  ? 12.238  12.217  23.852  1.00 18.28  ? 68   LYS A O     1 
ATOM   512   C CB    . LYS A 1 68  ? 14.233  13.354  26.043  1.00 18.21  ? 68   LYS A CB    1 
ATOM   513   C CG    . LYS A 1 68  ? 14.740  14.198  27.185  1.00 19.03  ? 68   LYS A CG    1 
ATOM   514   C CD    . LYS A 1 68  ? 15.972  13.592  27.820  1.00 22.97  ? 68   LYS A CD    1 
ATOM   515   C CE    . LYS A 1 68  ? 16.392  14.401  29.032  1.00 26.01  ? 68   LYS A CE    1 
ATOM   516   N NZ    . LYS A 1 68  ? 17.179  13.521  29.951  1.00 30.40  ? 68   LYS A NZ    1 
ATOM   517   N N     . TRP A 1 69  ? 13.050  14.167  23.052  1.00 17.19  ? 69   TRP A N     1 
ATOM   518   C CA    . TRP A 1 69  ? 12.985  13.782  21.675  1.00 17.00  ? 69   TRP A CA    1 
ATOM   519   C C     . TRP A 1 69  ? 14.257  14.207  20.972  1.00 17.51  ? 69   TRP A C     1 
ATOM   520   O O     . TRP A 1 69  ? 14.755  15.336  21.177  1.00 16.80  ? 69   TRP A O     1 
ATOM   521   C CB    . TRP A 1 69  ? 11.775  14.411  20.981  1.00 16.62  ? 69   TRP A CB    1 
ATOM   522   C CG    . TRP A 1 69  ? 10.445  13.843  21.433  1.00 16.64  ? 69   TRP A CG    1 
ATOM   523   C CD1   . TRP A 1 69  ? 9.719   14.234  22.519  1.00 15.99  ? 69   TRP A CD1   1 
ATOM   524   C CD2   . TRP A 1 69  ? 9.699   12.791  20.806  1.00 15.00  ? 69   TRP A CD2   1 
ATOM   525   N NE1   . TRP A 1 69  ? 8.554   13.496  22.598  1.00 16.77  ? 69   TRP A NE1   1 
ATOM   526   C CE2   . TRP A 1 69  ? 8.516   12.609  21.559  1.00 14.21  ? 69   TRP A CE2   1 
ATOM   527   C CE3   . TRP A 1 69  ? 9.911   11.992  19.672  1.00 16.51  ? 69   TRP A CE3   1 
ATOM   528   C CZ2   . TRP A 1 69  ? 7.554   11.656  21.232  1.00 14.32  ? 69   TRP A CZ2   1 
ATOM   529   C CZ3   . TRP A 1 69  ? 8.944   11.052  19.333  1.00 15.97  ? 69   TRP A CZ3   1 
ATOM   530   C CH2   . TRP A 1 69  ? 7.774   10.893  20.117  1.00 15.79  ? 69   TRP A CH2   1 
ATOM   531   N N     . TYR A 1 70  ? 14.780  13.286  20.152  1.00 17.75  ? 70   TYR A N     1 
ATOM   532   C CA    . TYR A 1 70  ? 15.963  13.538  19.340  1.00 18.41  ? 70   TYR A CA    1 
ATOM   533   C C     . TYR A 1 70  ? 17.146  14.006  20.180  1.00 18.91  ? 70   TYR A C     1 
ATOM   534   O O     . TYR A 1 70  ? 17.994  14.758  19.693  1.00 19.34  ? 70   TYR A O     1 
ATOM   535   C CB    . TYR A 1 70  ? 15.655  14.614  18.289  1.00 17.49  ? 70   TYR A CB    1 
ATOM   536   C CG    . TYR A 1 70  ? 14.432  14.352  17.458  1.00 17.38  ? 70   TYR A CG    1 
ATOM   537   C CD1   . TYR A 1 70  ? 13.325  15.213  17.532  1.00 15.68  ? 70   TYR A CD1   1 
ATOM   538   C CD2   . TYR A 1 70  ? 14.368  13.243  16.588  1.00 16.61  ? 70   TYR A CD2   1 
ATOM   539   C CE1   . TYR A 1 70  ? 12.182  14.987  16.754  1.00 15.54  ? 70   TYR A CE1   1 
ATOM   540   C CE2   . TYR A 1 70  ? 13.224  13.004  15.804  1.00 14.72  ? 70   TYR A CE2   1 
ATOM   541   C CZ    . TYR A 1 70  ? 12.140  13.885  15.891  1.00 15.59  ? 70   TYR A CZ    1 
ATOM   542   O OH    . TYR A 1 70  ? 11.009  13.677  15.127  1.00 15.52  ? 70   TYR A OH    1 
ATOM   543   N N     . GLU A 1 71  ? 17.217  13.548  21.424  1.00 19.78  ? 71   GLU A N     1 
ATOM   544   C CA    . GLU A 1 71  ? 18.057  14.202  22.442  1.00 21.24  ? 71   GLU A CA    1 
ATOM   545   C C     . GLU A 1 71  ? 19.561  14.347  22.135  1.00 21.34  ? 71   GLU A C     1 
ATOM   546   O O     . GLU A 1 71  ? 20.218  15.267  22.641  1.00 20.83  ? 71   GLU A O     1 
ATOM   547   C CB    . GLU A 1 71  ? 17.839  13.544  23.803  1.00 21.17  ? 71   GLU A CB    1 
ATOM   548   C CG    . GLU A 1 71  ? 18.516  12.191  23.980  1.00 22.45  ? 71   GLU A CG    1 
ATOM   549   C CD    . GLU A 1 71  ? 17.970  11.432  25.189  1.00 22.53  ? 71   GLU A CD    1 
ATOM   550   O OE1   . GLU A 1 71  ? 16.886  10.819  25.056  1.00 25.08  ? 71   GLU A OE1   1 
ATOM   551   O OE2   . GLU A 1 71  ? 18.613  11.454  26.263  1.00 22.77  ? 71   GLU A OE2   1 
ATOM   552   N N     . ASP A 1 72  ? 20.093  13.452  21.302  1.00 22.08  ? 72   ASP A N     1 
ATOM   553   C CA    . ASP A 1 72  ? 21.542  13.392  21.059  1.00 22.92  ? 72   ASP A CA    1 
ATOM   554   C C     . ASP A 1 72  ? 21.905  14.097  19.762  1.00 22.99  ? 72   ASP A C     1 
ATOM   555   O O     . ASP A 1 72  ? 23.036  14.019  19.294  1.00 23.38  ? 72   ASP A O     1 
ATOM   556   C CB    . ASP A 1 72  ? 22.060  11.933  21.079  1.00 23.38  ? 72   ASP A CB    1 
ATOM   557   C CG    . ASP A 1 72  ? 21.249  10.979  20.168  1.00 24.14  ? 72   ASP A CG    1 
ATOM   558   O OD1   . ASP A 1 72  ? 20.235  11.373  19.574  1.00 24.80  ? 72   ASP A OD1   1 
ATOM   559   O OD2   . ASP A 1 72  ? 21.626  9.797   20.067  1.00 27.25  ? 72   ASP A OD2   1 
ATOM   560   N N     . GLY A 1 73  ? 20.926  14.787  19.193  1.00 22.79  ? 73   GLY A N     1 
ATOM   561   C CA    . GLY A 1 73  ? 21.124  15.530  17.976  1.00 22.74  ? 73   GLY A CA    1 
ATOM   562   C C     . GLY A 1 73  ? 21.265  16.999  18.292  1.00 23.16  ? 73   GLY A C     1 
ATOM   563   O O     . GLY A 1 73  ? 20.826  17.468  19.366  1.00 22.90  ? 73   GLY A O     1 
ATOM   564   N N     . THR A 1 74  ? 21.902  17.721  17.366  1.00 22.61  ? 74   THR A N     1 
ATOM   565   C CA    . THR A 1 74  ? 22.036  19.165  17.487  1.00 22.10  ? 74   THR A CA    1 
ATOM   566   C C     . THR A 1 74  ? 21.505  19.841  16.224  1.00 21.60  ? 74   THR A C     1 
ATOM   567   O O     . THR A 1 74  ? 21.457  19.228  15.152  1.00 21.47  ? 74   THR A O     1 
ATOM   568   C CB    . THR A 1 74  ? 23.500  19.579  17.736  1.00 22.49  ? 74   THR A CB    1 
ATOM   569   O OG1   . THR A 1 74  ? 24.283  19.259  16.578  1.00 23.25  ? 74   THR A OG1   1 
ATOM   570   C CG2   . THR A 1 74  ? 24.074  18.849  18.965  1.00 21.05  ? 74   THR A CG2   1 
ATOM   571   N N     . LEU A 1 75  ? 21.102  21.101  16.372  1.00 21.19  ? 75   LEU A N     1 
ATOM   572   C CA    . LEU A 1 75  ? 20.515  21.909  15.299  1.00 20.62  ? 75   LEU A CA    1 
ATOM   573   C C     . LEU A 1 75  ? 20.503  23.366  15.697  1.00 21.12  ? 75   LEU A C     1 
ATOM   574   O O     . LEU A 1 75  ? 20.839  23.710  16.827  1.00 21.02  ? 75   LEU A O     1 
ATOM   575   C CB    . LEU A 1 75  ? 19.073  21.468  14.987  1.00 20.13  ? 75   LEU A CB    1 
ATOM   576   C CG    . LEU A 1 75  ? 17.915  21.751  15.957  1.00 19.28  ? 75   LEU A CG    1 
ATOM   577   C CD1   . LEU A 1 75  ? 16.615  21.385  15.288  1.00 18.12  ? 75   LEU A CD1   1 
ATOM   578   C CD2   . LEU A 1 75  ? 18.042  21.001  17.313  1.00 15.95  ? 75   LEU A CD2   1 
ATOM   579   N N     . ASN A 1 76  ? 20.104  24.219  14.757  1.00 21.75  ? 76   ASN A N     1 
ATOM   580   C CA    . ASN A 1 76  ? 19.837  25.627  15.048  1.00 21.99  ? 76   ASN A CA    1 
ATOM   581   C C     . ASN A 1 76  ? 18.500  26.023  14.413  1.00 21.74  ? 76   ASN A C     1 
ATOM   582   O O     . ASN A 1 76  ? 18.316  25.834  13.193  1.00 22.00  ? 76   ASN A O     1 
ATOM   583   C CB    . ASN A 1 76  ? 20.977  26.516  14.533  1.00 21.93  ? 76   ASN A CB    1 
ATOM   584   C CG    . ASN A 1 76  ? 20.902  27.942  15.079  1.00 23.21  ? 76   ASN A CG    1 
ATOM   585   O OD1   . ASN A 1 76  ? 21.717  28.357  15.924  1.00 24.73  ? 76   ASN A OD1   1 
ATOM   586   N ND2   . ASN A 1 76  ? 19.918  28.691  14.614  1.00 21.68  ? 76   ASN A ND2   1 
ATOM   587   N N     . LEU A 1 77  ? 17.568  26.540  15.226  1.00 20.70  ? 77   LEU A N     1 
ATOM   588   C CA    . LEU A 1 77  ? 16.217  26.880  14.725  1.00 19.97  ? 77   LEU A CA    1 
ATOM   589   C C     . LEU A 1 77  ? 16.279  28.020  13.695  1.00 19.72  ? 77   LEU A C     1 
ATOM   590   O O     . LEU A 1 77  ? 15.569  27.997  12.656  1.00 18.91  ? 77   LEU A O     1 
ATOM   591   C CB    . LEU A 1 77  ? 15.242  27.207  15.876  1.00 19.96  ? 77   LEU A CB    1 
ATOM   592   C CG    . LEU A 1 77  ? 13.853  27.794  15.528  1.00 19.90  ? 77   LEU A CG    1 
ATOM   593   C CD1   . LEU A 1 77  ? 12.844  27.493  16.585  1.00 15.98  ? 77   LEU A CD1   1 
ATOM   594   C CD2   . LEU A 1 77  ? 13.919  29.293  15.273  1.00 18.81  ? 77   LEU A CD2   1 
ATOM   595   N N     . ALA A 1 78  ? 17.151  28.996  13.963  1.00 19.31  ? 78   ALA A N     1 
ATOM   596   C CA    . ALA A 1 78  ? 17.352  30.099  13.016  1.00 19.69  ? 78   ALA A CA    1 
ATOM   597   C C     . ALA A 1 78  ? 17.903  29.626  11.656  1.00 19.99  ? 78   ALA A C     1 
ATOM   598   O O     . ALA A 1 78  ? 17.515  30.161  10.618  1.00 20.32  ? 78   ALA A O     1 
ATOM   599   C CB    . ALA A 1 78  ? 18.205  31.188  13.608  1.00 19.13  ? 78   ALA A CB    1 
ATOM   600   N N     . ALA A 1 79  ? 18.787  28.631  11.657  1.00 20.06  ? 79   ALA A N     1 
ATOM   601   C CA    . ALA A 1 79  ? 19.300  28.060  10.399  1.00 20.42  ? 79   ALA A CA    1 
ATOM   602   C C     . ALA A 1 79  ? 18.223  27.340  9.596   1.00 20.60  ? 79   ALA A C     1 
ATOM   603   O O     . ALA A 1 79  ? 18.175  27.456  8.368   1.00 21.69  ? 79   ALA A O     1 
ATOM   604   C CB    . ALA A 1 79  ? 20.490  27.147  10.643  1.00 19.93  ? 79   ALA A CB    1 
ATOM   605   N N     . ASN A 1 80  ? 17.354  26.617  10.289  1.00 20.75  ? 80   ASN A N     1 
ATOM   606   C CA    . ASN A 1 80  ? 16.238  25.919  9.649   1.00 20.51  ? 80   ASN A CA    1 
ATOM   607   C C     . ASN A 1 80  ? 15.140  26.841  9.117   1.00 20.01  ? 80   ASN A C     1 
ATOM   608   O O     . ASN A 1 80  ? 14.447  26.491  8.160   1.00 19.42  ? 80   ASN A O     1 
ATOM   609   C CB    . ASN A 1 80  ? 15.631  24.900  10.618  1.00 20.83  ? 80   ASN A CB    1 
ATOM   610   C CG    . ASN A 1 80  ? 16.384  23.602  10.624  1.00 21.14  ? 80   ASN A CG    1 
ATOM   611   O OD1   . ASN A 1 80  ? 16.112  22.729  9.818   1.00 23.40  ? 80   ASN A OD1   1 
ATOM   612   N ND2   . ASN A 1 80  ? 17.338  23.466  11.534  1.00 21.50  ? 80   ASN A ND2   1 
ATOM   613   N N     . CYS A 1 81  ? 14.987  28.003  9.751   1.00 19.49  ? 81   CYS A N     1 
ATOM   614   C CA    . CYS A 1 81  ? 13.965  28.978  9.365   1.00 19.18  ? 81   CYS A CA    1 
ATOM   615   C C     . CYS A 1 81  ? 14.514  29.998  8.390   1.00 19.11  ? 81   CYS A C     1 
ATOM   616   O O     . CYS A 1 81  ? 13.748  30.725  7.770   1.00 19.27  ? 81   CYS A O     1 
ATOM   617   C CB    . CYS A 1 81  ? 13.383  29.700  10.600  1.00 19.42  ? 81   CYS A CB    1 
ATOM   618   S SG    . CYS A 1 81  ? 12.433  28.611  11.700  1.00 19.53  ? 81   CYS A SG    1 
ATOM   619   N N     . LEU A 1 82  ? 15.832  30.046  8.224   1.00 19.40  ? 82   LEU A N     1 
ATOM   620   C CA    . LEU A 1 82  ? 16.443  31.121  7.438   1.00 19.75  ? 82   LEU A CA    1 
ATOM   621   C C     . LEU A 1 82  ? 17.576  30.672  6.532   1.00 20.39  ? 82   LEU A C     1 
ATOM   622   O O     . LEU A 1 82  ? 17.421  30.641  5.309   1.00 20.76  ? 82   LEU A O     1 
ATOM   623   C CB    . LEU A 1 82  ? 16.904  32.269  8.351   1.00 19.62  ? 82   LEU A CB    1 
ATOM   624   C CG    . LEU A 1 82  ? 15.875  32.977  9.254   1.00 20.09  ? 82   LEU A CG    1 
ATOM   625   C CD1   . LEU A 1 82  ? 16.559  33.779  10.367  1.00 20.73  ? 82   LEU A CD1   1 
ATOM   626   C CD2   . LEU A 1 82  ? 15.008  33.888  8.419   1.00 19.08  ? 82   LEU A CD2   1 
ATOM   627   N N     . ASP A 1 83  ? 18.714  30.333  7.134   1.00 21.18  ? 83   ASP A N     1 
ATOM   628   C CA    . ASP A 1 83  ? 19.948  30.045  6.405   1.00 21.77  ? 83   ASP A CA    1 
ATOM   629   C C     . ASP A 1 83  ? 19.763  29.015  5.305   1.00 21.64  ? 83   ASP A C     1 
ATOM   630   O O     . ASP A 1 83  ? 20.172  29.243  4.164   1.00 22.28  ? 83   ASP A O     1 
ATOM   631   C CB    . ASP A 1 83  ? 21.041  29.601  7.376   1.00 21.87  ? 83   ASP A CB    1 
ATOM   632   C CG    . ASP A 1 83  ? 21.304  30.631  8.455   1.00 23.10  ? 83   ASP A CG    1 
ATOM   633   O OD1   . ASP A 1 83  ? 22.454  31.135  8.530   1.00 22.79  ? 83   ASP A OD1   1 
ATOM   634   O OD2   . ASP A 1 83  ? 20.356  30.948  9.208   1.00 21.83  ? 83   ASP A OD2   1 
ATOM   635   N N     . ARG A 1 84  ? 19.118  27.898  5.633   1.00 21.54  ? 84   ARG A N     1 
ATOM   636   C CA    . ARG A 1 84  ? 18.975  26.807  4.662   1.00 20.84  ? 84   ARG A CA    1 
ATOM   637   C C     . ARG A 1 84  ? 18.139  27.196  3.422   1.00 21.29  ? 84   ARG A C     1 
ATOM   638   O O     . ARG A 1 84  ? 18.288  26.582  2.370   1.00 21.91  ? 84   ARG A O     1 
ATOM   639   C CB    . ARG A 1 84  ? 18.470  25.513  5.335   1.00 20.85  ? 84   ARG A CB    1 
ATOM   640   C CG    . ARG A 1 84  ? 17.028  25.526  5.854   1.00 19.79  ? 84   ARG A CG    1 
ATOM   641   C CD    . ARG A 1 84  ? 16.622  24.140  6.325   1.00 19.64  ? 84   ARG A CD    1 
ATOM   642   N NE    . ARG A 1 84  ? 15.254  24.065  6.844   1.00 16.48  ? 84   ARG A NE    1 
ATOM   643   C CZ    . ARG A 1 84  ? 14.544  22.938  6.934   1.00 14.69  ? 84   ARG A CZ    1 
ATOM   644   N NH1   . ARG A 1 84  ? 15.057  21.778  6.510   1.00 10.84  ? 84   ARG A NH1   1 
ATOM   645   N NH2   . ARG A 1 84  ? 13.312  22.966  7.437   1.00 10.57  ? 84   ARG A NH2   1 
ATOM   646   N N     . HIS A 1 85  ? 17.293  28.224  3.521   1.00 21.20  ? 85   HIS A N     1 
ATOM   647   C CA    . HIS A 1 85  ? 16.465  28.629  2.367   1.00 21.37  ? 85   HIS A CA    1 
ATOM   648   C C     . HIS A 1 85  ? 17.172  29.608  1.429   1.00 21.94  ? 85   HIS A C     1 
ATOM   649   O O     . HIS A 1 85  ? 16.706  29.842  0.321   1.00 21.57  ? 85   HIS A O     1 
ATOM   650   C CB    . HIS A 1 85  ? 15.108  29.224  2.813   1.00 21.05  ? 85   HIS A CB    1 
ATOM   651   C CG    . HIS A 1 85  ? 14.416  28.434  3.878   1.00 19.51  ? 85   HIS A CG    1 
ATOM   652   N ND1   . HIS A 1 85  ? 13.894  27.171  3.656   1.00 21.04  ? 85   HIS A ND1   1 
ATOM   653   C CD2   . HIS A 1 85  ? 14.177  28.718  5.179   1.00 15.77  ? 85   HIS A CD2   1 
ATOM   654   C CE1   . HIS A 1 85  ? 13.362  26.714  4.778   1.00 18.01  ? 85   HIS A CE1   1 
ATOM   655   N NE2   . HIS A 1 85  ? 13.535  27.629  5.721   1.00 16.45  ? 85   HIS A NE2   1 
ATOM   656   N N     . LEU A 1 86  ? 18.285  30.186  1.884   1.00 22.86  ? 86   LEU A N     1 
ATOM   657   C CA    . LEU A 1 86  ? 18.949  31.291  1.174   1.00 23.48  ? 86   LEU A CA    1 
ATOM   658   C C     . LEU A 1 86  ? 19.468  30.935  -0.227  1.00 24.33  ? 86   LEU A C     1 
ATOM   659   O O     . LEU A 1 86  ? 19.233  31.683  -1.174  1.00 24.51  ? 86   LEU A O     1 
ATOM   660   C CB    . LEU A 1 86  ? 20.079  31.872  2.027   1.00 23.43  ? 86   LEU A CB    1 
ATOM   661   C CG    . LEU A 1 86  ? 19.736  32.556  3.353   1.00 23.41  ? 86   LEU A CG    1 
ATOM   662   C CD1   . LEU A 1 86  ? 20.989  33.183  3.904   1.00 24.34  ? 86   LEU A CD1   1 
ATOM   663   C CD2   . LEU A 1 86  ? 18.686  33.620  3.138   1.00 23.35  ? 86   LEU A CD2   1 
ATOM   664   N N     . GLN A 1 87  ? 20.146  29.790  -0.342  1.00 24.70  ? 87   GLN A N     1 
ATOM   665   C CA    . GLN A 1 87  ? 20.747  29.319  -1.593  1.00 25.53  ? 87   GLN A CA    1 
ATOM   666   C C     . GLN A 1 87  ? 19.785  29.290  -2.784  1.00 25.74  ? 87   GLN A C     1 
ATOM   667   O O     . GLN A 1 87  ? 20.088  29.868  -3.831  1.00 25.24  ? 87   GLN A O     1 
ATOM   668   C CB    . GLN A 1 87  ? 21.354  27.921  -1.393  1.00 25.89  ? 87   GLN A CB    1 
ATOM   669   C CG    . GLN A 1 87  ? 21.924  27.266  -2.671  1.00 27.35  ? 87   GLN A CG    1 
ATOM   670   C CD    . GLN A 1 87  ? 23.043  28.076  -3.304  1.00 28.24  ? 87   GLN A CD    1 
ATOM   671   O OE1   . GLN A 1 87  ? 23.868  28.665  -2.602  1.00 28.52  ? 87   GLN A OE1   1 
ATOM   672   N NE2   . GLN A 1 87  ? 23.081  28.101  -4.636  1.00 26.81  ? 87   GLN A NE2   1 
ATOM   673   N N     . GLU A 1 88  ? 18.646  28.602  -2.621  1.00 25.83  ? 88   GLU A N     1 
ATOM   674   C CA    . GLU A 1 88  ? 17.649  28.470  -3.696  1.00 25.75  ? 88   GLU A CA    1 
ATOM   675   C C     . GLU A 1 88  ? 16.497  29.468  -3.598  1.00 24.81  ? 88   GLU A C     1 
ATOM   676   O O     . GLU A 1 88  ? 15.893  29.813  -4.619  1.00 24.30  ? 88   GLU A O     1 
ATOM   677   C CB    . GLU A 1 88  ? 17.097  27.046  -3.760  1.00 26.31  ? 88   GLU A CB    1 
ATOM   678   C CG    . GLU A 1 88  ? 18.189  25.957  -3.881  1.00 30.70  ? 88   GLU A CG    1 
ATOM   679   C CD    . GLU A 1 88  ? 18.565  25.609  -5.331  1.00 35.99  ? 88   GLU A CD    1 
ATOM   680   O OE1   . GLU A 1 88  ? 18.341  26.426  -6.266  1.00 35.36  ? 88   GLU A OE1   1 
ATOM   681   O OE2   . GLU A 1 88  ? 19.094  24.485  -5.524  1.00 39.39  ? 88   GLU A OE2   1 
ATOM   682   N N     . ASN A 1 89  ? 16.193  29.939  -2.385  1.00 23.80  ? 89   ASN A N     1 
ATOM   683   C CA    . ASN A 1 89  ? 15.013  30.793  -2.182  1.00 23.12  ? 89   ASN A CA    1 
ATOM   684   C C     . ASN A 1 89  ? 15.208  32.096  -1.391  1.00 22.50  ? 89   ASN A C     1 
ATOM   685   O O     . ASN A 1 89  ? 14.249  32.640  -0.834  1.00 22.35  ? 89   ASN A O     1 
ATOM   686   C CB    . ASN A 1 89  ? 13.874  29.966  -1.586  1.00 23.12  ? 89   ASN A CB    1 
ATOM   687   C CG    . ASN A 1 89  ? 13.298  28.981  -2.582  1.00 23.56  ? 89   ASN A CG    1 
ATOM   688   O OD1   . ASN A 1 89  ? 13.444  27.772  -2.421  1.00 25.65  ? 89   ASN A OD1   1 
ATOM   689   N ND2   . ASN A 1 89  ? 12.646  29.490  -3.612  1.00 20.94  ? 89   ASN A ND2   1 
ATOM   690   N N     . GLY A 1 90  ? 16.433  32.608  -1.380  1.00 21.83  ? 90   GLY A N     1 
ATOM   691   C CA    . GLY A 1 90  ? 16.758  33.849  -0.682  1.00 21.61  ? 90   GLY A CA    1 
ATOM   692   C C     . GLY A 1 90  ? 16.017  35.096  -1.141  1.00 21.79  ? 90   GLY A C     1 
ATOM   693   O O     . GLY A 1 90  ? 15.853  36.027  -0.349  1.00 21.07  ? 90   GLY A O     1 
ATOM   694   N N     . ASP A 1 91  ? 15.584  35.131  -2.409  1.00 22.17  ? 91   ASP A N     1 
ATOM   695   C CA    . ASP A 1 91  ? 14.755  36.250  -2.935  1.00 23.28  ? 91   ASP A CA    1 
ATOM   696   C C     . ASP A 1 91  ? 13.246  36.125  -2.633  1.00 22.92  ? 91   ASP A C     1 
ATOM   697   O O     . ASP A 1 91  ? 12.488  37.079  -2.782  1.00 23.08  ? 91   ASP A O     1 
ATOM   698   C CB    . ASP A 1 91  ? 14.962  36.436  -4.440  1.00 23.89  ? 91   ASP A CB    1 
ATOM   699   C CG    . ASP A 1 91  ? 16.387  36.841  -4.784  1.00 27.05  ? 91   ASP A CG    1 
ATOM   700   O OD1   . ASP A 1 91  ? 16.869  37.891  -4.300  1.00 29.92  ? 91   ASP A OD1   1 
ATOM   701   O OD2   . ASP A 1 91  ? 17.040  36.091  -5.535  1.00 31.92  ? 91   ASP A OD2   1 
ATOM   702   N N     . ARG A 1 92  ? 12.824  34.949  -2.201  1.00 22.44  ? 92   ARG A N     1 
ATOM   703   C CA    . ARG A 1 92  ? 11.442  34.740  -1.806  1.00 22.54  ? 92   ARG A CA    1 
ATOM   704   C C     . ARG A 1 92  ? 11.091  35.522  -0.535  1.00 21.46  ? 92   ARG A C     1 
ATOM   705   O O     . ARG A 1 92  ? 11.912  35.633  0.388   1.00 20.22  ? 92   ARG A O     1 
ATOM   706   C CB    . ARG A 1 92  ? 11.199  33.240  -1.604  1.00 22.88  ? 92   ARG A CB    1 
ATOM   707   C CG    . ARG A 1 92  ? 9.797   32.861  -1.216  1.00 24.58  ? 92   ARG A CG    1 
ATOM   708   C CD    . ARG A 1 92  ? 9.817   31.465  -0.665  1.00 28.50  ? 92   ARG A CD    1 
ATOM   709   N NE    . ARG A 1 92  ? 9.708   30.437  -1.699  1.00 32.04  ? 92   ARG A NE    1 
ATOM   710   C CZ    . ARG A 1 92  ? 9.988   29.146  -1.493  1.00 35.30  ? 92   ARG A CZ    1 
ATOM   711   N NH1   . ARG A 1 92  ? 10.433  28.734  -0.301  1.00 34.29  ? 92   ARG A NH1   1 
ATOM   712   N NH2   . ARG A 1 92  ? 9.840   28.264  -2.478  1.00 35.26  ? 92   ARG A NH2   1 
ATOM   713   N N     . THR A 1 93  ? 9.872   36.073  -0.525  1.00 20.90  ? 93   THR A N     1 
ATOM   714   C CA    . THR A 1 93  ? 9.315   36.753  0.644   1.00 20.30  ? 93   THR A CA    1 
ATOM   715   C C     . THR A 1 93  ? 9.123   35.773  1.805   1.00 19.73  ? 93   THR A C     1 
ATOM   716   O O     . THR A 1 93  ? 8.387   34.791  1.696   1.00 19.88  ? 93   THR A O     1 
ATOM   717   C CB    . THR A 1 93  ? 7.979   37.455  0.316   1.00 20.04  ? 93   THR A CB    1 
ATOM   718   O OG1   . THR A 1 93  ? 8.134   38.253  -0.868  1.00 21.85  ? 93   THR A OG1   1 
ATOM   719   C CG2   . THR A 1 93  ? 7.531   38.350  1.469   1.00 18.15  ? 93   THR A CG2   1 
ATOM   720   N N     . ALA A 1 94  ? 9.813   36.044  2.907   1.00 19.10  ? 94   ALA A N     1 
ATOM   721   C CA    . ALA A 1 94  ? 9.644   35.269  4.121   1.00 18.82  ? 94   ALA A CA    1 
ATOM   722   C C     . ALA A 1 94  ? 8.421   35.825  4.822   1.00 18.24  ? 94   ALA A C     1 
ATOM   723   O O     . ALA A 1 94  ? 7.504   35.079  5.168   1.00 17.66  ? 94   ALA A O     1 
ATOM   724   C CB    . ALA A 1 94  ? 10.877  35.370  5.009   1.00 18.11  ? 94   ALA A CB    1 
ATOM   725   N N     . ILE A 1 95  ? 8.400   37.153  4.976   1.00 18.17  ? 95   ILE A N     1 
ATOM   726   C CA    . ILE A 1 95  ? 7.314   37.848  5.686   1.00 17.62  ? 95   ILE A CA    1 
ATOM   727   C C     . ILE A 1 95  ? 6.719   39.000  4.878   1.00 17.45  ? 95   ILE A C     1 
ATOM   728   O O     . ILE A 1 95  ? 7.443   39.907  4.418   1.00 17.62  ? 95   ILE A O     1 
ATOM   729   C CB    . ILE A 1 95  ? 7.811   38.420  7.008   1.00 17.41  ? 95   ILE A CB    1 
ATOM   730   C CG1   . ILE A 1 95  ? 8.219   37.304  7.969   1.00 16.61  ? 95   ILE A CG1   1 
ATOM   731   C CG2   . ILE A 1 95  ? 6.766   39.359  7.627   1.00 17.45  ? 95   ILE A CG2   1 
ATOM   732   C CD1   . ILE A 1 95  ? 8.950   37.829  9.182   1.00 14.71  ? 95   ILE A CD1   1 
ATOM   733   N N     . ILE A 1 96  ? 5.403   38.953  4.709   1.00 17.12  ? 96   ILE A N     1 
ATOM   734   C CA    . ILE A 1 96  ? 4.659   40.102  4.214   1.00 17.42  ? 96   ILE A CA    1 
ATOM   735   C C     . ILE A 1 96  ? 4.133   40.781  5.446   1.00 17.11  ? 96   ILE A C     1 
ATOM   736   O O     . ILE A 1 96  ? 3.446   40.161  6.249   1.00 17.90  ? 96   ILE A O     1 
ATOM   737   C CB    . ILE A 1 96  ? 3.445   39.726  3.296   1.00 17.44  ? 96   ILE A CB    1 
ATOM   738   C CG1   . ILE A 1 96  ? 3.883   38.874  2.110   1.00 16.56  ? 96   ILE A CG1   1 
ATOM   739   C CG2   . ILE A 1 96  ? 2.695   40.993  2.842   1.00 18.08  ? 96   ILE A CG2   1 
ATOM   740   C CD1   . ILE A 1 96  ? 2.721   38.384  1.199   1.00 17.59  ? 96   ILE A CD1   1 
ATOM   741   N N     . TRP A 1 97  ? 4.478   42.047  5.611   1.00 16.86  ? 97   TRP A N     1 
ATOM   742   C CA    . TRP A 1 97  ? 3.953   42.835  6.707   1.00 16.45  ? 97   TRP A CA    1 
ATOM   743   C C     . TRP A 1 97  ? 2.898   43.807  6.199   1.00 16.32  ? 97   TRP A C     1 
ATOM   744   O O     . TRP A 1 97  ? 3.174   44.622  5.315   1.00 16.50  ? 97   TRP A O     1 
ATOM   745   C CB    . TRP A 1 97  ? 5.080   43.581  7.414   1.00 15.95  ? 97   TRP A CB    1 
ATOM   746   C CG    . TRP A 1 97  ? 4.595   44.416  8.549   1.00 16.80  ? 97   TRP A CG    1 
ATOM   747   C CD1   . TRP A 1 97  ? 4.181   43.975  9.796   1.00 14.95  ? 97   TRP A CD1   1 
ATOM   748   C CD2   . TRP A 1 97  ? 4.487   45.843  8.569   1.00 15.34  ? 97   TRP A CD2   1 
ATOM   749   N NE1   . TRP A 1 97  ? 3.818   45.048  10.571  1.00 14.63  ? 97   TRP A NE1   1 
ATOM   750   C CE2   . TRP A 1 97  ? 3.997   46.206  9.850   1.00 15.45  ? 97   TRP A CE2   1 
ATOM   751   C CE3   . TRP A 1 97  ? 4.756   46.850  7.631   1.00 15.92  ? 97   TRP A CE3   1 
ATOM   752   C CZ2   . TRP A 1 97  ? 3.755   47.534  10.211  1.00 14.71  ? 97   TRP A CZ2   1 
ATOM   753   C CZ3   . TRP A 1 97  ? 4.522   48.180  7.988   1.00 15.62  ? 97   TRP A CZ3   1 
ATOM   754   C CH2   . TRP A 1 97  ? 4.022   48.506  9.276   1.00 15.90  ? 97   TRP A CH2   1 
ATOM   755   N N     . GLU A 1 98  ? 1.690   43.703  6.745   1.00 16.30  ? 98   GLU A N     1 
ATOM   756   C CA    . GLU A 1 98  ? 0.602   44.622  6.410   1.00 16.37  ? 98   GLU A CA    1 
ATOM   757   C C     . GLU A 1 98  ? 0.321   45.513  7.617   1.00 16.60  ? 98   GLU A C     1 
ATOM   758   O O     . GLU A 1 98  ? 0.010   45.015  8.693   1.00 16.46  ? 98   GLU A O     1 
ATOM   759   C CB    . GLU A 1 98  ? -0.651  43.850  5.968   1.00 16.30  ? 98   GLU A CB    1 
ATOM   760   C CG    . GLU A 1 98  ? -1.941  44.670  5.907   1.00 16.19  ? 98   GLU A CG    1 
ATOM   761   C CD    . GLU A 1 98  ? -2.102  45.479  4.614   1.00 17.39  ? 98   GLU A CD    1 
ATOM   762   O OE1   . GLU A 1 98  ? -1.155  45.511  3.786   1.00 13.26  ? 98   GLU A OE1   1 
ATOM   763   O OE2   . GLU A 1 98  ? -3.203  46.068  4.429   1.00 17.71  ? 98   GLU A OE2   1 
ATOM   764   N N     . GLY A 1 99  ? 0.495   46.825  7.432   1.00 16.91  ? 99   GLY A N     1 
ATOM   765   C CA    . GLY A 1 99  ? 0.284   47.818  8.486   1.00 16.86  ? 99   GLY A CA    1 
ATOM   766   C C     . GLY A 1 99  ? -1.184  48.019  8.820   1.00 17.02  ? 99   GLY A C     1 
ATOM   767   O O     . GLY A 1 99  ? -2.059  47.751  7.996   1.00 17.29  ? 99   GLY A O     1 
ATOM   768   N N     . ASP A 1 100 ? -1.445  48.482  10.042  1.00 17.03  ? 100  ASP A N     1 
ATOM   769   C CA    . ASP A 1 100 ? -2.764  48.933  10.487  1.00 17.17  ? 100  ASP A CA    1 
ATOM   770   C C     . ASP A 1 100 ? -3.329  49.926  9.454   1.00 17.53  ? 100  ASP A C     1 
ATOM   771   O O     . ASP A 1 100 ? -4.501  49.853  9.058   1.00 16.71  ? 100  ASP A O     1 
ATOM   772   C CB    . ASP A 1 100 ? -2.599  49.574  11.870  1.00 17.13  ? 100  ASP A CB    1 
ATOM   773   C CG    . ASP A 1 100 ? -3.907  50.012  12.492  1.00 18.24  ? 100  ASP A CG    1 
ATOM   774   O OD1   . ASP A 1 100 ? -4.784  49.143  12.734  1.00 20.41  ? 100  ASP A OD1   1 
ATOM   775   O OD2   . ASP A 1 100 ? -4.040  51.226  12.782  1.00 17.83  ? 100  ASP A OD2   1 
ATOM   776   N N     . ASP A 1 101 ? -2.456  50.835  9.020   1.00 18.09  ? 101  ASP A N     1 
ATOM   777   C CA    . ASP A 1 101 ? -2.670  51.704  7.866   1.00 18.82  ? 101  ASP A CA    1 
ATOM   778   C C     . ASP A 1 101 ? -2.208  50.955  6.621   1.00 19.14  ? 101  ASP A C     1 
ATOM   779   O O     . ASP A 1 101 ? -1.030  50.610  6.473   1.00 18.94  ? 101  ASP A O     1 
ATOM   780   C CB    . ASP A 1 101 ? -1.861  52.999  8.033   1.00 19.17  ? 101  ASP A CB    1 
ATOM   781   C CG    . ASP A 1 101 ? -1.988  53.953  6.828   1.00 21.36  ? 101  ASP A CG    1 
ATOM   782   O OD1   . ASP A 1 101 ? -2.468  53.554  5.743   1.00 24.83  ? 101  ASP A OD1   1 
ATOM   783   O OD2   . ASP A 1 101 ? -1.598  55.120  6.967   1.00 21.17  ? 101  ASP A OD2   1 
ATOM   784   N N     . THR A 1 102 ? -3.148  50.702  5.720   1.00 19.78  ? 102  THR A N     1 
ATOM   785   C CA    . THR A 1 102 ? -2.902  49.815  4.591   1.00 19.76  ? 102  THR A CA    1 
ATOM   786   C C     . THR A 1 102 ? -1.891  50.390  3.583   1.00 20.52  ? 102  THR A C     1 
ATOM   787   O O     . THR A 1 102 ? -1.258  49.632  2.819   1.00 20.30  ? 102  THR A O     1 
ATOM   788   C CB    . THR A 1 102 ? -4.223  49.401  3.894   1.00 19.58  ? 102  THR A CB    1 
ATOM   789   O OG1   . THR A 1 102 ? -3.971  48.294  3.032   1.00 19.12  ? 102  THR A OG1   1 
ATOM   790   C CG2   . THR A 1 102 ? -4.804  50.547  3.068   1.00 18.77  ? 102  THR A CG2   1 
ATOM   791   N N     . SER A 1 103 ? -1.739  51.718  3.585   1.00 20.65  ? 103  SER A N     1 
ATOM   792   C CA    . SER A 1 103 ? -0.692  52.368  2.787   1.00 21.20  ? 103  SER A CA    1 
ATOM   793   C C     . SER A 1 103 ? 0.739   51.981  3.218   1.00 21.29  ? 103  SER A C     1 
ATOM   794   O O     . SER A 1 103 ? 1.681   52.227  2.477   1.00 21.31  ? 103  SER A O     1 
ATOM   795   C CB    . SER A 1 103 ? -0.861  53.896  2.786   1.00 21.35  ? 103  SER A CB    1 
ATOM   796   O OG    . SER A 1 103 ? -0.715  54.449  4.084   1.00 21.77  ? 103  SER A OG    1 
ATOM   797   N N     . GLN A 1 104 ? 0.886   51.376  4.400   1.00 21.24  ? 104  GLN A N     1 
ATOM   798   C CA    . GLN A 1 104 ? 2.182   50.907  4.887   1.00 22.05  ? 104  GLN A CA    1 
ATOM   799   C C     . GLN A 1 104 ? 2.278   49.389  4.817   1.00 22.79  ? 104  GLN A C     1 
ATOM   800   O O     . GLN A 1 104 ? 1.494   48.687  5.458   1.00 23.26  ? 104  GLN A O     1 
ATOM   801   C CB    . GLN A 1 104 ? 2.409   51.355  6.345   1.00 21.69  ? 104  GLN A CB    1 
ATOM   802   C CG    . GLN A 1 104 ? 2.649   52.845  6.523   1.00 21.38  ? 104  GLN A CG    1 
ATOM   803   C CD    . GLN A 1 104 ? 2.822   53.244  7.980   1.00 22.83  ? 104  GLN A CD    1 
ATOM   804   O OE1   . GLN A 1 104 ? 3.027   54.421  8.284   1.00 23.26  ? 104  GLN A OE1   1 
ATOM   805   N NE2   . GLN A 1 104 ? 2.747   52.276  8.886   1.00 21.73  ? 104  GLN A NE2   1 
ATOM   806   N N     . SER A 1 105 ? 3.223   48.873  4.034   1.00 23.55  ? 105  SER A N     1 
ATOM   807   C CA    . SER A 1 105 ? 3.501   47.440  4.029   1.00 24.50  ? 105  SER A CA    1 
ATOM   808   C C     . SER A 1 105 ? 4.917   47.130  3.543   1.00 24.64  ? 105  SER A C     1 
ATOM   809   O O     . SER A 1 105 ? 5.634   48.018  3.067   1.00 25.51  ? 105  SER A O     1 
ATOM   810   C CB    . SER A 1 105 ? 2.442   46.658  3.230   1.00 24.78  ? 105  SER A CB    1 
ATOM   811   O OG    . SER A 1 105 ? 2.605   46.841  1.833   1.00 28.28  ? 105  SER A OG    1 
ATOM   812   N N     . LYS A 1 106 ? 5.315   45.868  3.678   1.00 24.33  ? 106  LYS A N     1 
ATOM   813   C CA    . LYS A 1 106 ? 6.658   45.409  3.341   1.00 23.61  ? 106  LYS A CA    1 
ATOM   814   C C     . LYS A 1 106 ? 6.617   43.954  2.935   1.00 23.64  ? 106  LYS A C     1 
ATOM   815   O O     . LYS A 1 106 ? 5.856   43.154  3.505   1.00 23.69  ? 106  LYS A O     1 
ATOM   816   C CB    . LYS A 1 106 ? 7.570   45.464  4.564   1.00 23.53  ? 106  LYS A CB    1 
ATOM   817   C CG    . LYS A 1 106 ? 8.308   46.724  4.804   1.00 23.91  ? 106  LYS A CG    1 
ATOM   818   C CD    . LYS A 1 106 ? 8.873   46.696  6.211   1.00 23.63  ? 106  LYS A CD    1 
ATOM   819   C CE    . LYS A 1 106 ? 9.444   48.058  6.598   1.00 26.22  ? 106  LYS A CE    1 
ATOM   820   N NZ    . LYS A 1 106 ? 10.264  47.996  7.843   1.00 26.85  ? 106  LYS A NZ    1 
ATOM   821   N N     . HIS A 1 107 ? 7.475   43.627  1.975   1.00 23.46  ? 107  HIS A N     1 
ATOM   822   C CA    . HIS A 1 107 ? 7.872   42.273  1.648   1.00 23.61  ? 107  HIS A CA    1 
ATOM   823   C C     . HIS A 1 107 ? 9.309   42.104  2.110   1.00 23.15  ? 107  HIS A C     1 
ATOM   824   O O     . HIS A 1 107 ? 10.188  42.894  1.756   1.00 23.61  ? 107  HIS A O     1 
ATOM   825   C CB    . HIS A 1 107 ? 7.774   42.050  0.144   1.00 23.48  ? 107  HIS A CB    1 
ATOM   826   C CG    . HIS A 1 107 ? 6.367   41.908  -0.346  1.00 26.07  ? 107  HIS A CG    1 
ATOM   827   N ND1   . HIS A 1 107 ? 5.399   42.865  -0.116  1.00 28.16  ? 107  HIS A ND1   1 
ATOM   828   C CD2   . HIS A 1 107 ? 5.764   40.930  -1.065  1.00 27.59  ? 107  HIS A CD2   1 
ATOM   829   C CE1   . HIS A 1 107 ? 4.263   42.483  -0.670  1.00 27.64  ? 107  HIS A CE1   1 
ATOM   830   N NE2   . HIS A 1 107 ? 4.457   41.315  -1.254  1.00 27.92  ? 107  HIS A NE2   1 
ATOM   831   N N     . ILE A 1 108 ? 9.548   41.098  2.931   1.00 22.49  ? 108  ILE A N     1 
ATOM   832   C CA    . ILE A 1 108 ? 10.881  40.881  3.487   1.00 21.56  ? 108  ILE A CA    1 
ATOM   833   C C     . ILE A 1 108 ? 11.356  39.516  3.030   1.00 21.30  ? 108  ILE A C     1 
ATOM   834   O O     . ILE A 1 108 ? 10.807  38.481  3.446   1.00 20.78  ? 108  ILE A O     1 
ATOM   835   C CB    . ILE A 1 108 ? 10.836  40.984  5.024   1.00 21.95  ? 108  ILE A CB    1 
ATOM   836   C CG1   . ILE A 1 108 ? 10.321  42.384  5.417   1.00 21.74  ? 108  ILE A CG1   1 
ATOM   837   C CG2   . ILE A 1 108 ? 12.208  40.638  5.656   1.00 20.54  ? 108  ILE A CG2   1 
ATOM   838   C CD1   . ILE A 1 108 ? 9.830   42.479  6.824   1.00 23.30  ? 108  ILE A CD1   1 
ATOM   839   N N     . SER A 1 109 ? 12.342  39.525  2.135   1.00 20.92  ? 109  SER A N     1 
ATOM   840   C CA    . SER A 1 109 ? 12.900  38.290  1.582   1.00 20.60  ? 109  SER A CA    1 
ATOM   841   C C     . SER A 1 109 ? 13.552  37.453  2.688   1.00 20.86  ? 109  SER A C     1 
ATOM   842   O O     . SER A 1 109 ? 13.846  37.954  3.786   1.00 20.50  ? 109  SER A O     1 
ATOM   843   C CB    . SER A 1 109 ? 13.919  38.598  0.475   1.00 20.50  ? 109  SER A CB    1 
ATOM   844   O OG    . SER A 1 109 ? 15.128  39.143  1.004   1.00 19.09  ? 109  SER A OG    1 
ATOM   845   N N     . TYR A 1 110 ? 13.769  36.170  2.418   1.00 20.68  ? 110  TYR A N     1 
ATOM   846   C CA    . TYR A 1 110 ? 14.517  35.365  3.373   1.00 20.22  ? 110  TYR A CA    1 
ATOM   847   C C     . TYR A 1 110 ? 15.921  35.955  3.608   1.00 20.97  ? 110  TYR A C     1 
ATOM   848   O O     . TYR A 1 110 ? 16.440  35.916  4.724   1.00 20.69  ? 110  TYR A O     1 
ATOM   849   C CB    . TYR A 1 110 ? 14.567  33.899  2.935   1.00 19.20  ? 110  TYR A CB    1 
ATOM   850   C CG    . TYR A 1 110 ? 13.372  33.111  3.427   1.00 18.73  ? 110  TYR A CG    1 
ATOM   851   C CD1   . TYR A 1 110 ? 12.206  33.009  2.651   1.00 17.78  ? 110  TYR A CD1   1 
ATOM   852   C CD2   . TYR A 1 110 ? 13.393  32.474  4.676   1.00 17.96  ? 110  TYR A CD2   1 
ATOM   853   C CE1   . TYR A 1 110 ? 11.100  32.287  3.098   1.00 17.51  ? 110  TYR A CE1   1 
ATOM   854   C CE2   . TYR A 1 110 ? 12.271  31.750  5.145   1.00 16.88  ? 110  TYR A CE2   1 
ATOM   855   C CZ    . TYR A 1 110 ? 11.134  31.668  4.348   1.00 17.30  ? 110  TYR A CZ    1 
ATOM   856   O OH    . TYR A 1 110 ? 10.032  30.973  4.790   1.00 16.85  ? 110  TYR A OH    1 
ATOM   857   N N     . ARG A 1 111 ? 16.519  36.513  2.558   1.00 21.62  ? 111  ARG A N     1 
ATOM   858   C CA    . ARG A 1 111 ? 17.871  37.044  2.648   1.00 23.29  ? 111  ARG A CA    1 
ATOM   859   C C     . ARG A 1 111 ? 17.892  38.296  3.533   1.00 22.48  ? 111  ARG A C     1 
ATOM   860   O O     . ARG A 1 111 ? 18.787  38.452  4.362   1.00 22.90  ? 111  ARG A O     1 
ATOM   861   C CB    . ARG A 1 111 ? 18.468  37.296  1.250   1.00 22.72  ? 111  ARG A CB    1 
ATOM   862   C CG    . ARG A 1 111 ? 19.987  37.545  1.237   1.00 26.20  ? 111  ARG A CG    1 
ATOM   863   C CD    . ARG A 1 111 ? 20.592  37.671  -0.204  1.00 26.56  ? 111  ARG A CD    1 
ATOM   864   N NE    . ARG A 1 111 ? 20.448  36.436  -0.999  1.00 35.59  ? 111  ARG A NE    1 
ATOM   865   C CZ    . ARG A 1 111 ? 19.627  36.312  -2.054  1.00 39.16  ? 111  ARG A CZ    1 
ATOM   866   N NH1   . ARG A 1 111 ? 18.881  37.350  -2.452  1.00 39.45  ? 111  ARG A NH1   1 
ATOM   867   N NH2   . ARG A 1 111 ? 19.549  35.154  -2.722  1.00 39.19  ? 111  ARG A NH2   1 
ATOM   868   N N     . GLU A 1 112 ? 16.876  39.142  3.382   1.00 22.00  ? 112  GLU A N     1 
ATOM   869   C CA    . GLU A 1 112 ? 16.725  40.371  4.165   1.00 22.23  ? 112  GLU A CA    1 
ATOM   870   C C     . GLU A 1 112 ? 16.411  40.081  5.637   1.00 21.11  ? 112  GLU A C     1 
ATOM   871   O O     . GLU A 1 112 ? 16.991  40.694  6.544   1.00 20.59  ? 112  GLU A O     1 
ATOM   872   C CB    . GLU A 1 112 ? 15.640  41.265  3.558   1.00 22.14  ? 112  GLU A CB    1 
ATOM   873   C CG    . GLU A 1 112 ? 15.971  41.779  2.170   1.00 24.30  ? 112  GLU A CG    1 
ATOM   874   C CD    . GLU A 1 112 ? 14.784  42.428  1.462   1.00 25.32  ? 112  GLU A CD    1 
ATOM   875   O OE1   . GLU A 1 112 ? 13.617  42.036  1.720   1.00 27.59  ? 112  GLU A OE1   1 
ATOM   876   O OE2   . GLU A 1 112 ? 15.034  43.326  0.623   1.00 30.54  ? 112  GLU A OE2   1 
ATOM   877   N N     . LEU A 1 113 ? 15.486  39.149  5.861   1.00 19.97  ? 113  LEU A N     1 
ATOM   878   C CA    . LEU A 1 113 ? 15.222  38.634  7.205   1.00 19.44  ? 113  LEU A CA    1 
ATOM   879   C C     . LEU A 1 113 ? 16.471  37.991  7.864   1.00 19.53  ? 113  LEU A C     1 
ATOM   880   O O     . LEU A 1 113 ? 16.763  38.253  9.024   1.00 19.06  ? 113  LEU A O     1 
ATOM   881   C CB    . LEU A 1 113 ? 14.032  37.650  7.217   1.00 18.44  ? 113  LEU A CB    1 
ATOM   882   C CG    . LEU A 1 113 ? 13.516  37.321  8.622   1.00 18.67  ? 113  LEU A CG    1 
ATOM   883   C CD1   . LEU A 1 113 ? 13.132  38.602  9.440   1.00 15.67  ? 113  LEU A CD1   1 
ATOM   884   C CD2   . LEU A 1 113 ? 12.349  36.297  8.566   1.00 18.98  ? 113  LEU A CD2   1 
ATOM   885   N N     . HIS A 1 114 ? 17.187  37.148  7.123   1.00 19.26  ? 114  HIS A N     1 
ATOM   886   C CA    . HIS A 1 114 ? 18.395  36.517  7.638   1.00 18.98  ? 114  HIS A CA    1 
ATOM   887   C C     . HIS A 1 114 ? 19.410  37.565  8.084   1.00 18.93  ? 114  HIS A C     1 
ATOM   888   O O     . HIS A 1 114 ? 19.969  37.471  9.169   1.00 18.71  ? 114  HIS A O     1 
ATOM   889   C CB    . HIS A 1 114 ? 18.963  35.582  6.571   1.00 18.86  ? 114  HIS A CB    1 
ATOM   890   C CG    . HIS A 1 114 ? 20.369  35.143  6.822   1.00 19.11  ? 114  HIS A CG    1 
ATOM   891   N ND1   . HIS A 1 114 ? 21.455  35.793  6.271   1.00 18.28  ? 114  HIS A ND1   1 
ATOM   892   C CD2   . HIS A 1 114 ? 20.866  34.098  7.531   1.00 17.36  ? 114  HIS A CD2   1 
ATOM   893   C CE1   . HIS A 1 114 ? 22.561  35.168  6.644   1.00 19.97  ? 114  HIS A CE1   1 
ATOM   894   N NE2   . HIS A 1 114 ? 22.230  34.141  7.409   1.00 17.72  ? 114  HIS A NE2   1 
ATOM   895   N N     . ARG A 1 115 ? 19.608  38.589  7.257   1.00 19.65  ? 115  ARG A N     1 
ATOM   896   C CA    . ARG A 1 115 ? 20.595  39.638  7.517   1.00 19.59  ? 115  ARG A CA    1 
ATOM   897   C C     . ARG A 1 115 ? 20.343  40.403  8.816   1.00 19.61  ? 115  ARG A C     1 
ATOM   898   O O     . ARG A 1 115 ? 21.270  40.599  9.617   1.00 19.28  ? 115  ARG A O     1 
ATOM   899   C CB    . ARG A 1 115 ? 20.641  40.619  6.350   1.00 20.14  ? 115  ARG A CB    1 
ATOM   900   C CG    . ARG A 1 115 ? 21.618  41.740  6.562   1.00 21.29  ? 115  ARG A CG    1 
ATOM   901   C CD    . ARG A 1 115 ? 21.799  42.589  5.339   1.00 25.55  ? 115  ARG A CD    1 
ATOM   902   N NE    . ARG A 1 115 ? 22.646  43.729  5.689   1.00 32.44  ? 115  ARG A NE    1 
ATOM   903   C CZ    . ARG A 1 115 ? 23.920  43.869  5.332   1.00 34.79  ? 115  ARG A CZ    1 
ATOM   904   N NH1   . ARG A 1 115 ? 24.504  42.950  4.556   1.00 36.00  ? 115  ARG A NH1   1 
ATOM   905   N NH2   . ARG A 1 115 ? 24.600  44.951  5.729   1.00 35.32  ? 115  ARG A NH2   1 
ATOM   906   N N     . ASP A 1 116 ? 19.094  40.827  9.017   1.00 19.45  ? 116  ASP A N     1 
ATOM   907   C CA    . ASP A 1 116 ? 18.694  41.539  10.234  1.00 19.64  ? 116  ASP A CA    1 
ATOM   908   C C     . ASP A 1 116 ? 18.736  40.679  11.463  1.00 19.30  ? 116  ASP A C     1 
ATOM   909   O O     . ASP A 1 116 ? 19.054  41.154  12.554  1.00 20.01  ? 116  ASP A O     1 
ATOM   910   C CB    . ASP A 1 116 ? 17.331  42.202  10.068  1.00 19.80  ? 116  ASP A CB    1 
ATOM   911   C CG    . ASP A 1 116 ? 17.441  43.549  9.382   1.00 21.53  ? 116  ASP A CG    1 
ATOM   912   O OD1   . ASP A 1 116 ? 18.574  43.929  9.009   1.00 22.47  ? 116  ASP A OD1   1 
ATOM   913   O OD2   . ASP A 1 116 ? 16.414  44.235  9.212   1.00 24.35  ? 116  ASP A OD2   1 
ATOM   914   N N     . VAL A 1 117 ? 18.457  39.396  11.288  1.00 18.92  ? 117  VAL A N     1 
ATOM   915   C CA    . VAL A 1 117 ? 18.575  38.445  12.384  1.00 18.48  ? 117  VAL A CA    1 
ATOM   916   C C     . VAL A 1 117 ? 20.039  38.222  12.770  1.00 18.95  ? 117  VAL A C     1 
ATOM   917   O O     . VAL A 1 117 ? 20.349  38.094  13.957  1.00 19.45  ? 117  VAL A O     1 
ATOM   918   C CB    . VAL A 1 117 ? 17.853  37.122  12.060  1.00 18.52  ? 117  VAL A CB    1 
ATOM   919   C CG1   . VAL A 1 117 ? 18.299  35.970  13.024  1.00 18.24  ? 117  VAL A CG1   1 
ATOM   920   C CG2   . VAL A 1 117 ? 16.346  37.324  12.139  1.00 16.64  ? 117  VAL A CG2   1 
ATOM   921   N N     . CYS A 1 118 ? 20.933  38.175  11.779  1.00 19.03  ? 118  CYS A N     1 
ATOM   922   C CA    . CYS A 1 118 ? 22.370  38.086  12.062  1.00 19.50  ? 118  CYS A CA    1 
ATOM   923   C C     . CYS A 1 118 ? 22.842  39.329  12.790  1.00 19.41  ? 118  CYS A C     1 
ATOM   924   O O     . CYS A 1 118 ? 23.551  39.228  13.799  1.00 19.79  ? 118  CYS A O     1 
ATOM   925   C CB    . CYS A 1 118 ? 23.187  37.881  10.784  1.00 19.26  ? 118  CYS A CB    1 
ATOM   926   S SG    . CYS A 1 118 ? 22.983  36.239  10.117  1.00 17.83  ? 118  CYS A SG    1 
ATOM   927   N N     . ARG A 1 119 ? 22.427  40.494  12.298  1.00 19.20  ? 119  ARG A N     1 
ATOM   928   C CA    . ARG A 1 119 ? 22.810  41.753  12.932  1.00 19.14  ? 119  ARG A CA    1 
ATOM   929   C C     . ARG A 1 119 ? 22.269  41.828  14.368  1.00 18.58  ? 119  ARG A C     1 
ATOM   930   O O     . ARG A 1 119 ? 22.998  42.164  15.301  1.00 18.28  ? 119  ARG A O     1 
ATOM   931   C CB    . ARG A 1 119 ? 22.364  42.958  12.101  1.00 19.06  ? 119  ARG A CB    1 
ATOM   932   C CG    . ARG A 1 119 ? 23.134  43.147  10.799  1.00 19.71  ? 119  ARG A CG    1 
ATOM   933   C CD    . ARG A 1 119 ? 22.995  44.563  10.228  1.00 20.24  ? 119  ARG A CD    1 
ATOM   934   N NE    . ARG A 1 119 ? 21.605  44.894  9.950   1.00 22.17  ? 119  ARG A NE    1 
ATOM   935   C CZ    . ARG A 1 119 ? 21.158  46.105  9.608   1.00 23.05  ? 119  ARG A CZ    1 
ATOM   936   N NH1   . ARG A 1 119 ? 21.998  47.133  9.505   1.00 22.30  ? 119  ARG A NH1   1 
ATOM   937   N NH2   . ARG A 1 119 ? 19.857  46.288  9.381   1.00 19.64  ? 119  ARG A NH2   1 
ATOM   938   N N     . PHE A 1 120 ? 21.004  41.475  14.552  1.00 18.10  ? 120  PHE A N     1 
ATOM   939   C CA    . PHE A 1 120 ? 20.440  41.536  15.893  1.00 17.79  ? 120  PHE A CA    1 
ATOM   940   C C     . PHE A 1 120 ? 21.038  40.489  16.845  1.00 17.60  ? 120  PHE A C     1 
ATOM   941   O O     . PHE A 1 120 ? 21.153  40.727  18.049  1.00 16.97  ? 120  PHE A O     1 
ATOM   942   C CB    . PHE A 1 120 ? 18.909  41.489  15.878  1.00 17.57  ? 120  PHE A CB    1 
ATOM   943   C CG    . PHE A 1 120 ? 18.302  42.041  17.128  1.00 17.11  ? 120  PHE A CG    1 
ATOM   944   C CD1   . PHE A 1 120 ? 18.414  43.396  17.415  1.00 14.17  ? 120  PHE A CD1   1 
ATOM   945   C CD2   . PHE A 1 120 ? 17.650  41.205  18.035  1.00 17.54  ? 120  PHE A CD2   1 
ATOM   946   C CE1   . PHE A 1 120 ? 17.902  43.919  18.562  1.00 15.93  ? 120  PHE A CE1   1 
ATOM   947   C CE2   . PHE A 1 120 ? 17.106  41.719  19.201  1.00 17.14  ? 120  PHE A CE2   1 
ATOM   948   C CZ    . PHE A 1 120 ? 17.230  43.079  19.470  1.00 18.68  ? 120  PHE A CZ    1 
ATOM   949   N N     . ALA A 1 121 ? 21.427  39.340  16.301  1.00 17.14  ? 121  ALA A N     1 
ATOM   950   C CA    . ALA A 1 121 ? 22.085  38.327  17.098  1.00 17.17  ? 121  ALA A CA    1 
ATOM   951   C C     . ALA A 1 121 ? 23.425  38.834  17.634  1.00 17.64  ? 121  ALA A C     1 
ATOM   952   O O     . ALA A 1 121 ? 23.731  38.619  18.812  1.00 17.96  ? 121  ALA A O     1 
ATOM   953   C CB    . ALA A 1 121 ? 22.267  37.039  16.307  1.00 17.14  ? 121  ALA A CB    1 
ATOM   954   N N     . ASN A 1 122 ? 24.208  39.506  16.784  1.00 17.41  ? 122  ASN A N     1 
ATOM   955   C CA    . ASN A 1 122 ? 25.474  40.094  17.197  1.00 17.76  ? 122  ASN A CA    1 
ATOM   956   C C     . ASN A 1 122 ? 25.217  41.215  18.199  1.00 18.43  ? 122  ASN A C     1 
ATOM   957   O O     . ASN A 1 122 ? 25.947  41.336  19.203  1.00 18.31  ? 122  ASN A O     1 
ATOM   958   C CB    . ASN A 1 122 ? 26.267  40.634  16.000  1.00 17.88  ? 122  ASN A CB    1 
ATOM   959   C CG    . ASN A 1 122 ? 26.971  39.521  15.157  1.00 18.17  ? 122  ASN A CG    1 
ATOM   960   O OD1   . ASN A 1 122 ? 27.448  38.516  15.680  1.00 18.49  ? 122  ASN A OD1   1 
ATOM   961   N ND2   . ASN A 1 122 ? 27.062  39.746  13.856  1.00 16.41  ? 122  ASN A ND2   1 
ATOM   962   N N     . THR A 1 123 ? 24.189  42.032  17.919  1.00 18.51  ? 123  THR A N     1 
ATOM   963   C CA    . THR A 1 123 ? 23.705  43.039  18.868  1.00 18.90  ? 123  THR A CA    1 
ATOM   964   C C     . THR A 1 123 ? 23.486  42.394  20.244  1.00 19.34  ? 123  THR A C     1 
ATOM   965   O O     . THR A 1 123 ? 24.070  42.836  21.226  1.00 20.61  ? 123  THR A O     1 
ATOM   966   C CB    . THR A 1 123 ? 22.405  43.741  18.380  1.00 19.15  ? 123  THR A CB    1 
ATOM   967   O OG1   . THR A 1 123 ? 22.656  44.470  17.172  1.00 18.74  ? 123  THR A OG1   1 
ATOM   968   C CG2   . THR A 1 123 ? 21.882  44.709  19.435  1.00 19.43  ? 123  THR A CG2   1 
ATOM   969   N N     . LEU A 1 124 ? 22.696  41.328  20.318  1.00 19.07  ? 124  LEU A N     1 
ATOM   970   C CA    . LEU A 1 124 ? 22.462  40.655  21.605  1.00 19.42  ? 124  LEU A CA    1 
ATOM   971   C C     . LEU A 1 124 ? 23.767  40.227  22.315  1.00 19.60  ? 124  LEU A C     1 
ATOM   972   O O     . LEU A 1 124 ? 23.965  40.487  23.507  1.00 19.26  ? 124  LEU A O     1 
ATOM   973   C CB    . LEU A 1 124 ? 21.486  39.470  21.434  1.00 18.85  ? 124  LEU A CB    1 
ATOM   974   C CG    . LEU A 1 124 ? 20.033  39.780  21.026  1.00 18.72  ? 124  LEU A CG    1 
ATOM   975   C CD1   . LEU A 1 124 ? 19.224  38.514  20.694  1.00 16.51  ? 124  LEU A CD1   1 
ATOM   976   C CD2   . LEU A 1 124 ? 19.357  40.597  22.119  1.00 16.10  ? 124  LEU A CD2   1 
ATOM   977   N N     . LEU A 1 125 ? 24.662  39.603  21.562  1.00 20.08  ? 125  LEU A N     1 
ATOM   978   C CA    . LEU A 1 125 ? 25.915  39.074  22.106  1.00 20.56  ? 125  LEU A CA    1 
ATOM   979   C C     . LEU A 1 125 ? 26.799  40.192  22.638  1.00 21.05  ? 125  LEU A C     1 
ATOM   980   O O     . LEU A 1 125 ? 27.324  40.110  23.764  1.00 20.97  ? 125  LEU A O     1 
ATOM   981   C CB    . LEU A 1 125 ? 26.652  38.256  21.041  1.00 19.87  ? 125  LEU A CB    1 
ATOM   982   C CG    . LEU A 1 125 ? 25.994  36.928  20.661  1.00 19.81  ? 125  LEU A CG    1 
ATOM   983   C CD1   . LEU A 1 125 ? 26.507  36.418  19.319  1.00 18.64  ? 125  LEU A CD1   1 
ATOM   984   C CD2   . LEU A 1 125 ? 26.166  35.865  21.769  1.00 20.04  ? 125  LEU A CD2   1 
ATOM   985   N N     . ASP A 1 126 ? 26.949  41.236  21.825  1.00 22.10  ? 126  ASP A N     1 
ATOM   986   C CA    . ASP A 1 126 ? 27.656  42.455  22.225  1.00 23.42  ? 126  ASP A CA    1 
ATOM   987   C C     . ASP A 1 126 ? 27.105  43.079  23.518  1.00 23.77  ? 126  ASP A C     1 
ATOM   988   O O     . ASP A 1 126 ? 27.823  43.772  24.214  1.00 23.96  ? 126  ASP A O     1 
ATOM   989   C CB    . ASP A 1 126 ? 27.621  43.483  21.096  1.00 23.51  ? 126  ASP A CB    1 
ATOM   990   C CG    . ASP A 1 126 ? 28.530  43.103  19.924  1.00 26.72  ? 126  ASP A CG    1 
ATOM   991   O OD1   . ASP A 1 126 ? 29.324  42.126  20.042  1.00 30.10  ? 126  ASP A OD1   1 
ATOM   992   O OD2   . ASP A 1 126 ? 28.441  43.777  18.872  1.00 28.22  ? 126  ASP A OD2   1 
ATOM   993   N N     . LEU A 1 127 ? 25.838  42.819  23.835  1.00 23.96  ? 127  LEU A N     1 
ATOM   994   C CA    . LEU A 1 127 ? 25.210  43.368  25.032  1.00 24.36  ? 127  LEU A CA    1 
ATOM   995   C C     . LEU A 1 127 ? 25.444  42.452  26.233  1.00 24.92  ? 127  LEU A C     1 
ATOM   996   O O     . LEU A 1 127 ? 24.931  42.695  27.332  1.00 25.28  ? 127  LEU A O     1 
ATOM   997   C CB    . LEU A 1 127 ? 23.711  43.538  24.780  1.00 24.11  ? 127  LEU A CB    1 
ATOM   998   C CG    . LEU A 1 127 ? 23.001  44.873  25.003  1.00 24.13  ? 127  LEU A CG    1 
ATOM   999   C CD1   . LEU A 1 127 ? 23.911  46.116  24.887  1.00 21.67  ? 127  LEU A CD1   1 
ATOM   1000  C CD2   . LEU A 1 127 ? 21.830  44.951  24.024  1.00 23.33  ? 127  LEU A CD2   1 
ATOM   1001  N N     . GLY A 1 128 ? 26.224  41.395  26.029  1.00 25.19  ? 128  GLY A N     1 
ATOM   1002  C CA    . GLY A 1 128 ? 26.505  40.451  27.095  1.00 25.38  ? 128  GLY A CA    1 
ATOM   1003  C C     . GLY A 1 128 ? 25.450  39.371  27.268  1.00 25.42  ? 128  GLY A C     1 
ATOM   1004  O O     . GLY A 1 128 ? 25.514  38.590  28.227  1.00 25.83  ? 128  GLY A O     1 
ATOM   1005  N N     . ILE A 1 129 ? 24.489  39.308  26.350  1.00 24.88  ? 129  ILE A N     1 
ATOM   1006  C CA    . ILE A 1 129 ? 23.495  38.226  26.364  1.00 25.01  ? 129  ILE A CA    1 
ATOM   1007  C C     . ILE A 1 129 ? 24.156  36.913  25.911  1.00 24.90  ? 129  ILE A C     1 
ATOM   1008  O O     . ILE A 1 129 ? 24.917  36.892  24.939  1.00 25.15  ? 129  ILE A O     1 
ATOM   1009  C CB    . ILE A 1 129 ? 22.240  38.573  25.473  1.00 25.01  ? 129  ILE A CB    1 
ATOM   1010  C CG1   . ILE A 1 129 ? 21.508  39.831  25.993  1.00 25.43  ? 129  ILE A CG1   1 
ATOM   1011  C CG2   . ILE A 1 129 ? 21.290  37.384  25.325  1.00 23.79  ? 129  ILE A CG2   1 
ATOM   1012  C CD1   . ILE A 1 129 ? 20.813  39.701  27.380  1.00 27.02  ? 129  ILE A CD1   1 
ATOM   1013  N N     . LYS A 1 130 ? 23.872  35.835  26.629  1.00 24.70  ? 130  LYS A N     1 
ATOM   1014  C CA    . LYS A 1 130 ? 24.466  34.532  26.361  1.00 24.79  ? 130  LYS A CA    1 
ATOM   1015  C C     . LYS A 1 130 ? 23.389  33.460  26.202  1.00 24.38  ? 130  LYS A C     1 
ATOM   1016  O O     . LYS A 1 130 ? 22.229  33.666  26.559  1.00 24.78  ? 130  LYS A O     1 
ATOM   1017  C CB    . LYS A 1 130 ? 25.385  34.142  27.515  1.00 25.05  ? 130  LYS A CB    1 
ATOM   1018  C CG    . LYS A 1 130 ? 26.223  35.289  28.034  1.00 28.23  ? 130  LYS A CG    1 
ATOM   1019  C CD    . LYS A 1 130 ? 27.649  34.856  28.425  1.00 32.47  ? 130  LYS A CD    1 
ATOM   1020  C CE    . LYS A 1 130 ? 28.701  35.846  27.880  1.00 35.14  ? 130  LYS A CE    1 
ATOM   1021  N NZ    . LYS A 1 130 ? 28.394  37.286  28.217  1.00 37.01  ? 130  LYS A NZ    1 
ATOM   1022  N N     . LYS A 1 131 ? 23.785  32.307  25.687  1.00 23.49  ? 131  LYS A N     1 
ATOM   1023  C CA    . LYS A 1 131 ? 22.913  31.160  25.582  1.00 23.01  ? 131  LYS A CA    1 
ATOM   1024  C C     . LYS A 1 131 ? 22.302  30.880  26.950  1.00 22.70  ? 131  LYS A C     1 
ATOM   1025  O O     . LYS A 1 131 ? 23.002  30.915  27.945  1.00 23.27  ? 131  LYS A O     1 
ATOM   1026  C CB    . LYS A 1 131 ? 23.725  29.952  25.093  1.00 22.96  ? 131  LYS A CB    1 
ATOM   1027  C CG    . LYS A 1 131 ? 22.941  28.643  25.046  1.00 22.95  ? 131  LYS A CG    1 
ATOM   1028  C CD    . LYS A 1 131 ? 23.842  27.459  24.759  1.00 22.48  ? 131  LYS A CD    1 
ATOM   1029  C CE    . LYS A 1 131 ? 23.010  26.248  24.405  1.00 21.16  ? 131  LYS A CE    1 
ATOM   1030  N NZ    . LYS A 1 131 ? 23.808  25.017  24.161  1.00 19.29  ? 131  LYS A NZ    1 
ATOM   1031  N N     . GLY A 1 132 ? 20.999  30.624  27.010  1.00 22.39  ? 132  GLY A N     1 
ATOM   1032  C CA    . GLY A 1 132 ? 20.351  30.325  28.288  1.00 21.91  ? 132  GLY A CA    1 
ATOM   1033  C C     . GLY A 1 132 ? 19.723  31.510  29.027  1.00 21.58  ? 132  GLY A C     1 
ATOM   1034  O O     . GLY A 1 132 ? 18.823  31.306  29.843  1.00 21.86  ? 132  GLY A O     1 
ATOM   1035  N N     . ASP A 1 133 ? 20.194  32.727  28.758  1.00 20.63  ? 133  ASP A N     1 
ATOM   1036  C CA    . ASP A 1 133 ? 19.582  33.944  29.306  1.00 20.77  ? 133  ASP A CA    1 
ATOM   1037  C C     . ASP A 1 133 ? 18.163  34.146  28.798  1.00 20.58  ? 133  ASP A C     1 
ATOM   1038  O O     . ASP A 1 133 ? 17.848  33.815  27.649  1.00 20.77  ? 133  ASP A O     1 
ATOM   1039  C CB    . ASP A 1 133 ? 20.390  35.206  28.954  1.00 20.69  ? 133  ASP A CB    1 
ATOM   1040  C CG    . ASP A 1 133 ? 21.751  35.260  29.645  1.00 20.92  ? 133  ASP A CG    1 
ATOM   1041  O OD1   . ASP A 1 133 ? 22.028  34.467  30.570  1.00 19.97  ? 133  ASP A OD1   1 
ATOM   1042  O OD2   . ASP A 1 133 ? 22.554  36.115  29.245  1.00 22.22  ? 133  ASP A OD2   1 
ATOM   1043  N N     . VAL A 1 134 ? 17.313  34.696  29.662  1.00 19.97  ? 134  VAL A N     1 
ATOM   1044  C CA    . VAL A 1 134 ? 15.947  35.018  29.269  1.00 19.18  ? 134  VAL A CA    1 
ATOM   1045  C C     . VAL A 1 134 ? 15.861  36.480  28.841  1.00 19.40  ? 134  VAL A C     1 
ATOM   1046  O O     . VAL A 1 134 ? 16.389  37.382  29.526  1.00 19.45  ? 134  VAL A O     1 
ATOM   1047  C CB    . VAL A 1 134 ? 14.891  34.659  30.373  1.00 19.05  ? 134  VAL A CB    1 
ATOM   1048  C CG1   . VAL A 1 134 ? 13.459  35.000  29.923  1.00 17.74  ? 134  VAL A CG1   1 
ATOM   1049  C CG2   . VAL A 1 134 ? 14.991  33.197  30.739  1.00 16.82  ? 134  VAL A CG2   1 
ATOM   1050  N N     . VAL A 1 135 ? 15.197  36.683  27.696  1.00 18.71  ? 135  VAL A N     1 
ATOM   1051  C CA    . VAL A 1 135 ? 15.040  37.984  27.062  1.00 18.04  ? 135  VAL A CA    1 
ATOM   1052  C C     . VAL A 1 135 ? 13.535  38.202  26.927  1.00 18.77  ? 135  VAL A C     1 
ATOM   1053  O O     . VAL A 1 135 ? 12.838  37.402  26.259  1.00 19.02  ? 135  VAL A O     1 
ATOM   1054  C CB    . VAL A 1 135 ? 15.696  38.016  25.649  1.00 17.49  ? 135  VAL A CB    1 
ATOM   1055  C CG1   . VAL A 1 135 ? 15.395  39.324  24.923  1.00 17.36  ? 135  VAL A CG1   1 
ATOM   1056  C CG2   . VAL A 1 135 ? 17.228  37.736  25.708  1.00 16.45  ? 135  VAL A CG2   1 
ATOM   1057  N N     . ALA A 1 136 ? 13.037  39.258  27.566  1.00 18.46  ? 136  ALA A N     1 
ATOM   1058  C CA    . ALA A 1 136 ? 11.630  39.647  27.438  1.00 18.79  ? 136  ALA A CA    1 
ATOM   1059  C C     . ALA A 1 136 ? 11.406  40.438  26.150  1.00 19.21  ? 136  ALA A C     1 
ATOM   1060  O O     . ALA A 1 136 ? 12.184  41.370  25.816  1.00 19.25  ? 136  ALA A O     1 
ATOM   1061  C CB    . ALA A 1 136 ? 11.182  40.452  28.641  1.00 18.65  ? 136  ALA A CB    1 
ATOM   1062  N N     . ILE A 1 137 ? 10.376  40.026  25.408  1.00 18.59  ? 137  ILE A N     1 
ATOM   1063  C CA    . ILE A 1 137 ? 9.957   40.706  24.199  1.00 17.36  ? 137  ILE A CA    1 
ATOM   1064  C C     . ILE A 1 137 ? 8.509   41.177  24.399  1.00 18.08  ? 137  ILE A C     1 
ATOM   1065  O O     . ILE A 1 137 ? 7.575   40.364  24.553  1.00 18.01  ? 137  ILE A O     1 
ATOM   1066  C CB    . ILE A 1 137 ? 10.080  39.770  22.979  1.00 17.80  ? 137  ILE A CB    1 
ATOM   1067  C CG1   . ILE A 1 137 ? 11.549  39.366  22.760  1.00 16.55  ? 137  ILE A CG1   1 
ATOM   1068  C CG2   . ILE A 1 137 ? 9.431   40.404  21.728  1.00 16.33  ? 137  ILE A CG2   1 
ATOM   1069  C CD1   . ILE A 1 137 ? 11.781  38.206  21.786  1.00 16.69  ? 137  ILE A CD1   1 
ATOM   1070  N N     . TYR A 1 138 ? 8.331   42.498  24.401  1.00 17.50  ? 138  TYR A N     1 
ATOM   1071  C CA    . TYR A 1 138 ? 7.041   43.131  24.644  1.00 16.77  ? 138  TYR A CA    1 
ATOM   1072  C C     . TYR A 1 138 ? 6.843   44.006  23.432  1.00 17.12  ? 138  TYR A C     1 
ATOM   1073  O O     . TYR A 1 138 ? 7.105   45.216  23.466  1.00 16.96  ? 138  TYR A O     1 
ATOM   1074  C CB    . TYR A 1 138 ? 7.130   43.986  25.918  1.00 16.73  ? 138  TYR A CB    1 
ATOM   1075  C CG    . TYR A 1 138 ? 5.851   44.640  26.399  1.00 15.71  ? 138  TYR A CG    1 
ATOM   1076  C CD1   . TYR A 1 138 ? 4.684   43.885  26.600  1.00 15.70  ? 138  TYR A CD1   1 
ATOM   1077  C CD2   . TYR A 1 138 ? 5.831   46.002  26.733  1.00 15.55  ? 138  TYR A CD2   1 
ATOM   1078  C CE1   . TYR A 1 138 ? 3.514   44.481  27.076  1.00 16.59  ? 138  TYR A CE1   1 
ATOM   1079  C CE2   . TYR A 1 138 ? 4.667   46.623  27.230  1.00 14.80  ? 138  TYR A CE2   1 
ATOM   1080  C CZ    . TYR A 1 138 ? 3.509   45.860  27.396  1.00 16.37  ? 138  TYR A CZ    1 
ATOM   1081  O OH    . TYR A 1 138 ? 2.347   46.442  27.860  1.00 16.08  ? 138  TYR A OH    1 
ATOM   1082  N N     . MET A 1 139 ? 6.401   43.382  22.348  1.00 17.06  ? 139  MET A N     1 
ATOM   1083  C CA    . MET A 1 139 ? 6.419   44.031  21.051  1.00 17.44  ? 139  MET A CA    1 
ATOM   1084  C C     . MET A 1 139 ? 5.022   44.048  20.415  1.00 16.74  ? 139  MET A C     1 
ATOM   1085  O O     . MET A 1 139 ? 4.195   43.186  20.729  1.00 16.25  ? 139  MET A O     1 
ATOM   1086  C CB    . MET A 1 139 ? 7.411   43.310  20.119  1.00 18.29  ? 139  MET A CB    1 
ATOM   1087  C CG    . MET A 1 139 ? 8.880   43.485  20.474  1.00 19.88  ? 139  MET A CG    1 
ATOM   1088  S SD    . MET A 1 139 ? 9.469   45.099  20.012  1.00 28.92  ? 139  MET A SD    1 
ATOM   1089  C CE    . MET A 1 139 ? 9.914   44.863  18.297  1.00 25.15  ? 139  MET A CE    1 
ATOM   1090  N N     . PRO A 1 140 ? 4.772   45.027  19.519  1.00 15.92  ? 140  PRO A N     1 
ATOM   1091  C CA    . PRO A 1 140 ? 3.588   45.027  18.676  1.00 16.10  ? 140  PRO A CA    1 
ATOM   1092  C C     . PRO A 1 140 ? 3.802   44.110  17.452  1.00 16.49  ? 140  PRO A C     1 
ATOM   1093  O O     . PRO A 1 140 ? 4.886   43.520  17.294  1.00 17.15  ? 140  PRO A O     1 
ATOM   1094  C CB    . PRO A 1 140 ? 3.477   46.487  18.251  1.00 15.87  ? 140  PRO A CB    1 
ATOM   1095  C CG    . PRO A 1 140 ? 4.902   47.010  18.281  1.00 15.26  ? 140  PRO A CG    1 
ATOM   1096  C CD    . PRO A 1 140 ? 5.652   46.188  19.254  1.00 16.02  ? 140  PRO A CD    1 
ATOM   1097  N N     . MET A 1 141 ? 2.800   44.016  16.585  1.00 16.44  ? 141  MET A N     1 
ATOM   1098  C CA    . MET A 1 141 ? 2.850   43.131  15.428  1.00 16.27  ? 141  MET A CA    1 
ATOM   1099  C C     . MET A 1 141 ? 3.635   43.774  14.270  1.00 16.59  ? 141  MET A C     1 
ATOM   1100  O O     . MET A 1 141 ? 3.070   44.173  13.245  1.00 16.67  ? 141  MET A O     1 
ATOM   1101  C CB    . MET A 1 141 ? 1.427   42.696  15.028  1.00 16.31  ? 141  MET A CB    1 
ATOM   1102  C CG    . MET A 1 141 ? 0.833   41.575  15.905  1.00 15.13  ? 141  MET A CG    1 
ATOM   1103  S SD    . MET A 1 141 ? 1.639   39.962  15.590  1.00 16.52  ? 141  MET A SD    1 
ATOM   1104  C CE    . MET A 1 141 ? 0.641   39.340  14.237  1.00 13.63  ? 141  MET A CE    1 
ATOM   1105  N N     . VAL A 1 142 ? 4.947   43.881  14.480  1.00 16.48  ? 142  VAL A N     1 
ATOM   1106  C CA    . VAL A 1 142 ? 5.895   44.465  13.529  1.00 16.59  ? 142  VAL A CA    1 
ATOM   1107  C C     . VAL A 1 142 ? 6.993   43.418  13.258  1.00 17.03  ? 142  VAL A C     1 
ATOM   1108  O O     . VAL A 1 142 ? 7.226   42.515  14.088  1.00 17.14  ? 142  VAL A O     1 
ATOM   1109  C CB    . VAL A 1 142 ? 6.504   45.825  14.061  1.00 16.84  ? 142  VAL A CB    1 
ATOM   1110  C CG1   . VAL A 1 142 ? 5.392   46.909  14.304  1.00 15.95  ? 142  VAL A CG1   1 
ATOM   1111  C CG2   . VAL A 1 142 ? 7.329   45.606  15.351  1.00 15.59  ? 142  VAL A CG2   1 
ATOM   1112  N N     . PRO A 1 143 ? 7.649   43.489  12.088  1.00 17.08  ? 143  PRO A N     1 
ATOM   1113  C CA    . PRO A 1 143 ? 8.647   42.449  11.759  1.00 16.72  ? 143  PRO A CA    1 
ATOM   1114  C C     . PRO A 1 143 ? 9.828   42.379  12.732  1.00 16.10  ? 143  PRO A C     1 
ATOM   1115  O O     . PRO A 1 143 ? 10.460  41.348  12.861  1.00 15.69  ? 143  PRO A O     1 
ATOM   1116  C CB    . PRO A 1 143 ? 9.145   42.862  10.369  1.00 17.01  ? 143  PRO A CB    1 
ATOM   1117  C CG    . PRO A 1 143 ? 8.109   43.776  9.817   1.00 17.03  ? 143  PRO A CG    1 
ATOM   1118  C CD    . PRO A 1 143 ? 7.500   44.475  10.997  1.00 17.34  ? 143  PRO A CD    1 
ATOM   1119  N N     . GLU A 1 144 ? 10.121  43.480  13.405  1.00 16.73  ? 144  GLU A N     1 
ATOM   1120  C CA    . GLU A 1 144 ? 11.207  43.521  14.390  1.00 16.87  ? 144  GLU A CA    1 
ATOM   1121  C C     . GLU A 1 144 ? 10.948  42.586  15.577  1.00 17.00  ? 144  GLU A C     1 
ATOM   1122  O O     . GLU A 1 144 ? 11.901  42.131  16.222  1.00 17.30  ? 144  GLU A O     1 
ATOM   1123  C CB    . GLU A 1 144 ? 11.434  44.951  14.861  1.00 17.11  ? 144  GLU A CB    1 
ATOM   1124  C CG    . GLU A 1 144 ? 12.057  45.861  13.769  1.00 18.10  ? 144  GLU A CG    1 
ATOM   1125  C CD    . GLU A 1 144 ? 11.044  46.497  12.842  1.00 19.20  ? 144  GLU A CD    1 
ATOM   1126  O OE1   . GLU A 1 144 ? 9.822   46.236  12.958  1.00 19.65  ? 144  GLU A OE1   1 
ATOM   1127  O OE2   . GLU A 1 144 ? 11.482  47.272  11.977  1.00 21.16  ? 144  GLU A OE2   1 
ATOM   1128  N N     . ALA A 1 145 ? 9.677   42.281  15.855  1.00 16.51  ? 145  ALA A N     1 
ATOM   1129  C CA    . ALA A 1 145 ? 9.350   41.232  16.843  1.00 16.90  ? 145  ALA A CA    1 
ATOM   1130  C C     . ALA A 1 145 ? 9.855   39.862  16.398  1.00 16.54  ? 145  ALA A C     1 
ATOM   1131  O O     . ALA A 1 145 ? 10.343  39.091  17.211  1.00 17.07  ? 145  ALA A O     1 
ATOM   1132  C CB    . ALA A 1 145 ? 7.833   41.170  17.114  1.00 17.06  ? 145  ALA A CB    1 
ATOM   1133  N N     . ALA A 1 146 ? 9.725   39.564  15.107  1.00 15.89  ? 146  ALA A N     1 
ATOM   1134  C CA    . ALA A 1 146 ? 10.147  38.280  14.577  1.00 15.85  ? 146  ALA A CA    1 
ATOM   1135  C C     . ALA A 1 146 ? 11.672  38.222  14.565  1.00 15.73  ? 146  ALA A C     1 
ATOM   1136  O O     . ALA A 1 146 ? 12.264  37.198  14.909  1.00 15.93  ? 146  ALA A O     1 
ATOM   1137  C CB    . ALA A 1 146 ? 9.574   38.064  13.169  1.00 15.31  ? 146  ALA A CB    1 
ATOM   1138  N N     . VAL A 1 147 ? 12.302  39.331  14.177  1.00 15.91  ? 147  VAL A N     1 
ATOM   1139  C CA    . VAL A 1 147 ? 13.759  39.445  14.200  1.00 15.38  ? 147  VAL A CA    1 
ATOM   1140  C C     . VAL A 1 147 ? 14.279  39.127  15.605  1.00 15.75  ? 147  VAL A C     1 
ATOM   1141  O O     . VAL A 1 147 ? 15.206  38.328  15.765  1.00 16.07  ? 147  VAL A O     1 
ATOM   1142  C CB    . VAL A 1 147 ? 14.226  40.857  13.743  1.00 15.56  ? 147  VAL A CB    1 
ATOM   1143  C CG1   . VAL A 1 147 ? 15.731  41.034  13.920  1.00 13.25  ? 147  VAL A CG1   1 
ATOM   1144  C CG2   . VAL A 1 147 ? 13.829  41.091  12.284  1.00 14.73  ? 147  VAL A CG2   1 
ATOM   1145  N N     . ALA A 1 148 ? 13.660  39.734  16.614  1.00 15.51  ? 148  ALA A N     1 
ATOM   1146  C CA    . ALA A 1 148 ? 14.080  39.565  17.994  1.00 15.52  ? 148  ALA A CA    1 
ATOM   1147  C C     . ALA A 1 148 ? 13.968  38.096  18.426  1.00 15.96  ? 148  ALA A C     1 
ATOM   1148  O O     . ALA A 1 148 ? 14.926  37.528  18.943  1.00 16.15  ? 148  ALA A O     1 
ATOM   1149  C CB    . ALA A 1 148 ? 13.266  40.475  18.925  1.00 15.05  ? 148  ALA A CB    1 
ATOM   1150  N N     . MET A 1 149 ? 12.809  37.486  18.207  1.00 16.15  ? 149  MET A N     1 
ATOM   1151  C CA    . MET A 1 149 ? 12.618  36.073  18.543  1.00 16.40  ? 149  MET A CA    1 
ATOM   1152  C C     . MET A 1 149 ? 13.630  35.142  17.840  1.00 16.93  ? 149  MET A C     1 
ATOM   1153  O O     . MET A 1 149 ? 14.286  34.308  18.491  1.00 16.80  ? 149  MET A O     1 
ATOM   1154  C CB    . MET A 1 149 ? 11.177  35.649  18.210  1.00 16.77  ? 149  MET A CB    1 
ATOM   1155  C CG    . MET A 1 149 ? 10.096  36.421  18.989  1.00 14.76  ? 149  MET A CG    1 
ATOM   1156  S SD    . MET A 1 149 ? 8.418   36.139  18.360  1.00 15.62  ? 149  MET A SD    1 
ATOM   1157  C CE    . MET A 1 149 ? 8.159   34.395  18.763  1.00 14.86  ? 149  MET A CE    1 
ATOM   1158  N N     . LEU A 1 150 ? 13.767  35.293  16.520  1.00 17.07  ? 150  LEU A N     1 
ATOM   1159  C CA    . LEU A 1 150 ? 14.668  34.430  15.748  1.00 17.62  ? 150  LEU A CA    1 
ATOM   1160  C C     . LEU A 1 150 ? 16.139  34.613  16.099  1.00 17.55  ? 150  LEU A C     1 
ATOM   1161  O O     . LEU A 1 150 ? 16.911  33.672  15.999  1.00 18.04  ? 150  LEU A O     1 
ATOM   1162  C CB    . LEU A 1 150 ? 14.469  34.621  14.236  1.00 17.75  ? 150  LEU A CB    1 
ATOM   1163  C CG    . LEU A 1 150 ? 13.174  34.086  13.625  1.00 18.21  ? 150  LEU A CG    1 
ATOM   1164  C CD1   . LEU A 1 150 ? 12.718  34.921  12.419  1.00 16.76  ? 150  LEU A CD1   1 
ATOM   1165  C CD2   . LEU A 1 150 ? 13.344  32.619  13.259  1.00 18.22  ? 150  LEU A CD2   1 
ATOM   1166  N N     . ALA A 1 151 ? 16.522  35.828  16.488  1.00 17.52  ? 151  ALA A N     1 
ATOM   1167  C CA    . ALA A 1 151 ? 17.887  36.116  16.910  1.00 17.39  ? 151  ALA A CA    1 
ATOM   1168  C C     . ALA A 1 151 ? 18.191  35.540  18.297  1.00 17.63  ? 151  ALA A C     1 
ATOM   1169  O O     . ALA A 1 151 ? 19.327  35.141  18.582  1.00 17.64  ? 151  ALA A O     1 
ATOM   1170  C CB    . ALA A 1 151 ? 18.153  37.616  16.879  1.00 17.31  ? 151  ALA A CB    1 
ATOM   1171  N N     . CYS A 1 152 ? 17.178  35.516  19.160  1.00 17.35  ? 152  CYS A N     1 
ATOM   1172  C CA    . CYS A 1 152 ? 17.308  34.880  20.455  1.00 17.10  ? 152  CYS A CA    1 
ATOM   1173  C C     . CYS A 1 152 ? 17.566  33.379  20.258  1.00 17.27  ? 152  CYS A C     1 
ATOM   1174  O O     . CYS A 1 152 ? 18.504  32.788  20.844  1.00 16.72  ? 152  CYS A O     1 
ATOM   1175  C CB    . CYS A 1 152 ? 16.051  35.115  21.272  1.00 16.45  ? 152  CYS A CB    1 
ATOM   1176  S SG    . CYS A 1 152 ? 16.002  36.722  22.089  1.00 17.45  ? 152  CYS A SG    1 
ATOM   1177  N N     . ALA A 1 153 ? 16.743  32.777  19.398  1.00 17.54  ? 153  ALA A N     1 
ATOM   1178  C CA    . ALA A 1 153 ? 16.813  31.353  19.129  1.00 17.39  ? 153  ALA A CA    1 
ATOM   1179  C C     . ALA A 1 153 ? 18.159  30.996  18.492  1.00 17.47  ? 153  ALA A C     1 
ATOM   1180  O O     . ALA A 1 153 ? 18.744  29.939  18.797  1.00 17.42  ? 153  ALA A O     1 
ATOM   1181  C CB    . ALA A 1 153 ? 15.646  30.916  18.240  1.00 17.38  ? 153  ALA A CB    1 
ATOM   1182  N N     . ARG A 1 154 ? 18.638  31.878  17.612  1.00 16.83  ? 154  ARG A N     1 
ATOM   1183  C CA    . ARG A 1 154 ? 19.911  31.667  16.914  1.00 16.58  ? 154  ARG A CA    1 
ATOM   1184  C C     . ARG A 1 154 ? 21.086  31.521  17.886  1.00 16.85  ? 154  ARG A C     1 
ATOM   1185  O O     . ARG A 1 154 ? 21.980  30.686  17.666  1.00 16.35  ? 154  ARG A O     1 
ATOM   1186  C CB    . ARG A 1 154 ? 20.186  32.796  15.918  1.00 15.93  ? 154  ARG A CB    1 
ATOM   1187  C CG    . ARG A 1 154 ? 21.442  32.591  15.075  1.00 15.85  ? 154  ARG A CG    1 
ATOM   1188  C CD    . ARG A 1 154 ? 21.545  33.650  13.954  1.00 16.96  ? 154  ARG A CD    1 
ATOM   1189  N NE    . ARG A 1 154 ? 22.551  33.353  12.917  1.00 16.97  ? 154  ARG A NE    1 
ATOM   1190  C CZ    . ARG A 1 154 ? 22.302  32.718  11.772  1.00 18.52  ? 154  ARG A CZ    1 
ATOM   1191  N NH1   . ARG A 1 154 ? 21.091  32.260  11.508  1.00 19.90  ? 154  ARG A NH1   1 
ATOM   1192  N NH2   . ARG A 1 154 ? 23.264  32.530  10.883  1.00 19.11  ? 154  ARG A NH2   1 
ATOM   1193  N N     . ILE A 1 155 ? 21.077  32.328  18.947  1.00 16.58  ? 155  ILE A N     1 
ATOM   1194  C CA    . ILE A 1 155 ? 22.144  32.296  19.924  1.00 17.51  ? 155  ILE A CA    1 
ATOM   1195  C C     . ILE A 1 155 ? 21.805  31.454  21.149  1.00 18.03  ? 155  ILE A C     1 
ATOM   1196  O O     . ILE A 1 155 ? 22.568  31.397  22.095  1.00 18.70  ? 155  ILE A O     1 
ATOM   1197  C CB    . ILE A 1 155 ? 22.623  33.732  20.334  1.00 17.98  ? 155  ILE A CB    1 
ATOM   1198  C CG1   . ILE A 1 155 ? 21.587  34.457  21.206  1.00 17.42  ? 155  ILE A CG1   1 
ATOM   1199  C CG2   . ILE A 1 155 ? 23.010  34.553  19.080  1.00 17.57  ? 155  ILE A CG2   1 
ATOM   1200  C CD1   . ILE A 1 155 ? 22.090  35.764  21.805  1.00 17.92  ? 155  ILE A CD1   1 
ATOM   1201  N N     . GLY A 1 156 ? 20.673  30.769  21.123  1.00 19.18  ? 156  GLY A N     1 
ATOM   1202  C CA    . GLY A 1 156 ? 20.318  29.889  22.237  1.00 19.44  ? 156  GLY A CA    1 
ATOM   1203  C C     . GLY A 1 156 ? 19.868  30.678  23.465  1.00 19.93  ? 156  GLY A C     1 
ATOM   1204  O O     . GLY A 1 156 ? 19.834  30.139  24.571  1.00 19.23  ? 156  GLY A O     1 
ATOM   1205  N N     . ALA A 1 157 ? 19.548  31.965  23.276  1.00 19.96  ? 157  ALA A N     1 
ATOM   1206  C CA    . ALA A 1 157 ? 18.906  32.737  24.329  1.00 20.34  ? 157  ALA A CA    1 
ATOM   1207  C C     . ALA A 1 157 ? 17.445  32.261  24.379  1.00 20.67  ? 157  ALA A C     1 
ATOM   1208  O O     . ALA A 1 157 ? 16.919  31.742  23.375  1.00 21.48  ? 157  ALA A O     1 
ATOM   1209  C CB    . ALA A 1 157 ? 18.997  34.212  24.058  1.00 19.95  ? 157  ALA A CB    1 
ATOM   1210  N N     . VAL A 1 158 ? 16.819  32.380  25.550  1.00 19.93  ? 158  VAL A N     1 
ATOM   1211  C CA    . VAL A 1 158 ? 15.467  31.866  25.766  1.00 19.47  ? 158  VAL A CA    1 
ATOM   1212  C C     . VAL A 1 158 ? 14.506  33.065  25.790  1.00 19.21  ? 158  VAL A C     1 
ATOM   1213  O O     . VAL A 1 158 ? 14.465  33.822  26.760  1.00 19.22  ? 158  VAL A O     1 
ATOM   1214  C CB    . VAL A 1 158 ? 15.402  31.083  27.112  1.00 19.82  ? 158  VAL A CB    1 
ATOM   1215  C CG1   . VAL A 1 158 ? 14.001  30.619  27.406  1.00 18.50  ? 158  VAL A CG1   1 
ATOM   1216  C CG2   . VAL A 1 158 ? 16.398  29.922  27.117  1.00 19.10  ? 158  VAL A CG2   1 
ATOM   1217  N N     . HIS A 1 159 ? 13.759  33.272  24.715  1.00 18.54  ? 159  HIS A N     1 
ATOM   1218  C CA    . HIS A 1 159 ? 12.890  34.427  24.687  1.00 17.72  ? 159  HIS A CA    1 
ATOM   1219  C C     . HIS A 1 159 ? 11.624  34.161  25.476  1.00 18.02  ? 159  HIS A C     1 
ATOM   1220  O O     . HIS A 1 159 ? 11.172  33.015  25.590  1.00 17.64  ? 159  HIS A O     1 
ATOM   1221  C CB    . HIS A 1 159 ? 12.616  34.972  23.267  1.00 17.02  ? 159  HIS A CB    1 
ATOM   1222  C CG    . HIS A 1 159 ? 11.857  34.043  22.371  1.00 14.66  ? 159  HIS A CG    1 
ATOM   1223  N ND1   . HIS A 1 159 ? 10.525  33.731  22.562  1.00 13.39  ? 159  HIS A ND1   1 
ATOM   1224  C CD2   . HIS A 1 159 ? 12.230  33.409  21.240  1.00 13.24  ? 159  HIS A CD2   1 
ATOM   1225  C CE1   . HIS A 1 159 ? 10.126  32.905  21.612  1.00 14.73  ? 159  HIS A CE1   1 
ATOM   1226  N NE2   . HIS A 1 159 ? 11.138  32.702  20.790  1.00 15.51  ? 159  HIS A NE2   1 
ATOM   1227  N N     . SER A 1 160 ? 11.095  35.240  26.042  1.00 17.96  ? 160  SER A N     1 
ATOM   1228  C CA    . SER A 1 160 ? 9.814   35.225  26.721  1.00 18.25  ? 160  SER A CA    1 
ATOM   1229  C C     . SER A 1 160 ? 8.993   36.380  26.155  1.00 18.19  ? 160  SER A C     1 
ATOM   1230  O O     . SER A 1 160 ? 9.169   37.545  26.510  1.00 18.64  ? 160  SER A O     1 
ATOM   1231  C CB    . SER A 1 160 ? 10.012  35.338  28.240  1.00 17.59  ? 160  SER A CB    1 
ATOM   1232  O OG    . SER A 1 160 ? 8.776   35.262  28.905  1.00 17.62  ? 160  SER A OG    1 
ATOM   1233  N N     . VAL A 1 161 ? 8.120   36.046  25.224  1.00 18.59  ? 161  VAL A N     1 
ATOM   1234  C CA    . VAL A 1 161 ? 7.275   37.041  24.598  1.00 18.34  ? 161  VAL A CA    1 
ATOM   1235  C C     . VAL A 1 161 ? 6.087   37.339  25.520  1.00 18.36  ? 161  VAL A C     1 
ATOM   1236  O O     . VAL A 1 161 ? 5.405   36.429  26.032  1.00 17.54  ? 161  VAL A O     1 
ATOM   1237  C CB    . VAL A 1 161 ? 6.831   36.600  23.167  1.00 18.78  ? 161  VAL A CB    1 
ATOM   1238  C CG1   . VAL A 1 161 ? 5.992   37.695  22.486  1.00 17.09  ? 161  VAL A CG1   1 
ATOM   1239  C CG2   . VAL A 1 161 ? 8.083   36.238  22.305  1.00 18.15  ? 161  VAL A CG2   1 
ATOM   1240  N N     . ILE A 1 162 ? 5.892   38.633  25.745  1.00 18.35  ? 162  ILE A N     1 
ATOM   1241  C CA    . ILE A 1 162 ? 4.814   39.151  26.562  1.00 18.04  ? 162  ILE A CA    1 
ATOM   1242  C C     . ILE A 1 162 ? 3.856   39.918  25.655  1.00 18.13  ? 162  ILE A C     1 
ATOM   1243  O O     . ILE A 1 162 ? 4.218   40.950  25.100  1.00 18.07  ? 162  ILE A O     1 
ATOM   1244  C CB    . ILE A 1 162 ? 5.349   40.047  27.689  1.00 18.07  ? 162  ILE A CB    1 
ATOM   1245  C CG1   . ILE A 1 162 ? 6.407   39.285  28.508  1.00 17.54  ? 162  ILE A CG1   1 
ATOM   1246  C CG2   . ILE A 1 162 ? 4.181   40.513  28.605  1.00 18.64  ? 162  ILE A CG2   1 
ATOM   1247  C CD1   . ILE A 1 162 ? 7.271   40.159  29.396  1.00 16.19  ? 162  ILE A CD1   1 
ATOM   1248  N N     . PHE A 1 163 ? 2.646   39.380  25.497  1.00 18.30  ? 163  PHE A N     1 
ATOM   1249  C CA    . PHE A 1 163 ? 1.569   40.003  24.716  1.00 18.56  ? 163  PHE A CA    1 
ATOM   1250  C C     . PHE A 1 163 ? 1.466   41.503  25.026  1.00 18.66  ? 163  PHE A C     1 
ATOM   1251  O O     . PHE A 1 163 ? 1.413   41.899  26.202  1.00 18.68  ? 163  PHE A O     1 
ATOM   1252  C CB    . PHE A 1 163 ? 0.250   39.278  25.015  1.00 18.36  ? 163  PHE A CB    1 
ATOM   1253  C CG    . PHE A 1 163 ? -0.985  39.950  24.454  1.00 18.30  ? 163  PHE A CG    1 
ATOM   1254  C CD1   . PHE A 1 163 ? -1.207  40.009  23.085  1.00 20.14  ? 163  PHE A CD1   1 
ATOM   1255  C CD2   . PHE A 1 163 ? -1.955  40.468  25.314  1.00 19.85  ? 163  PHE A CD2   1 
ATOM   1256  C CE1   . PHE A 1 163 ? -2.372  40.621  22.559  1.00 21.88  ? 163  PHE A CE1   1 
ATOM   1257  C CE2   . PHE A 1 163 ? -3.140  41.065  24.813  1.00 21.65  ? 163  PHE A CE2   1 
ATOM   1258  C CZ    . PHE A 1 163 ? -3.347  41.145  23.434  1.00 20.60  ? 163  PHE A CZ    1 
ATOM   1259  N N     . GLY A 1 164 ? 1.452   42.322  23.973  1.00 18.69  ? 164  GLY A N     1 
ATOM   1260  C CA    . GLY A 1 164 ? 1.478   43.780  24.121  1.00 19.28  ? 164  GLY A CA    1 
ATOM   1261  C C     . GLY A 1 164 ? 0.327   44.366  24.931  1.00 20.13  ? 164  GLY A C     1 
ATOM   1262  O O     . GLY A 1 164 ? 0.411   45.508  25.400  1.00 20.78  ? 164  GLY A O     1 
ATOM   1263  N N     . GLY A 1 165 ? -0.744  43.588  25.098  1.00 19.73  ? 165  GLY A N     1 
ATOM   1264  C CA    . GLY A 1 165 ? -1.941  44.059  25.768  1.00 19.33  ? 165  GLY A CA    1 
ATOM   1265  C C     . GLY A 1 165 ? -1.909  43.896  27.281  1.00 19.30  ? 165  GLY A C     1 
ATOM   1266  O O     . GLY A 1 165 ? -2.828  44.373  27.961  1.00 20.33  ? 165  GLY A O     1 
ATOM   1267  N N     . PHE A 1 166 ? -0.887  43.223  27.814  1.00 18.10  ? 166  PHE A N     1 
ATOM   1268  C CA    . PHE A 1 166 ? -0.703  43.144  29.267  1.00 17.65  ? 166  PHE A CA    1 
ATOM   1269  C C     . PHE A 1 166 ? -0.317  44.502  29.845  1.00 17.36  ? 166  PHE A C     1 
ATOM   1270  O O     . PHE A 1 166 ? 0.348   45.307  29.173  1.00 18.06  ? 166  PHE A O     1 
ATOM   1271  C CB    . PHE A 1 166 ? 0.358   42.105  29.641  1.00 17.73  ? 166  PHE A CB    1 
ATOM   1272  C CG    . PHE A 1 166 ? -0.145  40.697  29.607  1.00 17.03  ? 166  PHE A CG    1 
ATOM   1273  C CD1   . PHE A 1 166 ? -1.243  40.311  30.381  1.00 17.62  ? 166  PHE A CD1   1 
ATOM   1274  C CD2   . PHE A 1 166 ? 0.457   39.758  28.796  1.00 17.48  ? 166  PHE A CD2   1 
ATOM   1275  C CE1   . PHE A 1 166 ? -1.725  39.008  30.348  1.00 17.02  ? 166  PHE A CE1   1 
ATOM   1276  C CE2   . PHE A 1 166 ? -0.028  38.444  28.746  1.00 19.45  ? 166  PHE A CE2   1 
ATOM   1277  C CZ    . PHE A 1 166 ? -1.122  38.073  29.526  1.00 18.63  ? 166  PHE A CZ    1 
ATOM   1278  N N     . SER A 1 167 ? -0.754  44.755  31.075  1.00 16.79  ? 167  SER A N     1 
ATOM   1279  C CA    . SER A 1 167 ? -0.404  45.959  31.837  1.00 15.78  ? 167  SER A CA    1 
ATOM   1280  C C     . SER A 1 167 ? 1.020   45.917  32.449  1.00 15.70  ? 167  SER A C     1 
ATOM   1281  O O     . SER A 1 167 ? 1.631   44.851  32.532  1.00 14.85  ? 167  SER A O     1 
ATOM   1282  C CB    . SER A 1 167 ? -1.405  46.141  32.964  1.00 15.36  ? 167  SER A CB    1 
ATOM   1283  O OG    . SER A 1 167 ? -1.234  45.120  33.933  1.00 16.56  ? 167  SER A OG    1 
ATOM   1284  N N     . PRO A 1 168 ? 1.565   47.096  32.852  1.00 15.52  ? 168  PRO A N     1 
ATOM   1285  C CA    . PRO A 1 168 ? 2.828   47.139  33.589  1.00 15.57  ? 168  PRO A CA    1 
ATOM   1286  C C     . PRO A 1 168 ? 2.973   46.066  34.684  1.00 16.20  ? 168  PRO A C     1 
ATOM   1287  O O     . PRO A 1 168 ? 4.044   45.477  34.850  1.00 15.96  ? 168  PRO A O     1 
ATOM   1288  C CB    . PRO A 1 168 ? 2.812   48.535  34.188  1.00 15.21  ? 168  PRO A CB    1 
ATOM   1289  C CG    . PRO A 1 168 ? 2.108   49.353  33.142  1.00 15.33  ? 168  PRO A CG    1 
ATOM   1290  C CD    . PRO A 1 168 ? 1.070   48.456  32.538  1.00 14.83  ? 168  PRO A CD    1 
ATOM   1291  N N     . GLU A 1 169 ? 1.902   45.814  35.415  1.00 16.92  ? 169  GLU A N     1 
ATOM   1292  C CA    . GLU A 1 169 ? 1.941   44.872  36.517  1.00 18.27  ? 169  GLU A CA    1 
ATOM   1293  C C     . GLU A 1 169 ? 2.077   43.421  35.999  1.00 17.99  ? 169  GLU A C     1 
ATOM   1294  O O     . GLU A 1 169 ? 2.865   42.633  36.526  1.00 18.83  ? 169  GLU A O     1 
ATOM   1295  C CB    . GLU A 1 169 ? 0.724   45.101  37.434  1.00 18.38  ? 169  GLU A CB    1 
ATOM   1296  C CG    . GLU A 1 169 ? 0.607   44.163  38.629  1.00 22.43  ? 169  GLU A CG    1 
ATOM   1297  C CD    . GLU A 1 169 ? 1.691   44.391  39.674  1.00 28.09  ? 169  GLU A CD    1 
ATOM   1298  O OE1   . GLU A 1 169 ? 1.956   45.575  40.019  1.00 29.39  ? 169  GLU A OE1   1 
ATOM   1299  O OE2   . GLU A 1 169 ? 2.275   43.378  40.141  1.00 29.42  ? 169  GLU A OE2   1 
ATOM   1300  N N     . ALA A 1 170 ? 1.339   43.094  34.946  1.00 17.61  ? 170  ALA A N     1 
ATOM   1301  C CA    . ALA A 1 170 ? 1.442   41.787  34.291  1.00 16.97  ? 170  ALA A CA    1 
ATOM   1302  C C     . ALA A 1 170 ? 2.835   41.578  33.699  1.00 16.63  ? 170  ALA A C     1 
ATOM   1303  O O     . ALA A 1 170 ? 3.397   40.474  33.763  1.00 17.15  ? 170  ALA A O     1 
ATOM   1304  C CB    . ALA A 1 170 ? 0.373   41.659  33.216  1.00 16.69  ? 170  ALA A CB    1 
ATOM   1305  N N     . VAL A 1 171 ? 3.399   42.650  33.151  1.00 15.99  ? 171  VAL A N     1 
ATOM   1306  C CA    . VAL A 1 171 ? 4.745   42.637  32.581  1.00 15.19  ? 171  VAL A CA    1 
ATOM   1307  C C     . VAL A 1 171 ? 5.826   42.432  33.642  1.00 15.90  ? 171  VAL A C     1 
ATOM   1308  O O     . VAL A 1 171 ? 6.656   41.551  33.502  1.00 16.19  ? 171  VAL A O     1 
ATOM   1309  C CB    . VAL A 1 171 ? 5.018   43.918  31.771  1.00 14.92  ? 171  VAL A CB    1 
ATOM   1310  C CG1   . VAL A 1 171 ? 6.471   44.012  31.389  1.00 12.17  ? 171  VAL A CG1   1 
ATOM   1311  C CG2   . VAL A 1 171 ? 4.124   43.949  30.524  1.00 13.91  ? 171  VAL A CG2   1 
ATOM   1312  N N     . ALA A 1 172 ? 5.802   43.237  34.697  1.00 16.29  ? 172  ALA A N     1 
ATOM   1313  C CA    . ALA A 1 172 ? 6.713   43.080  35.815  1.00 17.05  ? 172  ALA A CA    1 
ATOM   1314  C C     . ALA A 1 172 ? 6.675   41.655  36.360  1.00 17.46  ? 172  ALA A C     1 
ATOM   1315  O O     . ALA A 1 172 ? 7.724   41.011  36.526  1.00 18.53  ? 172  ALA A O     1 
ATOM   1316  C CB    . ALA A 1 172 ? 6.382   44.099  36.933  1.00 16.75  ? 172  ALA A CB    1 
ATOM   1317  N N     . GLY A 1 173 ? 5.476   41.152  36.629  1.00 17.47  ? 173  GLY A N     1 
ATOM   1318  C CA    . GLY A 1 173 ? 5.336   39.772  37.085  1.00 17.28  ? 173  GLY A CA    1 
ATOM   1319  C C     . GLY A 1 173 ? 6.156   38.795  36.250  1.00 17.78  ? 173  GLY A C     1 
ATOM   1320  O O     . GLY A 1 173 ? 6.896   37.975  36.801  1.00 18.78  ? 173  GLY A O     1 
ATOM   1321  N N     . ARG A 1 174 ? 6.040   38.891  34.928  1.00 17.17  ? 174  ARG A N     1 
ATOM   1322  C CA    . ARG A 1 174 ? 6.683   37.952  34.010  1.00 17.27  ? 174  ARG A CA    1 
ATOM   1323  C C     . ARG A 1 174 ? 8.204   38.131  34.010  1.00 17.21  ? 174  ARG A C     1 
ATOM   1324  O O     . ARG A 1 174 ? 8.964   37.160  33.961  1.00 16.57  ? 174  ARG A O     1 
ATOM   1325  C CB    . ARG A 1 174 ? 6.084   38.097  32.598  1.00 17.10  ? 174  ARG A CB    1 
ATOM   1326  C CG    . ARG A 1 174 ? 4.666   37.497  32.501  1.00 17.28  ? 174  ARG A CG    1 
ATOM   1327  C CD    . ARG A 1 174 ? 3.818   37.994  31.312  1.00 17.50  ? 174  ARG A CD    1 
ATOM   1328  N NE    . ARG A 1 174 ? 2.549   37.272  31.286  1.00 19.51  ? 174  ARG A NE    1 
ATOM   1329  C CZ    . ARG A 1 174 ? 1.548   37.478  32.146  1.00 20.92  ? 174  ARG A CZ    1 
ATOM   1330  N NH1   . ARG A 1 174 ? 1.655   38.412  33.077  1.00 20.41  ? 174  ARG A NH1   1 
ATOM   1331  N NH2   . ARG A 1 174 ? 0.434   36.751  32.084  1.00 19.20  ? 174  ARG A NH2   1 
ATOM   1332  N N     . ILE A 1 175 ? 8.637   39.380  34.106  1.00 17.62  ? 175  ILE A N     1 
ATOM   1333  C CA    . ILE A 1 175 ? 10.056  39.694  34.153  1.00 18.43  ? 175  ILE A CA    1 
ATOM   1334  C C     . ILE A 1 175 ? 10.679  39.160  35.454  1.00 18.89  ? 175  ILE A C     1 
ATOM   1335  O O     . ILE A 1 175 ? 11.792  38.663  35.450  1.00 19.12  ? 175  ILE A O     1 
ATOM   1336  C CB    . ILE A 1 175 ? 10.300  41.218  34.054  1.00 18.39  ? 175  ILE A CB    1 
ATOM   1337  C CG1   . ILE A 1 175 ? 9.986   41.729  32.632  1.00 17.97  ? 175  ILE A CG1   1 
ATOM   1338  C CG2   . ILE A 1 175 ? 11.742  41.589  34.512  1.00 17.71  ? 175  ILE A CG2   1 
ATOM   1339  C CD1   . ILE A 1 175 ? 9.989   43.236  32.567  1.00 14.30  ? 175  ILE A CD1   1 
ATOM   1340  N N     . ILE A 1 176 ? 9.956   39.284  36.560  1.00 19.82  ? 176  ILE A N     1 
ATOM   1341  C CA    . ILE A 1 176 ? 10.462  38.830  37.856  1.00 20.26  ? 176  ILE A CA    1 
ATOM   1342  C C     . ILE A 1 176 ? 10.563  37.300  37.907  1.00 20.77  ? 176  ILE A C     1 
ATOM   1343  O O     . ILE A 1 176 ? 11.553  36.753  38.377  1.00 21.52  ? 176  ILE A O     1 
ATOM   1344  C CB    . ILE A 1 176 ? 9.592   39.371  39.015  1.00 20.14  ? 176  ILE A CB    1 
ATOM   1345  C CG1   . ILE A 1 176 ? 9.750   40.894  39.124  1.00 19.49  ? 176  ILE A CG1   1 
ATOM   1346  C CG2   . ILE A 1 176 ? 9.972   38.707  40.336  1.00 19.60  ? 176  ILE A CG2   1 
ATOM   1347  C CD1   . ILE A 1 176 ? 8.586   41.595  39.847  1.00 18.44  ? 176  ILE A CD1   1 
ATOM   1348  N N     . ASP A 1 177 ? 9.544   36.603  37.412  1.00 21.31  ? 177  ASP A N     1 
ATOM   1349  C CA    . ASP A 1 177 ? 9.540   35.148  37.505  1.00 21.07  ? 177  ASP A CA    1 
ATOM   1350  C C     . ASP A 1 177 ? 10.656  34.557  36.668  1.00 20.46  ? 177  ASP A C     1 
ATOM   1351  O O     . ASP A 1 177 ? 11.258  33.559  37.042  1.00 20.55  ? 177  ASP A O     1 
ATOM   1352  C CB    . ASP A 1 177 ? 8.201   34.574  37.058  1.00 21.23  ? 177  ASP A CB    1 
ATOM   1353  C CG    . ASP A 1 177 ? 8.140   33.066  37.217  1.00 22.57  ? 177  ASP A CG    1 
ATOM   1354  O OD1   . ASP A 1 177 ? 8.424   32.339  36.238  1.00 24.31  ? 177  ASP A OD1   1 
ATOM   1355  O OD2   . ASP A 1 177 ? 7.820   32.602  38.331  1.00 24.22  ? 177  ASP A OD2   1 
ATOM   1356  N N     . SER A 1 178 ? 10.922  35.184  35.528  1.00 20.16  ? 178  SER A N     1 
ATOM   1357  C CA    . SER A 1 178 ? 11.842  34.629  34.535  1.00 19.62  ? 178  SER A CA    1 
ATOM   1358  C C     . SER A 1 178 ? 13.271  35.165  34.686  1.00 19.10  ? 178  SER A C     1 
ATOM   1359  O O     . SER A 1 178 ? 14.184  34.701  33.981  1.00 18.46  ? 178  SER A O     1 
ATOM   1360  C CB    . SER A 1 178 ? 11.326  34.925  33.122  1.00 19.33  ? 178  SER A CB    1 
ATOM   1361  O OG    . SER A 1 178 ? 11.472  36.309  32.831  1.00 20.28  ? 178  SER A OG    1 
ATOM   1362  N N     . SER A 1 179 ? 13.447  36.133  35.594  1.00 18.10  ? 179  SER A N     1 
ATOM   1363  C CA    . SER A 1 179 ? 14.693  36.900  35.718  1.00 18.08  ? 179  SER A CA    1 
ATOM   1364  C C     . SER A 1 179 ? 15.185  37.433  34.362  1.00 18.13  ? 179  SER A C     1 
ATOM   1365  O O     . SER A 1 179 ? 16.366  37.326  34.064  1.00 18.70  ? 179  SER A O     1 
ATOM   1366  C CB    . SER A 1 179 ? 15.818  36.068  36.379  1.00 17.79  ? 179  SER A CB    1 
ATOM   1367  O OG    . SER A 1 179 ? 15.583  35.852  37.760  1.00 17.34  ? 179  SER A OG    1 
ATOM   1368  N N     . SER A 1 180 ? 14.293  37.993  33.551  1.00 18.08  ? 180  SER A N     1 
ATOM   1369  C CA    . SER A 1 180 ? 14.671  38.583  32.252  1.00 18.35  ? 180  SER A CA    1 
ATOM   1370  C C     . SER A 1 180 ? 15.799  39.573  32.381  1.00 18.07  ? 180  SER A C     1 
ATOM   1371  O O     . SER A 1 180 ? 15.783  40.429  33.263  1.00 18.23  ? 180  SER A O     1 
ATOM   1372  C CB    . SER A 1 180 ? 13.475  39.268  31.583  1.00 18.35  ? 180  SER A CB    1 
ATOM   1373  O OG    . SER A 1 180 ? 12.483  38.317  31.192  1.00 20.68  ? 180  SER A OG    1 
ATOM   1374  N N     . ARG A 1 181 ? 16.770  39.467  31.484  1.00 18.35  ? 181  ARG A N     1 
ATOM   1375  C CA    . ARG A 1 181 ? 17.990  40.282  31.549  1.00 19.00  ? 181  ARG A CA    1 
ATOM   1376  C C     . ARG A 1 181 ? 17.894  41.541  30.704  1.00 18.48  ? 181  ARG A C     1 
ATOM   1377  O O     . ARG A 1 181 ? 18.699  42.469  30.830  1.00 18.27  ? 181  ARG A O     1 
ATOM   1378  C CB    . ARG A 1 181 ? 19.195  39.437  31.089  1.00 19.71  ? 181  ARG A CB    1 
ATOM   1379  C CG    . ARG A 1 181 ? 19.690  38.441  32.151  1.00 22.00  ? 181  ARG A CG    1 
ATOM   1380  C CD    . ARG A 1 181 ? 20.156  39.241  33.348  1.00 28.42  ? 181  ARG A CD    1 
ATOM   1381  N NE    . ARG A 1 181 ? 20.515  38.424  34.506  1.00 32.53  ? 181  ARG A NE    1 
ATOM   1382  C CZ    . ARG A 1 181 ? 20.552  38.894  35.746  1.00 33.41  ? 181  ARG A CZ    1 
ATOM   1383  N NH1   . ARG A 1 181 ? 20.235  40.163  35.979  1.00 35.35  ? 181  ARG A NH1   1 
ATOM   1384  N NH2   . ARG A 1 181 ? 20.893  38.103  36.756  1.00 35.19  ? 181  ARG A NH2   1 
ATOM   1385  N N     . LEU A 1 182 ? 16.898  41.535  29.820  1.00 18.42  ? 182  LEU A N     1 
ATOM   1386  C CA    . LEU A 1 182 ? 16.751  42.507  28.746  1.00 18.06  ? 182  LEU A CA    1 
ATOM   1387  C C     . LEU A 1 182 ? 15.279  42.562  28.382  1.00 17.47  ? 182  LEU A C     1 
ATOM   1388  O O     . LEU A 1 182 ? 14.574  41.551  28.446  1.00 17.56  ? 182  LEU A O     1 
ATOM   1389  C CB    . LEU A 1 182 ? 17.572  42.067  27.528  1.00 18.23  ? 182  LEU A CB    1 
ATOM   1390  C CG    . LEU A 1 182 ? 17.432  42.837  26.201  1.00 19.08  ? 182  LEU A CG    1 
ATOM   1391  C CD1   . LEU A 1 182 ? 18.004  44.270  26.283  1.00 19.05  ? 182  LEU A CD1   1 
ATOM   1392  C CD2   . LEU A 1 182 ? 18.093  42.061  25.076  1.00 18.49  ? 182  LEU A CD2   1 
ATOM   1393  N N     . VAL A 1 183 ? 14.818  43.757  28.044  1.00 17.08  ? 183  VAL A N     1 
ATOM   1394  C CA    . VAL A 1 183 ? 13.472  43.972  27.547  1.00 16.82  ? 183  VAL A CA    1 
ATOM   1395  C C     . VAL A 1 183 ? 13.546  44.621  26.158  1.00 17.50  ? 183  VAL A C     1 
ATOM   1396  O O     . VAL A 1 183 ? 14.234  45.655  25.975  1.00 17.12  ? 183  VAL A O     1 
ATOM   1397  C CB    . VAL A 1 183 ? 12.628  44.861  28.495  1.00 17.28  ? 183  VAL A CB    1 
ATOM   1398  C CG1   . VAL A 1 183 ? 11.206  45.067  27.913  1.00 16.44  ? 183  VAL A CG1   1 
ATOM   1399  C CG2   . VAL A 1 183 ? 12.553  44.249  29.895  1.00 15.76  ? 183  VAL A CG2   1 
ATOM   1400  N N     . ILE A 1 184 ? 12.845  43.998  25.196  1.00 17.02  ? 184  ILE A N     1 
ATOM   1401  C CA    . ILE A 1 184 ? 12.738  44.495  23.838  1.00 17.26  ? 184  ILE A CA    1 
ATOM   1402  C C     . ILE A 1 184 ? 11.307  44.984  23.551  1.00 17.19  ? 184  ILE A C     1 
ATOM   1403  O O     . ILE A 1 184 ? 10.358  44.211  23.612  1.00 16.88  ? 184  ILE A O     1 
ATOM   1404  C CB    . ILE A 1 184 ? 13.175  43.429  22.792  1.00 17.16  ? 184  ILE A CB    1 
ATOM   1405  C CG1   . ILE A 1 184 ? 14.602  42.957  23.112  1.00 17.82  ? 184  ILE A CG1   1 
ATOM   1406  C CG2   . ILE A 1 184 ? 13.061  44.018  21.359  1.00 16.20  ? 184  ILE A CG2   1 
ATOM   1407  C CD1   . ILE A 1 184 ? 15.165  41.823  22.239  1.00 17.79  ? 184  ILE A CD1   1 
ATOM   1408  N N     . THR A 1 185 ? 11.173  46.270  23.229  1.00 17.20  ? 185  THR A N     1 
ATOM   1409  C CA    . THR A 1 185 ? 9.869   46.889  23.070  1.00 17.21  ? 185  THR A CA    1 
ATOM   1410  C C     . THR A 1 185 ? 9.930   47.953  21.987  1.00 17.09  ? 185  THR A C     1 
ATOM   1411  O O     . THR A 1 185 ? 10.979  48.127  21.343  1.00 17.17  ? 185  THR A O     1 
ATOM   1412  C CB    . THR A 1 185 ? 9.314   47.460  24.425  1.00 17.78  ? 185  THR A CB    1 
ATOM   1413  O OG1   . THR A 1 185 ? 7.934   47.825  24.270  1.00 20.22  ? 185  THR A OG1   1 
ATOM   1414  C CG2   . THR A 1 185 ? 10.091  48.690  24.911  1.00 16.16  ? 185  THR A CG2   1 
ATOM   1415  N N     . ALA A 1 186 ? 8.802   48.636  21.768  1.00 16.52  ? 186  ALA A N     1 
ATOM   1416  C CA    . ALA A 1 186 ? 8.707   49.752  20.812  1.00 16.07  ? 186  ALA A CA    1 
ATOM   1417  C C     . ALA A 1 186 ? 8.211   50.960  21.572  1.00 16.07  ? 186  ALA A C     1 
ATOM   1418  O O     . ALA A 1 186 ? 7.577   50.789  22.632  1.00 16.73  ? 186  ALA A O     1 
ATOM   1419  C CB    . ALA A 1 186 ? 7.746   49.409  19.693  1.00 15.29  ? 186  ALA A CB    1 
ATOM   1420  N N     . ASP A 1 187 ? 8.505   52.167  21.081  1.00 16.10  ? 187  ASP A N     1 
ATOM   1421  C CA    . ASP A 1 187 ? 7.929   53.394  21.666  1.00 16.59  ? 187  ASP A CA    1 
ATOM   1422  C C     . ASP A 1 187 ? 6.407   53.289  21.836  1.00 17.26  ? 187  ASP A C     1 
ATOM   1423  O O     . ASP A 1 187 ? 5.872   53.510  22.920  1.00 17.09  ? 187  ASP A O     1 
ATOM   1424  C CB    . ASP A 1 187 ? 8.322   54.675  20.896  1.00 16.54  ? 187  ASP A CB    1 
ATOM   1425  C CG    . ASP A 1 187 ? 8.048   54.614  19.398  1.00 17.05  ? 187  ASP A CG    1 
ATOM   1426  O OD1   . ASP A 1 187 ? 7.340   53.707  18.895  1.00 14.94  ? 187  ASP A OD1   1 
ATOM   1427  O OD2   . ASP A 1 187 ? 8.568   55.520  18.697  1.00 18.27  ? 187  ASP A OD2   1 
ATOM   1428  N N     . GLU A 1 188 ? 5.735   52.881  20.760  1.00 17.94  ? 188  GLU A N     1 
ATOM   1429  C CA    . GLU A 1 188 ? 4.304   52.640  20.764  1.00 18.29  ? 188  GLU A CA    1 
ATOM   1430  C C     . GLU A 1 188 ? 3.922   51.561  19.751  1.00 18.03  ? 188  GLU A C     1 
ATOM   1431  O O     . GLU A 1 188 ? 4.544   51.435  18.706  1.00 17.90  ? 188  GLU A O     1 
ATOM   1432  C CB    . GLU A 1 188 ? 3.538   53.927  20.421  1.00 17.94  ? 188  GLU A CB    1 
ATOM   1433  C CG    . GLU A 1 188 ? 3.453   54.941  21.533  1.00 17.11  ? 188  GLU A CG    1 
ATOM   1434  C CD    . GLU A 1 188 ? 2.891   56.281  21.059  1.00 19.50  ? 188  GLU A CD    1 
ATOM   1435  O OE1   . GLU A 1 188 ? 3.020   56.638  19.857  1.00 19.47  ? 188  GLU A OE1   1 
ATOM   1436  O OE2   . GLU A 1 188 ? 2.309   56.992  21.898  1.00 22.67  ? 188  GLU A OE2   1 
ATOM   1437  N N     . GLY A 1 189 ? 2.898   50.782  20.086  1.00 18.10  ? 189  GLY A N     1 
ATOM   1438  C CA    . GLY A 1 189 ? 2.219   49.941  19.114  1.00 19.29  ? 189  GLY A CA    1 
ATOM   1439  C C     . GLY A 1 189 ? 1.121   50.757  18.448  1.00 19.64  ? 189  GLY A C     1 
ATOM   1440  O O     . GLY A 1 189 ? 0.708   51.796  18.974  1.00 19.73  ? 189  GLY A O     1 
ATOM   1441  N N     . VAL A 1 190 ? 0.687   50.307  17.274  1.00 20.07  ? 190  VAL A N     1 
ATOM   1442  C CA    . VAL A 1 190 ? -0.399  50.944  16.520  1.00 20.33  ? 190  VAL A CA    1 
ATOM   1443  C C     . VAL A 1 190 ? -1.477  49.889  16.220  1.00 20.94  ? 190  VAL A C     1 
ATOM   1444  O O     . VAL A 1 190 ? -1.202  48.859  15.605  1.00 21.16  ? 190  VAL A O     1 
ATOM   1445  C CB    . VAL A 1 190 ? 0.086   51.555  15.185  1.00 20.30  ? 190  VAL A CB    1 
ATOM   1446  C CG1   . VAL A 1 190 ? -1.094  52.127  14.389  1.00 20.21  ? 190  VAL A CG1   1 
ATOM   1447  C CG2   . VAL A 1 190 ? 1.139   52.618  15.401  1.00 19.55  ? 190  VAL A CG2   1 
ATOM   1448  N N     . ARG A 1 191 ? -2.703  50.161  16.647  1.00 21.27  ? 191  ARG A N     1 
ATOM   1449  C CA    . ARG A 1 191 ? -3.807  49.239  16.464  1.00 21.61  ? 191  ARG A CA    1 
ATOM   1450  C C     . ARG A 1 191 ? -5.103  50.025  16.349  1.00 20.99  ? 191  ARG A C     1 
ATOM   1451  O O     . ARG A 1 191 ? -5.400  50.822  17.222  1.00 21.51  ? 191  ARG A O     1 
ATOM   1452  C CB    . ARG A 1 191 ? -3.871  48.321  17.680  1.00 22.00  ? 191  ARG A CB    1 
ATOM   1453  C CG    . ARG A 1 191 ? -4.882  47.211  17.588  1.00 23.58  ? 191  ARG A CG    1 
ATOM   1454  C CD    . ARG A 1 191 ? -4.784  46.313  18.814  1.00 28.39  ? 191  ARG A CD    1 
ATOM   1455  N NE    . ARG A 1 191 ? -5.172  44.944  18.477  1.00 32.40  ? 191  ARG A NE    1 
ATOM   1456  C CZ    . ARG A 1 191 ? -6.390  44.491  18.677  1.00 34.03  ? 191  ARG A CZ    1 
ATOM   1457  N NH1   . ARG A 1 191 ? -7.275  45.309  19.234  1.00 36.88  ? 191  ARG A NH1   1 
ATOM   1458  N NH2   . ARG A 1 191 ? -6.719  43.250  18.345  1.00 35.18  ? 191  ARG A NH2   1 
ATOM   1459  N N     . ALA A 1 192 ? -5.870  49.784  15.292  1.00 20.58  ? 192  ALA A N     1 
ATOM   1460  C CA    . ALA A 1 192 ? -7.115  50.522  15.016  1.00 20.94  ? 192  ALA A CA    1 
ATOM   1461  C C     . ALA A 1 192 ? -6.987  52.058  15.086  1.00 21.14  ? 192  ALA A C     1 
ATOM   1462  O O     . ALA A 1 192 ? -7.803  52.740  15.740  1.00 20.72  ? 192  ALA A O     1 
ATOM   1463  C CB    . ALA A 1 192 ? -8.275  50.010  15.900  1.00 21.13  ? 192  ALA A CB    1 
ATOM   1464  N N     . GLY A 1 193 ? -5.963  52.582  14.399  1.00 21.30  ? 193  GLY A N     1 
ATOM   1465  C CA    . GLY A 1 193 ? -5.704  54.024  14.300  1.00 21.86  ? 193  GLY A CA    1 
ATOM   1466  C C     . GLY A 1 193 ? -5.289  54.649  15.618  1.00 22.81  ? 193  GLY A C     1 
ATOM   1467  O O     . GLY A 1 193 ? -5.260  55.882  15.758  1.00 22.92  ? 193  GLY A O     1 
ATOM   1468  N N     . ARG A 1 194 ? -4.965  53.792  16.584  1.00 23.26  ? 194  ARG A N     1 
ATOM   1469  C CA    . ARG A 1 194 ? -4.629  54.199  17.949  1.00 24.03  ? 194  ARG A CA    1 
ATOM   1470  C C     . ARG A 1 194 ? -3.236  53.715  18.395  1.00 23.74  ? 194  ARG A C     1 
ATOM   1471  O O     . ARG A 1 194 ? -2.774  52.666  17.976  1.00 23.35  ? 194  ARG A O     1 
ATOM   1472  C CB    . ARG A 1 194 ? -5.681  53.623  18.899  1.00 24.29  ? 194  ARG A CB    1 
ATOM   1473  C CG    . ARG A 1 194 ? -6.759  54.598  19.325  1.00 26.12  ? 194  ARG A CG    1 
ATOM   1474  C CD    . ARG A 1 194 ? -8.137  53.952  19.552  1.00 29.34  ? 194  ARG A CD    1 
ATOM   1475  N NE    . ARG A 1 194 ? -8.113  52.716  20.323  1.00 31.70  ? 194  ARG A NE    1 
ATOM   1476  C CZ    . ARG A 1 194 ? -8.743  52.526  21.477  1.00 34.51  ? 194  ARG A CZ    1 
ATOM   1477  N NH1   . ARG A 1 194 ? -9.467  53.491  22.027  1.00 35.93  ? 194  ARG A NH1   1 
ATOM   1478  N NH2   . ARG A 1 194 ? -8.652  51.355  22.089  1.00 36.28  ? 194  ARG A NH2   1 
ATOM   1479  N N     . SER A 1 195 ? -2.586  54.480  19.265  1.00 24.02  ? 195  SER A N     1 
ATOM   1480  C CA    . SER A 1 195 ? -1.303  54.087  19.859  1.00 23.97  ? 195  SER A CA    1 
ATOM   1481  C C     . SER A 1 195 ? -1.441  53.239  21.123  1.00 23.21  ? 195  SER A C     1 
ATOM   1482  O O     . SER A 1 195 ? -2.338  53.459  21.924  1.00 23.05  ? 195  SER A O     1 
ATOM   1483  C CB    . SER A 1 195 ? -0.483  55.339  20.177  1.00 24.32  ? 195  SER A CB    1 
ATOM   1484  O OG    . SER A 1 195 ? 0.201   55.770  18.993  1.00 26.87  ? 195  SER A OG    1 
ATOM   1485  N N     . ILE A 1 196 ? -0.539  52.281  21.297  1.00 22.29  ? 196  ILE A N     1 
ATOM   1486  C CA    . ILE A 1 196 ? -0.411  51.535  22.549  1.00 21.36  ? 196  ILE A CA    1 
ATOM   1487  C C     . ILE A 1 196 ? 0.876   51.994  23.233  1.00 20.94  ? 196  ILE A C     1 
ATOM   1488  O O     . ILE A 1 196 ? 1.934   51.917  22.630  1.00 20.74  ? 196  ILE A O     1 
ATOM   1489  C CB    . ILE A 1 196 ? -0.347  50.018  22.298  1.00 21.06  ? 196  ILE A CB    1 
ATOM   1490  C CG1   . ILE A 1 196 ? -1.626  49.535  21.598  1.00 23.03  ? 196  ILE A CG1   1 
ATOM   1491  C CG2   . ILE A 1 196 ? -0.115  49.254  23.597  1.00 20.92  ? 196  ILE A CG2   1 
ATOM   1492  C CD1   . ILE A 1 196 ? -2.949  50.016  22.262  1.00 26.06  ? 196  ILE A CD1   1 
ATOM   1493  N N     . PRO A 1 197 ? 0.803   52.442  24.504  1.00 20.70  ? 197  PRO A N     1 
ATOM   1494  C CA    . PRO A 1 197 ? 2.038   53.016  25.073  1.00 20.53  ? 197  PRO A CA    1 
ATOM   1495  C C     . PRO A 1 197 ? 2.978   51.945  25.647  1.00 20.38  ? 197  PRO A C     1 
ATOM   1496  O O     . PRO A 1 197 ? 3.168   51.872  26.869  1.00 20.92  ? 197  PRO A O     1 
ATOM   1497  C CB    . PRO A 1 197 ? 1.519   53.945  26.185  1.00 20.05  ? 197  PRO A CB    1 
ATOM   1498  C CG    . PRO A 1 197 ? 0.184   53.337  26.616  1.00 20.68  ? 197  PRO A CG    1 
ATOM   1499  C CD    . PRO A 1 197 ? -0.315  52.435  25.479  1.00 20.46  ? 197  PRO A CD    1 
ATOM   1500  N N     . LEU A 1 198 ? 3.581   51.136  24.776  1.00 19.63  ? 198  LEU A N     1 
ATOM   1501  C CA    . LEU A 1 198 ? 4.426   50.024  25.228  1.00 18.89  ? 198  LEU A CA    1 
ATOM   1502  C C     . LEU A 1 198 ? 5.656   50.436  26.047  1.00 18.70  ? 198  LEU A C     1 
ATOM   1503  O O     . LEU A 1 198 ? 5.890   49.895  27.125  1.00 19.05  ? 198  LEU A O     1 
ATOM   1504  C CB    . LEU A 1 198 ? 4.835   49.128  24.054  1.00 18.51  ? 198  LEU A CB    1 
ATOM   1505  C CG    . LEU A 1 198 ? 3.747   48.377  23.267  1.00 17.96  ? 198  LEU A CG    1 
ATOM   1506  C CD1   . LEU A 1 198 ? 4.378   47.615  22.142  1.00 16.03  ? 198  LEU A CD1   1 
ATOM   1507  C CD2   . LEU A 1 198 ? 2.961   47.418  24.156  1.00 14.84  ? 198  LEU A CD2   1 
ATOM   1508  N N     . LYS A 1 199 ? 6.455   51.367  25.548  1.00 18.77  ? 199  LYS A N     1 
ATOM   1509  C CA    . LYS A 1 199 ? 7.668   51.755  26.280  1.00 19.15  ? 199  LYS A CA    1 
ATOM   1510  C C     . LYS A 1 199 ? 7.329   52.354  27.660  1.00 18.85  ? 199  LYS A C     1 
ATOM   1511  O O     . LYS A 1 199 ? 7.971   52.014  28.656  1.00 18.66  ? 199  LYS A O     1 
ATOM   1512  C CB    . LYS A 1 199 ? 8.605   52.643  25.429  1.00 19.01  ? 199  LYS A CB    1 
ATOM   1513  C CG    . LYS A 1 199 ? 9.545   53.589  26.208  1.00 21.33  ? 199  LYS A CG    1 
ATOM   1514  C CD    . LYS A 1 199 ? 10.661  52.903  26.981  1.00 21.88  ? 199  LYS A CD    1 
ATOM   1515  C CE    . LYS A 1 199 ? 11.865  53.826  27.151  1.00 20.49  ? 199  LYS A CE    1 
ATOM   1516  N NZ    . LYS A 1 199 ? 11.770  54.730  28.321  1.00 22.64  ? 199  LYS A NZ    1 
ATOM   1517  N N     . LYS A 1 200 ? 6.284   53.180  27.723  1.00 18.60  ? 200  LYS A N     1 
ATOM   1518  C CA    . LYS A 1 200 ? 5.844   53.741  28.995  1.00 18.75  ? 200  LYS A CA    1 
ATOM   1519  C C     . LYS A 1 200 ? 5.383   52.659  29.978  1.00 18.32  ? 200  LYS A C     1 
ATOM   1520  O O     . LYS A 1 200 ? 5.703   52.728  31.163  1.00 18.55  ? 200  LYS A O     1 
ATOM   1521  C CB    . LYS A 1 200 ? 4.751   54.785  28.782  1.00 18.94  ? 200  LYS A CB    1 
ATOM   1522  C CG    . LYS A 1 200 ? 4.333   55.489  30.066  1.00 21.22  ? 200  LYS A CG    1 
ATOM   1523  C CD    . LYS A 1 200 ? 2.946   56.135  29.907  1.00 26.88  ? 200  LYS A CD    1 
ATOM   1524  C CE    . LYS A 1 200 ? 2.593   57.005  31.123  1.00 29.01  ? 200  LYS A CE    1 
ATOM   1525  N NZ    . LYS A 1 200 ? 3.629   58.077  31.329  1.00 29.54  ? 200  LYS A NZ    1 
ATOM   1526  N N     . ASN A 1 201 ? 4.619   51.680  29.491  1.00 18.10  ? 201  ASN A N     1 
ATOM   1527  C CA    . ASN A 1 201 ? 4.313   50.453  30.257  1.00 18.00  ? 201  ASN A CA    1 
ATOM   1528  C C     . ASN A 1 201 ? 5.558   49.735  30.766  1.00 17.38  ? 201  ASN A C     1 
ATOM   1529  O O     . ASN A 1 201 ? 5.584   49.213  31.875  1.00 16.55  ? 201  ASN A O     1 
ATOM   1530  C CB    . ASN A 1 201 ? 3.523   49.466  29.403  1.00 18.05  ? 201  ASN A CB    1 
ATOM   1531  C CG    . ASN A 1 201 ? 2.078   49.884  29.211  1.00 19.50  ? 201  ASN A CG    1 
ATOM   1532  O OD1   . ASN A 1 201 ? 1.626   50.907  29.746  1.00 19.44  ? 201  ASN A OD1   1 
ATOM   1533  N ND2   . ASN A 1 201 ? 1.344   49.094  28.438  1.00 18.41  ? 201  ASN A ND2   1 
ATOM   1534  N N     . VAL A 1 202 ? 6.593   49.703  29.942  1.00 17.10  ? 202  VAL A N     1 
ATOM   1535  C CA    . VAL A 1 202 ? 7.853   49.118  30.377  1.00 17.10  ? 202  VAL A CA    1 
ATOM   1536  C C     . VAL A 1 202 ? 8.460   49.954  31.517  1.00 16.94  ? 202  VAL A C     1 
ATOM   1537  O O     . VAL A 1 202 ? 8.904   49.390  32.528  1.00 17.10  ? 202  VAL A O     1 
ATOM   1538  C CB    . VAL A 1 202 ? 8.832   48.884  29.187  1.00 16.85  ? 202  VAL A CB    1 
ATOM   1539  C CG1   . VAL A 1 202 ? 10.192  48.505  29.677  1.00 16.29  ? 202  VAL A CG1   1 
ATOM   1540  C CG2   . VAL A 1 202 ? 8.279   47.794  28.247  1.00 15.93  ? 202  VAL A CG2   1 
ATOM   1541  N N     . ASP A 1 203 ? 8.423   51.280  31.376  1.00 16.85  ? 203  ASP A N     1 
ATOM   1542  C CA    . ASP A 1 203 ? 8.954   52.181  32.401  1.00 17.03  ? 203  ASP A CA    1 
ATOM   1543  C C     . ASP A 1 203 ? 8.289   51.913  33.735  1.00 17.60  ? 203  ASP A C     1 
ATOM   1544  O O     . ASP A 1 203 ? 8.973   51.808  34.756  1.00 18.28  ? 203  ASP A O     1 
ATOM   1545  C CB    . ASP A 1 203 ? 8.775   53.655  32.015  1.00 16.99  ? 203  ASP A CB    1 
ATOM   1546  C CG    . ASP A 1 203 ? 9.764   54.121  30.941  1.00 17.01  ? 203  ASP A CG    1 
ATOM   1547  O OD1   . ASP A 1 203 ? 10.748  53.409  30.636  1.00 16.87  ? 203  ASP A OD1   1 
ATOM   1548  O OD2   . ASP A 1 203 ? 9.567   55.229  30.416  1.00 16.95  ? 203  ASP A OD2   1 
ATOM   1549  N N     . ASP A 1 204 ? 6.960   51.795  33.710  1.00 17.87  ? 204  ASP A N     1 
ATOM   1550  C CA    . ASP A 1 204 ? 6.154   51.572  34.901  1.00 18.55  ? 204  ASP A CA    1 
ATOM   1551  C C     . ASP A 1 204 ? 6.442   50.207  35.516  1.00 18.53  ? 204  ASP A C     1 
ATOM   1552  O O     . ASP A 1 204 ? 6.606   50.097  36.725  1.00 19.11  ? 204  ASP A O     1 
ATOM   1553  C CB    . ASP A 1 204 ? 4.652   51.781  34.604  1.00 18.04  ? 204  ASP A CB    1 
ATOM   1554  C CG    . ASP A 1 204 ? 4.319   53.250  34.233  1.00 20.37  ? 204  ASP A CG    1 
ATOM   1555  O OD1   . ASP A 1 204 ? 3.203   53.518  33.732  1.00 22.52  ? 204  ASP A OD1   1 
ATOM   1556  O OD2   . ASP A 1 204 ? 5.175   54.149  34.426  1.00 19.33  ? 204  ASP A OD2   1 
ATOM   1557  N N     . ALA A 1 205 ? 6.544   49.184  34.675  1.00 19.32  ? 205  ALA A N     1 
ATOM   1558  C CA    . ALA A 1 205 ? 6.857   47.816  35.124  1.00 19.95  ? 205  ALA A CA    1 
ATOM   1559  C C     . ALA A 1 205 ? 8.201   47.761  35.849  1.00 20.13  ? 205  ALA A C     1 
ATOM   1560  O O     . ALA A 1 205 ? 8.296   47.171  36.922  1.00 19.00  ? 205  ALA A O     1 
ATOM   1561  C CB    . ALA A 1 205 ? 6.821   46.821  33.952  1.00 19.44  ? 205  ALA A CB    1 
ATOM   1562  N N     . LEU A 1 206 ? 9.210   48.422  35.266  1.00 21.21  ? 206  LEU A N     1 
ATOM   1563  C CA    . LEU A 1 206 ? 10.571  48.457  35.822  1.00 22.15  ? 206  LEU A CA    1 
ATOM   1564  C C     . LEU A 1 206 ? 10.743  49.308  37.083  1.00 22.50  ? 206  LEU A C     1 
ATOM   1565  O O     . LEU A 1 206 ? 11.795  49.256  37.711  1.00 22.76  ? 206  LEU A O     1 
ATOM   1566  C CB    . LEU A 1 206 ? 11.589  48.890  34.750  1.00 22.00  ? 206  LEU A CB    1 
ATOM   1567  C CG    . LEU A 1 206 ? 11.701  47.994  33.511  1.00 22.60  ? 206  LEU A CG    1 
ATOM   1568  C CD1   . LEU A 1 206 ? 12.765  48.502  32.548  1.00 23.52  ? 206  LEU A CD1   1 
ATOM   1569  C CD2   . LEU A 1 206 ? 11.993  46.577  33.863  1.00 22.31  ? 206  LEU A CD2   1 
ATOM   1570  N N     . LYS A 1 207 ? 9.734   50.094  37.452  1.00 23.20  ? 207  LYS A N     1 
ATOM   1571  C CA    . LYS A 1 207 ? 9.757   50.787  38.750  1.00 24.18  ? 207  LYS A CA    1 
ATOM   1572  C C     . LYS A 1 207 ? 9.366   49.902  39.939  1.00 24.30  ? 207  LYS A C     1 
ATOM   1573  O O     . LYS A 1 207 ? 9.675   50.224  41.093  1.00 24.05  ? 207  LYS A O     1 
ATOM   1574  C CB    . LYS A 1 207 ? 8.902   52.047  38.722  1.00 24.32  ? 207  LYS A CB    1 
ATOM   1575  C CG    . LYS A 1 207 ? 9.647   53.192  38.080  1.00 26.15  ? 207  LYS A CG    1 
ATOM   1576  C CD    . LYS A 1 207 ? 8.749   54.295  37.623  1.00 28.35  ? 207  LYS A CD    1 
ATOM   1577  C CE    . LYS A 1 207 ? 9.606   55.503  37.227  1.00 31.79  ? 207  LYS A CE    1 
ATOM   1578  N NZ    . LYS A 1 207 ? 8.889   56.430  36.289  1.00 33.52  ? 207  LYS A NZ    1 
ATOM   1579  N N     . ASN A 1 208 ? 8.695   48.792  39.650  1.00 24.40  ? 208  ASN A N     1 
ATOM   1580  C CA    . ASN A 1 208 ? 8.394   47.787  40.652  1.00 25.13  ? 208  ASN A CA    1 
ATOM   1581  C C     . ASN A 1 208 ? 9.699   47.359  41.305  1.00 25.90  ? 208  ASN A C     1 
ATOM   1582  O O     . ASN A 1 208 ? 10.597  46.899  40.609  1.00 26.47  ? 208  ASN A O     1 
ATOM   1583  C CB    . ASN A 1 208 ? 7.697   46.597  40.004  1.00 25.12  ? 208  ASN A CB    1 
ATOM   1584  C CG    . ASN A 1 208 ? 7.237   45.570  41.012  1.00 25.45  ? 208  ASN A CG    1 
ATOM   1585  O OD1   . ASN A 1 208 ? 7.974   45.207  41.935  1.00 24.70  ? 208  ASN A OD1   1 
ATOM   1586  N ND2   . ASN A 1 208 ? 6.014   45.081  40.833  1.00 23.85  ? 208  ASN A ND2   1 
ATOM   1587  N N     . PRO A 1 209 ? 9.825   47.543  42.643  1.00 26.72  ? 209  PRO A N     1 
ATOM   1588  C CA    . PRO A 1 209 ? 11.102  47.335  43.326  1.00 26.55  ? 209  PRO A CA    1 
ATOM   1589  C C     . PRO A 1 209 ? 11.535  45.869  43.336  1.00 26.82  ? 209  PRO A C     1 
ATOM   1590  O O     . PRO A 1 209 ? 12.670  45.565  43.710  1.00 27.10  ? 209  PRO A O     1 
ATOM   1591  C CB    . PRO A 1 209 ? 10.808  47.817  44.751  1.00 26.47  ? 209  PRO A CB    1 
ATOM   1592  C CG    . PRO A 1 209 ? 9.356   47.564  44.930  1.00 26.20  ? 209  PRO A CG    1 
ATOM   1593  C CD    . PRO A 1 209 ? 8.775   47.957  43.601  1.00 26.93  ? 209  PRO A CD    1 
ATOM   1594  N N     . ASN A 1 210 ? 10.643  44.971  42.922  1.00 26.75  ? 210  ASN A N     1 
ATOM   1595  C CA    . ASN A 1 210 ? 10.977  43.553  42.849  1.00 26.83  ? 210  ASN A CA    1 
ATOM   1596  C C     . ASN A 1 210 ? 11.603  43.154  41.525  1.00 26.06  ? 210  ASN A C     1 
ATOM   1597  O O     . ASN A 1 210 ? 12.102  42.026  41.381  1.00 25.94  ? 210  ASN A O     1 
ATOM   1598  C CB    . ASN A 1 210 ? 9.769   42.681  43.212  1.00 26.93  ? 210  ASN A CB    1 
ATOM   1599  C CG    . ASN A 1 210 ? 9.451   42.757  44.689  1.00 30.12  ? 210  ASN A CG    1 
ATOM   1600  O OD1   . ASN A 1 210 ? 10.282  42.389  45.531  1.00 31.85  ? 210  ASN A OD1   1 
ATOM   1601  N ND2   . ASN A 1 210 ? 8.277   43.288  45.021  1.00 31.50  ? 210  ASN A ND2   1 
ATOM   1602  N N     . VAL A 1 211 ? 11.601  44.090  40.576  1.00 25.28  ? 211  VAL A N     1 
ATOM   1603  C CA    . VAL A 1 211 ? 12.285  43.890  39.305  1.00 24.74  ? 211  VAL A CA    1 
ATOM   1604  C C     . VAL A 1 211 ? 13.732  44.270  39.516  1.00 24.66  ? 211  VAL A C     1 
ATOM   1605  O O     . VAL A 1 211 ? 14.025  45.435  39.768  1.00 24.78  ? 211  VAL A O     1 
ATOM   1606  C CB    . VAL A 1 211 ? 11.677  44.740  38.138  1.00 25.01  ? 211  VAL A CB    1 
ATOM   1607  C CG1   . VAL A 1 211 ? 12.511  44.564  36.862  1.00 23.64  ? 211  VAL A CG1   1 
ATOM   1608  C CG2   . VAL A 1 211 ? 10.207  44.363  37.877  1.00 23.62  ? 211  VAL A CG2   1 
ATOM   1609  N N     . THR A 1 212 ? 14.626  43.285  39.413  1.00 24.52  ? 212  THR A N     1 
ATOM   1610  C CA    . THR A 1 212 ? 16.049  43.471  39.736  1.00 24.43  ? 212  THR A CA    1 
ATOM   1611  C C     . THR A 1 212 ? 16.992  42.989  38.625  1.00 24.55  ? 212  THR A C     1 
ATOM   1612  O O     . THR A 1 212 ? 18.192  43.274  38.645  1.00 23.90  ? 212  THR A O     1 
ATOM   1613  C CB    . THR A 1 212 ? 16.431  42.716  41.038  1.00 24.57  ? 212  THR A CB    1 
ATOM   1614  O OG1   . THR A 1 212 ? 16.231  41.305  40.845  1.00 23.78  ? 212  THR A OG1   1 
ATOM   1615  C CG2   . THR A 1 212 ? 15.599  43.203  42.230  1.00 23.88  ? 212  THR A CG2   1 
ATOM   1616  N N     . SER A 1 213 ? 16.430  42.260  37.660  1.00 24.41  ? 213  SER A N     1 
ATOM   1617  C CA    . SER A 1 213 ? 17.216  41.446  36.746  1.00 23.88  ? 213  SER A CA    1 
ATOM   1618  C C     . SER A 1 213 ? 17.546  42.151  35.436  1.00 23.49  ? 213  SER A C     1 
ATOM   1619  O O     . SER A 1 213 ? 18.416  41.692  34.685  1.00 23.53  ? 213  SER A O     1 
ATOM   1620  C CB    . SER A 1 213 ? 16.469  40.139  36.458  1.00 23.95  ? 213  SER A CB    1 
ATOM   1621  O OG    . SER A 1 213 ? 15.226  40.402  35.833  1.00 24.38  ? 213  SER A OG    1 
ATOM   1622  N N     . VAL A 1 214 ? 16.850  43.255  35.162  1.00 22.82  ? 214  VAL A N     1 
ATOM   1623  C CA    . VAL A 1 214 ? 16.916  43.918  33.849  1.00 22.33  ? 214  VAL A CA    1 
ATOM   1624  C C     . VAL A 1 214 ? 18.047  44.934  33.756  1.00 22.17  ? 214  VAL A C     1 
ATOM   1625  O O     . VAL A 1 214 ? 18.131  45.850  34.557  1.00 21.66  ? 214  VAL A O     1 
ATOM   1626  C CB    . VAL A 1 214 ? 15.570  44.598  33.462  1.00 22.36  ? 214  VAL A CB    1 
ATOM   1627  C CG1   . VAL A 1 214 ? 15.656  45.186  32.045  1.00 21.20  ? 214  VAL A CG1   1 
ATOM   1628  C CG2   . VAL A 1 214 ? 14.445  43.590  33.524  1.00 22.06  ? 214  VAL A CG2   1 
ATOM   1629  N N     . GLU A 1 215 ? 18.903  44.762  32.755  1.00 22.52  ? 215  GLU A N     1 
ATOM   1630  C CA    . GLU A 1 215 ? 20.048  45.638  32.564  1.00 22.67  ? 215  GLU A CA    1 
ATOM   1631  C C     . GLU A 1 215 ? 19.807  46.671  31.458  1.00 21.83  ? 215  GLU A C     1 
ATOM   1632  O O     . GLU A 1 215 ? 20.160  47.836  31.599  1.00 21.93  ? 215  GLU A O     1 
ATOM   1633  C CB    . GLU A 1 215 ? 21.291  44.792  32.305  1.00 23.21  ? 215  GLU A CB    1 
ATOM   1634  C CG    . GLU A 1 215 ? 21.831  44.156  33.607  1.00 27.48  ? 215  GLU A CG    1 
ATOM   1635  C CD    . GLU A 1 215 ? 22.565  42.820  33.405  1.00 32.04  ? 215  GLU A CD    1 
ATOM   1636  O OE1   . GLU A 1 215 ? 22.843  42.134  34.436  1.00 34.05  ? 215  GLU A OE1   1 
ATOM   1637  O OE2   . GLU A 1 215 ? 22.860  42.456  32.236  1.00 32.48  ? 215  GLU A OE2   1 
ATOM   1638  N N     . HIS A 1 216 ? 19.203  46.249  30.356  1.00 20.87  ? 216  HIS A N     1 
ATOM   1639  C CA    . HIS A 1 216 ? 18.899  47.186  29.284  1.00 19.91  ? 216  HIS A CA    1 
ATOM   1640  C C     . HIS A 1 216 ? 17.481  47.041  28.797  1.00 18.73  ? 216  HIS A C     1 
ATOM   1641  O O     . HIS A 1 216 ? 16.838  46.013  29.000  1.00 17.64  ? 216  HIS A O     1 
ATOM   1642  C CB    . HIS A 1 216 ? 19.876  47.011  28.117  1.00 20.05  ? 216  HIS A CB    1 
ATOM   1643  C CG    . HIS A 1 216 ? 21.292  47.327  28.476  1.00 22.37  ? 216  HIS A CG    1 
ATOM   1644  N ND1   . HIS A 1 216 ? 21.736  48.618  28.690  1.00 25.27  ? 216  HIS A ND1   1 
ATOM   1645  C CD2   . HIS A 1 216 ? 22.360  46.523  28.681  1.00 23.54  ? 216  HIS A CD2   1 
ATOM   1646  C CE1   . HIS A 1 216 ? 23.017  48.594  29.011  1.00 25.52  ? 216  HIS A CE1   1 
ATOM   1647  N NE2   . HIS A 1 216 ? 23.420  47.334  29.006  1.00 25.80  ? 216  HIS A NE2   1 
ATOM   1648  N N     . VAL A 1 217 ? 17.013  48.101  28.154  1.00 18.08  ? 217  VAL A N     1 
ATOM   1649  C CA    . VAL A 1 217 ? 15.800  48.073  27.342  1.00 16.99  ? 217  VAL A CA    1 
ATOM   1650  C C     . VAL A 1 217 ? 16.135  48.551  25.921  1.00 17.11  ? 217  VAL A C     1 
ATOM   1651  O O     . VAL A 1 217 ? 16.640  49.669  25.745  1.00 16.91  ? 217  VAL A O     1 
ATOM   1652  C CB    . VAL A 1 217 ? 14.671  48.945  27.952  1.00 16.92  ? 217  VAL A CB    1 
ATOM   1653  C CG1   . VAL A 1 217 ? 13.421  48.931  27.051  1.00 15.05  ? 217  VAL A CG1   1 
ATOM   1654  C CG2   . VAL A 1 217 ? 14.347  48.464  29.385  1.00 15.74  ? 217  VAL A CG2   1 
ATOM   1655  N N     . ILE A 1 218 ? 15.872  47.692  24.926  1.00 16.57  ? 218  ILE A N     1 
ATOM   1656  C CA    . ILE A 1 218 ? 16.018  48.051  23.510  1.00 16.37  ? 218  ILE A CA    1 
ATOM   1657  C C     . ILE A 1 218 ? 14.662  48.525  23.010  1.00 16.55  ? 218  ILE A C     1 
ATOM   1658  O O     . ILE A 1 218 ? 13.633  47.901  23.287  1.00 16.64  ? 218  ILE A O     1 
ATOM   1659  C CB    . ILE A 1 218 ? 16.559  46.859  22.663  1.00 16.96  ? 218  ILE A CB    1 
ATOM   1660  C CG1   . ILE A 1 218 ? 17.977  46.479  23.117  1.00 16.36  ? 218  ILE A CG1   1 
ATOM   1661  C CG2   . ILE A 1 218 ? 16.504  47.141  21.132  1.00 17.51  ? 218  ILE A CG2   1 
ATOM   1662  C CD1   . ILE A 1 218 ? 18.602  45.342  22.315  1.00 16.33  ? 218  ILE A CD1   1 
ATOM   1663  N N     . VAL A 1 219 ? 14.669  49.647  22.296  1.00 16.88  ? 219  VAL A N     1 
ATOM   1664  C CA    . VAL A 1 219 ? 13.456  50.345  21.913  1.00 16.76  ? 219  VAL A CA    1 
ATOM   1665  C C     . VAL A 1 219 ? 13.420  50.621  20.414  1.00 17.33  ? 219  VAL A C     1 
ATOM   1666  O O     . VAL A 1 219 ? 14.254  51.343  19.876  1.00 16.72  ? 219  VAL A O     1 
ATOM   1667  C CB    . VAL A 1 219 ? 13.275  51.689  22.684  1.00 17.05  ? 219  VAL A CB    1 
ATOM   1668  C CG1   . VAL A 1 219 ? 11.894  52.299  22.363  1.00 17.33  ? 219  VAL A CG1   1 
ATOM   1669  C CG2   . VAL A 1 219 ? 13.438  51.507  24.216  1.00 15.43  ? 219  VAL A CG2   1 
ATOM   1670  N N     . LEU A 1 220 ? 12.431  50.037  19.747  1.00 17.88  ? 220  LEU A N     1 
ATOM   1671  C CA    . LEU A 1 220 ? 12.133  50.362  18.366  1.00 17.87  ? 220  LEU A CA    1 
ATOM   1672  C C     . LEU A 1 220 ? 11.299  51.647  18.217  1.00 18.44  ? 220  LEU A C     1 
ATOM   1673  O O     . LEU A 1 220 ? 10.159  51.716  18.699  1.00 17.56  ? 220  LEU A O     1 
ATOM   1674  C CB    . LEU A 1 220 ? 11.388  49.199  17.713  1.00 17.62  ? 220  LEU A CB    1 
ATOM   1675  C CG    . LEU A 1 220 ? 11.092  49.485  16.232  1.00 17.08  ? 220  LEU A CG    1 
ATOM   1676  C CD1   . LEU A 1 220 ? 12.352  49.365  15.349  1.00 14.04  ? 220  LEU A CD1   1 
ATOM   1677  C CD2   . LEU A 1 220 ? 9.936   48.634  15.710  1.00 12.95  ? 220  LEU A CD2   1 
ATOM   1678  N N     . LYS A 1 221 ? 11.849  52.647  17.518  1.00 18.85  ? 221  LYS A N     1 
ATOM   1679  C CA    . LYS A 1 221 ? 11.083  53.846  17.139  1.00 19.50  ? 221  LYS A CA    1 
ATOM   1680  C C     . LYS A 1 221 ? 10.032  53.521  16.052  1.00 19.95  ? 221  LYS A C     1 
ATOM   1681  O O     . LYS A 1 221 ? 10.279  53.688  14.843  1.00 20.63  ? 221  LYS A O     1 
ATOM   1682  C CB    . LYS A 1 221 ? 12.024  54.977  16.690  1.00 19.36  ? 221  LYS A CB    1 
ATOM   1683  C CG    . LYS A 1 221 ? 11.387  56.374  16.677  1.00 19.99  ? 221  LYS A CG    1 
ATOM   1684  C CD    . LYS A 1 221 ? 12.381  57.473  16.276  1.00 20.15  ? 221  LYS A CD    1 
ATOM   1685  C CE    . LYS A 1 221 ? 13.174  58.052  17.472  1.00 22.46  ? 221  LYS A CE    1 
ATOM   1686  N NZ    . LYS A 1 221 ? 12.388  58.979  18.400  1.00 22.74  ? 221  LYS A NZ    1 
ATOM   1687  N N     . ARG A 1 222 ? 8.867   53.042  16.488  1.00 20.13  ? 222  ARG A N     1 
ATOM   1688  C CA    . ARG A 1 222 ? 7.776   52.706  15.572  1.00 20.18  ? 222  ARG A CA    1 
ATOM   1689  C C     . ARG A 1 222 ? 6.967   53.929  15.151  1.00 20.46  ? 222  ARG A C     1 
ATOM   1690  O O     . ARG A 1 222 ? 6.637   54.089  13.967  1.00 21.45  ? 222  ARG A O     1 
ATOM   1691  C CB    . ARG A 1 222 ? 6.847   51.623  16.173  1.00 20.28  ? 222  ARG A CB    1 
ATOM   1692  C CG    . ARG A 1 222 ? 5.521   51.376  15.413  1.00 18.20  ? 222  ARG A CG    1 
ATOM   1693  C CD    . ARG A 1 222 ? 5.746   50.761  14.029  1.00 19.07  ? 222  ARG A CD    1 
ATOM   1694  N NE    . ARG A 1 222 ? 4.496   50.637  13.276  1.00 17.51  ? 222  ARG A NE    1 
ATOM   1695  C CZ    . ARG A 1 222 ? 3.988   51.581  12.488  1.00 19.87  ? 222  ARG A CZ    1 
ATOM   1696  N NH1   . ARG A 1 222 ? 4.633   52.733  12.319  1.00 19.00  ? 222  ARG A NH1   1 
ATOM   1697  N NH2   . ARG A 1 222 ? 2.825   51.373  11.870  1.00 19.82  ? 222  ARG A NH2   1 
ATOM   1698  N N     . THR A 1 223 ? 6.631   54.775  16.113  1.00 20.60  ? 223  THR A N     1 
ATOM   1699  C CA    . THR A 1 223 ? 5.833   55.968  15.832  1.00 20.94  ? 223  THR A CA    1 
ATOM   1700  C C     . THR A 1 223 ? 6.620   57.286  15.952  1.00 21.81  ? 223  THR A C     1 
ATOM   1701  O O     . THR A 1 223 ? 6.210   58.293  15.390  1.00 22.69  ? 223  THR A O     1 
ATOM   1702  C CB    . THR A 1 223 ? 4.581   56.055  16.733  1.00 20.28  ? 223  THR A CB    1 
ATOM   1703  O OG1   . THR A 1 223 ? 4.986   56.345  18.067  1.00 20.33  ? 223  THR A OG1   1 
ATOM   1704  C CG2   . THR A 1 223 ? 3.803   54.762  16.722  1.00 18.77  ? 223  THR A CG2   1 
ATOM   1705  N N     . GLY A 1 224 ? 7.735   57.286  16.673  1.00 22.36  ? 224  GLY A N     1 
ATOM   1706  C CA    . GLY A 1 224 ? 8.491   58.507  16.888  1.00 23.68  ? 224  GLY A CA    1 
ATOM   1707  C C     . GLY A 1 224 ? 7.875   59.426  17.932  1.00 25.06  ? 224  GLY A C     1 
ATOM   1708  O O     . GLY A 1 224 ? 8.256   60.600  18.050  1.00 25.90  ? 224  GLY A O     1 
ATOM   1709  N N     . SER A 1 225 ? 6.912   58.915  18.690  1.00 25.89  ? 225  SER A N     1 
ATOM   1710  C CA    . SER A 1 225 ? 6.318   59.690  19.778  1.00 26.91  ? 225  SER A CA    1 
ATOM   1711  C C     . SER A 1 225 ? 7.338   60.071  20.833  1.00 27.01  ? 225  SER A C     1 
ATOM   1712  O O     . SER A 1 225 ? 8.370   59.408  20.983  1.00 26.69  ? 225  SER A O     1 
ATOM   1713  C CB    . SER A 1 225 ? 5.216   58.898  20.450  1.00 27.01  ? 225  SER A CB    1 
ATOM   1714  O OG    . SER A 1 225 ? 4.219   58.631  19.500  1.00 29.77  ? 225  SER A OG    1 
ATOM   1715  N N     . ASP A 1 226 ? 7.016   61.135  21.560  1.00 27.32  ? 226  ASP A N     1 
ATOM   1716  C CA    . ASP A 1 226 ? 7.798   61.590  22.686  1.00 28.50  ? 226  ASP A CA    1 
ATOM   1717  C C     . ASP A 1 226 ? 7.665   60.583  23.815  1.00 27.76  ? 226  ASP A C     1 
ATOM   1718  O O     . ASP A 1 226 ? 6.544   60.225  24.190  1.00 28.85  ? 226  ASP A O     1 
ATOM   1719  C CB    . ASP A 1 226 ? 7.291   62.970  23.130  1.00 29.35  ? 226  ASP A CB    1 
ATOM   1720  C CG    . ASP A 1 226 ? 7.667   64.082  22.136  1.00 33.24  ? 226  ASP A CG    1 
ATOM   1721  O OD1   . ASP A 1 226 ? 8.377   63.779  21.124  1.00 35.01  ? 226  ASP A OD1   1 
ATOM   1722  O OD2   . ASP A 1 226 ? 7.255   65.258  22.370  1.00 36.77  ? 226  ASP A OD2   1 
ATOM   1723  N N     . ILE A 1 227 ? 8.790   60.090  24.321  1.00 26.45  ? 227  ILE A N     1 
ATOM   1724  C CA    . ILE A 1 227 ? 8.779   59.146  25.442  1.00 25.49  ? 227  ILE A CA    1 
ATOM   1725  C C     . ILE A 1 227 ? 9.836   59.574  26.436  1.00 25.22  ? 227  ILE A C     1 
ATOM   1726  O O     . ILE A 1 227 ? 10.726  60.346  26.100  1.00 25.48  ? 227  ILE A O     1 
ATOM   1727  C CB    . ILE A 1 227 ? 9.051   57.658  25.004  1.00 25.56  ? 227  ILE A CB    1 
ATOM   1728  C CG1   . ILE A 1 227 ? 10.401  57.520  24.272  1.00 25.53  ? 227  ILE A CG1   1 
ATOM   1729  C CG2   . ILE A 1 227 ? 7.881   57.093  24.189  1.00 25.47  ? 227  ILE A CG2   1 
ATOM   1730  C CD1   . ILE A 1 227 ? 10.812  56.093  23.900  1.00 24.68  ? 227  ILE A CD1   1 
ATOM   1731  N N     . ASP A 1 228 ? 9.741   59.081  27.662  1.00 24.84  ? 228  ASP A N     1 
ATOM   1732  C CA    . ASP A 1 228 ? 10.844  59.201  28.612  1.00 24.12  ? 228  ASP A CA    1 
ATOM   1733  C C     . ASP A 1 228 ? 11.974  58.223  28.245  1.00 23.59  ? 228  ASP A C     1 
ATOM   1734  O O     . ASP A 1 228 ? 11.753  57.209  27.562  1.00 22.41  ? 228  ASP A O     1 
ATOM   1735  C CB    . ASP A 1 228 ? 10.350  58.972  30.042  1.00 24.05  ? 228  ASP A CB    1 
ATOM   1736  C CG    . ASP A 1 228 ? 9.195   59.898  30.412  1.00 25.54  ? 228  ASP A CG    1 
ATOM   1737  O OD1   . ASP A 1 228 ? 8.222   59.410  31.020  1.00 26.80  ? 228  ASP A OD1   1 
ATOM   1738  O OD2   . ASP A 1 228 ? 9.252   61.113  30.095  1.00 25.90  ? 228  ASP A OD2   1 
ATOM   1739  N N     . TRP A 1 229 ? 13.178  58.549  28.719  1.00 23.10  ? 229  TRP A N     1 
ATOM   1740  C CA    . TRP A 1 229 ? 14.401  57.831  28.391  1.00 22.33  ? 229  TRP A CA    1 
ATOM   1741  C C     . TRP A 1 229 ? 15.294  57.761  29.624  1.00 22.80  ? 229  TRP A C     1 
ATOM   1742  O O     . TRP A 1 229 ? 15.527  58.774  30.273  1.00 23.25  ? 229  TRP A O     1 
ATOM   1743  C CB    . TRP A 1 229 ? 15.132  58.575  27.277  1.00 20.67  ? 229  TRP A CB    1 
ATOM   1744  C CG    . TRP A 1 229 ? 16.057  57.730  26.461  1.00 19.71  ? 229  TRP A CG    1 
ATOM   1745  C CD1   . TRP A 1 229 ? 17.416  57.785  26.455  1.00 18.97  ? 229  TRP A CD1   1 
ATOM   1746  C CD2   . TRP A 1 229 ? 15.692  56.703  25.514  1.00 19.65  ? 229  TRP A CD2   1 
ATOM   1747  N NE1   . TRP A 1 229 ? 17.929  56.863  25.554  1.00 19.15  ? 229  TRP A NE1   1 
ATOM   1748  C CE2   . TRP A 1 229 ? 16.894  56.187  24.972  1.00 17.91  ? 229  TRP A CE2   1 
ATOM   1749  C CE3   . TRP A 1 229 ? 14.466  56.172  25.071  1.00 18.48  ? 229  TRP A CE3   1 
ATOM   1750  C CZ2   . TRP A 1 229 ? 16.907  55.170  24.026  1.00 18.47  ? 229  TRP A CZ2   1 
ATOM   1751  C CZ3   . TRP A 1 229 ? 14.485  55.169  24.131  1.00 17.70  ? 229  TRP A CZ3   1 
ATOM   1752  C CH2   . TRP A 1 229 ? 15.695  54.669  23.625  1.00 18.54  ? 229  TRP A CH2   1 
ATOM   1753  N N     . GLN A 1 230 ? 15.782  56.567  29.946  1.00 23.29  ? 230  GLN A N     1 
ATOM   1754  C CA    . GLN A 1 230 ? 16.790  56.390  30.997  1.00 23.93  ? 230  GLN A CA    1 
ATOM   1755  C C     . GLN A 1 230 ? 18.143  56.119  30.351  1.00 24.39  ? 230  GLN A C     1 
ATOM   1756  O O     . GLN A 1 230 ? 18.415  55.004  29.908  1.00 24.85  ? 230  GLN A O     1 
ATOM   1757  C CB    . GLN A 1 230 ? 16.416  55.262  31.967  1.00 23.40  ? 230  GLN A CB    1 
ATOM   1758  C CG    . GLN A 1 230 ? 17.302  55.178  33.210  1.00 23.31  ? 230  GLN A CG    1 
ATOM   1759  C CD    . GLN A 1 230 ? 16.796  54.157  34.243  1.00 23.79  ? 230  GLN A CD    1 
ATOM   1760  O OE1   . GLN A 1 230 ? 15.630  54.184  34.649  1.00 23.56  ? 230  GLN A OE1   1 
ATOM   1761  N NE2   . GLN A 1 230 ? 17.675  53.262  34.669  1.00 23.68  ? 230  GLN A NE2   1 
ATOM   1762  N N     . GLU A 1 231 ? 18.965  57.162  30.289  1.00 25.10  ? 231  GLU A N     1 
ATOM   1763  C CA    . GLU A 1 231 ? 20.343  57.107  29.781  1.00 26.14  ? 231  GLU A CA    1 
ATOM   1764  C C     . GLU A 1 231 ? 21.122  55.891  30.320  1.00 25.49  ? 231  GLU A C     1 
ATOM   1765  O O     . GLU A 1 231 ? 21.070  55.572  31.521  1.00 24.69  ? 231  GLU A O     1 
ATOM   1766  C CB    . GLU A 1 231 ? 21.072  58.411  30.152  1.00 27.26  ? 231  GLU A CB    1 
ATOM   1767  C CG    . GLU A 1 231 ? 21.777  59.116  28.984  1.00 31.27  ? 231  GLU A CG    1 
ATOM   1768  C CD    . GLU A 1 231 ? 20.847  59.371  27.789  1.00 36.25  ? 231  GLU A CD    1 
ATOM   1769  O OE1   . GLU A 1 231 ? 19.740  59.956  27.972  1.00 36.09  ? 231  GLU A OE1   1 
ATOM   1770  O OE2   . GLU A 1 231 ? 21.235  58.976  26.661  1.00 38.88  ? 231  GLU A OE2   1 
ATOM   1771  N N     . GLY A 1 232 ? 21.827  55.203  29.426  1.00 24.92  ? 232  GLY A N     1 
ATOM   1772  C CA    . GLY A 1 232 ? 22.541  53.989  29.810  1.00 24.36  ? 232  GLY A CA    1 
ATOM   1773  C C     . GLY A 1 232 ? 21.680  52.738  29.744  1.00 23.86  ? 232  GLY A C     1 
ATOM   1774  O O     . GLY A 1 232 ? 22.070  51.755  29.104  1.00 24.43  ? 232  GLY A O     1 
ATOM   1775  N N     . ARG A 1 233 ? 20.509  52.760  30.380  1.00 23.00  ? 233  ARG A N     1 
ATOM   1776  C CA    . ARG A 1 233 ? 19.592  51.618  30.284  1.00 22.30  ? 233  ARG A CA    1 
ATOM   1777  C C     . ARG A 1 233 ? 18.944  51.499  28.902  1.00 21.99  ? 233  ARG A C     1 
ATOM   1778  O O     . ARG A 1 233 ? 18.940  50.418  28.304  1.00 21.84  ? 233  ARG A O     1 
ATOM   1779  C CB    . ARG A 1 233 ? 18.519  51.666  31.365  1.00 22.21  ? 233  ARG A CB    1 
ATOM   1780  C CG    . ARG A 1 233 ? 17.577  50.451  31.359  1.00 21.07  ? 233  ARG A CG    1 
ATOM   1781  C CD    . ARG A 1 233 ? 16.346  50.728  32.201  1.00 19.54  ? 233  ARG A CD    1 
ATOM   1782  N NE    . ARG A 1 233 ? 15.400  51.581  31.497  1.00 19.13  ? 233  ARG A NE    1 
ATOM   1783  C CZ    . ARG A 1 233 ? 14.230  51.986  31.980  1.00 19.71  ? 233  ARG A CZ    1 
ATOM   1784  N NH1   . ARG A 1 233 ? 13.850  51.640  33.201  1.00 18.49  ? 233  ARG A NH1   1 
ATOM   1785  N NH2   . ARG A 1 233 ? 13.437  52.757  31.232  1.00 19.89  ? 233  ARG A NH2   1 
ATOM   1786  N N     . ASP A 1 234 ? 18.418  52.614  28.395  1.00 21.54  ? 234  ASP A N     1 
ATOM   1787  C CA    . ASP A 1 234 ? 17.602  52.603  27.175  1.00 20.62  ? 234  ASP A CA    1 
ATOM   1788  C C     . ASP A 1 234 ? 18.421  52.783  25.916  1.00 20.44  ? 234  ASP A C     1 
ATOM   1789  O O     . ASP A 1 234 ? 19.222  53.708  25.803  1.00 20.53  ? 234  ASP A O     1 
ATOM   1790  C CB    . ASP A 1 234 ? 16.504  53.662  27.248  1.00 20.53  ? 234  ASP A CB    1 
ATOM   1791  C CG    . ASP A 1 234 ? 15.508  53.396  28.356  1.00 18.76  ? 234  ASP A CG    1 
ATOM   1792  O OD1   . ASP A 1 234 ? 15.478  52.255  28.861  1.00 17.82  ? 234  ASP A OD1   1 
ATOM   1793  O OD2   . ASP A 1 234 ? 14.750  54.325  28.712  1.00 16.65  ? 234  ASP A OD2   1 
ATOM   1794  N N     . LEU A 1 235 ? 18.192  51.892  24.966  1.00 20.55  ? 235  LEU A N     1 
ATOM   1795  C CA    . LEU A 1 235 ? 18.920  51.870  23.709  1.00 20.81  ? 235  LEU A CA    1 
ATOM   1796  C C     . LEU A 1 235 ? 17.943  51.773  22.543  1.00 20.83  ? 235  LEU A C     1 
ATOM   1797  O O     . LEU A 1 235 ? 17.023  50.956  22.561  1.00 20.69  ? 235  LEU A O     1 
ATOM   1798  C CB    . LEU A 1 235 ? 19.867  50.666  23.682  1.00 20.88  ? 235  LEU A CB    1 
ATOM   1799  C CG    . LEU A 1 235 ? 20.926  50.568  24.786  1.00 22.10  ? 235  LEU A CG    1 
ATOM   1800  C CD1   . LEU A 1 235 ? 21.401  49.124  24.968  1.00 21.30  ? 235  LEU A CD1   1 
ATOM   1801  C CD2   . LEU A 1 235 ? 22.075  51.517  24.470  1.00 21.30  ? 235  LEU A CD2   1 
ATOM   1802  N N     . TRP A 1 236 ? 18.146  52.618  21.539  1.00 20.55  ? 236  TRP A N     1 
ATOM   1803  C CA    . TRP A 1 236 ? 17.351  52.559  20.323  1.00 19.95  ? 236  TRP A CA    1 
ATOM   1804  C C     . TRP A 1 236 ? 17.780  51.368  19.478  1.00 20.08  ? 236  TRP A C     1 
ATOM   1805  O O     . TRP A 1 236 ? 18.988  51.101  19.329  1.00 19.99  ? 236  TRP A O     1 
ATOM   1806  C CB    . TRP A 1 236 ? 17.497  53.844  19.514  1.00 19.01  ? 236  TRP A CB    1 
ATOM   1807  C CG    . TRP A 1 236 ? 16.849  55.032  20.123  1.00 18.75  ? 236  TRP A CG    1 
ATOM   1808  C CD1   . TRP A 1 236 ? 17.477  56.141  20.624  1.00 17.97  ? 236  TRP A CD1   1 
ATOM   1809  C CD2   . TRP A 1 236 ? 15.435  55.255  20.302  1.00 17.57  ? 236  TRP A CD2   1 
ATOM   1810  N NE1   . TRP A 1 236 ? 16.543  57.045  21.094  1.00 17.05  ? 236  TRP A NE1   1 
ATOM   1811  C CE2   . TRP A 1 236 ? 15.286  56.531  20.899  1.00 17.56  ? 236  TRP A CE2   1 
ATOM   1812  C CE3   . TRP A 1 236 ? 14.286  54.508  20.003  1.00 16.58  ? 236  TRP A CE3   1 
ATOM   1813  C CZ2   . TRP A 1 236 ? 14.034  57.068  21.220  1.00 17.72  ? 236  TRP A CZ2   1 
ATOM   1814  C CZ3   . TRP A 1 236 ? 13.048  55.041  20.312  1.00 16.79  ? 236  TRP A CZ3   1 
ATOM   1815  C CH2   . TRP A 1 236 ? 12.930  56.317  20.911  1.00 17.97  ? 236  TRP A CH2   1 
ATOM   1816  N N     . TRP A 1 237 ? 16.779  50.659  18.955  1.00 19.74  ? 237  TRP A N     1 
ATOM   1817  C CA    . TRP A 1 237 ? 16.952  49.501  18.082  1.00 20.30  ? 237  TRP A CA    1 
ATOM   1818  C C     . TRP A 1 237 ? 17.894  49.812  16.903  1.00 21.86  ? 237  TRP A C     1 
ATOM   1819  O O     . TRP A 1 237 ? 18.874  49.064  16.656  1.00 21.68  ? 237  TRP A O     1 
ATOM   1820  C CB    . TRP A 1 237 ? 15.574  49.044  17.573  1.00 19.29  ? 237  TRP A CB    1 
ATOM   1821  C CG    . TRP A 1 237 ? 15.613  47.997  16.496  1.00 19.47  ? 237  TRP A CG    1 
ATOM   1822  C CD1   . TRP A 1 237 ? 15.991  48.169  15.187  1.00 18.05  ? 237  TRP A CD1   1 
ATOM   1823  C CD2   . TRP A 1 237 ? 15.259  46.612  16.629  1.00 18.91  ? 237  TRP A CD2   1 
ATOM   1824  N NE1   . TRP A 1 237 ? 15.899  46.980  14.508  1.00 18.34  ? 237  TRP A NE1   1 
ATOM   1825  C CE2   . TRP A 1 237 ? 15.454  46.007  15.363  1.00 18.81  ? 237  TRP A CE2   1 
ATOM   1826  C CE3   . TRP A 1 237 ? 14.792  45.823  17.696  1.00 18.30  ? 237  TRP A CE3   1 
ATOM   1827  C CZ2   . TRP A 1 237 ? 15.211  44.645  15.135  1.00 18.55  ? 237  TRP A CZ2   1 
ATOM   1828  C CZ3   . TRP A 1 237 ? 14.541  44.473  17.465  1.00 18.71  ? 237  TRP A CZ3   1 
ATOM   1829  C CH2   . TRP A 1 237 ? 14.747  43.900  16.195  1.00 18.49  ? 237  TRP A CH2   1 
ATOM   1830  N N     . ARG A 1 238 ? 17.577  50.900  16.180  1.00 22.50  ? 238  ARG A N     1 
ATOM   1831  C CA    . ARG A 1 238 ? 18.317  51.338  15.006  1.00 24.49  ? 238  ARG A CA    1 
ATOM   1832  C C     . ARG A 1 238 ? 19.796  51.658  15.311  1.00 23.80  ? 238  ARG A C     1 
ATOM   1833  O O     . ARG A 1 238 ? 20.679  51.249  14.556  1.00 23.44  ? 238  ARG A O     1 
ATOM   1834  C CB    . ARG A 1 238 ? 17.615  52.538  14.335  1.00 24.48  ? 238  ARG A CB    1 
ATOM   1835  C CG    . ARG A 1 238 ? 18.264  52.968  13.002  1.00 28.30  ? 238  ARG A CG    1 
ATOM   1836  C CD    . ARG A 1 238 ? 17.939  54.432  12.564  1.00 28.41  ? 238  ARG A CD    1 
ATOM   1837  N NE    . ARG A 1 238 ? 18.762  54.838  11.413  1.00 36.06  ? 238  ARG A NE    1 
ATOM   1838  C CZ    . ARG A 1 238 ? 18.517  54.508  10.139  1.00 38.93  ? 238  ARG A CZ    1 
ATOM   1839  N NH1   . ARG A 1 238 ? 17.455  53.773  9.816   1.00 39.81  ? 238  ARG A NH1   1 
ATOM   1840  N NH2   . ARG A 1 238 ? 19.340  54.920  9.173   1.00 40.99  ? 238  ARG A NH2   1 
ATOM   1841  N N     . ASP A 1 239 ? 20.055  52.380  16.407  1.00 23.45  ? 239  ASP A N     1 
ATOM   1842  C CA    . ASP A 1 239 ? 21.424  52.682  16.838  1.00 23.17  ? 239  ASP A CA    1 
ATOM   1843  C C     . ASP A 1 239 ? 22.256  51.395  16.940  1.00 23.22  ? 239  ASP A C     1 
ATOM   1844  O O     . ASP A 1 239 ? 23.358  51.291  16.385  1.00 22.69  ? 239  ASP A O     1 
ATOM   1845  C CB    . ASP A 1 239 ? 21.424  53.425  18.185  1.00 23.19  ? 239  ASP A CB    1 
ATOM   1846  C CG    . ASP A 1 239 ? 20.936  54.865  18.071  1.00 23.34  ? 239  ASP A CG    1 
ATOM   1847  O OD1   . ASP A 1 239 ? 20.734  55.318  16.929  1.00 22.10  ? 239  ASP A OD1   1 
ATOM   1848  O OD2   . ASP A 1 239 ? 20.757  55.550  19.119  1.00 23.17  ? 239  ASP A OD2   1 
ATOM   1849  N N     . LEU A 1 240 ? 21.685  50.398  17.607  1.00 22.95  ? 240  LEU A N     1 
ATOM   1850  C CA    . LEU A 1 240 ? 22.378  49.147  17.833  1.00 22.85  ? 240  LEU A CA    1 
ATOM   1851  C C     . LEU A 1 240 ? 22.556  48.315  16.564  1.00 22.86  ? 240  LEU A C     1 
ATOM   1852  O O     . LEU A 1 240 ? 23.650  47.851  16.283  1.00 22.33  ? 240  LEU A O     1 
ATOM   1853  C CB    . LEU A 1 240 ? 21.673  48.332  18.918  1.00 22.67  ? 240  LEU A CB    1 
ATOM   1854  C CG    . LEU A 1 240 ? 21.732  48.861  20.351  1.00 22.39  ? 240  LEU A CG    1 
ATOM   1855  C CD1   . LEU A 1 240 ? 20.862  48.013  21.275  1.00 21.46  ? 240  LEU A CD1   1 
ATOM   1856  C CD2   . LEU A 1 240 ? 23.163  48.907  20.854  1.00 20.77  ? 240  LEU A CD2   1 
ATOM   1857  N N     . ILE A 1 241 ? 21.481  48.125  15.808  1.00 23.21  ? 241  ILE A N     1 
ATOM   1858  C CA    . ILE A 1 241 ? 21.511  47.198  14.688  1.00 23.47  ? 241  ILE A CA    1 
ATOM   1859  C C     . ILE A 1 241 ? 22.362  47.694  13.506  1.00 24.51  ? 241  ILE A C     1 
ATOM   1860  O O     . ILE A 1 241 ? 23.018  46.881  12.826  1.00 24.29  ? 241  ILE A O     1 
ATOM   1861  C CB    . ILE A 1 241 ? 20.081  46.750  14.248  1.00 23.35  ? 241  ILE A CB    1 
ATOM   1862  C CG1   . ILE A 1 241 ? 20.154  45.370  13.556  1.00 23.38  ? 241  ILE A CG1   1 
ATOM   1863  C CG2   . ILE A 1 241 ? 19.411  47.833  13.404  1.00 22.17  ? 241  ILE A CG2   1 
ATOM   1864  C CD1   . ILE A 1 241 ? 18.819  44.775  13.088  1.00 22.81  ? 241  ILE A CD1   1 
ATOM   1865  N N     . GLU A 1 242 ? 22.373  49.013  13.293  1.00 25.33  ? 242  GLU A N     1 
ATOM   1866  C CA    . GLU A 1 242 ? 23.146  49.628  12.205  1.00 26.67  ? 242  GLU A CA    1 
ATOM   1867  C C     . GLU A 1 242 ? 24.656  49.543  12.447  1.00 26.48  ? 242  GLU A C     1 
ATOM   1868  O O     . GLU A 1 242 ? 25.445  49.616  11.505  1.00 26.13  ? 242  GLU A O     1 
ATOM   1869  C CB    . GLU A 1 242 ? 22.740  51.093  11.992  1.00 27.36  ? 242  GLU A CB    1 
ATOM   1870  C CG    . GLU A 1 242 ? 21.340  51.316  11.391  1.00 31.55  ? 242  GLU A CG    1 
ATOM   1871  C CD    . GLU A 1 242 ? 21.088  50.578  10.052  1.00 35.77  ? 242  GLU A CD    1 
ATOM   1872  O OE1   . GLU A 1 242 ? 21.997  50.528  9.182   1.00 34.59  ? 242  GLU A OE1   1 
ATOM   1873  O OE2   . GLU A 1 242 ? 19.947  50.067  9.872   1.00 38.02  ? 242  GLU A OE2   1 
ATOM   1874  N N     . LYS A 1 243 ? 25.059  49.395  13.705  1.00 26.18  ? 243  LYS A N     1 
ATOM   1875  C CA    . LYS A 1 243 ? 26.480  49.236  13.995  1.00 27.23  ? 243  LYS A CA    1 
ATOM   1876  C C     . LYS A 1 243 ? 26.899  47.752  14.066  1.00 26.06  ? 243  LYS A C     1 
ATOM   1877  O O     . LYS A 1 243 ? 28.074  47.425  14.187  1.00 26.26  ? 243  LYS A O     1 
ATOM   1878  C CB    . LYS A 1 243 ? 26.919  50.065  15.224  1.00 26.66  ? 243  LYS A CB    1 
ATOM   1879  C CG    . LYS A 1 243 ? 26.650  49.426  16.563  1.00 28.50  ? 243  LYS A CG    1 
ATOM   1880  C CD    . LYS A 1 243 ? 26.828  50.419  17.731  1.00 29.22  ? 243  LYS A CD    1 
ATOM   1881  C CE    . LYS A 1 243 ? 26.808  49.672  19.070  1.00 31.63  ? 243  LYS A CE    1 
ATOM   1882  N NZ    . LYS A 1 243 ? 26.541  50.609  20.188  1.00 33.29  ? 243  LYS A NZ    1 
ATOM   1883  N N     . ALA A 1 244 ? 25.928  46.864  13.936  1.00 25.40  ? 244  ALA A N     1 
ATOM   1884  C CA    . ALA A 1 244 ? 26.192  45.442  14.072  1.00 24.77  ? 244  ALA A CA    1 
ATOM   1885  C C     . ALA A 1 244 ? 26.596  44.800  12.735  1.00 24.15  ? 244  ALA A C     1 
ATOM   1886  O O     . ALA A 1 244 ? 26.155  45.232  11.656  1.00 24.43  ? 244  ALA A O     1 
ATOM   1887  C CB    . ALA A 1 244 ? 24.980  44.731  14.681  1.00 24.65  ? 244  ALA A CB    1 
ATOM   1888  N N     . SER A 1 245 ? 27.440  43.778  12.820  1.00 23.04  ? 245  SER A N     1 
ATOM   1889  C CA    . SER A 1 245 ? 27.867  43.015  11.661  1.00 22.20  ? 245  SER A CA    1 
ATOM   1890  C C     . SER A 1 245 ? 26.725  42.107  11.165  1.00 22.46  ? 245  SER A C     1 
ATOM   1891  O O     . SER A 1 245 ? 25.996  41.527  11.979  1.00 21.94  ? 245  SER A O     1 
ATOM   1892  C CB    . SER A 1 245 ? 29.084  42.174  12.030  1.00 21.86  ? 245  SER A CB    1 
ATOM   1893  O OG    . SER A 1 245 ? 29.344  41.208  11.042  1.00 19.76  ? 245  SER A OG    1 
ATOM   1894  N N     . PRO A 1 246 ? 26.554  42.001  9.829   1.00 22.66  ? 246  PRO A N     1 
ATOM   1895  C CA    . PRO A 1 246 ? 25.576  41.093  9.230   1.00 22.83  ? 246  PRO A CA    1 
ATOM   1896  C C     . PRO A 1 246 ? 26.075  39.663  9.111   1.00 23.49  ? 246  PRO A C     1 
ATOM   1897  O O     . PRO A 1 246 ? 25.366  38.828  8.572   1.00 22.95  ? 246  PRO A O     1 
ATOM   1898  C CB    . PRO A 1 246 ? 25.334  41.681  7.843   1.00 22.33  ? 246  PRO A CB    1 
ATOM   1899  C CG    . PRO A 1 246 ? 26.316  42.795  7.686   1.00 23.45  ? 246  PRO A CG    1 
ATOM   1900  C CD    . PRO A 1 246 ? 27.273  42.774  8.809   1.00 22.59  ? 246  PRO A CD    1 
ATOM   1901  N N     . GLU A 1 247 ? 27.278  39.391  9.621   1.00 24.67  ? 247  GLU A N     1 
ATOM   1902  C CA    . GLU A 1 247 ? 27.891  38.073  9.531   1.00 25.97  ? 247  GLU A CA    1 
ATOM   1903  C C     . GLU A 1 247 ? 27.706  37.389  10.871  1.00 25.65  ? 247  GLU A C     1 
ATOM   1904  O O     . GLU A 1 247 ? 28.249  37.852  11.896  1.00 25.45  ? 247  GLU A O     1 
ATOM   1905  C CB    . GLU A 1 247 ? 29.401  38.158  9.259   1.00 26.79  ? 247  GLU A CB    1 
ATOM   1906  C CG    . GLU A 1 247 ? 29.876  39.304  8.353   1.00 31.60  ? 247  GLU A CG    1 
ATOM   1907  C CD    . GLU A 1 247 ? 29.915  38.923  6.877   1.00 36.12  ? 247  GLU A CD    1 
ATOM   1908  O OE1   . GLU A 1 247 ? 30.879  38.232  6.461   1.00 36.09  ? 247  GLU A OE1   1 
ATOM   1909  O OE2   . GLU A 1 247 ? 28.987  39.339  6.135   1.00 39.06  ? 247  GLU A OE2   1 
ATOM   1910  N N     . HIS A 1 248 ? 26.951  36.293  10.877  1.00 24.87  ? 248  HIS A N     1 
ATOM   1911  C CA    . HIS A 1 248 ? 26.848  35.495  12.080  1.00 24.38  ? 248  HIS A CA    1 
ATOM   1912  C C     . HIS A 1 248 ? 26.734  34.033  11.751  1.00 24.71  ? 248  HIS A C     1 
ATOM   1913  O O     . HIS A 1 248 ? 25.859  33.614  10.999  1.00 24.52  ? 248  HIS A O     1 
ATOM   1914  C CB    . HIS A 1 248 ? 25.691  35.937  12.958  1.00 24.00  ? 248  HIS A CB    1 
ATOM   1915  C CG    . HIS A 1 248 ? 25.657  35.241  14.278  1.00 22.89  ? 248  HIS A CG    1 
ATOM   1916  N ND1   . HIS A 1 248 ? 25.040  34.018  14.459  1.00 21.69  ? 248  HIS A ND1   1 
ATOM   1917  C CD2   . HIS A 1 248 ? 26.184  35.582  15.477  1.00 20.21  ? 248  HIS A CD2   1 
ATOM   1918  C CE1   . HIS A 1 248 ? 25.193  33.638  15.716  1.00 21.73  ? 248  HIS A CE1   1 
ATOM   1919  N NE2   . HIS A 1 248 ? 25.873  34.574  16.357  1.00 20.43  ? 248  HIS A NE2   1 
ATOM   1920  N N     . GLN A 1 249 ? 27.645  33.259  12.318  1.00 25.41  ? 249  GLN A N     1 
ATOM   1921  C CA    . GLN A 1 249 ? 27.693  31.837  12.067  1.00 26.77  ? 249  GLN A CA    1 
ATOM   1922  C C     . GLN A 1 249 ? 26.972  31.164  13.216  1.00 26.20  ? 249  GLN A C     1 
ATOM   1923  O O     . GLN A 1 249 ? 27.307  31.399  14.378  1.00 26.10  ? 249  GLN A O     1 
ATOM   1924  C CB    . GLN A 1 249 ? 29.139  31.347  11.914  1.00 27.32  ? 249  GLN A CB    1 
ATOM   1925  C CG    . GLN A 1 249 ? 30.032  32.277  11.050  1.00 31.47  ? 249  GLN A CG    1 
ATOM   1926  C CD    . GLN A 1 249 ? 29.421  32.642  9.681   1.00 36.13  ? 249  GLN A CD    1 
ATOM   1927  O OE1   . GLN A 1 249 ? 29.224  33.834  9.356   1.00 36.43  ? 249  GLN A OE1   1 
ATOM   1928  N NE2   . GLN A 1 249 ? 29.125  31.615  8.872   1.00 37.12  ? 249  GLN A NE2   1 
ATOM   1929  N N     . PRO A 1 250 ? 25.944  30.359  12.892  1.00 26.23  ? 250  PRO A N     1 
ATOM   1930  C CA    . PRO A 1 250 ? 25.088  29.777  13.926  1.00 26.45  ? 250  PRO A CA    1 
ATOM   1931  C C     . PRO A 1 250 ? 25.725  28.549  14.576  1.00 26.64  ? 250  PRO A C     1 
ATOM   1932  O O     . PRO A 1 250 ? 26.288  27.692  13.885  1.00 26.60  ? 250  PRO A O     1 
ATOM   1933  C CB    . PRO A 1 250 ? 23.807  29.408  13.163  1.00 26.26  ? 250  PRO A CB    1 
ATOM   1934  C CG    . PRO A 1 250 ? 24.254  29.159  11.752  1.00 26.33  ? 250  PRO A CG    1 
ATOM   1935  C CD    . PRO A 1 250 ? 25.544  29.946  11.531  1.00 26.19  ? 250  PRO A CD    1 
ATOM   1936  N N     . GLU A 1 251 ? 25.647  28.486  15.899  1.00 27.24  ? 251  GLU A N     1 
ATOM   1937  C CA    . GLU A 1 251 ? 26.188  27.360  16.663  1.00 27.48  ? 251  GLU A CA    1 
ATOM   1938  C C     . GLU A 1 251 ? 25.125  26.287  16.810  1.00 27.02  ? 251  GLU A C     1 
ATOM   1939  O O     . GLU A 1 251 ? 23.916  26.565  16.757  1.00 26.81  ? 251  GLU A O     1 
ATOM   1940  C CB    . GLU A 1 251 ? 26.621  27.793  18.070  1.00 28.33  ? 251  GLU A CB    1 
ATOM   1941  C CG    . GLU A 1 251 ? 27.438  29.091  18.161  1.00 31.31  ? 251  GLU A CG    1 
ATOM   1942  C CD    . GLU A 1 251 ? 28.907  28.860  18.006  1.00 37.06  ? 251  GLU A CD    1 
ATOM   1943  O OE1   . GLU A 1 251 ? 29.333  27.677  17.945  1.00 40.25  ? 251  GLU A OE1   1 
ATOM   1944  O OE2   . GLU A 1 251 ? 29.650  29.863  17.945  1.00 40.41  ? 251  GLU A OE2   1 
ATOM   1945  N N     . ALA A 1 252 ? 25.593  25.058  16.994  1.00 26.48  ? 252  ALA A N     1 
ATOM   1946  C CA    . ALA A 1 252 ? 24.738  23.942  17.323  1.00 25.86  ? 252  ALA A CA    1 
ATOM   1947  C C     . ALA A 1 252 ? 24.196  24.070  18.745  1.00 25.49  ? 252  ALA A C     1 
ATOM   1948  O O     . ALA A 1 252 ? 24.954  24.283  19.690  1.00 25.43  ? 252  ALA A O     1 
ATOM   1949  C CB    . ALA A 1 252 ? 25.495  22.651  17.166  1.00 25.73  ? 252  ALA A CB    1 
ATOM   1950  N N     . MET A 1 253 ? 22.875  23.948  18.858  1.00 24.86  ? 253  MET A N     1 
ATOM   1951  C CA    . MET A 1 253 ? 22.160  23.793  20.120  1.00 24.22  ? 253  MET A CA    1 
ATOM   1952  C C     . MET A 1 253 ? 21.726  22.344  20.222  1.00 23.85  ? 253  MET A C     1 
ATOM   1953  O O     . MET A 1 253 ? 21.387  21.715  19.208  1.00 23.67  ? 253  MET A O     1 
ATOM   1954  C CB    . MET A 1 253 ? 20.891  24.656  20.106  1.00 24.04  ? 253  MET A CB    1 
ATOM   1955  C CG    . MET A 1 253 ? 21.126  26.091  19.690  1.00 24.50  ? 253  MET A CG    1 
ATOM   1956  S SD    . MET A 1 253 ? 22.111  26.951  20.925  1.00 25.12  ? 253  MET A SD    1 
ATOM   1957  C CE    . MET A 1 253 ? 23.080  28.092  19.922  1.00 24.15  ? 253  MET A CE    1 
ATOM   1958  N N     . ASN A 1 254 ? 21.691  21.817  21.434  1.00 23.72  ? 254  ASN A N     1 
ATOM   1959  C CA    . ASN A 1 254 ? 21.076  20.509  21.649  1.00 24.10  ? 254  ASN A CA    1 
ATOM   1960  C C     . ASN A 1 254 ? 19.554  20.556  21.423  1.00 23.01  ? 254  ASN A C     1 
ATOM   1961  O O     . ASN A 1 254 ? 18.896  21.570  21.690  1.00 22.85  ? 254  ASN A O     1 
ATOM   1962  C CB    . ASN A 1 254 ? 21.394  19.982  23.055  1.00 24.76  ? 254  ASN A CB    1 
ATOM   1963  C CG    . ASN A 1 254 ? 22.894  20.035  23.373  1.00 28.68  ? 254  ASN A CG    1 
ATOM   1964  O OD1   . ASN A 1 254 ? 23.747  19.656  22.536  1.00 29.95  ? 254  ASN A OD1   1 
ATOM   1965  N ND2   . ASN A 1 254 ? 23.226  20.505  24.595  1.00 30.31  ? 254  ASN A ND2   1 
ATOM   1966  N N     . ALA A 1 255 ? 19.013  19.439  20.945  1.00 21.94  ? 255  ALA A N     1 
ATOM   1967  C CA    . ALA A 1 255 ? 17.590  19.272  20.712  1.00 20.99  ? 255  ALA A CA    1 
ATOM   1968  C C     . ALA A 1 255 ? 16.762  19.628  21.953  1.00 20.64  ? 255  ALA A C     1 
ATOM   1969  O O     . ALA A 1 255 ? 15.645  20.148  21.823  1.00 20.54  ? 255  ALA A O     1 
ATOM   1970  C CB    . ALA A 1 255 ? 17.297  17.844  20.256  1.00 21.21  ? 255  ALA A CB    1 
ATOM   1971  N N     . GLU A 1 256 ? 17.317  19.375  23.143  1.00 19.52  ? 256  GLU A N     1 
ATOM   1972  C CA    . GLU A 1 256 ? 16.638  19.708  24.406  1.00 19.03  ? 256  GLU A CA    1 
ATOM   1973  C C     . GLU A 1 256 ? 17.103  21.014  25.082  1.00 19.26  ? 256  GLU A C     1 
ATOM   1974  O O     . GLU A 1 256 ? 16.699  21.299  26.208  1.00 19.00  ? 256  GLU A O     1 
ATOM   1975  C CB    . GLU A 1 256 ? 16.696  18.545  25.409  1.00 18.42  ? 256  GLU A CB    1 
ATOM   1976  C CG    . GLU A 1 256 ? 15.900  17.287  25.024  1.00 17.67  ? 256  GLU A CG    1 
ATOM   1977  C CD    . GLU A 1 256 ? 14.399  17.537  24.833  1.00 18.88  ? 256  GLU A CD    1 
ATOM   1978  O OE1   . GLU A 1 256 ? 13.825  18.477  25.433  1.00 19.08  ? 256  GLU A OE1   1 
ATOM   1979  O OE2   . GLU A 1 256 ? 13.781  16.772  24.073  1.00 18.28  ? 256  GLU A OE2   1 
ATOM   1980  N N     . ASP A 1 257 ? 17.938  21.815  24.416  1.00 19.28  ? 257  ASP A N     1 
ATOM   1981  C CA    . ASP A 1 257 ? 18.209  23.142  24.948  1.00 19.05  ? 257  ASP A CA    1 
ATOM   1982  C C     . ASP A 1 257 ? 16.892  23.929  24.928  1.00 19.30  ? 257  ASP A C     1 
ATOM   1983  O O     . ASP A 1 257 ? 16.128  23.850  23.942  1.00 19.13  ? 257  ASP A O     1 
ATOM   1984  C CB    . ASP A 1 257 ? 19.242  23.887  24.113  1.00 19.60  ? 257  ASP A CB    1 
ATOM   1985  C CG    . ASP A 1 257 ? 20.677  23.404  24.340  1.00 19.63  ? 257  ASP A CG    1 
ATOM   1986  O OD1   . ASP A 1 257 ? 20.974  22.781  25.385  1.00 21.46  ? 257  ASP A OD1   1 
ATOM   1987  O OD2   . ASP A 1 257 ? 21.515  23.672  23.455  1.00 18.32  ? 257  ASP A OD2   1 
ATOM   1988  N N     . PRO A 1 258 ? 16.622  24.689  26.009  1.00 18.68  ? 258  PRO A N     1 
ATOM   1989  C CA    . PRO A 1 258 ? 15.412  25.491  26.094  1.00 18.20  ? 258  PRO A CA    1 
ATOM   1990  C C     . PRO A 1 258 ? 15.315  26.486  24.920  1.00 17.98  ? 258  PRO A C     1 
ATOM   1991  O O     . PRO A 1 258 ? 16.323  27.110  24.543  1.00 18.17  ? 258  PRO A O     1 
ATOM   1992  C CB    . PRO A 1 258 ? 15.568  26.234  27.434  1.00 17.71  ? 258  PRO A CB    1 
ATOM   1993  C CG    . PRO A 1 258 ? 16.547  25.428  28.234  1.00 19.06  ? 258  PRO A CG    1 
ATOM   1994  C CD    . PRO A 1 258 ? 17.469  24.806  27.220  1.00 19.08  ? 258  PRO A CD    1 
ATOM   1995  N N     . LEU A 1 259 ? 14.118  26.633  24.360  1.00 16.76  ? 259  LEU A N     1 
ATOM   1996  C CA    . LEU A 1 259 ? 13.913  27.534  23.227  1.00 16.64  ? 259  LEU A CA    1 
ATOM   1997  C C     . LEU A 1 259 ? 13.149  28.794  23.651  1.00 17.13  ? 259  LEU A C     1 
ATOM   1998  O O     . LEU A 1 259 ? 13.579  29.925  23.373  1.00 16.85  ? 259  LEU A O     1 
ATOM   1999  C CB    . LEU A 1 259 ? 13.197  26.809  22.066  1.00 16.36  ? 259  LEU A CB    1 
ATOM   2000  C CG    . LEU A 1 259 ? 12.804  27.677  20.865  1.00 16.26  ? 259  LEU A CG    1 
ATOM   2001  C CD1   . LEU A 1 259 ? 14.052  28.106  20.078  1.00 15.61  ? 259  LEU A CD1   1 
ATOM   2002  C CD2   . LEU A 1 259 ? 11.786  26.973  19.978  1.00 15.90  ? 259  LEU A CD2   1 
ATOM   2003  N N     . PHE A 1 260 ? 12.009  28.594  24.312  1.00 17.83  ? 260  PHE A N     1 
ATOM   2004  C CA    . PHE A 1 260 ? 11.253  29.716  24.852  1.00 18.62  ? 260  PHE A CA    1 
ATOM   2005  C C     . PHE A 1 260 ? 10.371  29.366  26.063  1.00 19.69  ? 260  PHE A C     1 
ATOM   2006  O O     . PHE A 1 260 ? 10.102  28.169  26.338  1.00 19.48  ? 260  PHE A O     1 
ATOM   2007  C CB    . PHE A 1 260 ? 10.449  30.430  23.752  1.00 17.89  ? 260  PHE A CB    1 
ATOM   2008  C CG    . PHE A 1 260 ? 9.302   29.619  23.182  1.00 17.82  ? 260  PHE A CG    1 
ATOM   2009  C CD1   . PHE A 1 260 ? 8.057   29.600  23.809  1.00 16.42  ? 260  PHE A CD1   1 
ATOM   2010  C CD2   . PHE A 1 260 ? 9.458   28.910  21.991  1.00 16.97  ? 260  PHE A CD2   1 
ATOM   2011  C CE1   . PHE A 1 260 ? 7.009   28.861  23.277  1.00 16.79  ? 260  PHE A CE1   1 
ATOM   2012  C CE2   . PHE A 1 260 ? 8.408   28.176  21.442  1.00 16.58  ? 260  PHE A CE2   1 
ATOM   2013  C CZ    . PHE A 1 260 ? 7.179   28.153  22.088  1.00 17.59  ? 260  PHE A CZ    1 
ATOM   2014  N N     . ILE A 1 261 ? 9.973   30.429  26.780  1.00 19.88  ? 261  ILE A N     1 
ATOM   2015  C CA    . ILE A 1 261 ? 8.964   30.407  27.823  1.00 21.03  ? 261  ILE A CA    1 
ATOM   2016  C C     . ILE A 1 261 ? 7.747   31.149  27.281  1.00 20.81  ? 261  ILE A C     1 
ATOM   2017  O O     . ILE A 1 261 ? 7.904   32.152  26.558  1.00 20.91  ? 261  ILE A O     1 
ATOM   2018  C CB    . ILE A 1 261 ? 9.366   31.252  29.053  1.00 21.07  ? 261  ILE A CB    1 
ATOM   2019  C CG1   . ILE A 1 261 ? 10.731  30.909  29.606  1.00 23.00  ? 261  ILE A CG1   1 
ATOM   2020  C CG2   . ILE A 1 261 ? 8.352   31.104  30.161  1.00 22.25  ? 261  ILE A CG2   1 
ATOM   2021  C CD1   . ILE A 1 261 ? 11.109  31.907  30.748  1.00 22.71  ? 261  ILE A CD1   1 
ATOM   2022  N N     . LEU A 1 262 ? 6.549   30.681  27.644  1.00 20.24  ? 262  LEU A N     1 
ATOM   2023  C CA    . LEU A 1 262 ? 5.321   31.451  27.449  1.00 20.21  ? 262  LEU A CA    1 
ATOM   2024  C C     . LEU A 1 262 ? 4.436   31.370  28.663  1.00 19.61  ? 262  LEU A C     1 
ATOM   2025  O O     . LEU A 1 262 ? 3.906   30.297  28.981  1.00 19.27  ? 262  LEU A O     1 
ATOM   2026  C CB    . LEU A 1 262 ? 4.510   30.984  26.232  1.00 20.59  ? 262  LEU A CB    1 
ATOM   2027  C CG    . LEU A 1 262 ? 4.426   31.914  25.023  1.00 21.72  ? 262  LEU A CG    1 
ATOM   2028  C CD1   . LEU A 1 262 ? 3.389   31.356  24.073  1.00 22.89  ? 262  LEU A CD1   1 
ATOM   2029  C CD2   . LEU A 1 262 ? 4.107   33.339  25.413  1.00 19.15  ? 262  LEU A CD2   1 
ATOM   2030  N N     . TYR A 1 263 ? 4.259   32.504  29.332  1.00 19.28  ? 263  TYR A N     1 
ATOM   2031  C CA    . TYR A 1 263 ? 3.370   32.544  30.505  1.00 19.04  ? 263  TYR A CA    1 
ATOM   2032  C C     . TYR A 1 263 ? 1.917   32.252  30.118  1.00 19.09  ? 263  TYR A C     1 
ATOM   2033  O O     . TYR A 1 263 ? 1.364   32.848  29.182  1.00 19.53  ? 263  TYR A O     1 
ATOM   2034  C CB    . TYR A 1 263 ? 3.568   33.827  31.313  1.00 18.43  ? 263  TYR A CB    1 
ATOM   2035  C CG    . TYR A 1 263 ? 4.906   33.773  32.004  1.00 19.00  ? 263  TYR A CG    1 
ATOM   2036  C CD1   . TYR A 1 263 ? 6.074   34.176  31.351  1.00 17.07  ? 263  TYR A CD1   1 
ATOM   2037  C CD2   . TYR A 1 263 ? 5.015   33.250  33.298  1.00 18.65  ? 263  TYR A CD2   1 
ATOM   2038  C CE1   . TYR A 1 263 ? 7.315   34.089  31.982  1.00 18.08  ? 263  TYR A CE1   1 
ATOM   2039  C CE2   . TYR A 1 263 ? 6.235   33.164  33.933  1.00 18.60  ? 263  TYR A CE2   1 
ATOM   2040  C CZ    . TYR A 1 263 ? 7.382   33.582  33.273  1.00 18.97  ? 263  TYR A CZ    1 
ATOM   2041  O OH    . TYR A 1 263 ? 8.584   33.469  33.918  1.00 19.75  ? 263  TYR A OH    1 
ATOM   2042  N N     . THR A 1 264 ? 1.338   31.291  30.832  1.00 19.30  ? 264  THR A N     1 
ATOM   2043  C CA    . THR A 1 264 ? 0.045   30.719  30.513  1.00 18.74  ? 264  THR A CA    1 
ATOM   2044  C C     . THR A 1 264 ? -0.761  30.643  31.798  1.00 19.51  ? 264  THR A C     1 
ATOM   2045  O O     . THR A 1 264 ? -0.260  30.194  32.844  1.00 18.88  ? 264  THR A O     1 
ATOM   2046  C CB    . THR A 1 264 ? 0.258   29.324  29.914  1.00 19.04  ? 264  THR A CB    1 
ATOM   2047  O OG1   . THR A 1 264 ? 1.221   29.445  28.850  1.00 20.08  ? 264  THR A OG1   1 
ATOM   2048  C CG2   . THR A 1 264 ? -1.026  28.730  29.380  1.00 14.81  ? 264  THR A CG2   1 
ATOM   2049  N N     . SER A 1 265 ? -2.001  31.120  31.718  1.00 19.83  ? 265  SER A N     1 
ATOM   2050  C CA    . SER A 1 265 ? -2.913  31.057  32.829  1.00 20.81  ? 265  SER A CA    1 
ATOM   2051  C C     . SER A 1 265 ? -3.286  29.612  33.128  1.00 21.53  ? 265  SER A C     1 
ATOM   2052  O O     . SER A 1 265 ? -3.516  28.808  32.212  1.00 21.25  ? 265  SER A O     1 
ATOM   2053  C CB    . SER A 1 265 ? -4.177  31.834  32.509  1.00 20.78  ? 265  SER A CB    1 
ATOM   2054  O OG    . SER A 1 265 ? -3.926  33.217  32.457  1.00 21.54  ? 265  SER A OG    1 
ATOM   2055  N N     . GLY A 1 266 ? -3.371  29.301  34.416  1.00 22.08  ? 266  GLY A N     1 
ATOM   2056  C CA    . GLY A 1 266 ? -3.783  27.984  34.851  1.00 22.91  ? 266  GLY A CA    1 
ATOM   2057  C C     . GLY A 1 266 ? -4.991  28.035  35.762  1.00 23.56  ? 266  GLY A C     1 
ATOM   2058  O O     . GLY A 1 266 ? -5.505  29.118  36.080  1.00 23.15  ? 266  GLY A O     1 
ATOM   2059  N N     . SER A 1 267 ? -5.437  26.844  36.158  1.00 24.37  ? 267  SER A N     1 
ATOM   2060  C CA    . SER A 1 267 ? -6.540  26.655  37.077  1.00 25.75  ? 267  SER A CA    1 
ATOM   2061  C C     . SER A 1 267 ? -6.268  27.194  38.491  1.00 26.46  ? 267  SER A C     1 
ATOM   2062  O O     . SER A 1 267 ? -7.196  27.628  39.174  1.00 26.85  ? 267  SER A O     1 
ATOM   2063  C CB    . SER A 1 267 ? -6.906  25.176  37.145  1.00 26.03  ? 267  SER A CB    1 
ATOM   2064  O OG    . SER A 1 267 ? -8.260  25.021  37.556  1.00 28.68  ? 267  SER A OG    1 
ATOM   2065  N N     . THR A 1 268 ? -5.018  27.158  38.947  1.00 26.78  ? 268  THR A N     1 
ATOM   2066  C CA    . THR A 1 268 ? -4.686  27.826  40.198  1.00 27.79  ? 268  THR A CA    1 
ATOM   2067  C C     . THR A 1 268 ? -3.466  28.722  40.072  1.00 27.11  ? 268  THR A C     1 
ATOM   2068  O O     . THR A 1 268 ? -2.562  28.455  39.277  1.00 26.73  ? 268  THR A O     1 
ATOM   2069  C CB    . THR A 1 268 ? -4.448  26.843  41.380  1.00 28.34  ? 268  THR A CB    1 
ATOM   2070  O OG1   . THR A 1 268 ? -3.395  25.939  41.045  1.00 29.03  ? 268  THR A OG1   1 
ATOM   2071  C CG2   . THR A 1 268 ? -5.710  26.067  41.723  1.00 29.59  ? 268  THR A CG2   1 
ATOM   2072  N N     . GLY A 1 269 ? -3.460  29.779  40.877  1.00 26.90  ? 269  GLY A N     1 
ATOM   2073  C CA    . GLY A 1 269 ? -2.317  30.685  40.984  1.00 26.89  ? 269  GLY A CA    1 
ATOM   2074  C C     . GLY A 1 269 ? -2.088  31.594  39.793  1.00 26.70  ? 269  GLY A C     1 
ATOM   2075  O O     . GLY A 1 269 ? -2.943  31.740  38.911  1.00 26.26  ? 269  GLY A O     1 
ATOM   2076  N N     . LYS A 1 270 ? -0.916  32.212  39.771  1.00 26.60  ? 270  LYS A N     1 
ATOM   2077  C CA    . LYS A 1 270 ? -0.592  33.157  38.729  1.00 27.11  ? 270  LYS A CA    1 
ATOM   2078  C C     . LYS A 1 270 ? -0.018  32.398  37.517  1.00 26.07  ? 270  LYS A C     1 
ATOM   2079  O O     . LYS A 1 270 ? 0.404   31.245  37.663  1.00 25.61  ? 270  LYS A O     1 
ATOM   2080  C CB    . LYS A 1 270 ? 0.331   34.255  39.284  1.00 27.42  ? 270  LYS A CB    1 
ATOM   2081  C CG    . LYS A 1 270 ? -0.407  35.226  40.270  1.00 29.55  ? 270  LYS A CG    1 
ATOM   2082  C CD    . LYS A 1 270 ? 0.304   36.594  40.495  1.00 30.03  ? 270  LYS A CD    1 
ATOM   2083  C CE    . LYS A 1 270 ? -0.391  37.750  39.708  1.00 34.90  ? 270  LYS A CE    1 
ATOM   2084  N NZ    . LYS A 1 270 ? 0.228   39.163  39.816  1.00 32.49  ? 270  LYS A NZ    1 
ATOM   2085  N N     . PRO A 1 271 ? -0.023  33.024  36.315  1.00 25.16  ? 271  PRO A N     1 
ATOM   2086  C CA    . PRO A 1 271 ? 0.469   32.322  35.138  1.00 24.30  ? 271  PRO A CA    1 
ATOM   2087  C C     . PRO A 1 271 ? 1.899   31.814  35.338  1.00 23.79  ? 271  PRO A C     1 
ATOM   2088  O O     . PRO A 1 271 ? 2.712   32.487  35.989  1.00 22.67  ? 271  PRO A O     1 
ATOM   2089  C CB    . PRO A 1 271 ? 0.454   33.404  34.046  1.00 24.31  ? 271  PRO A CB    1 
ATOM   2090  C CG    . PRO A 1 271 ? -0.597  34.342  34.469  1.00 24.95  ? 271  PRO A CG    1 
ATOM   2091  C CD    . PRO A 1 271 ? -0.458  34.393  35.979  1.00 25.21  ? 271  PRO A CD    1 
ATOM   2092  N N     . LYS A 1 272 ? 2.173   30.629  34.781  1.00 23.12  ? 272  LYS A N     1 
ATOM   2093  C CA    . LYS A 1 272 ? 3.500   30.019  34.799  1.00 22.44  ? 272  LYS A CA    1 
ATOM   2094  C C     . LYS A 1 272 ? 4.121   29.915  33.393  1.00 21.80  ? 272  LYS A C     1 
ATOM   2095  O O     . LYS A 1 272 ? 3.412   29.807  32.375  1.00 20.87  ? 272  LYS A O     1 
ATOM   2096  C CB    . LYS A 1 272 ? 3.459   28.644  35.473  1.00 23.22  ? 272  LYS A CB    1 
ATOM   2097  C CG    . LYS A 1 272 ? 2.739   28.583  36.824  1.00 23.26  ? 272  LYS A CG    1 
ATOM   2098  C CD    . LYS A 1 272 ? 3.328   29.554  37.855  1.00 27.16  ? 272  LYS A CD    1 
ATOM   2099  C CE    . LYS A 1 272 ? 2.865   29.198  39.304  1.00 29.45  ? 272  LYS A CE    1 
ATOM   2100  N NZ    . LYS A 1 272 ? 1.351   29.165  39.475  1.00 31.58  ? 272  LYS A NZ    1 
ATOM   2101  N N     . GLY A 1 273 ? 5.453   29.943  33.349  1.00 20.62  ? 273  GLY A N     1 
ATOM   2102  C CA    . GLY A 1 273 ? 6.183   29.865  32.086  1.00 19.31  ? 273  GLY A CA    1 
ATOM   2103  C C     . GLY A 1 273 ? 6.244   28.469  31.501  1.00 18.19  ? 273  GLY A C     1 
ATOM   2104  O O     . GLY A 1 273 ? 7.086   27.662  31.893  1.00 18.45  ? 273  GLY A O     1 
ATOM   2105  N N     . VAL A 1 274 ? 5.340   28.173  30.576  1.00 17.41  ? 274  VAL A N     1 
ATOM   2106  C CA    . VAL A 1 274 ? 5.392   26.919  29.803  1.00 16.78  ? 274  VAL A CA    1 
ATOM   2107  C C     . VAL A 1 274 ? 6.659   26.919  28.931  1.00 16.96  ? 274  VAL A C     1 
ATOM   2108  O O     . VAL A 1 274 ? 6.844   27.817  28.087  1.00 16.78  ? 274  VAL A O     1 
ATOM   2109  C CB    . VAL A 1 274 ? 4.098   26.703  28.952  1.00 16.74  ? 274  VAL A CB    1 
ATOM   2110  C CG1   . VAL A 1 274 ? 4.202   25.445  28.057  1.00 15.56  ? 274  VAL A CG1   1 
ATOM   2111  C CG2   . VAL A 1 274 ? 2.866   26.614  29.859  1.00 13.85  ? 274  VAL A CG2   1 
ATOM   2112  N N     . LEU A 1 275 ? 7.525   25.926  29.152  1.00 16.92  ? 275  LEU A N     1 
ATOM   2113  C CA    . LEU A 1 275 ? 8.813   25.852  28.476  1.00 17.46  ? 275  LEU A CA    1 
ATOM   2114  C C     . LEU A 1 275 ? 8.887   24.849  27.317  1.00 18.28  ? 275  LEU A C     1 
ATOM   2115  O O     . LEU A 1 275 ? 8.598   23.660  27.474  1.00 18.95  ? 275  LEU A O     1 
ATOM   2116  C CB    . LEU A 1 275 ? 9.930   25.577  29.477  1.00 17.22  ? 275  LEU A CB    1 
ATOM   2117  C CG    . LEU A 1 275 ? 11.413  25.641  29.052  1.00 17.37  ? 275  LEU A CG    1 
ATOM   2118  C CD1   . LEU A 1 275 ? 12.214  26.146  30.258  1.00 16.60  ? 275  LEU A CD1   1 
ATOM   2119  C CD2   . LEU A 1 275 ? 11.951  24.266  28.573  1.00 17.34  ? 275  LEU A CD2   1 
ATOM   2120  N N     . HIS A 1 276 ? 9.305   25.341  26.158  1.00 18.16  ? 276  HIS A N     1 
ATOM   2121  C CA    . HIS A 1 276 ? 9.606   24.477  25.036  1.00 18.39  ? 276  HIS A CA    1 
ATOM   2122  C C     . HIS A 1 276 ? 11.095  24.454  24.760  1.00 18.65  ? 276  HIS A C     1 
ATOM   2123  O O     . HIS A 1 276 ? 11.789  25.467  24.928  1.00 19.19  ? 276  HIS A O     1 
ATOM   2124  C CB    . HIS A 1 276 ? 8.857   24.936  23.799  1.00 17.97  ? 276  HIS A CB    1 
ATOM   2125  C CG    . HIS A 1 276 ? 7.392   24.659  23.870  1.00 18.16  ? 276  HIS A CG    1 
ATOM   2126  N ND1   . HIS A 1 276 ? 6.856   23.438  23.540  1.00 18.19  ? 276  HIS A ND1   1 
ATOM   2127  C CD2   . HIS A 1 276 ? 6.358   25.425  24.277  1.00 18.25  ? 276  HIS A CD2   1 
ATOM   2128  C CE1   . HIS A 1 276 ? 5.549   23.470  23.718  1.00 18.27  ? 276  HIS A CE1   1 
ATOM   2129  N NE2   . HIS A 1 276 ? 5.221   24.665  24.161  1.00 16.33  ? 276  HIS A NE2   1 
ATOM   2130  N N     . THR A 1 277 ? 11.569  23.283  24.344  1.00 18.47  ? 277  THR A N     1 
ATOM   2131  C CA    . THR A 1 277 ? 12.930  23.111  23.853  1.00 18.15  ? 277  THR A CA    1 
ATOM   2132  C C     . THR A 1 277 ? 12.931  23.184  22.321  1.00 18.41  ? 277  THR A C     1 
ATOM   2133  O O     . THR A 1 277 ? 11.993  23.728  21.721  1.00 18.09  ? 277  THR A O     1 
ATOM   2134  C CB    . THR A 1 277 ? 13.595  21.798  24.377  1.00 18.17  ? 277  THR A CB    1 
ATOM   2135  O OG1   . THR A 1 277 ? 12.875  20.657  23.899  1.00 17.37  ? 277  THR A OG1   1 
ATOM   2136  C CG2   . THR A 1 277 ? 13.631  21.789  25.893  1.00 16.79  ? 277  THR A CG2   1 
ATOM   2137  N N     . THR A 1 278 ? 13.965  22.629  21.690  1.00 18.31  ? 278  THR A N     1 
ATOM   2138  C CA    . THR A 1 278 ? 14.276  23.009  20.310  1.00 17.68  ? 278  THR A CA    1 
ATOM   2139  C C     . THR A 1 278 ? 13.904  22.012  19.202  1.00 17.97  ? 278  THR A C     1 
ATOM   2140  O O     . THR A 1 278 ? 13.130  22.359  18.287  1.00 17.89  ? 278  THR A O     1 
ATOM   2141  C CB    . THR A 1 278 ? 15.735  23.448  20.212  1.00 17.92  ? 278  THR A CB    1 
ATOM   2142  O OG1   . THR A 1 278 ? 15.962  24.459  21.206  1.00 17.45  ? 278  THR A OG1   1 
ATOM   2143  C CG2   . THR A 1 278 ? 16.087  23.992  18.781  1.00 16.85  ? 278  THR A CG2   1 
ATOM   2144  N N     . GLY A 1 279 ? 14.430  20.787  19.290  1.00 17.59  ? 279  GLY A N     1 
ATOM   2145  C CA    . GLY A 1 279 ? 14.307  19.818  18.210  1.00 16.96  ? 279  GLY A CA    1 
ATOM   2146  C C     . GLY A 1 279 ? 12.870  19.389  18.000  1.00 17.38  ? 279  GLY A C     1 
ATOM   2147  O O     . GLY A 1 279 ? 12.278  19.702  16.966  1.00 17.10  ? 279  GLY A O     1 
ATOM   2148  N N     . GLY A 1 280 ? 12.317  18.659  18.975  1.00 17.02  ? 280  GLY A N     1 
ATOM   2149  C CA    . GLY A 1 280 ? 10.939  18.172  18.914  1.00 17.21  ? 280  GLY A CA    1 
ATOM   2150  C C     . GLY A 1 280 ? 9.890   19.249  18.629  1.00 17.68  ? 280  GLY A C     1 
ATOM   2151  O O     . GLY A 1 280 ? 9.006   19.072  17.783  1.00 17.97  ? 280  GLY A O     1 
ATOM   2152  N N     . TYR A 1 281 ? 10.000  20.380  19.319  1.00 17.75  ? 281  TYR A N     1 
ATOM   2153  C CA    . TYR A 1 281 ? 9.123   21.509  19.084  1.00 17.58  ? 281  TYR A CA    1 
ATOM   2154  C C     . TYR A 1 281 ? 9.088   21.900  17.590  1.00 18.22  ? 281  TYR A C     1 
ATOM   2155  O O     . TYR A 1 281 ? 8.014   22.016  16.982  1.00 19.00  ? 281  TYR A O     1 
ATOM   2156  C CB    . TYR A 1 281 ? 9.530   22.718  19.949  1.00 16.86  ? 281  TYR A CB    1 
ATOM   2157  C CG    . TYR A 1 281 ? 8.774   23.939  19.500  1.00 16.97  ? 281  TYR A CG    1 
ATOM   2158  C CD1   . TYR A 1 281 ? 7.458   24.165  19.939  1.00 14.77  ? 281  TYR A CD1   1 
ATOM   2159  C CD2   . TYR A 1 281 ? 9.334   24.831  18.571  1.00 14.55  ? 281  TYR A CD2   1 
ATOM   2160  C CE1   . TYR A 1 281 ? 6.733   25.252  19.480  1.00 14.35  ? 281  TYR A CE1   1 
ATOM   2161  C CE2   . TYR A 1 281 ? 8.610   25.923  18.117  1.00 14.14  ? 281  TYR A CE2   1 
ATOM   2162  C CZ    . TYR A 1 281 ? 7.315   26.119  18.572  1.00 14.67  ? 281  TYR A CZ    1 
ATOM   2163  O OH    . TYR A 1 281 ? 6.601   27.191  18.130  1.00 14.83  ? 281  TYR A OH    1 
ATOM   2164  N N     . LEU A 1 282 ? 10.267  22.093  17.005  1.00 18.30  ? 282  LEU A N     1 
ATOM   2165  C CA    . LEU A 1 282 ? 10.383  22.586  15.635  1.00 17.50  ? 282  LEU A CA    1 
ATOM   2166  C C     . LEU A 1 282 ? 9.985   21.542  14.602  1.00 17.91  ? 282  LEU A C     1 
ATOM   2167  O O     . LEU A 1 282 ? 9.388   21.887  13.559  1.00 18.29  ? 282  LEU A O     1 
ATOM   2168  C CB    . LEU A 1 282 ? 11.794  23.112  15.345  1.00 17.13  ? 282  LEU A CB    1 
ATOM   2169  C CG    . LEU A 1 282 ? 11.906  24.023  14.107  1.00 16.40  ? 282  LEU A CG    1 
ATOM   2170  C CD1   . LEU A 1 282 ? 10.928  25.202  14.184  1.00 14.14  ? 282  LEU A CD1   1 
ATOM   2171  C CD2   . LEU A 1 282 ? 13.354  24.485  13.904  1.00 16.06  ? 282  LEU A CD2   1 
ATOM   2172  N N     . VAL A 1 283 ? 10.329  20.284  14.880  1.00 17.41  ? 283  VAL A N     1 
ATOM   2173  C CA    . VAL A 1 283 ? 9.906   19.185  14.033  1.00 17.03  ? 283  VAL A CA    1 
ATOM   2174  C C     . VAL A 1 283 ? 8.378   19.150  14.026  1.00 17.20  ? 283  VAL A C     1 
ATOM   2175  O O     . VAL A 1 283 ? 7.762   18.982  12.962  1.00 18.21  ? 283  VAL A O     1 
ATOM   2176  C CB    . VAL A 1 283 ? 10.447  17.825  14.529  1.00 17.05  ? 283  VAL A CB    1 
ATOM   2177  C CG1   . VAL A 1 283 ? 9.731   16.671  13.844  1.00 16.29  ? 283  VAL A CG1   1 
ATOM   2178  C CG2   . VAL A 1 283 ? 11.989  17.713  14.322  1.00 17.79  ? 283  VAL A CG2   1 
ATOM   2179  N N     . TYR A 1 284 ? 7.763   19.302  15.202  1.00 16.79  ? 284  TYR A N     1 
ATOM   2180  C CA    . TYR A 1 284 ? 6.313   19.134  15.313  1.00 16.19  ? 284  TYR A CA    1 
ATOM   2181  C C     . TYR A 1 284 ? 5.586   20.316  14.656  1.00 16.14  ? 284  TYR A C     1 
ATOM   2182  O O     . TYR A 1 284 ? 4.622   20.116  13.919  1.00 16.30  ? 284  TYR A O     1 
ATOM   2183  C CB    . TYR A 1 284 ? 5.873   18.928  16.771  1.00 16.03  ? 284  TYR A CB    1 
ATOM   2184  C CG    . TYR A 1 284 ? 4.494   18.273  16.907  1.00 15.64  ? 284  TYR A CG    1 
ATOM   2185  C CD1   . TYR A 1 284 ? 3.415   18.992  17.422  1.00 15.56  ? 284  TYR A CD1   1 
ATOM   2186  C CD2   . TYR A 1 284 ? 4.275   16.950  16.498  1.00 15.65  ? 284  TYR A CD2   1 
ATOM   2187  C CE1   . TYR A 1 284 ? 2.166   18.428  17.548  1.00 15.92  ? 284  TYR A CE1   1 
ATOM   2188  C CE2   . TYR A 1 284 ? 3.013   16.367  16.603  1.00 16.09  ? 284  TYR A CE2   1 
ATOM   2189  C CZ    . TYR A 1 284 ? 1.959   17.120  17.131  1.00 16.87  ? 284  TYR A CZ    1 
ATOM   2190  O OH    . TYR A 1 284 ? 0.694   16.577  17.245  1.00 15.79  ? 284  TYR A OH    1 
ATOM   2191  N N     . ALA A 1 285 ? 6.085   21.532  14.889  1.00 15.97  ? 285  ALA A N     1 
ATOM   2192  C CA    . ALA A 1 285 ? 5.506   22.743  14.291  1.00 15.77  ? 285  ALA A CA    1 
ATOM   2193  C C     . ALA A 1 285 ? 5.542   22.672  12.777  1.00 15.99  ? 285  ALA A C     1 
ATOM   2194  O O     . ALA A 1 285 ? 4.500   22.894  12.145  1.00 16.50  ? 285  ALA A O     1 
ATOM   2195  C CB    . ALA A 1 285 ? 6.186   24.042  14.806  1.00 15.21  ? 285  ALA A CB    1 
ATOM   2196  N N     . ALA A 1 286 ? 6.709   22.353  12.199  1.00 15.02  ? 286  ALA A N     1 
ATOM   2197  C CA    . ALA A 1 286 ? 6.837   22.284  10.741  1.00 15.00  ? 286  ALA A CA    1 
ATOM   2198  C C     . ALA A 1 286 ? 5.954   21.194  10.117  1.00 15.08  ? 286  ALA A C     1 
ATOM   2199  O O     . ALA A 1 286 ? 5.314   21.423  9.086   1.00 15.26  ? 286  ALA A O     1 
ATOM   2200  C CB    . ALA A 1 286 ? 8.317   22.099  10.309  1.00 14.74  ? 286  ALA A CB    1 
ATOM   2201  N N     . THR A 1 287 ? 5.921   20.025  10.757  1.00 14.91  ? 287  THR A N     1 
ATOM   2202  C CA    . THR A 1 287 ? 5.168   18.854  10.287  1.00 15.15  ? 287  THR A CA    1 
ATOM   2203  C C     . THR A 1 287 ? 3.664   19.125  10.288  1.00 15.54  ? 287  THR A C     1 
ATOM   2204  O O     . THR A 1 287 ? 2.961   18.806  9.336   1.00 15.63  ? 287  THR A O     1 
ATOM   2205  C CB    . THR A 1 287 ? 5.493   17.611  11.173  1.00 15.40  ? 287  THR A CB    1 
ATOM   2206  O OG1   . THR A 1 287 ? 6.890   17.277  11.053  1.00 15.29  ? 287  THR A OG1   1 
ATOM   2207  C CG2   . THR A 1 287 ? 4.612   16.403  10.809  1.00 14.80  ? 287  THR A CG2   1 
ATOM   2208  N N     . THR A 1 288 ? 3.170   19.714  11.368  1.00 16.04  ? 288  THR A N     1 
ATOM   2209  C CA    . THR A 1 288 ? 1.754   20.009  11.475  1.00 16.09  ? 288  THR A CA    1 
ATOM   2210  C C     . THR A 1 288 ? 1.379   21.151  10.515  1.00 16.74  ? 288  THR A C     1 
ATOM   2211  O O     . THR A 1 288 ? 0.379   21.053  9.797   1.00 16.85  ? 288  THR A O     1 
ATOM   2212  C CB    . THR A 1 288 ? 1.399   20.374  12.907  1.00 16.00  ? 288  THR A CB    1 
ATOM   2213  O OG1   . THR A 1 288 ? 2.305   21.387  13.362  1.00 16.25  ? 288  THR A OG1   1 
ATOM   2214  C CG2   . THR A 1 288 ? 1.518   19.135  13.821  1.00 15.46  ? 288  THR A CG2   1 
ATOM   2215  N N     . PHE A 1 289 ? 2.173   22.224  10.490  1.00 16.93  ? 289  PHE A N     1 
ATOM   2216  C CA    . PHE A 1 289 ? 1.914   23.303  9.550   1.00 18.02  ? 289  PHE A CA    1 
ATOM   2217  C C     . PHE A 1 289 ? 1.815   22.770  8.106   1.00 18.93  ? 289  PHE A C     1 
ATOM   2218  O O     . PHE A 1 289 ? 0.828   23.011  7.428   1.00 18.84  ? 289  PHE A O     1 
ATOM   2219  C CB    . PHE A 1 289 ? 2.953   24.428  9.645   1.00 17.81  ? 289  PHE A CB    1 
ATOM   2220  C CG    . PHE A 1 289 ? 2.900   25.402  8.480   1.00 17.20  ? 289  PHE A CG    1 
ATOM   2221  C CD1   . PHE A 1 289 ? 2.102   26.531  8.538   1.00 14.29  ? 289  PHE A CD1   1 
ATOM   2222  C CD2   . PHE A 1 289 ? 3.641   25.159  7.313   1.00 17.50  ? 289  PHE A CD2   1 
ATOM   2223  C CE1   . PHE A 1 289 ? 2.048   27.406  7.448   1.00 16.66  ? 289  PHE A CE1   1 
ATOM   2224  C CE2   . PHE A 1 289 ? 3.604   26.036  6.222   1.00 15.60  ? 289  PHE A CE2   1 
ATOM   2225  C CZ    . PHE A 1 289 ? 2.806   27.152  6.277   1.00 15.12  ? 289  PHE A CZ    1 
ATOM   2226  N N     . LYS A 1 290 ? 2.828   22.028  7.662   1.00 20.22  ? 290  LYS A N     1 
ATOM   2227  C CA    . LYS A 1 290 ? 2.846   21.501  6.284   1.00 21.07  ? 290  LYS A CA    1 
ATOM   2228  C C     . LYS A 1 290 ? 1.615   20.652  5.964   1.00 21.05  ? 290  LYS A C     1 
ATOM   2229  O O     . LYS A 1 290 ? 0.916   20.929  5.020   1.00 22.25  ? 290  LYS A O     1 
ATOM   2230  C CB    . LYS A 1 290 ? 4.127   20.701  6.006   1.00 21.17  ? 290  LYS A CB    1 
ATOM   2231  C CG    . LYS A 1 290 ? 4.251   20.181  4.539   1.00 22.03  ? 290  LYS A CG    1 
ATOM   2232  C CD    . LYS A 1 290 ? 5.710   20.097  4.072   1.00 21.94  ? 290  LYS A CD    1 
ATOM   2233  C CE    . LYS A 1 290 ? 6.235   18.683  4.094   1.00 23.21  ? 290  LYS A CE    1 
ATOM   2234  N NZ    . LYS A 1 290 ? 7.733   18.601  3.882   1.00 23.03  ? 290  LYS A NZ    1 
ATOM   2235  N N     . TYR A 1 291 ? 1.363   19.631  6.763   1.00 20.83  ? 291  TYR A N     1 
ATOM   2236  C CA    . TYR A 1 291 ? 0.327   18.660  6.477   1.00 20.64  ? 291  TYR A CA    1 
ATOM   2237  C C     . TYR A 1 291 ? -1.096  19.197  6.652   1.00 20.75  ? 291  TYR A C     1 
ATOM   2238  O O     . TYR A 1 291 ? -1.967  18.982  5.772   1.00 20.35  ? 291  TYR A O     1 
ATOM   2239  C CB    . TYR A 1 291 ? 0.544   17.412  7.326   1.00 20.69  ? 291  TYR A CB    1 
ATOM   2240  C CG    . TYR A 1 291 ? 1.726   16.545  6.900   1.00 20.74  ? 291  TYR A CG    1 
ATOM   2241  C CD1   . TYR A 1 291 ? 2.321   15.662  7.802   1.00 21.91  ? 291  TYR A CD1   1 
ATOM   2242  C CD2   . TYR A 1 291 ? 2.237   16.592  5.600   1.00 20.16  ? 291  TYR A CD2   1 
ATOM   2243  C CE1   . TYR A 1 291 ? 3.386   14.841  7.429   1.00 21.09  ? 291  TYR A CE1   1 
ATOM   2244  C CE2   . TYR A 1 291 ? 3.322   15.788  5.211   1.00 20.34  ? 291  TYR A CE2   1 
ATOM   2245  C CZ    . TYR A 1 291 ? 3.882   14.906  6.129   1.00 22.37  ? 291  TYR A CZ    1 
ATOM   2246  O OH    . TYR A 1 291 ? 4.940   14.085  5.759   1.00 22.04  ? 291  TYR A OH    1 
ATOM   2247  N N     . VAL A 1 292 ? -1.321  19.908  7.762   1.00 19.71  ? 292  VAL A N     1 
ATOM   2248  C CA    . VAL A 1 292 ? -2.644  20.417  8.100   1.00 19.09  ? 292  VAL A CA    1 
ATOM   2249  C C     . VAL A 1 292 ? -3.089  21.588  7.192   1.00 19.58  ? 292  VAL A C     1 
ATOM   2250  O O     . VAL A 1 292 ? -4.273  21.685  6.836   1.00 20.32  ? 292  VAL A O     1 
ATOM   2251  C CB    . VAL A 1 292 ? -2.762  20.742  9.632   1.00 19.42  ? 292  VAL A CB    1 
ATOM   2252  C CG1   . VAL A 1 292 ? -4.108  21.364  9.982   1.00 17.52  ? 292  VAL A CG1   1 
ATOM   2253  C CG2   . VAL A 1 292 ? -2.535  19.469  10.465  1.00 17.59  ? 292  VAL A CG2   1 
ATOM   2254  N N     . PHE A 1 293 ? -2.161  22.460  6.811   1.00 18.85  ? 293  PHE A N     1 
ATOM   2255  C CA    . PHE A 1 293 ? -2.478  23.535  5.878   1.00 18.94  ? 293  PHE A CA    1 
ATOM   2256  C C     . PHE A 1 293 ? -2.210  23.158  4.424   1.00 19.93  ? 293  PHE A C     1 
ATOM   2257  O O     . PHE A 1 293 ? -2.406  23.986  3.520   1.00 20.15  ? 293  PHE A O     1 
ATOM   2258  C CB    . PHE A 1 293 ? -1.728  24.814  6.249   1.00 18.60  ? 293  PHE A CB    1 
ATOM   2259  C CG    . PHE A 1 293 ? -2.141  25.372  7.577   1.00 17.80  ? 293  PHE A CG    1 
ATOM   2260  C CD1   . PHE A 1 293 ? -1.228  25.467  8.614   1.00 16.98  ? 293  PHE A CD1   1 
ATOM   2261  C CD2   . PHE A 1 293 ? -3.462  25.744  7.800   1.00 14.95  ? 293  PHE A CD2   1 
ATOM   2262  C CE1   . PHE A 1 293 ? -1.625  25.947  9.863   1.00 18.87  ? 293  PHE A CE1   1 
ATOM   2263  C CE2   . PHE A 1 293 ? -3.876  26.228  9.035   1.00 17.54  ? 293  PHE A CE2   1 
ATOM   2264  C CZ    . PHE A 1 293 ? -2.960  26.342  10.070  1.00 18.32  ? 293  PHE A CZ    1 
ATOM   2265  N N     . ASP A 1 294 ? -1.766  21.912  4.219   1.00 20.22  ? 294  ASP A N     1 
ATOM   2266  C CA    . ASP A 1 294 ? -1.476  21.351  2.910   1.00 20.91  ? 294  ASP A CA    1 
ATOM   2267  C C     . ASP A 1 294 ? -0.530  22.266  2.122   1.00 21.29  ? 294  ASP A C     1 
ATOM   2268  O O     . ASP A 1 294 ? -0.755  22.570  0.944   1.00 20.02  ? 294  ASP A O     1 
ATOM   2269  C CB    . ASP A 1 294 ? -2.773  21.058  2.138   1.00 21.09  ? 294  ASP A CB    1 
ATOM   2270  C CG    . ASP A 1 294 ? -2.566  20.055  1.018   1.00 22.35  ? 294  ASP A CG    1 
ATOM   2271  O OD1   . ASP A 1 294 ? -3.064  20.304  -0.092  1.00 22.73  ? 294  ASP A OD1   1 
ATOM   2272  O OD2   . ASP A 1 294 ? -1.897  19.023  1.241   1.00 21.96  ? 294  ASP A OD2   1 
ATOM   2273  N N     . TYR A 1 295 ? 0.531   22.698  2.798   1.00 21.92  ? 295  TYR A N     1 
ATOM   2274  C CA    . TYR A 1 295 ? 1.370   23.743  2.262   1.00 23.31  ? 295  TYR A CA    1 
ATOM   2275  C C     . TYR A 1 295 ? 2.114   23.272  1.048   1.00 23.12  ? 295  TYR A C     1 
ATOM   2276  O O     . TYR A 1 295 ? 2.819   22.272  1.110   1.00 23.35  ? 295  TYR A O     1 
ATOM   2277  C CB    . TYR A 1 295 ? 2.363   24.296  3.288   1.00 24.54  ? 295  TYR A CB    1 
ATOM   2278  C CG    . TYR A 1 295 ? 3.376   25.218  2.630   1.00 26.65  ? 295  TYR A CG    1 
ATOM   2279  C CD1   . TYR A 1 295 ? 3.059   26.552  2.333   1.00 27.28  ? 295  TYR A CD1   1 
ATOM   2280  C CD2   . TYR A 1 295 ? 4.637   24.742  2.261   1.00 28.39  ? 295  TYR A CD2   1 
ATOM   2281  C CE1   . TYR A 1 295 ? 3.990   27.383  1.698   1.00 28.06  ? 295  TYR A CE1   1 
ATOM   2282  C CE2   . TYR A 1 295 ? 5.560   25.559  1.631   1.00 28.42  ? 295  TYR A CE2   1 
ATOM   2283  C CZ    . TYR A 1 295 ? 5.237   26.870  1.355   1.00 27.75  ? 295  TYR A CZ    1 
ATOM   2284  O OH    . TYR A 1 295 ? 6.197   27.661  0.739   1.00 30.74  ? 295  TYR A OH    1 
ATOM   2285  N N     . HIS A 1 296 ? 1.944   24.010  -0.057  1.00 23.29  ? 296  HIS A N     1 
ATOM   2286  C CA    . HIS A 1 296 ? 2.679   23.771  -1.319  1.00 22.16  ? 296  HIS A CA    1 
ATOM   2287  C C     . HIS A 1 296 ? 3.538   24.995  -1.542  1.00 21.81  ? 296  HIS A C     1 
ATOM   2288  O O     . HIS A 1 296 ? 3.106   26.091  -1.208  1.00 21.51  ? 296  HIS A O     1 
ATOM   2289  C CB    . HIS A 1 296 ? 1.701   23.603  -2.478  1.00 21.48  ? 296  HIS A CB    1 
ATOM   2290  C CG    . HIS A 1 296 ? 0.997   22.275  -2.488  1.00 21.80  ? 296  HIS A CG    1 
ATOM   2291  N ND1   . HIS A 1 296 ? 0.103   21.893  -1.509  1.00 19.40  ? 296  HIS A ND1   1 
ATOM   2292  C CD2   . HIS A 1 296 ? 1.061   21.238  -3.358  1.00 20.99  ? 296  HIS A CD2   1 
ATOM   2293  C CE1   . HIS A 1 296 ? -0.354  20.685  -1.775  1.00 19.38  ? 296  HIS A CE1   1 
ATOM   2294  N NE2   . HIS A 1 296 ? 0.213   20.262  -2.890  1.00 21.22  ? 296  HIS A NE2   1 
ATOM   2295  N N     . PRO A 1 297 ? 4.770   24.827  -2.058  1.00 21.73  ? 297  PRO A N     1 
ATOM   2296  C CA    . PRO A 1 297 ? 5.572   26.042  -2.313  1.00 21.44  ? 297  PRO A CA    1 
ATOM   2297  C C     . PRO A 1 297 ? 4.823   27.087  -3.173  1.00 21.22  ? 297  PRO A C     1 
ATOM   2298  O O     . PRO A 1 297 ? 4.039   26.740  -4.082  1.00 20.52  ? 297  PRO A O     1 
ATOM   2299  C CB    . PRO A 1 297 ? 6.839   25.512  -3.010  1.00 21.91  ? 297  PRO A CB    1 
ATOM   2300  C CG    . PRO A 1 297 ? 6.935   24.035  -2.576  1.00 21.99  ? 297  PRO A CG    1 
ATOM   2301  C CD    . PRO A 1 297 ? 5.496   23.580  -2.399  1.00 21.97  ? 297  PRO A CD    1 
ATOM   2302  N N     . GLY A 1 298 ? 5.027   28.356  -2.829  1.00 21.11  ? 298  GLY A N     1 
ATOM   2303  C CA    . GLY A 1 298 ? 4.273   29.443  -3.427  1.00 21.34  ? 298  GLY A CA    1 
ATOM   2304  C C     . GLY A 1 298 ? 2.989   29.827  -2.696  1.00 21.80  ? 298  GLY A C     1 
ATOM   2305  O O     . GLY A 1 298 ? 2.387   30.865  -3.034  1.00 23.04  ? 298  GLY A O     1 
ATOM   2306  N N     . ASP A 1 299 ? 2.561   29.031  -1.705  1.00 20.64  ? 299  ASP A N     1 
ATOM   2307  C CA    . ASP A 1 299 ? 1.299   29.308  -0.998  1.00 20.11  ? 299  ASP A CA    1 
ATOM   2308  C C     . ASP A 1 299 ? 1.455   30.535  -0.086  1.00 19.55  ? 299  ASP A C     1 
ATOM   2309  O O     . ASP A 1 299 ? 2.367   30.591  0.738   1.00 20.68  ? 299  ASP A O     1 
ATOM   2310  C CB    . ASP A 1 299 ? 0.799   28.095  -0.179  1.00 19.80  ? 299  ASP A CB    1 
ATOM   2311  C CG    . ASP A 1 299 ? 0.190   26.971  -1.042  1.00 20.94  ? 299  ASP A CG    1 
ATOM   2312  O OD1   . ASP A 1 299 ? -0.063  27.171  -2.246  1.00 22.54  ? 299  ASP A OD1   1 
ATOM   2313  O OD2   . ASP A 1 299 ? -0.034  25.858  -0.510  1.00 21.41  ? 299  ASP A OD2   1 
ATOM   2314  N N     . ILE A 1 300 ? 0.588   31.532  -0.243  1.00 18.73  ? 300  ILE A N     1 
ATOM   2315  C CA    . ILE A 1 300 ? 0.609   32.679  0.681   1.00 17.05  ? 300  ILE A CA    1 
ATOM   2316  C C     . ILE A 1 300 ? -0.228  32.329  1.903   1.00 16.34  ? 300  ILE A C     1 
ATOM   2317  O O     . ILE A 1 300 ? -1.384  31.891  1.785   1.00 15.61  ? 300  ILE A O     1 
ATOM   2318  C CB    . ILE A 1 300 ? 0.135   34.014  0.024   1.00 16.90  ? 300  ILE A CB    1 
ATOM   2319  C CG1   . ILE A 1 300 ? 0.806   34.225  -1.347  1.00 17.15  ? 300  ILE A CG1   1 
ATOM   2320  C CG2   . ILE A 1 300 ? 0.352   35.207  0.980   1.00 14.84  ? 300  ILE A CG2   1 
ATOM   2321  C CD1   . ILE A 1 300 ? 2.313   34.467  -1.303  1.00 15.19  ? 300  ILE A CD1   1 
ATOM   2322  N N     . TYR A 1 301 ? 0.378   32.519  3.074   1.00 16.17  ? 301  TYR A N     1 
ATOM   2323  C CA    . TYR A 1 301 ? -0.172  32.031  4.323   1.00 16.15  ? 301  TYR A CA    1 
ATOM   2324  C C     . TYR A 1 301 ? -0.284  33.146  5.345   1.00 16.37  ? 301  TYR A C     1 
ATOM   2325  O O     . TYR A 1 301 ? 0.673   33.914  5.554   1.00 16.63  ? 301  TYR A O     1 
ATOM   2326  C CB    . TYR A 1 301 ? 0.669   30.872  4.862   1.00 15.87  ? 301  TYR A CB    1 
ATOM   2327  C CG    . TYR A 1 301 ? 0.323   30.467  6.277   1.00 16.95  ? 301  TYR A CG    1 
ATOM   2328  C CD1   . TYR A 1 301 ? 1.010   31.010  7.359   1.00 16.57  ? 301  TYR A CD1   1 
ATOM   2329  C CD2   . TYR A 1 301 ? -0.705  29.549  6.537   1.00 15.29  ? 301  TYR A CD2   1 
ATOM   2330  C CE1   . TYR A 1 301 ? 0.692   30.649  8.658   1.00 16.33  ? 301  TYR A CE1   1 
ATOM   2331  C CE2   . TYR A 1 301 ? -1.033  29.194  7.833   1.00 16.11  ? 301  TYR A CE2   1 
ATOM   2332  C CZ    . TYR A 1 301 ? -0.325  29.746  8.884   1.00 16.80  ? 301  TYR A CZ    1 
ATOM   2333  O OH    . TYR A 1 301 ? -0.632  29.389  10.179  1.00 18.77  ? 301  TYR A OH    1 
ATOM   2334  N N     . TRP A 1 302 ? -1.458  33.215  5.974   1.00 16.23  ? 302  TRP A N     1 
ATOM   2335  C CA    . TRP A 1 302 ? -1.778  34.218  6.974   1.00 16.27  ? 302  TRP A CA    1 
ATOM   2336  C C     . TRP A 1 302 ? -2.501  33.630  8.165   1.00 17.13  ? 302  TRP A C     1 
ATOM   2337  O O     . TRP A 1 302 ? -3.681  33.228  8.090   1.00 16.72  ? 302  TRP A O     1 
ATOM   2338  C CB    . TRP A 1 302 ? -2.639  35.330  6.379   1.00 15.94  ? 302  TRP A CB    1 
ATOM   2339  C CG    . TRP A 1 302 ? -2.956  36.480  7.327   1.00 14.62  ? 302  TRP A CG    1 
ATOM   2340  C CD1   . TRP A 1 302 ? -2.226  36.884  8.413   1.00 13.18  ? 302  TRP A CD1   1 
ATOM   2341  C CD2   . TRP A 1 302 ? -4.049  37.409  7.213   1.00 14.65  ? 302  TRP A CD2   1 
ATOM   2342  N NE1   . TRP A 1 302 ? -2.814  37.981  9.000   1.00 13.86  ? 302  TRP A NE1   1 
ATOM   2343  C CE2   . TRP A 1 302 ? -3.938  38.320  8.292   1.00 14.67  ? 302  TRP A CE2   1 
ATOM   2344  C CE3   . TRP A 1 302 ? -5.128  37.539  6.323   1.00 13.68  ? 302  TRP A CE3   1 
ATOM   2345  C CZ2   . TRP A 1 302 ? -4.869  39.348  8.502   1.00 15.64  ? 302  TRP A CZ2   1 
ATOM   2346  C CZ3   . TRP A 1 302 ? -6.054  38.555  6.530   1.00 13.80  ? 302  TRP A CZ3   1 
ATOM   2347  C CH2   . TRP A 1 302 ? -5.916  39.452  7.605   1.00 15.21  ? 302  TRP A CH2   1 
ATOM   2348  N N     . CYS A 1 303 ? -1.767  33.608  9.273   1.00 18.37  ? 303  CYS A N     1 
ATOM   2349  C CA    . CYS A 1 303 ? -2.309  33.347  10.584  1.00 18.28  ? 303  CYS A CA    1 
ATOM   2350  C C     . CYS A 1 303 ? -2.482  34.682  11.297  1.00 18.29  ? 303  CYS A C     1 
ATOM   2351  O O     . CYS A 1 303 ? -1.555  35.500  11.323  1.00 17.59  ? 303  CYS A O     1 
ATOM   2352  C CB    . CYS A 1 303 ? -1.357  32.446  11.340  1.00 18.78  ? 303  CYS A CB    1 
ATOM   2353  S SG    . CYS A 1 303 ? -1.617  32.463  13.102  1.00 20.98  ? 303  CYS A SG    1 
ATOM   2354  N N     . THR A 1 304 ? -3.667  34.901  11.872  1.00 18.32  ? 304  THR A N     1 
ATOM   2355  C CA    . THR A 1 304 ? -3.999  36.203  12.461  1.00 18.97  ? 304  THR A CA    1 
ATOM   2356  C C     . THR A 1 304 ? -3.578  36.366  13.930  1.00 19.68  ? 304  THR A C     1 
ATOM   2357  O O     . THR A 1 304 ? -3.641  37.465  14.479  1.00 19.47  ? 304  THR A O     1 
ATOM   2358  C CB    . THR A 1 304 ? -5.511  36.563  12.303  1.00 19.05  ? 304  THR A CB    1 
ATOM   2359  O OG1   . THR A 1 304 ? -6.310  35.664  13.095  1.00 18.98  ? 304  THR A OG1   1 
ATOM   2360  C CG2   . THR A 1 304 ? -5.936  36.513  10.816  1.00 17.36  ? 304  THR A CG2   1 
ATOM   2361  N N     . ALA A 1 305 ? -3.132  35.276  14.546  1.00 19.80  ? 305  ALA A N     1 
ATOM   2362  C CA    . ALA A 1 305 ? -2.813  35.269  15.967  1.00 20.38  ? 305  ALA A CA    1 
ATOM   2363  C C     . ALA A 1 305 ? -1.697  36.236  16.289  1.00 20.44  ? 305  ALA A C     1 
ATOM   2364  O O     . ALA A 1 305 ? -0.785  36.423  15.496  1.00 20.78  ? 305  ALA A O     1 
ATOM   2365  C CB    . ALA A 1 305 ? -2.402  33.880  16.410  1.00 20.35  ? 305  ALA A CB    1 
ATOM   2366  N N     . ASP A 1 306 ? -1.761  36.825  17.477  1.00 19.99  ? 306  ASP A N     1 
ATOM   2367  C CA    . ASP A 1 306 ? -0.702  37.703  17.914  1.00 19.33  ? 306  ASP A CA    1 
ATOM   2368  C C     . ASP A 1 306 ? 0.553   36.886  18.209  1.00 19.98  ? 306  ASP A C     1 
ATOM   2369  O O     . ASP A 1 306 ? 0.478   35.733  18.652  1.00 20.02  ? 306  ASP A O     1 
ATOM   2370  C CB    . ASP A 1 306 ? -1.137  38.521  19.123  1.00 18.20  ? 306  ASP A CB    1 
ATOM   2371  C CG    . ASP A 1 306 ? -0.275  39.725  19.330  1.00 16.80  ? 306  ASP A CG    1 
ATOM   2372  O OD1   . ASP A 1 306 ? 0.788   39.606  19.975  1.00 16.37  ? 306  ASP A OD1   1 
ATOM   2373  O OD2   . ASP A 1 306 ? -0.643  40.800  18.824  1.00 16.56  ? 306  ASP A OD2   1 
ATOM   2374  N N     . VAL A 1 307 ? 1.704   37.485  17.913  1.00 20.23  ? 307  VAL A N     1 
ATOM   2375  C CA    . VAL A 1 307 ? 3.019   36.938  18.254  1.00 20.17  ? 307  VAL A CA    1 
ATOM   2376  C C     . VAL A 1 307 ? 3.159   36.613  19.764  1.00 20.53  ? 307  VAL A C     1 
ATOM   2377  O O     . VAL A 1 307 ? 3.897   35.705  20.146  1.00 20.32  ? 307  VAL A O     1 
ATOM   2378  C CB    . VAL A 1 307 ? 4.124   37.937  17.773  1.00 20.33  ? 307  VAL A CB    1 
ATOM   2379  C CG1   . VAL A 1 307 ? 4.308   39.090  18.753  1.00 19.24  ? 307  VAL A CG1   1 
ATOM   2380  C CG2   . VAL A 1 307 ? 5.423   37.242  17.503  1.00 21.36  ? 307  VAL A CG2   1 
ATOM   2381  N N     . GLY A 1 308 ? 2.432   37.346  20.610  1.00 20.52  ? 308  GLY A N     1 
ATOM   2382  C CA    . GLY A 1 308 ? 2.498   37.155  22.058  1.00 20.87  ? 308  GLY A CA    1 
ATOM   2383  C C     . GLY A 1 308 ? 1.895   35.861  22.589  1.00 20.81  ? 308  GLY A C     1 
ATOM   2384  O O     . GLY A 1 308 ? 1.956   35.597  23.793  1.00 21.30  ? 308  GLY A O     1 
ATOM   2385  N N     . TRP A 1 309 ? 1.318   35.057  21.701  1.00 20.16  ? 309  TRP A N     1 
ATOM   2386  C CA    . TRP A 1 309 ? 0.649   33.812  22.084  1.00 19.81  ? 309  TRP A CA    1 
ATOM   2387  C C     . TRP A 1 309 ? 1.261   32.648  21.305  1.00 19.63  ? 309  TRP A C     1 
ATOM   2388  O O     . TRP A 1 309 ? 1.830   32.855  20.222  1.00 19.71  ? 309  TRP A O     1 
ATOM   2389  C CB    . TRP A 1 309 ? -0.849  33.866  21.737  1.00 19.45  ? 309  TRP A CB    1 
ATOM   2390  C CG    . TRP A 1 309 ? -1.607  35.040  22.289  1.00 18.93  ? 309  TRP A CG    1 
ATOM   2391  C CD1   . TRP A 1 309 ? -2.365  35.935  21.581  1.00 19.48  ? 309  TRP A CD1   1 
ATOM   2392  C CD2   . TRP A 1 309 ? -1.688  35.436  23.660  1.00 18.66  ? 309  TRP A CD2   1 
ATOM   2393  N NE1   . TRP A 1 309 ? -2.909  36.873  22.437  1.00 20.38  ? 309  TRP A NE1   1 
ATOM   2394  C CE2   . TRP A 1 309 ? -2.501  36.587  23.717  1.00 19.09  ? 309  TRP A CE2   1 
ATOM   2395  C CE3   . TRP A 1 309 ? -1.140  34.932  24.853  1.00 19.28  ? 309  TRP A CE3   1 
ATOM   2396  C CZ2   . TRP A 1 309 ? -2.798  37.228  24.916  1.00 18.47  ? 309  TRP A CZ2   1 
ATOM   2397  C CZ3   . TRP A 1 309 ? -1.422  35.570  26.032  1.00 19.38  ? 309  TRP A CZ3   1 
ATOM   2398  C CH2   . TRP A 1 309 ? -2.251  36.715  26.057  1.00 18.98  ? 309  TRP A CH2   1 
ATOM   2399  N N     . VAL A 1 310 ? 1.081   31.432  21.822  1.00 18.80  ? 310  VAL A N     1 
ATOM   2400  C CA    . VAL A 1 310 ? 1.651   30.234  21.206  1.00 18.43  ? 310  VAL A CA    1 
ATOM   2401  C C     . VAL A 1 310 ? 1.302   30.080  19.713  1.00 18.46  ? 310  VAL A C     1 
ATOM   2402  O O     . VAL A 1 310 ? 2.146   29.620  18.927  1.00 18.27  ? 310  VAL A O     1 
ATOM   2403  C CB    . VAL A 1 310 ? 1.340   28.921  22.034  1.00 18.45  ? 310  VAL A CB    1 
ATOM   2404  C CG1   . VAL A 1 310 ? -0.114  28.447  21.834  1.00 16.10  ? 310  VAL A CG1   1 
ATOM   2405  C CG2   . VAL A 1 310 ? 2.366   27.812  21.722  1.00 16.50  ? 310  VAL A CG2   1 
ATOM   2406  N N     . THR A 1 311 ? 0.076   30.452  19.332  1.00 17.72  ? 311  THR A N     1 
ATOM   2407  C CA    . THR A 1 311 ? -0.346  30.345  17.936  1.00 17.81  ? 311  THR A CA    1 
ATOM   2408  C C     . THR A 1 311 ? 0.580   31.195  17.075  1.00 17.93  ? 311  THR A C     1 
ATOM   2409  O O     . THR A 1 311 ? 0.973   30.782  15.978  1.00 18.24  ? 311  THR A O     1 
ATOM   2410  C CB    . THR A 1 311 ? -1.863  30.721  17.710  1.00 17.70  ? 311  THR A CB    1 
ATOM   2411  O OG1   . THR A 1 311 ? -2.694  29.893  18.521  1.00 17.26  ? 311  THR A OG1   1 
ATOM   2412  C CG2   . THR A 1 311 ? -2.290  30.496  16.259  1.00 16.59  ? 311  THR A CG2   1 
ATOM   2413  N N     . GLY A 1 312 ? 0.955   32.356  17.604  1.00 17.58  ? 312  GLY A N     1 
ATOM   2414  C CA    . GLY A 1 312 ? 1.859   33.270  16.930  1.00 18.30  ? 312  GLY A CA    1 
ATOM   2415  C C     . GLY A 1 312 ? 3.279   32.738  16.866  1.00 19.17  ? 312  GLY A C     1 
ATOM   2416  O O     . GLY A 1 312 ? 4.020   33.061  15.950  1.00 19.86  ? 312  GLY A O     1 
ATOM   2417  N N     . HIS A 1 313 ? 3.677   31.926  17.837  1.00 18.97  ? 313  HIS A N     1 
ATOM   2418  C CA    . HIS A 1 313 ? 5.022   31.330  17.812  1.00 18.97  ? 313  HIS A CA    1 
ATOM   2419  C C     . HIS A 1 313 ? 5.078   30.244  16.759  1.00 19.12  ? 313  HIS A C     1 
ATOM   2420  O O     . HIS A 1 313 ? 5.882   30.312  15.821  1.00 19.72  ? 313  HIS A O     1 
ATOM   2421  C CB    . HIS A 1 313 ? 5.388   30.753  19.191  1.00 18.69  ? 313  HIS A CB    1 
ATOM   2422  C CG    . HIS A 1 313 ? 5.600   31.803  20.238  1.00 18.23  ? 313  HIS A CG    1 
ATOM   2423  N ND1   . HIS A 1 313 ? 6.532   31.672  21.250  1.00 18.39  ? 313  HIS A ND1   1 
ATOM   2424  C CD2   . HIS A 1 313 ? 5.013   33.012  20.418  1.00 14.48  ? 313  HIS A CD2   1 
ATOM   2425  C CE1   . HIS A 1 313 ? 6.510   32.756  22.009  1.00 16.41  ? 313  HIS A CE1   1 
ATOM   2426  N NE2   . HIS A 1 313 ? 5.596   33.581  21.527  1.00 17.14  ? 313  HIS A NE2   1 
ATOM   2427  N N     . SER A 1 314 ? 4.200   29.256  16.911  1.00 18.37  ? 314  SER A N     1 
ATOM   2428  C CA    . SER A 1 314 ? 4.268   28.036  16.138  1.00 17.90  ? 314  SER A CA    1 
ATOM   2429  C C     . SER A 1 314 ? 3.749   28.226  14.735  1.00 18.02  ? 314  SER A C     1 
ATOM   2430  O O     . SER A 1 314 ? 4.287   27.619  13.807  1.00 17.52  ? 314  SER A O     1 
ATOM   2431  C CB    . SER A 1 314 ? 3.469   26.928  16.825  1.00 17.42  ? 314  SER A CB    1 
ATOM   2432  O OG    . SER A 1 314 ? 3.981   26.692  18.124  1.00 18.61  ? 314  SER A OG    1 
ATOM   2433  N N     . TYR A 1 315 ? 2.707   29.046  14.574  1.00 17.76  ? 315  TYR A N     1 
ATOM   2434  C CA    . TYR A 1 315 ? 2.031   29.126  13.273  1.00 18.14  ? 315  TYR A CA    1 
ATOM   2435  C C     . TYR A 1 315 ? 1.992   30.486  12.571  1.00 18.76  ? 315  TYR A C     1 
ATOM   2436  O O     . TYR A 1 315 ? 1.438   30.601  11.485  1.00 19.61  ? 315  TYR A O     1 
ATOM   2437  C CB    . TYR A 1 315 ? 0.653   28.449  13.339  1.00 17.49  ? 315  TYR A CB    1 
ATOM   2438  C CG    . TYR A 1 315 ? 0.768   27.003  13.802  1.00 16.68  ? 315  TYR A CG    1 
ATOM   2439  C CD1   . TYR A 1 315 ? 0.415   26.641  15.111  1.00 14.61  ? 315  TYR A CD1   1 
ATOM   2440  C CD2   . TYR A 1 315 ? 1.267   26.007  12.947  1.00 14.37  ? 315  TYR A CD2   1 
ATOM   2441  C CE1   . TYR A 1 315 ? 0.564   25.319  15.561  1.00 15.15  ? 315  TYR A CE1   1 
ATOM   2442  C CE2   . TYR A 1 315 ? 1.397   24.672  13.381  1.00 14.63  ? 315  TYR A CE2   1 
ATOM   2443  C CZ    . TYR A 1 315 ? 1.055   24.352  14.697  1.00 15.97  ? 315  TYR A CZ    1 
ATOM   2444  O OH    . TYR A 1 315 ? 1.147   23.072  15.146  1.00 15.75  ? 315  TYR A OH    1 
ATOM   2445  N N     . LEU A 1 316 ? 2.586   31.510  13.169  1.00 19.24  ? 316  LEU A N     1 
ATOM   2446  C CA    . LEU A 1 316 ? 2.886   32.716  12.410  1.00 19.29  ? 316  LEU A CA    1 
ATOM   2447  C C     . LEU A 1 316 ? 4.335   32.650  11.956  1.00 19.57  ? 316  LEU A C     1 
ATOM   2448  O O     . LEU A 1 316 ? 4.638   32.977  10.811  1.00 19.32  ? 316  LEU A O     1 
ATOM   2449  C CB    . LEU A 1 316 ? 2.666   33.950  13.274  1.00 19.78  ? 316  LEU A CB    1 
ATOM   2450  C CG    . LEU A 1 316 ? 2.502   35.383  12.772  1.00 21.65  ? 316  LEU A CG    1 
ATOM   2451  C CD1   . LEU A 1 316 ? 3.018   36.287  13.900  1.00 23.13  ? 316  LEU A CD1   1 
ATOM   2452  C CD2   . LEU A 1 316 ? 3.236   35.695  11.466  1.00 23.38  ? 316  LEU A CD2   1 
ATOM   2453  N N     . LEU A 1 317 ? 5.230   32.221  12.859  1.00 19.70  ? 317  LEU A N     1 
ATOM   2454  C CA    . LEU A 1 317 ? 6.676   32.288  12.625  1.00 20.05  ? 317  LEU A CA    1 
ATOM   2455  C C     . LEU A 1 317 ? 7.348   30.935  12.431  1.00 19.75  ? 317  LEU A C     1 
ATOM   2456  O O     . LEU A 1 317 ? 7.791   30.624  11.329  1.00 19.36  ? 317  LEU A O     1 
ATOM   2457  C CB    . LEU A 1 317 ? 7.388   33.083  13.731  1.00 20.65  ? 317  LEU A CB    1 
ATOM   2458  C CG    . LEU A 1 317 ? 6.893   34.514  13.946  1.00 23.31  ? 317  LEU A CG    1 
ATOM   2459  C CD1   . LEU A 1 317 ? 7.670   35.178  15.051  1.00 25.73  ? 317  LEU A CD1   1 
ATOM   2460  C CD2   . LEU A 1 317 ? 7.004   35.360  12.663  1.00 26.52  ? 317  LEU A CD2   1 
ATOM   2461  N N     . TYR A 1 318 ? 7.407   30.119  13.480  1.00 19.58  ? 318  TYR A N     1 
ATOM   2462  C CA    . TYR A 1 318 ? 8.270   28.937  13.419  1.00 19.94  ? 318  TYR A CA    1 
ATOM   2463  C C     . TYR A 1 318 ? 7.901   27.839  12.400  1.00 19.67  ? 318  TYR A C     1 
ATOM   2464  O O     . TYR A 1 318 ? 8.743   27.452  11.584  1.00 19.68  ? 318  TYR A O     1 
ATOM   2465  C CB    . TYR A 1 318 ? 8.596   28.400  14.817  1.00 19.92  ? 318  TYR A CB    1 
ATOM   2466  C CG    . TYR A 1 318 ? 9.353   29.419  15.651  1.00 20.65  ? 318  TYR A CG    1 
ATOM   2467  C CD1   . TYR A 1 318 ? 10.352  30.214  15.076  1.00 20.16  ? 318  TYR A CD1   1 
ATOM   2468  C CD2   . TYR A 1 318 ? 9.072   29.596  17.018  1.00 20.38  ? 318  TYR A CD2   1 
ATOM   2469  C CE1   . TYR A 1 318 ? 11.049  31.155  15.841  1.00 20.85  ? 318  TYR A CE1   1 
ATOM   2470  C CE2   . TYR A 1 318 ? 9.777   30.516  17.784  1.00 18.14  ? 318  TYR A CE2   1 
ATOM   2471  C CZ    . TYR A 1 318 ? 10.761  31.291  17.191  1.00 19.90  ? 318  TYR A CZ    1 
ATOM   2472  O OH    . TYR A 1 318 ? 11.448  32.229  17.927  1.00 21.53  ? 318  TYR A OH    1 
ATOM   2473  N N     . GLY A 1 319 ? 6.659   27.365  12.422  1.00 19.63  ? 319  GLY A N     1 
ATOM   2474  C CA    . GLY A 1 319 ? 6.198   26.360  11.451  1.00 18.59  ? 319  GLY A CA    1 
ATOM   2475  C C     . GLY A 1 319 ? 6.374   26.825  10.008  1.00 18.23  ? 319  GLY A C     1 
ATOM   2476  O O     . GLY A 1 319 ? 7.025   26.150  9.217   1.00 18.05  ? 319  GLY A O     1 
ATOM   2477  N N     . PRO A 1 320 ? 5.785   27.985  9.662   1.00 17.90  ? 320  PRO A N     1 
ATOM   2478  C CA    . PRO A 1 320 ? 5.891   28.552  8.332   1.00 17.70  ? 320  PRO A CA    1 
ATOM   2479  C C     . PRO A 1 320 ? 7.321   28.742  7.846   1.00 17.68  ? 320  PRO A C     1 
ATOM   2480  O O     . PRO A 1 320 ? 7.647   28.297  6.739   1.00 17.55  ? 320  PRO A O     1 
ATOM   2481  C CB    . PRO A 1 320 ? 5.181   29.909  8.473   1.00 17.74  ? 320  PRO A CB    1 
ATOM   2482  C CG    . PRO A 1 320 ? 4.202   29.697  9.552   1.00 18.52  ? 320  PRO A CG    1 
ATOM   2483  C CD    . PRO A 1 320 ? 4.912   28.803  10.527  1.00 17.98  ? 320  PRO A CD    1 
ATOM   2484  N N     . LEU A 1 321 ? 8.152   29.416  8.647   1.00 17.45  ? 321  LEU A N     1 
ATOM   2485  C CA    . LEU A 1 321 ? 9.507   29.733  8.226   1.00 17.08  ? 321  LEU A CA    1 
ATOM   2486  C C     . LEU A 1 321 ? 10.378  28.493  8.060   1.00 17.15  ? 321  LEU A C     1 
ATOM   2487  O O     . LEU A 1 321 ? 11.111  28.392  7.075   1.00 17.15  ? 321  LEU A O     1 
ATOM   2488  C CB    . LEU A 1 321 ? 10.159  30.784  9.118   1.00 16.78  ? 321  LEU A CB    1 
ATOM   2489  C CG    . LEU A 1 321 ? 9.503   32.190  9.114   1.00 17.34  ? 321  LEU A CG    1 
ATOM   2490  C CD1   . LEU A 1 321 ? 10.233  33.126  10.075  1.00 14.38  ? 321  LEU A CD1   1 
ATOM   2491  C CD2   . LEU A 1 321 ? 9.375   32.837  7.717   1.00 14.51  ? 321  LEU A CD2   1 
ATOM   2492  N N     . ALA A 1 322 ? 10.257  27.531  8.977   1.00 16.71  ? 322  ALA A N     1 
ATOM   2493  C CA    . ALA A 1 322 ? 10.965  26.265  8.832   1.00 16.67  ? 322  ALA A CA    1 
ATOM   2494  C C     . ALA A 1 322 ? 10.639  25.631  7.494   1.00 16.95  ? 322  ALA A C     1 
ATOM   2495  O O     . ALA A 1 322 ? 11.489  24.973  6.900   1.00 17.41  ? 322  ALA A O     1 
ATOM   2496  C CB    . ALA A 1 322 ? 10.615  25.309  9.956   1.00 16.43  ? 322  ALA A CB    1 
ATOM   2497  N N     . CYS A 1 323 ? 9.410   25.833  7.024   1.00 17.09  ? 323  CYS A N     1 
ATOM   2498  C CA    . CYS A 1 323 ? 8.926   25.166  5.825   1.00 17.64  ? 323  CYS A CA    1 
ATOM   2499  C C     . CYS A 1 323 ? 9.224   25.953  4.561   1.00 17.88  ? 323  CYS A C     1 
ATOM   2500  O O     . CYS A 1 323 ? 8.953   25.464  3.457   1.00 17.84  ? 323  CYS A O     1 
ATOM   2501  C CB    . CYS A 1 323 ? 7.422   24.866  5.926   1.00 17.34  ? 323  CYS A CB    1 
ATOM   2502  S SG    . CYS A 1 323 ? 7.022   23.349  6.814   1.00 18.46  ? 323  CYS A SG    1 
ATOM   2503  N N     . GLY A 1 324 ? 9.802   27.150  4.729   1.00 18.61  ? 324  GLY A N     1 
ATOM   2504  C CA    . GLY A 1 324 ? 10.204  28.017  3.607   1.00 18.16  ? 324  GLY A CA    1 
ATOM   2505  C C     . GLY A 1 324 ? 9.017   28.765  3.041   1.00 18.81  ? 324  GLY A C     1 
ATOM   2506  O O     . GLY A 1 324 ? 9.021   29.166  1.869   1.00 19.58  ? 324  GLY A O     1 
ATOM   2507  N N     . ALA A 1 325 ? 7.990   28.960  3.868   1.00 18.52  ? 325  ALA A N     1 
ATOM   2508  C CA    . ALA A 1 325 ? 6.763   29.645  3.435   1.00 18.36  ? 325  ALA A CA    1 
ATOM   2509  C C     . ALA A 1 325 ? 6.826   31.181  3.432   1.00 18.43  ? 325  ALA A C     1 
ATOM   2510  O O     . ALA A 1 325 ? 7.690   31.784  4.064   1.00 19.06  ? 325  ALA A O     1 
ATOM   2511  C CB    . ALA A 1 325 ? 5.582   29.178  4.280   1.00 18.07  ? 325  ALA A CB    1 
ATOM   2512  N N     . THR A 1 326 ? 5.893   31.804  2.719   1.00 18.56  ? 326  THR A N     1 
ATOM   2513  C CA    . THR A 1 326 ? 5.628   33.212  2.888   1.00 19.11  ? 326  THR A CA    1 
ATOM   2514  C C     . THR A 1 326 ? 4.520   33.289  3.917   1.00 19.45  ? 326  THR A C     1 
ATOM   2515  O O     . THR A 1 326 ? 3.428   32.706  3.736   1.00 19.64  ? 326  THR A O     1 
ATOM   2516  C CB    . THR A 1 326 ? 5.199   33.921  1.595   1.00 18.98  ? 326  THR A CB    1 
ATOM   2517  O OG1   . THR A 1 326 ? 6.242   33.801  0.625   1.00 20.95  ? 326  THR A OG1   1 
ATOM   2518  C CG2   . THR A 1 326 ? 4.947   35.410  1.857   1.00 18.07  ? 326  THR A CG2   1 
ATOM   2519  N N     . THR A 1 327 ? 4.826   33.979  5.011   1.00 18.33  ? 327  THR A N     1 
ATOM   2520  C CA    . THR A 1 327 ? 3.884   34.116  6.098   1.00 17.81  ? 327  THR A CA    1 
ATOM   2521  C C     . THR A 1 327 ? 3.549   35.594  6.265   1.00 17.86  ? 327  THR A C     1 
ATOM   2522  O O     . THR A 1 327 ? 4.415   36.444  6.137   1.00 17.41  ? 327  THR A O     1 
ATOM   2523  C CB    . THR A 1 327 ? 4.408   33.468  7.400   1.00 17.09  ? 327  THR A CB    1 
ATOM   2524  O OG1   . THR A 1 327 ? 3.393   33.550  8.393   1.00 17.09  ? 327  THR A OG1   1 
ATOM   2525  C CG2   . THR A 1 327 ? 5.649   34.159  7.918   1.00 16.46  ? 327  THR A CG2   1 
ATOM   2526  N N     . LEU A 1 328 ? 2.276   35.892  6.496   1.00 18.35  ? 328  LEU A N     1 
ATOM   2527  C CA    . LEU A 1 328 ? 1.823   37.276  6.574   1.00 18.68  ? 328  LEU A CA    1 
ATOM   2528  C C     . LEU A 1 328 ? 1.691   37.693  8.018   1.00 18.77  ? 328  LEU A C     1 
ATOM   2529  O O     . LEU A 1 328 ? 1.093   36.978  8.826   1.00 19.42  ? 328  LEU A O     1 
ATOM   2530  C CB    . LEU A 1 328 ? 0.480   37.461  5.863   1.00 18.64  ? 328  LEU A CB    1 
ATOM   2531  C CG    . LEU A 1 328 ? 0.096   38.921  5.507   1.00 19.28  ? 328  LEU A CG    1 
ATOM   2532  C CD1   . LEU A 1 328 ? -0.900  38.931  4.387   1.00 18.67  ? 328  LEU A CD1   1 
ATOM   2533  C CD2   . LEU A 1 328 ? -0.454  39.734  6.691   1.00 16.83  ? 328  LEU A CD2   1 
ATOM   2534  N N     . MET A 1 329 ? 2.256   38.852  8.330   1.00 18.95  ? 329  MET A N     1 
ATOM   2535  C CA    . MET A 1 329 ? 2.143   39.467  9.645   1.00 19.28  ? 329  MET A CA    1 
ATOM   2536  C C     . MET A 1 329 ? 1.334   40.755  9.510   1.00 18.23  ? 329  MET A C     1 
ATOM   2537  O O     . MET A 1 329 ? 1.756   41.711  8.871   1.00 18.07  ? 329  MET A O     1 
ATOM   2538  C CB    . MET A 1 329 ? 3.524   39.740  10.254  1.00 18.75  ? 329  MET A CB    1 
ATOM   2539  C CG    . MET A 1 329 ? 3.464   40.300  11.669  1.00 19.81  ? 329  MET A CG    1 
ATOM   2540  S SD    . MET A 1 329 ? 5.015   40.972  12.333  1.00 23.67  ? 329  MET A SD    1 
ATOM   2541  C CE    . MET A 1 329 ? 5.693   39.549  13.174  1.00 19.40  ? 329  MET A CE    1 
ATOM   2542  N N     . PHE A 1 330 ? 0.151   40.749  10.100  1.00 17.74  ? 330  PHE A N     1 
ATOM   2543  C CA    . PHE A 1 330 ? -0.760  41.884  10.042  1.00 17.36  ? 330  PHE A CA    1 
ATOM   2544  C C     . PHE A 1 330 ? -0.641  42.689  11.334  1.00 17.31  ? 330  PHE A C     1 
ATOM   2545  O O     . PHE A 1 330 ? -0.742  42.130  12.440  1.00 17.32  ? 330  PHE A O     1 
ATOM   2546  C CB    . PHE A 1 330 ? -2.185  41.369  9.843   1.00 16.95  ? 330  PHE A CB    1 
ATOM   2547  C CG    . PHE A 1 330 ? -3.223  42.432  9.843   1.00 17.38  ? 330  PHE A CG    1 
ATOM   2548  C CD1   . PHE A 1 330 ? -3.049  43.609  9.102   1.00 17.33  ? 330  PHE A CD1   1 
ATOM   2549  C CD2   . PHE A 1 330 ? -4.400  42.257  10.570  1.00 17.78  ? 330  PHE A CD2   1 
ATOM   2550  C CE1   . PHE A 1 330 ? -4.019  44.614  9.085   1.00 15.26  ? 330  PHE A CE1   1 
ATOM   2551  C CE2   . PHE A 1 330 ? -5.377  43.242  10.559  1.00 18.89  ? 330  PHE A CE2   1 
ATOM   2552  C CZ    . PHE A 1 330 ? -5.188  44.426  9.802   1.00 17.09  ? 330  PHE A CZ    1 
ATOM   2553  N N     . GLU A 1 331 ? -0.413  43.992  11.185  1.00 17.11  ? 331  GLU A N     1 
ATOM   2554  C CA    . GLU A 1 331 ? -0.241  44.891  12.324  1.00 17.27  ? 331  GLU A CA    1 
ATOM   2555  C C     . GLU A 1 331 ? -1.544  45.200  13.096  1.00 17.84  ? 331  GLU A C     1 
ATOM   2556  O O     . GLU A 1 331 ? -1.501  45.533  14.287  1.00 17.13  ? 331  GLU A O     1 
ATOM   2557  C CB    . GLU A 1 331 ? 0.406   46.184  11.866  1.00 16.88  ? 331  GLU A CB    1 
ATOM   2558  C CG    . GLU A 1 331 ? 0.783   47.099  13.002  1.00 17.25  ? 331  GLU A CG    1 
ATOM   2559  C CD    . GLU A 1 331 ? 1.312   48.451  12.545  1.00 18.46  ? 331  GLU A CD    1 
ATOM   2560  O OE1   . GLU A 1 331 ? 0.780   49.037  11.575  1.00 16.38  ? 331  GLU A OE1   1 
ATOM   2561  O OE2   . GLU A 1 331 ? 2.268   48.936  13.184  1.00 20.53  ? 331  GLU A OE2   1 
ATOM   2562  N N     . GLY A 1 332 ? -2.689  45.098  12.419  1.00 18.04  ? 332  GLY A N     1 
ATOM   2563  C CA    . GLY A 1 332 ? -3.929  45.640  12.972  1.00 19.10  ? 332  GLY A CA    1 
ATOM   2564  C C     . GLY A 1 332 ? -4.962  44.659  13.490  1.00 19.25  ? 332  GLY A C     1 
ATOM   2565  O O     . GLY A 1 332 ? -4.627  43.652  14.104  1.00 19.42  ? 332  GLY A O     1 
ATOM   2566  N N     . VAL A 1 333 ? -6.219  44.994  13.233  1.00 19.59  ? 333  VAL A N     1 
ATOM   2567  C CA    . VAL A 1 333 ? -7.401  44.248  13.667  1.00 19.97  ? 333  VAL A CA    1 
ATOM   2568  C C     . VAL A 1 333 ? -8.208  43.926  12.394  1.00 19.53  ? 333  VAL A C     1 
ATOM   2569  O O     . VAL A 1 333 ? -8.385  44.791  11.551  1.00 18.95  ? 333  VAL A O     1 
ATOM   2570  C CB    . VAL A 1 333 ? -8.316  45.106  14.608  1.00 20.44  ? 333  VAL A CB    1 
ATOM   2571  C CG1   . VAL A 1 333 ? -8.849  44.251  15.743  1.00 21.28  ? 333  VAL A CG1   1 
ATOM   2572  C CG2   . VAL A 1 333 ? -7.575  46.316  15.148  1.00 21.55  ? 333  VAL A CG2   1 
ATOM   2573  N N     . PRO A 1 334 ? -8.693  42.686  12.258  1.00 19.90  ? 334  PRO A N     1 
ATOM   2574  C CA    . PRO A 1 334 ? -9.329  42.203  11.019  1.00 19.98  ? 334  PRO A CA    1 
ATOM   2575  C C     . PRO A 1 334 ? -10.603 42.959  10.608  1.00 19.94  ? 334  PRO A C     1 
ATOM   2576  O O     . PRO A 1 334 ? -11.130 42.712  9.517   1.00 19.86  ? 334  PRO A O     1 
ATOM   2577  C CB    . PRO A 1 334 ? -9.693  40.734  11.355  1.00 20.37  ? 334  PRO A CB    1 
ATOM   2578  C CG    . PRO A 1 334 ? -8.801  40.365  12.510  1.00 20.60  ? 334  PRO A CG    1 
ATOM   2579  C CD    . PRO A 1 334 ? -8.645  41.636  13.299  1.00 19.62  ? 334  PRO A CD    1 
ATOM   2580  N N     . ASN A 1 335 ? -11.080 43.862  11.466  1.00 18.93  ? 335  ASN A N     1 
ATOM   2581  C CA    . ASN A 1 335 ? -12.326 44.588  11.211  1.00 18.04  ? 335  ASN A CA    1 
ATOM   2582  C C     . ASN A 1 335 ? -12.207 46.108  11.314  1.00 17.61  ? 335  ASN A C     1 
ATOM   2583  O O     . ASN A 1 335 ? -13.210 46.818  11.481  1.00 16.72  ? 335  ASN A O     1 
ATOM   2584  C CB    . ASN A 1 335 ? -13.484 44.066  12.086  1.00 17.41  ? 335  ASN A CB    1 
ATOM   2585  C CG    . ASN A 1 335 ? -13.255 44.259  13.595  1.00 17.93  ? 335  ASN A CG    1 
ATOM   2586  O OD1   . ASN A 1 335 ? -14.159 44.007  14.386  1.00 19.20  ? 335  ASN A OD1   1 
ATOM   2587  N ND2   . ASN A 1 335 ? -12.068 44.691  13.990  1.00 14.83  ? 335  ASN A ND2   1 
ATOM   2588  N N     . TRP A 1 336 ? -10.978 46.600  11.197  1.00 17.29  ? 336  TRP A N     1 
ATOM   2589  C CA    . TRP A 1 336 ? -10.740 48.039  11.208  1.00 16.69  ? 336  TRP A CA    1 
ATOM   2590  C C     . TRP A 1 336 ? -9.893  48.421  9.994   1.00 16.41  ? 336  TRP A C     1 
ATOM   2591  O O     . TRP A 1 336 ? -8.908  47.717  9.689   1.00 16.02  ? 336  TRP A O     1 
ATOM   2592  C CB    . TRP A 1 336 ? -10.072 48.476  12.521  1.00 16.46  ? 336  TRP A CB    1 
ATOM   2593  C CG    . TRP A 1 336 ? -10.012 49.974  12.682  1.00 17.56  ? 336  TRP A CG    1 
ATOM   2594  C CD1   . TRP A 1 336 ? -10.905 50.772  13.359  1.00 16.68  ? 336  TRP A CD1   1 
ATOM   2595  C CD2   . TRP A 1 336 ? -9.025  50.860  12.130  1.00 16.95  ? 336  TRP A CD2   1 
ATOM   2596  N NE1   . TRP A 1 336 ? -10.532 52.088  13.253  1.00 16.43  ? 336  TRP A NE1   1 
ATOM   2597  C CE2   . TRP A 1 336 ? -9.379  52.169  12.513  1.00 16.36  ? 336  TRP A CE2   1 
ATOM   2598  C CE3   . TRP A 1 336 ? -7.869  50.672  11.360  1.00 18.11  ? 336  TRP A CE3   1 
ATOM   2599  C CZ2   . TRP A 1 336 ? -8.613  53.284  12.155  1.00 16.46  ? 336  TRP A CZ2   1 
ATOM   2600  C CZ3   . TRP A 1 336 ? -7.113  51.785  10.994  1.00 15.88  ? 336  TRP A CZ3   1 
ATOM   2601  C CH2   . TRP A 1 336 ? -7.490  53.068  11.392  1.00 16.89  ? 336  TRP A CH2   1 
ATOM   2602  N N     . PRO A 1 337 ? -10.251 49.535  9.305   1.00 15.79  ? 337  PRO A N     1 
ATOM   2603  C CA    . PRO A 1 337 ? -11.352 50.465  9.592   1.00 16.06  ? 337  PRO A CA    1 
ATOM   2604  C C     . PRO A 1 337 ? -12.777 49.944  9.370   1.00 16.40  ? 337  PRO A C     1 
ATOM   2605  O O     . PRO A 1 337 ? -13.705 50.536  9.895   1.00 16.55  ? 337  PRO A O     1 
ATOM   2606  C CB    . PRO A 1 337 ? -11.106 51.643  8.631   1.00 16.10  ? 337  PRO A CB    1 
ATOM   2607  C CG    . PRO A 1 337 ? -9.934  51.294  7.805   1.00 15.18  ? 337  PRO A CG    1 
ATOM   2608  C CD    . PRO A 1 337 ? -9.482  49.926  8.114   1.00 15.59  ? 337  PRO A CD    1 
ATOM   2609  N N     . THR A 1 338 ? -12.943 48.896  8.565   1.00 16.40  ? 338  THR A N     1 
ATOM   2610  C CA    . THR A 1 338 ? -14.270 48.338  8.224   1.00 16.52  ? 338  THR A CA    1 
ATOM   2611  C C     . THR A 1 338 ? -14.230 46.817  8.401   1.00 16.00  ? 338  THR A C     1 
ATOM   2612  O O     . THR A 1 338 ? -13.160 46.231  8.341   1.00 16.01  ? 338  THR A O     1 
ATOM   2613  C CB    . THR A 1 338 ? -14.691 48.632  6.751   1.00 16.18  ? 338  THR A CB    1 
ATOM   2614  O OG1   . THR A 1 338 ? -13.931 47.808  5.865   1.00 17.88  ? 338  THR A OG1   1 
ATOM   2615  C CG2   . THR A 1 338 ? -14.501 50.104  6.364   1.00 16.46  ? 338  THR A CG2   1 
ATOM   2616  N N     . PRO A 1 339 ? -15.392 46.174  8.608   1.00 15.92  ? 339  PRO A N     1 
ATOM   2617  C CA    . PRO A 1 339 ? -15.457 44.714  8.759   1.00 15.53  ? 339  PRO A CA    1 
ATOM   2618  C C     . PRO A 1 339 ? -14.896 43.934  7.547   1.00 15.94  ? 339  PRO A C     1 
ATOM   2619  O O     . PRO A 1 339 ? -14.574 42.734  7.684   1.00 16.70  ? 339  PRO A O     1 
ATOM   2620  C CB    . PRO A 1 339 ? -16.959 44.445  8.887   1.00 15.55  ? 339  PRO A CB    1 
ATOM   2621  C CG    . PRO A 1 339 ? -17.555 45.732  9.321   1.00 15.55  ? 339  PRO A CG    1 
ATOM   2622  C CD    . PRO A 1 339 ? -16.727 46.798  8.706   1.00 16.00  ? 339  PRO A CD    1 
ATOM   2623  N N     . ALA A 1 340 ? -14.770 44.595  6.389   1.00 14.90  ? 340  ALA A N     1 
ATOM   2624  C CA    . ALA A 1 340 ? -14.146 43.983  5.187   1.00 14.73  ? 340  ALA A CA    1 
ATOM   2625  C C     . ALA A 1 340 ? -12.622 43.902  5.225   1.00 14.42  ? 340  ALA A C     1 
ATOM   2626  O O     . ALA A 1 340 ? -12.013 43.361  4.291   1.00 14.04  ? 340  ALA A O     1 
ATOM   2627  C CB    . ALA A 1 340 ? -14.574 44.721  3.904   1.00 14.81  ? 340  ALA A CB    1 
ATOM   2628  N N     . ARG A 1 341 ? -11.998 44.420  6.287   1.00 14.04  ? 341  ARG A N     1 
ATOM   2629  C CA    . ARG A 1 341 ? -10.540 44.506  6.305   1.00 14.40  ? 341  ARG A CA    1 
ATOM   2630  C C     . ARG A 1 341 ? -9.857  43.161  6.033   1.00 15.11  ? 341  ARG A C     1 
ATOM   2631  O O     . ARG A 1 341 ? -8.992  43.065  5.136   1.00 16.08  ? 341  ARG A O     1 
ATOM   2632  C CB    . ARG A 1 341 ? -10.005 45.151  7.584   1.00 13.80  ? 341  ARG A CB    1 
ATOM   2633  C CG    . ARG A 1 341 ? -8.479  45.383  7.539   1.00 13.60  ? 341  ARG A CG    1 
ATOM   2634  C CD    . ARG A 1 341 ? -8.123  46.469  6.499   1.00 14.13  ? 341  ARG A CD    1 
ATOM   2635  N NE    . ARG A 1 341 ? -6.680  46.617  6.260   1.00 16.20  ? 341  ARG A NE    1 
ATOM   2636  C CZ    . ARG A 1 341 ? -5.827  47.246  7.072   1.00 13.66  ? 341  ARG A CZ    1 
ATOM   2637  N NH1   . ARG A 1 341 ? -6.254  47.789  8.201   1.00 15.69  ? 341  ARG A NH1   1 
ATOM   2638  N NH2   . ARG A 1 341 ? -4.536  47.320  6.755   1.00 13.44  ? 341  ARG A NH2   1 
ATOM   2639  N N     . MET A 1 342 ? -10.249 42.137  6.789   1.00 15.22  ? 342  MET A N     1 
ATOM   2640  C CA    . MET A 1 342 ? -9.638  40.814  6.688   1.00 15.87  ? 342  MET A CA    1 
ATOM   2641  C C     . MET A 1 342 ? -9.596  40.300  5.255   1.00 16.14  ? 342  MET A C     1 
ATOM   2642  O O     . MET A 1 342 ? -8.538  39.898  4.762   1.00 16.60  ? 342  MET A O     1 
ATOM   2643  C CB    . MET A 1 342 ? -10.343 39.791  7.598   1.00 15.95  ? 342  MET A CB    1 
ATOM   2644  C CG    . MET A 1 342 ? -9.615  38.442  7.634   1.00 13.65  ? 342  MET A CG    1 
ATOM   2645  S SD    . MET A 1 342 ? -10.435 37.195  8.633   1.00 16.13  ? 342  MET A SD    1 
ATOM   2646  C CE    . MET A 1 342 ? -11.819 36.687  7.593   1.00 16.51  ? 342  MET A CE    1 
ATOM   2647  N N     . CYS A 1 343 ? -10.742 40.352  4.582   1.00 16.91  ? 343  CYS A N     1 
ATOM   2648  C CA    . CYS A 1 343 ? -10.852 39.922  3.178   1.00 16.93  ? 343  CYS A CA    1 
ATOM   2649  C C     . CYS A 1 343 ? -10.172 40.861  2.182   1.00 17.06  ? 343  CYS A C     1 
ATOM   2650  O O     . CYS A 1 343 ? -9.778  40.411  1.099   1.00 17.18  ? 343  CYS A O     1 
ATOM   2651  C CB    . CYS A 1 343 ? -12.316 39.715  2.803   1.00 16.46  ? 343  CYS A CB    1 
ATOM   2652  S SG    . CYS A 1 343 ? -13.054 38.315  3.680   1.00 17.97  ? 343  CYS A SG    1 
ATOM   2653  N N     . GLN A 1 344 ? -10.058 42.154  2.525   1.00 17.15  ? 344  GLN A N     1 
ATOM   2654  C CA    . GLN A 1 344 ? -9.253  43.120  1.724   1.00 17.23  ? 344  GLN A CA    1 
ATOM   2655  C C     . GLN A 1 344 ? -7.766  42.787  1.786   1.00 17.46  ? 344  GLN A C     1 
ATOM   2656  O O     . GLN A 1 344 ? -7.071  42.951  0.788   1.00 17.62  ? 344  GLN A O     1 
ATOM   2657  C CB    . GLN A 1 344 ? -9.452  44.582  2.176   1.00 17.00  ? 344  GLN A CB    1 
ATOM   2658  C CG    . GLN A 1 344 ? -10.823 45.180  1.816   1.00 15.88  ? 344  GLN A CG    1 
ATOM   2659  C CD    . GLN A 1 344 ? -11.161 46.464  2.598   1.00 17.46  ? 344  GLN A CD    1 
ATOM   2660  O OE1   . GLN A 1 344 ? -12.150 47.136  2.293   1.00 17.07  ? 344  GLN A OE1   1 
ATOM   2661  N NE2   . GLN A 1 344 ? -10.342 46.809  3.598   1.00 15.46  ? 344  GLN A NE2   1 
ATOM   2662  N N     . VAL A 1 345 ? -7.291  42.344  2.961   1.00 17.85  ? 345  VAL A N     1 
ATOM   2663  C CA    . VAL A 1 345 ? -5.910  41.841  3.142   1.00 18.08  ? 345  VAL A CA    1 
ATOM   2664  C C     . VAL A 1 345 ? -5.687  40.562  2.305   1.00 18.17  ? 345  VAL A C     1 
ATOM   2665  O O     . VAL A 1 345 ? -4.646  40.393  1.675   1.00 17.98  ? 345  VAL A O     1 
ATOM   2666  C CB    . VAL A 1 345 ? -5.550  41.595  4.652   1.00 18.10  ? 345  VAL A CB    1 
ATOM   2667  C CG1   . VAL A 1 345 ? -4.121  41.052  4.824   1.00 17.35  ? 345  VAL A CG1   1 
ATOM   2668  C CG2   . VAL A 1 345 ? -5.689  42.873  5.469   1.00 18.67  ? 345  VAL A CG2   1 
ATOM   2669  N N     . VAL A 1 346 ? -6.680  39.680  2.296   1.00 18.42  ? 346  VAL A N     1 
ATOM   2670  C CA    . VAL A 1 346 ? -6.636  38.456  1.490   1.00 18.60  ? 346  VAL A CA    1 
ATOM   2671  C C     . VAL A 1 346 ? -6.498  38.765  -0.011  1.00 18.76  ? 346  VAL A C     1 
ATOM   2672  O O     . VAL A 1 346 ? -5.621  38.191  -0.696  1.00 18.79  ? 346  VAL A O     1 
ATOM   2673  C CB    . VAL A 1 346 ? -7.876  37.567  1.766   1.00 18.36  ? 346  VAL A CB    1 
ATOM   2674  C CG1   . VAL A 1 346 ? -8.085  36.515  0.670   1.00 18.08  ? 346  VAL A CG1   1 
ATOM   2675  C CG2   . VAL A 1 346 ? -7.741  36.913  3.129   1.00 18.39  ? 346  VAL A CG2   1 
ATOM   2676  N N     . ASP A 1 347 ? -7.348  39.669  -0.507  1.00 18.32  ? 347  ASP A N     1 
ATOM   2677  C CA    . ASP A 1 347 ? -7.260  40.122  -1.894  1.00 18.78  ? 347  ASP A CA    1 
ATOM   2678  C C     . ASP A 1 347 ? -5.936  40.798  -2.154  1.00 18.73  ? 347  ASP A C     1 
ATOM   2679  O O     . ASP A 1 347 ? -5.264  40.455  -3.128  1.00 19.25  ? 347  ASP A O     1 
ATOM   2680  C CB    . ASP A 1 347 ? -8.397  41.074  -2.256  1.00 18.54  ? 347  ASP A CB    1 
ATOM   2681  C CG    . ASP A 1 347 ? -9.746  40.382  -2.314  1.00 19.86  ? 347  ASP A CG    1 
ATOM   2682  O OD1   . ASP A 1 347 ? -9.812  39.127  -2.223  1.00 20.74  ? 347  ASP A OD1   1 
ATOM   2683  O OD2   . ASP A 1 347 ? -10.754 41.102  -2.451  1.00 21.37  ? 347  ASP A OD2   1 
ATOM   2684  N N     . LYS A 1 348 ? -5.552  41.729  -1.276  1.00 18.45  ? 348  LYS A N     1 
ATOM   2685  C CA    . LYS A 1 348 ? -4.336  42.536  -1.464  1.00 18.38  ? 348  LYS A CA    1 
ATOM   2686  C C     . LYS A 1 348 ? -3.103  41.643  -1.623  1.00 18.18  ? 348  LYS A C     1 
ATOM   2687  O O     . LYS A 1 348 ? -2.299  41.851  -2.532  1.00 17.19  ? 348  LYS A O     1 
ATOM   2688  C CB    . LYS A 1 348 ? -4.143  43.547  -0.321  1.00 18.36  ? 348  LYS A CB    1 
ATOM   2689  C CG    . LYS A 1 348 ? -2.941  44.487  -0.506  1.00 18.86  ? 348  LYS A CG    1 
ATOM   2690  C CD    . LYS A 1 348 ? -2.687  45.418  0.727   1.00 18.05  ? 348  LYS A CD    1 
ATOM   2691  C CE    . LYS A 1 348 ? -1.632  46.508  0.399   1.00 17.58  ? 348  LYS A CE    1 
ATOM   2692  N NZ    . LYS A 1 348 ? -1.239  47.402  1.569   1.00 18.15  ? 348  LYS A NZ    1 
ATOM   2693  N N     . HIS A 1 349 ? -2.987  40.622  -0.779  1.00 18.00  ? 349  HIS A N     1 
ATOM   2694  C CA    . HIS A 1 349 ? -1.787  39.796  -0.790  1.00 18.79  ? 349  HIS A CA    1 
ATOM   2695  C C     . HIS A 1 349 ? -1.951  38.420  -1.448  1.00 19.15  ? 349  HIS A C     1 
ATOM   2696  O O     . HIS A 1 349 ? -1.039  37.582  -1.386  1.00 20.35  ? 349  HIS A O     1 
ATOM   2697  C CB    . HIS A 1 349 ? -1.159  39.739  0.619   1.00 18.76  ? 349  HIS A CB    1 
ATOM   2698  C CG    . HIS A 1 349 ? -0.819  41.100  1.167   1.00 19.13  ? 349  HIS A CG    1 
ATOM   2699  N ND1   . HIS A 1 349 ? 0.156   41.903  0.612   1.00 19.25  ? 349  HIS A ND1   1 
ATOM   2700  C CD2   . HIS A 1 349 ? -1.374  41.828  2.164   1.00 18.93  ? 349  HIS A CD2   1 
ATOM   2701  C CE1   . HIS A 1 349 ? 0.218   43.046  1.269   1.00 17.70  ? 349  HIS A CE1   1 
ATOM   2702  N NE2   . HIS A 1 349 ? -0.703  43.028  2.214   1.00 19.39  ? 349  HIS A NE2   1 
ATOM   2703  N N     . GLN A 1 350 ? -3.091  38.204  -2.099  1.00 19.01  ? 350  GLN A N     1 
ATOM   2704  C CA    . GLN A 1 350 ? -3.395  36.924  -2.752  1.00 18.76  ? 350  GLN A CA    1 
ATOM   2705  C C     . GLN A 1 350 ? -3.175  35.713  -1.796  1.00 18.68  ? 350  GLN A C     1 
ATOM   2706  O O     . GLN A 1 350 ? -2.547  34.707  -2.162  1.00 19.26  ? 350  GLN A O     1 
ATOM   2707  C CB    . GLN A 1 350 ? -2.612  36.785  -4.065  1.00 18.59  ? 350  GLN A CB    1 
ATOM   2708  C CG    . GLN A 1 350 ? -3.021  37.812  -5.174  1.00 18.33  ? 350  GLN A CG    1 
ATOM   2709  C CD    . GLN A 1 350 ? -4.449  37.585  -5.646  1.00 19.78  ? 350  GLN A CD    1 
ATOM   2710  O OE1   . GLN A 1 350 ? -5.338  38.415  -5.398  1.00 21.21  ? 350  GLN A OE1   1 
ATOM   2711  N NE2   . GLN A 1 350 ? -4.692  36.438  -6.304  1.00 18.48  ? 350  GLN A NE2   1 
ATOM   2712  N N     . VAL A 1 351 ? -3.695  35.840  -0.573  1.00 17.73  ? 351  VAL A N     1 
ATOM   2713  C CA    . VAL A 1 351 ? -3.539  34.836  0.494   1.00 16.35  ? 351  VAL A CA    1 
ATOM   2714  C C     . VAL A 1 351 ? -4.273  33.553  0.143   1.00 16.19  ? 351  VAL A C     1 
ATOM   2715  O O     . VAL A 1 351 ? -5.450  33.578  -0.188  1.00 16.17  ? 351  VAL A O     1 
ATOM   2716  C CB    . VAL A 1 351 ? -4.048  35.391  1.845   1.00 16.38  ? 351  VAL A CB    1 
ATOM   2717  C CG1   . VAL A 1 351 ? -4.086  34.290  2.955   1.00 16.12  ? 351  VAL A CG1   1 
ATOM   2718  C CG2   . VAL A 1 351 ? -3.191  36.566  2.286   1.00 15.89  ? 351  VAL A CG2   1 
ATOM   2719  N N     . ASN A 1 352 ? -3.568  32.425  0.216   1.00 16.69  ? 352  ASN A N     1 
ATOM   2720  C CA    . ASN A 1 352 ? -4.131  31.114  -0.126  1.00 16.47  ? 352  ASN A CA    1 
ATOM   2721  C C     . ASN A 1 352 ? -4.598  30.310  1.091   1.00 16.62  ? 352  ASN A C     1 
ATOM   2722  O O     . ASN A 1 352 ? -5.474  29.451  0.984   1.00 16.60  ? 352  ASN A O     1 
ATOM   2723  C CB    . ASN A 1 352 ? -3.105  30.302  -0.915  1.00 16.53  ? 352  ASN A CB    1 
ATOM   2724  C CG    . ASN A 1 352 ? -2.608  31.031  -2.147  1.00 16.95  ? 352  ASN A CG    1 
ATOM   2725  O OD1   . ASN A 1 352 ? -1.417  31.370  -2.259  1.00 16.69  ? 352  ASN A OD1   1 
ATOM   2726  N ND2   . ASN A 1 352 ? -3.519  31.291  -3.073  1.00 13.83  ? 352  ASN A ND2   1 
ATOM   2727  N N     . ILE A 1 353 ? -3.973  30.560  2.239   1.00 16.89  ? 353  ILE A N     1 
ATOM   2728  C CA    . ILE A 1 353 ? -4.317  29.857  3.485   1.00 16.67  ? 353  ILE A CA    1 
ATOM   2729  C C     . ILE A 1 353 ? -4.581  30.889  4.560   1.00 16.52  ? 353  ILE A C     1 
ATOM   2730  O O     . ILE A 1 353 ? -3.735  31.739  4.833   1.00 15.90  ? 353  ILE A O     1 
ATOM   2731  C CB    . ILE A 1 353 ? -3.200  28.895  3.948   1.00 16.55  ? 353  ILE A CB    1 
ATOM   2732  C CG1   . ILE A 1 353 ? -2.874  27.878  2.846   1.00 16.32  ? 353  ILE A CG1   1 
ATOM   2733  C CG2   . ILE A 1 353 ? -3.618  28.188  5.221   1.00 16.83  ? 353  ILE A CG2   1 
ATOM   2734  C CD1   . ILE A 1 353 ? -1.469  27.295  2.901   1.00 14.02  ? 353  ILE A CD1   1 
ATOM   2735  N N     . LEU A 1 354 ? -5.777  30.824  5.145   1.00 16.92  ? 354  LEU A N     1 
ATOM   2736  C CA    . LEU A 1 354 ? -6.161  31.756  6.188   1.00 16.73  ? 354  LEU A CA    1 
ATOM   2737  C C     . LEU A 1 354 ? -6.485  30.999  7.467   1.00 16.90  ? 354  LEU A C     1 
ATOM   2738  O O     . LEU A 1 354 ? -7.289  30.074  7.462   1.00 17.34  ? 354  LEU A O     1 
ATOM   2739  C CB    . LEU A 1 354 ? -7.338  32.635  5.738   1.00 16.45  ? 354  LEU A CB    1 
ATOM   2740  C CG    . LEU A 1 354 ? -7.981  33.563  6.781   1.00 15.96  ? 354  LEU A CG    1 
ATOM   2741  C CD1   . LEU A 1 354 ? -7.007  34.660  7.255   1.00 13.78  ? 354  LEU A CD1   1 
ATOM   2742  C CD2   . LEU A 1 354 ? -9.308  34.160  6.255   1.00 16.93  ? 354  LEU A CD2   1 
ATOM   2743  N N     . TYR A 1 355 ? -5.861  31.417  8.563   1.00 17.05  ? 355  TYR A N     1 
ATOM   2744  C CA    . TYR A 1 355 ? -5.971  30.728  9.854   1.00 16.73  ? 355  TYR A CA    1 
ATOM   2745  C C     . TYR A 1 355 ? -6.330  31.767  10.896  1.00 16.62  ? 355  TYR A C     1 
ATOM   2746  O O     . TYR A 1 355 ? -5.503  32.606  11.221  1.00 16.47  ? 355  TYR A O     1 
ATOM   2747  C CB    . TYR A 1 355 ? -4.614  30.112  10.181  1.00 16.29  ? 355  TYR A CB    1 
ATOM   2748  C CG    . TYR A 1 355 ? -4.528  29.256  11.433  1.00 16.61  ? 355  TYR A CG    1 
ATOM   2749  C CD1   . TYR A 1 355 ? -5.597  28.459  11.848  1.00 15.08  ? 355  TYR A CD1   1 
ATOM   2750  C CD2   . TYR A 1 355 ? -3.332  29.200  12.163  1.00 15.92  ? 355  TYR A CD2   1 
ATOM   2751  C CE1   . TYR A 1 355 ? -5.479  27.651  12.964  1.00 15.55  ? 355  TYR A CE1   1 
ATOM   2752  C CE2   . TYR A 1 355 ? -3.204  28.402  13.287  1.00 17.03  ? 355  TYR A CE2   1 
ATOM   2753  C CZ    . TYR A 1 355 ? -4.284  27.630  13.687  1.00 18.11  ? 355  TYR A CZ    1 
ATOM   2754  O OH    . TYR A 1 355 ? -4.157  26.831  14.810  1.00 17.64  ? 355  TYR A OH    1 
ATOM   2755  N N     . THR A 1 356 ? -7.561  31.729  11.405  1.00 16.97  ? 356  THR A N     1 
ATOM   2756  C CA    . THR A 1 356 ? -7.989  32.743  12.379  1.00 17.40  ? 356  THR A CA    1 
ATOM   2757  C C     . THR A 1 356 ? -8.745  32.180  13.597  1.00 17.33  ? 356  THR A C     1 
ATOM   2758  O O     . THR A 1 356 ? -8.738  30.965  13.825  1.00 17.88  ? 356  THR A O     1 
ATOM   2759  C CB    . THR A 1 356 ? -8.717  33.974  11.699  1.00 17.21  ? 356  THR A CB    1 
ATOM   2760  O OG1   . THR A 1 356 ? -8.869  35.047  12.641  1.00 17.47  ? 356  THR A OG1   1 
ATOM   2761  C CG2   . THR A 1 356 ? -10.060 33.605  11.135  1.00 17.42  ? 356  THR A CG2   1 
ATOM   2762  N N     . ALA A 1 357 ? -9.359  33.065  14.378  1.00 17.06  ? 357  ALA A N     1 
ATOM   2763  C CA    . ALA A 1 357 ? -10.072 32.701  15.620  1.00 17.30  ? 357  ALA A CA    1 
ATOM   2764  C C     . ALA A 1 357 ? -11.604 32.853  15.511  1.00 17.05  ? 357  ALA A C     1 
ATOM   2765  O O     . ALA A 1 357 ? -12.096 33.771  14.854  1.00 17.32  ? 357  ALA A O     1 
ATOM   2766  C CB    . ALA A 1 357 ? -9.556  33.549  16.770  1.00 16.22  ? 357  ALA A CB    1 
ATOM   2767  N N     . PRO A 1 358 ? -12.368 31.943  16.148  1.00 17.48  ? 358  PRO A N     1 
ATOM   2768  C CA    . PRO A 1 358 ? -13.833 32.058  16.197  1.00 17.13  ? 358  PRO A CA    1 
ATOM   2769  C C     . PRO A 1 358 ? -14.369 33.399  16.694  1.00 17.75  ? 358  PRO A C     1 
ATOM   2770  O O     . PRO A 1 358 ? -15.438 33.837  16.237  1.00 17.95  ? 358  PRO A O     1 
ATOM   2771  C CB    . PRO A 1 358 ? -14.235 30.930  17.155  1.00 16.57  ? 358  PRO A CB    1 
ATOM   2772  C CG    . PRO A 1 358 ? -13.223 29.898  16.942  1.00 16.94  ? 358  PRO A CG    1 
ATOM   2773  C CD    . PRO A 1 358 ? -11.918 30.681  16.775  1.00 17.20  ? 358  PRO A CD    1 
ATOM   2774  N N     . THR A 1 359 ? -13.664 34.043  17.626  1.00 18.07  ? 359  THR A N     1 
ATOM   2775  C CA    . THR A 1 359 ? -14.123 35.339  18.118  1.00 18.56  ? 359  THR A CA    1 
ATOM   2776  C C     . THR A 1 359 ? -14.089 36.346  16.960  1.00 18.78  ? 359  THR A C     1 
ATOM   2777  O O     . THR A 1 359 ? -15.040 37.122  16.786  1.00 18.41  ? 359  THR A O     1 
ATOM   2778  C CB    . THR A 1 359 ? -13.313 35.846  19.339  1.00 18.29  ? 359  THR A CB    1 
ATOM   2779  O OG1   . THR A 1 359 ? -13.505 34.952  20.437  1.00 21.10  ? 359  THR A OG1   1 
ATOM   2780  C CG2   . THR A 1 359 ? -13.804 37.199  19.774  1.00 18.92  ? 359  THR A CG2   1 
ATOM   2781  N N     . ALA A 1 360 ? -12.997 36.323  16.179  1.00 18.70  ? 360  ALA A N     1 
ATOM   2782  C CA    . ALA A 1 360 ? -12.888 37.161  14.983  1.00 18.91  ? 360  ALA A CA    1 
ATOM   2783  C C     . ALA A 1 360 ? -14.002 36.815  13.988  1.00 19.00  ? 360  ALA A C     1 
ATOM   2784  O O     . ALA A 1 360 ? -14.720 37.703  13.529  1.00 19.28  ? 360  ALA A O     1 
ATOM   2785  C CB    . ALA A 1 360 ? -11.512 37.031  14.345  1.00 18.57  ? 360  ALA A CB    1 
ATOM   2786  N N     . ILE A 1 361 ? -14.182 35.524  13.704  1.00 18.88  ? 361  ILE A N     1 
ATOM   2787  C CA    . ILE A 1 361 ? -15.244 35.081  12.784  1.00 18.25  ? 361  ILE A CA    1 
ATOM   2788  C C     . ILE A 1 361 ? -16.619 35.562  13.241  1.00 18.17  ? 361  ILE A C     1 
ATOM   2789  O O     . ILE A 1 361 ? -17.401 36.075  12.436  1.00 17.77  ? 361  ILE A O     1 
ATOM   2790  C CB    . ILE A 1 361 ? -15.225 33.534  12.563  1.00 18.50  ? 361  ILE A CB    1 
ATOM   2791  C CG1   . ILE A 1 361 ? -13.920 33.126  11.860  1.00 17.29  ? 361  ILE A CG1   1 
ATOM   2792  C CG2   . ILE A 1 361 ? -16.463 33.068  11.752  1.00 17.59  ? 361  ILE A CG2   1 
ATOM   2793  C CD1   . ILE A 1 361 ? -13.517 31.663  12.099  1.00 17.88  ? 361  ILE A CD1   1 
ATOM   2794  N N     . ARG A 1 362 ? -16.897 35.419  14.538  1.00 17.75  ? 362  ARG A N     1 
ATOM   2795  C CA    . ARG A 1 362 ? -18.171 35.870  15.110  1.00 17.48  ? 362  ARG A CA    1 
ATOM   2796  C C     . ARG A 1 362 ? -18.347 37.385  15.021  1.00 17.83  ? 362  ARG A C     1 
ATOM   2797  O O     . ARG A 1 362 ? -19.457 37.862  14.728  1.00 17.59  ? 362  ARG A O     1 
ATOM   2798  C CB    . ARG A 1 362 ? -18.330 35.394  16.549  1.00 17.27  ? 362  ARG A CB    1 
ATOM   2799  C CG    . ARG A 1 362 ? -18.617 33.901  16.662  1.00 17.43  ? 362  ARG A CG    1 
ATOM   2800  C CD    . ARG A 1 362 ? -19.111 33.527  18.070  1.00 19.83  ? 362  ARG A CD    1 
ATOM   2801  N NE    . ARG A 1 362 ? -18.077 33.780  19.087  1.00 23.26  ? 362  ARG A NE    1 
ATOM   2802  C CZ    . ARG A 1 362 ? -17.175 32.882  19.472  1.00 22.33  ? 362  ARG A CZ    1 
ATOM   2803  N NH1   . ARG A 1 362 ? -17.181 31.650  18.951  1.00 23.04  ? 362  ARG A NH1   1 
ATOM   2804  N NH2   . ARG A 1 362 ? -16.277 33.217  20.377  1.00 22.55  ? 362  ARG A NH2   1 
ATOM   2805  N N     . ALA A 1 363 ? -17.255 38.127  15.249  1.00 17.62  ? 363  ALA A N     1 
ATOM   2806  C CA    . ALA A 1 363 ? -17.268 39.577  15.111  1.00 18.63  ? 363  ALA A CA    1 
ATOM   2807  C C     . ALA A 1 363 ? -17.595 40.015  13.672  1.00 19.35  ? 363  ALA A C     1 
ATOM   2808  O O     . ALA A 1 363 ? -18.332 40.987  13.478  1.00 19.07  ? 363  ALA A O     1 
ATOM   2809  C CB    . ALA A 1 363 ? -15.952 40.194  15.581  1.00 17.90  ? 363  ALA A CB    1 
ATOM   2810  N N     . LEU A 1 364 ? -17.059 39.292  12.682  1.00 20.18  ? 364  LEU A N     1 
ATOM   2811  C CA    . LEU A 1 364 ? -17.334 39.587  11.265  1.00 20.92  ? 364  LEU A CA    1 
ATOM   2812  C C     . LEU A 1 364 ? -18.754 39.180  10.870  1.00 21.36  ? 364  LEU A C     1 
ATOM   2813  O O     . LEU A 1 364 ? -19.423 39.889  10.117  1.00 21.39  ? 364  LEU A O     1 
ATOM   2814  C CB    . LEU A 1 364 ? -16.296 38.934  10.337  1.00 20.54  ? 364  LEU A CB    1 
ATOM   2815  C CG    . LEU A 1 364 ? -14.800 39.351  10.413  1.00 22.48  ? 364  LEU A CG    1 
ATOM   2816  C CD1   . LEU A 1 364 ? -14.025 38.782  9.249   1.00 22.34  ? 364  LEU A CD1   1 
ATOM   2817  C CD2   . LEU A 1 364 ? -14.574 40.874  10.454  1.00 21.78  ? 364  LEU A CD2   1 
ATOM   2818  N N     . MET A 1 365 ? -19.204 38.042  11.395  1.00 21.83  ? 365  MET A N     1 
ATOM   2819  C CA    . MET A 1 365 ? -20.500 37.475  11.059  1.00 22.51  ? 365  MET A CA    1 
ATOM   2820  C C     . MET A 1 365 ? -21.604 38.386  11.559  1.00 21.69  ? 365  MET A C     1 
ATOM   2821  O O     . MET A 1 365 ? -22.656 38.492  10.923  1.00 22.39  ? 365  MET A O     1 
ATOM   2822  C CB    . MET A 1 365 ? -20.642 36.047  11.639  1.00 22.69  ? 365  MET A CB    1 
ATOM   2823  C CG    . MET A 1 365 ? -22.037 35.376  11.427  1.00 24.42  ? 365  MET A CG    1 
ATOM   2824  S SD    . MET A 1 365 ? -22.122 33.633  11.911  1.00 25.37  ? 365  MET A SD    1 
ATOM   2825  C CE    . MET A 1 365 ? -20.810 33.658  13.084  1.00 25.55  ? 365  MET A CE    1 
ATOM   2826  N N     . ALA A 1 366 ? -21.375 39.054  12.686  1.00 20.91  ? 366  ALA A N     1 
ATOM   2827  C CA    . ALA A 1 366 ? -22.326 40.042  13.175  1.00 20.59  ? 366  ALA A CA    1 
ATOM   2828  C C     . ALA A 1 366 ? -22.554 41.133  12.141  1.00 20.44  ? 366  ALA A C     1 
ATOM   2829  O O     . ALA A 1 366 ? -23.617 41.756  12.125  1.00 20.17  ? 366  ALA A O     1 
ATOM   2830  C CB    . ALA A 1 366 ? -21.861 40.671  14.506  1.00 20.55  ? 366  ALA A CB    1 
ATOM   2831  N N     . GLU A 1 367 ? -21.546 41.370  11.297  1.00 20.28  ? 367  GLU A N     1 
ATOM   2832  C CA    . GLU A 1 367 ? -21.627 42.405  10.258  1.00 20.11  ? 367  GLU A CA    1 
ATOM   2833  C C     . GLU A 1 367 ? -22.124 41.878  8.923   1.00 19.43  ? 367  GLU A C     1 
ATOM   2834  O O     . GLU A 1 367 ? -22.283 42.662  7.969   1.00 19.15  ? 367  GLU A O     1 
ATOM   2835  C CB    . GLU A 1 367 ? -20.286 43.117  10.077  1.00 20.00  ? 367  GLU A CB    1 
ATOM   2836  C CG    . GLU A 1 367 ? -19.769 43.726  11.354  1.00 23.18  ? 367  GLU A CG    1 
ATOM   2837  C CD    . GLU A 1 367 ? -20.816 44.557  12.110  1.00 27.55  ? 367  GLU A CD    1 
ATOM   2838  O OE1   . GLU A 1 367 ? -21.569 45.338  11.477  1.00 26.41  ? 367  GLU A OE1   1 
ATOM   2839  O OE2   . GLU A 1 367 ? -20.873 44.413  13.357  1.00 30.61  ? 367  GLU A OE2   1 
ATOM   2840  N N     . GLY A 1 368 ? -22.375 40.569  8.856   1.00 18.14  ? 368  GLY A N     1 
ATOM   2841  C CA    . GLY A 1 368 ? -22.932 39.970  7.648   1.00 17.96  ? 368  GLY A CA    1 
ATOM   2842  C C     . GLY A 1 368 ? -22.073 40.233  6.429   1.00 18.27  ? 368  GLY A C     1 
ATOM   2843  O O     . GLY A 1 368 ? -20.831 40.105  6.491   1.00 18.19  ? 368  GLY A O     1 
ATOM   2844  N N     . ASP A 1 369 ? -22.716 40.616  5.323   1.00 17.72  ? 369  ASP A N     1 
ATOM   2845  C CA    . ASP A 1 369 ? -22.012 40.776  4.035   1.00 17.63  ? 369  ASP A CA    1 
ATOM   2846  C C     . ASP A 1 369 ? -21.082 42.002  4.016   1.00 16.89  ? 369  ASP A C     1 
ATOM   2847  O O     . ASP A 1 369 ? -20.292 42.167  3.092   1.00 15.39  ? 369  ASP A O     1 
ATOM   2848  C CB    . ASP A 1 369 ? -23.016 40.823  2.857   1.00 18.12  ? 369  ASP A CB    1 
ATOM   2849  C CG    . ASP A 1 369 ? -23.583 39.436  2.484   1.00 19.76  ? 369  ASP A CG    1 
ATOM   2850  O OD1   . ASP A 1 369 ? -23.131 38.399  3.036   1.00 21.91  ? 369  ASP A OD1   1 
ATOM   2851  O OD2   . ASP A 1 369 ? -24.500 39.382  1.622   1.00 22.17  ? 369  ASP A OD2   1 
ATOM   2852  N N     . LYS A 1 370 ? -21.197 42.867  5.031   1.00 16.72  ? 370  LYS A N     1 
ATOM   2853  C CA    . LYS A 1 370 ? -20.254 43.975  5.204   1.00 16.98  ? 370  LYS A CA    1 
ATOM   2854  C C     . LYS A 1 370 ? -18.826 43.461  5.430   1.00 16.96  ? 370  LYS A C     1 
ATOM   2855  O O     . LYS A 1 370 ? -17.854 44.173  5.167   1.00 17.17  ? 370  LYS A O     1 
ATOM   2856  C CB    . LYS A 1 370 ? -20.679 44.932  6.331   1.00 16.97  ? 370  LYS A CB    1 
ATOM   2857  C CG    . LYS A 1 370 ? -21.801 45.901  5.948   1.00 18.64  ? 370  LYS A CG    1 
ATOM   2858  C CD    . LYS A 1 370 ? -21.428 46.789  4.764   1.00 21.84  ? 370  LYS A CD    1 
ATOM   2859  C CE    . LYS A 1 370 ? -22.558 47.747  4.416   1.00 23.38  ? 370  LYS A CE    1 
ATOM   2860  N NZ    . LYS A 1 370 ? -22.346 48.397  3.087   1.00 23.66  ? 370  LYS A NZ    1 
ATOM   2861  N N     . ALA A 1 371 ? -18.708 42.211  5.866   1.00 16.69  ? 371  ALA A N     1 
ATOM   2862  C CA    . ALA A 1 371 ? -17.408 41.576  6.022   1.00 17.00  ? 371  ALA A CA    1 
ATOM   2863  C C     . ALA A 1 371 ? -16.771 41.135  4.686   1.00 17.33  ? 371  ALA A C     1 
ATOM   2864  O O     . ALA A 1 371 ? -15.567 40.870  4.650   1.00 17.74  ? 371  ALA A O     1 
ATOM   2865  C CB    . ALA A 1 371 ? -17.517 40.387  6.982   1.00 16.81  ? 371  ALA A CB    1 
ATOM   2866  N N     . ILE A 1 372 ? -17.567 41.050  3.614   1.00 16.91  ? 372  ILE A N     1 
ATOM   2867  C CA    . ILE A 1 372 ? -17.079 40.597  2.293   1.00 17.29  ? 372  ILE A CA    1 
ATOM   2868  C C     . ILE A 1 372 ? -17.296 41.616  1.141   1.00 18.50  ? 372  ILE A C     1 
ATOM   2869  O O     . ILE A 1 372 ? -16.857 41.400  -0.001  1.00 18.56  ? 372  ILE A O     1 
ATOM   2870  C CB    . ILE A 1 372 ? -17.636 39.169  1.889   1.00 16.78  ? 372  ILE A CB    1 
ATOM   2871  C CG1   . ILE A 1 372 ? -19.155 39.180  1.611   1.00 16.56  ? 372  ILE A CG1   1 
ATOM   2872  C CG2   . ILE A 1 372 ? -17.271 38.140  2.948   1.00 16.21  ? 372  ILE A CG2   1 
ATOM   2873  C CD1   . ILE A 1 372 ? -19.711 37.870  0.997   1.00 15.87  ? 372  ILE A CD1   1 
ATOM   2874  N N     . GLU A 1 373 ? -17.955 42.726  1.449   1.00 19.38  ? 373  GLU A N     1 
ATOM   2875  C CA    . GLU A 1 373 ? -18.368 43.672  0.426   1.00 20.60  ? 373  GLU A CA    1 
ATOM   2876  C C     . GLU A 1 373 ? -17.183 44.269  -0.321  1.00 20.50  ? 373  GLU A C     1 
ATOM   2877  O O     . GLU A 1 373 ? -16.263 44.810  0.292   1.00 20.62  ? 373  GLU A O     1 
ATOM   2878  C CB    . GLU A 1 373 ? -19.194 44.789  1.049   1.00 20.70  ? 373  GLU A CB    1 
ATOM   2879  C CG    . GLU A 1 373 ? -19.933 45.620  0.038   1.00 23.85  ? 373  GLU A CG    1 
ATOM   2880  C CD    . GLU A 1 373 ? -20.753 46.699  0.702   1.00 28.84  ? 373  GLU A CD    1 
ATOM   2881  O OE1   . GLU A 1 373 ? -21.881 46.410  1.175   1.00 30.91  ? 373  GLU A OE1   1 
ATOM   2882  O OE2   . GLU A 1 373 ? -20.256 47.836  0.769   1.00 30.35  ? 373  GLU A OE2   1 
ATOM   2883  N N     . GLY A 1 374 ? -17.231 44.177  -1.653  1.00 20.80  ? 374  GLY A N     1 
ATOM   2884  C CA    . GLY A 1 374 ? -16.177 44.695  -2.528  1.00 19.85  ? 374  GLY A CA    1 
ATOM   2885  C C     . GLY A 1 374 ? -14.942 43.821  -2.609  1.00 20.01  ? 374  GLY A C     1 
ATOM   2886  O O     . GLY A 1 374 ? -13.950 44.218  -3.217  1.00 20.12  ? 374  GLY A O     1 
ATOM   2887  N N     . THR A 1 375 ? -14.995 42.631  -2.006  1.00 19.47  ? 375  THR A N     1 
ATOM   2888  C CA    . THR A 1 375 ? -13.846 41.738  -1.991  1.00 19.26  ? 375  THR A CA    1 
ATOM   2889  C C     . THR A 1 375 ? -14.087 40.471  -2.805  1.00 20.00  ? 375  THR A C     1 
ATOM   2890  O O     . THR A 1 375 ? -15.232 40.018  -2.937  1.00 19.68  ? 375  THR A O     1 
ATOM   2891  C CB    . THR A 1 375 ? -13.421 41.343  -0.547  1.00 18.92  ? 375  THR A CB    1 
ATOM   2892  O OG1   . THR A 1 375 ? -14.432 40.519  0.040   1.00 17.63  ? 375  THR A OG1   1 
ATOM   2893  C CG2   . THR A 1 375 ? -13.183 42.584  0.320   1.00 17.91  ? 375  THR A CG2   1 
ATOM   2894  N N     . ASP A 1 376 ? -12.993 39.884  -3.307  1.00 20.18  ? 376  ASP A N     1 
ATOM   2895  C CA    . ASP A 1 376 ? -13.058 38.741  -4.210  1.00 20.35  ? 376  ASP A CA    1 
ATOM   2896  C C     . ASP A 1 376 ? -12.905 37.405  -3.463  1.00 20.15  ? 376  ASP A C     1 
ATOM   2897  O O     . ASP A 1 376 ? -13.811 36.581  -3.484  1.00 19.64  ? 376  ASP A O     1 
ATOM   2898  C CB    . ASP A 1 376 ? -11.984 38.907  -5.281  1.00 21.22  ? 376  ASP A CB    1 
ATOM   2899  C CG    . ASP A 1 376 ? -12.037 37.833  -6.347  1.00 23.00  ? 376  ASP A CG    1 
ATOM   2900  O OD1   . ASP A 1 376 ? -11.508 36.729  -6.123  1.00 22.35  ? 376  ASP A OD1   1 
ATOM   2901  O OD2   . ASP A 1 376 ? -12.561 38.123  -7.450  1.00 29.54  ? 376  ASP A OD2   1 
ATOM   2902  N N     . ARG A 1 377 ? -11.749 37.199  -2.823  1.00 19.93  ? 377  ARG A N     1 
ATOM   2903  C CA    . ARG A 1 377 ? -11.471 36.043  -1.946  1.00 19.68  ? 377  ARG A CA    1 
ATOM   2904  C C     . ARG A 1 377 ? -11.097 34.756  -2.685  1.00 19.69  ? 377  ARG A C     1 
ATOM   2905  O O     . ARG A 1 377 ? -10.867 33.709  -2.044  1.00 19.64  ? 377  ARG A O     1 
ATOM   2906  C CB    . ARG A 1 377 ? -12.633 35.766  -0.976  1.00 19.80  ? 377  ARG A CB    1 
ATOM   2907  C CG    . ARG A 1 377 ? -12.872 36.834  0.111   1.00 21.21  ? 377  ARG A CG    1 
ATOM   2908  C CD    . ARG A 1 377 ? -14.374 36.875  0.471   1.00 20.73  ? 377  ARG A CD    1 
ATOM   2909  N NE    . ARG A 1 377 ? -15.109 37.516  -0.626  1.00 20.86  ? 377  ARG A NE    1 
ATOM   2910  C CZ    . ARG A 1 377 ? -16.278 37.114  -1.117  1.00 17.61  ? 377  ARG A CZ    1 
ATOM   2911  N NH1   . ARG A 1 377 ? -16.897 36.052  -0.634  1.00 16.66  ? 377  ARG A NH1   1 
ATOM   2912  N NH2   . ARG A 1 377 ? -16.818 37.786  -2.112  1.00 16.94  ? 377  ARG A NH2   1 
ATOM   2913  N N     . SER A 1 378 ? -11.026 34.832  -4.015  1.00 18.87  ? 378  SER A N     1 
ATOM   2914  C CA    . SER A 1 378 ? -10.774 33.668  -4.865  1.00 18.82  ? 378  SER A CA    1 
ATOM   2915  C C     . SER A 1 378 ? -9.440  32.968  -4.646  1.00 18.46  ? 378  SER A C     1 
ATOM   2916  O O     . SER A 1 378 ? -9.340  31.773  -4.907  1.00 18.48  ? 378  SER A O     1 
ATOM   2917  C CB    . SER A 1 378 ? -10.886 34.034  -6.346  1.00 18.76  ? 378  SER A CB    1 
ATOM   2918  O OG    . SER A 1 378 ? -12.219 34.383  -6.649  1.00 21.30  ? 378  SER A OG    1 
ATOM   2919  N N     . SER A 1 379 ? -8.417  33.706  -4.209  1.00 17.84  ? 379  SER A N     1 
ATOM   2920  C CA    . SER A 1 379 ? -7.111  33.092  -3.923  1.00 17.28  ? 379  SER A CA    1 
ATOM   2921  C C     . SER A 1 379 ? -7.153  32.066  -2.769  1.00 17.63  ? 379  SER A C     1 
ATOM   2922  O O     . SER A 1 379 ? -6.280  31.226  -2.681  1.00 17.42  ? 379  SER A O     1 
ATOM   2923  C CB    . SER A 1 379 ? -6.038  34.151  -3.671  1.00 16.96  ? 379  SER A CB    1 
ATOM   2924  O OG    . SER A 1 379 ? -6.425  35.065  -2.656  1.00 15.91  ? 379  SER A OG    1 
ATOM   2925  N N     . LEU A 1 380 ? -8.162  32.118  -1.909  1.00 17.73  ? 380  LEU A N     1 
ATOM   2926  C CA    . LEU A 1 380 ? -8.216  31.196  -0.764  1.00 18.91  ? 380  LEU A CA    1 
ATOM   2927  C C     . LEU A 1 380 ? -8.413  29.729  -1.178  1.00 19.17  ? 380  LEU A C     1 
ATOM   2928  O O     . LEU A 1 380 ? -9.144  29.434  -2.135  1.00 19.80  ? 380  LEU A O     1 
ATOM   2929  C CB    . LEU A 1 380 ? -9.297  31.628  0.236   1.00 18.80  ? 380  LEU A CB    1 
ATOM   2930  C CG    . LEU A 1 380 ? -9.009  32.858  1.126   1.00 19.61  ? 380  LEU A CG    1 
ATOM   2931  C CD1   . LEU A 1 380 ? -10.204 33.196  1.984   1.00 19.60  ? 380  LEU A CD1   1 
ATOM   2932  C CD2   . LEU A 1 380 ? -7.769  32.676  2.010   1.00 20.99  ? 380  LEU A CD2   1 
ATOM   2933  N N     . ARG A 1 381 ? -7.751  28.821  -0.469  1.00 19.14  ? 381  ARG A N     1 
ATOM   2934  C CA    . ARG A 1 381 ? -7.872  27.388  -0.733  1.00 19.46  ? 381  ARG A CA    1 
ATOM   2935  C C     . ARG A 1 381 ? -8.113  26.612  0.549   1.00 19.46  ? 381  ARG A C     1 
ATOM   2936  O O     . ARG A 1 381 ? -8.783  25.588  0.551   1.00 19.96  ? 381  ARG A O     1 
ATOM   2937  C CB    . ARG A 1 381 ? -6.622  26.851  -1.443  1.00 19.54  ? 381  ARG A CB    1 
ATOM   2938  C CG    . ARG A 1 381 ? -6.560  27.157  -2.936  1.00 19.44  ? 381  ARG A CG    1 
ATOM   2939  C CD    . ARG A 1 381 ? -5.464  26.367  -3.647  1.00 19.93  ? 381  ARG A CD    1 
ATOM   2940  N NE    . ARG A 1 381 ? -4.132  26.880  -3.321  1.00 22.60  ? 381  ARG A NE    1 
ATOM   2941  C CZ    . ARG A 1 381 ? -3.489  27.838  -3.993  1.00 23.42  ? 381  ARG A CZ    1 
ATOM   2942  N NH1   . ARG A 1 381 ? -4.053  28.417  -5.063  1.00 20.45  ? 381  ARG A NH1   1 
ATOM   2943  N NH2   . ARG A 1 381 ? -2.274  28.225  -3.579  1.00 21.65  ? 381  ARG A NH2   1 
ATOM   2944  N N     . ILE A 1 382 ? -7.566  27.108  1.648   1.00 19.47  ? 382  ILE A N     1 
ATOM   2945  C CA    . ILE A 1 382 ? -7.707  26.451  2.948   1.00 19.00  ? 382  ILE A CA    1 
ATOM   2946  C C     . ILE A 1 382 ? -8.065  27.517  3.965   1.00 18.59  ? 382  ILE A C     1 
ATOM   2947  O O     . ILE A 1 382 ? -7.503  28.612  3.918   1.00 18.95  ? 382  ILE A O     1 
ATOM   2948  C CB    . ILE A 1 382 ? -6.363  25.755  3.379   1.00 19.09  ? 382  ILE A CB    1 
ATOM   2949  C CG1   . ILE A 1 382 ? -5.856  24.790  2.289   1.00 18.58  ? 382  ILE A CG1   1 
ATOM   2950  C CG2   . ILE A 1 382 ? -6.488  25.098  4.751   1.00 17.25  ? 382  ILE A CG2   1 
ATOM   2951  C CD1   . ILE A 1 382 ? -6.654  23.513  2.159   1.00 20.02  ? 382  ILE A CD1   1 
ATOM   2952  N N     . LEU A 1 383 ? -9.002  27.189  4.856   1.00 18.18  ? 383  LEU A N     1 
ATOM   2953  C CA    . LEU A 1 383 ? -9.294  27.976  6.057   1.00 18.21  ? 383  LEU A CA    1 
ATOM   2954  C C     . LEU A 1 383 ? -8.961  27.156  7.281   1.00 18.12  ? 383  LEU A C     1 
ATOM   2955  O O     . LEU A 1 383 ? -8.915  25.917  7.199   1.00 18.20  ? 383  LEU A O     1 
ATOM   2956  C CB    . LEU A 1 383 ? -10.775 28.363  6.150   1.00 18.08  ? 383  LEU A CB    1 
ATOM   2957  C CG    . LEU A 1 383 ? -11.320 29.265  5.046   1.00 18.74  ? 383  LEU A CG    1 
ATOM   2958  C CD1   . LEU A 1 383 ? -12.865 29.407  5.183   1.00 16.69  ? 383  LEU A CD1   1 
ATOM   2959  C CD2   . LEU A 1 383 ? -10.598 30.611  5.030   1.00 16.52  ? 383  LEU A CD2   1 
ATOM   2960  N N     . GLY A 1 384 ? -8.748  27.852  8.407   1.00 17.34  ? 384  GLY A N     1 
ATOM   2961  C CA    . GLY A 1 384 ? -8.540  27.233  9.708   1.00 16.93  ? 384  GLY A CA    1 
ATOM   2962  C C     . GLY A 1 384 ? -9.095  28.069  10.863  1.00 17.42  ? 384  GLY A C     1 
ATOM   2963  O O     . GLY A 1 384 ? -9.353  29.286  10.737  1.00 17.36  ? 384  GLY A O     1 
ATOM   2964  N N     . SER A 1 385 ? -9.286  27.403  11.993  1.00 17.01  ? 385  SER A N     1 
ATOM   2965  C CA    . SER A 1 385 ? -9.885  28.005  13.158  1.00 17.25  ? 385  SER A CA    1 
ATOM   2966  C C     . SER A 1 385 ? -9.141  27.434  14.358  1.00 17.58  ? 385  SER A C     1 
ATOM   2967  O O     . SER A 1 385 ? -8.876  26.215  14.405  1.00 16.72  ? 385  SER A O     1 
ATOM   2968  C CB    . SER A 1 385 ? -11.371 27.649  13.247  1.00 17.07  ? 385  SER A CB    1 
ATOM   2969  O OG    . SER A 1 385 ? -11.986 28.248  14.386  1.00 18.14  ? 385  SER A OG    1 
ATOM   2970  N N     . VAL A 1 386 ? -8.811  28.326  15.306  1.00 17.20  ? 386  VAL A N     1 
ATOM   2971  C CA    . VAL A 1 386 ? -8.074  27.971  16.510  1.00 17.11  ? 386  VAL A CA    1 
ATOM   2972  C C     . VAL A 1 386 ? -8.534  28.779  17.732  1.00 17.61  ? 386  VAL A C     1 
ATOM   2973  O O     . VAL A 1 386 ? -8.942  29.943  17.618  1.00 17.14  ? 386  VAL A O     1 
ATOM   2974  C CB    . VAL A 1 386 ? -6.541  28.170  16.297  1.00 17.39  ? 386  VAL A CB    1 
ATOM   2975  C CG1   . VAL A 1 386 ? -6.203  29.639  15.924  1.00 18.01  ? 386  VAL A CG1   1 
ATOM   2976  C CG2   . VAL A 1 386 ? -5.732  27.720  17.487  1.00 16.34  ? 386  VAL A CG2   1 
ATOM   2977  N N     . GLY A 1 387 ? -8.458  28.145  18.901  1.00 18.03  ? 387  GLY A N     1 
ATOM   2978  C CA    . GLY A 1 387 ? -8.337  28.876  20.149  1.00 19.01  ? 387  GLY A CA    1 
ATOM   2979  C C     . GLY A 1 387 ? -9.473  28.602  21.089  1.00 20.20  ? 387  GLY A C     1 
ATOM   2980  O O     . GLY A 1 387 ? -9.337  28.807  22.288  1.00 20.25  ? 387  GLY A O     1 
ATOM   2981  N N     . GLU A 1 388 ? -10.585 28.107  20.539  1.00 21.36  ? 388  GLU A N     1 
ATOM   2982  C CA    . GLU A 1 388 ? -11.839 28.013  21.255  1.00 22.76  ? 388  GLU A CA    1 
ATOM   2983  C C     . GLU A 1 388 ? -12.821 27.205  20.426  1.00 23.05  ? 388  GLU A C     1 
ATOM   2984  O O     . GLU A 1 388 ? -12.605 27.015  19.228  1.00 23.11  ? 388  GLU A O     1 
ATOM   2985  C CB    . GLU A 1 388 ? -12.413 29.419  21.497  1.00 23.25  ? 388  GLU A CB    1 
ATOM   2986  C CG    . GLU A 1 388 ? -12.431 30.281  20.240  1.00 24.35  ? 388  GLU A CG    1 
ATOM   2987  C CD    . GLU A 1 388 ? -12.849 31.716  20.481  1.00 24.69  ? 388  GLU A CD    1 
ATOM   2988  O OE1   . GLU A 1 388 ? -13.931 31.939  21.076  1.00 28.20  ? 388  GLU A OE1   1 
ATOM   2989  O OE2   . GLU A 1 388 ? -12.103 32.618  20.046  1.00 26.93  ? 388  GLU A OE2   1 
ATOM   2990  N N     . PRO A 1 389 ? -13.919 26.732  21.052  1.00 23.29  ? 389  PRO A N     1 
ATOM   2991  C CA    . PRO A 1 389 ? -14.905 26.028  20.248  1.00 23.40  ? 389  PRO A CA    1 
ATOM   2992  C C     . PRO A 1 389 ? -15.530 26.958  19.217  1.00 23.28  ? 389  PRO A C     1 
ATOM   2993  O O     . PRO A 1 389 ? -15.559 28.174  19.397  1.00 23.26  ? 389  PRO A O     1 
ATOM   2994  C CB    . PRO A 1 389 ? -15.948 25.576  21.281  1.00 23.71  ? 389  PRO A CB    1 
ATOM   2995  C CG    . PRO A 1 389 ? -15.208 25.584  22.594  1.00 23.61  ? 389  PRO A CG    1 
ATOM   2996  C CD    . PRO A 1 389 ? -14.307 26.776  22.474  1.00 23.06  ? 389  PRO A CD    1 
ATOM   2997  N N     . ILE A 1 390 ? -15.987 26.384  18.120  1.00 23.43  ? 390  ILE A N     1 
ATOM   2998  C CA    . ILE A 1 390 ? -16.653 27.154  17.092  1.00 23.56  ? 390  ILE A CA    1 
ATOM   2999  C C     . ILE A 1 390 ? -18.004 26.472  16.888  1.00 23.72  ? 390  ILE A C     1 
ATOM   3000  O O     . ILE A 1 390 ? -18.044 25.280  16.585  1.00 23.09  ? 390  ILE A O     1 
ATOM   3001  C CB    . ILE A 1 390 ? -15.813 27.181  15.777  1.00 23.42  ? 390  ILE A CB    1 
ATOM   3002  C CG1   . ILE A 1 390 ? -16.362 28.230  14.803  1.00 23.88  ? 390  ILE A CG1   1 
ATOM   3003  C CG2   . ILE A 1 390 ? -15.748 25.780  15.109  1.00 23.24  ? 390  ILE A CG2   1 
ATOM   3004  C CD1   . ILE A 1 390 ? -15.491 28.450  13.533  1.00 23.05  ? 390  ILE A CD1   1 
ATOM   3005  N N     . ASN A 1 391 ? -19.104 27.199  17.085  1.00 24.07  ? 391  ASN A N     1 
ATOM   3006  C CA    . ASN A 1 391 ? -20.405 26.588  16.846  1.00 24.72  ? 391  ASN A CA    1 
ATOM   3007  C C     . ASN A 1 391 ? -20.671 26.386  15.357  1.00 23.67  ? 391  ASN A C     1 
ATOM   3008  O O     . ASN A 1 391 ? -20.105 27.101  14.542  1.00 22.85  ? 391  ASN A O     1 
ATOM   3009  C CB    . ASN A 1 391 ? -21.536 27.329  17.570  1.00 26.37  ? 391  ASN A CB    1 
ATOM   3010  C CG    . ASN A 1 391 ? -22.020 28.552  16.831  1.00 30.21  ? 391  ASN A CG    1 
ATOM   3011  O OD1   . ASN A 1 391 ? -21.263 29.508  16.590  1.00 33.70  ? 391  ASN A OD1   1 
ATOM   3012  N ND2   . ASN A 1 391 ? -23.316 28.557  16.517  1.00 32.99  ? 391  ASN A ND2   1 
ATOM   3013  N N     . PRO A 1 392 ? -21.497 25.374  15.003  1.00 23.17  ? 392  PRO A N     1 
ATOM   3014  C CA    . PRO A 1 392 ? -21.804 25.044  13.611  1.00 22.78  ? 392  PRO A CA    1 
ATOM   3015  C C     . PRO A 1 392 ? -22.176 26.230  12.717  1.00 21.94  ? 392  PRO A C     1 
ATOM   3016  O O     . PRO A 1 392 ? -21.721 26.287  11.558  1.00 21.38  ? 392  PRO A O     1 
ATOM   3017  C CB    . PRO A 1 392 ? -22.988 24.061  13.732  1.00 22.96  ? 392  PRO A CB    1 
ATOM   3018  C CG    . PRO A 1 392 ? -22.761 23.380  15.005  1.00 23.02  ? 392  PRO A CG    1 
ATOM   3019  C CD    . PRO A 1 392 ? -22.182 24.447  15.929  1.00 23.44  ? 392  PRO A CD    1 
ATOM   3020  N N     . GLU A 1 393 ? -22.985 27.160  13.220  1.00 20.98  ? 393  GLU A N     1 
ATOM   3021  C CA    . GLU A 1 393 ? -23.414 28.290  12.356  1.00 21.55  ? 393  GLU A CA    1 
ATOM   3022  C C     . GLU A 1 393 ? -22.333 29.325  12.086  1.00 19.93  ? 393  GLU A C     1 
ATOM   3023  O O     . GLU A 1 393 ? -22.326 29.919  11.018  1.00 19.97  ? 393  GLU A O     1 
ATOM   3024  C CB    . GLU A 1 393 ? -24.733 28.935  12.801  1.00 22.18  ? 393  GLU A CB    1 
ATOM   3025  C CG    . GLU A 1 393 ? -24.826 29.123  14.270  1.00 26.77  ? 393  GLU A CG    1 
ATOM   3026  C CD    . GLU A 1 393 ? -26.080 29.832  14.704  1.00 32.58  ? 393  GLU A CD    1 
ATOM   3027  O OE1   . GLU A 1 393 ? -27.196 29.422  14.260  1.00 33.68  ? 393  GLU A OE1   1 
ATOM   3028  O OE2   . GLU A 1 393 ? -25.924 30.799  15.498  1.00 33.86  ? 393  GLU A OE2   1 
ATOM   3029  N N     . ALA A 1 394 ? -21.410 29.513  13.028  1.00 18.83  ? 394  ALA A N     1 
ATOM   3030  C CA    . ALA A 1 394 ? -20.205 30.293  12.753  1.00 17.42  ? 394  ALA A CA    1 
ATOM   3031  C C     . ALA A 1 394 ? -19.287 29.545  11.793  1.00 17.04  ? 394  ALA A C     1 
ATOM   3032  O O     . ALA A 1 394 ? -18.730 30.144  10.859  1.00 16.98  ? 394  ALA A O     1 
ATOM   3033  C CB    . ALA A 1 394 ? -19.470 30.654  14.033  1.00 17.32  ? 394  ALA A CB    1 
ATOM   3034  N N     . TRP A 1 395 ? -19.135 28.239  12.004  1.00 16.21  ? 395  TRP A N     1 
ATOM   3035  C CA    . TRP A 1 395 ? -18.330 27.409  11.096  1.00 16.39  ? 395  TRP A CA    1 
ATOM   3036  C C     . TRP A 1 395 ? -18.877 27.482  9.653   1.00 16.15  ? 395  TRP A C     1 
ATOM   3037  O O     . TRP A 1 395 ? -18.102 27.667  8.698   1.00 15.70  ? 395  TRP A O     1 
ATOM   3038  C CB    . TRP A 1 395 ? -18.296 25.970  11.594  1.00 16.25  ? 395  TRP A CB    1 
ATOM   3039  C CG    . TRP A 1 395 ? -17.324 25.050  10.898  1.00 16.17  ? 395  TRP A CG    1 
ATOM   3040  C CD1   . TRP A 1 395 ? -16.138 24.580  11.403  1.00 15.53  ? 395  TRP A CD1   1 
ATOM   3041  C CD2   . TRP A 1 395 ? -17.473 24.440  9.605   1.00 16.03  ? 395  TRP A CD2   1 
ATOM   3042  N NE1   . TRP A 1 395 ? -15.545 23.727  10.511  1.00 15.44  ? 395  TRP A NE1   1 
ATOM   3043  C CE2   . TRP A 1 395 ? -16.334 23.631  9.394   1.00 16.28  ? 395  TRP A CE2   1 
ATOM   3044  C CE3   . TRP A 1 395 ? -18.446 24.518  8.593   1.00 15.82  ? 395  TRP A CE3   1 
ATOM   3045  C CZ2   . TRP A 1 395 ? -16.154 22.886  8.224   1.00 16.09  ? 395  TRP A CZ2   1 
ATOM   3046  C CZ3   . TRP A 1 395 ? -18.261 23.796  7.438   1.00 15.80  ? 395  TRP A CZ3   1 
ATOM   3047  C CH2   . TRP A 1 395 ? -17.119 22.988  7.259   1.00 16.48  ? 395  TRP A CH2   1 
ATOM   3048  N N     . GLU A 1 396 ? -20.205 27.377  9.514   1.00 16.26  ? 396  GLU A N     1 
ATOM   3049  C CA    . GLU A 1 396 ? -20.871 27.434  8.190   1.00 17.02  ? 396  GLU A CA    1 
ATOM   3050  C C     . GLU A 1 396 ? -20.797 28.823  7.543   1.00 16.29  ? 396  GLU A C     1 
ATOM   3051  O O     . GLU A 1 396 ? -20.597 28.934  6.331   1.00 16.89  ? 396  GLU A O     1 
ATOM   3052  C CB    . GLU A 1 396 ? -22.329 26.903  8.223   1.00 17.23  ? 396  GLU A CB    1 
ATOM   3053  C CG    . GLU A 1 396 ? -22.473 25.413  8.603   1.00 20.23  ? 396  GLU A CG    1 
ATOM   3054  C CD    . GLU A 1 396 ? -22.171 24.441  7.449   1.00 25.35  ? 396  GLU A CD    1 
ATOM   3055  O OE1   . GLU A 1 396 ? -22.039 24.898  6.302   1.00 26.21  ? 396  GLU A OE1   1 
ATOM   3056  O OE2   . GLU A 1 396 ? -22.092 23.202  7.675   1.00 28.38  ? 396  GLU A OE2   1 
ATOM   3057  N N     . TRP A 1 397 ? -20.925 29.878  8.340   1.00 15.63  ? 397  TRP A N     1 
ATOM   3058  C CA    . TRP A 1 397 ? -20.792 31.223  7.815   1.00 14.69  ? 397  TRP A CA    1 
ATOM   3059  C C     . TRP A 1 397 ? -19.369 31.453  7.275   1.00 15.19  ? 397  TRP A C     1 
ATOM   3060  O O     . TRP A 1 397 ? -19.189 31.882  6.140   1.00 15.31  ? 397  TRP A O     1 
ATOM   3061  C CB    . TRP A 1 397 ? -21.159 32.253  8.882   1.00 14.12  ? 397  TRP A CB    1 
ATOM   3062  C CG    . TRP A 1 397 ? -21.126 33.670  8.341   1.00 14.14  ? 397  TRP A CG    1 
ATOM   3063  C CD1   . TRP A 1 397 ? -22.167 34.353  7.742   1.00 12.78  ? 397  TRP A CD1   1 
ATOM   3064  C CD2   . TRP A 1 397 ? -19.998 34.551  8.315   1.00 13.03  ? 397  TRP A CD2   1 
ATOM   3065  N NE1   . TRP A 1 397 ? -21.747 35.598  7.360   1.00 13.10  ? 397  TRP A NE1   1 
ATOM   3066  C CE2   . TRP A 1 397 ? -20.423 35.752  7.693   1.00 13.02  ? 397  TRP A CE2   1 
ATOM   3067  C CE3   . TRP A 1 397 ? -18.664 34.450  8.764   1.00 12.63  ? 397  TRP A CE3   1 
ATOM   3068  C CZ2   . TRP A 1 397 ? -19.559 36.858  7.515   1.00 12.25  ? 397  TRP A CZ2   1 
ATOM   3069  C CZ3   . TRP A 1 397 ? -17.806 35.540  8.570   1.00 12.13  ? 397  TRP A CZ3   1 
ATOM   3070  C CH2   . TRP A 1 397 ? -18.262 36.725  7.949   1.00 12.37  ? 397  TRP A CH2   1 
ATOM   3071  N N     . TYR A 1 398 ? -18.357 31.156  8.088   1.00 15.46  ? 398  TYR A N     1 
ATOM   3072  C CA    . TYR A 1 398 ? -16.948 31.181  7.649   1.00 15.64  ? 398  TYR A CA    1 
ATOM   3073  C C     . TYR A 1 398 ? -16.703 30.364  6.356   1.00 15.86  ? 398  TYR A C     1 
ATOM   3074  O O     . TYR A 1 398 ? -16.056 30.844  5.430   1.00 16.17  ? 398  TYR A O     1 
ATOM   3075  C CB    . TYR A 1 398 ? -16.092 30.613  8.781   1.00 14.83  ? 398  TYR A CB    1 
ATOM   3076  C CG    . TYR A 1 398 ? -14.579 30.702  8.675   1.00 14.92  ? 398  TYR A CG    1 
ATOM   3077  C CD1   . TYR A 1 398 ? -13.929 31.880  8.315   1.00 13.90  ? 398  TYR A CD1   1 
ATOM   3078  C CD2   . TYR A 1 398 ? -13.791 29.614  9.056   1.00 16.30  ? 398  TYR A CD2   1 
ATOM   3079  C CE1   . TYR A 1 398 ? -12.531 31.957  8.298   1.00 14.03  ? 398  TYR A CE1   1 
ATOM   3080  C CE2   . TYR A 1 398 ? -12.403 29.676  9.045   1.00 12.77  ? 398  TYR A CE2   1 
ATOM   3081  C CZ    . TYR A 1 398 ? -11.777 30.847  8.666   1.00 14.41  ? 398  TYR A CZ    1 
ATOM   3082  O OH    . TYR A 1 398 ? -10.393 30.885  8.662   1.00 14.12  ? 398  TYR A OH    1 
ATOM   3083  N N     . TRP A 1 399 ? -17.229 29.141  6.311   1.00 16.48  ? 399  TRP A N     1 
ATOM   3084  C CA    . TRP A 1 399 ? -17.024 28.225  5.184   1.00 17.39  ? 399  TRP A CA    1 
ATOM   3085  C C     . TRP A 1 399 ? -17.697 28.773  3.921   1.00 18.15  ? 399  TRP A C     1 
ATOM   3086  O O     . TRP A 1 399 ? -17.170 28.629  2.825   1.00 19.28  ? 399  TRP A O     1 
ATOM   3087  C CB    . TRP A 1 399 ? -17.539 26.818  5.555   1.00 17.39  ? 399  TRP A CB    1 
ATOM   3088  C CG    . TRP A 1 399 ? -17.485 25.772  4.464   1.00 17.77  ? 399  TRP A CG    1 
ATOM   3089  C CD1   . TRP A 1 399 ? -16.418 24.962  4.145   1.00 17.83  ? 399  TRP A CD1   1 
ATOM   3090  C CD2   . TRP A 1 399 ? -18.554 25.397  3.561   1.00 18.62  ? 399  TRP A CD2   1 
ATOM   3091  N NE1   . TRP A 1 399 ? -16.758 24.107  3.106   1.00 19.10  ? 399  TRP A NE1   1 
ATOM   3092  C CE2   . TRP A 1 399 ? -18.052 24.368  2.718   1.00 18.23  ? 399  TRP A CE2   1 
ATOM   3093  C CE3   . TRP A 1 399 ? -19.882 25.833  3.387   1.00 19.87  ? 399  TRP A CE3   1 
ATOM   3094  C CZ2   . TRP A 1 399 ? -18.823 23.784  1.704   1.00 18.73  ? 399  TRP A CZ2   1 
ATOM   3095  C CZ3   . TRP A 1 399 ? -20.663 25.244  2.379   1.00 18.67  ? 399  TRP A CZ3   1 
ATOM   3096  C CH2   . TRP A 1 399 ? -20.127 24.223  1.553   1.00 19.23  ? 399  TRP A CH2   1 
ATOM   3097  N N     . LYS A 1 400 ? -18.848 29.418  4.083   1.00 18.33  ? 400  LYS A N     1 
ATOM   3098  C CA    . LYS A 1 400 ? -19.641 29.922  2.960   1.00 19.28  ? 400  LYS A CA    1 
ATOM   3099  C C     . LYS A 1 400 ? -19.229 31.322  2.484   1.00 19.12  ? 400  LYS A C     1 
ATOM   3100  O O     . LYS A 1 400 ? -19.082 31.573  1.279   1.00 18.82  ? 400  LYS A O     1 
ATOM   3101  C CB    . LYS A 1 400 ? -21.127 29.930  3.354   1.00 19.02  ? 400  LYS A CB    1 
ATOM   3102  C CG    . LYS A 1 400 ? -22.058 30.507  2.315   1.00 20.21  ? 400  LYS A CG    1 
ATOM   3103  C CD    . LYS A 1 400 ? -23.485 30.640  2.855   1.00 20.32  ? 400  LYS A CD    1 
ATOM   3104  C CE    . LYS A 1 400 ? -24.454 31.158  1.754   1.00 24.68  ? 400  LYS A CE    1 
ATOM   3105  N NZ    . LYS A 1 400 ? -25.756 31.619  2.355   1.00 24.00  ? 400  LYS A NZ    1 
ATOM   3106  N N     . LYS A 1 401 ? -19.058 32.228  3.445   1.00 18.88  ? 401  LYS A N     1 
ATOM   3107  C CA    . LYS A 1 401 ? -18.790 33.634  3.167   1.00 18.55  ? 401  LYS A CA    1 
ATOM   3108  C C     . LYS A 1 401 ? -17.323 33.935  2.868   1.00 18.59  ? 401  LYS A C     1 
ATOM   3109  O O     . LYS A 1 401 ? -16.998 34.679  1.931   1.00 18.54  ? 401  LYS A O     1 
ATOM   3110  C CB    . LYS A 1 401 ? -19.290 34.494  4.334   1.00 17.95  ? 401  LYS A CB    1 
ATOM   3111  C CG    . LYS A 1 401 ? -20.818 34.495  4.454   1.00 17.80  ? 401  LYS A CG    1 
ATOM   3112  C CD    . LYS A 1 401 ? -21.483 35.071  3.188   1.00 18.14  ? 401  LYS A CD    1 
ATOM   3113  C CE    . LYS A 1 401 ? -22.988 34.947  3.225   1.00 18.23  ? 401  LYS A CE    1 
ATOM   3114  N NZ    . LYS A 1 401 ? -23.625 35.957  2.329   1.00 18.00  ? 401  LYS A NZ    1 
ATOM   3115  N N     . ILE A 1 402 ? -16.430 33.348  3.649   1.00 18.47  ? 402  ILE A N     1 
ATOM   3116  C CA    . ILE A 1 402 ? -15.029 33.633  3.453   1.00 18.47  ? 402  ILE A CA    1 
ATOM   3117  C C     . ILE A 1 402 ? -14.443 32.658  2.426   1.00 19.51  ? 402  ILE A C     1 
ATOM   3118  O O     . ILE A 1 402 ? -13.709 33.061  1.514   1.00 19.24  ? 402  ILE A O     1 
ATOM   3119  C CB    . ILE A 1 402 ? -14.245 33.573  4.783   1.00 18.07  ? 402  ILE A CB    1 
ATOM   3120  C CG1   . ILE A 1 402 ? -14.894 34.479  5.849   1.00 16.77  ? 402  ILE A CG1   1 
ATOM   3121  C CG2   . ILE A 1 402 ? -12.754 33.869  4.544   1.00 16.28  ? 402  ILE A CG2   1 
ATOM   3122  C CD1   . ILE A 1 402 ? -15.121 35.930  5.446   1.00 14.59  ? 402  ILE A CD1   1 
ATOM   3123  N N     . GLY A 1 403 ? -14.765 31.377  2.588   1.00 20.07  ? 403  GLY A N     1 
ATOM   3124  C CA    . GLY A 1 403 ? -14.158 30.350  1.758   1.00 21.15  ? 403  GLY A CA    1 
ATOM   3125  C C     . GLY A 1 403 ? -14.959 30.035  0.523   1.00 21.63  ? 403  GLY A C     1 
ATOM   3126  O O     . GLY A 1 403 ? -14.569 29.161  -0.252  1.00 21.93  ? 403  GLY A O     1 
ATOM   3127  N N     . LYS A 1 404 ? -16.080 30.738  0.357   1.00 22.01  ? 404  LYS A N     1 
ATOM   3128  C CA    . LYS A 1 404 ? -16.946 30.617  -0.816  1.00 23.25  ? 404  LYS A CA    1 
ATOM   3129  C C     . LYS A 1 404 ? -17.387 29.165  -1.055  1.00 23.88  ? 404  LYS A C     1 
ATOM   3130  O O     . LYS A 1 404 ? -17.546 28.726  -2.191  1.00 23.52  ? 404  LYS A O     1 
ATOM   3131  C CB    . LYS A 1 404 ? -16.279 31.250  -2.043  1.00 22.89  ? 404  LYS A CB    1 
ATOM   3132  C CG    . LYS A 1 404 ? -16.142 32.801  -1.926  1.00 24.86  ? 404  LYS A CG    1 
ATOM   3133  C CD    . LYS A 1 404 ? -15.258 33.428  -3.019  1.00 24.22  ? 404  LYS A CD    1 
ATOM   3134  C CE    . LYS A 1 404 ? -15.878 33.276  -4.377  1.00 26.71  ? 404  LYS A CE    1 
ATOM   3135  N NZ    . LYS A 1 404 ? -15.044 33.897  -5.446  1.00 30.42  ? 404  LYS A NZ    1 
ATOM   3136  N N     . GLU A 1 405 ? -17.580 28.425  0.044   1.00 24.70  ? 405  GLU A N     1 
ATOM   3137  C CA    . GLU A 1 405 ? -17.954 27.009  -0.014  1.00 25.72  ? 405  GLU A CA    1 
ATOM   3138  C C     . GLU A 1 405 ? -16.900 26.130  -0.696  1.00 24.87  ? 405  GLU A C     1 
ATOM   3139  O O     . GLU A 1 405 ? -17.136 24.951  -0.962  1.00 25.47  ? 405  GLU A O     1 
ATOM   3140  C CB    . GLU A 1 405 ? -19.319 26.850  -0.688  1.00 25.54  ? 405  GLU A CB    1 
ATOM   3141  C CG    . GLU A 1 405 ? -20.376 27.826  -0.125  1.00 27.80  ? 405  GLU A CG    1 
ATOM   3142  C CD    . GLU A 1 405 ? -21.794 27.522  -0.608  1.00 28.32  ? 405  GLU A CD    1 
ATOM   3143  O OE1   . GLU A 1 405 ? -22.710 28.299  -0.254  1.00 32.59  ? 405  GLU A OE1   1 
ATOM   3144  O OE2   . GLU A 1 405 ? -21.995 26.507  -1.318  1.00 31.38  ? 405  GLU A OE2   1 
ATOM   3145  N N     . LYS A 1 406 ? -15.721 26.688  -0.943  1.00 24.36  ? 406  LYS A N     1 
ATOM   3146  C CA    . LYS A 1 406 ? -14.702 25.988  -1.743  1.00 23.89  ? 406  LYS A CA    1 
ATOM   3147  C C     . LYS A 1 406 ? -13.543 25.450  -0.912  1.00 22.89  ? 406  LYS A C     1 
ATOM   3148  O O     . LYS A 1 406 ? -12.764 24.614  -1.391  1.00 21.90  ? 406  LYS A O     1 
ATOM   3149  C CB    . LYS A 1 406 ? -14.173 26.916  -2.863  1.00 23.93  ? 406  LYS A CB    1 
ATOM   3150  C CG    . LYS A 1 406 ? -15.123 27.025  -4.057  1.00 24.01  ? 406  LYS A CG    1 
ATOM   3151  C CD    . LYS A 1 406 ? -14.567 27.922  -5.140  1.00 25.45  ? 406  LYS A CD    1 
ATOM   3152  C CE    . LYS A 1 406 ? -15.641 28.236  -6.214  1.00 28.55  ? 406  LYS A CE    1 
ATOM   3153  N NZ    . LYS A 1 406 ? -15.107 28.211  -7.639  1.00 28.54  ? 406  LYS A NZ    1 
ATOM   3154  N N     . CYS A 1 407 ? -13.444 25.934  0.328   1.00 22.10  ? 407  CYS A N     1 
ATOM   3155  C CA    . CYS A 1 407 ? -12.262 25.718  1.165   1.00 21.18  ? 407  CYS A CA    1 
ATOM   3156  C C     . CYS A 1 407 ? -12.588 24.880  2.373   1.00 21.14  ? 407  CYS A C     1 
ATOM   3157  O O     . CYS A 1 407 ? -13.505 25.190  3.129   1.00 21.57  ? 407  CYS A O     1 
ATOM   3158  C CB    . CYS A 1 407 ? -11.687 27.045  1.655   1.00 20.81  ? 407  CYS A CB    1 
ATOM   3159  S SG    . CYS A 1 407 ? -11.189 28.208  0.360   1.00 18.32  ? 407  CYS A SG    1 
ATOM   3160  N N     . PRO A 1 408 ? -11.842 23.802  2.561   1.00 21.13  ? 408  PRO A N     1 
ATOM   3161  C CA    . PRO A 1 408 ? -11.899 23.090  3.830   1.00 21.16  ? 408  PRO A CA    1 
ATOM   3162  C C     . PRO A 1 408 ? -11.508 24.000  5.000   1.00 20.88  ? 408  PRO A C     1 
ATOM   3163  O O     . PRO A 1 408 ? -10.658 24.901  4.853   1.00 20.94  ? 408  PRO A O     1 
ATOM   3164  C CB    . PRO A 1 408 ? -10.866 21.977  3.649   1.00 20.96  ? 408  PRO A CB    1 
ATOM   3165  C CG    . PRO A 1 408 ? -10.812 21.774  2.182   1.00 22.08  ? 408  PRO A CG    1 
ATOM   3166  C CD    . PRO A 1 408 ? -10.963 23.139  1.590   1.00 21.25  ? 408  PRO A CD    1 
ATOM   3167  N N     . VAL A 1 409 ? -12.149 23.767  6.141   1.00 19.98  ? 409  VAL A N     1 
ATOM   3168  C CA    . VAL A 1 409 ? -11.820 24.445  7.380   1.00 19.05  ? 409  VAL A CA    1 
ATOM   3169  C C     . VAL A 1 409 ? -11.136 23.432  8.277   1.00 18.78  ? 409  VAL A C     1 
ATOM   3170  O O     . VAL A 1 409 ? -11.742 22.417  8.607   1.00 18.82  ? 409  VAL A O     1 
ATOM   3171  C CB    . VAL A 1 409 ? -13.096 24.983  8.107   1.00 19.17  ? 409  VAL A CB    1 
ATOM   3172  C CG1   . VAL A 1 409 ? -12.744 25.523  9.507   1.00 18.61  ? 409  VAL A CG1   1 
ATOM   3173  C CG2   . VAL A 1 409 ? -13.768 26.069  7.298   1.00 17.76  ? 409  VAL A CG2   1 
ATOM   3174  N N     . VAL A 1 410 ? -9.881  23.690  8.647   1.00 18.13  ? 410  VAL A N     1 
ATOM   3175  C CA    . VAL A 1 410 ? -9.222  22.914  9.707   1.00 18.06  ? 410  VAL A CA    1 
ATOM   3176  C C     . VAL A 1 410 ? -9.451  23.569  11.086  1.00 17.56  ? 410  VAL A C     1 
ATOM   3177  O O     . VAL A 1 410 ? -8.947  24.645  11.366  1.00 18.09  ? 410  VAL A O     1 
ATOM   3178  C CB    . VAL A 1 410 ? -7.704  22.644  9.428   1.00 18.10  ? 410  VAL A CB    1 
ATOM   3179  C CG1   . VAL A 1 410 ? -7.533  21.717  8.216   1.00 19.13  ? 410  VAL A CG1   1 
ATOM   3180  C CG2   . VAL A 1 410 ? -6.927  23.947  9.224   1.00 18.18  ? 410  VAL A CG2   1 
ATOM   3181  N N     . ASP A 1 411 ? -10.264 22.938  11.917  1.00 17.20  ? 411  ASP A N     1 
ATOM   3182  C CA    . ASP A 1 411 ? -10.498 23.390  13.287  1.00 16.74  ? 411  ASP A CA    1 
ATOM   3183  C C     . ASP A 1 411 ? -9.435  22.681  14.097  1.00 16.51  ? 411  ASP A C     1 
ATOM   3184  O O     . ASP A 1 411 ? -9.525  21.467  14.289  1.00 16.62  ? 411  ASP A O     1 
ATOM   3185  C CB    . ASP A 1 411 ? -11.900 22.982  13.712  1.00 16.31  ? 411  ASP A CB    1 
ATOM   3186  C CG    . ASP A 1 411 ? -12.239 23.340  15.152  1.00 17.58  ? 411  ASP A CG    1 
ATOM   3187  O OD1   . ASP A 1 411 ? -11.460 24.003  15.867  1.00 14.92  ? 411  ASP A OD1   1 
ATOM   3188  O OD2   . ASP A 1 411 ? -13.354 22.953  15.569  1.00 17.97  ? 411  ASP A OD2   1 
ATOM   3189  N N     . THR A 1 412 ? -8.403  23.429  14.513  1.00 16.06  ? 412  THR A N     1 
ATOM   3190  C CA    . THR A 1 412 ? -7.262  22.864  15.227  1.00 15.61  ? 412  THR A CA    1 
ATOM   3191  C C     . THR A 1 412 ? -7.379  22.978  16.762  1.00 16.63  ? 412  THR A C     1 
ATOM   3192  O O     . THR A 1 412 ? -7.360  24.073  17.322  1.00 17.07  ? 412  THR A O     1 
ATOM   3193  C CB    . THR A 1 412 ? -5.918  23.503  14.761  1.00 16.37  ? 412  THR A CB    1 
ATOM   3194  O OG1   . THR A 1 412 ? -5.901  24.909  15.057  1.00 14.23  ? 412  THR A OG1   1 
ATOM   3195  C CG2   . THR A 1 412 ? -5.664  23.275  13.250  1.00 13.94  ? 412  THR A CG2   1 
ATOM   3196  N N     . TRP A 1 413 ? -7.535  21.846  17.443  1.00 16.75  ? 413  TRP A N     1 
ATOM   3197  C CA    . TRP A 1 413 ? -7.458  21.854  18.894  1.00 17.13  ? 413  TRP A CA    1 
ATOM   3198  C C     . TRP A 1 413 ? -6.029  21.529  19.327  1.00 16.84  ? 413  TRP A C     1 
ATOM   3199  O O     . TRP A 1 413 ? -5.446  20.539  18.890  1.00 16.94  ? 413  TRP A O     1 
ATOM   3200  C CB    . TRP A 1 413 ? -8.456  20.898  19.573  1.00 17.00  ? 413  TRP A CB    1 
ATOM   3201  C CG    . TRP A 1 413 ? -8.206  20.859  21.069  1.00 18.44  ? 413  TRP A CG    1 
ATOM   3202  C CD1   . TRP A 1 413 ? -8.703  21.735  22.013  1.00 17.66  ? 413  TRP A CD1   1 
ATOM   3203  C CD2   . TRP A 1 413 ? -7.348  19.948  21.785  1.00 19.05  ? 413  TRP A CD2   1 
ATOM   3204  N NE1   . TRP A 1 413 ? -8.226  21.412  23.257  1.00 16.82  ? 413  TRP A NE1   1 
ATOM   3205  C CE2   . TRP A 1 413 ? -7.390  20.328  23.157  1.00 18.26  ? 413  TRP A CE2   1 
ATOM   3206  C CE3   . TRP A 1 413 ? -6.554  18.850  21.407  1.00 18.74  ? 413  TRP A CE3   1 
ATOM   3207  C CZ2   . TRP A 1 413 ? -6.668  19.646  24.153  1.00 16.76  ? 413  TRP A CZ2   1 
ATOM   3208  C CZ3   . TRP A 1 413 ? -5.826  18.171  22.407  1.00 18.21  ? 413  TRP A CZ3   1 
ATOM   3209  C CH2   . TRP A 1 413 ? -5.893  18.580  23.766  1.00 17.97  ? 413  TRP A CH2   1 
ATOM   3210  N N     . TRP A 1 414 ? -5.478  22.389  20.175  1.00 16.45  ? 414  TRP A N     1 
ATOM   3211  C CA    . TRP A 1 414 ? -4.185  22.159  20.826  1.00 16.61  ? 414  TRP A CA    1 
ATOM   3212  C C     . TRP A 1 414 ? -4.096  23.175  21.963  1.00 16.55  ? 414  TRP A C     1 
ATOM   3213  O O     . TRP A 1 414 ? -5.097  23.844  22.275  1.00 16.24  ? 414  TRP A O     1 
ATOM   3214  C CB    . TRP A 1 414 ? -3.000  22.245  19.833  1.00 16.32  ? 414  TRP A CB    1 
ATOM   3215  C CG    . TRP A 1 414 ? -2.874  23.550  19.053  1.00 16.10  ? 414  TRP A CG    1 
ATOM   3216  C CD1   . TRP A 1 414 ? -3.765  24.060  18.142  1.00 15.93  ? 414  TRP A CD1   1 
ATOM   3217  C CD2   . TRP A 1 414 ? -1.787  24.494  19.122  1.00 14.38  ? 414  TRP A CD2   1 
ATOM   3218  N NE1   . TRP A 1 414 ? -3.292  25.257  17.628  1.00 16.21  ? 414  TRP A NE1   1 
ATOM   3219  C CE2   . TRP A 1 414 ? -2.090  25.551  18.222  1.00 14.66  ? 414  TRP A CE2   1 
ATOM   3220  C CE3   . TRP A 1 414 ? -0.591  24.547  19.857  1.00 13.61  ? 414  TRP A CE3   1 
ATOM   3221  C CZ2   . TRP A 1 414 ? -1.247  26.663  18.049  1.00 15.82  ? 414  TRP A CZ2   1 
ATOM   3222  C CZ3   . TRP A 1 414 ? 0.269   25.637  19.671  1.00 15.74  ? 414  TRP A CZ3   1 
ATOM   3223  C CH2   . TRP A 1 414 ? -0.063  26.684  18.766  1.00 15.87  ? 414  TRP A CH2   1 
ATOM   3224  N N     . GLN A 1 415 ? -2.931  23.263  22.602  1.00 17.02  ? 415  GLN A N     1 
ATOM   3225  C CA    . GLN A 1 415 ? -2.728  24.183  23.737  1.00 17.38  ? 415  GLN A CA    1 
ATOM   3226  C C     . GLN A 1 415 ? -1.287  24.639  23.797  1.00 17.36  ? 415  GLN A C     1 
ATOM   3227  O O     . GLN A 1 415 ? -0.437  24.128  23.057  1.00 17.43  ? 415  GLN A O     1 
ATOM   3228  C CB    . GLN A 1 415 ? -3.076  23.526  25.071  1.00 17.33  ? 415  GLN A CB    1 
ATOM   3229  C CG    . GLN A 1 415 ? -4.130  22.438  25.034  1.00 17.49  ? 415  GLN A CG    1 
ATOM   3230  C CD    . GLN A 1 415 ? -4.253  21.747  26.391  1.00 17.58  ? 415  GLN A CD    1 
ATOM   3231  O OE1   . GLN A 1 415 ? -3.475  20.829  26.720  1.00 15.51  ? 415  GLN A OE1   1 
ATOM   3232  N NE2   . GLN A 1 415 ? -5.226  22.187  27.185  1.00 14.86  ? 415  GLN A NE2   1 
ATOM   3233  N N     . THR A 1 416 ? -1.004  25.575  24.706  1.00 16.97  ? 416  THR A N     1 
ATOM   3234  C CA    . THR A 1 416 ? 0.347   26.108  24.848  1.00 16.51  ? 416  THR A CA    1 
ATOM   3235  C C     . THR A 1 416 ? 1.318   24.981  25.251  1.00 16.35  ? 416  THR A C     1 
ATOM   3236  O O     . THR A 1 416 ? 2.456   24.920  24.775  1.00 16.04  ? 416  THR A O     1 
ATOM   3237  C CB    . THR A 1 416 ? 0.383   27.290  25.849  1.00 16.38  ? 416  THR A CB    1 
ATOM   3238  O OG1   . THR A 1 416 ? -0.546  28.295  25.439  1.00 17.24  ? 416  THR A OG1   1 
ATOM   3239  C CG2   . THR A 1 416 ? 1.766   27.930  25.902  1.00 15.83  ? 416  THR A CG2   1 
ATOM   3240  N N     . GLU A 1 417 ? 0.840   24.080  26.106  1.00 15.93  ? 417  GLU A N     1 
ATOM   3241  C CA    . GLU A 1 417 ? 1.614   22.929  26.552  1.00 16.04  ? 417  GLU A CA    1 
ATOM   3242  C C     . GLU A 1 417 ? 1.843   21.832  25.515  1.00 15.96  ? 417  GLU A C     1 
ATOM   3243  O O     . GLU A 1 417 ? 2.621   20.912  25.771  1.00 16.50  ? 417  GLU A O     1 
ATOM   3244  C CB    . GLU A 1 417 ? 0.972   22.325  27.804  1.00 16.06  ? 417  GLU A CB    1 
ATOM   3245  C CG    . GLU A 1 417 ? 0.840   23.311  28.947  1.00 16.99  ? 417  GLU A CG    1 
ATOM   3246  C CD    . GLU A 1 417 ? -0.480  24.047  28.961  1.00 19.14  ? 417  GLU A CD    1 
ATOM   3247  O OE1   . GLU A 1 417 ? -1.136  24.141  27.898  1.00 19.92  ? 417  GLU A OE1   1 
ATOM   3248  O OE2   . GLU A 1 417 ? -0.866  24.529  30.056  1.00 19.20  ? 417  GLU A OE2   1 
ATOM   3249  N N     . THR A 1 418 ? 1.183   21.910  24.361  1.00 15.77  ? 418  THR A N     1 
ATOM   3250  C CA    . THR A 1 418 ? 1.346   20.889  23.324  1.00 16.06  ? 418  THR A CA    1 
ATOM   3251  C C     . THR A 1 418 ? 2.220   21.305  22.133  1.00 16.56  ? 418  THR A C     1 
ATOM   3252  O O     . THR A 1 418 ? 2.568   20.471  21.305  1.00 17.01  ? 418  THR A O     1 
ATOM   3253  C CB    . THR A 1 418 ? -0.019  20.328  22.822  1.00 16.52  ? 418  THR A CB    1 
ATOM   3254  O OG1   . THR A 1 418 ? -0.614  21.211  21.843  1.00 15.11  ? 418  THR A OG1   1 
ATOM   3255  C CG2   . THR A 1 418 ? -0.978  20.089  24.019  1.00 16.32  ? 418  THR A CG2   1 
ATOM   3256  N N     . GLY A 1 419 ? 2.570   22.583  22.038  1.00 16.97  ? 419  GLY A N     1 
ATOM   3257  C CA    . GLY A 1 419 ? 3.507   23.042  21.009  1.00 16.71  ? 419  GLY A CA    1 
ATOM   3258  C C     . GLY A 1 419 ? 2.928   23.167  19.612  1.00 16.91  ? 419  GLY A C     1 
ATOM   3259  O O     . GLY A 1 419 ? 3.288   24.082  18.861  1.00 16.61  ? 419  GLY A O     1 
ATOM   3260  N N     . GLY A 1 420 ? 2.032   22.251  19.257  1.00 16.73  ? 420  GLY A N     1 
ATOM   3261  C CA    . GLY A 1 420 ? 1.404   22.272  17.941  1.00 15.79  ? 420  GLY A CA    1 
ATOM   3262  C C     . GLY A 1 420 ? 0.109   21.489  17.910  1.00 16.00  ? 420  GLY A C     1 
ATOM   3263  O O     . GLY A 1 420 ? -0.329  20.930  18.921  1.00 15.68  ? 420  GLY A O     1 
ATOM   3264  N N     . PHE A 1 421 ? -0.490  21.429  16.728  1.00 16.36  ? 421  PHE A N     1 
ATOM   3265  C CA    . PHE A 1 421 ? -1.792  20.794  16.534  1.00 16.28  ? 421  PHE A CA    1 
ATOM   3266  C C     . PHE A 1 421 ? -1.843  19.385  17.118  1.00 16.72  ? 421  PHE A C     1 
ATOM   3267  O O     . PHE A 1 421 ? -0.933  18.584  16.895  1.00 16.47  ? 421  PHE A O     1 
ATOM   3268  C CB    . PHE A 1 421 ? -2.159  20.732  15.047  1.00 15.91  ? 421  PHE A CB    1 
ATOM   3269  C CG    . PHE A 1 421 ? -2.070  22.051  14.327  1.00 15.58  ? 421  PHE A CG    1 
ATOM   3270  C CD1   . PHE A 1 421 ? -1.850  22.083  12.962  1.00 15.65  ? 421  PHE A CD1   1 
ATOM   3271  C CD2   . PHE A 1 421 ? -2.230  23.250  15.001  1.00 14.85  ? 421  PHE A CD2   1 
ATOM   3272  C CE1   . PHE A 1 421 ? -1.779  23.281  12.275  1.00 14.94  ? 421  PHE A CE1   1 
ATOM   3273  C CE2   . PHE A 1 421 ? -2.147  24.440  14.321  1.00 14.29  ? 421  PHE A CE2   1 
ATOM   3274  C CZ    . PHE A 1 421 ? -1.926  24.458  12.970  1.00 15.36  ? 421  PHE A CZ    1 
ATOM   3275  N N     . MET A 1 422 ? -2.945  19.089  17.809  1.00 16.59  ? 422  MET A N     1 
ATOM   3276  C CA    . MET A 1 422 ? -3.153  17.812  18.466  1.00 16.83  ? 422  MET A CA    1 
ATOM   3277  C C     . MET A 1 422 ? -4.316  17.024  17.854  1.00 17.07  ? 422  MET A C     1 
ATOM   3278  O O     . MET A 1 422 ? -4.171  15.827  17.548  1.00 17.46  ? 422  MET A O     1 
ATOM   3279  C CB    . MET A 1 422 ? -3.393  18.041  19.957  1.00 16.50  ? 422  MET A CB    1 
ATOM   3280  C CG    . MET A 1 422 ? -2.223  18.699  20.624  1.00 17.07  ? 422  MET A CG    1 
ATOM   3281  S SD    . MET A 1 422 ? -0.775  17.616  20.622  1.00 18.92  ? 422  MET A SD    1 
ATOM   3282  C CE    . MET A 1 422 ? -1.342  16.415  21.831  1.00 15.16  ? 422  MET A CE    1 
ATOM   3283  N N     . ILE A 1 423 ? -5.463  17.685  17.702  1.00 16.90  ? 423  ILE A N     1 
ATOM   3284  C CA    . ILE A 1 423 ? -6.627  17.100  17.064  1.00 17.31  ? 423  ILE A CA    1 
ATOM   3285  C C     . ILE A 1 423 ? -7.108  18.093  16.025  1.00 17.84  ? 423  ILE A C     1 
ATOM   3286  O O     . ILE A 1 423 ? -7.470  19.236  16.350  1.00 18.12  ? 423  ILE A O     1 
ATOM   3287  C CB    . ILE A 1 423 ? -7.751  16.742  18.087  1.00 17.35  ? 423  ILE A CB    1 
ATOM   3288  C CG1   . ILE A 1 423 ? -7.219  15.730  19.108  1.00 17.50  ? 423  ILE A CG1   1 
ATOM   3289  C CG2   . ILE A 1 423 ? -9.011  16.209  17.379  1.00 15.83  ? 423  ILE A CG2   1 
ATOM   3290  C CD1   . ILE A 1 423 ? -8.098  15.560  20.333  1.00 17.67  ? 423  ILE A CD1   1 
ATOM   3291  N N     . THR A 1 424 ? -7.111  17.650  14.775  1.00 17.96  ? 424  THR A N     1 
ATOM   3292  C CA    . THR A 1 424 ? -7.365  18.545  13.659  1.00 18.63  ? 424  THR A CA    1 
ATOM   3293  C C     . THR A 1 424 ? -7.730  17.763  12.402  1.00 18.34  ? 424  THR A C     1 
ATOM   3294  O O     . THR A 1 424 ? -7.279  16.628  12.238  1.00 18.41  ? 424  THR A O     1 
ATOM   3295  C CB    . THR A 1 424 ? -6.128  19.476  13.391  1.00 18.91  ? 424  THR A CB    1 
ATOM   3296  O OG1   . THR A 1 424 ? -6.362  20.265  12.218  1.00 20.63  ? 424  THR A OG1   1 
ATOM   3297  C CG2   . THR A 1 424 ? -4.818  18.678  13.218  1.00 18.00  ? 424  THR A CG2   1 
ATOM   3298  N N     . PRO A 1 425 ? -8.561  18.352  11.509  1.00 18.23  ? 425  PRO A N     1 
ATOM   3299  C CA    . PRO A 1 425 ? -8.694  17.692  10.193  1.00 18.08  ? 425  PRO A CA    1 
ATOM   3300  C C     . PRO A 1 425 ? -7.398  17.864  9.410   1.00 18.35  ? 425  PRO A C     1 
ATOM   3301  O O     . PRO A 1 425 ? -6.630  18.805  9.685   1.00 18.24  ? 425  PRO A O     1 
ATOM   3302  C CB    . PRO A 1 425 ? -9.816  18.498  9.487   1.00 17.81  ? 425  PRO A CB    1 
ATOM   3303  C CG    . PRO A 1 425 ? -10.431 19.373  10.545  1.00 17.48  ? 425  PRO A CG    1 
ATOM   3304  C CD    . PRO A 1 425 ? -9.390  19.571  11.603  1.00 18.06  ? 425  PRO A CD    1 
ATOM   3305  N N     . LEU A 1 426 ? -7.130  16.942  8.490   1.00 18.13  ? 426  LEU A N     1 
ATOM   3306  C CA    . LEU A 1 426 ? -6.247  17.240  7.373   1.00 18.79  ? 426  LEU A CA    1 
ATOM   3307  C C     . LEU A 1 426 ? -7.151  17.379  6.152   1.00 19.10  ? 426  LEU A C     1 
ATOM   3308  O O     . LEU A 1 426 ? -8.028  16.542  5.931   1.00 19.49  ? 426  LEU A O     1 
ATOM   3309  C CB    . LEU A 1 426 ? -5.149  16.170  7.177   1.00 19.62  ? 426  LEU A CB    1 
ATOM   3310  C CG    . LEU A 1 426 ? -3.939  16.125  8.123   1.00 18.52  ? 426  LEU A CG    1 
ATOM   3311  C CD1   . LEU A 1 426 ? -4.368  15.767  9.552   1.00 20.69  ? 426  LEU A CD1   1 
ATOM   3312  C CD2   . LEU A 1 426 ? -2.961  15.126  7.638   1.00 18.15  ? 426  LEU A CD2   1 
ATOM   3313  N N     . PRO A 1 427 ? -6.963  18.458  5.370   1.00 19.40  ? 427  PRO A N     1 
ATOM   3314  C CA    . PRO A 1 427 ? -7.940  18.881  4.356   1.00 19.13  ? 427  PRO A CA    1 
ATOM   3315  C C     . PRO A 1 427 ? -8.182  17.872  3.213   1.00 19.92  ? 427  PRO A C     1 
ATOM   3316  O O     . PRO A 1 427 ? -9.324  17.761  2.691   1.00 19.60  ? 427  PRO A O     1 
ATOM   3317  C CB    . PRO A 1 427 ? -7.327  20.171  3.812   1.00 19.41  ? 427  PRO A CB    1 
ATOM   3318  C CG    . PRO A 1 427 ? -5.871  20.087  4.122   1.00 18.86  ? 427  PRO A CG    1 
ATOM   3319  C CD    . PRO A 1 427 ? -5.782  19.346  5.411   1.00 18.92  ? 427  PRO A CD    1 
ATOM   3320  N N     . GLY A 1 428 ? -7.128  17.148  2.819   1.00 19.76  ? 428  GLY A N     1 
ATOM   3321  C CA    . GLY A 1 428 ? -7.276  16.112  1.790   1.00 19.93  ? 428  GLY A CA    1 
ATOM   3322  C C     . GLY A 1 428 ? -7.631  14.742  2.325   1.00 20.17  ? 428  GLY A C     1 
ATOM   3323  O O     . GLY A 1 428 ? -7.885  13.843  1.538   1.00 20.76  ? 428  GLY A O     1 
ATOM   3324  N N     . ALA A 1 429 ? -7.657  14.577  3.653   1.00 20.00  ? 429  ALA A N     1 
ATOM   3325  C CA    . ALA A 1 429 ? -7.796  13.239  4.267   1.00 20.16  ? 429  ALA A CA    1 
ATOM   3326  C C     . ALA A 1 429 ? -9.067  12.990  5.091   1.00 20.15  ? 429  ALA A C     1 
ATOM   3327  O O     . ALA A 1 429 ? -9.539  11.848  5.168   1.00 19.71  ? 429  ALA A O     1 
ATOM   3328  C CB    . ALA A 1 429 ? -6.548  12.880  5.108   1.00 19.66  ? 429  ALA A CB    1 
ATOM   3329  N N     . ILE A 1 430 ? -9.606  14.047  5.705   1.00 20.13  ? 430  ILE A N     1 
ATOM   3330  C CA    . ILE A 1 430 ? -10.695 13.911  6.669   1.00 19.99  ? 430  ILE A CA    1 
ATOM   3331  C C     . ILE A 1 430 ? -11.901 14.743  6.227   1.00 19.93  ? 430  ILE A C     1 
ATOM   3332  O O     . ILE A 1 430 ? -11.782 15.934  5.924   1.00 20.54  ? 430  ILE A O     1 
ATOM   3333  C CB    . ILE A 1 430 ? -10.228 14.305  8.108   1.00 20.21  ? 430  ILE A CB    1 
ATOM   3334  C CG1   . ILE A 1 430 ? -9.136  13.344  8.602   1.00 20.90  ? 430  ILE A CG1   1 
ATOM   3335  C CG2   . ILE A 1 430 ? -11.375 14.256  9.092   1.00 20.26  ? 430  ILE A CG2   1 
ATOM   3336  C CD1   . ILE A 1 430 ? -8.418  13.779  9.869   1.00 20.41  ? 430  ILE A CD1   1 
ATOM   3337  N N     . GLU A 1 431 ? -13.057 14.100  6.162   1.00 19.50  ? 431  GLU A N     1 
ATOM   3338  C CA    . GLU A 1 431 ? -14.306 14.793  5.888   1.00 19.62  ? 431  GLU A CA    1 
ATOM   3339  C C     . GLU A 1 431 ? -14.723 15.584  7.119   1.00 19.38  ? 431  GLU A C     1 
ATOM   3340  O O     . GLU A 1 431 ? -14.565 15.106  8.245   1.00 19.42  ? 431  GLU A O     1 
ATOM   3341  C CB    . GLU A 1 431 ? -15.396 13.800  5.517   1.00 19.27  ? 431  GLU A CB    1 
ATOM   3342  C CG    . GLU A 1 431 ? -15.069 12.980  4.291   1.00 21.39  ? 431  GLU A CG    1 
ATOM   3343  C CD    . GLU A 1 431 ? -16.266 12.229  3.770   1.00 23.56  ? 431  GLU A CD    1 
ATOM   3344  O OE1   . GLU A 1 431 ? -16.886 11.470  4.537   1.00 26.62  ? 431  GLU A OE1   1 
ATOM   3345  O OE2   . GLU A 1 431 ? -16.588 12.390  2.589   1.00 25.68  ? 431  GLU A OE2   1 
ATOM   3346  N N     . LEU A 1 432 ? -15.262 16.779  6.902   1.00 19.07  ? 432  LEU A N     1 
ATOM   3347  C CA    . LEU A 1 432 ? -15.468 17.744  8.001   1.00 19.01  ? 432  LEU A CA    1 
ATOM   3348  C C     . LEU A 1 432 ? -16.875 17.690  8.612   1.00 19.36  ? 432  LEU A C     1 
ATOM   3349  O O     . LEU A 1 432 ? -17.868 17.550  7.896   1.00 19.78  ? 432  LEU A O     1 
ATOM   3350  C CB    . LEU A 1 432 ? -15.138 19.174  7.523   1.00 18.34  ? 432  LEU A CB    1 
ATOM   3351  C CG    . LEU A 1 432 ? -13.864 19.338  6.676   1.00 17.68  ? 432  LEU A CG    1 
ATOM   3352  C CD1   . LEU A 1 432 ? -13.661 20.749  6.107   1.00 13.87  ? 432  LEU A CD1   1 
ATOM   3353  C CD2   . LEU A 1 432 ? -12.639 18.885  7.477   1.00 17.62  ? 432  LEU A CD2   1 
ATOM   3354  N N     . LYS A 1 433 ? -16.946 17.756  9.938   1.00 19.80  ? 433  LYS A N     1 
ATOM   3355  C CA    . LYS A 1 433 ? -18.205 18.065  10.637  1.00 20.09  ? 433  LYS A CA    1 
ATOM   3356  C C     . LYS A 1 433 ? -18.083 19.457  11.257  1.00 20.31  ? 433  LYS A C     1 
ATOM   3357  O O     . LYS A 1 433 ? -17.136 19.723  12.002  1.00 20.58  ? 433  LYS A O     1 
ATOM   3358  C CB    . LYS A 1 433 ? -18.531 17.017  11.697  1.00 19.62  ? 433  LYS A CB    1 
ATOM   3359  C CG    . LYS A 1 433 ? -18.772 15.606  11.111  1.00 20.65  ? 433  LYS A CG    1 
ATOM   3360  C CD    . LYS A 1 433 ? -18.839 14.545  12.189  1.00 20.02  ? 433  LYS A CD    1 
ATOM   3361  C CE    . LYS A 1 433 ? -18.974 13.179  11.584  1.00 20.74  ? 433  LYS A CE    1 
ATOM   3362  N NZ    . LYS A 1 433 ? -19.387 12.163  12.599  1.00 23.02  ? 433  LYS A NZ    1 
ATOM   3363  N N     . ALA A 1 434 ? -19.006 20.354  10.910  1.00 19.89  ? 434  ALA A N     1 
ATOM   3364  C CA    . ALA A 1 434 ? -18.993 21.710  11.457  1.00 19.10  ? 434  ALA A CA    1 
ATOM   3365  C C     . ALA A 1 434 ? -19.014 21.692  12.992  1.00 19.35  ? 434  ALA A C     1 
ATOM   3366  O O     . ALA A 1 434 ? -19.988 21.226  13.627  1.00 19.58  ? 434  ALA A O     1 
ATOM   3367  C CB    . ALA A 1 434 ? -20.160 22.519  10.900  1.00 19.17  ? 434  ALA A CB    1 
ATOM   3368  N N     . GLY A 1 435 ? -17.932 22.188  13.588  1.00 18.94  ? 435  GLY A N     1 
ATOM   3369  C CA    . GLY A 1 435 ? -17.806 22.226  15.039  1.00 18.16  ? 435  GLY A CA    1 
ATOM   3370  C C     . GLY A 1 435 ? -16.863 21.200  15.622  1.00 17.92  ? 435  GLY A C     1 
ATOM   3371  O O     . GLY A 1 435 ? -16.548 21.273  16.795  1.00 18.18  ? 435  GLY A O     1 
ATOM   3372  N N     . SER A 1 436 ? -16.386 20.256  14.810  1.00 17.84  ? 436  SER A N     1 
ATOM   3373  C CA    . SER A 1 436 ? -15.507 19.183  15.303  1.00 17.53  ? 436  SER A CA    1 
ATOM   3374  C C     . SER A 1 436 ? -14.024 19.356  14.878  1.00 18.04  ? 436  SER A C     1 
ATOM   3375  O O     . SER A 1 436 ? -13.705 19.613  13.706  1.00 17.58  ? 436  SER A O     1 
ATOM   3376  C CB    . SER A 1 436 ? -16.051 17.812  14.857  1.00 17.20  ? 436  SER A CB    1 
ATOM   3377  O OG    . SER A 1 436 ? -15.219 16.721  15.245  1.00 16.70  ? 436  SER A OG    1 
ATOM   3378  N N     . ALA A 1 437 ? -13.117 19.197  15.840  1.00 17.83  ? 437  ALA A N     1 
ATOM   3379  C CA    . ALA A 1 437 ? -11.683 19.159  15.539  1.00 17.42  ? 437  ALA A CA    1 
ATOM   3380  C C     . ALA A 1 437 ? -11.346 17.871  14.770  1.00 17.24  ? 437  ALA A C     1 
ATOM   3381  O O     . ALA A 1 437 ? -10.398 17.841  13.980  1.00 17.90  ? 437  ALA A O     1 
ATOM   3382  C CB    . ALA A 1 437 ? -10.836 19.293  16.826  1.00 16.67  ? 437  ALA A CB    1 
ATOM   3383  N N     . THR A 1 438 ? -12.156 16.834  14.978  1.00 17.01  ? 438  THR A N     1 
ATOM   3384  C CA    . THR A 1 438 ? -12.108 15.542  14.234  1.00 16.72  ? 438  THR A CA    1 
ATOM   3385  C C     . THR A 1 438 ? -11.124 14.533  14.846  1.00 17.29  ? 438  THR A C     1 
ATOM   3386  O O     . THR A 1 438 ? -11.367 14.020  15.953  1.00 17.69  ? 438  THR A O     1 
ATOM   3387  C CB    . THR A 1 438 ? -11.914 15.669  12.668  1.00 16.62  ? 438  THR A CB    1 
ATOM   3388  O OG1   . THR A 1 438 ? -10.552 15.999  12.360  1.00 16.83  ? 438  THR A OG1   1 
ATOM   3389  C CG2   . THR A 1 438 ? -12.825 16.729  12.063  1.00 15.00  ? 438  THR A CG2   1 
ATOM   3390  N N     . ARG A 1 439 ? -10.019 14.262  14.149  1.00 17.02  ? 439  ARG A N     1 
ATOM   3391  C CA    . ARG A 1 439 ? -9.166  13.132  14.468  1.00 16.76  ? 439  ARG A CA    1 
ATOM   3392  C C     . ARG A 1 439 ? -7.831  13.605  15.003  1.00 16.58  ? 439  ARG A C     1 
ATOM   3393  O O     . ARG A 1 439 ? -7.382  14.697  14.643  1.00 16.70  ? 439  ARG A O     1 
ATOM   3394  C CB    . ARG A 1 439 ? -8.935  12.270  13.214  1.00 17.46  ? 439  ARG A CB    1 
ATOM   3395  C CG    . ARG A 1 439 ? -10.191 11.679  12.576  1.00 18.23  ? 439  ARG A CG    1 
ATOM   3396  C CD    . ARG A 1 439 ? -9.903  10.268  11.967  1.00 19.62  ? 439  ARG A CD    1 
ATOM   3397  N NE    . ARG A 1 439 ? -11.079 9.747   11.264  1.00 19.85  ? 439  ARG A NE    1 
ATOM   3398  C CZ    . ARG A 1 439 ? -12.109 9.125   11.842  1.00 21.26  ? 439  ARG A CZ    1 
ATOM   3399  N NH1   . ARG A 1 439 ? -12.140 8.919   13.160  1.00 21.22  ? 439  ARG A NH1   1 
ATOM   3400  N NH2   . ARG A 1 439 ? -13.129 8.717   11.097  1.00 20.30  ? 439  ARG A NH2   1 
ATOM   3401  N N     . PRO A 1 440 ? -7.171  12.777  15.851  1.00 16.56  ? 440  PRO A N     1 
ATOM   3402  C CA    . PRO A 1 440 ? -5.850  13.136  16.385  1.00 16.06  ? 440  PRO A CA    1 
ATOM   3403  C C     . PRO A 1 440 ? -4.819  13.239  15.299  1.00 15.91  ? 440  PRO A C     1 
ATOM   3404  O O     . PRO A 1 440 ? -4.919  12.532  14.297  1.00 15.80  ? 440  PRO A O     1 
ATOM   3405  C CB    . PRO A 1 440 ? -5.485  11.950  17.287  1.00 16.41  ? 440  PRO A CB    1 
ATOM   3406  C CG    . PRO A 1 440 ? -6.405  10.806  16.856  1.00 16.38  ? 440  PRO A CG    1 
ATOM   3407  C CD    . PRO A 1 440 ? -7.647  11.467  16.360  1.00 16.61  ? 440  PRO A CD    1 
ATOM   3408  N N     . PHE A 1 441 ? -3.829  14.112  15.484  1.00 16.12  ? 441  PHE A N     1 
ATOM   3409  C CA    . PHE A 1 441 ? -2.707  14.174  14.549  1.00 16.11  ? 441  PHE A CA    1 
ATOM   3410  C C     . PHE A 1 441 ? -1.753  12.999  14.791  1.00 16.92  ? 441  PHE A C     1 
ATOM   3411  O O     . PHE A 1 441 ? -1.827  12.331  15.835  1.00 16.95  ? 441  PHE A O     1 
ATOM   3412  C CB    . PHE A 1 441 ? -1.955  15.488  14.711  1.00 15.94  ? 441  PHE A CB    1 
ATOM   3413  C CG    . PHE A 1 441 ? -0.980  15.772  13.593  1.00 14.71  ? 441  PHE A CG    1 
ATOM   3414  C CD1   . PHE A 1 441 ? -1.439  16.139  12.331  1.00 12.94  ? 441  PHE A CD1   1 
ATOM   3415  C CD2   . PHE A 1 441 ? 0.391   15.683  13.813  1.00 11.20  ? 441  PHE A CD2   1 
ATOM   3416  C CE1   . PHE A 1 441 ? -0.535  16.394  11.273  1.00 13.62  ? 441  PHE A CE1   1 
ATOM   3417  C CE2   . PHE A 1 441 ? 1.292   15.939  12.793  1.00 11.85  ? 441  PHE A CE2   1 
ATOM   3418  C CZ    . PHE A 1 441 ? 0.834   16.298  11.510  1.00 12.78  ? 441  PHE A CZ    1 
ATOM   3419  N N     . PHE A 1 442 ? -0.867  12.752  13.830  1.00 17.59  ? 442  PHE A N     1 
ATOM   3420  C CA    . PHE A 1 442 ? 0.247   11.805  14.000  1.00 18.10  ? 442  PHE A CA    1 
ATOM   3421  C C     . PHE A 1 442 ? 0.944   11.947  15.358  1.00 18.48  ? 442  PHE A C     1 
ATOM   3422  O O     . PHE A 1 442 ? 1.435   13.032  15.733  1.00 17.93  ? 442  PHE A O     1 
ATOM   3423  C CB    . PHE A 1 442 ? 1.257   11.940  12.851  1.00 18.14  ? 442  PHE A CB    1 
ATOM   3424  C CG    . PHE A 1 442 ? 0.609   11.963  11.475  1.00 19.42  ? 442  PHE A CG    1 
ATOM   3425  C CD1   . PHE A 1 442 ? 0.929   12.955  10.554  1.00 19.35  ? 442  PHE A CD1   1 
ATOM   3426  C CD2   . PHE A 1 442 ? -0.359  11.014  11.125  1.00 19.35  ? 442  PHE A CD2   1 
ATOM   3427  C CE1   . PHE A 1 442 ? 0.326   12.982  9.290   1.00 19.95  ? 442  PHE A CE1   1 
ATOM   3428  C CE2   . PHE A 1 442 ? -0.974  11.038  9.875   1.00 20.13  ? 442  PHE A CE2   1 
ATOM   3429  C CZ    . PHE A 1 442 ? -0.626  12.022  8.951   1.00 20.32  ? 442  PHE A CZ    1 
ATOM   3430  N N     . GLY A 1 443 ? 0.941   10.838  16.095  1.00 18.12  ? 443  GLY A N     1 
ATOM   3431  C CA    . GLY A 1 443 ? 1.683   10.718  17.333  1.00 18.14  ? 443  GLY A CA    1 
ATOM   3432  C C     . GLY A 1 443 ? 0.830   11.035  18.532  1.00 18.29  ? 443  GLY A C     1 
ATOM   3433  O O     . GLY A 1 443 ? 1.318   11.014  19.655  1.00 18.45  ? 443  GLY A O     1 
ATOM   3434  N N     . VAL A 1 444 ? -0.446  11.340  18.296  1.00 18.06  ? 444  VAL A N     1 
ATOM   3435  C CA    . VAL A 1 444 ? -1.322  11.838  19.361  1.00 17.36  ? 444  VAL A CA    1 
ATOM   3436  C C     . VAL A 1 444 ? -2.336  10.774  19.748  1.00 17.71  ? 444  VAL A C     1 
ATOM   3437  O O     . VAL A 1 444 ? -3.137  10.343  18.913  1.00 17.58  ? 444  VAL A O     1 
ATOM   3438  C CB    . VAL A 1 444 ? -2.033  13.166  18.958  1.00 17.43  ? 444  VAL A CB    1 
ATOM   3439  C CG1   . VAL A 1 444 ? -3.023  13.627  20.056  1.00 15.00  ? 444  VAL A CG1   1 
ATOM   3440  C CG2   . VAL A 1 444 ? -0.984  14.232  18.624  1.00 16.56  ? 444  VAL A CG2   1 
ATOM   3441  N N     . GLN A 1 445 ? -2.260  10.327  21.002  1.00 17.76  ? 445  GLN A N     1 
ATOM   3442  C CA    . GLN A 1 445 ? -3.215  9.373   21.539  1.00 18.56  ? 445  GLN A CA    1 
ATOM   3443  C C     . GLN A 1 445 ? -4.145  10.028  22.563  1.00 18.75  ? 445  GLN A C     1 
ATOM   3444  O O     . GLN A 1 445 ? -3.846  10.069  23.770  1.00 18.46  ? 445  GLN A O     1 
ATOM   3445  C CB    . GLN A 1 445 ? -2.503  8.173   22.157  1.00 18.81  ? 445  GLN A CB    1 
ATOM   3446  C CG    . GLN A 1 445 ? -1.432  7.583   21.255  1.00 20.78  ? 445  GLN A CG    1 
ATOM   3447  C CD    . GLN A 1 445 ? -0.902  6.254   21.769  1.00 23.85  ? 445  GLN A CD    1 
ATOM   3448  O OE1   . GLN A 1 445 ? -1.676  5.359   22.139  1.00 24.06  ? 445  GLN A OE1   1 
ATOM   3449  N NE2   . GLN A 1 445 ? 0.419   6.108   21.766  1.00 23.37  ? 445  GLN A NE2   1 
ATOM   3450  N N     . PRO A 1 446 ? -5.283  10.548  22.085  1.00 19.12  ? 446  PRO A N     1 
ATOM   3451  C CA    . PRO A 1 446 ? -6.225  11.034  23.064  1.00 19.30  ? 446  PRO A CA    1 
ATOM   3452  C C     . PRO A 1 446 ? -6.966  9.873   23.723  1.00 19.97  ? 446  PRO A C     1 
ATOM   3453  O O     . PRO A 1 446 ? -7.014  8.770   23.183  1.00 19.82  ? 446  PRO A O     1 
ATOM   3454  C CB    . PRO A 1 446 ? -7.186  11.889  22.235  1.00 19.05  ? 446  PRO A CB    1 
ATOM   3455  C CG    . PRO A 1 446 ? -7.146  11.288  20.861  1.00 20.15  ? 446  PRO A CG    1 
ATOM   3456  C CD    . PRO A 1 446 ? -5.774  10.690  20.695  1.00 19.22  ? 446  PRO A CD    1 
ATOM   3457  N N     . ALA A 1 447 ? -7.518  10.137  24.899  1.00 20.55  ? 447  ALA A N     1 
ATOM   3458  C CA    . ALA A 1 447 ? -8.538  9.298   25.479  1.00 21.09  ? 447  ALA A CA    1 
ATOM   3459  C C     . ALA A 1 447 ? -9.452  10.194  26.316  1.00 21.64  ? 447  ALA A C     1 
ATOM   3460  O O     . ALA A 1 447 ? -9.112  11.350  26.620  1.00 21.08  ? 447  ALA A O     1 
ATOM   3461  C CB    . ALA A 1 447 ? -7.919  8.188   26.338  1.00 20.85  ? 447  ALA A CB    1 
ATOM   3462  N N     . LEU A 1 448 ? -10.615 9.648   26.664  1.00 22.07  ? 448  LEU A N     1 
ATOM   3463  C CA    . LEU A 1 448 ? -11.552 10.311  27.528  1.00 22.23  ? 448  LEU A CA    1 
ATOM   3464  C C     . LEU A 1 448 ? -11.659 9.461   28.780  1.00 23.15  ? 448  LEU A C     1 
ATOM   3465  O O     . LEU A 1 448 ? -11.782 8.223   28.693  1.00 23.20  ? 448  LEU A O     1 
ATOM   3466  C CB    . LEU A 1 448 ? -12.912 10.456  26.835  1.00 21.91  ? 448  LEU A CB    1 
ATOM   3467  C CG    . LEU A 1 448 ? -12.981 11.242  25.513  1.00 21.70  ? 448  LEU A CG    1 
ATOM   3468  C CD1   . LEU A 1 448 ? -14.384 11.148  24.852  1.00 19.93  ? 448  LEU A CD1   1 
ATOM   3469  C CD2   . LEU A 1 448 ? -12.570 12.709  25.673  1.00 22.33  ? 448  LEU A CD2   1 
ATOM   3470  N N     . VAL A 1 449 ? -11.576 10.122  29.943  1.00 23.35  ? 449  VAL A N     1 
ATOM   3471  C CA    . VAL A 1 449 ? -11.754 9.453   31.238  1.00 23.13  ? 449  VAL A CA    1 
ATOM   3472  C C     . VAL A 1 449 ? -12.818 10.188  32.063  1.00 23.70  ? 449  VAL A C     1 
ATOM   3473  O O     . VAL A 1 449 ? -13.021 11.395  31.899  1.00 23.75  ? 449  VAL A O     1 
ATOM   3474  C CB    . VAL A 1 449 ? -10.408 9.337   32.047  1.00 23.20  ? 449  VAL A CB    1 
ATOM   3475  C CG1   . VAL A 1 449 ? -9.352  8.525   31.270  1.00 20.91  ? 449  VAL A CG1   1 
ATOM   3476  C CG2   . VAL A 1 449 ? -9.867  10.711  32.440  1.00 22.20  ? 449  VAL A CG2   1 
ATOM   3477  N N     . ASP A 1 450 ? -13.510 9.477   32.944  1.00 24.21  ? 450  ASP A N     1 
ATOM   3478  C CA    . ASP A 1 450 ? -14.412 10.173  33.873  1.00 24.72  ? 450  ASP A CA    1 
ATOM   3479  C C     . ASP A 1 450 ? -13.615 10.814  35.007  1.00 24.71  ? 450  ASP A C     1 
ATOM   3480  O O     . ASP A 1 450 ? -12.384 10.819  34.983  1.00 24.39  ? 450  ASP A O     1 
ATOM   3481  C CB    . ASP A 1 450 ? -15.512 9.259   34.412  1.00 24.35  ? 450  ASP A CB    1 
ATOM   3482  C CG    . ASP A 1 450 ? -14.971 8.100   35.218  1.00 25.27  ? 450  ASP A CG    1 
ATOM   3483  O OD1   . ASP A 1 450 ? -13.749 8.060   35.533  1.00 23.73  ? 450  ASP A OD1   1 
ATOM   3484  O OD2   . ASP A 1 450 ? -15.795 7.215   35.528  1.00 26.05  ? 450  ASP A OD2   1 
ATOM   3485  N N     . ASN A 1 451 ? -14.323 11.363  35.983  1.00 25.39  ? 451  ASN A N     1 
ATOM   3486  C CA    . ASN A 1 451 ? -13.687 12.064  37.086  1.00 26.42  ? 451  ASN A CA    1 
ATOM   3487  C C     . ASN A 1 451 ? -12.832 11.154  37.964  1.00 27.13  ? 451  ASN A C     1 
ATOM   3488  O O     . ASN A 1 451 ? -11.948 11.631  38.677  1.00 27.08  ? 451  ASN A O     1 
ATOM   3489  C CB    . ASN A 1 451 ? -14.736 12.817  37.909  1.00 26.15  ? 451  ASN A CB    1 
ATOM   3490  C CG    . ASN A 1 451 ? -15.351 13.985  37.147  1.00 27.21  ? 451  ASN A CG    1 
ATOM   3491  O OD1   . ASN A 1 451 ? -14.785 14.472  36.174  1.00 26.81  ? 451  ASN A OD1   1 
ATOM   3492  N ND2   . ASN A 1 451 ? -16.512 14.444  37.599  1.00 27.69  ? 451  ASN A ND2   1 
ATOM   3493  N N     . GLU A 1 452 ? -13.088 9.846   37.882  1.00 28.16  ? 452  GLU A N     1 
ATOM   3494  C CA    . GLU A 1 452 ? -12.343 8.820   38.638  1.00 29.13  ? 452  GLU A CA    1 
ATOM   3495  C C     . GLU A 1 452 ? -11.197 8.203   37.820  1.00 28.74  ? 452  GLU A C     1 
ATOM   3496  O O     . GLU A 1 452 ? -10.487 7.316   38.290  1.00 28.78  ? 452  GLU A O     1 
ATOM   3497  C CB    . GLU A 1 452 ? -13.291 7.716   39.136  1.00 29.51  ? 452  GLU A CB    1 
ATOM   3498  C CG    . GLU A 1 452 ? -14.334 8.153   40.184  1.00 33.40  ? 452  GLU A CG    1 
ATOM   3499  C CD    . GLU A 1 452 ? -15.339 9.213   39.686  1.00 38.83  ? 452  GLU A CD    1 
ATOM   3500  O OE1   . GLU A 1 452 ? -15.917 9.053   38.576  1.00 41.30  ? 452  GLU A OE1   1 
ATOM   3501  O OE2   . GLU A 1 452 ? -15.557 10.212  40.418  1.00 40.64  ? 452  GLU A OE2   1 
ATOM   3502  N N     . GLY A 1 453 ? -11.007 8.672   36.597  1.00 28.96  ? 453  GLY A N     1 
ATOM   3503  C CA    . GLY A 1 453 ? -9.920  8.154   35.762  1.00 29.18  ? 453  GLY A CA    1 
ATOM   3504  C C     . GLY A 1 453 ? -10.258 6.910   34.955  1.00 29.42  ? 453  GLY A C     1 
ATOM   3505  O O     . GLY A 1 453 ? -9.382  6.355   34.279  1.00 28.90  ? 453  GLY A O     1 
ATOM   3506  N N     . HIS A 1 454 ? -11.519 6.471   35.034  1.00 30.26  ? 454  HIS A N     1 
ATOM   3507  C CA    . HIS A 1 454 ? -12.004 5.324   34.258  1.00 31.79  ? 454  HIS A CA    1 
ATOM   3508  C C     . HIS A 1 454 ? -12.134 5.726   32.782  1.00 32.30  ? 454  HIS A C     1 
ATOM   3509  O O     . HIS A 1 454 ? -12.912 6.629   32.456  1.00 31.94  ? 454  HIS A O     1 
ATOM   3510  C CB    . HIS A 1 454 ? -13.384 4.851   34.731  1.00 31.98  ? 454  HIS A CB    1 
ATOM   3511  C CG    . HIS A 1 454 ? -13.504 4.630   36.209  1.00 34.53  ? 454  HIS A CG    1 
ATOM   3512  N ND1   . HIS A 1 454 ? -12.580 3.905   36.940  1.00 35.98  ? 454  HIS A ND1   1 
ATOM   3513  C CD2   . HIS A 1 454 ? -14.476 4.992   37.083  1.00 34.75  ? 454  HIS A CD2   1 
ATOM   3514  C CE1   . HIS A 1 454 ? -12.968 3.853   38.204  1.00 36.97  ? 454  HIS A CE1   1 
ATOM   3515  N NE2   . HIS A 1 454 ? -14.115 4.502   38.316  1.00 37.63  ? 454  HIS A NE2   1 
ATOM   3516  N N     . PRO A 1 455 ? -11.360 5.072   31.892  1.00 32.92  ? 455  PRO A N     1 
ATOM   3517  C CA    . PRO A 1 455 ? -11.485 5.269   30.447  1.00 33.18  ? 455  PRO A CA    1 
ATOM   3518  C C     . PRO A 1 455 ? -12.907 5.031   29.953  1.00 33.44  ? 455  PRO A C     1 
ATOM   3519  O O     . PRO A 1 455 ? -13.597 4.128   30.438  1.00 33.18  ? 455  PRO A O     1 
ATOM   3520  C CB    . PRO A 1 455 ? -10.521 4.229   29.871  1.00 33.54  ? 455  PRO A CB    1 
ATOM   3521  C CG    . PRO A 1 455 ? -9.457  4.101   30.928  1.00 32.99  ? 455  PRO A CG    1 
ATOM   3522  C CD    . PRO A 1 455 ? -10.269 4.128   32.211  1.00 33.20  ? 455  PRO A CD    1 
ATOM   3523  N N     . GLN A 1 456 ? -13.343 5.886   29.028  1.00 33.69  ? 456  GLN A N     1 
ATOM   3524  C CA    . GLN A 1 456 ? -14.689 5.831   28.459  1.00 33.59  ? 456  GLN A CA    1 
ATOM   3525  C C     . GLN A 1 456 ? -14.515 5.535   26.982  1.00 33.86  ? 456  GLN A C     1 
ATOM   3526  O O     . GLN A 1 456 ? -13.844 6.299   26.254  1.00 33.15  ? 456  GLN A O     1 
ATOM   3527  C CB    . GLN A 1 456 ? -15.450 7.148   28.672  1.00 33.39  ? 456  GLN A CB    1 
ATOM   3528  C CG    . GLN A 1 456 ? -15.637 7.590   30.145  1.00 34.28  ? 456  GLN A CG    1 
ATOM   3529  C CD    . GLN A 1 456 ? -16.314 6.533   31.051  1.00 36.18  ? 456  GLN A CD    1 
ATOM   3530  O OE1   . GLN A 1 456 ? -15.824 6.240   32.149  1.00 36.03  ? 456  GLN A OE1   1 
ATOM   3531  N NE2   . GLN A 1 456 ? -17.440 5.972   30.591  1.00 35.33  ? 456  GLN A NE2   1 
ATOM   3532  N N     . GLU A 1 457 ? -15.083 4.402   26.555  1.00 34.01  ? 457  GLU A N     1 
ATOM   3533  C CA    . GLU A 1 457 ? -14.895 3.921   25.183  1.00 34.30  ? 457  GLU A CA    1 
ATOM   3534  C C     . GLU A 1 457 ? -16.097 4.153   24.257  1.00 33.09  ? 457  GLU A C     1 
ATOM   3535  O O     . GLU A 1 457 ? -17.248 4.223   24.703  1.00 32.47  ? 457  GLU A O     1 
ATOM   3536  C CB    . GLU A 1 457 ? -14.422 2.461   25.171  1.00 35.46  ? 457  GLU A CB    1 
ATOM   3537  C CG    . GLU A 1 457 ? -12.932 2.300   24.822  1.00 38.71  ? 457  GLU A CG    1 
ATOM   3538  C CD    . GLU A 1 457 ? -12.007 2.422   26.029  1.00 43.17  ? 457  GLU A CD    1 
ATOM   3539  O OE1   . GLU A 1 457 ? -10.991 3.155   25.936  1.00 46.11  ? 457  GLU A OE1   1 
ATOM   3540  O OE2   . GLU A 1 457 ? -12.288 1.785   27.071  1.00 44.96  ? 457  GLU A OE2   1 
ATOM   3541  N N     . GLY A 1 458 ? -15.800 4.291   22.965  1.00 32.38  ? 458  GLY A N     1 
ATOM   3542  C CA    . GLY A 1 458 ? -16.812 4.537   21.947  1.00 31.19  ? 458  GLY A CA    1 
ATOM   3543  C C     . GLY A 1 458 ? -17.409 5.932   22.036  1.00 30.61  ? 458  GLY A C     1 
ATOM   3544  O O     . GLY A 1 458 ? -16.728 6.885   22.421  1.00 30.49  ? 458  GLY A O     1 
ATOM   3545  N N     . ALA A 1 459 ? -18.691 6.035   21.687  1.00 29.80  ? 459  ALA A N     1 
ATOM   3546  C CA    . ALA A 1 459 ? -19.405 7.295   21.640  1.00 29.31  ? 459  ALA A CA    1 
ATOM   3547  C C     . ALA A 1 459 ? -19.817 7.727   23.045  1.00 28.91  ? 459  ALA A C     1 
ATOM   3548  O O     . ALA A 1 459 ? -20.850 7.306   23.586  1.00 28.86  ? 459  ALA A O     1 
ATOM   3549  C CB    . ALA A 1 459 ? -20.619 7.192   20.699  1.00 28.95  ? 459  ALA A CB    1 
ATOM   3550  N N     . THR A 1 460 ? -18.989 8.581   23.633  1.00 28.61  ? 460  THR A N     1 
ATOM   3551  C CA    . THR A 1 460 ? -19.174 9.012   25.019  1.00 28.11  ? 460  THR A CA    1 
ATOM   3552  C C     . THR A 1 460 ? -18.537 10.372  25.235  1.00 27.71  ? 460  THR A C     1 
ATOM   3553  O O     . THR A 1 460 ? -18.088 11.024  24.286  1.00 27.23  ? 460  THR A O     1 
ATOM   3554  C CB    . THR A 1 460 ? -18.567 7.977   25.982  1.00 28.24  ? 460  THR A CB    1 
ATOM   3555  O OG1   . THR A 1 460 ? -18.904 8.311   27.333  1.00 28.25  ? 460  THR A OG1   1 
ATOM   3556  C CG2   . THR A 1 460 ? -17.060 7.896   25.805  1.00 28.32  ? 460  THR A CG2   1 
ATOM   3557  N N     . GLU A 1 461 ? -18.520 10.818  26.477  1.00 27.33  ? 461  GLU A N     1 
ATOM   3558  C CA    . GLU A 1 461 ? -17.804 12.029  26.804  1.00 28.26  ? 461  GLU A CA    1 
ATOM   3559  C C     . GLU A 1 461 ? -17.053 11.926  28.121  1.00 26.59  ? 461  GLU A C     1 
ATOM   3560  O O     . GLU A 1 461 ? -17.409 11.132  28.992  1.00 26.77  ? 461  GLU A O     1 
ATOM   3561  C CB    . GLU A 1 461 ? -18.705 13.268  26.730  1.00 28.07  ? 461  GLU A CB    1 
ATOM   3562  C CG    . GLU A 1 461 ? -19.929 13.284  27.603  1.00 30.89  ? 461  GLU A CG    1 
ATOM   3563  C CD    . GLU A 1 461 ? -20.727 14.587  27.413  1.00 32.41  ? 461  GLU A CD    1 
ATOM   3564  O OE1   . GLU A 1 461 ? -20.086 15.655  27.217  1.00 37.05  ? 461  GLU A OE1   1 
ATOM   3565  O OE2   . GLU A 1 461 ? -21.988 14.548  27.437  1.00 37.18  ? 461  GLU A OE2   1 
ATOM   3566  N N     . GLY A 1 462 ? -15.987 12.707  28.243  1.00 25.58  ? 462  GLY A N     1 
ATOM   3567  C CA    . GLY A 1 462 ? -15.140 12.660  29.423  1.00 23.97  ? 462  GLY A CA    1 
ATOM   3568  C C     . GLY A 1 462 ? -14.074 13.727  29.418  1.00 23.21  ? 462  GLY A C     1 
ATOM   3569  O O     . GLY A 1 462 ? -14.094 14.649  28.593  1.00 23.08  ? 462  GLY A O     1 
ATOM   3570  N N     . ASN A 1 463 ? -13.145 13.593  30.357  1.00 22.26  ? 463  ASN A N     1 
ATOM   3571  C CA    . ASN A 1 463 ? -11.985 14.475  30.463  1.00 21.48  ? 463  ASN A CA    1 
ATOM   3572  C C     . ASN A 1 463 ? -10.936 14.118  29.421  1.00 20.95  ? 463  ASN A C     1 
ATOM   3573  O O     . ASN A 1 463 ? -10.555 12.945  29.285  1.00 20.83  ? 463  ASN A O     1 
ATOM   3574  C CB    . ASN A 1 463 ? -11.403 14.369  31.867  1.00 21.27  ? 463  ASN A CB    1 
ATOM   3575  C CG    . ASN A 1 463 ? -12.396 14.766  32.916  1.00 20.79  ? 463  ASN A CG    1 
ATOM   3576  O OD1   . ASN A 1 463 ? -12.853 15.905  32.926  1.00 21.75  ? 463  ASN A OD1   1 
ATOM   3577  N ND2   . ASN A 1 463 ? -12.758 13.829  33.798  1.00 18.10  ? 463  ASN A ND2   1 
ATOM   3578  N N     . LEU A 1 464 ? -10.481 15.111  28.666  1.00 20.36  ? 464  LEU A N     1 
ATOM   3579  C CA    . LEU A 1 464 ? -9.574  14.817  27.554  1.00 19.49  ? 464  LEU A CA    1 
ATOM   3580  C C     . LEU A 1 464 ? -8.136  14.698  28.030  1.00 19.22  ? 464  LEU A C     1 
ATOM   3581  O O     . LEU A 1 464 ? -7.542  15.680  28.481  1.00 19.28  ? 464  LEU A O     1 
ATOM   3582  C CB    . LEU A 1 464 ? -9.722  15.857  26.452  1.00 19.49  ? 464  LEU A CB    1 
ATOM   3583  C CG    . LEU A 1 464 ? -8.884  15.744  25.171  1.00 19.65  ? 464  LEU A CG    1 
ATOM   3584  C CD1   . LEU A 1 464 ? -9.006  14.399  24.412  1.00 16.33  ? 464  LEU A CD1   1 
ATOM   3585  C CD2   . LEU A 1 464 ? -9.228  16.928  24.260  1.00 19.33  ? 464  LEU A CD2   1 
ATOM   3586  N N     . VAL A 1 465 ? -7.602  13.479  27.962  1.00 19.04  ? 465  VAL A N     1 
ATOM   3587  C CA    . VAL A 1 465 ? -6.194  13.192  28.300  1.00 18.47  ? 465  VAL A CA    1 
ATOM   3588  C C     . VAL A 1 465 ? -5.436  12.742  27.047  1.00 18.77  ? 465  VAL A C     1 
ATOM   3589  O O     . VAL A 1 465 ? -6.031  12.250  26.086  1.00 18.51  ? 465  VAL A O     1 
ATOM   3590  C CB    . VAL A 1 465 ? -6.012  12.113  29.447  1.00 18.48  ? 465  VAL A CB    1 
ATOM   3591  C CG1   . VAL A 1 465 ? -6.575  12.593  30.805  1.00 17.67  ? 465  VAL A CG1   1 
ATOM   3592  C CG2   . VAL A 1 465 ? -6.589  10.745  29.058  1.00 17.45  ? 465  VAL A CG2   1 
ATOM   3593  N N     . ILE A 1 466 ? -4.121  12.950  27.051  1.00 18.96  ? 466  ILE A N     1 
ATOM   3594  C CA    . ILE A 1 466 ? -3.242  12.378  26.017  1.00 18.60  ? 466  ILE A CA    1 
ATOM   3595  C C     . ILE A 1 466 ? -2.369  11.333  26.739  1.00 18.72  ? 466  ILE A C     1 
ATOM   3596  O O     . ILE A 1 466 ? -1.726  11.637  27.754  1.00 18.48  ? 466  ILE A O     1 
ATOM   3597  C CB    . ILE A 1 466 ? -2.385  13.454  25.286  1.00 18.10  ? 466  ILE A CB    1 
ATOM   3598  C CG1   . ILE A 1 466 ? -3.239  14.673  24.854  1.00 18.54  ? 466  ILE A CG1   1 
ATOM   3599  C CG2   . ILE A 1 466 ? -1.685  12.860  24.090  1.00 17.74  ? 466  ILE A CG2   1 
ATOM   3600  C CD1   . ILE A 1 466 ? -4.519  14.337  24.008  1.00 17.81  ? 466  ILE A CD1   1 
ATOM   3601  N N     . THR A 1 467 ? -2.369  10.110  26.215  1.00 18.18  ? 467  THR A N     1 
ATOM   3602  C CA    . THR A 1 467 ? -1.823  8.963   26.937  1.00 18.02  ? 467  THR A CA    1 
ATOM   3603  C C     . THR A 1 467 ? -0.336  8.657   26.666  1.00 17.79  ? 467  THR A C     1 
ATOM   3604  O O     . THR A 1 467 ? 0.250   7.787   27.310  1.00 17.81  ? 467  THR A O     1 
ATOM   3605  C CB    . THR A 1 467 ? -2.690  7.700   26.731  1.00 17.29  ? 467  THR A CB    1 
ATOM   3606  O OG1   . THR A 1 467 ? -2.632  7.305   25.366  1.00 18.01  ? 467  THR A OG1   1 
ATOM   3607  C CG2   . THR A 1 467 ? -4.148  7.986   27.079  1.00 17.88  ? 467  THR A CG2   1 
ATOM   3608  N N     . ASP A 1 468 ? 0.281   9.400   25.758  1.00 17.92  ? 468  ASP A N     1 
ATOM   3609  C CA    . ASP A 1 468 ? 1.726   9.260   25.483  1.00 18.11  ? 468  ASP A CA    1 
ATOM   3610  C C     . ASP A 1 468 ? 2.236   10.598  24.974  1.00 17.58  ? 468  ASP A C     1 
ATOM   3611  O O     . ASP A 1 468 ? 1.433   11.506  24.697  1.00 17.59  ? 468  ASP A O     1 
ATOM   3612  C CB    . ASP A 1 468 ? 1.998   8.153   24.450  1.00 17.99  ? 468  ASP A CB    1 
ATOM   3613  C CG    . ASP A 1 468 ? 3.371   7.468   24.635  1.00 20.80  ? 468  ASP A CG    1 
ATOM   3614  O OD1   . ASP A 1 468 ? 4.326   8.082   25.178  1.00 20.94  ? 468  ASP A OD1   1 
ATOM   3615  O OD2   . ASP A 1 468 ? 3.497   6.293   24.220  1.00 22.10  ? 468  ASP A OD2   1 
ATOM   3616  N N     . SER A 1 469 ? 3.553   10.727  24.850  1.00 16.96  ? 469  SER A N     1 
ATOM   3617  C CA    . SER A 1 469 ? 4.152   11.984  24.412  1.00 16.83  ? 469  SER A CA    1 
ATOM   3618  C C     . SER A 1 469 ? 4.145   12.137  22.888  1.00 16.93  ? 469  SER A C     1 
ATOM   3619  O O     . SER A 1 469 ? 3.792   11.200  22.154  1.00 17.21  ? 469  SER A O     1 
ATOM   3620  C CB    . SER A 1 469 ? 5.556   12.156  25.005  1.00 16.92  ? 469  SER A CB    1 
ATOM   3621  O OG    . SER A 1 469 ? 6.145   13.388  24.608  1.00 17.11  ? 469  SER A OG    1 
ATOM   3622  N N     . TRP A 1 470 ? 4.469   13.344  22.432  1.00 16.42  ? 470  TRP A N     1 
ATOM   3623  C CA    . TRP A 1 470 ? 4.540   13.688  21.009  1.00 16.27  ? 470  TRP A CA    1 
ATOM   3624  C C     . TRP A 1 470 ? 5.679   14.712  20.949  1.00 16.33  ? 470  TRP A C     1 
ATOM   3625  O O     . TRP A 1 470 ? 6.027   15.310  21.993  1.00 16.84  ? 470  TRP A O     1 
ATOM   3626  C CB    . TRP A 1 470 ? 3.208   14.260  20.486  1.00 15.81  ? 470  TRP A CB    1 
ATOM   3627  C CG    . TRP A 1 470 ? 2.764   15.474  21.244  1.00 16.16  ? 470  TRP A CG    1 
ATOM   3628  C CD1   . TRP A 1 470 ? 2.894   16.802  20.858  1.00 15.30  ? 470  TRP A CD1   1 
ATOM   3629  C CD2   . TRP A 1 470 ? 2.169   15.492  22.543  1.00 15.57  ? 470  TRP A CD2   1 
ATOM   3630  N NE1   . TRP A 1 470 ? 2.398   17.627  21.844  1.00 14.30  ? 470  TRP A NE1   1 
ATOM   3631  C CE2   . TRP A 1 470 ? 1.953   16.852  22.889  1.00 15.44  ? 470  TRP A CE2   1 
ATOM   3632  C CE3   . TRP A 1 470 ? 1.795   14.494  23.453  1.00 14.69  ? 470  TRP A CE3   1 
ATOM   3633  C CZ2   . TRP A 1 470 ? 1.378   17.226  24.104  1.00 14.25  ? 470  TRP A CZ2   1 
ATOM   3634  C CZ3   . TRP A 1 470 ? 1.215   14.870  24.653  1.00 14.29  ? 470  TRP A CZ3   1 
ATOM   3635  C CH2   . TRP A 1 470 ? 1.015   16.221  24.969  1.00 14.96  ? 470  TRP A CH2   1 
ATOM   3636  N N     . PRO A 1 471 ? 6.330   14.850  19.785  1.00 15.88  ? 471  PRO A N     1 
ATOM   3637  C CA    . PRO A 1 471 ? 7.575   15.659  19.766  1.00 16.30  ? 471  PRO A CA    1 
ATOM   3638  C C     . PRO A 1 471 ? 7.477   17.123  20.262  1.00 16.59  ? 471  PRO A C     1 
ATOM   3639  O O     . PRO A 1 471 ? 8.455   17.635  20.825  1.00 17.12  ? 471  PRO A O     1 
ATOM   3640  C CB    . PRO A 1 471 ? 8.029   15.584  18.305  1.00 15.91  ? 471  PRO A CB    1 
ATOM   3641  C CG    . PRO A 1 471 ? 7.402   14.246  17.811  1.00 16.13  ? 471  PRO A CG    1 
ATOM   3642  C CD    . PRO A 1 471 ? 6.052   14.231  18.476  1.00 15.83  ? 471  PRO A CD    1 
ATOM   3643  N N     . GLY A 1 472 ? 6.314   17.764  20.084  1.00 16.63  ? 472  GLY A N     1 
ATOM   3644  C CA    . GLY A 1 472 ? 6.149   19.191  20.336  1.00 15.26  ? 472  GLY A CA    1 
ATOM   3645  C C     . GLY A 1 472 ? 5.700   19.486  21.743  1.00 15.87  ? 472  GLY A C     1 
ATOM   3646  O O     . GLY A 1 472 ? 5.443   20.631  22.067  1.00 16.10  ? 472  GLY A O     1 
ATOM   3647  N N     . GLN A 1 473 ? 5.609   18.461  22.590  1.00 15.84  ? 473  GLN A N     1 
ATOM   3648  C CA    . GLN A 1 473 ? 5.152   18.630  23.968  1.00 16.10  ? 473  GLN A CA    1 
ATOM   3649  C C     . GLN A 1 473 ? 6.082   19.572  24.791  1.00 16.76  ? 473  GLN A C     1 
ATOM   3650  O O     . GLN A 1 473 ? 7.315   19.409  24.799  1.00 16.56  ? 473  GLN A O     1 
ATOM   3651  C CB    . GLN A 1 473 ? 4.992   17.256  24.647  1.00 15.37  ? 473  GLN A CB    1 
ATOM   3652  C CG    . GLN A 1 473 ? 4.340   17.324  26.030  1.00 16.03  ? 473  GLN A CG    1 
ATOM   3653  C CD    . GLN A 1 473 ? 4.089   15.963  26.680  1.00 16.51  ? 473  GLN A CD    1 
ATOM   3654  O OE1   . GLN A 1 473 ? 4.689   14.957  26.296  1.00 18.01  ? 473  GLN A OE1   1 
ATOM   3655  N NE2   . GLN A 1 473 ? 3.201   15.935  27.682  1.00 15.37  ? 473  GLN A NE2   1 
ATOM   3656  N N     . ALA A 1 474 ? 5.493   20.563  25.468  1.00 17.11  ? 474  ALA A N     1 
ATOM   3657  C CA    . ALA A 1 474 ? 6.251   21.356  26.444  1.00 17.78  ? 474  ALA A CA    1 
ATOM   3658  C C     . ALA A 1 474 ? 6.993   20.430  27.411  1.00 18.46  ? 474  ALA A C     1 
ATOM   3659  O O     . ALA A 1 474 ? 6.450   19.381  27.800  1.00 19.38  ? 474  ALA A O     1 
ATOM   3660  C CB    . ALA A 1 474 ? 5.340   22.286  27.208  1.00 17.48  ? 474  ALA A CB    1 
ATOM   3661  N N     . ARG A 1 475 ? 8.213   20.813  27.808  1.00 18.60  ? 475  ARG A N     1 
ATOM   3662  C CA    . ARG A 1 475 ? 9.062   19.927  28.626  1.00 19.11  ? 475  ARG A CA    1 
ATOM   3663  C C     . ARG A 1 475 ? 8.965   20.157  30.137  1.00 19.38  ? 475  ARG A C     1 
ATOM   3664  O O     . ARG A 1 475 ? 9.222   19.241  30.926  1.00 19.38  ? 475  ARG A O     1 
ATOM   3665  C CB    . ARG A 1 475 ? 10.529  19.973  28.158  1.00 18.74  ? 475  ARG A CB    1 
ATOM   3666  C CG    . ARG A 1 475 ? 10.735  19.713  26.655  1.00 18.93  ? 475  ARG A CG    1 
ATOM   3667  C CD    . ARG A 1 475 ? 10.297  18.297  26.221  1.00 19.03  ? 475  ARG A CD    1 
ATOM   3668  N NE    . ARG A 1 475 ? 11.029  17.840  25.041  1.00 19.41  ? 475  ARG A NE    1 
ATOM   3669  C CZ    . ARG A 1 475 ? 10.524  17.703  23.808  1.00 20.31  ? 475  ARG A CZ    1 
ATOM   3670  N NH1   . ARG A 1 475 ? 9.241   17.978  23.545  1.00 19.04  ? 475  ARG A NH1   1 
ATOM   3671  N NH2   . ARG A 1 475 ? 11.319  17.287  22.823  1.00 18.55  ? 475  ARG A NH2   1 
ATOM   3672  N N     . THR A 1 476 ? 8.590   21.372  30.537  1.00 19.35  ? 476  THR A N     1 
ATOM   3673  C CA    . THR A 1 476 ? 8.502   21.719  31.958  1.00 19.46  ? 476  THR A CA    1 
ATOM   3674  C C     . THR A 1 476 ? 7.833   23.093  32.148  1.00 19.74  ? 476  THR A C     1 
ATOM   3675  O O     . THR A 1 476 ? 7.485   23.763  31.161  1.00 19.52  ? 476  THR A O     1 
ATOM   3676  C CB    . THR A 1 476 ? 9.917   21.674  32.658  1.00 19.29  ? 476  THR A CB    1 
ATOM   3677  O OG1   . THR A 1 476 ? 9.766   21.819  34.080  1.00 19.84  ? 476  THR A OG1   1 
ATOM   3678  C CG2   . THR A 1 476 ? 10.867  22.756  32.103  1.00 18.25  ? 476  THR A CG2   1 
ATOM   3679  N N     . LEU A 1 477 ? 7.641   23.488  33.408  1.00 19.51  ? 477  LEU A N     1 
ATOM   3680  C CA    . LEU A 1 477 ? 7.347   24.880  33.763  1.00 20.02  ? 477  LEU A CA    1 
ATOM   3681  C C     . LEU A 1 477 ? 8.648   25.518  34.232  1.00 20.85  ? 477  LEU A C     1 
ATOM   3682  O O     . LEU A 1 477 ? 9.389   24.910  35.008  1.00 21.54  ? 477  LEU A O     1 
ATOM   3683  C CB    . LEU A 1 477 ? 6.268   24.966  34.852  1.00 19.93  ? 477  LEU A CB    1 
ATOM   3684  C CG    . LEU A 1 477 ? 4.923   24.278  34.547  1.00 19.87  ? 477  LEU A CG    1 
ATOM   3685  C CD1   . LEU A 1 477 ? 3.972   24.388  35.727  1.00 19.40  ? 477  LEU A CD1   1 
ATOM   3686  C CD2   . LEU A 1 477 ? 4.289   24.843  33.271  1.00 20.27  ? 477  LEU A CD2   1 
ATOM   3687  N N     . PHE A 1 478 ? 8.953   26.713  33.726  1.00 21.31  ? 478  PHE A N     1 
ATOM   3688  C CA    . PHE A 1 478 ? 10.214  27.375  34.022  1.00 21.41  ? 478  PHE A CA    1 
ATOM   3689  C C     . PHE A 1 478 ? 10.454  27.416  35.533  1.00 21.26  ? 478  PHE A C     1 
ATOM   3690  O O     . PHE A 1 478 ? 9.594   27.853  36.282  1.00 21.63  ? 478  PHE A O     1 
ATOM   3691  C CB    . PHE A 1 478 ? 10.257  28.795  33.414  1.00 21.93  ? 478  PHE A CB    1 
ATOM   3692  C CG    . PHE A 1 478 ? 11.527  29.576  33.767  1.00 23.31  ? 478  PHE A CG    1 
ATOM   3693  C CD1   . PHE A 1 478 ? 12.722  29.364  33.058  1.00 24.65  ? 478  PHE A CD1   1 
ATOM   3694  C CD2   . PHE A 1 478 ? 11.535  30.484  34.823  1.00 23.10  ? 478  PHE A CD2   1 
ATOM   3695  C CE1   . PHE A 1 478 ? 13.894  30.061  33.385  1.00 24.86  ? 478  PHE A CE1   1 
ATOM   3696  C CE2   . PHE A 1 478 ? 12.706  31.190  35.155  1.00 24.79  ? 478  PHE A CE2   1 
ATOM   3697  C CZ    . PHE A 1 478 ? 13.888  30.977  34.430  1.00 23.02  ? 478  PHE A CZ    1 
ATOM   3698  N N     . GLY A 1 479 ? 11.612  26.926  35.967  1.00 21.16  ? 479  GLY A N     1 
ATOM   3699  C CA    . GLY A 1 479 ? 11.963  26.874  37.388  1.00 20.61  ? 479  GLY A CA    1 
ATOM   3700  C C     . GLY A 1 479 ? 11.125  25.983  38.301  1.00 20.24  ? 479  GLY A C     1 
ATOM   3701  O O     . GLY A 1 479 ? 11.286  26.037  39.515  1.00 20.61  ? 479  GLY A O     1 
ATOM   3702  N N     . ASP A 1 480 ? 10.237  25.156  37.755  1.00 19.86  ? 480  ASP A N     1 
ATOM   3703  C CA    . ASP A 1 480 ? 9.355   24.361  38.616  1.00 19.83  ? 480  ASP A CA    1 
ATOM   3704  C C     . ASP A 1 480 ? 8.793   23.113  37.923  1.00 20.13  ? 480  ASP A C     1 
ATOM   3705  O O     . ASP A 1 480 ? 7.599   23.031  37.568  1.00 19.56  ? 480  ASP A O     1 
ATOM   3706  C CB    . ASP A 1 480 ? 8.235   25.246  39.192  1.00 20.16  ? 480  ASP A CB    1 
ATOM   3707  C CG    . ASP A 1 480 ? 7.721   24.765  40.536  1.00 20.56  ? 480  ASP A CG    1 
ATOM   3708  O OD1   . ASP A 1 480 ? 7.965   23.598  40.922  1.00 23.81  ? 480  ASP A OD1   1 
ATOM   3709  O OD2   . ASP A 1 480 ? 7.035   25.561  41.206  1.00 21.09  ? 480  ASP A OD2   1 
ATOM   3710  N N     . HIS A 1 481 ? 9.669   22.131  37.763  1.00 20.27  ? 481  HIS A N     1 
ATOM   3711  C CA    . HIS A 1 481 ? 9.309   20.854  37.182  1.00 21.11  ? 481  HIS A CA    1 
ATOM   3712  C C     . HIS A 1 481 ? 8.342   20.043  38.057  1.00 20.87  ? 481  HIS A C     1 
ATOM   3713  O O     . HIS A 1 481 ? 7.519   19.287  37.547  1.00 20.19  ? 481  HIS A O     1 
ATOM   3714  C CB    . HIS A 1 481 ? 10.563  20.020  36.889  1.00 21.10  ? 481  HIS A CB    1 
ATOM   3715  C CG    . HIS A 1 481 ? 10.293  18.854  35.998  1.00 22.06  ? 481  HIS A CG    1 
ATOM   3716  N ND1   . HIS A 1 481 ? 9.894   19.004  34.685  1.00 23.21  ? 481  HIS A ND1   1 
ATOM   3717  C CD2   . HIS A 1 481 ? 10.335  17.521  36.233  1.00 21.36  ? 481  HIS A CD2   1 
ATOM   3718  C CE1   . HIS A 1 481 ? 9.734   17.809  34.143  1.00 23.55  ? 481  HIS A CE1   1 
ATOM   3719  N NE2   . HIS A 1 481 ? 9.979   16.893  35.067  1.00 22.85  ? 481  HIS A NE2   1 
ATOM   3720  N N     . GLU A 1 482 ? 8.466   20.188  39.371  1.00 21.08  ? 482  GLU A N     1 
ATOM   3721  C CA    . GLU A 1 482 ? 7.537   19.524  40.292  1.00 21.82  ? 482  GLU A CA    1 
ATOM   3722  C C     . GLU A 1 482 ? 6.136   20.043  40.137  1.00 21.94  ? 482  GLU A C     1 
ATOM   3723  O O     . GLU A 1 482 ? 5.198   19.269  40.222  1.00 22.31  ? 482  GLU A O     1 
ATOM   3724  C CB    . GLU A 1 482 ? 7.986   19.645  41.763  1.00 21.46  ? 482  GLU A CB    1 
ATOM   3725  C CG    . GLU A 1 482 ? 9.203   18.782  42.097  1.00 21.13  ? 482  GLU A CG    1 
ATOM   3726  C CD    . GLU A 1 482 ? 9.585   18.873  43.557  1.00 23.21  ? 482  GLU A CD    1 
ATOM   3727  O OE1   . GLU A 1 482 ? 8.681   19.114  44.403  1.00 25.15  ? 482  GLU A OE1   1 
ATOM   3728  O OE2   . GLU A 1 482 ? 10.790  18.701  43.862  1.00 23.94  ? 482  GLU A OE2   1 
ATOM   3729  N N     . ARG A 1 483 ? 5.987   21.353  39.932  1.00 22.54  ? 483  ARG A N     1 
ATOM   3730  C CA    . ARG A 1 483 ? 4.672   21.921  39.646  1.00 22.99  ? 483  ARG A CA    1 
ATOM   3731  C C     . ARG A 1 483 ? 4.154   21.382  38.310  1.00 23.02  ? 483  ARG A C     1 
ATOM   3732  O O     . ARG A 1 483 ? 2.952   21.081  38.163  1.00 23.34  ? 483  ARG A O     1 
ATOM   3733  C CB    . ARG A 1 483 ? 4.724   23.445  39.631  1.00 22.92  ? 483  ARG A CB    1 
ATOM   3734  C CG    . ARG A 1 483 ? 3.380   24.121  39.498  1.00 23.90  ? 483  ARG A CG    1 
ATOM   3735  C CD    . ARG A 1 483 ? 2.519   23.889  40.746  1.00 29.22  ? 483  ARG A CD    1 
ATOM   3736  N N     . PHE A 1 484 ? 5.066   21.252  37.348  1.00 22.62  ? 484  PHE A N     1 
ATOM   3737  C CA    . PHE A 1 484 ? 4.738   20.714  36.026  1.00 22.54  ? 484  PHE A CA    1 
ATOM   3738  C C     . PHE A 1 484 ? 4.127   19.317  36.158  1.00 22.69  ? 484  PHE A C     1 
ATOM   3739  O O     . PHE A 1 484 ? 3.111   19.025  35.542  1.00 22.94  ? 484  PHE A O     1 
ATOM   3740  C CB    . PHE A 1 484 ? 5.989   20.719  35.131  1.00 21.97  ? 484  PHE A CB    1 
ATOM   3741  C CG    . PHE A 1 484 ? 5.798   20.080  33.770  1.00 21.89  ? 484  PHE A CG    1 
ATOM   3742  C CD1   . PHE A 1 484 ? 5.064   20.723  32.768  1.00 22.76  ? 484  PHE A CD1   1 
ATOM   3743  C CD2   . PHE A 1 484 ? 6.390   18.858  33.476  1.00 20.99  ? 484  PHE A CD2   1 
ATOM   3744  C CE1   . PHE A 1 484 ? 4.919   20.135  31.498  1.00 22.38  ? 484  PHE A CE1   1 
ATOM   3745  C CE2   . PHE A 1 484 ? 6.240   18.267  32.223  1.00 20.53  ? 484  PHE A CE2   1 
ATOM   3746  C CZ    . PHE A 1 484 ? 5.510   18.897  31.240  1.00 20.85  ? 484  PHE A CZ    1 
ATOM   3747  N N     . GLU A 1 485 ? 4.737   18.463  36.969  1.00 23.16  ? 485  GLU A N     1 
ATOM   3748  C CA    . GLU A 1 485 ? 4.154   17.157  37.272  1.00 24.26  ? 485  GLU A CA    1 
ATOM   3749  C C     . GLU A 1 485 ? 2.778   17.268  37.937  1.00 24.35  ? 485  GLU A C     1 
ATOM   3750  O O     . GLU A 1 485 ? 1.835   16.583  37.546  1.00 24.62  ? 485  GLU A O     1 
ATOM   3751  C CB    . GLU A 1 485 ? 5.066   16.306  38.164  1.00 23.71  ? 485  GLU A CB    1 
ATOM   3752  C CG    . GLU A 1 485 ? 4.360   14.973  38.522  1.00 25.00  ? 485  GLU A CG    1 
ATOM   3753  C CD    . GLU A 1 485 ? 5.223   13.937  39.241  1.00 25.18  ? 485  GLU A CD    1 
ATOM   3754  O OE1   . GLU A 1 485 ? 6.467   14.128  39.336  1.00 27.29  ? 485  GLU A OE1   1 
ATOM   3755  O OE2   . GLU A 1 485 ? 4.639   12.914  39.694  1.00 23.38  ? 485  GLU A OE2   1 
ATOM   3756  N N     . GLN A 1 486 ? 2.688   18.130  38.941  1.00 24.66  ? 486  GLN A N     1 
ATOM   3757  C CA    . GLN A 1 486 ? 1.489   18.308  39.727  1.00 26.27  ? 486  GLN A CA    1 
ATOM   3758  C C     . GLN A 1 486 ? 0.318   18.823  38.888  1.00 25.33  ? 486  GLN A C     1 
ATOM   3759  O O     . GLN A 1 486 ? -0.817  18.354  39.041  1.00 25.63  ? 486  GLN A O     1 
ATOM   3760  C CB    . GLN A 1 486 ? 1.785   19.270  40.881  1.00 26.07  ? 486  GLN A CB    1 
ATOM   3761  C CG    . GLN A 1 486 ? 0.850   19.154  42.077  1.00 29.54  ? 486  GLN A CG    1 
ATOM   3762  C CD    . GLN A 1 486 ? 1.129   20.213  43.186  1.00 30.58  ? 486  GLN A CD    1 
ATOM   3763  O OE1   . GLN A 1 486 ? 1.032   19.900  44.392  1.00 34.75  ? 486  GLN A OE1   1 
ATOM   3764  N NE2   . GLN A 1 486 ? 1.461   21.465  42.777  1.00 32.22  ? 486  GLN A NE2   1 
ATOM   3765  N N     . THR A 1 487 ? 0.593   19.781  38.004  1.00 24.12  ? 487  THR A N     1 
ATOM   3766  C CA    . THR A 1 487 ? -0.460  20.394  37.227  1.00 23.37  ? 487  THR A CA    1 
ATOM   3767  C C     . THR A 1 487 ? -1.028  19.453  36.148  1.00 23.06  ? 487  THR A C     1 
ATOM   3768  O O     . THR A 1 487 ? -2.241  19.403  35.966  1.00 22.45  ? 487  THR A O     1 
ATOM   3769  C CB    . THR A 1 487 ? 0.014   21.723  36.587  1.00 23.70  ? 487  THR A CB    1 
ATOM   3770  O OG1   . THR A 1 487 ? 0.609   22.553  37.594  1.00 22.71  ? 487  THR A OG1   1 
ATOM   3771  C CG2   . THR A 1 487 ? -1.144  22.471  35.914  1.00 22.56  ? 487  THR A CG2   1 
ATOM   3772  N N     . TYR A 1 488 ? -0.167  18.702  35.458  1.00 22.22  ? 488  TYR A N     1 
ATOM   3773  C CA    . TYR A 1 488 ? -0.616  17.949  34.286  1.00 21.90  ? 488  TYR A CA    1 
ATOM   3774  C C     . TYR A 1 488 ? -0.616  16.439  34.390  1.00 22.42  ? 488  TYR A C     1 
ATOM   3775  O O     . TYR A 1 488 ? -1.302  15.784  33.612  1.00 23.13  ? 488  TYR A O     1 
ATOM   3776  C CB    . TYR A 1 488 ? 0.172   18.354  33.041  1.00 21.53  ? 488  TYR A CB    1 
ATOM   3777  C CG    . TYR A 1 488 ? 0.235   19.843  32.817  1.00 20.86  ? 488  TYR A CG    1 
ATOM   3778  C CD1   . TYR A 1 488 ? 1.404   20.558  33.095  1.00 19.99  ? 488  TYR A CD1   1 
ATOM   3779  C CD2   . TYR A 1 488 ? -0.877  20.548  32.349  1.00 19.47  ? 488  TYR A CD2   1 
ATOM   3780  C CE1   . TYR A 1 488 ? 1.464   21.915  32.890  1.00 19.62  ? 488  TYR A CE1   1 
ATOM   3781  C CE2   . TYR A 1 488 ? -0.821  21.917  32.144  1.00 19.36  ? 488  TYR A CE2   1 
ATOM   3782  C CZ    . TYR A 1 488 ? 0.355   22.590  32.407  1.00 20.48  ? 488  TYR A CZ    1 
ATOM   3783  O OH    . TYR A 1 488 ? 0.418   23.957  32.209  1.00 22.43  ? 488  TYR A OH    1 
ATOM   3784  N N     . PHE A 1 489 ? 0.129   15.880  35.339  1.00 22.89  ? 489  PHE A N     1 
ATOM   3785  C CA    . PHE A 1 489 ? 0.346   14.434  35.373  1.00 23.10  ? 489  PHE A CA    1 
ATOM   3786  C C     . PHE A 1 489 ? -0.082  13.787  36.675  1.00 23.43  ? 489  PHE A C     1 
ATOM   3787  O O     . PHE A 1 489 ? 0.148   12.599  36.879  1.00 24.25  ? 489  PHE A O     1 
ATOM   3788  C CB    . PHE A 1 489 ? 1.821   14.113  35.086  1.00 23.12  ? 489  PHE A CB    1 
ATOM   3789  C CG    . PHE A 1 489 ? 2.326   14.691  33.788  1.00 23.44  ? 489  PHE A CG    1 
ATOM   3790  C CD1   . PHE A 1 489 ? 2.921   15.957  33.759  1.00 22.28  ? 489  PHE A CD1   1 
ATOM   3791  C CD2   . PHE A 1 489 ? 2.185   13.986  32.598  1.00 21.60  ? 489  PHE A CD2   1 
ATOM   3792  C CE1   . PHE A 1 489 ? 3.367   16.492  32.571  1.00 23.15  ? 489  PHE A CE1   1 
ATOM   3793  C CE2   . PHE A 1 489 ? 2.632   14.514  31.405  1.00 22.17  ? 489  PHE A CE2   1 
ATOM   3794  C CZ    . PHE A 1 489 ? 3.220   15.765  31.376  1.00 23.39  ? 489  PHE A CZ    1 
ATOM   3795  N N     . SER A 1 490 ? -0.712  14.558  37.559  1.00 23.86  ? 490  SER A N     1 
ATOM   3796  C CA    . SER A 1 490 ? -1.104  14.029  38.867  1.00 23.44  ? 490  SER A CA    1 
ATOM   3797  C C     . SER A 1 490 ? -2.578  13.693  38.962  1.00 23.25  ? 490  SER A C     1 
ATOM   3798  O O     . SER A 1 490 ? -2.928  12.784  39.685  1.00 23.46  ? 490  SER A O     1 
ATOM   3799  C CB    . SER A 1 490 ? -0.692  14.975  40.004  1.00 23.37  ? 490  SER A CB    1 
ATOM   3800  O OG    . SER A 1 490 ? -1.580  16.072  40.110  1.00 23.89  ? 490  SER A OG    1 
ATOM   3801  N N     . THR A 1 491 ? -3.446  14.391  38.230  1.00 23.11  ? 491  THR A N     1 
ATOM   3802  C CA    . THR A 1 491 ? -4.884  14.083  38.299  1.00 23.00  ? 491  THR A CA    1 
ATOM   3803  C C     . THR A 1 491 ? -5.177  12.669  37.781  1.00 23.40  ? 491  THR A C     1 
ATOM   3804  O O     . THR A 1 491 ? -5.803  11.854  38.458  1.00 22.71  ? 491  THR A O     1 
ATOM   3805  C CB    . THR A 1 491 ? -5.725  15.123  37.537  1.00 23.26  ? 491  THR A CB    1 
ATOM   3806  O OG1   . THR A 1 491 ? -5.371  16.433  37.994  1.00 22.74  ? 491  THR A OG1   1 
ATOM   3807  C CG2   . THR A 1 491 ? -7.231  14.909  37.767  1.00 23.29  ? 491  THR A CG2   1 
ATOM   3808  N N     . PHE A 1 492 ? -4.713  12.386  36.569  1.00 23.87  ? 492  PHE A N     1 
ATOM   3809  C CA    . PHE A 1 492 ? -4.922  11.082  35.960  1.00 23.98  ? 492  PHE A CA    1 
ATOM   3810  C C     . PHE A 1 492 ? -3.557  10.486  35.707  1.00 23.91  ? 492  PHE A C     1 
ATOM   3811  O O     . PHE A 1 492 ? -2.856  10.887  34.789  1.00 23.82  ? 492  PHE A O     1 
ATOM   3812  C CB    . PHE A 1 492 ? -5.777  11.229  34.694  1.00 23.51  ? 492  PHE A CB    1 
ATOM   3813  C CG    . PHE A 1 492 ? -7.117  11.884  34.954  1.00 24.07  ? 492  PHE A CG    1 
ATOM   3814  C CD1   . PHE A 1 492 ? -7.460  13.082  34.322  1.00 22.83  ? 492  PHE A CD1   1 
ATOM   3815  C CD2   . PHE A 1 492 ? -8.026  11.321  35.871  1.00 23.97  ? 492  PHE A CD2   1 
ATOM   3816  C CE1   . PHE A 1 492 ? -8.681  13.695  34.563  1.00 21.06  ? 492  PHE A CE1   1 
ATOM   3817  C CE2   . PHE A 1 492 ? -9.253  11.941  36.130  1.00 22.81  ? 492  PHE A CE2   1 
ATOM   3818  C CZ    . PHE A 1 492 ? -9.584  13.125  35.462  1.00 22.04  ? 492  PHE A CZ    1 
ATOM   3819  N N     . LYS A 1 493 ? -3.173  9.546   36.560  1.00 24.20  ? 493  LYS A N     1 
ATOM   3820  C CA    . LYS A 1 493 ? -1.773  9.147   36.650  1.00 24.37  ? 493  LYS A CA    1 
ATOM   3821  C C     . LYS A 1 493 ? -1.246  8.572   35.357  1.00 23.58  ? 493  LYS A C     1 
ATOM   3822  O O     . LYS A 1 493 ? -1.956  7.884   34.646  1.00 23.57  ? 493  LYS A O     1 
ATOM   3823  C CB    . LYS A 1 493 ? -1.530  8.247   37.861  1.00 24.69  ? 493  LYS A CB    1 
ATOM   3824  C CG    . LYS A 1 493 ? -1.447  9.090   39.152  1.00 26.51  ? 493  LYS A CG    1 
ATOM   3825  C CD    . LYS A 1 493 ? -1.182  8.232   40.386  1.00 32.90  ? 493  LYS A CD    1 
ATOM   3826  N N     . ASN A 1 494 ? -0.018  8.939   35.017  1.00 23.27  ? 494  ASN A N     1 
ATOM   3827  C CA    . ASN A 1 494 ? 0.615   8.459   33.800  1.00 22.74  ? 494  ASN A CA    1 
ATOM   3828  C C     . ASN A 1 494 ? 0.010   9.001   32.514  1.00 22.26  ? 494  ASN A C     1 
ATOM   3829  O O     . ASN A 1 494 ? 0.184   8.419   31.444  1.00 21.62  ? 494  ASN A O     1 
ATOM   3830  C CB    . ASN A 1 494 ? 0.541   6.943   33.765  1.00 23.16  ? 494  ASN A CB    1 
ATOM   3831  C CG    . ASN A 1 494 ? 1.875   6.339   33.655  1.00 24.98  ? 494  ASN A CG    1 
ATOM   3832  O OD1   . ASN A 1 494 ? 2.499   6.356   32.585  1.00 24.41  ? 494  ASN A OD1   1 
ATOM   3833  N ND2   . ASN A 1 494 ? 2.378   5.845   34.788  1.00 27.20  ? 494  ASN A ND2   1 
ATOM   3834  N N     . MET A 1 495 ? -0.718  10.105  32.623  1.00 21.96  ? 495  MET A N     1 
ATOM   3835  C CA    . MET A 1 495 ? -1.422  10.673  31.479  1.00 22.43  ? 495  MET A CA    1 
ATOM   3836  C C     . MET A 1 495 ? -1.255  12.158  31.603  1.00 20.69  ? 495  MET A C     1 
ATOM   3837  O O     . MET A 1 495 ? -1.162  12.660  32.720  1.00 20.73  ? 495  MET A O     1 
ATOM   3838  C CB    . MET A 1 495 ? -2.920  10.308  31.501  1.00 21.72  ? 495  MET A CB    1 
ATOM   3839  C CG    . MET A 1 495 ? -3.221  8.828   31.324  1.00 23.85  ? 495  MET A CG    1 
ATOM   3840  S SD    . MET A 1 495 ? -4.989  8.449   31.449  1.00 26.76  ? 495  MET A SD    1 
ATOM   3841  C CE    . MET A 1 495 ? -5.053  7.587   33.039  1.00 30.73  ? 495  MET A CE    1 
ATOM   3842  N N     . TYR A 1 496 ? -1.191  12.841  30.460  1.00 19.80  ? 496  TYR A N     1 
ATOM   3843  C CA    . TYR A 1 496 ? -1.208  14.302  30.396  1.00 18.55  ? 496  TYR A CA    1 
ATOM   3844  C C     . TYR A 1 496 ? -2.658  14.753  30.381  1.00 18.35  ? 496  TYR A C     1 
ATOM   3845  O O     . TYR A 1 496 ? -3.385  14.443  29.431  1.00 18.33  ? 496  TYR A O     1 
ATOM   3846  C CB    . TYR A 1 496 ? -0.498  14.811  29.129  1.00 18.01  ? 496  TYR A CB    1 
ATOM   3847  C CG    . TYR A 1 496 ? -0.784  16.282  28.839  1.00 18.00  ? 496  TYR A CG    1 
ATOM   3848  C CD1   . TYR A 1 496 ? -0.082  17.286  29.503  1.00 18.55  ? 496  TYR A CD1   1 
ATOM   3849  C CD2   . TYR A 1 496 ? -1.766  16.666  27.934  1.00 17.37  ? 496  TYR A CD2   1 
ATOM   3850  C CE1   . TYR A 1 496 ? -0.333  18.612  29.279  1.00 18.39  ? 496  TYR A CE1   1 
ATOM   3851  C CE2   . TYR A 1 496 ? -2.027  18.022  27.694  1.00 18.56  ? 496  TYR A CE2   1 
ATOM   3852  C CZ    . TYR A 1 496 ? -1.296  18.987  28.373  1.00 18.37  ? 496  TYR A CZ    1 
ATOM   3853  O OH    . TYR A 1 496 ? -1.527  20.328  28.178  1.00 16.38  ? 496  TYR A OH    1 
ATOM   3854  N N     . PHE A 1 497 ? -3.081  15.475  31.422  1.00 18.04  ? 497  PHE A N     1 
ATOM   3855  C CA    . PHE A 1 497 ? -4.447  16.012  31.473  1.00 17.87  ? 497  PHE A CA    1 
ATOM   3856  C C     . PHE A 1 497 ? -4.511  17.418  30.896  1.00 17.76  ? 497  PHE A C     1 
ATOM   3857  O O     . PHE A 1 497 ? -3.851  18.318  31.399  1.00 17.61  ? 497  PHE A O     1 
ATOM   3858  C CB    . PHE A 1 497 ? -4.986  15.978  32.913  1.00 17.40  ? 497  PHE A CB    1 
ATOM   3859  C CG    . PHE A 1 497 ? -6.389  16.529  33.068  1.00 17.23  ? 497  PHE A CG    1 
ATOM   3860  C CD1   . PHE A 1 497 ? -7.375  16.290  32.106  1.00 17.79  ? 497  PHE A CD1   1 
ATOM   3861  C CD2   . PHE A 1 497 ? -6.737  17.261  34.208  1.00 15.85  ? 497  PHE A CD2   1 
ATOM   3862  C CE1   . PHE A 1 497 ? -8.681  16.799  32.273  1.00 15.84  ? 497  PHE A CE1   1 
ATOM   3863  C CE2   . PHE A 1 497 ? -8.035  17.760  34.368  1.00 14.86  ? 497  PHE A CE2   1 
ATOM   3864  C CZ    . PHE A 1 497 ? -9.003  17.514  33.400  1.00 14.88  ? 497  PHE A CZ    1 
ATOM   3865  N N     . SER A 1 498 ? -5.319  17.582  29.845  1.00 18.16  ? 498  SER A N     1 
ATOM   3866  C CA    . SER A 1 498 ? -5.447  18.823  29.076  1.00 18.38  ? 498  SER A CA    1 
ATOM   3867  C C     . SER A 1 498 ? -6.225  19.948  29.780  1.00 18.95  ? 498  SER A C     1 
ATOM   3868  O O     . SER A 1 498 ? -6.072  21.144  29.454  1.00 18.71  ? 498  SER A O     1 
ATOM   3869  C CB    . SER A 1 498 ? -6.128  18.510  27.733  1.00 18.77  ? 498  SER A CB    1 
ATOM   3870  O OG    . SER A 1 498 ? -7.528  18.286  27.869  1.00 19.32  ? 498  SER A OG    1 
ATOM   3871  N N     . GLY A 1 499 ? -7.090  19.552  30.713  1.00 19.07  ? 499  GLY A N     1 
ATOM   3872  C CA    . GLY A 1 499 ? -7.972  20.477  31.405  1.00 18.98  ? 499  GLY A CA    1 
ATOM   3873  C C     . GLY A 1 499 ? -9.255  20.716  30.634  1.00 19.14  ? 499  GLY A C     1 
ATOM   3874  O O     . GLY A 1 499 ? -10.096 21.488  31.075  1.00 19.11  ? 499  GLY A O     1 
ATOM   3875  N N     . ASP A 1 500 ? -9.396  20.062  29.478  1.00 19.53  ? 500  ASP A N     1 
ATOM   3876  C CA    . ASP A 1 500 ? -10.566 20.216  28.614  1.00 19.31  ? 500  ASP A CA    1 
ATOM   3877  C C     . ASP A 1 500 ? -11.471 19.009  28.707  1.00 19.89  ? 500  ASP A C     1 
ATOM   3878  O O     . ASP A 1 500 ? -11.017 17.884  28.980  1.00 19.60  ? 500  ASP A O     1 
ATOM   3879  C CB    . ASP A 1 500 ? -10.151 20.333  27.134  1.00 19.01  ? 500  ASP A CB    1 
ATOM   3880  C CG    . ASP A 1 500 ? -9.725  21.730  26.731  1.00 18.62  ? 500  ASP A CG    1 
ATOM   3881  O OD1   . ASP A 1 500 ? -10.493 22.700  26.929  1.00 16.68  ? 500  ASP A OD1   1 
ATOM   3882  O OD2   . ASP A 1 500 ? -8.617  21.843  26.170  1.00 18.03  ? 500  ASP A OD2   1 
ATOM   3883  N N     . GLY A 1 501 ? -12.747 19.243  28.423  1.00 20.23  ? 501  GLY A N     1 
ATOM   3884  C CA    . GLY A 1 501 ? -13.694 18.172  28.209  1.00 21.10  ? 501  GLY A CA    1 
ATOM   3885  C C     . GLY A 1 501 ? -13.928 17.958  26.730  1.00 21.55  ? 501  GLY A C     1 
ATOM   3886  O O     . GLY A 1 501 ? -13.728 18.870  25.908  1.00 21.92  ? 501  GLY A O     1 
ATOM   3887  N N     . ALA A 1 502 ? -14.356 16.753  26.373  1.00 21.68  ? 502  ALA A N     1 
ATOM   3888  C CA    . ALA A 1 502 ? -14.663 16.459  24.964  1.00 21.70  ? 502  ALA A CA    1 
ATOM   3889  C C     . ALA A 1 502 ? -15.658 15.314  24.842  1.00 21.81  ? 502  ALA A C     1 
ATOM   3890  O O     . ALA A 1 502 ? -15.778 14.506  25.760  1.00 21.97  ? 502  ALA A O     1 
ATOM   3891  C CB    . ALA A 1 502 ? -13.374 16.159  24.177  1.00 20.79  ? 502  ALA A CB    1 
ATOM   3892  N N     . ARG A 1 503 ? -16.406 15.270  23.738  1.00 22.08  ? 503  ARG A N     1 
ATOM   3893  C CA    . ARG A 1 503 ? -17.054 14.028  23.358  1.00 22.50  ? 503  ARG A CA    1 
ATOM   3894  C C     . ARG A 1 503 ? -16.461 13.427  22.098  1.00 21.74  ? 503  ARG A C     1 
ATOM   3895  O O     . ARG A 1 503 ? -15.892 14.130  21.256  1.00 21.42  ? 503  ARG A O     1 
ATOM   3896  C CB    . ARG A 1 503 ? -18.605 14.057  23.327  1.00 22.74  ? 503  ARG A CB    1 
ATOM   3897  C CG    . ARG A 1 503 ? -19.277 15.165  22.623  1.00 24.88  ? 503  ARG A CG    1 
ATOM   3898  C CD    . ARG A 1 503 ? -20.686 14.772  22.064  1.00 24.32  ? 503  ARG A CD    1 
ATOM   3899  N NE    . ARG A 1 503 ? -20.980 15.562  20.849  1.00 30.19  ? 503  ARG A NE    1 
ATOM   3900  C CZ    . ARG A 1 503 ? -20.974 16.914  20.794  1.00 34.52  ? 503  ARG A CZ    1 
ATOM   3901  N NH1   . ARG A 1 503 ? -20.700 17.662  21.889  1.00 30.28  ? 503  ARG A NH1   1 
ATOM   3902  N NH2   . ARG A 1 503 ? -21.247 17.539  19.633  1.00 34.41  ? 503  ARG A NH2   1 
ATOM   3903  N N     . ARG A 1 504 ? -16.551 12.105  22.021  1.00 21.17  ? 504  ARG A N     1 
ATOM   3904  C CA    . ARG A 1 504 ? -16.190 11.374  20.818  1.00 21.11  ? 504  ARG A CA    1 
ATOM   3905  C C     . ARG A 1 504 ? -17.504 10.785  20.286  1.00 21.35  ? 504  ARG A C     1 
ATOM   3906  O O     . ARG A 1 504 ? -18.289 10.210  21.062  1.00 21.76  ? 504  ARG A O     1 
ATOM   3907  C CB    . ARG A 1 504 ? -15.122 10.309  21.138  1.00 20.42  ? 504  ARG A CB    1 
ATOM   3908  C CG    . ARG A 1 504 ? -14.568 9.519   19.951  1.00 20.05  ? 504  ARG A CG    1 
ATOM   3909  C CD    . ARG A 1 504 ? -13.462 8.512   20.396  1.00 19.97  ? 504  ARG A CD    1 
ATOM   3910  N NE    . ARG A 1 504 ? -13.969 7.735   21.508  1.00 20.25  ? 504  ARG A NE    1 
ATOM   3911  C CZ    . ARG A 1 504 ? -13.414 7.601   22.715  1.00 21.08  ? 504  ARG A CZ    1 
ATOM   3912  N NH1   . ARG A 1 504 ? -12.223 8.131   23.018  1.00 21.39  ? 504  ARG A NH1   1 
ATOM   3913  N NH2   . ARG A 1 504 ? -14.057 6.880   23.619  1.00 18.87  ? 504  ARG A NH2   1 
ATOM   3914  N N     . ASP A 1 505 ? -17.772 10.995  18.996  1.00 21.36  ? 505  ASP A N     1 
ATOM   3915  C CA    . ASP A 1 505 ? -18.996 10.481  18.354  1.00 21.69  ? 505  ASP A CA    1 
ATOM   3916  C C     . ASP A 1 505 ? -18.778 9.063   17.787  1.00 22.62  ? 505  ASP A C     1 
ATOM   3917  O O     . ASP A 1 505 ? -17.696 8.507   17.934  1.00 22.99  ? 505  ASP A O     1 
ATOM   3918  C CB    . ASP A 1 505 ? -19.551 11.473  17.305  1.00 20.82  ? 505  ASP A CB    1 
ATOM   3919  C CG    . ASP A 1 505 ? -18.609 11.705  16.113  1.00 20.38  ? 505  ASP A CG    1 
ATOM   3920  O OD1   . ASP A 1 505 ? -17.733 10.871  15.819  1.00 20.14  ? 505  ASP A OD1   1 
ATOM   3921  O OD2   . ASP A 1 505 ? -18.758 12.741  15.435  1.00 20.40  ? 505  ASP A OD2   1 
ATOM   3922  N N     . GLU A 1 506 ? -19.797 8.486   17.146  1.00 23.91  ? 506  GLU A N     1 
ATOM   3923  C CA    . GLU A 1 506 ? -19.714 7.123   16.599  1.00 25.03  ? 506  GLU A CA    1 
ATOM   3924  C C     . GLU A 1 506 ? -18.693 7.006   15.471  1.00 24.16  ? 506  GLU A C     1 
ATOM   3925  O O     . GLU A 1 506 ? -18.308 5.905   15.113  1.00 24.52  ? 506  GLU A O     1 
ATOM   3926  C CB    . GLU A 1 506 ? -21.072 6.608   16.064  1.00 25.79  ? 506  GLU A CB    1 
ATOM   3927  C CG    . GLU A 1 506 ? -22.322 7.421   16.432  1.00 31.50  ? 506  GLU A CG    1 
ATOM   3928  C CD    . GLU A 1 506 ? -22.896 7.089   17.814  1.00 37.55  ? 506  GLU A CD    1 
ATOM   3929  O OE1   . GLU A 1 506 ? -23.237 8.054   18.555  1.00 40.36  ? 506  GLU A OE1   1 
ATOM   3930  O OE2   . GLU A 1 506 ? -23.026 5.878   18.147  1.00 39.02  ? 506  GLU A OE2   1 
ATOM   3931  N N     . ASP A 1 507 ? -18.294 8.125   14.877  1.00 23.60  ? 507  ASP A N     1 
ATOM   3932  C CA    . ASP A 1 507 ? -17.300 8.103   13.806  1.00 22.89  ? 507  ASP A CA    1 
ATOM   3933  C C     . ASP A 1 507 ? -15.885 8.199   14.363  1.00 22.66  ? 507  ASP A C     1 
ATOM   3934  O O     . ASP A 1 507 ? -14.908 8.133   13.609  1.00 22.58  ? 507  ASP A O     1 
ATOM   3935  C CB    . ASP A 1 507 ? -17.559 9.236   12.821  1.00 22.94  ? 507  ASP A CB    1 
ATOM   3936  C CG    . ASP A 1 507 ? -18.728 8.959   11.904  1.00 23.49  ? 507  ASP A CG    1 
ATOM   3937  O OD1   . ASP A 1 507 ? -18.904 7.796   11.482  1.00 25.83  ? 507  ASP A OD1   1 
ATOM   3938  O OD2   . ASP A 1 507 ? -19.475 9.903   11.584  1.00 23.60  ? 507  ASP A OD2   1 
ATOM   3939  N N     . GLY A 1 508 ? -15.780 8.359   15.687  1.00 22.16  ? 508  GLY A N     1 
ATOM   3940  C CA    . GLY A 1 508 ? -14.496 8.561   16.343  1.00 21.33  ? 508  GLY A CA    1 
ATOM   3941  C C     . GLY A 1 508 ? -14.015 10.020  16.352  1.00 20.99  ? 508  GLY A C     1 
ATOM   3942  O O     . GLY A 1 508 ? -12.849 10.285  16.702  1.00 20.24  ? 508  GLY A O     1 
ATOM   3943  N N     . TYR A 1 509 ? -14.895 10.961  15.976  1.00 19.68  ? 509  TYR A N     1 
ATOM   3944  C CA    . TYR A 1 509 ? -14.524 12.388  15.964  1.00 19.04  ? 509  TYR A CA    1 
ATOM   3945  C C     . TYR A 1 509 ? -14.637 12.998  17.353  1.00 18.26  ? 509  TYR A C     1 
ATOM   3946  O O     . TYR A 1 509 ? -15.611 12.755  18.057  1.00 17.27  ? 509  TYR A O     1 
ATOM   3947  C CB    . TYR A 1 509 ? -15.430 13.211  15.036  1.00 19.31  ? 509  TYR A CB    1 
ATOM   3948  C CG    . TYR A 1 509 ? -15.161 13.103  13.555  1.00 19.59  ? 509  TYR A CG    1 
ATOM   3949  C CD1   . TYR A 1 509 ? -14.748 11.892  12.982  1.00 19.68  ? 509  TYR A CD1   1 
ATOM   3950  C CD2   . TYR A 1 509 ? -15.372 14.206  12.708  1.00 17.17  ? 509  TYR A CD2   1 
ATOM   3951  C CE1   . TYR A 1 509 ? -14.520 11.784  11.617  1.00 20.48  ? 509  TYR A CE1   1 
ATOM   3952  C CE2   . TYR A 1 509 ? -15.126 14.110  11.329  1.00 17.59  ? 509  TYR A CE2   1 
ATOM   3953  C CZ    . TYR A 1 509 ? -14.706 12.897  10.798  1.00 19.46  ? 509  TYR A CZ    1 
ATOM   3954  O OH    . TYR A 1 509 ? -14.471 12.768  9.454   1.00 20.75  ? 509  TYR A OH    1 
ATOM   3955  N N     . TYR A 1 510 ? -13.662 13.836  17.706  1.00 17.88  ? 510  TYR A N     1 
ATOM   3956  C CA    . TYR A 1 510 ? -13.717 14.619  18.946  1.00 17.92  ? 510  TYR A CA    1 
ATOM   3957  C C     . TYR A 1 510 ? -14.384 15.988  18.788  1.00 17.64  ? 510  TYR A C     1 
ATOM   3958  O O     . TYR A 1 510 ? -14.141 16.717  17.817  1.00 18.04  ? 510  TYR A O     1 
ATOM   3959  C CB    . TYR A 1 510 ? -12.320 14.751  19.565  1.00 17.82  ? 510  TYR A CB    1 
ATOM   3960  C CG    . TYR A 1 510 ? -11.746 13.426  20.030  1.00 17.51  ? 510  TYR A CG    1 
ATOM   3961  C CD1   . TYR A 1 510 ? -11.033 12.601  19.159  1.00 16.51  ? 510  TYR A CD1   1 
ATOM   3962  C CD2   . TYR A 1 510 ? -11.953 12.983  21.347  1.00 17.01  ? 510  TYR A CD2   1 
ATOM   3963  C CE1   . TYR A 1 510 ? -10.508 11.368  19.605  1.00 18.38  ? 510  TYR A CE1   1 
ATOM   3964  C CE2   . TYR A 1 510 ? -11.443 11.772  21.805  1.00 16.43  ? 510  TYR A CE2   1 
ATOM   3965  C CZ    . TYR A 1 510 ? -10.718 10.968  20.939  1.00 18.40  ? 510  TYR A CZ    1 
ATOM   3966  O OH    . TYR A 1 510 ? -10.219 9.769   21.408  1.00 19.04  ? 510  TYR A OH    1 
ATOM   3967  N N     . TRP A 1 511 ? -15.231 16.316  19.757  1.00 17.79  ? 511  TRP A N     1 
ATOM   3968  C CA    . TRP A 1 511 ? -15.883 17.614  19.857  1.00 18.20  ? 511  TRP A CA    1 
ATOM   3969  C C     . TRP A 1 511 ? -15.432 18.231  21.187  1.00 19.34  ? 511  TRP A C     1 
ATOM   3970  O O     . TRP A 1 511 ? -15.820 17.755  22.246  1.00 19.57  ? 511  TRP A O     1 
ATOM   3971  C CB    . TRP A 1 511 ? -17.408 17.453  19.816  1.00 17.38  ? 511  TRP A CB    1 
ATOM   3972  C CG    . TRP A 1 511 ? -17.925 16.814  18.554  1.00 15.74  ? 511  TRP A CG    1 
ATOM   3973  C CD1   . TRP A 1 511 ? -17.844 15.495  18.211  1.00 15.93  ? 511  TRP A CD1   1 
ATOM   3974  C CD2   . TRP A 1 511 ? -18.609 17.466  17.478  1.00 16.64  ? 511  TRP A CD2   1 
ATOM   3975  N NE1   . TRP A 1 511 ? -18.437 15.276  16.977  1.00 16.78  ? 511  TRP A NE1   1 
ATOM   3976  C CE2   . TRP A 1 511 ? -18.905 16.470  16.500  1.00 17.18  ? 511  TRP A CE2   1 
ATOM   3977  C CE3   . TRP A 1 511 ? -19.000 18.796  17.236  1.00 15.48  ? 511  TRP A CE3   1 
ATOM   3978  C CZ2   . TRP A 1 511 ? -19.574 16.763  15.306  1.00 16.00  ? 511  TRP A CZ2   1 
ATOM   3979  C CZ3   . TRP A 1 511 ? -19.670 19.088  16.050  1.00 16.11  ? 511  TRP A CZ3   1 
ATOM   3980  C CH2   . TRP A 1 511 ? -19.942 18.068  15.093  1.00 16.72  ? 511  TRP A CH2   1 
ATOM   3981  N N     . ILE A 1 512 ? -14.578 19.250  21.124  1.00 20.50  ? 512  ILE A N     1 
ATOM   3982  C CA    . ILE A 1 512 ? -14.029 19.861  22.332  1.00 22.64  ? 512  ILE A CA    1 
ATOM   3983  C C     . ILE A 1 512 ? -15.051 20.804  22.957  1.00 23.64  ? 512  ILE A C     1 
ATOM   3984  O O     . ILE A 1 512 ? -15.448 21.800  22.353  1.00 24.65  ? 512  ILE A O     1 
ATOM   3985  C CB    . ILE A 1 512 ? -12.671 20.583  22.117  1.00 22.50  ? 512  ILE A CB    1 
ATOM   3986  C CG1   . ILE A 1 512 ? -11.529 19.571  21.934  1.00 24.22  ? 512  ILE A CG1   1 
ATOM   3987  C CG2   . ILE A 1 512 ? -12.317 21.372  23.362  1.00 22.27  ? 512  ILE A CG2   1 
ATOM   3988  C CD1   . ILE A 1 512 ? -11.459 18.919  20.574  1.00 27.52  ? 512  ILE A CD1   1 
ATOM   3989  N N     . THR A 1 513 ? -15.482 20.476  24.167  1.00 24.30  ? 513  THR A N     1 
ATOM   3990  C CA    . THR A 1 513 ? -16.563 21.222  24.776  1.00 25.24  ? 513  THR A CA    1 
ATOM   3991  C C     . THR A 1 513 ? -16.051 22.388  25.619  1.00 25.00  ? 513  THR A C     1 
ATOM   3992  O O     . THR A 1 513 ? -16.776 23.360  25.825  1.00 26.19  ? 513  THR A O     1 
ATOM   3993  C CB    . THR A 1 513 ? -17.519 20.291  25.547  1.00 25.22  ? 513  THR A CB    1 
ATOM   3994  O OG1   . THR A 1 513 ? -16.813 19.670  26.621  1.00 27.60  ? 513  THR A OG1   1 
ATOM   3995  C CG2   . THR A 1 513 ? -18.053 19.207  24.608  1.00 25.65  ? 513  THR A CG2   1 
ATOM   3996  N N     . GLY A 1 514 ? -14.796 22.303  26.063  1.00 24.48  ? 514  GLY A N     1 
ATOM   3997  C CA    . GLY A 1 514 ? -14.128 23.411  26.751  1.00 23.72  ? 514  GLY A CA    1 
ATOM   3998  C C     . GLY A 1 514 ? -13.497 23.010  28.072  1.00 23.28  ? 514  GLY A C     1 
ATOM   3999  O O     . GLY A 1 514 ? -13.590 21.846  28.487  1.00 23.25  ? 514  GLY A O     1 
ATOM   4000  N N     . ARG A 1 515 ? -12.875 23.978  28.747  1.00 22.36  ? 515  ARG A N     1 
ATOM   4001  C CA    . ARG A 1 515 ? -12.227 23.726  30.035  1.00 21.26  ? 515  ARG A CA    1 
ATOM   4002  C C     . ARG A 1 515 ? -13.190 23.169  31.077  1.00 21.22  ? 515  ARG A C     1 
ATOM   4003  O O     . ARG A 1 515 ? -14.307 23.659  31.224  1.00 21.02  ? 515  ARG A O     1 
ATOM   4004  C CB    . ARG A 1 515 ? -11.579 24.999  30.585  1.00 21.05  ? 515  ARG A CB    1 
ATOM   4005  C CG    . ARG A 1 515 ? -10.630 25.717  29.632  1.00 19.93  ? 515  ARG A CG    1 
ATOM   4006  C CD    . ARG A 1 515 ? -9.447  24.870  29.258  1.00 18.74  ? 515  ARG A CD    1 
ATOM   4007  N NE    . ARG A 1 515 ? -8.541  24.640  30.381  1.00 17.43  ? 515  ARG A NE    1 
ATOM   4008  C CZ    . ARG A 1 515 ? -7.228  24.527  30.253  1.00 17.05  ? 515  ARG A CZ    1 
ATOM   4009  N NH1   . ARG A 1 515 ? -6.680  24.645  29.038  1.00 15.34  ? 515  ARG A NH1   1 
ATOM   4010  N NH2   . ARG A 1 515 ? -6.466  24.310  31.331  1.00 15.78  ? 515  ARG A NH2   1 
ATOM   4011  N N     . VAL A 1 516 ? -12.736 22.151  31.804  1.00 21.17  ? 516  VAL A N     1 
ATOM   4012  C CA    . VAL A 1 516 ? -13.481 21.582  32.938  1.00 21.21  ? 516  VAL A CA    1 
ATOM   4013  C C     . VAL A 1 516 ? -12.823 22.035  34.243  1.00 21.53  ? 516  VAL A C     1 
ATOM   4014  O O     . VAL A 1 516 ? -13.289 21.716  35.339  1.00 22.03  ? 516  VAL A O     1 
ATOM   4015  C CB    . VAL A 1 516 ? -13.524 20.036  32.894  1.00 20.97  ? 516  VAL A CB    1 
ATOM   4016  C CG1   . VAL A 1 516 ? -14.352 19.564  31.688  1.00 20.71  ? 516  VAL A CG1   1 
ATOM   4017  C CG2   . VAL A 1 516 ? -12.107 19.450  32.858  1.00 19.80  ? 516  VAL A CG2   1 
ATOM   4018  N N     . ASP A 1 517 ? -11.721 22.762  34.113  1.00 21.40  ? 517  ASP A N     1 
ATOM   4019  C CA    . ASP A 1 517 ? -11.055 23.355  35.265  1.00 21.42  ? 517  ASP A CA    1 
ATOM   4020  C C     . ASP A 1 517 ? -11.495 24.831  35.408  1.00 21.59  ? 517  ASP A C     1 
ATOM   4021  O O     . ASP A 1 517 ? -12.460 25.255  34.755  1.00 22.29  ? 517  ASP A O     1 
ATOM   4022  C CB    . ASP A 1 517 ? -9.544  23.168  35.138  1.00 21.17  ? 517  ASP A CB    1 
ATOM   4023  C CG    . ASP A 1 517 ? -8.976  23.747  33.850  1.00 20.82  ? 517  ASP A CG    1 
ATOM   4024  O OD1   . ASP A 1 517 ? -7.758  23.633  33.626  1.00 21.48  ? 517  ASP A OD1   1 
ATOM   4025  O OD2   . ASP A 1 517 ? -9.718  24.329  33.056  1.00 21.65  ? 517  ASP A OD2   1 
ATOM   4026  N N     . ASP A 1 518 ? -10.836 25.610  36.252  1.00 21.38  ? 518  ASP A N     1 
ATOM   4027  C CA    . ASP A 1 518 ? -11.292 26.985  36.476  1.00 22.08  ? 518  ASP A CA    1 
ATOM   4028  C C     . ASP A 1 518 ? -10.548 27.967  35.567  1.00 21.82  ? 518  ASP A C     1 
ATOM   4029  O O     . ASP A 1 518 ? -10.019 28.987  36.030  1.00 22.15  ? 518  ASP A O     1 
ATOM   4030  C CB    . ASP A 1 518 ? -11.161 27.375  37.964  1.00 22.73  ? 518  ASP A CB    1 
ATOM   4031  C CG    . ASP A 1 518 ? -12.066 26.539  38.870  1.00 24.02  ? 518  ASP A CG    1 
ATOM   4032  O OD1   . ASP A 1 518 ? -13.205 26.214  38.459  1.00 25.57  ? 518  ASP A OD1   1 
ATOM   4033  O OD2   . ASP A 1 518 ? -11.634 26.199  39.990  1.00 26.86  ? 518  ASP A OD2   1 
ATOM   4034  N N     . VAL A 1 519 ? -10.505 27.630  34.280  1.00 20.99  ? 519  VAL A N     1 
ATOM   4035  C CA    . VAL A 1 519 ? -9.875  28.442  33.271  1.00 20.25  ? 519  VAL A CA    1 
ATOM   4036  C C     . VAL A 1 519 ? -10.950 28.953  32.341  1.00 20.90  ? 519  VAL A C     1 
ATOM   4037  O O     . VAL A 1 519 ? -11.893 28.235  31.987  1.00 21.13  ? 519  VAL A O     1 
ATOM   4038  C CB    . VAL A 1 519 ? -8.790  27.661  32.485  1.00 20.61  ? 519  VAL A CB    1 
ATOM   4039  C CG1   . VAL A 1 519 ? -8.197  28.513  31.321  1.00 19.24  ? 519  VAL A CG1   1 
ATOM   4040  C CG2   . VAL A 1 519 ? -7.690  27.201  33.421  1.00 17.63  ? 519  VAL A CG2   1 
ATOM   4041  N N     . LEU A 1 520 ? -10.807 30.207  31.942  1.00 21.12  ? 520  LEU A N     1 
ATOM   4042  C CA    . LEU A 1 520 ? -11.809 30.850  31.120  1.00 21.44  ? 520  LEU A CA    1 
ATOM   4043  C C     . LEU A 1 520 ? -11.285 31.045  29.701  1.00 21.74  ? 520  LEU A C     1 
ATOM   4044  O O     . LEU A 1 520 ? -10.064 31.084  29.460  1.00 21.44  ? 520  LEU A O     1 
ATOM   4045  C CB    . LEU A 1 520 ? -12.204 32.205  31.735  1.00 21.92  ? 520  LEU A CB    1 
ATOM   4046  C CG    . LEU A 1 520 ? -13.075 32.271  33.004  1.00 22.91  ? 520  LEU A CG    1 
ATOM   4047  C CD1   . LEU A 1 520 ? -13.772 33.601  33.100  1.00 24.05  ? 520  LEU A CD1   1 
ATOM   4048  C CD2   . LEU A 1 520 ? -14.125 31.150  33.091  1.00 24.29  ? 520  LEU A CD2   1 
ATOM   4049  N N     . ASN A 1 521 ? -12.212 31.176  28.765  1.00 21.73  ? 521  ASN A N     1 
ATOM   4050  C CA    . ASN A 1 521 ? -11.852 31.479  27.407  1.00 22.07  ? 521  ASN A CA    1 
ATOM   4051  C C     . ASN A 1 521 ? -12.594 32.728  26.990  1.00 21.65  ? 521  ASN A C     1 
ATOM   4052  O O     . ASN A 1 521 ? -13.790 32.677  26.746  1.00 20.96  ? 521  ASN A O     1 
ATOM   4053  C CB    . ASN A 1 521 ? -12.200 30.323  26.492  1.00 22.87  ? 521  ASN A CB    1 
ATOM   4054  C CG    . ASN A 1 521 ? -11.439 30.376  25.169  1.00 25.43  ? 521  ASN A CG    1 
ATOM   4055  O OD1   . ASN A 1 521 ? -10.835 29.375  24.746  1.00 26.72  ? 521  ASN A OD1   1 
ATOM   4056  N ND2   . ASN A 1 521 ? -11.480 31.541  24.497  1.00 26.00  ? 521  ASN A ND2   1 
ATOM   4057  N N     . VAL A 1 522 ? -11.872 33.844  26.922  1.00 21.46  ? 522  VAL A N     1 
ATOM   4058  C CA    . VAL A 1 522 ? -12.482 35.146  26.744  1.00 22.03  ? 522  VAL A CA    1 
ATOM   4059  C C     . VAL A 1 522 ? -11.861 35.787  25.519  1.00 22.80  ? 522  VAL A C     1 
ATOM   4060  O O     . VAL A 1 522 ? -10.671 36.155  25.518  1.00 22.99  ? 522  VAL A O     1 
ATOM   4061  C CB    . VAL A 1 522 ? -12.309 36.050  27.995  1.00 22.06  ? 522  VAL A CB    1 
ATOM   4062  C CG1   . VAL A 1 522 ? -12.973 37.384  27.780  1.00 22.19  ? 522  VAL A CG1   1 
ATOM   4063  C CG2   . VAL A 1 522 ? -12.882 35.383  29.281  1.00 21.54  ? 522  VAL A CG2   1 
ATOM   4064  N N     . SER A 1 523 ? -12.666 35.908  24.463  1.00 23.50  ? 523  SER A N     1 
ATOM   4065  C CA    . SER A 1 523 ? -12.192 36.452  23.188  1.00 24.24  ? 523  SER A CA    1 
ATOM   4066  C C     . SER A 1 523 ? -11.026 35.625  22.664  1.00 24.36  ? 523  SER A C     1 
ATOM   4067  O O     . SER A 1 523 ? -10.140 36.150  21.996  1.00 24.93  ? 523  SER A O     1 
ATOM   4068  C CB    . SER A 1 523 ? -11.762 37.926  23.329  1.00 23.83  ? 523  SER A CB    1 
ATOM   4069  O OG    . SER A 1 523 ? -12.880 38.771  23.457  1.00 24.60  ? 523  SER A OG    1 
ATOM   4070  N N     . GLY A 1 524 ? -11.035 34.330  22.954  1.00 24.73  ? 524  GLY A N     1 
ATOM   4071  C CA    . GLY A 1 524 ? -9.945  33.451  22.536  1.00 25.25  ? 524  GLY A CA    1 
ATOM   4072  C C     . GLY A 1 524 ? -8.671  33.650  23.347  1.00 25.80  ? 524  GLY A C     1 
ATOM   4073  O O     . GLY A 1 524 ? -7.575  33.345  22.851  1.00 26.44  ? 524  GLY A O     1 
ATOM   4074  N N     . HIS A 1 525 ? -8.822  34.182  24.570  1.00 25.33  ? 525  HIS A N     1 
ATOM   4075  C CA    . HIS A 1 525 ? -7.746  34.300  25.560  1.00 25.31  ? 525  HIS A CA    1 
ATOM   4076  C C     . HIS A 1 525 ? -8.014  33.438  26.792  1.00 24.86  ? 525  HIS A C     1 
ATOM   4077  O O     . HIS A 1 525 ? -9.094  33.478  27.406  1.00 24.70  ? 525  HIS A O     1 
ATOM   4078  C CB    . HIS A 1 525 ? -7.543  35.749  26.009  1.00 25.82  ? 525  HIS A CB    1 
ATOM   4079  C CG    . HIS A 1 525 ? -7.247  36.695  24.882  1.00 28.51  ? 525  HIS A CG    1 
ATOM   4080  N ND1   . HIS A 1 525 ? -7.962  37.856  24.675  1.00 30.62  ? 525  HIS A ND1   1 
ATOM   4081  C CD2   . HIS A 1 525 ? -6.325  36.642  23.894  1.00 29.45  ? 525  HIS A CD2   1 
ATOM   4082  C CE1   . HIS A 1 525 ? -7.496  38.473  23.604  1.00 30.59  ? 525  HIS A CE1   1 
ATOM   4083  N NE2   . HIS A 1 525 ? -6.502  37.759  23.113  1.00 30.14  ? 525  HIS A NE2   1 
ATOM   4084  N N     . ARG A 1 526 ? -6.989  32.678  27.151  1.00 24.01  ? 526  ARG A N     1 
ATOM   4085  C CA    . ARG A 1 526 ? -7.007  31.777  28.266  1.00 22.68  ? 526  ARG A CA    1 
ATOM   4086  C C     . ARG A 1 526 ? -6.651  32.552  29.547  1.00 22.72  ? 526  ARG A C     1 
ATOM   4087  O O     . ARG A 1 526 ? -5.572  33.127  29.641  1.00 22.74  ? 526  ARG A O     1 
ATOM   4088  C CB    . ARG A 1 526 ? -5.993  30.689  27.958  1.00 22.58  ? 526  ARG A CB    1 
ATOM   4089  C CG    . ARG A 1 526 ? -5.649  29.762  29.082  1.00 20.63  ? 526  ARG A CG    1 
ATOM   4090  C CD    . ARG A 1 526 ? -4.765  28.659  28.563  1.00 18.06  ? 526  ARG A CD    1 
ATOM   4091  N NE    . ARG A 1 526 ? -4.215  27.925  29.694  1.00 16.20  ? 526  ARG A NE    1 
ATOM   4092  C CZ    . ARG A 1 526 ? -3.547  26.787  29.611  1.00 15.17  ? 526  ARG A CZ    1 
ATOM   4093  N NH1   . ARG A 1 526 ? -3.311  26.222  28.424  1.00 13.28  ? 526  ARG A NH1   1 
ATOM   4094  N NH2   . ARG A 1 526 ? -3.111  26.222  30.734  1.00 12.53  ? 526  ARG A NH2   1 
ATOM   4095  N N     . LEU A 1 527 ? -7.570  32.573  30.510  1.00 22.24  ? 527  LEU A N     1 
ATOM   4096  C CA    . LEU A 1 527 ? -7.384  33.280  31.784  1.00 22.85  ? 527  LEU A CA    1 
ATOM   4097  C C     . LEU A 1 527 ? -7.865  32.422  32.943  1.00 22.44  ? 527  LEU A C     1 
ATOM   4098  O O     . LEU A 1 527 ? -8.871  31.749  32.814  1.00 23.55  ? 527  LEU A O     1 
ATOM   4099  C CB    . LEU A 1 527 ? -8.185  34.574  31.813  1.00 22.82  ? 527  LEU A CB    1 
ATOM   4100  C CG    . LEU A 1 527 ? -7.876  35.705  30.843  1.00 23.96  ? 527  LEU A CG    1 
ATOM   4101  C CD1   . LEU A 1 527 ? -9.127  36.531  30.671  1.00 24.55  ? 527  LEU A CD1   1 
ATOM   4102  C CD2   . LEU A 1 527 ? -6.722  36.546  31.358  1.00 25.26  ? 527  LEU A CD2   1 
ATOM   4103  N N     . GLY A 1 528 ? -7.160  32.438  34.065  1.00 21.89  ? 528  GLY A N     1 
ATOM   4104  C CA    . GLY A 1 528 ? -7.611  31.698  35.241  1.00 22.09  ? 528  GLY A CA    1 
ATOM   4105  C C     . GLY A 1 528 ? -8.565  32.546  36.066  1.00 22.02  ? 528  GLY A C     1 
ATOM   4106  O O     . GLY A 1 528 ? -8.389  33.766  36.156  1.00 21.74  ? 528  GLY A O     1 
ATOM   4107  N N     . THR A 1 529 ? -9.585  31.919  36.653  1.00 22.26  ? 529  THR A N     1 
ATOM   4108  C CA    . THR A 1 529 ? -10.522 32.660  37.527  1.00 22.56  ? 529  THR A CA    1 
ATOM   4109  C C     . THR A 1 529 ? -9.873  33.051  38.851  1.00 22.44  ? 529  THR A C     1 
ATOM   4110  O O     . THR A 1 529 ? -10.180 34.116  39.389  1.00 22.43  ? 529  THR A O     1 
ATOM   4111  C CB    . THR A 1 529 ? -11.819 31.908  37.835  1.00 22.55  ? 529  THR A CB    1 
ATOM   4112  O OG1   . THR A 1 529 ? -11.504 30.687  38.498  1.00 22.83  ? 529  THR A OG1   1 
ATOM   4113  C CG2   . THR A 1 529 ? -12.586 31.608  36.557  1.00 23.54  ? 529  THR A CG2   1 
ATOM   4114  N N     . ALA A 1 530 ? -8.983  32.197  39.363  1.00 21.98  ? 530  ALA A N     1 
ATOM   4115  C CA    . ALA A 1 530 ? -8.246  32.513  40.586  1.00 22.20  ? 530  ALA A CA    1 
ATOM   4116  C C     . ALA A 1 530 ? -7.386  33.775  40.445  1.00 22.30  ? 530  ALA A C     1 
ATOM   4117  O O     . ALA A 1 530 ? -7.321  34.586  41.364  1.00 22.33  ? 530  ALA A O     1 
ATOM   4118  C CB    . ALA A 1 530 ? -7.400  31.313  41.056  1.00 21.41  ? 530  ALA A CB    1 
ATOM   4119  N N     . GLU A 1 531 ? -6.765  33.970  39.287  1.00 22.88  ? 531  GLU A N     1 
ATOM   4120  C CA    . GLU A 1 531 ? -5.889  35.118  39.108  1.00 23.49  ? 531  GLU A CA    1 
ATOM   4121  C C     . GLU A 1 531 ? -6.675  36.433  39.026  1.00 23.01  ? 531  GLU A C     1 
ATOM   4122  O O     . GLU A 1 531 ? -6.165  37.490  39.428  1.00 22.97  ? 531  GLU A O     1 
ATOM   4123  C CB    . GLU A 1 531 ? -4.927  34.920  37.924  1.00 23.72  ? 531  GLU A CB    1 
ATOM   4124  C CG    . GLU A 1 531 ? -5.508  35.198  36.545  1.00 25.96  ? 531  GLU A CG    1 
ATOM   4125  C CD    . GLU A 1 531 ? -4.508  34.951  35.414  1.00 25.08  ? 531  GLU A CD    1 
ATOM   4126  O OE1   . GLU A 1 531 ? -3.593  35.774  35.198  1.00 26.54  ? 531  GLU A OE1   1 
ATOM   4127  O OE2   . GLU A 1 531 ? -4.651  33.926  34.738  1.00 27.63  ? 531  GLU A OE2   1 
ATOM   4128  N N     . ILE A 1 532 ? -7.916  36.362  38.530  1.00 22.60  ? 532  ILE A N     1 
ATOM   4129  C CA    . ILE A 1 532 ? -8.796  37.534  38.507  1.00 21.60  ? 532  ILE A CA    1 
ATOM   4130  C C     . ILE A 1 532 ? -9.317  37.811  39.927  1.00 22.13  ? 532  ILE A C     1 
ATOM   4131  O O     . ILE A 1 532 ? -9.342  38.977  40.370  1.00 22.02  ? 532  ILE A O     1 
ATOM   4132  C CB    . ILE A 1 532 ? -9.946  37.385  37.488  1.00 21.80  ? 532  ILE A CB    1 
ATOM   4133  C CG1   . ILE A 1 532 ? -9.375  37.043  36.093  1.00 21.91  ? 532  ILE A CG1   1 
ATOM   4134  C CG2   . ILE A 1 532 ? -10.840 38.670  37.445  1.00 19.23  ? 532  ILE A CG2   1 
ATOM   4135  C CD1   . ILE A 1 532 ? -10.401 36.551  35.083  1.00 21.24  ? 532  ILE A CD1   1 
ATOM   4136  N N     . GLU A 1 533 ? -9.709  36.747  40.634  1.00 21.52  ? 533  GLU A N     1 
ATOM   4137  C CA    . GLU A 1 533 ? -9.974  36.813  42.074  1.00 22.38  ? 533  GLU A CA    1 
ATOM   4138  C C     . GLU A 1 533 ? -8.875  37.510  42.910  1.00 22.48  ? 533  GLU A C     1 
ATOM   4139  O O     . GLU A 1 533 ? -9.180  38.443  43.665  1.00 22.53  ? 533  GLU A O     1 
ATOM   4140  C CB    . GLU A 1 533 ? -10.306 35.422  42.625  1.00 21.75  ? 533  GLU A CB    1 
ATOM   4141  C CG    . GLU A 1 533 ? -11.662 34.946  42.091  1.00 23.33  ? 533  GLU A CG    1 
ATOM   4142  C CD    . GLU A 1 533 ? -11.985 33.480  42.368  1.00 22.47  ? 533  GLU A CD    1 
ATOM   4143  O OE1   . GLU A 1 533 ? -11.307 32.837  43.203  1.00 23.54  ? 533  GLU A OE1   1 
ATOM   4144  O OE2   . GLU A 1 533 ? -12.954 32.986  41.757  1.00 19.99  ? 533  GLU A OE2   1 
ATOM   4145  N N     . SER A 1 534 ? -7.618  37.077  42.775  1.00 22.45  ? 534  SER A N     1 
ATOM   4146  C CA    . SER A 1 534 ? -6.500  37.772  43.426  1.00 23.12  ? 534  SER A CA    1 
ATOM   4147  C C     . SER A 1 534 ? -6.435  39.258  43.073  1.00 22.66  ? 534  SER A C     1 
ATOM   4148  O O     . SER A 1 534 ? -6.236  40.089  43.952  1.00 22.96  ? 534  SER A O     1 
ATOM   4149  C CB    . SER A 1 534 ? -5.163  37.154  43.024  1.00 23.30  ? 534  SER A CB    1 
ATOM   4150  O OG    . SER A 1 534 ? -4.996  35.934  43.683  1.00 27.74  ? 534  SER A OG    1 
ATOM   4151  N N     . ALA A 1 535 ? -6.550  39.579  41.782  1.00 22.22  ? 535  ALA A N     1 
ATOM   4152  C CA    . ALA A 1 535 ? -6.531  40.979  41.333  1.00 22.19  ? 535  ALA A CA    1 
ATOM   4153  C C     . ALA A 1 535 ? -7.590  41.779  42.070  1.00 21.84  ? 535  ALA A C     1 
ATOM   4154  O O     . ALA A 1 535 ? -7.301  42.858  42.616  1.00 22.09  ? 535  ALA A O     1 
ATOM   4155  C CB    . ALA A 1 535 ? -6.717  41.088  39.817  1.00 21.57  ? 535  ALA A CB    1 
ATOM   4156  N N     . LEU A 1 536 ? -8.794  41.218  42.129  1.00 21.46  ? 536  LEU A N     1 
ATOM   4157  C CA    . LEU A 1 536 ? -9.933  41.882  42.771  1.00 21.60  ? 536  LEU A CA    1 
ATOM   4158  C C     . LEU A 1 536 ? -9.732  42.091  44.270  1.00 21.44  ? 536  LEU A C     1 
ATOM   4159  O O     . LEU A 1 536 ? -9.849  43.209  44.781  1.00 21.32  ? 536  LEU A O     1 
ATOM   4160  C CB    . LEU A 1 536 ? -11.216 41.098  42.518  1.00 20.79  ? 536  LEU A CB    1 
ATOM   4161  C CG    . LEU A 1 536 ? -11.779 41.242  41.111  1.00 21.91  ? 536  LEU A CG    1 
ATOM   4162  C CD1   . LEU A 1 536 ? -12.645 40.044  40.766  1.00 21.29  ? 536  LEU A CD1   1 
ATOM   4163  C CD2   . LEU A 1 536 ? -12.578 42.539  40.986  1.00 22.46  ? 536  LEU A CD2   1 
ATOM   4164  N N     . VAL A 1 537 ? -9.428  40.996  44.957  1.00 21.46  ? 537  VAL A N     1 
ATOM   4165  C CA    . VAL A 1 537 ? -9.175  40.994  46.399  1.00 21.34  ? 537  VAL A CA    1 
ATOM   4166  C C     . VAL A 1 537 ? -8.039  41.934  46.805  1.00 21.33  ? 537  VAL A C     1 
ATOM   4167  O O     . VAL A 1 537 ? -8.042  42.472  47.906  1.00 21.39  ? 537  VAL A O     1 
ATOM   4168  C CB    . VAL A 1 537 ? -8.952  39.532  46.887  1.00 21.62  ? 537  VAL A CB    1 
ATOM   4169  C CG1   . VAL A 1 537 ? -8.277  39.468  48.275  1.00 21.47  ? 537  VAL A CG1   1 
ATOM   4170  C CG2   . VAL A 1 537 ? -10.297 38.756  46.842  1.00 21.01  ? 537  VAL A CG2   1 
ATOM   4171  N N     . ALA A 1 538 ? -7.086  42.161  45.905  1.00 21.68  ? 538  ALA A N     1 
ATOM   4172  C CA    . ALA A 1 538 ? -6.041  43.155  46.148  1.00 21.83  ? 538  ALA A CA    1 
ATOM   4173  C C     . ALA A 1 538 ? -6.603  44.591  46.213  1.00 22.11  ? 538  ALA A C     1 
ATOM   4174  O O     . ALA A 1 538 ? -5.967  45.472  46.800  1.00 21.79  ? 538  ALA A O     1 
ATOM   4175  C CB    . ALA A 1 538 ? -4.935  43.049  45.095  1.00 21.67  ? 538  ALA A CB    1 
ATOM   4176  N N     . HIS A 1 539 ? -7.783  44.832  45.630  1.00 22.26  ? 539  HIS A N     1 
ATOM   4177  C CA    . HIS A 1 539 ? -8.427  46.141  45.808  1.00 23.04  ? 539  HIS A CA    1 
ATOM   4178  C C     . HIS A 1 539 ? -8.698  46.423  47.319  1.00 23.20  ? 539  HIS A C     1 
ATOM   4179  O O     . HIS A 1 539 ? -9.244  45.561  48.012  1.00 22.62  ? 539  HIS A O     1 
ATOM   4180  C CB    . HIS A 1 539 ? -9.694  46.288  44.956  1.00 23.02  ? 539  HIS A CB    1 
ATOM   4181  C CG    . HIS A 1 539 ? -10.252 47.681  44.944  1.00 23.73  ? 539  HIS A CG    1 
ATOM   4182  N ND1   . HIS A 1 539 ? -11.009 48.191  45.982  1.00 24.75  ? 539  HIS A ND1   1 
ATOM   4183  C CD2   . HIS A 1 539 ? -10.143 48.680  44.035  1.00 23.50  ? 539  HIS A CD2   1 
ATOM   4184  C CE1   . HIS A 1 539 ? -11.332 49.445  45.716  1.00 23.92  ? 539  HIS A CE1   1 
ATOM   4185  N NE2   . HIS A 1 539 ? -10.819 49.766  44.542  1.00 24.97  ? 539  HIS A NE2   1 
ATOM   4186  N N     . PRO A 1 540 ? -8.317  47.626  47.820  1.00 23.37  ? 540  PRO A N     1 
ATOM   4187  C CA    . PRO A 1 540 ? -8.424  47.907  49.263  1.00 23.54  ? 540  PRO A CA    1 
ATOM   4188  C C     . PRO A 1 540 ? -9.859  47.911  49.847  1.00 23.35  ? 540  PRO A C     1 
ATOM   4189  O O     . PRO A 1 540 ? -10.018 47.847  51.059  1.00 23.86  ? 540  PRO A O     1 
ATOM   4190  C CB    . PRO A 1 540 ? -7.773  49.287  49.412  1.00 23.58  ? 540  PRO A CB    1 
ATOM   4191  C CG    . PRO A 1 540 ? -7.881  49.923  48.066  1.00 23.88  ? 540  PRO A CG    1 
ATOM   4192  C CD    . PRO A 1 540 ? -7.780  48.784  47.078  1.00 23.87  ? 540  PRO A CD    1 
ATOM   4193  N N     . LYS A 1 541 ? -10.884 47.942  49.003  1.00 23.15  ? 541  LYS A N     1 
ATOM   4194  C CA    . LYS A 1 541 ? -12.284 47.921  49.476  1.00 22.63  ? 541  LYS A CA    1 
ATOM   4195  C C     . LYS A 1 541 ? -12.952 46.560  49.390  1.00 22.19  ? 541  LYS A C     1 
ATOM   4196  O O     . LYS A 1 541 ? -14.075 46.394  49.844  1.00 21.66  ? 541  LYS A O     1 
ATOM   4197  C CB    . LYS A 1 541 ? -13.112 48.946  48.709  1.00 22.68  ? 541  LYS A CB    1 
ATOM   4198  C CG    . LYS A 1 541 ? -13.053 50.332  49.354  1.00 24.25  ? 541  LYS A CG    1 
ATOM   4199  C CD    . LYS A 1 541 ? -13.621 51.393  48.456  1.00 26.48  ? 541  LYS A CD    1 
ATOM   4200  C CE    . LYS A 1 541 ? -13.933 52.647  49.243  1.00 29.18  ? 541  LYS A CE    1 
ATOM   4201  N NZ    . LYS A 1 541 ? -13.022 52.847  50.431  1.00 31.82  ? 541  LYS A NZ    1 
ATOM   4202  N N     . ILE A 1 542 ? -12.240 45.588  48.812  1.00 22.33  ? 542  ILE A N     1 
ATOM   4203  C CA    . ILE A 1 542 ? -12.782 44.266  48.523  1.00 21.47  ? 542  ILE A CA    1 
ATOM   4204  C C     . ILE A 1 542 ? -12.222 43.249  49.500  1.00 22.39  ? 542  ILE A C     1 
ATOM   4205  O O     . ILE A 1 542 ? -11.012 43.218  49.729  1.00 22.07  ? 542  ILE A O     1 
ATOM   4206  C CB    . ILE A 1 542 ? -12.453 43.844  47.073  1.00 21.79  ? 542  ILE A CB    1 
ATOM   4207  C CG1   . ILE A 1 542 ? -13.140 44.804  46.086  1.00 20.71  ? 542  ILE A CG1   1 
ATOM   4208  C CG2   . ILE A 1 542 ? -12.810 42.341  46.806  1.00 18.65  ? 542  ILE A CG2   1 
ATOM   4209  C CD1   . ILE A 1 542 ? -12.827 44.522  44.630  1.00 20.98  ? 542  ILE A CD1   1 
ATOM   4210  N N     . ALA A 1 543 ? -13.123 42.434  50.053  1.00 22.49  ? 543  ALA A N     1 
ATOM   4211  C CA    . ALA A 1 543 ? -12.797 41.356  50.977  1.00 23.38  ? 543  ALA A CA    1 
ATOM   4212  C C     . ALA A 1 543 ? -12.729 40.003  50.266  1.00 23.80  ? 543  ALA A C     1 
ATOM   4213  O O     . ALA A 1 543 ? -11.824 39.213  50.509  1.00 23.94  ? 543  ALA A O     1 
ATOM   4214  C CB    . ALA A 1 543 ? -13.856 41.289  52.100  1.00 23.33  ? 543  ALA A CB    1 
ATOM   4215  N N     . GLU A 1 544 ? -13.717 39.729  49.419  1.00 23.81  ? 544  GLU A N     1 
ATOM   4216  C CA    . GLU A 1 544 ? -13.797 38.450  48.728  1.00 24.47  ? 544  GLU A CA    1 
ATOM   4217  C C     . GLU A 1 544 ? -14.316 38.618  47.305  1.00 24.08  ? 544  GLU A C     1 
ATOM   4218  O O     . GLU A 1 544 ? -14.987 39.610  46.977  1.00 23.41  ? 544  GLU A O     1 
ATOM   4219  C CB    . GLU A 1 544 ? -14.719 37.472  49.472  1.00 24.74  ? 544  GLU A CB    1 
ATOM   4220  C CG    . GLU A 1 544 ? -14.312 37.149  50.900  1.00 27.26  ? 544  GLU A CG    1 
ATOM   4221  C CD    . GLU A 1 544 ? -15.415 36.450  51.646  1.00 29.83  ? 544  GLU A CD    1 
ATOM   4222  O OE1   . GLU A 1 544 ? -15.964 37.030  52.610  1.00 31.59  ? 544  GLU A OE1   1 
ATOM   4223  O OE2   . GLU A 1 544 ? -15.757 35.328  51.243  1.00 32.13  ? 544  GLU A OE2   1 
ATOM   4224  N N     . ALA A 1 545 ? -14.001 37.637  46.470  1.00 23.63  ? 545  ALA A N     1 
ATOM   4225  C CA    . ALA A 1 545 ? -14.480 37.637  45.109  1.00 24.29  ? 545  ALA A CA    1 
ATOM   4226  C C     . ALA A 1 545 ? -14.526 36.223  44.546  1.00 24.17  ? 545  ALA A C     1 
ATOM   4227  O O     . ALA A 1 545 ? -13.749 35.356  44.943  1.00 24.34  ? 545  ALA A O     1 
ATOM   4228  C CB    . ALA A 1 545 ? -13.631 38.599  44.196  1.00 24.00  ? 545  ALA A CB    1 
ATOM   4229  N N     . ALA A 1 546 ? -15.462 36.013  43.625  1.00 23.86  ? 546  ALA A N     1 
ATOM   4230  C CA    . ALA A 1 546 ? -15.607 34.753  42.924  1.00 23.21  ? 546  ALA A CA    1 
ATOM   4231  C C     . ALA A 1 546 ? -15.978 35.077  41.489  1.00 22.91  ? 546  ALA A C     1 
ATOM   4232  O O     . ALA A 1 546 ? -16.969 35.742  41.210  1.00 22.73  ? 546  ALA A O     1 
ATOM   4233  C CB    . ALA A 1 546 ? -16.657 33.872  43.583  1.00 22.75  ? 546  ALA A CB    1 
ATOM   4234  N N     . VAL A 1 547 ? -15.135 34.608  40.589  1.00 23.11  ? 547  VAL A N     1 
ATOM   4235  C CA    . VAL A 1 547 ? -15.232 34.914  39.184  1.00 23.34  ? 547  VAL A CA    1 
ATOM   4236  C C     . VAL A 1 547 ? -15.693 33.650  38.481  1.00 23.67  ? 547  VAL A C     1 
ATOM   4237  O O     . VAL A 1 547 ? -15.229 32.550  38.791  1.00 24.05  ? 547  VAL A O     1 
ATOM   4238  C CB    . VAL A 1 547 ? -13.863 35.407  38.653  1.00 23.15  ? 547  VAL A CB    1 
ATOM   4239  C CG1   . VAL A 1 547 ? -13.875 35.555  37.142  1.00 22.92  ? 547  VAL A CG1   1 
ATOM   4240  C CG2   . VAL A 1 547 ? -13.500 36.735  39.328  1.00 22.22  ? 547  VAL A CG2   1 
ATOM   4241  N N     . VAL A 1 548 ? -16.655 33.814  37.586  1.00 24.23  ? 548  VAL A N     1 
ATOM   4242  C CA    . VAL A 1 548 ? -17.158 32.720  36.748  1.00 24.75  ? 548  VAL A CA    1 
ATOM   4243  C C     . VAL A 1 548 ? -17.209 33.240  35.311  1.00 25.04  ? 548  VAL A C     1 
ATOM   4244  O O     . VAL A 1 548 ? -17.198 34.451  35.082  1.00 25.51  ? 548  VAL A O     1 
ATOM   4245  C CB    . VAL A 1 548 ? -18.576 32.187  37.222  1.00 24.91  ? 548  VAL A CB    1 
ATOM   4246  C CG1   . VAL A 1 548 ? -18.493 31.542  38.610  1.00 23.71  ? 548  VAL A CG1   1 
ATOM   4247  C CG2   . VAL A 1 548 ? -19.647 33.300  37.207  1.00 24.78  ? 548  VAL A CG2   1 
ATOM   4248  N N     . GLY A 1 549 ? -17.227 32.327  34.345  1.00 25.63  ? 549  GLY A N     1 
ATOM   4249  C CA    . GLY A 1 549 ? -17.473 32.689  32.950  1.00 25.24  ? 549  GLY A CA    1 
ATOM   4250  C C     . GLY A 1 549 ? -18.943 32.486  32.645  1.00 25.52  ? 549  GLY A C     1 
ATOM   4251  O O     . GLY A 1 549 ? -19.591 31.627  33.236  1.00 25.20  ? 549  GLY A O     1 
ATOM   4252  N N     . ILE A 1 550 ? -19.471 33.310  31.745  1.00 25.65  ? 550  ILE A N     1 
ATOM   4253  C CA    . ILE A 1 550 ? -20.821 33.152  31.215  1.00 25.84  ? 550  ILE A CA    1 
ATOM   4254  C C     . ILE A 1 550 ? -20.734 33.188  29.686  1.00 25.71  ? 550  ILE A C     1 
ATOM   4255  O O     . ILE A 1 550 ? -19.753 33.700  29.138  1.00 25.04  ? 550  ILE A O     1 
ATOM   4256  C CB    . ILE A 1 550 ? -21.789 34.250  31.724  1.00 25.92  ? 550  ILE A CB    1 
ATOM   4257  C CG1   . ILE A 1 550 ? -21.351 35.651  31.261  1.00 26.11  ? 550  ILE A CG1   1 
ATOM   4258  C CG2   . ILE A 1 550 ? -21.880 34.215  33.240  1.00 26.26  ? 550  ILE A CG2   1 
ATOM   4259  C CD1   . ILE A 1 550 ? -22.390 36.739  31.577  1.00 26.54  ? 550  ILE A CD1   1 
ATOM   4260  N N     . PRO A 1 551 ? -21.740 32.613  29.002  1.00 25.55  ? 551  PRO A N     1 
ATOM   4261  C CA    . PRO A 1 551 ? -21.781 32.637  27.555  1.00 25.42  ? 551  PRO A CA    1 
ATOM   4262  C C     . PRO A 1 551 ? -21.884 34.056  27.031  1.00 25.28  ? 551  PRO A C     1 
ATOM   4263  O O     . PRO A 1 551 ? -22.469 34.926  27.673  1.00 25.40  ? 551  PRO A O     1 
ATOM   4264  C CB    . PRO A 1 551 ? -23.056 31.853  27.233  1.00 25.50  ? 551  PRO A CB    1 
ATOM   4265  C CG    . PRO A 1 551 ? -23.217 30.940  28.412  1.00 25.35  ? 551  PRO A CG    1 
ATOM   4266  C CD    . PRO A 1 551 ? -22.878 31.849  29.550  1.00 25.57  ? 551  PRO A CD    1 
ATOM   4267  N N     . HIS A 1 552 ? -21.280 34.290  25.879  1.00 24.70  ? 552  HIS A N     1 
ATOM   4268  C CA    . HIS A 1 552 ? -21.319 35.589  25.286  1.00 24.48  ? 552  HIS A CA    1 
ATOM   4269  C C     . HIS A 1 552 ? -21.232 35.377  23.795  1.00 24.44  ? 552  HIS A C     1 
ATOM   4270  O O     . HIS A 1 552 ? -20.301 34.725  23.309  1.00 25.00  ? 552  HIS A O     1 
ATOM   4271  C CB    . HIS A 1 552 ? -20.161 36.446  25.791  1.00 24.30  ? 552  HIS A CB    1 
ATOM   4272  C CG    . HIS A 1 552 ? -20.176 37.840  25.249  1.00 24.87  ? 552  HIS A CG    1 
ATOM   4273  N ND1   . HIS A 1 552 ? -20.400 38.945  26.043  1.00 24.36  ? 552  HIS A ND1   1 
ATOM   4274  C CD2   . HIS A 1 552 ? -20.031 38.305  23.984  1.00 24.60  ? 552  HIS A CD2   1 
ATOM   4275  C CE1   . HIS A 1 552 ? -20.379 40.032  25.293  1.00 25.15  ? 552  HIS A CE1   1 
ATOM   4276  N NE2   . HIS A 1 552 ? -20.160 39.671  24.041  1.00 26.45  ? 552  HIS A NE2   1 
ATOM   4277  N N     . ALA A 1 553 ? -22.190 35.957  23.076  1.00 24.27  ? 553  ALA A N     1 
ATOM   4278  C CA    . ALA A 1 553 ? -22.391 35.705  21.651  1.00 23.87  ? 553  ALA A CA    1 
ATOM   4279  C C     . ALA A 1 553 ? -21.190 36.014  20.742  1.00 23.84  ? 553  ALA A C     1 
ATOM   4280  O O     . ALA A 1 553 ? -21.030 35.382  19.688  1.00 23.64  ? 553  ALA A O     1 
ATOM   4281  C CB    . ALA A 1 553 ? -23.646 36.429  21.164  1.00 23.75  ? 553  ALA A CB    1 
ATOM   4282  N N     . ILE A 1 554 ? -20.373 37.000  21.120  1.00 23.88  ? 554  ILE A N     1 
ATOM   4283  C CA    . ILE A 1 554 ? -19.131 37.270  20.379  1.00 24.24  ? 554  ILE A CA    1 
ATOM   4284  C C     . ILE A 1 554 ? -17.919 36.701  21.106  1.00 24.13  ? 554  ILE A C     1 
ATOM   4285  O O     . ILE A 1 554 ? -17.179 35.891  20.536  1.00 24.77  ? 554  ILE A O     1 
ATOM   4286  C CB    . ILE A 1 554 ? -18.910 38.791  19.999  1.00 24.69  ? 554  ILE A CB    1 
ATOM   4287  C CG1   . ILE A 1 554 ? -20.145 39.385  19.282  1.00 25.65  ? 554  ILE A CG1   1 
ATOM   4288  C CG2   . ILE A 1 554 ? -17.619 38.986  19.150  1.00 23.29  ? 554  ILE A CG2   1 
ATOM   4289  C CD1   . ILE A 1 554 ? -20.405 38.843  17.865  1.00 26.03  ? 554  ILE A CD1   1 
ATOM   4290  N N     . LYS A 1 555 ? -17.743 37.110  22.359  1.00 23.62  ? 555  LYS A N     1 
ATOM   4291  C CA    . LYS A 1 555 ? -16.574 36.749  23.162  1.00 23.84  ? 555  LYS A CA    1 
ATOM   4292  C C     . LYS A 1 555 ? -16.433 35.258  23.528  1.00 23.62  ? 555  LYS A C     1 
ATOM   4293  O O     . LYS A 1 555 ? -15.340 34.815  23.919  1.00 23.55  ? 555  LYS A O     1 
ATOM   4294  C CB    . LYS A 1 555 ? -16.551 37.590  24.442  1.00 24.13  ? 555  LYS A CB    1 
ATOM   4295  C CG    . LYS A 1 555 ? -16.419 39.088  24.180  1.00 25.64  ? 555  LYS A CG    1 
ATOM   4296  C CD    . LYS A 1 555 ? -15.830 39.811  25.371  1.00 27.09  ? 555  LYS A CD    1 
ATOM   4297  C CE    . LYS A 1 555 ? -16.859 40.568  26.148  1.00 28.64  ? 555  LYS A CE    1 
ATOM   4298  N NZ    . LYS A 1 555 ? -16.345 41.968  26.374  1.00 29.81  ? 555  LYS A NZ    1 
ATOM   4299  N N     . GLY A 1 556 ? -17.528 34.498  23.430  1.00 23.11  ? 556  GLY A N     1 
ATOM   4300  C CA    . GLY A 1 556 ? -17.530 33.089  23.833  1.00 22.75  ? 556  GLY A CA    1 
ATOM   4301  C C     . GLY A 1 556 ? -17.900 32.994  25.299  1.00 22.90  ? 556  GLY A C     1 
ATOM   4302  O O     . GLY A 1 556 ? -18.963 32.506  25.635  1.00 22.73  ? 556  GLY A O     1 
ATOM   4303  N N     . GLN A 1 557 ? -17.012 33.472  26.167  1.00 22.97  ? 557  GLN A N     1 
ATOM   4304  C CA    . GLN A 1 557 ? -17.328 33.694  27.570  1.00 23.65  ? 557  GLN A CA    1 
ATOM   4305  C C     . GLN A 1 557 ? -17.087 35.148  27.908  1.00 23.36  ? 557  GLN A C     1 
ATOM   4306  O O     . GLN A 1 557 ? -16.189 35.774  27.361  1.00 24.00  ? 557  GLN A O     1 
ATOM   4307  C CB    . GLN A 1 557 ? -16.479 32.807  28.512  1.00 23.45  ? 557  GLN A CB    1 
ATOM   4308  C CG    . GLN A 1 557 ? -16.846 31.346  28.490  1.00 23.59  ? 557  GLN A CG    1 
ATOM   4309  C CD    . GLN A 1 557 ? -16.151 30.538  29.581  1.00 25.25  ? 557  GLN A CD    1 
ATOM   4310  O OE1   . GLN A 1 557 ? -14.914 30.480  29.629  1.00 26.87  ? 557  GLN A OE1   1 
ATOM   4311  N NE2   . GLN A 1 557 ? -16.951 29.891  30.459  1.00 24.14  ? 557  GLN A NE2   1 
ATOM   4312  N N     . ALA A 1 558 ? -17.909 35.681  28.801  1.00 23.46  ? 558  ALA A N     1 
ATOM   4313  C CA    . ALA A 1 558 ? -17.664 36.973  29.423  1.00 23.30  ? 558  ALA A CA    1 
ATOM   4314  C C     . ALA A 1 558 ? -17.279 36.702  30.871  1.00 23.00  ? 558  ALA A C     1 
ATOM   4315  O O     . ALA A 1 558 ? -17.514 35.613  31.374  1.00 23.38  ? 558  ALA A O     1 
ATOM   4316  C CB    . ALA A 1 558 ? -18.908 37.876  29.332  1.00 23.04  ? 558  ALA A CB    1 
ATOM   4317  N N     . ILE A 1 559 ? -16.652 37.686  31.515  1.00 23.01  ? 559  ILE A N     1 
ATOM   4318  C CA    . ILE A 1 559 ? -16.202 37.580  32.900  1.00 22.41  ? 559  ILE A CA    1 
ATOM   4319  C C     . ILE A 1 559 ? -17.233 38.163  33.840  1.00 22.23  ? 559  ILE A C     1 
ATOM   4320  O O     . ILE A 1 559 ? -17.552 39.350  33.763  1.00 22.19  ? 559  ILE A O     1 
ATOM   4321  C CB    . ILE A 1 559 ? -14.821 38.284  33.106  1.00 22.80  ? 559  ILE A CB    1 
ATOM   4322  C CG1   . ILE A 1 559 ? -13.748 37.592  32.242  1.00 23.00  ? 559  ILE A CG1   1 
ATOM   4323  C CG2   . ILE A 1 559 ? -14.437 38.283  34.584  1.00 20.84  ? 559  ILE A CG2   1 
ATOM   4324  C CD1   . ILE A 1 559 ? -12.491 38.383  31.955  1.00 21.80  ? 559  ILE A CD1   1 
ATOM   4325  N N     . TYR A 1 560 ? -17.763 37.320  34.719  1.00 22.64  ? 560  TYR A N     1 
ATOM   4326  C CA    . TYR A 1 560 ? -18.774 37.746  35.680  1.00 22.66  ? 560  TYR A CA    1 
ATOM   4327  C C     . TYR A 1 560 ? -18.176 37.580  37.064  1.00 22.70  ? 560  TYR A C     1 
ATOM   4328  O O     . TYR A 1 560 ? -17.795 36.479  37.454  1.00 22.71  ? 560  TYR A O     1 
ATOM   4329  C CB    . TYR A 1 560 ? -20.047 36.919  35.492  1.00 23.27  ? 560  TYR A CB    1 
ATOM   4330  C CG    . TYR A 1 560 ? -21.270 37.291  36.325  1.00 23.45  ? 560  TYR A CG    1 
ATOM   4331  C CD1   . TYR A 1 560 ? -21.260 37.186  37.715  1.00 23.18  ? 560  TYR A CD1   1 
ATOM   4332  C CD2   . TYR A 1 560 ? -22.460 37.698  35.705  1.00 24.19  ? 560  TYR A CD2   1 
ATOM   4333  C CE1   . TYR A 1 560 ? -22.397 37.495  38.471  1.00 23.37  ? 560  TYR A CE1   1 
ATOM   4334  C CE2   . TYR A 1 560 ? -23.603 38.013  36.454  1.00 24.20  ? 560  TYR A CE2   1 
ATOM   4335  C CZ    . TYR A 1 560 ? -23.560 37.908  37.835  1.00 24.79  ? 560  TYR A CZ    1 
ATOM   4336  O OH    . TYR A 1 560 ? -24.683 38.211  38.591  1.00 25.96  ? 560  TYR A OH    1 
ATOM   4337  N N     . ALA A 1 561 ? -18.041 38.691  37.785  1.00 22.66  ? 561  ALA A N     1 
ATOM   4338  C CA    . ALA A 1 561 ? -17.380 38.681  39.092  1.00 22.38  ? 561  ALA A CA    1 
ATOM   4339  C C     . ALA A 1 561 ? -18.385 39.000  40.204  1.00 22.77  ? 561  ALA A C     1 
ATOM   4340  O O     . ALA A 1 561 ? -19.018 40.053  40.197  1.00 22.25  ? 561  ALA A O     1 
ATOM   4341  C CB    . ALA A 1 561 ? -16.185 39.661  39.118  1.00 21.26  ? 561  ALA A CB    1 
ATOM   4342  N N     . TYR A 1 562 ? -18.553 38.052  41.122  1.00 23.07  ? 562  TYR A N     1 
ATOM   4343  C CA    . TYR A 1 562 ? -19.245 38.295  42.373  1.00 23.97  ? 562  TYR A CA    1 
ATOM   4344  C C     . TYR A 1 562 ? -18.258 38.908  43.372  1.00 23.97  ? 562  TYR A C     1 
ATOM   4345  O O     . TYR A 1 562 ? -17.170 38.345  43.603  1.00 23.96  ? 562  TYR A O     1 
ATOM   4346  C CB    . TYR A 1 562 ? -19.766 36.977  42.962  1.00 24.18  ? 562  TYR A CB    1 
ATOM   4347  C CG    . TYR A 1 562 ? -20.846 36.293  42.178  1.00 24.55  ? 562  TYR A CG    1 
ATOM   4348  C CD1   . TYR A 1 562 ? -20.530 35.378  41.173  1.00 23.63  ? 562  TYR A CD1   1 
ATOM   4349  C CD2   . TYR A 1 562 ? -22.197 36.530  42.469  1.00 24.70  ? 562  TYR A CD2   1 
ATOM   4350  C CE1   . TYR A 1 562 ? -21.535 34.735  40.455  1.00 25.00  ? 562  TYR A CE1   1 
ATOM   4351  C CE2   . TYR A 1 562 ? -23.210 35.878  41.764  1.00 24.99  ? 562  TYR A CE2   1 
ATOM   4352  C CZ    . TYR A 1 562 ? -22.879 34.985  40.757  1.00 25.26  ? 562  TYR A CZ    1 
ATOM   4353  O OH    . TYR A 1 562 ? -23.891 34.333  40.063  1.00 25.15  ? 562  TYR A OH    1 
ATOM   4354  N N     . VAL A 1 563 ? -18.650 40.017  43.991  1.00 24.06  ? 563  VAL A N     1 
ATOM   4355  C CA    . VAL A 1 563 ? -17.725 40.800  44.823  1.00 24.73  ? 563  VAL A CA    1 
ATOM   4356  C C     . VAL A 1 563 ? -18.287 41.179  46.197  1.00 25.11  ? 563  VAL A C     1 
ATOM   4357  O O     . VAL A 1 563 ? -19.350 41.806  46.313  1.00 25.09  ? 563  VAL A O     1 
ATOM   4358  C CB    . VAL A 1 563 ? -17.225 42.091  44.075  1.00 24.92  ? 563  VAL A CB    1 
ATOM   4359  C CG1   . VAL A 1 563 ? -16.288 42.935  44.961  1.00 24.44  ? 563  VAL A CG1   1 
ATOM   4360  C CG2   . VAL A 1 563 ? -16.538 41.722  42.766  1.00 24.62  ? 563  VAL A CG2   1 
ATOM   4361  N N     . THR A 1 564 ? -17.551 40.805  47.235  1.00 25.62  ? 564  THR A N     1 
ATOM   4362  C CA    . THR A 1 564 ? -17.907 41.186  48.588  1.00 26.25  ? 564  THR A CA    1 
ATOM   4363  C C     . THR A 1 564 ? -16.964 42.270  49.106  1.00 26.85  ? 564  THR A C     1 
ATOM   4364  O O     . THR A 1 564 ? -15.749 42.079  49.192  1.00 26.93  ? 564  THR A O     1 
ATOM   4365  C CB    . THR A 1 564 ? -17.931 39.960  49.537  1.00 26.12  ? 564  THR A CB    1 
ATOM   4366  O OG1   . THR A 1 564 ? -18.855 38.995  49.030  1.00 25.38  ? 564  THR A OG1   1 
ATOM   4367  C CG2   . THR A 1 564 ? -18.365 40.371  50.959  1.00 25.74  ? 564  THR A CG2   1 
ATOM   4368  N N     . LEU A 1 565 ? -17.543 43.404  49.473  1.00 27.83  ? 565  LEU A N     1 
ATOM   4369  C CA    . LEU A 1 565 ? -16.767 44.497  50.024  1.00 28.63  ? 565  LEU A CA    1 
ATOM   4370  C C     . LEU A 1 565 ? -16.454 44.308  51.505  1.00 29.63  ? 565  LEU A C     1 
ATOM   4371  O O     . LEU A 1 565 ? -17.218 43.657  52.244  1.00 29.74  ? 565  LEU A O     1 
ATOM   4372  C CB    . LEU A 1 565 ? -17.464 45.835  49.779  1.00 28.19  ? 565  LEU A CB    1 
ATOM   4373  C CG    . LEU A 1 565 ? -17.866 46.059  48.314  1.00 27.89  ? 565  LEU A CG    1 
ATOM   4374  C CD1   . LEU A 1 565 ? -18.643 47.376  48.116  1.00 25.74  ? 565  LEU A CD1   1 
ATOM   4375  C CD2   . LEU A 1 565 ? -16.639 45.968  47.401  1.00 27.40  ? 565  LEU A CD2   1 
ATOM   4376  N N     . ASN A 1 566 ? -15.313 44.870  51.920  1.00 30.79  ? 566  ASN A N     1 
ATOM   4377  C CA    . ASN A 1 566 ? -14.963 45.022  53.325  1.00 31.88  ? 566  ASN A CA    1 
ATOM   4378  C C     . ASN A 1 566 ? -16.155 45.641  54.069  1.00 33.39  ? 566  ASN A C     1 
ATOM   4379  O O     . ASN A 1 566 ? -16.928 46.410  53.482  1.00 33.38  ? 566  ASN A O     1 
ATOM   4380  C CB    . ASN A 1 566 ? -13.716 45.898  53.464  1.00 31.37  ? 566  ASN A CB    1 
ATOM   4381  C CG    . ASN A 1 566 ? -12.443 45.233  52.920  1.00 30.98  ? 566  ASN A CG    1 
ATOM   4382  O OD1   . ASN A 1 566 ? -12.290 44.015  52.961  1.00 30.42  ? 566  ASN A OD1   1 
ATOM   4383  N ND2   . ASN A 1 566 ? -11.512 46.049  52.434  1.00 29.90  ? 566  ASN A ND2   1 
ATOM   4384  N N     . HIS A 1 567 ? -16.339 45.294  55.341  1.00 35.38  ? 567  HIS A N     1 
ATOM   4385  C CA    . HIS A 1 567 ? -17.543 45.755  56.043  1.00 37.31  ? 567  HIS A CA    1 
ATOM   4386  C C     . HIS A 1 567 ? -17.602 47.265  56.219  1.00 37.34  ? 567  HIS A C     1 
ATOM   4387  O O     . HIS A 1 567 ? -16.583 47.918  56.434  1.00 37.40  ? 567  HIS A O     1 
ATOM   4388  C CB    . HIS A 1 567 ? -17.789 44.991  57.348  1.00 38.39  ? 567  HIS A CB    1 
ATOM   4389  C CG    . HIS A 1 567 ? -18.642 43.773  57.153  1.00 42.53  ? 567  HIS A CG    1 
ATOM   4390  N ND1   . HIS A 1 567 ? -18.132 42.489  57.180  1.00 45.47  ? 567  HIS A ND1   1 
ATOM   4391  C CD2   . HIS A 1 567 ? -19.961 43.650  56.856  1.00 45.51  ? 567  HIS A CD2   1 
ATOM   4392  C CE1   . HIS A 1 567 ? -19.108 41.627  56.944  1.00 47.11  ? 567  HIS A CE1   1 
ATOM   4393  N NE2   . HIS A 1 567 ? -20.228 42.306  56.744  1.00 47.18  ? 567  HIS A NE2   1 
ATOM   4394  N N     . GLY A 1 568 ? -18.806 47.810  56.074  1.00 37.60  ? 568  GLY A N     1 
ATOM   4395  C CA    . GLY A 1 568 ? -19.005 49.250  56.108  1.00 37.78  ? 568  GLY A CA    1 
ATOM   4396  C C     . GLY A 1 568 ? -18.966 49.911  54.746  1.00 37.95  ? 568  GLY A C     1 
ATOM   4397  O O     . GLY A 1 568 ? -19.495 51.011  54.596  1.00 37.99  ? 568  GLY A O     1 
ATOM   4398  N N     . GLU A 1 569 ? -18.330 49.260  53.760  1.00 37.89  ? 569  GLU A N     1 
ATOM   4399  C CA    . GLU A 1 569 ? -18.204 49.826  52.400  1.00 37.57  ? 569  GLU A CA    1 
ATOM   4400  C C     . GLU A 1 569 ? -19.493 49.626  51.607  1.00 36.86  ? 569  GLU A C     1 
ATOM   4401  O O     . GLU A 1 569 ? -20.153 48.592  51.738  1.00 36.60  ? 569  GLU A O     1 
ATOM   4402  C CB    . GLU A 1 569 ? -17.014 49.229  51.617  1.00 37.76  ? 569  GLU A CB    1 
ATOM   4403  C CG    . GLU A 1 569 ? -15.693 49.116  52.387  1.00 38.87  ? 569  GLU A CG    1 
ATOM   4404  C CD    . GLU A 1 569 ? -14.886 50.413  52.463  1.00 41.50  ? 569  GLU A CD    1 
ATOM   4405  O OE1   . GLU A 1 569 ? -15.390 51.484  52.038  1.00 41.75  ? 569  GLU A OE1   1 
ATOM   4406  O OE2   . GLU A 1 569 ? -13.728 50.347  52.955  1.00 42.17  ? 569  GLU A OE2   1 
ATOM   4407  N N     . GLU A 1 570 ? -19.832 50.621  50.788  1.00 36.03  ? 570  GLU A N     1 
ATOM   4408  C CA    . GLU A 1 570 ? -21.031 50.600  49.955  1.00 35.71  ? 570  GLU A CA    1 
ATOM   4409  C C     . GLU A 1 570 ? -20.690 50.615  48.460  1.00 34.91  ? 570  GLU A C     1 
ATOM   4410  O O     . GLU A 1 570 ? -19.755 51.299  48.032  1.00 34.69  ? 570  GLU A O     1 
ATOM   4411  C CB    . GLU A 1 570 ? -21.919 51.821  50.254  1.00 35.62  ? 570  GLU A CB    1 
ATOM   4412  C CG    . GLU A 1 570 ? -22.895 51.674  51.399  1.00 36.68  ? 570  GLU A CG    1 
ATOM   4413  C CD    . GLU A 1 570 ? -23.897 52.847  51.411  1.00 36.31  ? 570  GLU A CD    1 
ATOM   4414  N N     . PRO A 1 571 ? -21.468 49.880  47.653  1.00 34.21  ? 571  PRO A N     1 
ATOM   4415  C CA    . PRO A 1 571 ? -21.360 50.034  46.199  1.00 33.83  ? 571  PRO A CA    1 
ATOM   4416  C C     . PRO A 1 571 ? -21.755 51.432  45.691  1.00 33.38  ? 571  PRO A C     1 
ATOM   4417  O O     . PRO A 1 571 ? -22.493 52.164  46.361  1.00 33.04  ? 571  PRO A O     1 
ATOM   4418  C CB    . PRO A 1 571 ? -22.340 48.990  45.642  1.00 33.66  ? 571  PRO A CB    1 
ATOM   4419  C CG    . PRO A 1 571 ? -22.675 48.096  46.769  1.00 34.56  ? 571  PRO A CG    1 
ATOM   4420  C CD    . PRO A 1 571 ? -22.448 48.854  48.045  1.00 34.07  ? 571  PRO A CD    1 
ATOM   4421  N N     . SER A 1 572 ? -21.249 51.770  44.504  1.00 32.83  ? 572  SER A N     1 
ATOM   4422  C CA    . SER A 1 572 ? -21.603 52.986  43.758  1.00 32.04  ? 572  SER A CA    1 
ATOM   4423  C C     . SER A 1 572 ? -21.189 52.766  42.303  1.00 31.60  ? 572  SER A C     1 
ATOM   4424  O O     . SER A 1 572 ? -20.418 51.842  42.019  1.00 31.51  ? 572  SER A O     1 
ATOM   4425  C CB    . SER A 1 572 ? -20.895 54.212  44.326  1.00 31.79  ? 572  SER A CB    1 
ATOM   4426  O OG    . SER A 1 572 ? -19.503 53.995  44.444  1.00 31.88  ? 572  SER A OG    1 
ATOM   4427  N N     . PRO A 1 573 ? -21.729 53.577  41.367  1.00 31.16  ? 573  PRO A N     1 
ATOM   4428  C CA    . PRO A 1 573 ? -21.250 53.471  39.978  1.00 30.22  ? 573  PRO A CA    1 
ATOM   4429  C C     . PRO A 1 573 ? -19.787 53.889  39.841  1.00 29.59  ? 573  PRO A C     1 
ATOM   4430  O O     . PRO A 1 573 ? -19.072 53.335  38.992  1.00 29.47  ? 573  PRO A O     1 
ATOM   4431  C CB    . PRO A 1 573 ? -22.172 54.433  39.203  1.00 30.60  ? 573  PRO A CB    1 
ATOM   4432  C CG    . PRO A 1 573 ? -23.381 54.630  40.093  1.00 30.77  ? 573  PRO A CG    1 
ATOM   4433  C CD    . PRO A 1 573 ? -22.816 54.573  41.499  1.00 31.03  ? 573  PRO A CD    1 
ATOM   4434  N N     . GLU A 1 574 ? -19.357 54.860  40.655  1.00 28.15  ? 574  GLU A N     1 
ATOM   4435  C CA    . GLU A 1 574 ? -17.951 55.254  40.728  1.00 27.57  ? 574  GLU A CA    1 
ATOM   4436  C C     . GLU A 1 574 ? -17.068 54.042  41.023  1.00 26.50  ? 574  GLU A C     1 
ATOM   4437  O O     . GLU A 1 574 ? -16.063 53.817  40.343  1.00 25.27  ? 574  GLU A O     1 
ATOM   4438  C CB    . GLU A 1 574 ? -17.710 56.319  41.813  1.00 27.83  ? 574  GLU A CB    1 
ATOM   4439  C CG    . GLU A 1 574 ? -18.285 57.715  41.521  1.00 31.05  ? 574  GLU A CG    1 
ATOM   4440  C CD    . GLU A 1 574 ? -19.822 57.813  41.688  1.00 34.07  ? 574  GLU A CD    1 
ATOM   4441  O OE1   . GLU A 1 574 ? -20.452 56.886  42.276  1.00 32.55  ? 574  GLU A OE1   1 
ATOM   4442  O OE2   . GLU A 1 574 ? -20.393 58.843  41.229  1.00 36.21  ? 574  GLU A OE2   1 
ATOM   4443  N N     . LEU A 1 575 ? -17.460 53.282  42.049  1.00 25.79  ? 575  LEU A N     1 
ATOM   4444  C CA    . LEU A 1 575 ? -16.701 52.130  42.521  1.00 25.49  ? 575  LEU A CA    1 
ATOM   4445  C C     . LEU A 1 575 ? -16.726 50.989  41.491  1.00 25.28  ? 575  LEU A C     1 
ATOM   4446  O O     . LEU A 1 575 ? -15.744 50.263  41.318  1.00 24.98  ? 575  LEU A O     1 
ATOM   4447  C CB    . LEU A 1 575 ? -17.213 51.661  43.884  1.00 25.10  ? 575  LEU A CB    1 
ATOM   4448  C CG    . LEU A 1 575 ? -16.481 50.434  44.434  1.00 26.10  ? 575  LEU A CG    1 
ATOM   4449  C CD1   . LEU A 1 575 ? -15.059 50.764  44.902  1.00 24.48  ? 575  LEU A CD1   1 
ATOM   4450  C CD2   . LEU A 1 575 ? -17.310 49.769  45.538  1.00 27.34  ? 575  LEU A CD2   1 
ATOM   4451  N N     . TYR A 1 576 ? -17.843 50.886  40.783  1.00 24.77  ? 576  TYR A N     1 
ATOM   4452  C CA    . TYR A 1 576 ? -18.006 49.927  39.712  1.00 24.63  ? 576  TYR A CA    1 
ATOM   4453  C C     . TYR A 1 576 ? -16.955 50.087  38.599  1.00 24.19  ? 576  TYR A C     1 
ATOM   4454  O O     . TYR A 1 576 ? -16.256 49.123  38.237  1.00 23.94  ? 576  TYR A O     1 
ATOM   4455  C CB    . TYR A 1 576 ? -19.419 50.047  39.153  1.00 24.87  ? 576  TYR A CB    1 
ATOM   4456  C CG    . TYR A 1 576 ? -19.846 48.887  38.289  1.00 26.21  ? 576  TYR A CG    1 
ATOM   4457  C CD1   . TYR A 1 576 ? -20.668 47.881  38.793  1.00 26.29  ? 576  TYR A CD1   1 
ATOM   4458  C CD2   . TYR A 1 576 ? -19.446 48.812  36.954  1.00 26.98  ? 576  TYR A CD2   1 
ATOM   4459  C CE1   . TYR A 1 576 ? -21.078 46.834  37.985  1.00 26.75  ? 576  TYR A CE1   1 
ATOM   4460  C CE2   . TYR A 1 576 ? -19.840 47.766  36.144  1.00 27.26  ? 576  TYR A CE2   1 
ATOM   4461  C CZ    . TYR A 1 576 ? -20.650 46.785  36.665  1.00 26.85  ? 576  TYR A CZ    1 
ATOM   4462  O OH    . TYR A 1 576 ? -21.023 45.760  35.848  1.00 26.98  ? 576  TYR A OH    1 
ATOM   4463  N N     . ALA A 1 577 ? -16.848 51.300  38.064  1.00 23.19  ? 577  ALA A N     1 
ATOM   4464  C CA    . ALA A 1 577 ? -15.828 51.616  37.076  1.00 22.27  ? 577  ALA A CA    1 
ATOM   4465  C C     . ALA A 1 577 ? -14.440 51.393  37.674  1.00 22.23  ? 577  ALA A C     1 
ATOM   4466  O O     . ALA A 1 577 ? -13.551 50.848  37.016  1.00 22.13  ? 577  ALA A O     1 
ATOM   4467  C CB    . ALA A 1 577 ? -15.982 53.043  36.603  1.00 21.35  ? 577  ALA A CB    1 
ATOM   4468  N N     . GLU A 1 578 ? -14.277 51.782  38.937  1.00 21.71  ? 578  GLU A N     1 
ATOM   4469  C CA    . GLU A 1 578 ? -12.971 51.770  39.590  1.00 21.58  ? 578  GLU A CA    1 
ATOM   4470  C C     . GLU A 1 578 ? -12.424 50.362  39.772  1.00 20.79  ? 578  GLU A C     1 
ATOM   4471  O O     . GLU A 1 578 ? -11.220 50.128  39.593  1.00 20.54  ? 578  GLU A O     1 
ATOM   4472  C CB    . GLU A 1 578 ? -13.060 52.473  40.934  1.00 21.66  ? 578  GLU A CB    1 
ATOM   4473  C CG    . GLU A 1 578 ? -11.783 52.414  41.764  1.00 24.02  ? 578  GLU A CG    1 
ATOM   4474  C CD    . GLU A 1 578 ? -11.964 53.087  43.108  1.00 26.64  ? 578  GLU A CD    1 
ATOM   4475  O OE1   . GLU A 1 578 ? -12.396 54.271  43.133  1.00 27.02  ? 578  GLU A OE1   1 
ATOM   4476  O OE2   . GLU A 1 578 ? -11.685 52.430  44.128  1.00 25.87  ? 578  GLU A OE2   1 
ATOM   4477  N N     . VAL A 1 579 ? -13.316 49.439  40.121  1.00 20.45  ? 579  VAL A N     1 
ATOM   4478  C CA    . VAL A 1 579 ? -12.973 48.020  40.269  1.00 20.74  ? 579  VAL A CA    1 
ATOM   4479  C C     . VAL A 1 579 ? -12.656 47.368  38.897  1.00 20.89  ? 579  VAL A C     1 
ATOM   4480  O O     . VAL A 1 579 ? -11.711 46.598  38.792  1.00 21.36  ? 579  VAL A O     1 
ATOM   4481  C CB    . VAL A 1 579 ? -14.040 47.255  41.113  1.00 20.69  ? 579  VAL A CB    1 
ATOM   4482  C CG1   . VAL A 1 579 ? -13.834 45.735  41.069  1.00 20.98  ? 579  VAL A CG1   1 
ATOM   4483  C CG2   . VAL A 1 579 ? -14.008 47.720  42.573  1.00 19.83  ? 579  VAL A CG2   1 
ATOM   4484  N N     . ARG A 1 580 ? -13.393 47.722  37.843  1.00 21.00  ? 580  ARG A N     1 
ATOM   4485  C CA    . ARG A 1 580 ? -13.014 47.301  36.485  1.00 21.39  ? 580  ARG A CA    1 
ATOM   4486  C C     . ARG A 1 580 ? -11.622 47.820  36.072  1.00 20.99  ? 580  ARG A C     1 
ATOM   4487  O O     . ARG A 1 580 ? -10.773 47.072  35.580  1.00 19.86  ? 580  ARG A O     1 
ATOM   4488  C CB    . ARG A 1 580 ? -14.071 47.719  35.455  1.00 21.46  ? 580  ARG A CB    1 
ATOM   4489  C CG    . ARG A 1 580 ? -15.477 47.158  35.752  1.00 25.49  ? 580  ARG A CG    1 
ATOM   4490  C CD    . ARG A 1 580 ? -16.295 46.807  34.480  1.00 29.33  ? 580  ARG A CD    1 
ATOM   4491  N NE    . ARG A 1 580 ? -16.159 47.803  33.423  1.00 33.25  ? 580  ARG A NE    1 
ATOM   4492  C CZ    . ARG A 1 580 ? -16.163 47.526  32.125  1.00 36.07  ? 580  ARG A CZ    1 
ATOM   4493  N NH1   . ARG A 1 580 ? -16.288 46.270  31.699  1.00 36.62  ? 580  ARG A NH1   1 
ATOM   4494  N NH2   . ARG A 1 580 ? -16.013 48.508  31.248  1.00 38.55  ? 580  ARG A NH2   1 
ATOM   4495  N N     . ASN A 1 581 ? -11.409 49.121  36.271  1.00 21.33  ? 581  ASN A N     1 
ATOM   4496  C CA    . ASN A 1 581 ? -10.130 49.764  35.996  1.00 20.93  ? 581  ASN A CA    1 
ATOM   4497  C C     . ASN A 1 581 ? -9.018  49.084  36.810  1.00 20.68  ? 581  ASN A C     1 
ATOM   4498  O O     . ASN A 1 581 ? -7.904  48.871  36.307  1.00 19.85  ? 581  ASN A O     1 
ATOM   4499  C CB    . ASN A 1 581 ? -10.203 51.283  36.293  1.00 20.55  ? 581  ASN A CB    1 
ATOM   4500  C CG    . ASN A 1 581 ? -10.911 52.083  35.167  1.00 21.58  ? 581  ASN A CG    1 
ATOM   4501  O OD1   . ASN A 1 581 ? -10.793 51.769  33.980  1.00 21.52  ? 581  ASN A OD1   1 
ATOM   4502  N ND2   . ASN A 1 581 ? -11.651 53.109  35.554  1.00 20.34  ? 581  ASN A ND2   1 
ATOM   4503  N N     . TRP A 1 582 ? -9.346  48.723  38.057  1.00 20.39  ? 582  TRP A N     1 
ATOM   4504  C CA    . TRP A 1 582 ? -8.393  48.035  38.941  1.00 20.23  ? 582  TRP A CA    1 
ATOM   4505  C C     . TRP A 1 582 ? -7.861  46.741  38.287  1.00 19.95  ? 582  TRP A C     1 
ATOM   4506  O O     . TRP A 1 582 ? -6.660  46.523  38.222  1.00 19.87  ? 582  TRP A O     1 
ATOM   4507  C CB    . TRP A 1 582 ? -9.028  47.754  40.312  1.00 19.95  ? 582  TRP A CB    1 
ATOM   4508  C CG    . TRP A 1 582 ? -8.138  47.033  41.234  1.00 19.78  ? 582  TRP A CG    1 
ATOM   4509  C CD1   . TRP A 1 582 ? -8.112  45.689  41.458  1.00 18.12  ? 582  TRP A CD1   1 
ATOM   4510  C CD2   . TRP A 1 582 ? -7.119  47.611  42.071  1.00 20.07  ? 582  TRP A CD2   1 
ATOM   4511  N NE1   . TRP A 1 582 ? -7.141  45.387  42.389  1.00 19.40  ? 582  TRP A NE1   1 
ATOM   4512  C CE2   . TRP A 1 582 ? -6.515  46.545  42.783  1.00 19.29  ? 582  TRP A CE2   1 
ATOM   4513  C CE3   . TRP A 1 582 ? -6.664  48.928  42.293  1.00 20.65  ? 582  TRP A CE3   1 
ATOM   4514  C CZ2   . TRP A 1 582 ? -5.476  46.744  43.702  1.00 18.68  ? 582  TRP A CZ2   1 
ATOM   4515  C CZ3   . TRP A 1 582 ? -5.629  49.136  43.216  1.00 20.15  ? 582  TRP A CZ3   1 
ATOM   4516  C CH2   . TRP A 1 582 ? -5.042  48.036  43.912  1.00 19.34  ? 582  TRP A CH2   1 
ATOM   4517  N N     . VAL A 1 583 ? -8.759  45.904  37.791  1.00 19.87  ? 583  VAL A N     1 
ATOM   4518  C CA    . VAL A 1 583 ? -8.346  44.665  37.122  1.00 20.31  ? 583  VAL A CA    1 
ATOM   4519  C C     . VAL A 1 583 ? -7.638  44.949  35.776  1.00 20.64  ? 583  VAL A C     1 
ATOM   4520  O O     . VAL A 1 583 ? -6.669  44.273  35.405  1.00 20.60  ? 583  VAL A O     1 
ATOM   4521  C CB    . VAL A 1 583 ? -9.549  43.706  36.941  1.00 20.30  ? 583  VAL A CB    1 
ATOM   4522  C CG1   . VAL A 1 583 ? -9.156  42.472  36.159  1.00 19.96  ? 583  VAL A CG1   1 
ATOM   4523  C CG2   . VAL A 1 583 ? -10.162 43.333  38.295  1.00 18.82  ? 583  VAL A CG2   1 
ATOM   4524  N N     . ARG A 1 584 ? -8.116  45.962  35.066  1.00 20.57  ? 584  ARG A N     1 
ATOM   4525  C CA    . ARG A 1 584 ? -7.469  46.416  33.845  1.00 22.14  ? 584  ARG A CA    1 
ATOM   4526  C C     . ARG A 1 584 ? -5.997  46.779  34.137  1.00 21.38  ? 584  ARG A C     1 
ATOM   4527  O O     . ARG A 1 584 ? -5.107  46.483  33.348  1.00 21.93  ? 584  ARG A O     1 
ATOM   4528  C CB    . ARG A 1 584 ? -8.296  47.562  33.221  1.00 21.47  ? 584  ARG A CB    1 
ATOM   4529  C CG    . ARG A 1 584 ? -7.604  48.375  32.136  1.00 26.16  ? 584  ARG A CG    1 
ATOM   4530  C CD    . ARG A 1 584 ? -8.433  49.605  31.678  1.00 25.15  ? 584  ARG A CD    1 
ATOM   4531  N NE    . ARG A 1 584 ? -9.325  49.214  30.572  1.00 33.53  ? 584  ARG A NE    1 
ATOM   4532  C CZ    . ARG A 1 584 ? -9.048  49.381  29.272  1.00 33.05  ? 584  ARG A CZ    1 
ATOM   4533  N NH1   . ARG A 1 584 ? -7.910  49.955  28.873  1.00 32.23  ? 584  ARG A NH1   1 
ATOM   4534  N NH2   . ARG A 1 584 ? -9.926  48.979  28.368  1.00 33.54  ? 584  ARG A NH2   1 
ATOM   4535  N N     . LYS A 1 585 ? -5.747  47.373  35.297  1.00 21.07  ? 585  LYS A N     1 
ATOM   4536  C CA    . LYS A 1 585 ? -4.401  47.734  35.721  1.00 21.07  ? 585  LYS A CA    1 
ATOM   4537  C C     . LYS A 1 585 ? -3.549  46.548  36.197  1.00 19.85  ? 585  LYS A C     1 
ATOM   4538  O O     . LYS A 1 585 ? -2.332  46.536  35.973  1.00 17.90  ? 585  LYS A O     1 
ATOM   4539  C CB    . LYS A 1 585 ? -4.473  48.804  36.826  1.00 21.19  ? 585  LYS A CB    1 
ATOM   4540  C CG    . LYS A 1 585 ? -3.156  49.086  37.546  1.00 21.94  ? 585  LYS A CG    1 
ATOM   4541  C CD    . LYS A 1 585 ? -3.379  50.054  38.708  1.00 24.39  ? 585  LYS A CD    1 
ATOM   4542  C CE    . LYS A 1 585 ? -2.857  49.505  40.066  1.00 27.96  ? 585  LYS A CE    1 
ATOM   4543  N NZ    . LYS A 1 585 ? -3.606  48.292  40.512  1.00 26.30  ? 585  LYS A NZ    1 
ATOM   4544  N N     . GLU A 1 586 ? -4.185  45.582  36.873  1.00 19.47  ? 586  GLU A N     1 
ATOM   4545  C CA    . GLU A 1 586 ? -3.476  44.449  37.483  1.00 20.15  ? 586  GLU A CA    1 
ATOM   4546  C C     . GLU A 1 586 ? -3.020  43.430  36.444  1.00 20.44  ? 586  GLU A C     1 
ATOM   4547  O O     . GLU A 1 586 ? -1.947  42.828  36.578  1.00 20.80  ? 586  GLU A O     1 
ATOM   4548  C CB    . GLU A 1 586 ? -4.360  43.755  38.522  1.00 20.94  ? 586  GLU A CB    1 
ATOM   4549  C CG    . GLU A 1 586 ? -4.546  44.544  39.834  1.00 21.96  ? 586  GLU A CG    1 
ATOM   4550  C CD    . GLU A 1 586 ? -3.246  44.675  40.614  1.00 25.44  ? 586  GLU A CD    1 
ATOM   4551  O OE1   . GLU A 1 586 ? -2.604  43.636  40.879  1.00 26.53  ? 586  GLU A OE1   1 
ATOM   4552  O OE2   . GLU A 1 586 ? -2.858  45.814  40.946  1.00 25.67  ? 586  GLU A OE2   1 
ATOM   4553  N N     . ILE A 1 587 ? -3.835  43.255  35.406  1.00 20.17  ? 587  ILE A N     1 
ATOM   4554  C CA    . ILE A 1 587 ? -3.622  42.213  34.415  1.00 20.70  ? 587  ILE A CA    1 
ATOM   4555  C C     . ILE A 1 587 ? -3.632  42.808  33.015  1.00 21.04  ? 587  ILE A C     1 
ATOM   4556  O O     . ILE A 1 587 ? -2.668  42.657  32.263  1.00 21.25  ? 587  ILE A O     1 
ATOM   4557  C CB    . ILE A 1 587 ? -4.679  41.082  34.522  1.00 20.53  ? 587  ILE A CB    1 
ATOM   4558  C CG1   . ILE A 1 587 ? -4.650  40.453  35.924  1.00 20.04  ? 587  ILE A CG1   1 
ATOM   4559  C CG2   . ILE A 1 587 ? -4.443  40.011  33.423  1.00 20.50  ? 587  ILE A CG2   1 
ATOM   4560  C CD1   . ILE A 1 587 ? -5.924  39.718  36.294  1.00 20.59  ? 587  ILE A CD1   1 
ATOM   4561  N N     . GLY A 1 588 ? -4.716  43.492  32.673  1.00 21.11  ? 588  GLY A N     1 
ATOM   4562  C CA    . GLY A 1 588 ? -4.845  44.081  31.355  1.00 21.55  ? 588  GLY A CA    1 
ATOM   4563  C C     . GLY A 1 588 ? -6.305  44.114  30.965  1.00 21.75  ? 588  GLY A C     1 
ATOM   4564  O O     . GLY A 1 588 ? -7.132  43.479  31.622  1.00 21.70  ? 588  GLY A O     1 
ATOM   4565  N N     . PRO A 1 589 ? -6.632  44.878  29.915  1.00 22.20  ? 589  PRO A N     1 
ATOM   4566  C CA    . PRO A 1 589 ? -8.002  45.015  29.398  1.00 23.25  ? 589  PRO A CA    1 
ATOM   4567  C C     . PRO A 1 589 ? -8.663  43.688  29.064  1.00 23.97  ? 589  PRO A C     1 
ATOM   4568  O O     . PRO A 1 589 ? -9.873  43.557  29.246  1.00 24.79  ? 589  PRO A O     1 
ATOM   4569  C CB    . PRO A 1 589 ? -7.827  45.847  28.124  1.00 23.10  ? 589  PRO A CB    1 
ATOM   4570  C CG    . PRO A 1 589 ? -6.549  46.615  28.357  1.00 23.88  ? 589  PRO A CG    1 
ATOM   4571  C CD    . PRO A 1 589 ? -5.668  45.708  29.171  1.00 22.32  ? 589  PRO A CD    1 
ATOM   4572  N N     . LEU A 1 590 ? -7.869  42.721  28.602  1.00 24.54  ? 590  LEU A N     1 
ATOM   4573  C CA    . LEU A 1 590 ? -8.347  41.371  28.288  1.00 25.34  ? 590  LEU A CA    1 
ATOM   4574  C C     . LEU A 1 590 ? -9.030  40.689  29.469  1.00 25.87  ? 590  LEU A C     1 
ATOM   4575  O O     . LEU A 1 590 ? -9.907  39.866  29.260  1.00 26.95  ? 590  LEU A O     1 
ATOM   4576  C CB    . LEU A 1 590 ? -7.196  40.487  27.734  1.00 25.47  ? 590  LEU A CB    1 
ATOM   4577  C CG    . LEU A 1 590 ? -6.144  39.846  28.669  1.00 26.27  ? 590  LEU A CG    1 
ATOM   4578  C CD1   . LEU A 1 590 ? -5.339  38.755  27.952  1.00 26.77  ? 590  LEU A CD1   1 
ATOM   4579  C CD2   . LEU A 1 590 ? -5.187  40.885  29.311  1.00 25.55  ? 590  LEU A CD2   1 
ATOM   4580  N N     . ALA A 1 591 ? -8.628  41.024  30.701  1.00 26.27  ? 591  ALA A N     1 
ATOM   4581  C CA    . ALA A 1 591 ? -9.172  40.382  31.919  1.00 26.36  ? 591  ALA A CA    1 
ATOM   4582  C C     . ALA A 1 591 ? -10.245 41.206  32.643  1.00 26.57  ? 591  ALA A C     1 
ATOM   4583  O O     . ALA A 1 591 ? -10.673 40.845  33.727  1.00 26.70  ? 591  ALA A O     1 
ATOM   4584  C CB    . ALA A 1 591 ? -8.048  40.039  32.888  1.00 25.49  ? 591  ALA A CB    1 
ATOM   4585  N N     . THR A 1 592 ? -10.657 42.317  32.046  1.00 27.01  ? 592  THR A N     1 
ATOM   4586  C CA    . THR A 1 592 ? -11.616 43.215  32.657  1.00 27.97  ? 592  THR A CA    1 
ATOM   4587  C C     . THR A 1 592 ? -12.999 42.563  32.849  1.00 27.81  ? 592  THR A C     1 
ATOM   4588  O O     . THR A 1 592 ? -13.635 42.174  31.878  1.00 27.29  ? 592  THR A O     1 
ATOM   4589  C CB    . THR A 1 592 ? -11.737 44.522  31.812  1.00 28.60  ? 592  THR A CB    1 
ATOM   4590  O OG1   . THR A 1 592 ? -10.467 45.185  31.805  1.00 29.76  ? 592  THR A OG1   1 
ATOM   4591  C CG2   . THR A 1 592 ? -12.810 45.483  32.383  1.00 29.34  ? 592  THR A CG2   1 
ATOM   4592  N N     . PRO A 1 593 ? -13.478 42.467  34.109  1.00 28.30  ? 593  PRO A N     1 
ATOM   4593  C CA    . PRO A 1 593 ? -14.827 41.911  34.294  1.00 28.58  ? 593  PRO A CA    1 
ATOM   4594  C C     . PRO A 1 593 ? -15.866 42.610  33.434  1.00 28.90  ? 593  PRO A C     1 
ATOM   4595  O O     . PRO A 1 593 ? -15.871 43.831  33.316  1.00 28.99  ? 593  PRO A O     1 
ATOM   4596  C CB    . PRO A 1 593 ? -15.117 42.149  35.777  1.00 28.77  ? 593  PRO A CB    1 
ATOM   4597  C CG    . PRO A 1 593 ? -13.762 42.239  36.421  1.00 28.49  ? 593  PRO A CG    1 
ATOM   4598  C CD    . PRO A 1 593 ? -12.844 42.836  35.393  1.00 28.07  ? 593  PRO A CD    1 
ATOM   4599  N N     . ASP A 1 594 ? -16.719 41.821  32.806  1.00 29.25  ? 594  ASP A N     1 
ATOM   4600  C CA    . ASP A 1 594 ? -17.856 42.358  32.087  1.00 29.53  ? 594  ASP A CA    1 
ATOM   4601  C C     . ASP A 1 594 ? -18.984 42.751  33.060  1.00 28.93  ? 594  ASP A C     1 
ATOM   4602  O O     . ASP A 1 594 ? -19.661 43.762  32.877  1.00 28.69  ? 594  ASP A O     1 
ATOM   4603  C CB    . ASP A 1 594 ? -18.325 41.331  31.060  1.00 29.64  ? 594  ASP A CB    1 
ATOM   4604  C CG    . ASP A 1 594 ? -17.307 41.123  29.975  1.00 32.71  ? 594  ASP A CG    1 
ATOM   4605  O OD1   . ASP A 1 594 ? -17.467 41.814  28.950  1.00 34.59  ? 594  ASP A OD1   1 
ATOM   4606  O OD2   . ASP A 1 594 ? -16.335 40.313  30.150  1.00 34.46  ? 594  ASP A OD2   1 
ATOM   4607  N N     . VAL A 1 595 ? -19.180 41.936  34.089  1.00 28.28  ? 595  VAL A N     1 
ATOM   4608  C CA    . VAL A 1 595 ? -20.185 42.223  35.086  1.00 28.10  ? 595  VAL A CA    1 
ATOM   4609  C C     . VAL A 1 595 ? -19.542 42.174  36.455  1.00 27.48  ? 595  VAL A C     1 
ATOM   4610  O O     . VAL A 1 595 ? -18.704 41.311  36.725  1.00 27.00  ? 595  VAL A O     1 
ATOM   4611  C CB    . VAL A 1 595 ? -21.382 41.211  35.014  1.00 28.53  ? 595  VAL A CB    1 
ATOM   4612  C CG1   . VAL A 1 595 ? -22.398 41.486  36.095  1.00 26.43  ? 595  VAL A CG1   1 
ATOM   4613  C CG2   . VAL A 1 595 ? -22.037 41.250  33.626  1.00 29.18  ? 595  VAL A CG2   1 
ATOM   4614  N N     . LEU A 1 596 ? -19.933 43.124  37.300  1.00 27.54  ? 596  LEU A N     1 
ATOM   4615  C CA    . LEU A 1 596 ? -19.656 43.070  38.743  1.00 27.66  ? 596  LEU A CA    1 
ATOM   4616  C C     . LEU A 1 596 ? -20.958 42.914  39.520  1.00 27.97  ? 596  LEU A C     1 
ATOM   4617  O O     . LEU A 1 596 ? -21.869 43.755  39.430  1.00 28.03  ? 596  LEU A O     1 
ATOM   4618  C CB    . LEU A 1 596 ? -18.915 44.320  39.225  1.00 27.45  ? 596  LEU A CB    1 
ATOM   4619  C CG    . LEU A 1 596 ? -17.562 44.695  38.611  1.00 26.99  ? 596  LEU A CG    1 
ATOM   4620  C CD1   . LEU A 1 596 ? -17.160 46.067  39.147  1.00 26.04  ? 596  LEU A CD1   1 
ATOM   4621  C CD2   . LEU A 1 596 ? -16.514 43.659  38.949  1.00 26.51  ? 596  LEU A CD2   1 
ATOM   4622  N N     . HIS A 1 597 ? -21.029 41.833  40.291  1.00 28.41  ? 597  HIS A N     1 
ATOM   4623  C CA    . HIS A 1 597 ? -22.192 41.495  41.093  1.00 28.44  ? 597  HIS A CA    1 
ATOM   4624  C C     . HIS A 1 597 ? -21.800 41.691  42.549  1.00 28.69  ? 597  HIS A C     1 
ATOM   4625  O O     . HIS A 1 597 ? -21.137 40.830  43.148  1.00 29.04  ? 597  HIS A O     1 
ATOM   4626  C CB    . HIS A 1 597 ? -22.573 40.039  40.820  1.00 28.53  ? 597  HIS A CB    1 
ATOM   4627  C CG    . HIS A 1 597 ? -23.744 39.541  41.616  1.00 30.17  ? 597  HIS A CG    1 
ATOM   4628  N ND1   . HIS A 1 597 ? -24.773 38.820  41.048  1.00 31.05  ? 597  HIS A ND1   1 
ATOM   4629  C CD2   . HIS A 1 597 ? -24.044 39.647  42.934  1.00 29.94  ? 597  HIS A CD2   1 
ATOM   4630  C CE1   . HIS A 1 597 ? -25.652 38.498  41.981  1.00 30.92  ? 597  HIS A CE1   1 
ATOM   4631  N NE2   . HIS A 1 597 ? -25.232 38.988  43.133  1.00 32.10  ? 597  HIS A NE2   1 
ATOM   4632  N N     . TRP A 1 598 ? -22.179 42.833  43.121  1.00 28.62  ? 598  TRP A N     1 
ATOM   4633  C CA    . TRP A 1 598 ? -21.959 43.058  44.548  1.00 28.52  ? 598  TRP A CA    1 
ATOM   4634  C C     . TRP A 1 598 ? -22.893 42.137  45.347  1.00 29.21  ? 598  TRP A C     1 
ATOM   4635  O O     . TRP A 1 598 ? -24.120 42.113  45.129  1.00 29.07  ? 598  TRP A O     1 
ATOM   4636  C CB    . TRP A 1 598 ? -22.237 44.503  44.956  1.00 27.48  ? 598  TRP A CB    1 
ATOM   4637  C CG    . TRP A 1 598 ? -21.823 45.565  44.014  1.00 27.52  ? 598  TRP A CG    1 
ATOM   4638  C CD1   . TRP A 1 598 ? -22.653 46.385  43.286  1.00 27.28  ? 598  TRP A CD1   1 
ATOM   4639  C CD2   . TRP A 1 598 ? -20.482 45.985  43.715  1.00 26.84  ? 598  TRP A CD2   1 
ATOM   4640  N NE1   . TRP A 1 598 ? -21.908 47.286  42.550  1.00 26.76  ? 598  TRP A NE1   1 
ATOM   4641  C CE2   . TRP A 1 598 ? -20.576 47.062  42.791  1.00 27.22  ? 598  TRP A CE2   1 
ATOM   4642  C CE3   . TRP A 1 598 ? -19.213 45.556  44.128  1.00 26.00  ? 598  TRP A CE3   1 
ATOM   4643  C CZ2   . TRP A 1 598 ? -19.437 47.724  42.280  1.00 27.32  ? 598  TRP A CZ2   1 
ATOM   4644  C CZ3   . TRP A 1 598 ? -18.081 46.198  43.603  1.00 27.16  ? 598  TRP A CZ3   1 
ATOM   4645  C CH2   . TRP A 1 598 ? -18.206 47.281  42.695  1.00 27.11  ? 598  TRP A CH2   1 
ATOM   4646  N N     . THR A 1 599 ? -22.313 41.397  46.281  1.00 29.99  ? 599  THR A N     1 
ATOM   4647  C CA    . THR A 1 599 ? -23.084 40.500  47.134  1.00 30.58  ? 599  THR A CA    1 
ATOM   4648  C C     . THR A 1 599 ? -22.443 40.319  48.516  1.00 31.47  ? 599  THR A C     1 
ATOM   4649  O O     . THR A 1 599 ? -21.233 40.495  48.687  1.00 31.16  ? 599  THR A O     1 
ATOM   4650  C CB    . THR A 1 599 ? -23.281 39.119  46.455  1.00 30.17  ? 599  THR A CB    1 
ATOM   4651  O OG1   . THR A 1 599 ? -24.230 38.339  47.200  1.00 31.65  ? 599  THR A OG1   1 
ATOM   4652  C CG2   . THR A 1 599 ? -21.979 38.361  46.352  1.00 28.92  ? 599  THR A CG2   1 
ATOM   4653  N N     . ASP A 1 600 ? -23.271 39.974  49.499  1.00 32.73  ? 600  ASP A N     1 
ATOM   4654  C CA    . ASP A 1 600 ? -22.774 39.455  50.774  1.00 33.92  ? 600  ASP A CA    1 
ATOM   4655  C C     . ASP A 1 600 ? -23.106 37.969  50.900  1.00 34.11  ? 600  ASP A C     1 
ATOM   4656  O O     . ASP A 1 600 ? -22.820 37.344  51.915  1.00 34.00  ? 600  ASP A O     1 
ATOM   4657  C CB    . ASP A 1 600 ? -23.352 40.241  51.952  1.00 34.03  ? 600  ASP A CB    1 
ATOM   4658  C CG    . ASP A 1 600 ? -22.722 41.614  52.095  1.00 36.05  ? 600  ASP A CG    1 
ATOM   4659  O OD1   . ASP A 1 600 ? -21.474 41.719  51.987  1.00 37.15  ? 600  ASP A OD1   1 
ATOM   4660  O OD2   . ASP A 1 600 ? -23.478 42.588  52.332  1.00 36.96  ? 600  ASP A OD2   1 
ATOM   4661  N N     . SER A 1 601 ? -23.676 37.410  49.837  1.00 34.64  ? 601  SER A N     1 
ATOM   4662  C CA    . SER A 1 601 ? -24.216 36.063  49.862  1.00 35.05  ? 601  SER A CA    1 
ATOM   4663  C C     . SER A 1 601 ? -23.388 35.063  49.076  1.00 35.76  ? 601  SER A C     1 
ATOM   4664  O O     . SER A 1 601 ? -23.957 34.249  48.344  1.00 35.91  ? 601  SER A O     1 
ATOM   4665  C CB    . SER A 1 601 ? -25.638 36.057  49.298  1.00 34.76  ? 601  SER A CB    1 
ATOM   4666  O OG    . SER A 1 601 ? -26.488 36.891  50.040  1.00 34.37  ? 601  SER A OG    1 
ATOM   4667  N N     . LEU A 1 602 ? -22.065 35.088  49.217  1.00 36.55  ? 602  LEU A N     1 
ATOM   4668  C CA    . LEU A 1 602 ? -21.279 34.056  48.538  1.00 37.56  ? 602  LEU A CA    1 
ATOM   4669  C C     . LEU A 1 602 ? -21.625 32.690  49.162  1.00 38.87  ? 602  LEU A C     1 
ATOM   4670  O O     . LEU A 1 602 ? -21.607 32.549  50.387  1.00 38.61  ? 602  LEU A O     1 
ATOM   4671  C CB    . LEU A 1 602 ? -19.768 34.351  48.521  1.00 36.80  ? 602  LEU A CB    1 
ATOM   4672  C CG    . LEU A 1 602 ? -19.283 35.496  47.608  1.00 36.05  ? 602  LEU A CG    1 
ATOM   4673  C CD1   . LEU A 1 602 ? -17.770 35.671  47.683  1.00 34.16  ? 602  LEU A CD1   1 
ATOM   4674  C CD2   . LEU A 1 602 ? -19.720 35.329  46.151  1.00 34.93  ? 602  LEU A CD2   1 
ATOM   4675  N N     . PRO A 1 603 ? -22.008 31.710  48.313  1.00 40.21  ? 603  PRO A N     1 
ATOM   4676  C CA    . PRO A 1 603 ? -22.405 30.379  48.770  1.00 41.66  ? 603  PRO A CA    1 
ATOM   4677  C C     . PRO A 1 603 ? -21.186 29.534  49.143  1.00 43.19  ? 603  PRO A C     1 
ATOM   4678  O O     . PRO A 1 603 ? -20.352 29.213  48.276  1.00 43.45  ? 603  PRO A O     1 
ATOM   4679  C CB    . PRO A 1 603 ? -23.114 29.792  47.549  1.00 41.56  ? 603  PRO A CB    1 
ATOM   4680  C CG    . PRO A 1 603 ? -22.491 30.471  46.394  1.00 40.58  ? 603  PRO A CG    1 
ATOM   4681  C CD    . PRO A 1 603 ? -22.090 31.835  46.847  1.00 40.16  ? 603  PRO A CD    1 
ATOM   4682  N N     . LYS A 1 604 ? -21.079 29.198  50.425  1.00 44.61  ? 604  LYS A N     1 
ATOM   4683  C CA    . LYS A 1 604 ? -19.941 28.418  50.924  1.00 46.20  ? 604  LYS A CA    1 
ATOM   4684  C C     . LYS A 1 604 ? -20.391 27.098  51.541  1.00 47.12  ? 604  LYS A C     1 
ATOM   4685  O O     . LYS A 1 604 ? -21.506 26.996  52.053  1.00 47.20  ? 604  LYS A O     1 
ATOM   4686  C CB    . LYS A 1 604 ? -19.109 29.228  51.928  1.00 45.98  ? 604  LYS A CB    1 
ATOM   4687  C CG    . LYS A 1 604 ? -18.326 30.359  51.298  1.00 45.79  ? 604  LYS A CG    1 
ATOM   4688  C CD    . LYS A 1 604 ? -17.585 31.152  52.348  1.00 46.64  ? 604  LYS A CD    1 
ATOM   4689  C CE    . LYS A 1 604 ? -17.221 32.547  51.855  1.00 46.43  ? 604  LYS A CE    1 
ATOM   4690  N NZ    . LYS A 1 604 ? -17.018 33.494  52.998  1.00 46.39  ? 604  LYS A NZ    1 
ATOM   4691  N N     . THR A 1 605 ? -19.522 26.092  51.467  1.00 48.34  ? 605  THR A N     1 
ATOM   4692  C CA    . THR A 1 605 ? -19.785 24.797  52.087  1.00 49.73  ? 605  THR A CA    1 
ATOM   4693  C C     . THR A 1 605 ? -19.547 24.900  53.587  1.00 50.56  ? 605  THR A C     1 
ATOM   4694  O O     . THR A 1 605 ? -19.092 25.938  54.085  1.00 50.75  ? 605  THR A O     1 
ATOM   4695  C CB    . THR A 1 605 ? -18.903 23.661  51.492  1.00 49.72  ? 605  THR A CB    1 
ATOM   4696  O OG1   . THR A 1 605 ? -17.526 23.855  51.860  1.00 49.88  ? 605  THR A OG1   1 
ATOM   4697  C CG2   . THR A 1 605 ? -19.040 23.601  49.963  1.00 49.98  ? 605  THR A CG2   1 
ATOM   4698  N N     . ARG A 1 606 ? -19.852 23.816  54.297  1.00 51.61  ? 606  ARG A N     1 
ATOM   4699  C CA    . ARG A 1 606 ? -19.667 23.734  55.751  1.00 52.49  ? 606  ARG A CA    1 
ATOM   4700  C C     . ARG A 1 606 ? -18.225 24.086  56.190  1.00 52.71  ? 606  ARG A C     1 
ATOM   4701  O O     . ARG A 1 606 ? -18.008 24.588  57.304  1.00 52.62  ? 606  ARG A O     1 
ATOM   4702  C CB    . ARG A 1 606 ? -20.096 22.351  56.255  1.00 52.53  ? 606  ARG A CB    1 
ATOM   4703  C CG    . ARG A 1 606 ? -21.290 21.775  55.485  1.00 53.81  ? 606  ARG A CG    1 
ATOM   4704  C CD    . ARG A 1 606 ? -22.212 20.937  56.366  1.00 56.20  ? 606  ARG A CD    1 
ATOM   4705  N NE    . ARG A 1 606 ? -23.089 21.780  57.185  1.00 57.68  ? 606  ARG A NE    1 
ATOM   4706  C CZ    . ARG A 1 606 ? -24.340 22.118  56.871  1.00 57.83  ? 606  ARG A CZ    1 
ATOM   4707  N NH1   . ARG A 1 606 ? -24.898 21.687  55.744  1.00 57.44  ? 606  ARG A NH1   1 
ATOM   4708  N NH2   . ARG A 1 606 ? -25.038 22.894  57.692  1.00 57.57  ? 606  ARG A NH2   1 
ATOM   4709  N N     . SER A 1 607 ? -17.267 23.856  55.287  1.00 52.89  ? 607  SER A N     1 
ATOM   4710  C CA    . SER A 1 607 ? -15.848 24.161  55.517  1.00 53.00  ? 607  SER A CA    1 
ATOM   4711  C C     . SER A 1 607 ? -15.363 25.444  54.811  1.00 52.76  ? 607  SER A C     1 
ATOM   4712  O O     . SER A 1 607 ? -14.161 25.637  54.615  1.00 52.80  ? 607  SER A O     1 
ATOM   4713  C CB    . SER A 1 607 ? -14.974 22.956  55.123  1.00 53.13  ? 607  SER A CB    1 
ATOM   4714  O OG    . SER A 1 607 ? -15.266 22.509  53.806  1.00 53.70  ? 607  SER A OG    1 
ATOM   4715  N N     . GLY A 1 608 ? -16.299 26.313  54.434  1.00 52.52  ? 608  GLY A N     1 
ATOM   4716  C CA    . GLY A 1 608 ? -15.969 27.629  53.868  1.00 52.00  ? 608  GLY A CA    1 
ATOM   4717  C C     . GLY A 1 608 ? -15.415 27.666  52.446  1.00 51.56  ? 608  GLY A C     1 
ATOM   4718  O O     . GLY A 1 608 ? -14.715 28.615  52.073  1.00 51.85  ? 608  GLY A O     1 
ATOM   4719  N N     . ALA A 1 609 ? -15.732 26.650  51.646  1.00 50.74  ? 609  ALA A N     1 
ATOM   4720  C CA    . ALA A 1 609 ? -15.275 26.589  50.262  1.00 49.93  ? 609  ALA A CA    1 
ATOM   4721  C C     . ALA A 1 609 ? -16.389 27.004  49.304  1.00 49.28  ? 609  ALA A C     1 
ATOM   4722  O O     . ALA A 1 609 ? -17.534 26.577  49.460  1.00 49.20  ? 609  ALA A O     1 
ATOM   4723  C CB    . ALA A 1 609 ? -14.765 25.195  49.927  1.00 50.08  ? 609  ALA A CB    1 
ATOM   4724  N N     . ILE A 1 610 ? -16.042 27.823  48.311  1.00 48.21  ? 610  ILE A N     1 
ATOM   4725  C CA    . ILE A 1 610 ? -17.029 28.428  47.412  1.00 47.24  ? 610  ILE A CA    1 
ATOM   4726  C C     . ILE A 1 610 ? -17.657 27.402  46.476  1.00 46.50  ? 610  ILE A C     1 
ATOM   4727  O O     . ILE A 1 610 ? -16.949 26.664  45.794  1.00 46.37  ? 610  ILE A O     1 
ATOM   4728  C CB    . ILE A 1 610 ? -16.426 29.602  46.571  1.00 47.24  ? 610  ILE A CB    1 
ATOM   4729  C CG1   . ILE A 1 610 ? -15.644 30.591  47.455  1.00 47.22  ? 610  ILE A CG1   1 
ATOM   4730  C CG2   . ILE A 1 610 ? -17.514 30.320  45.761  1.00 46.87  ? 610  ILE A CG2   1 
ATOM   4731  C CD1   . ILE A 1 610 ? -16.483 31.431  48.391  1.00 46.11  ? 610  ILE A CD1   1 
ATOM   4732  N N     . MET A 1 611 ? -18.988 27.359  46.468  1.00 45.63  ? 611  MET A N     1 
ATOM   4733  C CA    . MET A 1 611 ? -19.742 26.548  45.518  1.00 44.95  ? 611  MET A CA    1 
ATOM   4734  C C     . MET A 1 611 ? -19.843 27.261  44.165  1.00 44.50  ? 611  MET A C     1 
ATOM   4735  O O     . MET A 1 611 ? -20.791 28.013  43.913  1.00 44.49  ? 611  MET A O     1 
ATOM   4736  C CB    . MET A 1 611 ? -21.133 26.224  46.069  1.00 45.07  ? 611  MET A CB    1 
ATOM   4737  N N     . ARG A 1 612 ? -18.857 27.017  43.303  1.00 43.65  ? 612  ARG A N     1 
ATOM   4738  C CA    . ARG A 1 612 ? -18.760 27.697  42.017  1.00 43.05  ? 612  ARG A CA    1 
ATOM   4739  C C     . ARG A 1 612 ? -19.881 27.364  41.042  1.00 42.22  ? 612  ARG A C     1 
ATOM   4740  O O     . ARG A 1 612 ? -20.316 28.229  40.279  1.00 42.12  ? 612  ARG A O     1 
ATOM   4741  C CB    . ARG A 1 612 ? -17.412 27.411  41.345  1.00 43.38  ? 612  ARG A CB    1 
ATOM   4742  C CG    . ARG A 1 612 ? -16.223 27.990  42.074  1.00 44.52  ? 612  ARG A CG    1 
ATOM   4743  C CD    . ARG A 1 612 ? -15.170 28.597  41.126  1.00 47.23  ? 612  ARG A CD    1 
ATOM   4744  N NE    . ARG A 1 612 ? -14.545 29.762  41.751  1.00 49.12  ? 612  ARG A NE    1 
ATOM   4745  C CZ    . ARG A 1 612 ? -13.881 29.718  42.906  1.00 50.63  ? 612  ARG A CZ    1 
ATOM   4746  N NH1   . ARG A 1 612 ? -13.738 28.567  43.564  1.00 51.46  ? 612  ARG A NH1   1 
ATOM   4747  N NH2   . ARG A 1 612 ? -13.364 30.821  43.415  1.00 51.06  ? 612  ARG A NH2   1 
ATOM   4748  N N     . ARG A 1 613 ? -20.328 26.108  41.049  1.00 41.26  ? 613  ARG A N     1 
ATOM   4749  C CA    . ARG A 1 613 ? -21.293 25.631  40.059  1.00 40.37  ? 613  ARG A CA    1 
ATOM   4750  C C     . ARG A 1 613 ? -22.587 26.442  40.114  1.00 39.76  ? 613  ARG A C     1 
ATOM   4751  O O     . ARG A 1 613 ? -23.148 26.796  39.074  1.00 39.71  ? 613  ARG A O     1 
ATOM   4752  C CB    . ARG A 1 613 ? -21.566 24.125  40.214  1.00 40.74  ? 613  ARG A CB    1 
ATOM   4753  N N     . ILE A 1 614 ? -23.039 26.748  41.328  1.00 38.87  ? 614  ILE A N     1 
ATOM   4754  C CA    . ILE A 1 614 ? -24.258 27.525  41.525  1.00 38.20  ? 614  ILE A CA    1 
ATOM   4755  C C     . ILE A 1 614 ? -24.094 28.991  41.089  1.00 37.15  ? 614  ILE A C     1 
ATOM   4756  O O     . ILE A 1 614 ? -25.031 29.593  40.557  1.00 37.05  ? 614  ILE A O     1 
ATOM   4757  C CB    . ILE A 1 614 ? -24.809 27.396  42.992  1.00 38.35  ? 614  ILE A CB    1 
ATOM   4758  C CG1   . ILE A 1 614 ? -26.321 27.631  43.040  1.00 39.27  ? 614  ILE A CG1   1 
ATOM   4759  C CG2   . ILE A 1 614 ? -24.108 28.331  43.947  1.00 38.55  ? 614  ILE A CG2   1 
ATOM   4760  C CD1   . ILE A 1 614 ? -27.169 26.385  42.757  1.00 40.68  ? 614  ILE A CD1   1 
ATOM   4761  N N     . LEU A 1 615 ? -22.909 29.549  41.318  1.00 35.88  ? 615  LEU A N     1 
ATOM   4762  C CA    . LEU A 1 615 ? -22.580 30.892  40.854  1.00 34.81  ? 615  LEU A CA    1 
ATOM   4763  C C     . LEU A 1 615 ? -22.610 30.959  39.336  1.00 34.65  ? 615  LEU A C     1 
ATOM   4764  O O     . LEU A 1 615 ? -23.152 31.898  38.742  1.00 34.01  ? 615  LEU A O     1 
ATOM   4765  C CB    . LEU A 1 615 ? -21.196 31.301  41.363  1.00 34.33  ? 615  LEU A CB    1 
ATOM   4766  C CG    . LEU A 1 615 ? -21.116 31.503  42.876  1.00 33.22  ? 615  LEU A CG    1 
ATOM   4767  C CD1   . LEU A 1 615 ? -19.691 31.844  43.264  1.00 32.36  ? 615  LEU A CD1   1 
ATOM   4768  C CD2   . LEU A 1 615 ? -22.091 32.581  43.331  1.00 29.35  ? 615  LEU A CD2   1 
ATOM   4769  N N     . ARG A 1 616 ? -22.019 29.939  38.727  1.00 34.83  ? 616  ARG A N     1 
ATOM   4770  C CA    . ARG A 1 616 ? -21.940 29.803  37.286  1.00 35.56  ? 616  ARG A CA    1 
ATOM   4771  C C     . ARG A 1 616 ? -23.351 29.809  36.669  1.00 35.27  ? 616  ARG A C     1 
ATOM   4772  O O     . ARG A 1 616 ? -23.636 30.601  35.760  1.00 35.10  ? 616  ARG A O     1 
ATOM   4773  C CB    . ARG A 1 616 ? -21.206 28.499  36.973  1.00 35.91  ? 616  ARG A CB    1 
ATOM   4774  C CG    . ARG A 1 616 ? -20.265 28.523  35.787  1.00 39.12  ? 616  ARG A CG    1 
ATOM   4775  C CD    . ARG A 1 616 ? -19.374 27.266  35.827  1.00 43.03  ? 616  ARG A CD    1 
ATOM   4776  N NE    . ARG A 1 616 ? -18.121 27.468  36.565  1.00 45.84  ? 616  ARG A NE    1 
ATOM   4777  C CZ    . ARG A 1 616 ? -17.597 26.610  37.450  1.00 47.69  ? 616  ARG A CZ    1 
ATOM   4778  N NH1   . ARG A 1 616 ? -18.229 25.479  37.771  1.00 47.02  ? 616  ARG A NH1   1 
ATOM   4779  N NH2   . ARG A 1 616 ? -16.436 26.897  38.037  1.00 48.04  ? 616  ARG A NH2   1 
ATOM   4780  N N     . LYS A 1 617 ? -24.231 28.945  37.187  1.00 34.85  ? 617  LYS A N     1 
ATOM   4781  C CA    . LYS A 1 617 ? -25.593 28.801  36.670  1.00 34.41  ? 617  LYS A CA    1 
ATOM   4782  C C     . LYS A 1 617 ? -26.438 30.062  36.891  1.00 33.93  ? 617  LYS A C     1 
ATOM   4783  O O     . LYS A 1 617 ? -27.232 30.441  36.032  1.00 33.98  ? 617  LYS A O     1 
ATOM   4784  C CB    . LYS A 1 617 ? -26.277 27.563  37.274  1.00 34.57  ? 617  LYS A CB    1 
ATOM   4785  N N     . ILE A 1 618 ? -26.260 30.720  38.032  1.00 33.49  ? 618  ILE A N     1 
ATOM   4786  C CA    . ILE A 1 618 ? -27.012 31.943  38.310  1.00 33.30  ? 618  ILE A CA    1 
ATOM   4787  C C     . ILE A 1 618 ? -26.570 33.052  37.365  1.00 33.39  ? 618  ILE A C     1 
ATOM   4788  O O     . ILE A 1 618 ? -27.402 33.752  36.788  1.00 33.15  ? 618  ILE A O     1 
ATOM   4789  C CB    . ILE A 1 618 ? -26.893 32.394  39.785  1.00 33.21  ? 618  ILE A CB    1 
ATOM   4790  C CG1   . ILE A 1 618 ? -27.670 31.438  40.702  1.00 33.68  ? 618  ILE A CG1   1 
ATOM   4791  C CG2   . ILE A 1 618 ? -27.408 33.816  39.952  1.00 32.82  ? 618  ILE A CG2   1 
ATOM   4792  C CD1   . ILE A 1 618 ? -27.330 31.572  42.192  1.00 33.21  ? 618  ILE A CD1   1 
ATOM   4793  N N     . ALA A 1 619 ? -25.259 33.194  37.197  1.00 33.58  ? 619  ALA A N     1 
ATOM   4794  C CA    . ALA A 1 619 ? -24.715 34.215  36.320  1.00 33.91  ? 619  ALA A CA    1 
ATOM   4795  C C     . ALA A 1 619 ? -25.143 33.944  34.881  1.00 34.33  ? 619  ALA A C     1 
ATOM   4796  O O     . ALA A 1 619 ? -25.465 34.869  34.138  1.00 34.24  ? 619  ALA A O     1 
ATOM   4797  C CB    . ALA A 1 619 ? -23.226 34.257  36.444  1.00 33.66  ? 619  ALA A CB    1 
ATOM   4798  N N     . ALA A 1 620 ? -25.187 32.665  34.516  1.00 35.13  ? 620  ALA A N     1 
ATOM   4799  C CA    . ALA A 1 620 ? -25.663 32.235  33.202  1.00 36.12  ? 620  ALA A CA    1 
ATOM   4800  C C     . ALA A 1 620 ? -27.140 32.584  32.950  1.00 37.09  ? 620  ALA A C     1 
ATOM   4801  O O     . ALA A 1 620 ? -27.691 32.265  31.891  1.00 36.93  ? 620  ALA A O     1 
ATOM   4802  C CB    . ALA A 1 620 ? -25.418 30.739  33.013  1.00 35.88  ? 620  ALA A CB    1 
ATOM   4803  N N     . GLY A 1 621 ? -27.769 33.231  33.932  1.00 38.17  ? 621  GLY A N     1 
ATOM   4804  C CA    . GLY A 1 621 ? -29.130 33.732  33.794  1.00 39.50  ? 621  GLY A CA    1 
ATOM   4805  C C     . GLY A 1 621 ? -30.223 32.753  34.185  1.00 40.64  ? 621  GLY A C     1 
ATOM   4806  O O     . GLY A 1 621 ? -31.417 33.065  34.056  1.00 40.97  ? 621  GLY A O     1 
ATOM   4807  N N     . ASP A 1 622 ? -29.837 31.571  34.665  1.00 41.19  ? 622  ASP A N     1 
ATOM   4808  C CA    . ASP A 1 622 ? -30.826 30.560  35.026  1.00 41.61  ? 622  ASP A CA    1 
ATOM   4809  C C     . ASP A 1 622 ? -30.715 30.127  36.488  1.00 41.64  ? 622  ASP A C     1 
ATOM   4810  O O     . ASP A 1 622 ? -31.717 30.081  37.199  1.00 41.76  ? 622  ASP A O     1 
ATOM   4811  C CB    . ASP A 1 622 ? -30.762 29.360  34.063  1.00 41.98  ? 622  ASP A CB    1 
ATOM   4812  C CG    . ASP A 1 622 ? -29.593 28.431  34.345  1.00 42.54  ? 622  ASP A CG    1 
ATOM   4813  O OD1   . ASP A 1 622 ? -28.825 28.163  33.399  1.00 42.79  ? 622  ASP A OD1   1 
ATOM   4814  O OD2   . ASP A 1 622 ? -29.437 27.968  35.505  1.00 43.11  ? 622  ASP A OD2   1 
ATOM   4815  N N     . ALA A 1 633 ? -24.350 25.436  53.097  1.00 48.38  ? 633  ALA A N     1 
ATOM   4816  C CA    . ALA A 1 633 ? -24.076 25.860  54.466  1.00 48.69  ? 633  ALA A CA    1 
ATOM   4817  C C     . ALA A 1 633 ? -25.142 26.828  54.977  1.00 48.85  ? 633  ALA A C     1 
ATOM   4818  O O     . ALA A 1 633 ? -26.003 26.444  55.781  1.00 48.98  ? 633  ALA A O     1 
ATOM   4819  C CB    . ALA A 1 633 ? -22.676 26.468  54.591  1.00 48.37  ? 633  ALA A CB    1 
ATOM   4820  N N     . ASP A 1 634 ? -25.074 28.078  54.528  1.00 48.73  ? 634  ASP A N     1 
ATOM   4821  C CA    . ASP A 1 634 ? -26.136 29.045  54.781  1.00 48.80  ? 634  ASP A CA    1 
ATOM   4822  C C     . ASP A 1 634 ? -27.077 29.020  53.578  1.00 48.44  ? 634  ASP A C     1 
ATOM   4823  O O     . ASP A 1 634 ? -26.815 29.676  52.569  1.00 48.77  ? 634  ASP A O     1 
ATOM   4824  C CB    . ASP A 1 634 ? -25.561 30.453  55.007  1.00 49.17  ? 634  ASP A CB    1 
ATOM   4825  C CG    . ASP A 1 634 ? -26.647 31.507  55.211  1.00 49.95  ? 634  ASP A CG    1 
ATOM   4826  O OD1   . ASP A 1 634 ? -27.833 31.125  55.374  1.00 50.11  ? 634  ASP A OD1   1 
ATOM   4827  O OD2   . ASP A 1 634 ? -26.308 32.717  55.201  1.00 50.12  ? 634  ASP A OD2   1 
ATOM   4828  N N     . PRO A 1 635 ? -28.189 28.274  53.686  1.00 48.04  ? 635  PRO A N     1 
ATOM   4829  C CA    . PRO A 1 635 ? -28.992 27.961  52.495  1.00 47.30  ? 635  PRO A CA    1 
ATOM   4830  C C     . PRO A 1 635 ? -29.699 29.175  51.888  1.00 46.40  ? 635  PRO A C     1 
ATOM   4831  O O     . PRO A 1 635 ? -29.958 29.184  50.679  1.00 46.48  ? 635  PRO A O     1 
ATOM   4832  C CB    . PRO A 1 635 ? -30.015 26.927  53.013  1.00 47.51  ? 635  PRO A CB    1 
ATOM   4833  C CG    . PRO A 1 635 ? -29.495 26.492  54.384  1.00 47.93  ? 635  PRO A CG    1 
ATOM   4834  C CD    . PRO A 1 635 ? -28.776 27.695  54.909  1.00 47.90  ? 635  PRO A CD    1 
ATOM   4835  N N     . GLY A 1 636 ? -29.979 30.188  52.710  1.00 45.26  ? 636  GLY A N     1 
ATOM   4836  C CA    . GLY A 1 636 ? -30.686 31.398  52.266  1.00 44.05  ? 636  GLY A CA    1 
ATOM   4837  C C     . GLY A 1 636 ? -30.033 32.195  51.136  1.00 43.19  ? 636  GLY A C     1 
ATOM   4838  O O     . GLY A 1 636 ? -30.697 33.004  50.471  1.00 42.97  ? 636  GLY A O     1 
ATOM   4839  N N     . VAL A 1 637 ? -28.740 31.958  50.908  1.00 41.99  ? 637  VAL A N     1 
ATOM   4840  C CA    . VAL A 1 637 ? -27.948 32.784  49.986  1.00 40.83  ? 637  VAL A CA    1 
ATOM   4841  C C     . VAL A 1 637 ? -28.421 32.731  48.529  1.00 40.27  ? 637  VAL A C     1 
ATOM   4842  O O     . VAL A 1 637 ? -28.385 33.742  47.840  1.00 40.19  ? 637  VAL A O     1 
ATOM   4843  C CB    . VAL A 1 637 ? -26.419 32.508  50.093  1.00 40.65  ? 637  VAL A CB    1 
ATOM   4844  C CG1   . VAL A 1 637 ? -25.887 32.919  51.481  1.00 39.93  ? 637  VAL A CG1   1 
ATOM   4845  C CG2   . VAL A 1 637 ? -26.082 31.045  49.763  1.00 40.20  ? 637  VAL A CG2   1 
ATOM   4846  N N     . VAL A 1 638 ? -28.887 31.566  48.083  1.00 39.62  ? 638  VAL A N     1 
ATOM   4847  C CA    . VAL A 1 638 ? -29.320 31.382  46.693  1.00 39.15  ? 638  VAL A CA    1 
ATOM   4848  C C     . VAL A 1 638 ? -30.379 32.415  46.261  1.00 38.88  ? 638  VAL A C     1 
ATOM   4849  O O     . VAL A 1 638 ? -30.242 33.046  45.207  1.00 38.87  ? 638  VAL A O     1 
ATOM   4850  C CB    . VAL A 1 638 ? -29.800 29.916  46.410  1.00 39.11  ? 638  VAL A CB    1 
ATOM   4851  C CG1   . VAL A 1 638 ? -30.229 29.743  44.962  1.00 38.99  ? 638  VAL A CG1   1 
ATOM   4852  C CG2   . VAL A 1 638 ? -28.701 28.913  46.729  1.00 38.82  ? 638  VAL A CG2   1 
ATOM   4853  N N     . GLU A 1 639 ? -31.418 32.587  47.076  1.00 38.28  ? 639  GLU A N     1 
ATOM   4854  C CA    . GLU A 1 639 ? -32.494 33.531  46.766  1.00 37.81  ? 639  GLU A CA    1 
ATOM   4855  C C     . GLU A 1 639 ? -31.982 34.975  46.718  1.00 37.13  ? 639  GLU A C     1 
ATOM   4856  O O     . GLU A 1 639 ? -32.379 35.739  45.828  1.00 37.20  ? 639  GLU A O     1 
ATOM   4857  C CB    . GLU A 1 639 ? -33.672 33.402  47.754  1.00 37.80  ? 639  GLU A CB    1 
ATOM   4858  C CG    . GLU A 1 639 ? -34.960 34.111  47.280  1.00 38.91  ? 639  GLU A CG    1 
ATOM   4859  C CD    . GLU A 1 639 ? -35.805 34.692  48.429  1.00 40.33  ? 639  GLU A CD    1 
ATOM   4860  O OE1   . GLU A 1 639 ? -36.527 33.918  49.100  1.00 39.34  ? 639  GLU A OE1   1 
ATOM   4861  O OE2   . GLU A 1 639 ? -35.758 35.930  48.647  1.00 40.70  ? 639  GLU A OE2   1 
ATOM   4862  N N     . LYS A 1 640 ? -31.123 35.353  47.671  1.00 36.06  ? 640  LYS A N     1 
ATOM   4863  C CA    . LYS A 1 640 ? -30.501 36.680  47.636  1.00 35.46  ? 640  LYS A CA    1 
ATOM   4864  C C     . LYS A 1 640 ? -29.649 36.863  46.355  1.00 34.89  ? 640  LYS A C     1 
ATOM   4865  O O     . LYS A 1 640 ? -29.747 37.893  45.681  1.00 34.28  ? 640  LYS A O     1 
ATOM   4866  C CB    . LYS A 1 640 ? -29.699 36.967  48.912  1.00 35.27  ? 640  LYS A CB    1 
ATOM   4867  N N     . LEU A 1 641 ? -28.858 35.849  46.004  1.00 34.47  ? 641  LEU A N     1 
ATOM   4868  C CA    . LEU A 1 641 ? -28.090 35.864  44.762  1.00 34.67  ? 641  LEU A CA    1 
ATOM   4869  C C     . LEU A 1 641 ? -28.979 36.038  43.520  1.00 35.16  ? 641  LEU A C     1 
ATOM   4870  O O     . LEU A 1 641 ? -28.640 36.803  42.613  1.00 34.76  ? 641  LEU A O     1 
ATOM   4871  C CB    . LEU A 1 641 ? -27.222 34.616  44.630  1.00 34.25  ? 641  LEU A CB    1 
ATOM   4872  C CG    . LEU A 1 641 ? -26.046 34.444  45.592  1.00 33.72  ? 641  LEU A CG    1 
ATOM   4873  C CD1   . LEU A 1 641 ? -25.601 33.000  45.596  1.00 31.80  ? 641  LEU A CD1   1 
ATOM   4874  C CD2   . LEU A 1 641 ? -24.868 35.355  45.257  1.00 32.62  ? 641  LEU A CD2   1 
ATOM   4875  N N     . LEU A 1 642 ? -30.120 35.348  43.500  1.00 36.07  ? 642  LEU A N     1 
ATOM   4876  C CA    . LEU A 1 642 ? -31.061 35.416  42.373  1.00 36.74  ? 642  LEU A CA    1 
ATOM   4877  C C     . LEU A 1 642 ? -31.745 36.777  42.259  1.00 37.23  ? 642  LEU A C     1 
ATOM   4878  O O     . LEU A 1 642 ? -31.914 37.298  41.153  1.00 37.06  ? 642  LEU A O     1 
ATOM   4879  C CB    . LEU A 1 642 ? -32.104 34.293  42.449  1.00 36.78  ? 642  LEU A CB    1 
ATOM   4880  C CG    . LEU A 1 642 ? -31.677 32.861  42.075  1.00 37.30  ? 642  LEU A CG    1 
ATOM   4881  C CD1   . LEU A 1 642 ? -32.773 31.849  42.414  1.00 37.90  ? 642  LEU A CD1   1 
ATOM   4882  C CD2   . LEU A 1 642 ? -31.274 32.719  40.599  1.00 37.76  ? 642  LEU A CD2   1 
ATOM   4883  N N     . GLU A 1 643 ? -32.134 37.341  43.402  1.00 37.97  ? 643  GLU A N     1 
ATOM   4884  C CA    . GLU A 1 643 ? -32.708 38.688  43.459  1.00 38.77  ? 643  GLU A CA    1 
ATOM   4885  C C     . GLU A 1 643 ? -31.715 39.716  42.930  1.00 38.84  ? 643  GLU A C     1 
ATOM   4886  O O     . GLU A 1 643 ? -32.054 40.548  42.082  1.00 38.82  ? 643  GLU A O     1 
ATOM   4887  C CB    . GLU A 1 643 ? -33.085 39.058  44.895  1.00 38.77  ? 643  GLU A CB    1 
ATOM   4888  C CG    . GLU A 1 643 ? -34.483 38.675  45.329  1.00 39.02  ? 643  GLU A CG    1 
ATOM   4889  C CD    . GLU A 1 643 ? -34.784 39.094  46.777  1.00 39.55  ? 643  GLU A CD    1 
ATOM   4890  O OE1   . GLU A 1 643 ? -35.936 38.870  47.226  1.00 39.75  ? 643  GLU A OE1   1 
ATOM   4891  O OE2   . GLU A 1 643 ? -33.873 39.635  47.463  1.00 38.64  ? 643  GLU A OE2   1 
ATOM   4892  N N     . GLU A 1 644 ? -30.489 39.651  43.448  1.00 39.16  ? 644  GLU A N     1 
ATOM   4893  C CA    . GLU A 1 644 ? -29.409 40.529  43.010  1.00 39.18  ? 644  GLU A CA    1 
ATOM   4894  C C     . GLU A 1 644 ? -29.160 40.397  41.502  1.00 39.74  ? 644  GLU A C     1 
ATOM   4895  O O     . GLU A 1 644 ? -29.062 41.406  40.788  1.00 39.44  ? 644  GLU A O     1 
ATOM   4896  C CB    . GLU A 1 644 ? -28.135 40.230  43.798  1.00 38.77  ? 644  GLU A CB    1 
ATOM   4897  C CG    . GLU A 1 644 ? -28.185 40.667  45.248  1.00 37.45  ? 644  GLU A CG    1 
ATOM   4898  C CD    . GLU A 1 644 ? -27.227 39.880  46.124  1.00 36.28  ? 644  GLU A CD    1 
ATOM   4899  O OE1   . GLU A 1 644 ? -26.488 39.027  45.579  1.00 34.57  ? 644  GLU A OE1   1 
ATOM   4900  O OE2   . GLU A 1 644 ? -27.224 40.102  47.359  1.00 35.73  ? 644  GLU A OE2   1 
ATOM   4901  N N     . LYS A 1 645 ? -29.086 39.154  41.024  1.00 40.27  ? 645  LYS A N     1 
ATOM   4902  C CA    . LYS A 1 645 ? -28.860 38.896  39.608  1.00 41.19  ? 645  LYS A CA    1 
ATOM   4903  C C     . LYS A 1 645 ? -29.960 39.519  38.760  1.00 41.90  ? 645  LYS A C     1 
ATOM   4904  O O     . LYS A 1 645 ? -29.676 40.079  37.700  1.00 42.56  ? 645  LYS A O     1 
ATOM   4905  C CB    . LYS A 1 645 ? -28.752 37.398  39.324  1.00 40.99  ? 645  LYS A CB    1 
ATOM   4906  C CG    . LYS A 1 645 ? -27.866 37.059  38.127  1.00 41.31  ? 645  LYS A CG    1 
ATOM   4907  C CD    . LYS A 1 645 ? -28.557 37.289  36.796  1.00 41.27  ? 645  LYS A CD    1 
ATOM   4908  C CE    . LYS A 1 645 ? -27.584 37.112  35.642  1.00 40.41  ? 645  LYS A CE    1 
ATOM   4909  N NZ    . LYS A 1 645 ? -28.145 37.691  34.406  1.00 39.86  ? 645  LYS A NZ    1 
ATOM   4910  N N     . GLN A 1 646 ? -31.205 39.424  39.231  1.00 42.74  ? 646  GLN A N     1 
ATOM   4911  C CA    . GLN A 1 646 ? -32.366 39.983  38.528  1.00 43.26  ? 646  GLN A CA    1 
ATOM   4912  C C     . GLN A 1 646 ? -32.301 41.503  38.332  1.00 43.25  ? 646  GLN A C     1 
ATOM   4913  O O     . GLN A 1 646 ? -32.676 42.001  37.273  1.00 43.29  ? 646  GLN A O     1 
ATOM   4914  C CB    . GLN A 1 646 ? -33.667 39.593  39.232  1.00 43.48  ? 646  GLN A CB    1 
ATOM   4915  C CG    . GLN A 1 646 ? -34.900 39.656  38.335  1.00 45.00  ? 646  GLN A CG    1 
ATOM   4916  C CD    . GLN A 1 646 ? -34.924 38.573  37.249  1.00 46.66  ? 646  GLN A CD    1 
ATOM   4917  O OE1   . GLN A 1 646 ? -35.914 38.433  36.516  1.00 46.65  ? 646  GLN A OE1   1 
ATOM   4918  N NE2   . GLN A 1 646 ? -33.840 37.799  37.150  1.00 47.02  ? 646  GLN A NE2   1 
ATOM   4919  N N     . ALA A 1 647 ? -31.821 42.227  39.340  1.00 43.19  ? 647  ALA A N     1 
ATOM   4920  C CA    . ALA A 1 647 ? -31.595 43.667  39.212  1.00 43.72  ? 647  ALA A CA    1 
ATOM   4921  C C     . ALA A 1 647 ? -30.697 44.080  38.010  1.00 44.07  ? 647  ALA A C     1 
ATOM   4922  O O     . ALA A 1 647 ? -29.606 43.518  37.754  1.00 44.35  ? 647  ALA A O     1 
ATOM   4923  C CB    . ALA A 1 647 ? -31.052 44.235  40.527  1.00 43.76  ? 647  ALA A CB    1 
ATOM   4924  N N     . HIS B 1 5   ? -32.132 66.864  47.799  1.00 52.58  ? 5    HIS B N     1 
ATOM   4925  C CA    . HIS B 1 5   ? -31.086 67.870  48.162  1.00 52.39  ? 5    HIS B CA    1 
ATOM   4926  C C     . HIS B 1 5   ? -30.871 68.887  47.036  1.00 51.16  ? 5    HIS B C     1 
ATOM   4927  O O     . HIS B 1 5   ? -30.889 68.534  45.851  1.00 51.31  ? 5    HIS B O     1 
ATOM   4928  C CB    . HIS B 1 5   ? -29.764 67.167  48.499  1.00 53.24  ? 5    HIS B CB    1 
ATOM   4929  C CG    . HIS B 1 5   ? -28.853 67.969  49.381  1.00 55.89  ? 5    HIS B CG    1 
ATOM   4930  N ND1   . HIS B 1 5   ? -27.638 68.464  48.947  1.00 58.02  ? 5    HIS B ND1   1 
ATOM   4931  C CD2   . HIS B 1 5   ? -28.977 68.356  50.677  1.00 58.17  ? 5    HIS B CD2   1 
ATOM   4932  C CE1   . HIS B 1 5   ? -27.056 69.124  49.936  1.00 59.57  ? 5    HIS B CE1   1 
ATOM   4933  N NE2   . HIS B 1 5   ? -27.845 69.070  50.998  1.00 59.53  ? 5    HIS B NE2   1 
ATOM   4934  N N     . LYS B 1 6   ? -30.671 70.148  47.413  1.00 49.27  ? 6    LYS B N     1 
ATOM   4935  C CA    . LYS B 1 6   ? -30.380 71.204  46.442  1.00 47.31  ? 6    LYS B CA    1 
ATOM   4936  C C     . LYS B 1 6   ? -28.869 71.488  46.376  1.00 45.18  ? 6    LYS B C     1 
ATOM   4937  O O     . LYS B 1 6   ? -28.172 71.457  47.391  1.00 45.38  ? 6    LYS B O     1 
ATOM   4938  C CB    . LYS B 1 6   ? -31.158 72.487  46.786  1.00 47.54  ? 6    LYS B CB    1 
ATOM   4939  C CG    . LYS B 1 6   ? -32.649 72.261  47.079  1.00 47.91  ? 6    LYS B CG    1 
ATOM   4940  C CD    . LYS B 1 6   ? -33.432 73.574  47.313  1.00 48.29  ? 6    LYS B CD    1 
ATOM   4941  C CE    . LYS B 1 6   ? -34.320 73.940  46.110  1.00 48.46  ? 6    LYS B CE    1 
ATOM   4942  N NZ    . LYS B 1 6   ? -35.266 75.087  46.356  1.00 47.03  ? 6    LYS B NZ    1 
ATOM   4943  N N     . HIS B 1 7   ? -28.361 71.726  45.174  1.00 42.17  ? 7    HIS B N     1 
ATOM   4944  C CA    . HIS B 1 7   ? -27.037 72.294  45.025  1.00 38.99  ? 7    HIS B CA    1 
ATOM   4945  C C     . HIS B 1 7   ? -27.204 73.794  45.025  1.00 37.11  ? 7    HIS B C     1 
ATOM   4946  O O     . HIS B 1 7   ? -27.832 74.360  44.114  1.00 36.60  ? 7    HIS B O     1 
ATOM   4947  C CB    . HIS B 1 7   ? -26.377 71.820  43.737  1.00 39.08  ? 7    HIS B CB    1 
ATOM   4948  C CG    . HIS B 1 7   ? -25.891 70.408  43.804  1.00 38.93  ? 7    HIS B CG    1 
ATOM   4949  N ND1   . HIS B 1 7   ? -24.662 70.069  44.327  1.00 37.69  ? 7    HIS B ND1   1 
ATOM   4950  C CD2   . HIS B 1 7   ? -26.481 69.246  43.439  1.00 38.42  ? 7    HIS B CD2   1 
ATOM   4951  C CE1   . HIS B 1 7   ? -24.509 68.760  44.267  1.00 38.10  ? 7    HIS B CE1   1 
ATOM   4952  N NE2   . HIS B 1 7   ? -25.597 68.236  43.729  1.00 38.34  ? 7    HIS B NE2   1 
ATOM   4953  N N     . ALA B 1 8   ? -26.667 74.425  46.070  1.00 34.75  ? 8    ALA B N     1 
ATOM   4954  C CA    . ALA B 1 8   ? -26.649 75.879  46.194  1.00 32.66  ? 8    ALA B CA    1 
ATOM   4955  C C     . ALA B 1 8   ? -25.835 76.522  45.075  1.00 31.42  ? 8    ALA B C     1 
ATOM   4956  O O     . ALA B 1 8   ? -24.969 75.882  44.455  1.00 31.01  ? 8    ALA B O     1 
ATOM   4957  C CB    . ALA B 1 8   ? -26.096 76.294  47.552  1.00 32.59  ? 8    ALA B CB    1 
ATOM   4958  N N     . ILE B 1 9   ? -26.136 77.790  44.821  1.00 30.02  ? 9    ILE B N     1 
ATOM   4959  C CA    . ILE B 1 9   ? -25.414 78.594  43.843  1.00 28.54  ? 9    ILE B CA    1 
ATOM   4960  C C     . ILE B 1 9   ? -24.047 78.936  44.440  1.00 28.06  ? 9    ILE B C     1 
ATOM   4961  O O     . ILE B 1 9   ? -23.974 79.580  45.472  1.00 27.85  ? 9    ILE B O     1 
ATOM   4962  C CB    . ILE B 1 9   ? -26.226 79.866  43.475  1.00 27.84  ? 9    ILE B CB    1 
ATOM   4963  C CG1   . ILE B 1 9   ? -27.545 79.458  42.817  1.00 27.36  ? 9    ILE B CG1   1 
ATOM   4964  C CG2   . ILE B 1 9   ? -25.434 80.794  42.555  1.00 26.94  ? 9    ILE B CG2   1 
ATOM   4965  C CD1   . ILE B 1 9   ? -28.713 80.327  43.198  1.00 26.50  ? 9    ILE B CD1   1 
ATOM   4966  N N     . PRO B 1 10  ? -22.959 78.479  43.804  1.00 27.78  ? 10   PRO B N     1 
ATOM   4967  C CA    . PRO B 1 10  ? -21.658 78.785  44.396  1.00 27.45  ? 10   PRO B CA    1 
ATOM   4968  C C     . PRO B 1 10  ? -21.339 80.287  44.372  1.00 27.23  ? 10   PRO B C     1 
ATOM   4969  O O     . PRO B 1 10  ? -21.828 81.020  43.490  1.00 26.60  ? 10   PRO B O     1 
ATOM   4970  C CB    . PRO B 1 10  ? -20.668 77.987  43.542  1.00 27.12  ? 10   PRO B CB    1 
ATOM   4971  C CG    . PRO B 1 10  ? -21.352 77.760  42.258  1.00 27.67  ? 10   PRO B CG    1 
ATOM   4972  C CD    . PRO B 1 10  ? -22.837 77.699  42.561  1.00 27.95  ? 10   PRO B CD    1 
ATOM   4973  N N     . ALA B 1 11  ? -20.520 80.711  45.344  1.00 26.83  ? 11   ALA B N     1 
ATOM   4974  C CA    . ALA B 1 11  ? -20.176 82.125  45.558  1.00 26.43  ? 11   ALA B CA    1 
ATOM   4975  C C     . ALA B 1 11  ? -19.614 82.837  44.313  1.00 25.90  ? 11   ALA B C     1 
ATOM   4976  O O     . ALA B 1 11  ? -20.051 83.943  43.986  1.00 25.54  ? 11   ALA B O     1 
ATOM   4977  C CB    . ALA B 1 11  ? -19.232 82.275  46.771  1.00 26.27  ? 11   ALA B CB    1 
ATOM   4978  N N     . ASN B 1 12  ? -18.687 82.194  43.603  1.00 25.42  ? 12   ASN B N     1 
ATOM   4979  C CA    . ASN B 1 12  ? -18.107 82.786  42.387  1.00 25.29  ? 12   ASN B CA    1 
ATOM   4980  C C     . ASN B 1 12  ? -19.136 83.127  41.281  1.00 24.95  ? 12   ASN B C     1 
ATOM   4981  O O     . ASN B 1 12  ? -19.020 84.145  40.589  1.00 24.99  ? 12   ASN B O     1 
ATOM   4982  C CB    . ASN B 1 12  ? -16.937 81.934  41.848  1.00 25.12  ? 12   ASN B CB    1 
ATOM   4983  C CG    . ASN B 1 12  ? -17.376 80.572  41.338  1.00 25.49  ? 12   ASN B CG    1 
ATOM   4984  O OD1   . ASN B 1 12  ? -17.940 79.768  42.083  1.00 24.75  ? 12   ASN B OD1   1 
ATOM   4985  N ND2   . ASN B 1 12  ? -17.115 80.304  40.054  1.00 24.53  ? 12   ASN B ND2   1 
ATOM   4986  N N     . ILE B 1 13  ? -20.139 82.261  41.150  1.00 24.69  ? 13   ILE B N     1 
ATOM   4987  C CA    . ILE B 1 13  ? -21.218 82.401  40.175  1.00 24.26  ? 13   ILE B CA    1 
ATOM   4988  C C     . ILE B 1 13  ? -22.188 83.501  40.599  1.00 24.64  ? 13   ILE B C     1 
ATOM   4989  O O     . ILE B 1 13  ? -22.573 84.361  39.795  1.00 24.14  ? 13   ILE B O     1 
ATOM   4990  C CB    . ILE B 1 13  ? -21.962 81.034  39.958  1.00 23.77  ? 13   ILE B CB    1 
ATOM   4991  C CG1   . ILE B 1 13  ? -21.022 79.990  39.310  1.00 23.25  ? 13   ILE B CG1   1 
ATOM   4992  C CG2   . ILE B 1 13  ? -23.239 81.211  39.132  1.00 23.13  ? 13   ILE B CG2   1 
ATOM   4993  C CD1   . ILE B 1 13  ? -20.448 80.373  37.923  1.00 18.37  ? 13   ILE B CD1   1 
ATOM   4994  N N     . ALA B 1 14  ? -22.585 83.465  41.867  1.00 25.03  ? 14   ALA B N     1 
ATOM   4995  C CA    . ALA B 1 14  ? -23.401 84.530  42.434  1.00 25.31  ? 14   ALA B CA    1 
ATOM   4996  C C     . ALA B 1 14  ? -22.788 85.908  42.150  1.00 25.67  ? 14   ALA B C     1 
ATOM   4997  O O     . ALA B 1 14  ? -23.494 86.822  41.728  1.00 25.89  ? 14   ALA B O     1 
ATOM   4998  C CB    . ALA B 1 14  ? -23.577 84.313  43.928  1.00 25.08  ? 14   ALA B CB    1 
ATOM   4999  N N     . ASP B 1 15  ? -21.482 86.053  42.363  1.00 25.83  ? 15   ASP B N     1 
ATOM   5000  C CA    . ASP B 1 15  ? -20.825 87.341  42.154  1.00 26.89  ? 15   ASP B CA    1 
ATOM   5001  C C     . ASP B 1 15  ? -20.890 87.859  40.722  1.00 27.88  ? 15   ASP B C     1 
ATOM   5002  O O     . ASP B 1 15  ? -21.009 89.054  40.506  1.00 28.08  ? 15   ASP B O     1 
ATOM   5003  C CB    . ASP B 1 15  ? -19.356 87.285  42.574  1.00 26.77  ? 15   ASP B CB    1 
ATOM   5004  C CG    . ASP B 1 15  ? -19.170 87.100  44.074  1.00 25.98  ? 15   ASP B CG    1 
ATOM   5005  O OD1   . ASP B 1 15  ? -20.162 87.202  44.832  1.00 21.80  ? 15   ASP B OD1   1 
ATOM   5006  O OD2   . ASP B 1 15  ? -18.009 86.831  44.474  1.00 26.42  ? 15   ASP B OD2   1 
ATOM   5007  N N     . ARG B 1 16  ? -20.802 86.953  39.751  1.00 28.87  ? 16   ARG B N     1 
ATOM   5008  C CA    . ARG B 1 16  ? -20.650 87.330  38.360  1.00 29.90  ? 16   ARG B CA    1 
ATOM   5009  C C     . ARG B 1 16  ? -21.916 87.186  37.512  1.00 29.12  ? 16   ARG B C     1 
ATOM   5010  O O     . ARG B 1 16  ? -21.922 87.616  36.358  1.00 29.14  ? 16   ARG B O     1 
ATOM   5011  C CB    . ARG B 1 16  ? -19.523 86.503  37.725  1.00 30.14  ? 16   ARG B CB    1 
ATOM   5012  C CG    . ARG B 1 16  ? -19.936 85.053  37.400  1.00 32.53  ? 16   ARG B CG    1 
ATOM   5013  C CD    . ARG B 1 16  ? -18.750 84.196  36.948  1.00 32.89  ? 16   ARG B CD    1 
ATOM   5014  N NE    . ARG B 1 16  ? -18.506 84.285  35.509  1.00 38.81  ? 16   ARG B NE    1 
ATOM   5015  C CZ    . ARG B 1 16  ? -17.547 85.024  34.946  1.00 41.57  ? 16   ARG B CZ    1 
ATOM   5016  N NH1   . ARG B 1 16  ? -16.721 85.765  35.694  1.00 41.51  ? 16   ARG B NH1   1 
ATOM   5017  N NH2   . ARG B 1 16  ? -17.410 85.012  33.619  1.00 42.48  ? 16   ARG B NH2   1 
ATOM   5018  N N     . CYS B 1 17  ? -22.967 86.570  38.055  1.00 28.50  ? 17   CYS B N     1 
ATOM   5019  C CA    . CYS B 1 17  ? -24.118 86.174  37.226  1.00 28.05  ? 17   CYS B CA    1 
ATOM   5020  C C     . CYS B 1 17  ? -24.862 87.344  36.578  1.00 27.84  ? 17   CYS B C     1 
ATOM   5021  O O     . CYS B 1 17  ? -25.003 88.415  37.168  1.00 28.13  ? 17   CYS B O     1 
ATOM   5022  C CB    . CYS B 1 17  ? -25.079 85.246  37.973  1.00 27.87  ? 17   CYS B CB    1 
ATOM   5023  S SG    . CYS B 1 17  ? -25.876 85.959  39.412  1.00 28.09  ? 17   CYS B SG    1 
ATOM   5024  N N     . LEU B 1 18  ? -25.300 87.127  35.342  1.00 27.15  ? 18   LEU B N     1 
ATOM   5025  C CA    . LEU B 1 18  ? -26.086 88.104  34.609  1.00 26.43  ? 18   LEU B CA    1 
ATOM   5026  C C     . LEU B 1 18  ? -27.462 88.236  35.252  1.00 26.37  ? 18   LEU B C     1 
ATOM   5027  O O     . LEU B 1 18  ? -28.073 89.311  35.246  1.00 26.41  ? 18   LEU B O     1 
ATOM   5028  C CB    . LEU B 1 18  ? -26.220 87.676  33.143  1.00 26.34  ? 18   LEU B CB    1 
ATOM   5029  C CG    . LEU B 1 18  ? -24.914 87.482  32.358  1.00 26.58  ? 18   LEU B CG    1 
ATOM   5030  C CD1   . LEU B 1 18  ? -25.194 87.154  30.911  1.00 26.54  ? 18   LEU B CD1   1 
ATOM   5031  C CD2   . LEU B 1 18  ? -23.973 88.684  32.465  1.00 27.79  ? 18   LEU B CD2   1 
ATOM   5032  N N     . ILE B 1 19  ? -27.933 87.128  35.819  1.00 25.85  ? 19   ILE B N     1 
ATOM   5033  C CA    . ILE B 1 19  ? -29.272 87.043  36.351  1.00 25.56  ? 19   ILE B CA    1 
ATOM   5034  C C     . ILE B 1 19  ? -29.281 86.332  37.697  1.00 25.73  ? 19   ILE B C     1 
ATOM   5035  O O     . ILE B 1 19  ? -28.986 85.133  37.780  1.00 25.73  ? 19   ILE B O     1 
ATOM   5036  C CB    . ILE B 1 19  ? -30.238 86.364  35.332  1.00 25.78  ? 19   ILE B CB    1 
ATOM   5037  C CG1   . ILE B 1 19  ? -30.567 87.373  34.213  1.00 26.21  ? 19   ILE B CG1   1 
ATOM   5038  C CG2   . ILE B 1 19  ? -31.514 85.833  36.044  1.00 23.36  ? 19   ILE B CG2   1 
ATOM   5039  C CD1   . ILE B 1 19  ? -31.431 86.843  33.111  1.00 27.34  ? 19   ILE B CD1   1 
ATOM   5040  N N     . ASN B 1 20  ? -29.615 87.080  38.747  1.00 25.58  ? 20   ASN B N     1 
ATOM   5041  C CA    . ASN B 1 20  ? -29.705 86.509  40.098  1.00 25.53  ? 20   ASN B CA    1 
ATOM   5042  C C     . ASN B 1 20  ? -31.106 85.962  40.387  1.00 25.55  ? 20   ASN B C     1 
ATOM   5043  O O     . ASN B 1 20  ? -31.990 86.088  39.556  1.00 25.03  ? 20   ASN B O     1 
ATOM   5044  C CB    . ASN B 1 20  ? -29.224 87.508  41.162  1.00 25.33  ? 20   ASN B CB    1 
ATOM   5045  C CG    . ASN B 1 20  ? -30.079 88.760  41.241  1.00 25.29  ? 20   ASN B CG    1 
ATOM   5046  O OD1   . ASN B 1 20  ? -31.310 88.697  41.234  1.00 27.03  ? 20   ASN B OD1   1 
ATOM   5047  N ND2   . ASN B 1 20  ? -29.423 89.909  41.319  1.00 23.34  ? 20   ASN B ND2   1 
ATOM   5048  N N     . PRO B 1 21  ? -31.311 85.334  41.557  1.00 26.32  ? 21   PRO B N     1 
ATOM   5049  C CA    . PRO B 1 21  ? -32.638 84.792  41.811  1.00 27.11  ? 21   PRO B CA    1 
ATOM   5050  C C     . PRO B 1 21  ? -33.777 85.826  41.671  1.00 28.28  ? 21   PRO B C     1 
ATOM   5051  O O     . PRO B 1 21  ? -34.828 85.495  41.109  1.00 28.51  ? 21   PRO B O     1 
ATOM   5052  C CB    . PRO B 1 21  ? -32.536 84.287  43.252  1.00 26.49  ? 21   PRO B CB    1 
ATOM   5053  C CG    . PRO B 1 21  ? -31.103 84.024  43.444  1.00 26.91  ? 21   PRO B CG    1 
ATOM   5054  C CD    . PRO B 1 21  ? -30.392 85.075  42.681  1.00 26.23  ? 21   PRO B CD    1 
ATOM   5055  N N     . GLU B 1 22  ? -33.569 87.047  42.175  1.00 29.46  ? 22   GLU B N     1 
ATOM   5056  C CA    . GLU B 1 22  ? -34.588 88.102  42.112  1.00 30.94  ? 22   GLU B CA    1 
ATOM   5057  C C     . GLU B 1 22  ? -34.875 88.527  40.678  1.00 30.70  ? 22   GLU B C     1 
ATOM   5058  O O     . GLU B 1 22  ? -36.034 88.685  40.293  1.00 30.89  ? 22   GLU B O     1 
ATOM   5059  C CB    . GLU B 1 22  ? -34.192 89.339  42.945  1.00 31.75  ? 22   GLU B CB    1 
ATOM   5060  C CG    . GLU B 1 22  ? -33.748 89.044  44.377  1.00 35.46  ? 22   GLU B CG    1 
ATOM   5061  C CD    . GLU B 1 22  ? -32.218 89.007  44.529  1.00 40.47  ? 22   GLU B CD    1 
ATOM   5062  O OE1   . GLU B 1 22  ? -31.642 87.883  44.559  1.00 40.53  ? 22   GLU B OE1   1 
ATOM   5063  O OE2   . GLU B 1 22  ? -31.604 90.110  44.617  1.00 41.03  ? 22   GLU B OE2   1 
ATOM   5064  N N     . GLN B 1 23  ? -33.817 88.710  39.889  1.00 30.69  ? 23   GLN B N     1 
ATOM   5065  C CA    . GLN B 1 23  ? -33.976 89.084  38.483  1.00 30.54  ? 23   GLN B CA    1 
ATOM   5066  C C     . GLN B 1 23  ? -34.679 88.006  37.673  1.00 30.29  ? 23   GLN B C     1 
ATOM   5067  O O     . GLN B 1 23  ? -35.422 88.327  36.750  1.00 30.58  ? 23   GLN B O     1 
ATOM   5068  C CB    . GLN B 1 23  ? -32.631 89.425  37.840  1.00 30.57  ? 23   GLN B CB    1 
ATOM   5069  C CG    . GLN B 1 23  ? -31.944 90.619  38.455  1.00 30.66  ? 23   GLN B CG    1 
ATOM   5070  C CD    . GLN B 1 23  ? -30.450 90.613  38.225  1.00 30.85  ? 23   GLN B CD    1 
ATOM   5071  O OE1   . GLN B 1 23  ? -29.795 89.576  38.315  1.00 31.06  ? 23   GLN B OE1   1 
ATOM   5072  N NE2   . GLN B 1 23  ? -29.898 91.782  37.943  1.00 31.16  ? 23   GLN B NE2   1 
ATOM   5073  N N     . TYR B 1 24  ? -34.438 86.735  37.985  1.00 29.95  ? 24   TYR B N     1 
ATOM   5074  C CA    . TYR B 1 24  ? -35.168 85.678  37.284  1.00 30.05  ? 24   TYR B CA    1 
ATOM   5075  C C     . TYR B 1 24  ? -36.675 85.807  37.555  1.00 30.39  ? 24   TYR B C     1 
ATOM   5076  O O     . TYR B 1 24  ? -37.474 85.809  36.617  1.00 29.67  ? 24   TYR B O     1 
ATOM   5077  C CB    . TYR B 1 24  ? -34.691 84.268  37.646  1.00 29.38  ? 24   TYR B CB    1 
ATOM   5078  C CG    . TYR B 1 24  ? -35.670 83.214  37.160  1.00 29.39  ? 24   TYR B CG    1 
ATOM   5079  C CD1   . TYR B 1 24  ? -35.620 82.735  35.848  1.00 30.29  ? 24   TYR B CD1   1 
ATOM   5080  C CD2   . TYR B 1 24  ? -36.672 82.723  37.998  1.00 28.82  ? 24   TYR B CD2   1 
ATOM   5081  C CE1   . TYR B 1 24  ? -36.542 81.774  35.394  1.00 29.72  ? 24   TYR B CE1   1 
ATOM   5082  C CE2   . TYR B 1 24  ? -37.596 81.777  37.551  1.00 26.92  ? 24   TYR B CE2   1 
ATOM   5083  C CZ    . TYR B 1 24  ? -37.522 81.305  36.255  1.00 28.25  ? 24   TYR B CZ    1 
ATOM   5084  O OH    . TYR B 1 24  ? -38.433 80.375  35.819  1.00 26.82  ? 24   TYR B OH    1 
ATOM   5085  N N     . GLU B 1 25  ? -37.047 85.918  38.834  1.00 30.99  ? 25   GLU B N     1 
ATOM   5086  C CA    . GLU B 1 25  ? -38.467 85.995  39.205  1.00 32.06  ? 25   GLU B CA    1 
ATOM   5087  C C     . GLU B 1 25  ? -39.162 87.193  38.575  1.00 31.46  ? 25   GLU B C     1 
ATOM   5088  O O     . GLU B 1 25  ? -40.249 87.053  38.012  1.00 31.38  ? 25   GLU B O     1 
ATOM   5089  C CB    . GLU B 1 25  ? -38.675 85.969  40.729  1.00 32.42  ? 25   GLU B CB    1 
ATOM   5090  C CG    . GLU B 1 25  ? -38.367 84.597  41.388  1.00 35.79  ? 25   GLU B CG    1 
ATOM   5091  C CD    . GLU B 1 25  ? -39.256 83.430  40.905  1.00 39.10  ? 25   GLU B CD    1 
ATOM   5092  O OE1   . GLU B 1 25  ? -40.342 83.654  40.314  1.00 41.63  ? 25   GLU B OE1   1 
ATOM   5093  O OE2   . GLU B 1 25  ? -38.870 82.264  41.132  1.00 41.37  ? 25   GLU B OE2   1 
ATOM   5094  N N     . THR B 1 26  ? -38.503 88.348  38.646  1.00 31.22  ? 26   THR B N     1 
ATOM   5095  C CA    . THR B 1 26  ? -39.007 89.588  38.074  1.00 30.96  ? 26   THR B CA    1 
ATOM   5096  C C     . THR B 1 26  ? -39.184 89.454  36.559  1.00 30.91  ? 26   THR B C     1 
ATOM   5097  O O     . THR B 1 26  ? -40.231 89.804  36.016  1.00 30.76  ? 26   THR B O     1 
ATOM   5098  C CB    . THR B 1 26  ? -38.057 90.782  38.412  1.00 31.20  ? 26   THR B CB    1 
ATOM   5099  O OG1   . THR B 1 26  ? -38.030 90.999  39.833  1.00 30.98  ? 26   THR B OG1   1 
ATOM   5100  C CG2   . THR B 1 26  ? -38.491 92.085  37.702  1.00 30.51  ? 26   THR B CG2   1 
ATOM   5101  N N     . LYS B 1 27  ? -38.154 88.948  35.885  1.00 30.81  ? 27   LYS B N     1 
ATOM   5102  C CA    . LYS B 1 27  ? -38.153 88.895  34.426  1.00 30.89  ? 27   LYS B CA    1 
ATOM   5103  C C     . LYS B 1 27  ? -39.138 87.851  33.931  1.00 30.27  ? 27   LYS B C     1 
ATOM   5104  O O     . LYS B 1 27  ? -39.813 88.070  32.925  1.00 30.12  ? 27   LYS B O     1 
ATOM   5105  C CB    . LYS B 1 27  ? -36.752 88.616  33.871  1.00 30.96  ? 27   LYS B CB    1 
ATOM   5106  C CG    . LYS B 1 27  ? -35.774 89.760  34.031  1.00 31.85  ? 27   LYS B CG    1 
ATOM   5107  C CD    . LYS B 1 27  ? -34.497 89.474  33.261  1.00 34.34  ? 27   LYS B CD    1 
ATOM   5108  C CE    . LYS B 1 27  ? -33.792 90.764  32.894  1.00 38.18  ? 27   LYS B CE    1 
ATOM   5109  N NZ    . LYS B 1 27  ? -33.174 90.717  31.539  1.00 40.07  ? 27   LYS B NZ    1 
ATOM   5110  N N     . TYR B 1 28  ? -39.222 86.728  34.648  1.00 29.93  ? 28   TYR B N     1 
ATOM   5111  C CA    . TYR B 1 28  ? -40.167 85.684  34.294  1.00 29.91  ? 28   TYR B CA    1 
ATOM   5112  C C     . TYR B 1 28  ? -41.589 86.227  34.365  1.00 30.15  ? 28   TYR B C     1 
ATOM   5113  O O     . TYR B 1 28  ? -42.373 86.026  33.432  1.00 30.30  ? 28   TYR B O     1 
ATOM   5114  C CB    . TYR B 1 28  ? -40.021 84.403  35.138  1.00 29.47  ? 28   TYR B CB    1 
ATOM   5115  C CG    . TYR B 1 28  ? -40.980 83.347  34.643  1.00 29.33  ? 28   TYR B CG    1 
ATOM   5116  C CD1   . TYR B 1 28  ? -40.680 82.570  33.526  1.00 29.18  ? 28   TYR B CD1   1 
ATOM   5117  C CD2   . TYR B 1 28  ? -42.233 83.185  35.233  1.00 29.98  ? 28   TYR B CD2   1 
ATOM   5118  C CE1   . TYR B 1 28  ? -41.589 81.629  33.042  1.00 28.53  ? 28   TYR B CE1   1 
ATOM   5119  C CE2   . TYR B 1 28  ? -43.146 82.256  34.747  1.00 28.99  ? 28   TYR B CE2   1 
ATOM   5120  C CZ    . TYR B 1 28  ? -42.811 81.487  33.659  1.00 28.48  ? 28   TYR B CZ    1 
ATOM   5121  O OH    . TYR B 1 28  ? -43.722 80.580  33.187  1.00 30.09  ? 28   TYR B OH    1 
ATOM   5122  N N     . LYS B 1 29  ? -41.910 86.923  35.458  1.00 30.30  ? 29   LYS B N     1 
ATOM   5123  C CA    . LYS B 1 29  ? -43.237 87.522  35.621  1.00 30.57  ? 29   LYS B CA    1 
ATOM   5124  C C     . LYS B 1 29  ? -43.572 88.487  34.491  1.00 30.64  ? 29   LYS B C     1 
ATOM   5125  O O     . LYS B 1 29  ? -44.669 88.433  33.949  1.00 30.80  ? 29   LYS B O     1 
ATOM   5126  C CB    . LYS B 1 29  ? -43.397 88.199  36.996  1.00 30.85  ? 29   LYS B CB    1 
ATOM   5127  N N     . GLN B 1 30  ? -42.634 89.349  34.110  1.00 31.01  ? 30   GLN B N     1 
ATOM   5128  C CA    . GLN B 1 30  ? -42.916 90.301  33.025  1.00 31.59  ? 30   GLN B CA    1 
ATOM   5129  C C     . GLN B 1 30  ? -43.077 89.584  31.694  1.00 31.81  ? 30   GLN B C     1 
ATOM   5130  O O     . GLN B 1 30  ? -43.956 89.935  30.902  1.00 31.34  ? 30   GLN B O     1 
ATOM   5131  C CB    . GLN B 1 30  ? -41.849 91.391  32.911  1.00 31.53  ? 30   GLN B CB    1 
ATOM   5132  C CG    . GLN B 1 30  ? -42.273 92.577  32.038  1.00 31.67  ? 30   GLN B CG    1 
ATOM   5133  C CD    . GLN B 1 30  ? -41.112 93.509  31.681  1.00 32.12  ? 30   GLN B CD    1 
ATOM   5134  O OE1   . GLN B 1 30  ? -39.942 93.164  31.864  1.00 33.17  ? 30   GLN B OE1   1 
ATOM   5135  N NE2   . GLN B 1 30  ? -41.437 94.693  31.155  1.00 31.42  ? 30   GLN B NE2   1 
ATOM   5136  N N     . SER B 1 31  ? -42.234 88.574  31.460  1.00 32.13  ? 31   SER B N     1 
ATOM   5137  C CA    . SER B 1 31  ? -42.274 87.809  30.211  1.00 32.54  ? 31   SER B CA    1 
ATOM   5138  C C     . SER B 1 31  ? -43.664 87.208  29.983  1.00 32.75  ? 31   SER B C     1 
ATOM   5139  O O     . SER B 1 31  ? -44.103 87.044  28.842  1.00 32.41  ? 31   SER B O     1 
ATOM   5140  C CB    . SER B 1 31  ? -41.193 86.714  30.189  1.00 32.17  ? 31   SER B CB    1 
ATOM   5141  O OG    . SER B 1 31  ? -41.491 85.665  31.098  1.00 31.96  ? 31   SER B OG    1 
ATOM   5142  N N     . ILE B 1 32  ? -44.339 86.908  31.092  1.00 33.14  ? 32   ILE B N     1 
ATOM   5143  C CA    . ILE B 1 32  ? -45.628 86.212  31.098  1.00 33.49  ? 32   ILE B CA    1 
ATOM   5144  C C     . ILE B 1 32  ? -46.769 87.209  31.056  1.00 33.90  ? 32   ILE B C     1 
ATOM   5145  O O     . ILE B 1 32  ? -47.668 87.075  30.228  1.00 33.88  ? 32   ILE B O     1 
ATOM   5146  C CB    . ILE B 1 32  ? -45.756 85.274  32.341  1.00 33.52  ? 32   ILE B CB    1 
ATOM   5147  C CG1   . ILE B 1 32  ? -44.717 84.148  32.271  1.00 33.85  ? 32   ILE B CG1   1 
ATOM   5148  C CG2   . ILE B 1 32  ? -47.164 84.693  32.480  1.00 33.74  ? 32   ILE B CG2   1 
ATOM   5149  C CD1   . ILE B 1 32  ? -44.493 83.541  30.855  1.00 33.53  ? 32   ILE B CD1   1 
ATOM   5150  N N     . ASN B 1 33  ? -46.711 88.215  31.936  1.00 34.19  ? 33   ASN B N     1 
ATOM   5151  C CA    . ASN B 1 33  ? -47.765 89.224  32.043  1.00 34.52  ? 33   ASN B CA    1 
ATOM   5152  C C     . ASN B 1 33  ? -47.772 90.213  30.885  1.00 33.93  ? 33   ASN B C     1 
ATOM   5153  O O     . ASN B 1 33  ? -48.839 90.657  30.468  1.00 34.26  ? 33   ASN B O     1 
ATOM   5154  C CB    . ASN B 1 33  ? -47.663 89.990  33.369  1.00 35.24  ? 33   ASN B CB    1 
ATOM   5155  C CG    . ASN B 1 33  ? -47.832 89.086  34.598  1.00 37.40  ? 33   ASN B CG    1 
ATOM   5156  O OD1   . ASN B 1 33  ? -48.209 87.909  34.491  1.00 39.90  ? 33   ASN B OD1   1 
ATOM   5157  N ND2   . ASN B 1 33  ? -47.548 89.643  35.776  1.00 38.28  ? 33   ASN B ND2   1 
ATOM   5158  N N     . ASP B 1 34  ? -46.589 90.556  30.377  1.00 32.87  ? 34   ASP B N     1 
ATOM   5159  C CA    . ASP B 1 34  ? -46.460 91.541  29.302  1.00 32.18  ? 34   ASP B CA    1 
ATOM   5160  C C     . ASP B 1 34  ? -45.370 91.182  28.277  1.00 31.54  ? 34   ASP B C     1 
ATOM   5161  O O     . ASP B 1 34  ? -44.332 91.864  28.224  1.00 31.11  ? 34   ASP B O     1 
ATOM   5162  C CB    . ASP B 1 34  ? -46.184 92.930  29.896  1.00 32.41  ? 34   ASP B CB    1 
ATOM   5163  C CG    . ASP B 1 34  ? -46.322 94.058  28.871  1.00 33.35  ? 34   ASP B CG    1 
ATOM   5164  O OD1   . ASP B 1 34  ? -46.817 93.821  27.739  1.00 34.74  ? 34   ASP B OD1   1 
ATOM   5165  O OD2   . ASP B 1 34  ? -45.938 95.197  29.206  1.00 33.43  ? 34   ASP B OD2   1 
ATOM   5166  N N     . PRO B 1 35  ? -45.616 90.138  27.441  1.00 30.98  ? 35   PRO B N     1 
ATOM   5167  C CA    . PRO B 1 35  ? -44.611 89.645  26.473  1.00 30.75  ? 35   PRO B CA    1 
ATOM   5168  C C     . PRO B 1 35  ? -44.137 90.717  25.474  1.00 30.44  ? 35   PRO B C     1 
ATOM   5169  O O     . PRO B 1 35  ? -42.987 90.667  25.015  1.00 29.74  ? 35   PRO B O     1 
ATOM   5170  C CB    . PRO B 1 35  ? -45.343 88.522  25.718  1.00 30.59  ? 35   PRO B CB    1 
ATOM   5171  C CG    . PRO B 1 35  ? -46.582 88.247  26.468  1.00 30.48  ? 35   PRO B CG    1 
ATOM   5172  C CD    . PRO B 1 35  ? -46.884 89.385  27.364  1.00 30.70  ? 35   PRO B CD    1 
ATOM   5173  N N     . ASP B 1 36  ? -45.020 91.667  25.155  1.00 30.15  ? 36   ASP B N     1 
ATOM   5174  C CA    . ASP B 1 36  ? -44.713 92.729  24.191  1.00 30.19  ? 36   ASP B CA    1 
ATOM   5175  C C     . ASP B 1 36  ? -43.613 93.680  24.658  1.00 29.75  ? 36   ASP B C     1 
ATOM   5176  O O     . ASP B 1 36  ? -42.707 94.020  23.887  1.00 29.64  ? 36   ASP B O     1 
ATOM   5177  C CB    . ASP B 1 36  ? -45.989 93.475  23.771  1.00 30.44  ? 36   ASP B CB    1 
ATOM   5178  C CG    . ASP B 1 36  ? -46.797 92.705  22.724  1.00 31.06  ? 36   ASP B CG    1 
ATOM   5179  O OD1   . ASP B 1 36  ? -47.986 93.016  22.512  1.00 33.19  ? 36   ASP B OD1   1 
ATOM   5180  O OD2   . ASP B 1 36  ? -46.244 91.774  22.109  1.00 31.69  ? 36   ASP B OD2   1 
ATOM   5181  N N     . THR B 1 37  ? -43.686 94.092  25.921  1.00 29.61  ? 37   THR B N     1 
ATOM   5182  C CA    . THR B 1 37  ? -42.653 94.937  26.531  1.00 29.22  ? 37   THR B CA    1 
ATOM   5183  C C     . THR B 1 37  ? -41.385 94.109  26.748  1.00 28.73  ? 37   THR B C     1 
ATOM   5184  O O     . THR B 1 37  ? -40.287 94.528  26.359  1.00 28.70  ? 37   THR B O     1 
ATOM   5185  C CB    . THR B 1 37  ? -43.151 95.551  27.863  1.00 29.57  ? 37   THR B CB    1 
ATOM   5186  O OG1   . THR B 1 37  ? -44.442 96.151  27.652  1.00 29.44  ? 37   THR B OG1   1 
ATOM   5187  C CG2   . THR B 1 37  ? -42.163 96.597  28.424  1.00 29.07  ? 37   THR B CG2   1 
ATOM   5188  N N     . PHE B 1 38  ? -41.547 92.920  27.328  1.00 27.82  ? 38   PHE B N     1 
ATOM   5189  C CA    . PHE B 1 38  ? -40.406 92.065  27.629  1.00 27.22  ? 38   PHE B CA    1 
ATOM   5190  C C     . PHE B 1 38  ? -39.581 91.708  26.380  1.00 26.86  ? 38   PHE B C     1 
ATOM   5191  O O     . PHE B 1 38  ? -38.372 91.974  26.327  1.00 26.71  ? 38   PHE B O     1 
ATOM   5192  C CB    . PHE B 1 38  ? -40.830 90.802  28.378  1.00 27.13  ? 38   PHE B CB    1 
ATOM   5193  C CG    . PHE B 1 38  ? -39.676 89.941  28.770  1.00 27.62  ? 38   PHE B CG    1 
ATOM   5194  C CD1   . PHE B 1 38  ? -38.957 90.214  29.942  1.00 28.04  ? 38   PHE B CD1   1 
ATOM   5195  C CD2   . PHE B 1 38  ? -39.275 88.885  27.958  1.00 26.05  ? 38   PHE B CD2   1 
ATOM   5196  C CE1   . PHE B 1 38  ? -37.868 89.442  30.311  1.00 27.58  ? 38   PHE B CE1   1 
ATOM   5197  C CE2   . PHE B 1 38  ? -38.187 88.109  28.315  1.00 27.85  ? 38   PHE B CE2   1 
ATOM   5198  C CZ    . PHE B 1 38  ? -37.474 88.389  29.499  1.00 27.77  ? 38   PHE B CZ    1 
ATOM   5199  N N     . TRP B 1 39  ? -40.243 91.116  25.388  1.00 25.90  ? 39   TRP B N     1 
ATOM   5200  C CA    . TRP B 1 39  ? -39.604 90.760  24.127  1.00 25.30  ? 39   TRP B CA    1 
ATOM   5201  C C     . TRP B 1 39  ? -39.358 91.950  23.181  1.00 25.33  ? 39   TRP B C     1 
ATOM   5202  O O     . TRP B 1 39  ? -38.562 91.845  22.251  1.00 25.27  ? 39   TRP B O     1 
ATOM   5203  C CB    . TRP B 1 39  ? -40.357 89.606  23.440  1.00 24.50  ? 39   TRP B CB    1 
ATOM   5204  C CG    . TRP B 1 39  ? -40.271 88.326  24.245  1.00 25.01  ? 39   TRP B CG    1 
ATOM   5205  C CD1   . TRP B 1 39  ? -41.295 87.693  24.905  1.00 24.13  ? 39   TRP B CD1   1 
ATOM   5206  C CD2   . TRP B 1 39  ? -39.084 87.543  24.507  1.00 24.51  ? 39   TRP B CD2   1 
ATOM   5207  N NE1   . TRP B 1 39  ? -40.822 86.564  25.542  1.00 24.09  ? 39   TRP B NE1   1 
ATOM   5208  C CE2   . TRP B 1 39  ? -39.473 86.452  25.318  1.00 24.33  ? 39   TRP B CE2   1 
ATOM   5209  C CE3   . TRP B 1 39  ? -37.735 87.660  24.136  1.00 24.32  ? 39   TRP B CE3   1 
ATOM   5210  C CZ2   . TRP B 1 39  ? -38.559 85.481  25.762  1.00 23.72  ? 39   TRP B CZ2   1 
ATOM   5211  C CZ3   . TRP B 1 39  ? -36.826 86.689  24.585  1.00 23.98  ? 39   TRP B CZ3   1 
ATOM   5212  C CH2   . TRP B 1 39  ? -37.247 85.622  25.387  1.00 23.55  ? 39   TRP B CH2   1 
ATOM   5213  N N     . GLY B 1 40  ? -40.022 93.075  23.425  1.00 25.86  ? 40   GLY B N     1 
ATOM   5214  C CA    . GLY B 1 40  ? -39.700 94.328  22.727  1.00 26.77  ? 40   GLY B CA    1 
ATOM   5215  C C     . GLY B 1 40  ? -38.331 94.861  23.127  1.00 27.70  ? 40   GLY B C     1 
ATOM   5216  O O     . GLY B 1 40  ? -37.524 95.253  22.273  1.00 28.21  ? 40   GLY B O     1 
ATOM   5217  N N     . GLU B 1 41  ? -38.061 94.859  24.430  1.00 28.05  ? 41   GLU B N     1 
ATOM   5218  C CA    . GLU B 1 41  ? -36.768 95.276  24.952  1.00 28.91  ? 41   GLU B CA    1 
ATOM   5219  C C     . GLU B 1 41  ? -35.701 94.217  24.689  1.00 27.95  ? 41   GLU B C     1 
ATOM   5220  O O     . GLU B 1 41  ? -34.586 94.530  24.266  1.00 27.90  ? 41   GLU B O     1 
ATOM   5221  C CB    . GLU B 1 41  ? -36.873 95.606  26.453  1.00 28.77  ? 41   GLU B CB    1 
ATOM   5222  C CG    . GLU B 1 41  ? -37.510 96.965  26.730  1.00 30.83  ? 41   GLU B CG    1 
ATOM   5223  C CD    . GLU B 1 41  ? -37.997 97.143  28.190  1.00 31.50  ? 41   GLU B CD    1 
ATOM   5224  O OE1   . GLU B 1 41  ? -38.965 97.919  28.405  1.00 33.34  ? 41   GLU B OE1   1 
ATOM   5225  O OE2   . GLU B 1 41  ? -37.418 96.519  29.113  1.00 34.48  ? 41   GLU B OE2   1 
ATOM   5226  N N     . GLN B 1 42  ? -36.056 92.960  24.914  1.00 27.76  ? 42   GLN B N     1 
ATOM   5227  C CA    . GLN B 1 42  ? -35.088 91.873  24.833  1.00 27.36  ? 42   GLN B CA    1 
ATOM   5228  C C     . GLN B 1 42  ? -34.660 91.609  23.384  1.00 26.88  ? 42   GLN B C     1 
ATOM   5229  O O     . GLN B 1 42  ? -33.512 91.251  23.129  1.00 26.92  ? 42   GLN B O     1 
ATOM   5230  C CB    . GLN B 1 42  ? -35.626 90.618  25.554  1.00 27.37  ? 42   GLN B CB    1 
ATOM   5231  C CG    . GLN B 1 42  ? -34.607 89.492  25.838  1.00 27.63  ? 42   GLN B CG    1 
ATOM   5232  C CD    . GLN B 1 42  ? -33.213 89.970  26.288  1.00 28.62  ? 42   GLN B CD    1 
ATOM   5233  O OE1   . GLN B 1 42  ? -32.201 89.585  25.686  1.00 30.37  ? 42   GLN B OE1   1 
ATOM   5234  N NE2   . GLN B 1 42  ? -33.154 90.784  27.347  1.00 26.60  ? 42   GLN B NE2   1 
ATOM   5235  N N     . GLY B 1 43  ? -35.573 91.839  22.444  1.00 26.58  ? 43   GLY B N     1 
ATOM   5236  C CA    . GLY B 1 43  ? -35.285 91.719  21.009  1.00 26.20  ? 43   GLY B CA    1 
ATOM   5237  C C     . GLY B 1 43  ? -34.170 92.624  20.509  1.00 26.44  ? 43   GLY B C     1 
ATOM   5238  O O     . GLY B 1 43  ? -33.643 92.418  19.405  1.00 26.26  ? 43   GLY B O     1 
ATOM   5239  N N     . LYS B 1 44  ? -33.805 93.619  21.324  1.00 26.29  ? 44   LYS B N     1 
ATOM   5240  C CA    . LYS B 1 44  ? -32.683 94.524  21.029  1.00 26.58  ? 44   LYS B CA    1 
ATOM   5241  C C     . LYS B 1 44  ? -31.303 93.868  21.187  1.00 26.39  ? 44   LYS B C     1 
ATOM   5242  O O     . LYS B 1 44  ? -30.280 94.492  20.889  1.00 26.04  ? 44   LYS B O     1 
ATOM   5243  C CB    . LYS B 1 44  ? -32.752 95.807  21.895  1.00 27.18  ? 44   LYS B CB    1 
ATOM   5244  C CG    . LYS B 1 44  ? -34.024 96.653  21.741  1.00 27.31  ? 44   LYS B CG    1 
ATOM   5245  C CD    . LYS B 1 44  ? -34.201 97.177  20.304  1.00 28.60  ? 44   LYS B CD    1 
ATOM   5246  C CE    . LYS B 1 44  ? -35.582 97.817  20.097  1.00 29.57  ? 44   LYS B CE    1 
ATOM   5247  N NZ    . LYS B 1 44  ? -35.946 98.805  21.156  1.00 29.59  ? 44   LYS B NZ    1 
ATOM   5248  N N     . ILE B 1 45  ? -31.261 92.621  21.657  1.00 26.14  ? 45   ILE B N     1 
ATOM   5249  C CA    . ILE B 1 45  ? -30.008 91.851  21.629  1.00 26.06  ? 45   ILE B CA    1 
ATOM   5250  C C     . ILE B 1 45  ? -29.424 91.760  20.199  1.00 26.26  ? 45   ILE B C     1 
ATOM   5251  O O     . ILE B 1 45  ? -28.203 91.627  20.008  1.00 26.66  ? 45   ILE B O     1 
ATOM   5252  C CB    . ILE B 1 45  ? -30.179 90.434  22.240  1.00 26.42  ? 45   ILE B CB    1 
ATOM   5253  C CG1   . ILE B 1 45  ? -28.820 89.890  22.727  1.00 25.51  ? 45   ILE B CG1   1 
ATOM   5254  C CG2   . ILE B 1 45  ? -30.941 89.477  21.251  1.00 25.47  ? 45   ILE B CG2   1 
ATOM   5255  C CD1   . ILE B 1 45  ? -28.910 88.595  23.613  1.00 25.57  ? 45   ILE B CD1   1 
ATOM   5256  N N     . LEU B 1 46  ? -30.301 91.836  19.199  1.00 26.07  ? 46   LEU B N     1 
ATOM   5257  C CA    . LEU B 1 46  ? -29.881 91.869  17.795  1.00 25.25  ? 46   LEU B CA    1 
ATOM   5258  C C     . LEU B 1 46  ? -29.910 93.285  17.259  1.00 25.54  ? 46   LEU B C     1 
ATOM   5259  O O     . LEU B 1 46  ? -30.650 94.128  17.768  1.00 25.60  ? 46   LEU B O     1 
ATOM   5260  C CB    . LEU B 1 46  ? -30.779 90.982  16.942  1.00 24.27  ? 46   LEU B CB    1 
ATOM   5261  C CG    . LEU B 1 46  ? -30.982 89.536  17.409  1.00 23.65  ? 46   LEU B CG    1 
ATOM   5262  C CD1   . LEU B 1 46  ? -31.936 88.818  16.469  1.00 24.19  ? 46   LEU B CD1   1 
ATOM   5263  C CD2   . LEU B 1 46  ? -29.661 88.767  17.542  1.00 19.67  ? 46   LEU B CD2   1 
ATOM   5264  N N     . ASP B 1 47  ? -29.067 93.534  16.257  1.00 25.99  ? 47   ASP B N     1 
ATOM   5265  C CA    . ASP B 1 47  ? -29.182 94.691  15.373  1.00 26.21  ? 47   ASP B CA    1 
ATOM   5266  C C     . ASP B 1 47  ? -30.287 94.431  14.327  1.00 26.63  ? 47   ASP B C     1 
ATOM   5267  O O     . ASP B 1 47  ? -30.326 93.377  13.660  1.00 26.60  ? 47   ASP B O     1 
ATOM   5268  C CB    . ASP B 1 47  ? -27.863 94.947  14.642  1.00 26.18  ? 47   ASP B CB    1 
ATOM   5269  C CG    . ASP B 1 47  ? -26.717 95.371  15.576  1.00 27.76  ? 47   ASP B CG    1 
ATOM   5270  O OD1   . ASP B 1 47  ? -25.600 95.563  15.043  1.00 28.12  ? 47   ASP B OD1   1 
ATOM   5271  O OD2   . ASP B 1 47  ? -26.908 95.528  16.816  1.00 28.91  ? 47   ASP B OD2   1 
ATOM   5272  N N     . TRP B 1 48  ? -31.176 95.405  14.186  1.00 26.79  ? 48   TRP B N     1 
ATOM   5273  C CA    . TRP B 1 48  ? -32.282 95.320  13.264  1.00 27.05  ? 48   TRP B CA    1 
ATOM   5274  C C     . TRP B 1 48  ? -32.111 96.416  12.229  1.00 27.93  ? 48   TRP B C     1 
ATOM   5275  O O     . TRP B 1 48  ? -31.733 97.538  12.567  1.00 27.50  ? 48   TRP B O     1 
ATOM   5276  C CB    . TRP B 1 48  ? -33.595 95.488  14.017  1.00 26.55  ? 48   TRP B CB    1 
ATOM   5277  C CG    . TRP B 1 48  ? -33.937 94.324  14.897  1.00 26.33  ? 48   TRP B CG    1 
ATOM   5278  C CD1   . TRP B 1 48  ? -33.441 94.060  16.150  1.00 26.43  ? 48   TRP B CD1   1 
ATOM   5279  C CD2   . TRP B 1 48  ? -34.870 93.276  14.606  1.00 26.65  ? 48   TRP B CD2   1 
ATOM   5280  N NE1   . TRP B 1 48  ? -33.999 92.903  16.653  1.00 26.35  ? 48   TRP B NE1   1 
ATOM   5281  C CE2   . TRP B 1 48  ? -34.876 92.396  15.726  1.00 27.18  ? 48   TRP B CE2   1 
ATOM   5282  C CE3   . TRP B 1 48  ? -35.698 92.984  13.503  1.00 26.08  ? 48   TRP B CE3   1 
ATOM   5283  C CZ2   . TRP B 1 48  ? -35.686 91.243  15.777  1.00 25.25  ? 48   TRP B CZ2   1 
ATOM   5284  C CZ3   . TRP B 1 48  ? -36.498 91.835  13.552  1.00 25.96  ? 48   TRP B CZ3   1 
ATOM   5285  C CH2   . TRP B 1 48  ? -36.481 90.980  14.687  1.00 25.91  ? 48   TRP B CH2   1 
ATOM   5286  N N     . ILE B 1 49  ? -32.376 96.077  10.969  1.00 28.76  ? 49   ILE B N     1 
ATOM   5287  C CA    . ILE B 1 49  ? -32.205 97.012  9.854   1.00 29.94  ? 49   ILE B CA    1 
ATOM   5288  C C     . ILE B 1 49  ? -33.364 98.033  9.753   1.00 30.80  ? 49   ILE B C     1 
ATOM   5289  O O     . ILE B 1 49  ? -33.126 99.243  9.631   1.00 30.54  ? 49   ILE B O     1 
ATOM   5290  C CB    . ILE B 1 49  ? -31.967 96.253  8.535   1.00 29.99  ? 49   ILE B CB    1 
ATOM   5291  C CG1   . ILE B 1 49  ? -30.694 95.393  8.668   1.00 29.71  ? 49   ILE B CG1   1 
ATOM   5292  C CG2   . ILE B 1 49  ? -31.914 97.243  7.330   1.00 30.39  ? 49   ILE B CG2   1 
ATOM   5293  C CD1   . ILE B 1 49  ? -30.587 94.237  7.673   1.00 28.89  ? 49   ILE B CD1   1 
ATOM   5294  N N     . THR B 1 50  ? -34.605 97.549  9.791   1.00 31.78  ? 50   THR B N     1 
ATOM   5295  C CA    . THR B 1 50  ? -35.713 98.423  10.152  1.00 32.92  ? 50   THR B CA    1 
ATOM   5296  C C     . THR B 1 50  ? -36.260 97.857  11.446  1.00 33.02  ? 50   THR B C     1 
ATOM   5297  O O     . THR B 1 50  ? -36.496 96.656  11.528  1.00 32.73  ? 50   THR B O     1 
ATOM   5298  C CB    . THR B 1 50  ? -36.836 98.614  9.041   1.00 33.39  ? 50   THR B CB    1 
ATOM   5299  O OG1   . THR B 1 50  ? -37.960 97.754  9.273   1.00 34.62  ? 50   THR B OG1   1 
ATOM   5300  C CG2   . THR B 1 50  ? -36.310 98.397  7.637   1.00 33.43  ? 50   THR B CG2   1 
ATOM   5301  N N     . PRO B 1 51  ? -36.424 98.718  12.474  1.00 33.53  ? 51   PRO B N     1 
ATOM   5302  C CA    . PRO B 1 51  ? -36.922 98.246  13.757  1.00 33.67  ? 51   PRO B CA    1 
ATOM   5303  C C     . PRO B 1 51  ? -38.354 97.767  13.641  1.00 34.01  ? 51   PRO B C     1 
ATOM   5304  O O     . PRO B 1 51  ? -39.165 98.385  12.940  1.00 34.36  ? 51   PRO B O     1 
ATOM   5305  C CB    . PRO B 1 51  ? -36.840 99.492  14.648  1.00 33.56  ? 51   PRO B CB    1 
ATOM   5306  C CG    . PRO B 1 51  ? -36.871 100.632 13.716  1.00 33.73  ? 51   PRO B CG    1 
ATOM   5307  C CD    . PRO B 1 51  ? -36.148 100.169 12.497  1.00 33.61  ? 51   PRO B CD    1 
ATOM   5308  N N     . TYR B 1 52  ? -38.655 96.656  14.307  1.00 34.32  ? 52   TYR B N     1 
ATOM   5309  C CA    . TYR B 1 52  ? -40.034 96.183  14.438  1.00 34.22  ? 52   TYR B CA    1 
ATOM   5310  C C     . TYR B 1 52  ? -40.855 97.172  15.250  1.00 34.20  ? 52   TYR B C     1 
ATOM   5311  O O     . TYR B 1 52  ? -40.316 98.050  15.931  1.00 32.99  ? 52   TYR B O     1 
ATOM   5312  C CB    . TYR B 1 52  ? -40.091 94.795  15.102  1.00 34.34  ? 52   TYR B CB    1 
ATOM   5313  C CG    . TYR B 1 52  ? -39.283 94.680  16.377  1.00 34.38  ? 52   TYR B CG    1 
ATOM   5314  C CD1   . TYR B 1 52  ? -39.802 95.110  17.600  1.00 34.22  ? 52   TYR B CD1   1 
ATOM   5315  C CD2   . TYR B 1 52  ? -37.988 94.131  16.359  1.00 34.71  ? 52   TYR B CD2   1 
ATOM   5316  C CE1   . TYR B 1 52  ? -39.047 95.007  18.781  1.00 34.69  ? 52   TYR B CE1   1 
ATOM   5317  C CE2   . TYR B 1 52  ? -37.234 94.018  17.532  1.00 34.61  ? 52   TYR B CE2   1 
ATOM   5318  C CZ    . TYR B 1 52  ? -37.767 94.454  18.735  1.00 34.67  ? 52   TYR B CZ    1 
ATOM   5319  O OH    . TYR B 1 52  ? -37.017 94.348  19.887  1.00 34.86  ? 52   TYR B OH    1 
ATOM   5320  N N     . GLN B 1 53  ? -42.166 97.010  15.170  1.00 34.63  ? 53   GLN B N     1 
ATOM   5321  C CA    . GLN B 1 53  ? -43.081 97.796  15.972  1.00 35.86  ? 53   GLN B CA    1 
ATOM   5322  C C     . GLN B 1 53  ? -44.001 96.808  16.654  1.00 34.97  ? 53   GLN B C     1 
ATOM   5323  O O     . GLN B 1 53  ? -44.243 96.910  17.852  1.00 35.55  ? 53   GLN B O     1 
ATOM   5324  C CB    . GLN B 1 53  ? -43.856 98.791  15.098  1.00 35.70  ? 53   GLN B CB    1 
ATOM   5325  C CG    . GLN B 1 53  ? -44.338 100.036 15.836  1.00 37.80  ? 53   GLN B CG    1 
ATOM   5326  C CD    . GLN B 1 53  ? -44.668 101.188 14.881  1.00 38.72  ? 53   GLN B CD    1 
ATOM   5327  O OE1   . GLN B 1 53  ? -45.695 101.871 15.029  1.00 42.35  ? 53   GLN B OE1   1 
ATOM   5328  N NE2   . GLN B 1 53  ? -43.798 101.404 13.888  1.00 41.24  ? 53   GLN B NE2   1 
ATOM   5329  N N     . LYS B 1 54  ? -44.492 95.839  15.887  1.00 34.16  ? 54   LYS B N     1 
ATOM   5330  C CA    . LYS B 1 54  ? -45.234 94.724  16.448  1.00 33.30  ? 54   LYS B CA    1 
ATOM   5331  C C     . LYS B 1 54  ? -44.254 93.719  17.087  1.00 32.83  ? 54   LYS B C     1 
ATOM   5332  O O     . LYS B 1 54  ? -43.161 93.476  16.558  1.00 32.51  ? 54   LYS B O     1 
ATOM   5333  C CB    . LYS B 1 54  ? -46.109 94.075  15.365  1.00 33.32  ? 54   LYS B CB    1 
ATOM   5334  N N     . VAL B 1 55  ? -44.628 93.159  18.235  1.00 32.02  ? 55   VAL B N     1 
ATOM   5335  C CA    . VAL B 1 55  ? -43.811 92.126  18.861  1.00 31.48  ? 55   VAL B CA    1 
ATOM   5336  C C     . VAL B 1 55  ? -44.474 90.744  18.748  1.00 31.06  ? 55   VAL B C     1 
ATOM   5337  O O     . VAL B 1 55  ? -44.200 90.016  17.813  1.00 30.87  ? 55   VAL B O     1 
ATOM   5338  C CB    . VAL B 1 55  ? -43.386 92.501  20.304  1.00 31.82  ? 55   VAL B CB    1 
ATOM   5339  C CG1   . VAL B 1 55  ? -42.446 91.444  20.898  1.00 31.52  ? 55   VAL B CG1   1 
ATOM   5340  C CG2   . VAL B 1 55  ? -42.699 93.885  20.312  1.00 31.68  ? 55   VAL B CG2   1 
ATOM   5341  N N     . LYS B 1 56  ? -45.364 90.408  19.673  1.00 30.84  ? 56   LYS B N     1 
ATOM   5342  C CA    . LYS B 1 56  ? -46.056 89.114  19.665  1.00 30.53  ? 56   LYS B CA    1 
ATOM   5343  C C     . LYS B 1 56  ? -47.387 89.158  18.891  1.00 30.43  ? 56   LYS B C     1 
ATOM   5344  O O     . LYS B 1 56  ? -48.230 90.045  19.097  1.00 29.92  ? 56   LYS B O     1 
ATOM   5345  C CB    . LYS B 1 56  ? -46.285 88.660  21.111  1.00 30.41  ? 56   LYS B CB    1 
ATOM   5346  C CG    . LYS B 1 56  ? -46.979 87.324  21.300  1.00 30.22  ? 56   LYS B CG    1 
ATOM   5347  C CD    . LYS B 1 56  ? -47.350 87.150  22.774  1.00 29.72  ? 56   LYS B CD    1 
ATOM   5348  C CE    . LYS B 1 56  ? -47.888 85.768  23.065  1.00 30.32  ? 56   LYS B CE    1 
ATOM   5349  N NZ    . LYS B 1 56  ? -48.948 85.375  22.112  1.00 29.68  ? 56   LYS B NZ    1 
ATOM   5350  N N     . ASN B 1 57  ? -47.564 88.192  17.996  1.00 30.49  ? 57   ASN B N     1 
ATOM   5351  C CA    . ASN B 1 57  ? -48.800 88.065  17.220  1.00 30.27  ? 57   ASN B CA    1 
ATOM   5352  C C     . ASN B 1 57  ? -48.986 86.596  16.901  1.00 29.95  ? 57   ASN B C     1 
ATOM   5353  O O     . ASN B 1 57  ? -48.613 86.110  15.832  1.00 30.04  ? 57   ASN B O     1 
ATOM   5354  C CB    . ASN B 1 57  ? -48.736 88.931  15.952  1.00 30.19  ? 57   ASN B CB    1 
ATOM   5355  C CG    . ASN B 1 57  ? -50.004 88.852  15.101  1.00 31.08  ? 57   ASN B CG    1 
ATOM   5356  O OD1   . ASN B 1 57  ? -51.059 88.401  15.558  1.00 32.94  ? 57   ASN B OD1   1 
ATOM   5357  N ND2   . ASN B 1 57  ? -49.900 89.297  13.850  1.00 29.95  ? 57   ASN B ND2   1 
ATOM   5358  N N     . THR B 1 58  ? -49.549 85.877  17.861  1.00 29.82  ? 58   THR B N     1 
ATOM   5359  C CA    . THR B 1 58  ? -49.605 84.421  17.776  1.00 29.64  ? 58   THR B CA    1 
ATOM   5360  C C     . THR B 1 58  ? -50.961 83.877  18.220  1.00 29.84  ? 58   THR B C     1 
ATOM   5361  O O     . THR B 1 58  ? -51.601 84.423  19.120  1.00 29.57  ? 58   THR B O     1 
ATOM   5362  C CB    . THR B 1 58  ? -48.517 83.752  18.663  1.00 29.39  ? 58   THR B CB    1 
ATOM   5363  O OG1   . THR B 1 58  ? -48.862 83.914  20.041  1.00 28.60  ? 58   THR B OG1   1 
ATOM   5364  C CG2   . THR B 1 58  ? -47.111 84.351  18.414  1.00 28.97  ? 58   THR B CG2   1 
ATOM   5365  N N     . SER B 1 59  ? -51.386 82.786  17.598  1.00 30.01  ? 59   SER B N     1 
ATOM   5366  C CA    . SER B 1 59  ? -52.545 82.072  18.088  1.00 30.34  ? 59   SER B CA    1 
ATOM   5367  C C     . SER B 1 59  ? -52.313 80.571  17.984  1.00 30.29  ? 59   SER B C     1 
ATOM   5368  O O     . SER B 1 59  ? -51.721 80.097  17.016  1.00 30.22  ? 59   SER B O     1 
ATOM   5369  C CB    . SER B 1 59  ? -53.797 82.502  17.326  1.00 30.42  ? 59   SER B CB    1 
ATOM   5370  O OG    . SER B 1 59  ? -54.920 81.751  17.738  1.00 31.10  ? 59   SER B OG    1 
ATOM   5371  N N     . PHE B 1 60  ? -52.760 79.841  19.002  1.00 30.43  ? 60   PHE B N     1 
ATOM   5372  C CA    . PHE B 1 60  ? -52.714 78.380  19.003  1.00 30.93  ? 60   PHE B CA    1 
ATOM   5373  C C     . PHE B 1 60  ? -54.099 77.829  18.649  1.00 31.53  ? 60   PHE B C     1 
ATOM   5374  O O     . PHE B 1 60  ? -54.299 76.611  18.604  1.00 31.03  ? 60   PHE B O     1 
ATOM   5375  C CB    . PHE B 1 60  ? -52.285 77.851  20.389  1.00 30.93  ? 60   PHE B CB    1 
ATOM   5376  C CG    . PHE B 1 60  ? -50.780 77.922  20.677  1.00 30.37  ? 60   PHE B CG    1 
ATOM   5377  C CD1   . PHE B 1 60  ? -50.268 77.348  21.853  1.00 29.67  ? 60   PHE B CD1   1 
ATOM   5378  C CD2   . PHE B 1 60  ? -49.883 78.533  19.785  1.00 29.40  ? 60   PHE B CD2   1 
ATOM   5379  C CE1   . PHE B 1 60  ? -48.892 77.393  22.142  1.00 29.10  ? 60   PHE B CE1   1 
ATOM   5380  C CE2   . PHE B 1 60  ? -48.500 78.588  20.062  1.00 28.11  ? 60   PHE B CE2   1 
ATOM   5381  C CZ    . PHE B 1 60  ? -48.009 78.018  21.238  1.00 29.66  ? 60   PHE B CZ    1 
ATOM   5382  N N     . ALA B 1 61  ? -55.051 78.737  18.409  1.00 32.45  ? 61   ALA B N     1 
ATOM   5383  C CA    . ALA B 1 61  ? -56.462 78.378  18.172  1.00 33.51  ? 61   ALA B CA    1 
ATOM   5384  C C     . ALA B 1 61  ? -56.643 77.280  17.114  1.00 33.74  ? 61   ALA B C     1 
ATOM   5385  O O     . ALA B 1 61  ? -55.958 77.283  16.097  1.00 33.87  ? 61   ALA B O     1 
ATOM   5386  C CB    . ALA B 1 61  ? -57.309 79.642  17.805  1.00 33.49  ? 61   ALA B CB    1 
ATOM   5387  N N     . PRO B 1 62  ? -57.540 76.316  17.378  1.00 34.32  ? 62   PRO B N     1 
ATOM   5388  C CA    . PRO B 1 62  ? -57.867 75.293  16.389  1.00 35.00  ? 62   PRO B CA    1 
ATOM   5389  C C     . PRO B 1 62  ? -58.444 75.920  15.118  1.00 35.84  ? 62   PRO B C     1 
ATOM   5390  O O     . PRO B 1 62  ? -59.406 76.717  15.182  1.00 36.00  ? 62   PRO B O     1 
ATOM   5391  C CB    . PRO B 1 62  ? -58.936 74.448  17.094  1.00 34.98  ? 62   PRO B CB    1 
ATOM   5392  C CG    . PRO B 1 62  ? -58.777 74.731  18.528  1.00 34.12  ? 62   PRO B CG    1 
ATOM   5393  C CD    . PRO B 1 62  ? -58.272 76.119  18.643  1.00 34.19  ? 62   PRO B CD    1 
ATOM   5394  N N     . GLY B 1 63  ? -57.840 75.565  13.988  1.00 36.24  ? 63   GLY B N     1 
ATOM   5395  C CA    . GLY B 1 63  ? -58.188 76.127  12.689  1.00 37.13  ? 63   GLY B CA    1 
ATOM   5396  C C     . GLY B 1 63  ? -57.371 77.359  12.338  1.00 38.03  ? 63   GLY B C     1 
ATOM   5397  O O     . GLY B 1 63  ? -57.222 77.697  11.158  1.00 38.17  ? 63   GLY B O     1 
ATOM   5398  N N     . ASN B 1 64  ? -56.851 78.042  13.361  1.00 38.35  ? 64   ASN B N     1 
ATOM   5399  C CA    . ASN B 1 64  ? -56.033 79.244  13.156  1.00 38.55  ? 64   ASN B CA    1 
ATOM   5400  C C     . ASN B 1 64  ? -54.766 79.237  14.009  1.00 37.72  ? 64   ASN B C     1 
ATOM   5401  O O     . ASN B 1 64  ? -54.589 80.081  14.904  1.00 37.79  ? 64   ASN B O     1 
ATOM   5402  C CB    . ASN B 1 64  ? -56.845 80.536  13.370  1.00 39.18  ? 64   ASN B CB    1 
ATOM   5403  C CG    . ASN B 1 64  ? -56.074 81.793  12.949  1.00 41.89  ? 64   ASN B CG    1 
ATOM   5404  O OD1   . ASN B 1 64  ? -55.858 82.711  13.759  1.00 44.50  ? 64   ASN B OD1   1 
ATOM   5405  N ND2   . ASN B 1 64  ? -55.631 81.826  11.682  1.00 43.69  ? 64   ASN B ND2   1 
ATOM   5406  N N     . VAL B 1 65  ? -53.897 78.267  13.726  1.00 36.35  ? 65   VAL B N     1 
ATOM   5407  C CA    . VAL B 1 65  ? -52.583 78.209  14.345  1.00 35.18  ? 65   VAL B CA    1 
ATOM   5408  C C     . VAL B 1 65  ? -51.635 79.074  13.513  1.00 34.69  ? 65   VAL B C     1 
ATOM   5409  O O     . VAL B 1 65  ? -51.374 78.788  12.348  1.00 34.35  ? 65   VAL B O     1 
ATOM   5410  C CB    . VAL B 1 65  ? -52.057 76.747  14.492  1.00 35.08  ? 65   VAL B CB    1 
ATOM   5411  C CG1   . VAL B 1 65  ? -50.564 76.733  14.810  1.00 34.12  ? 65   VAL B CG1   1 
ATOM   5412  C CG2   . VAL B 1 65  ? -52.833 76.006  15.577  1.00 33.80  ? 65   VAL B CG2   1 
ATOM   5413  N N     . SER B 1 66  ? -51.145 80.146  14.122  1.00 33.96  ? 66   SER B N     1 
ATOM   5414  C CA    . SER B 1 66  ? -50.333 81.130  13.413  1.00 33.30  ? 66   SER B CA    1 
ATOM   5415  C C     . SER B 1 66  ? -49.383 81.788  14.398  1.00 32.36  ? 66   SER B C     1 
ATOM   5416  O O     . SER B 1 66  ? -49.823 82.342  15.415  1.00 32.11  ? 66   SER B O     1 
ATOM   5417  C CB    . SER B 1 66  ? -51.222 82.185  12.734  1.00 33.43  ? 66   SER B CB    1 
ATOM   5418  O OG    . SER B 1 66  ? -50.449 83.072  11.946  1.00 33.61  ? 66   SER B OG    1 
ATOM   5419  N N     . ILE B 1 67  ? -48.088 81.693  14.098  1.00 31.14  ? 67   ILE B N     1 
ATOM   5420  C CA    . ILE B 1 67  ? -47.031 82.205  14.975  1.00 30.69  ? 67   ILE B CA    1 
ATOM   5421  C C     . ILE B 1 67  ? -46.183 83.284  14.270  1.00 30.15  ? 67   ILE B C     1 
ATOM   5422  O O     . ILE B 1 67  ? -45.533 83.032  13.254  1.00 29.90  ? 67   ILE B O     1 
ATOM   5423  C CB    . ILE B 1 67  ? -46.128 81.057  15.549  1.00 30.57  ? 67   ILE B CB    1 
ATOM   5424  C CG1   . ILE B 1 67  ? -46.976 79.988  16.250  1.00 30.66  ? 67   ILE B CG1   1 
ATOM   5425  C CG2   . ILE B 1 67  ? -45.077 81.626  16.521  1.00 30.81  ? 67   ILE B CG2   1 
ATOM   5426  C CD1   . ILE B 1 67  ? -46.492 78.562  16.019  1.00 30.23  ? 67   ILE B CD1   1 
ATOM   5427  N N     . LYS B 1 68  ? -46.220 84.493  14.819  1.00 29.59  ? 68   LYS B N     1 
ATOM   5428  C CA    . LYS B 1 68  ? -45.474 85.612  14.267  1.00 29.48  ? 68   LYS B CA    1 
ATOM   5429  C C     . LYS B 1 68  ? -44.859 86.437  15.375  1.00 28.36  ? 68   LYS B C     1 
ATOM   5430  O O     . LYS B 1 68  ? -45.520 86.771  16.357  1.00 28.41  ? 68   LYS B O     1 
ATOM   5431  C CB    . LYS B 1 68  ? -46.350 86.495  13.365  1.00 29.27  ? 68   LYS B CB    1 
ATOM   5432  C CG    . LYS B 1 68  ? -46.687 85.870  12.024  1.00 30.10  ? 68   LYS B CG    1 
ATOM   5433  C CD    . LYS B 1 68  ? -47.503 86.798  11.137  1.00 31.11  ? 68   LYS B CD    1 
ATOM   5434  C CE    . LYS B 1 68  ? -47.598 86.247  9.700   1.00 35.75  ? 68   LYS B CE    1 
ATOM   5435  N NZ    . LYS B 1 68  ? -48.730 86.856  8.897   1.00 37.29  ? 68   LYS B NZ    1 
ATOM   5436  N N     . TRP B 1 69  ? -43.583 86.752  15.204  1.00 27.34  ? 69   TRP B N     1 
ATOM   5437  C CA    . TRP B 1 69  ? -42.865 87.586  16.138  1.00 26.67  ? 69   TRP B CA    1 
ATOM   5438  C C     . TRP B 1 69  ? -42.079 88.620  15.360  1.00 26.99  ? 69   TRP B C     1 
ATOM   5439  O O     . TRP B 1 69  ? -41.536 88.300  14.300  1.00 26.87  ? 69   TRP B O     1 
ATOM   5440  C CB    . TRP B 1 69  ? -41.921 86.740  16.995  1.00 25.60  ? 69   TRP B CB    1 
ATOM   5441  C CG    . TRP B 1 69  ? -42.614 85.894  18.016  1.00 24.41  ? 69   TRP B CG    1 
ATOM   5442  C CD1   . TRP B 1 69  ? -43.137 84.651  17.834  1.00 22.99  ? 69   TRP B CD1   1 
ATOM   5443  C CD2   . TRP B 1 69  ? -42.838 86.229  19.389  1.00 24.03  ? 69   TRP B CD2   1 
ATOM   5444  N NE1   . TRP B 1 69  ? -43.688 84.186  19.006  1.00 22.96  ? 69   TRP B NE1   1 
ATOM   5445  C CE2   . TRP B 1 69  ? -43.510 85.132  19.981  1.00 24.34  ? 69   TRP B CE2   1 
ATOM   5446  C CE3   . TRP B 1 69  ? -42.527 87.344  20.182  1.00 22.72  ? 69   TRP B CE3   1 
ATOM   5447  C CZ2   . TRP B 1 69  ? -43.892 85.126  21.335  1.00 23.91  ? 69   TRP B CZ2   1 
ATOM   5448  C CZ3   . TRP B 1 69  ? -42.898 87.333  21.525  1.00 22.90  ? 69   TRP B CZ3   1 
ATOM   5449  C CH2   . TRP B 1 69  ? -43.574 86.231  22.085  1.00 23.30  ? 69   TRP B CH2   1 
ATOM   5450  N N     . TYR B 1 70  ? -42.029 89.851  15.894  1.00 27.68  ? 70   TYR B N     1 
ATOM   5451  C CA    . TYR B 1 70  ? -41.295 90.983  15.314  1.00 28.04  ? 70   TYR B CA    1 
ATOM   5452  C C     . TYR B 1 70  ? -41.580 91.159  13.822  1.00 28.78  ? 70   TYR B C     1 
ATOM   5453  O O     . TYR B 1 70  ? -40.713 91.633  13.059  1.00 28.96  ? 70   TYR B O     1 
ATOM   5454  C CB    . TYR B 1 70  ? -39.788 90.797  15.507  1.00 27.83  ? 70   TYR B CB    1 
ATOM   5455  C CG    . TYR B 1 70  ? -39.340 90.463  16.907  1.00 28.39  ? 70   TYR B CG    1 
ATOM   5456  C CD1   . TYR B 1 70  ? -38.743 89.223  17.198  1.00 28.18  ? 70   TYR B CD1   1 
ATOM   5457  C CD2   . TYR B 1 70  ? -39.479 91.395  17.952  1.00 27.98  ? 70   TYR B CD2   1 
ATOM   5458  C CE1   . TYR B 1 70  ? -38.312 88.917  18.512  1.00 27.80  ? 70   TYR B CE1   1 
ATOM   5459  C CE2   . TYR B 1 70  ? -39.057 91.097  19.251  1.00 26.40  ? 70   TYR B CE2   1 
ATOM   5460  C CZ    . TYR B 1 70  ? -38.483 89.862  19.525  1.00 27.07  ? 70   TYR B CZ    1 
ATOM   5461  O OH    . TYR B 1 70  ? -38.061 89.594  20.805  1.00 26.86  ? 70   TYR B OH    1 
ATOM   5462  N N     . GLU B 1 71  ? -42.793 90.791  13.409  1.00 29.38  ? 71   GLU B N     1 
ATOM   5463  C CA    . GLU B 1 71  ? -43.080 90.528  11.992  1.00 29.89  ? 71   GLU B CA    1 
ATOM   5464  C C     . GLU B 1 71  ? -42.731 91.674  11.058  1.00 30.20  ? 71   GLU B C     1 
ATOM   5465  O O     . GLU B 1 71  ? -42.303 91.437  9.923   1.00 30.68  ? 71   GLU B O     1 
ATOM   5466  C CB    . GLU B 1 71  ? -44.515 90.055  11.788  1.00 29.89  ? 71   GLU B CB    1 
ATOM   5467  C CG    . GLU B 1 71  ? -45.587 91.098  11.990  1.00 30.20  ? 71   GLU B CG    1 
ATOM   5468  C CD    . GLU B 1 71  ? -46.959 90.477  12.206  1.00 31.07  ? 71   GLU B CD    1 
ATOM   5469  O OE1   . GLU B 1 71  ? -47.168 89.912  13.302  1.00 32.26  ? 71   GLU B OE1   1 
ATOM   5470  O OE2   . GLU B 1 71  ? -47.823 90.567  11.300  1.00 29.62  ? 71   GLU B OE2   1 
ATOM   5471  N N     . ASP B 1 72  ? -42.872 92.903  11.554  1.00 30.48  ? 72   ASP B N     1 
ATOM   5472  C CA    . ASP B 1 72  ? -42.576 94.108  10.762  1.00 30.83  ? 72   ASP B CA    1 
ATOM   5473  C C     . ASP B 1 72  ? -41.123 94.601  10.853  1.00 30.22  ? 72   ASP B C     1 
ATOM   5474  O O     . ASP B 1 72  ? -40.767 95.615  10.260  1.00 30.01  ? 72   ASP B O     1 
ATOM   5475  C CB    . ASP B 1 72  ? -43.592 95.234  11.039  1.00 31.28  ? 72   ASP B CB    1 
ATOM   5476  C CG    . ASP B 1 72  ? -43.619 95.690  12.493  1.00 32.31  ? 72   ASP B CG    1 
ATOM   5477  O OD1   . ASP B 1 72  ? -42.975 95.074  13.368  1.00 34.30  ? 72   ASP B OD1   1 
ATOM   5478  O OD2   . ASP B 1 72  ? -44.312 96.690  12.758  1.00 34.37  ? 72   ASP B OD2   1 
ATOM   5479  N N     . GLY B 1 73  ? -40.286 93.872  11.583  1.00 29.77  ? 73   GLY B N     1 
ATOM   5480  C CA    . GLY B 1 73  ? -38.860 94.170  11.609  1.00 28.80  ? 73   GLY B CA    1 
ATOM   5481  C C     . GLY B 1 73  ? -38.102 93.482  10.494  1.00 28.31  ? 73   GLY B C     1 
ATOM   5482  O O     . GLY B 1 73  ? -38.560 92.483  9.940   1.00 27.68  ? 73   GLY B O     1 
ATOM   5483  N N     . THR B 1 74  ? -36.945 94.038  10.151  1.00 28.27  ? 74   THR B N     1 
ATOM   5484  C CA    . THR B 1 74  ? -36.023 93.383  9.222   1.00 28.49  ? 74   THR B CA    1 
ATOM   5485  C C     . THR B 1 74  ? -34.625 93.344  9.836   1.00 28.21  ? 74   THR B C     1 
ATOM   5486  O O     . THR B 1 74  ? -34.306 94.126  10.734  1.00 28.26  ? 74   THR B O     1 
ATOM   5487  C CB    . THR B 1 74  ? -36.012 94.028  7.791   1.00 28.82  ? 74   THR B CB    1 
ATOM   5488  O OG1   . THR B 1 74  ? -35.413 95.334  7.827   1.00 29.50  ? 74   THR B OG1   1 
ATOM   5489  C CG2   . THR B 1 74  ? -37.426 94.129  7.233   1.00 28.73  ? 74   THR B CG2   1 
ATOM   5490  N N     . LEU B 1 75  ? -33.807 92.411  9.366   1.00 27.76  ? 75   LEU B N     1 
ATOM   5491  C CA    . LEU B 1 75  ? -32.520 92.130  9.977   1.00 27.57  ? 75   LEU B CA    1 
ATOM   5492  C C     . LEU B 1 75  ? -31.808 91.142  9.097   1.00 27.77  ? 75   LEU B C     1 
ATOM   5493  O O     . LEU B 1 75  ? -32.431 90.528  8.220   1.00 28.09  ? 75   LEU B O     1 
ATOM   5494  C CB    . LEU B 1 75  ? -32.688 91.531  11.383  1.00 27.36  ? 75   LEU B CB    1 
ATOM   5495  C CG    . LEU B 1 75  ? -32.997 90.029  11.547  1.00 26.89  ? 75   LEU B CG    1 
ATOM   5496  C CD1   . LEU B 1 75  ? -32.955 89.662  13.030  1.00 25.58  ? 75   LEU B CD1   1 
ATOM   5497  C CD2   . LEU B 1 75  ? -34.337 89.608  10.914  1.00 25.55  ? 75   LEU B CD2   1 
ATOM   5498  N N     . ASN B 1 76  ? -30.505 90.988  9.316   1.00 27.64  ? 76   ASN B N     1 
ATOM   5499  C CA    . ASN B 1 76  ? -29.767 89.914  8.662   1.00 27.62  ? 76   ASN B CA    1 
ATOM   5500  C C     . ASN B 1 76  ? -29.044 89.103  9.732   1.00 27.28  ? 76   ASN B C     1 
ATOM   5501  O O     . ASN B 1 76  ? -28.274 89.663  10.528  1.00 27.80  ? 76   ASN B O     1 
ATOM   5502  C CB    . ASN B 1 76  ? -28.798 90.475  7.617   1.00 27.67  ? 76   ASN B CB    1 
ATOM   5503  C CG    . ASN B 1 76  ? -28.266 89.399  6.665   1.00 28.88  ? 76   ASN B CG    1 
ATOM   5504  O OD1   . ASN B 1 76  ? -28.811 89.195  5.554   1.00 30.53  ? 76   ASN B OD1   1 
ATOM   5505  N ND2   . ASN B 1 76  ? -27.201 88.701  7.092   1.00 25.90  ? 76   ASN B ND2   1 
ATOM   5506  N N     . LEU B 1 77  ? -29.305 87.796  9.766   1.00 26.75  ? 77   LEU B N     1 
ATOM   5507  C CA    . LEU B 1 77  ? -28.684 86.900  10.759  1.00 25.96  ? 77   LEU B CA    1 
ATOM   5508  C C     . LEU B 1 77  ? -27.160 86.951  10.672  1.00 25.42  ? 77   LEU B C     1 
ATOM   5509  O O     . LEU B 1 77  ? -26.485 87.148  11.692  1.00 25.35  ? 77   LEU B O     1 
ATOM   5510  C CB    . LEU B 1 77  ? -29.189 85.456  10.598  1.00 26.11  ? 77   LEU B CB    1 
ATOM   5511  C CG    . LEU B 1 77  ? -28.569 84.376  11.500  1.00 26.57  ? 77   LEU B CG    1 
ATOM   5512  C CD1   . LEU B 1 77  ? -29.549 83.266  11.815  1.00 25.59  ? 77   LEU B CD1   1 
ATOM   5513  C CD2   . LEU B 1 77  ? -27.274 83.805  10.917  1.00 25.89  ? 77   LEU B CD2   1 
ATOM   5514  N N     . ALA B 1 78  ? -26.628 86.793  9.458   1.00 24.44  ? 78   ALA B N     1 
ATOM   5515  C CA    . ALA B 1 78  ? -25.177 86.771  9.249   1.00 24.02  ? 78   ALA B CA    1 
ATOM   5516  C C     . ALA B 1 78  ? -24.495 88.090  9.625   1.00 23.83  ? 78   ALA B C     1 
ATOM   5517  O O     . ALA B 1 78  ? -23.337 88.092  10.036  1.00 24.02  ? 78   ALA B O     1 
ATOM   5518  C CB    . ALA B 1 78  ? -24.836 86.375  7.836   1.00 23.30  ? 78   ALA B CB    1 
ATOM   5519  N N     . ALA B 1 79  ? -25.213 89.206  9.497   1.00 23.73  ? 79   ALA B N     1 
ATOM   5520  C CA    . ALA B 1 79  ? -24.685 90.492  9.948   1.00 23.43  ? 79   ALA B CA    1 
ATOM   5521  C C     . ALA B 1 79  ? -24.589 90.487  11.462  1.00 23.11  ? 79   ALA B C     1 
ATOM   5522  O O     . ALA B 1 79  ? -23.637 91.022  12.031  1.00 23.05  ? 79   ALA B O     1 
ATOM   5523  C CB    . ALA B 1 79  ? -25.565 91.641  9.472   1.00 23.56  ? 79   ALA B CB    1 
ATOM   5524  N N     . ASN B 1 80  ? -25.584 89.862  12.097  1.00 22.65  ? 80   ASN B N     1 
ATOM   5525  C CA    . ASN B 1 80  ? -25.642 89.749  13.548  1.00 22.27  ? 80   ASN B CA    1 
ATOM   5526  C C     . ASN B 1 80  ? -24.605 88.796  14.129  1.00 22.02  ? 80   ASN B C     1 
ATOM   5527  O O     . ASN B 1 80  ? -24.128 89.017  15.232  1.00 22.16  ? 80   ASN B O     1 
ATOM   5528  C CB    . ASN B 1 80  ? -27.056 89.355  14.015  1.00 22.01  ? 80   ASN B CB    1 
ATOM   5529  C CG    . ASN B 1 80  ? -27.971 90.553  14.189  1.00 20.53  ? 80   ASN B CG    1 
ATOM   5530  O OD1   . ASN B 1 80  ? -27.835 91.303  15.141  1.00 21.06  ? 80   ASN B OD1   1 
ATOM   5531  N ND2   . ASN B 1 80  ? -28.913 90.727  13.277  1.00 17.94  ? 80   ASN B ND2   1 
ATOM   5532  N N     . CYS B 1 81  ? -24.275 87.740  13.389  1.00 22.24  ? 81   CYS B N     1 
ATOM   5533  C CA    . CYS B 1 81  ? -23.313 86.725  13.833  1.00 22.34  ? 81   CYS B CA    1 
ATOM   5534  C C     . CYS B 1 81  ? -21.873 87.050  13.416  1.00 22.99  ? 81   CYS B C     1 
ATOM   5535  O O     . CYS B 1 81  ? -20.919 86.389  13.879  1.00 22.67  ? 81   CYS B O     1 
ATOM   5536  C CB    . CYS B 1 81  ? -23.704 85.336  13.315  1.00 22.37  ? 81   CYS B CB    1 
ATOM   5537  S SG    . CYS B 1 81  ? -25.274 84.687  13.995  1.00 20.89  ? 81   CYS B SG    1 
ATOM   5538  N N     . LEU B 1 82  ? -21.714 88.069  12.563  1.00 23.06  ? 82   LEU B N     1 
ATOM   5539  C CA    . LEU B 1 82  ? -20.408 88.383  11.991  1.00 23.46  ? 82   LEU B CA    1 
ATOM   5540  C C     . LEU B 1 82  ? -20.071 89.867  11.916  1.00 24.16  ? 82   LEU B C     1 
ATOM   5541  O O     . LEU B 1 82  ? -19.200 90.326  12.632  1.00 24.69  ? 82   LEU B O     1 
ATOM   5542  C CB    . LEU B 1 82  ? -20.270 87.752  10.604  1.00 23.53  ? 82   LEU B CB    1 
ATOM   5543  C CG    . LEU B 1 82  ? -20.462 86.240  10.444  1.00 22.90  ? 82   LEU B CG    1 
ATOM   5544  C CD1   . LEU B 1 82  ? -20.637 85.913  8.986   1.00 21.74  ? 82   LEU B CD1   1 
ATOM   5545  C CD2   . LEU B 1 82  ? -19.304 85.461  11.054  1.00 22.56  ? 82   LEU B CD2   1 
ATOM   5546  N N     . ASP B 1 83  ? -20.763 90.607  11.044  1.00 25.11  ? 83   ASP B N     1 
ATOM   5547  C CA    . ASP B 1 83  ? -20.393 91.978  10.693  1.00 25.32  ? 83   ASP B CA    1 
ATOM   5548  C C     . ASP B 1 83  ? -20.355 92.891  11.898  1.00 25.64  ? 83   ASP B C     1 
ATOM   5549  O O     . ASP B 1 83  ? -19.427 93.692  12.045  1.00 25.88  ? 83   ASP B O     1 
ATOM   5550  C CB    . ASP B 1 83  ? -21.375 92.547  9.660   1.00 25.67  ? 83   ASP B CB    1 
ATOM   5551  C CG    . ASP B 1 83  ? -21.521 91.657  8.451   1.00 26.91  ? 83   ASP B CG    1 
ATOM   5552  O OD1   . ASP B 1 83  ? -21.377 92.180  7.339   1.00 28.86  ? 83   ASP B OD1   1 
ATOM   5553  O OD2   . ASP B 1 83  ? -21.748 90.433  8.613   1.00 28.27  ? 83   ASP B OD2   1 
ATOM   5554  N N     . ARG B 1 84  ? -21.358 92.758  12.762  1.00 25.21  ? 84   ARG B N     1 
ATOM   5555  C CA    . ARG B 1 84  ? -21.490 93.656  13.884  1.00 25.30  ? 84   ARG B CA    1 
ATOM   5556  C C     . ARG B 1 84  ? -20.394 93.473  14.954  1.00 25.44  ? 84   ARG B C     1 
ATOM   5557  O O     . ARG B 1 84  ? -20.297 94.268  15.895  1.00 25.39  ? 84   ARG B O     1 
ATOM   5558  C CB    . ARG B 1 84  ? -22.904 93.577  14.477  1.00 24.87  ? 84   ARG B CB    1 
ATOM   5559  C CG    . ARG B 1 84  ? -23.221 92.340  15.288  1.00 24.89  ? 84   ARG B CG    1 
ATOM   5560  C CD    . ARG B 1 84  ? -24.536 92.560  16.028  1.00 23.39  ? 84   ARG B CD    1 
ATOM   5561  N NE    . ARG B 1 84  ? -24.897 91.410  16.841  1.00 23.65  ? 84   ARG B NE    1 
ATOM   5562  C CZ    . ARG B 1 84  ? -25.883 91.383  17.743  1.00 24.71  ? 84   ARG B CZ    1 
ATOM   5563  N NH1   . ARG B 1 84  ? -26.633 92.464  17.982  1.00 23.64  ? 84   ARG B NH1   1 
ATOM   5564  N NH2   . ARG B 1 84  ? -26.115 90.263  18.418  1.00 22.18  ? 84   ARG B NH2   1 
ATOM   5565  N N     . HIS B 1 85  ? -19.579 92.431  14.798  1.00 25.10  ? 85   HIS B N     1 
ATOM   5566  C CA    . HIS B 1 85  ? -18.522 92.128  15.768  1.00 24.98  ? 85   HIS B CA    1 
ATOM   5567  C C     . HIS B 1 85  ? -17.178 92.597  15.264  1.00 25.07  ? 85   HIS B C     1 
ATOM   5568  O O     . HIS B 1 85  ? -16.217 92.618  16.017  1.00 25.22  ? 85   HIS B O     1 
ATOM   5569  C CB    . HIS B 1 85  ? -18.454 90.616  16.100  1.00 24.45  ? 85   HIS B CB    1 
ATOM   5570  C CG    . HIS B 1 85  ? -19.726 90.069  16.658  1.00 23.09  ? 85   HIS B CG    1 
ATOM   5571  N ND1   . HIS B 1 85  ? -20.324 90.586  17.786  1.00 22.27  ? 85   HIS B ND1   1 
ATOM   5572  C CD2   . HIS B 1 85  ? -20.533 89.069  16.229  1.00 22.21  ? 85   HIS B CD2   1 
ATOM   5573  C CE1   . HIS B 1 85  ? -21.450 89.936  18.023  1.00 22.46  ? 85   HIS B CE1   1 
ATOM   5574  N NE2   . HIS B 1 85  ? -21.597 89.004  17.097  1.00 22.64  ? 85   HIS B NE2   1 
ATOM   5575  N N     . LEU B 1 86  ? -17.120 92.983  13.994  1.00 25.45  ? 86   LEU B N     1 
ATOM   5576  C CA    . LEU B 1 86  ? -15.845 93.238  13.336  1.00 26.00  ? 86   LEU B CA    1 
ATOM   5577  C C     . LEU B 1 86  ? -15.025 94.387  13.953  1.00 26.29  ? 86   LEU B C     1 
ATOM   5578  O O     . LEU B 1 86  ? -13.828 94.210  14.192  1.00 26.47  ? 86   LEU B O     1 
ATOM   5579  C CB    . LEU B 1 86  ? -16.031 93.443  11.823  1.00 25.76  ? 86   LEU B CB    1 
ATOM   5580  C CG    . LEU B 1 86  ? -16.491 92.285  10.928  1.00 26.13  ? 86   LEU B CG    1 
ATOM   5581  C CD1   . LEU B 1 86  ? -16.468 92.716  9.469   1.00 25.57  ? 86   LEU B CD1   1 
ATOM   5582  C CD2   . LEU B 1 86  ? -15.691 90.997  11.101  1.00 23.22  ? 86   LEU B CD2   1 
ATOM   5583  N N     . GLN B 1 87  ? -15.652 95.547  14.193  1.00 26.41  ? 87   GLN B N     1 
ATOM   5584  C CA    . GLN B 1 87  ? -14.931 96.740  14.690  1.00 26.61  ? 87   GLN B CA    1 
ATOM   5585  C C     . GLN B 1 87  ? -14.212 96.459  15.999  1.00 26.76  ? 87   GLN B C     1 
ATOM   5586  O O     . GLN B 1 87  ? -13.007 96.675  16.123  1.00 26.04  ? 87   GLN B O     1 
ATOM   5587  C CB    . GLN B 1 87  ? -15.872 97.940  14.915  1.00 26.54  ? 87   GLN B CB    1 
ATOM   5588  C CG    . GLN B 1 87  ? -15.711 99.089  13.924  1.00 26.92  ? 87   GLN B CG    1 
ATOM   5589  C CD    . GLN B 1 87  ? -14.270 99.535  13.709  1.00 26.53  ? 87   GLN B CD    1 
ATOM   5590  O OE1   . GLN B 1 87  ? -13.850 99.731  12.579  1.00 26.32  ? 87   GLN B OE1   1 
ATOM   5591  N NE2   . GLN B 1 87  ? -13.517 99.700  14.787  1.00 27.31  ? 87   GLN B NE2   1 
ATOM   5592  N N     . GLU B 1 88  ? -14.996 95.991  16.966  1.00 27.02  ? 88   GLU B N     1 
ATOM   5593  C CA    . GLU B 1 88  ? -14.520 95.666  18.286  1.00 27.63  ? 88   GLU B CA    1 
ATOM   5594  C C     . GLU B 1 88  ? -13.769 94.326  18.319  1.00 27.64  ? 88   GLU B C     1 
ATOM   5595  O O     . GLU B 1 88  ? -12.711 94.242  18.938  1.00 27.82  ? 88   GLU B O     1 
ATOM   5596  C CB    . GLU B 1 88  ? -15.698 95.636  19.278  1.00 27.57  ? 88   GLU B CB    1 
ATOM   5597  C CG    . GLU B 1 88  ? -15.267 95.862  20.737  1.00 28.49  ? 88   GLU B CG    1 
ATOM   5598  C CD    . GLU B 1 88  ? -16.267 95.352  21.779  1.00 27.59  ? 88   GLU B CD    1 
ATOM   5599  O OE1   . GLU B 1 88  ? -15.792 94.764  22.784  1.00 26.51  ? 88   GLU B OE1   1 
ATOM   5600  O OE2   . GLU B 1 88  ? -17.500 95.540  21.596  1.00 26.26  ? 88   GLU B OE2   1 
ATOM   5601  N N     . ASN B 1 89  ? -14.311 93.293  17.665  1.00 27.23  ? 89   ASN B N     1 
ATOM   5602  C CA    . ASN B 1 89  ? -13.840 91.923  17.886  1.00 27.38  ? 89   ASN B CA    1 
ATOM   5603  C C     . ASN B 1 89  ? -13.560 91.128  16.612  1.00 27.63  ? 89   ASN B C     1 
ATOM   5604  O O     . ASN B 1 89  ? -13.735 89.898  16.572  1.00 27.41  ? 89   ASN B O     1 
ATOM   5605  C CB    . ASN B 1 89  ? -14.831 91.150  18.770  1.00 27.29  ? 89   ASN B CB    1 
ATOM   5606  C CG    . ASN B 1 89  ? -14.968 91.741  20.163  1.00 27.76  ? 89   ASN B CG    1 
ATOM   5607  O OD1   . ASN B 1 89  ? -16.085 91.982  20.632  1.00 30.50  ? 89   ASN B OD1   1 
ATOM   5608  N ND2   . ASN B 1 89  ? -13.843 91.976  20.832  1.00 25.01  ? 89   ASN B ND2   1 
ATOM   5609  N N     . GLY B 1 90  ? -13.125 91.835  15.577  1.00 27.59  ? 90   GLY B N     1 
ATOM   5610  C CA    . GLY B 1 90  ? -12.730 91.200  14.336  1.00 27.80  ? 90   GLY B CA    1 
ATOM   5611  C C     . GLY B 1 90  ? -11.599 90.209  14.525  1.00 27.98  ? 90   GLY B C     1 
ATOM   5612  O O     . GLY B 1 90  ? -11.551 89.198  13.833  1.00 28.15  ? 90   GLY B O     1 
ATOM   5613  N N     . ASP B 1 91  ? -10.699 90.486  15.467  1.00 28.02  ? 91   ASP B N     1 
ATOM   5614  C CA    . ASP B 1 91  ? -9.545  89.602  15.723  1.00 28.38  ? 91   ASP B CA    1 
ATOM   5615  C C     . ASP B 1 91  ? -9.794  88.494  16.745  1.00 27.96  ? 91   ASP B C     1 
ATOM   5616  O O     . ASP B 1 91  ? -8.972  87.588  16.865  1.00 27.90  ? 91   ASP B O     1 
ATOM   5617  C CB    . ASP B 1 91  ? -8.314  90.407  16.156  1.00 28.56  ? 91   ASP B CB    1 
ATOM   5618  C CG    . ASP B 1 91  ? -7.717  91.228  15.021  1.00 30.83  ? 91   ASP B CG    1 
ATOM   5619  O OD1   . ASP B 1 91  ? -7.777  90.783  13.837  1.00 30.65  ? 91   ASP B OD1   1 
ATOM   5620  O OD2   . ASP B 1 91  ? -7.189  92.325  15.335  1.00 31.88  ? 91   ASP B OD2   1 
ATOM   5621  N N     . ARG B 1 92  ? -10.895 88.590  17.497  1.00 27.70  ? 92   ARG B N     1 
ATOM   5622  C CA    . ARG B 1 92  ? -11.302 87.530  18.427  1.00 27.74  ? 92   ARG B CA    1 
ATOM   5623  C C     . ARG B 1 92  ? -11.573 86.275  17.612  1.00 26.83  ? 92   ARG B C     1 
ATOM   5624  O O     . ARG B 1 92  ? -12.059 86.364  16.483  1.00 27.10  ? 92   ARG B O     1 
ATOM   5625  C CB    . ARG B 1 92  ? -12.563 87.929  19.225  1.00 27.82  ? 92   ARG B CB    1 
ATOM   5626  C CG    . ARG B 1 92  ? -13.055 86.861  20.225  1.00 28.44  ? 92   ARG B CG    1 
ATOM   5627  C CD    . ARG B 1 92  ? -14.337 87.244  20.964  1.00 28.80  ? 92   ARG B CD    1 
ATOM   5628  N NE    . ARG B 1 92  ? -14.145 88.356  21.901  1.00 31.89  ? 92   ARG B NE    1 
ATOM   5629  C CZ    . ARG B 1 92  ? -15.135 89.067  22.453  1.00 34.62  ? 92   ARG B CZ    1 
ATOM   5630  N NH1   . ARG B 1 92  ? -16.415 88.800  22.173  1.00 35.13  ? 92   ARG B NH1   1 
ATOM   5631  N NH2   . ARG B 1 92  ? -14.851 90.063  23.289  1.00 34.44  ? 92   ARG B NH2   1 
ATOM   5632  N N     . THR B 1 93  ? -11.242 85.118  18.178  1.00 26.42  ? 93   THR B N     1 
ATOM   5633  C CA    . THR B 1 93  ? -11.567 83.836  17.562  1.00 25.54  ? 93   THR B CA    1 
ATOM   5634  C C     . THR B 1 93  ? -13.078 83.632  17.586  1.00 25.02  ? 93   THR B C     1 
ATOM   5635  O O     . THR B 1 93  ? -13.707 83.751  18.634  1.00 24.80  ? 93   THR B O     1 
ATOM   5636  C CB    . THR B 1 93  ? -10.855 82.667  18.281  1.00 26.23  ? 93   THR B CB    1 
ATOM   5637  O OG1   . THR B 1 93  ? -9.476  83.005  18.500  1.00 26.30  ? 93   THR B OG1   1 
ATOM   5638  C CG2   . THR B 1 93  ? -10.955 81.358  17.469  1.00 24.29  ? 93   THR B CG2   1 
ATOM   5639  N N     . ALA B 1 94  ? -13.648 83.369  16.416  1.00 24.43  ? 94   ALA B N     1 
ATOM   5640  C CA    . ALA B 1 94  ? -15.065 83.042  16.291  1.00 24.50  ? 94   ALA B CA    1 
ATOM   5641  C C     . ALA B 1 94  ? -15.275 81.549  16.495  1.00 24.08  ? 94   ALA B C     1 
ATOM   5642  O O     . ALA B 1 94  ? -16.120 81.132  17.295  1.00 24.17  ? 94   ALA B O     1 
ATOM   5643  C CB    . ALA B 1 94  ? -15.605 83.476  14.930  1.00 24.48  ? 94   ALA B CB    1 
ATOM   5644  N N     . ILE B 1 95  ? -14.498 80.755  15.759  1.00 23.82  ? 95   ILE B N     1 
ATOM   5645  C CA    . ILE B 1 95  ? -14.527 79.280  15.860  1.00 23.04  ? 95   ILE B CA    1 
ATOM   5646  C C     . ILE B 1 95  ? -13.137 78.689  16.143  1.00 22.66  ? 95   ILE B C     1 
ATOM   5647  O O     . ILE B 1 95  ? -12.167 78.974  15.441  1.00 22.53  ? 95   ILE B O     1 
ATOM   5648  C CB    . ILE B 1 95  ? -15.102 78.616  14.568  1.00 23.14  ? 95   ILE B CB    1 
ATOM   5649  C CG1   . ILE B 1 95  ? -16.511 79.157  14.248  1.00 22.64  ? 95   ILE B CG1   1 
ATOM   5650  C CG2   . ILE B 1 95  ? -15.073 77.074  14.681  1.00 22.26  ? 95   ILE B CG2   1 
ATOM   5651  C CD1   . ILE B 1 95  ? -17.165 78.566  12.975  1.00 22.62  ? 95   ILE B CD1   1 
ATOM   5652  N N     . ILE B 1 96  ? -13.045 77.876  17.187  1.00 22.25  ? 96   ILE B N     1 
ATOM   5653  C CA    . ILE B 1 96  ? -11.888 77.022  17.371  1.00 21.50  ? 96   ILE B CA    1 
ATOM   5654  C C     . ILE B 1 96  ? -12.278 75.678  16.794  1.00 21.30  ? 96   ILE B C     1 
ATOM   5655  O O     . ILE B 1 96  ? -13.258 75.092  17.214  1.00 22.19  ? 96   ILE B O     1 
ATOM   5656  C CB    . ILE B 1 96  ? -11.516 76.849  18.853  1.00 21.17  ? 96   ILE B CB    1 
ATOM   5657  C CG1   . ILE B 1 96  ? -11.217 78.210  19.483  1.00 21.33  ? 96   ILE B CG1   1 
ATOM   5658  C CG2   . ILE B 1 96  ? -10.324 75.901  18.999  1.00 19.75  ? 96   ILE B CG2   1 
ATOM   5659  C CD1   . ILE B 1 96  ? -10.643 78.146  20.892  1.00 21.69  ? 96   ILE B CD1   1 
ATOM   5660  N N     . TRP B 1 97  ? -11.514 75.194  15.827  1.00 21.15  ? 97   TRP B N     1 
ATOM   5661  C CA    . TRP B 1 97  ? -11.774 73.888  15.237  1.00 20.46  ? 97   TRP B CA    1 
ATOM   5662  C C     . TRP B 1 97  ? -10.731 72.888  15.722  1.00 20.07  ? 97   TRP B C     1 
ATOM   5663  O O     . TRP B 1 97  ? -9.547  73.089  15.528  1.00 19.90  ? 97   TRP B O     1 
ATOM   5664  C CB    . TRP B 1 97  ? -11.770 73.962  13.711  1.00 19.95  ? 97   TRP B CB    1 
ATOM   5665  C CG    . TRP B 1 97  ? -12.018 72.621  13.062  1.00 20.37  ? 97   TRP B CG    1 
ATOM   5666  C CD1   . TRP B 1 97  ? -13.207 71.946  13.009  1.00 18.84  ? 97   TRP B CD1   1 
ATOM   5667  C CD2   . TRP B 1 97  ? -11.049 71.785  12.391  1.00 20.23  ? 97   TRP B CD2   1 
ATOM   5668  N NE1   . TRP B 1 97  ? -13.041 70.751  12.351  1.00 19.49  ? 97   TRP B NE1   1 
ATOM   5669  C CE2   . TRP B 1 97  ? -11.730 70.626  11.956  1.00 20.08  ? 97   TRP B CE2   1 
ATOM   5670  C CE3   . TRP B 1 97  ? -9.671  71.905  12.121  1.00 21.48  ? 97   TRP B CE3   1 
ATOM   5671  C CZ2   . TRP B 1 97  ? -11.082 69.580  11.252  1.00 19.04  ? 97   TRP B CZ2   1 
ATOM   5672  C CZ3   . TRP B 1 97  ? -9.019  70.855  11.416  1.00 19.06  ? 97   TRP B CZ3   1 
ATOM   5673  C CH2   . TRP B 1 97  ? -9.734  69.715  10.998  1.00 18.83  ? 97   TRP B CH2   1 
ATOM   5674  N N     . GLU B 1 98  ? -11.198 71.828  16.376  1.00 20.04  ? 98   GLU B N     1 
ATOM   5675  C CA    . GLU B 1 98  ? -10.347 70.783  16.916  1.00 19.38  ? 98   GLU B CA    1 
ATOM   5676  C C     . GLU B 1 98  ? -10.568 69.537  16.057  1.00 19.68  ? 98   GLU B C     1 
ATOM   5677  O O     . GLU B 1 98  ? -11.695 69.024  15.938  1.00 19.35  ? 98   GLU B O     1 
ATOM   5678  C CB    . GLU B 1 98  ? -10.678 70.545  18.403  1.00 19.43  ? 98   GLU B CB    1 
ATOM   5679  C CG    . GLU B 1 98  ? -9.989  69.338  19.119  1.00 18.14  ? 98   GLU B CG    1 
ATOM   5680  C CD    . GLU B 1 98  ? -8.472  69.413  19.216  1.00 17.72  ? 98   GLU B CD    1 
ATOM   5681  O OE1   . GLU B 1 98  ? -7.887  70.504  19.032  1.00 18.73  ? 98   GLU B OE1   1 
ATOM   5682  O OE2   . GLU B 1 98  ? -7.847  68.365  19.513  1.00 18.49  ? 98   GLU B OE2   1 
ATOM   5683  N N     . GLY B 1 99  ? -9.488  69.094  15.420  1.00 19.71  ? 99   GLY B N     1 
ATOM   5684  C CA    . GLY B 1 99  ? -9.520  67.930  14.557  1.00 20.20  ? 99   GLY B CA    1 
ATOM   5685  C C     . GLY B 1 99  ? -9.596  66.623  15.327  1.00 20.50  ? 99   GLY B C     1 
ATOM   5686  O O     . GLY B 1 99  ? -9.252  66.567  16.522  1.00 20.75  ? 99   GLY B O     1 
ATOM   5687  N N     . ASP B 1 100 ? -10.057 65.578  14.626  1.00 20.72  ? 100  ASP B N     1 
ATOM   5688  C CA    . ASP B 1 100 ? -10.180 64.226  15.141  1.00 20.59  ? 100  ASP B CA    1 
ATOM   5689  C C     . ASP B 1 100 ? -8.776  63.782  15.531  1.00 21.04  ? 100  ASP B C     1 
ATOM   5690  O O     . ASP B 1 100 ? -8.560  63.158  16.570  1.00 21.32  ? 100  ASP B O     1 
ATOM   5691  C CB    . ASP B 1 100 ? -10.786 63.343  14.052  1.00 20.33  ? 100  ASP B CB    1 
ATOM   5692  C CG    . ASP B 1 100 ? -11.028 61.897  14.507  1.00 21.23  ? 100  ASP B CG    1 
ATOM   5693  O OD1   . ASP B 1 100 ? -11.868 61.665  15.416  1.00 22.58  ? 100  ASP B OD1   1 
ATOM   5694  O OD2   . ASP B 1 100 ? -10.388 60.981  13.930  1.00 20.51  ? 100  ASP B OD2   1 
ATOM   5695  N N     . ASP B 1 101 ? -7.824  64.130  14.674  1.00 21.86  ? 101  ASP B N     1 
ATOM   5696  C CA    . ASP B 1 101 ? -6.395  64.084  14.959  1.00 22.15  ? 101  ASP B CA    1 
ATOM   5697  C C     . ASP B 1 101 ? -6.051  65.408  15.624  1.00 22.42  ? 101  ASP B C     1 
ATOM   5698  O O     . ASP B 1 101 ? -6.183  66.478  15.009  1.00 22.04  ? 101  ASP B O     1 
ATOM   5699  C CB    . ASP B 1 101 ? -5.637  63.964  13.640  1.00 22.37  ? 101  ASP B CB    1 
ATOM   5700  C CG    . ASP B 1 101 ? -4.122  63.922  13.810  1.00 24.45  ? 101  ASP B CG    1 
ATOM   5701  O OD1   . ASP B 1 101 ? -3.563  64.187  14.916  1.00 25.47  ? 101  ASP B OD1   1 
ATOM   5702  O OD2   . ASP B 1 101 ? -3.487  63.626  12.788  1.00 25.33  ? 101  ASP B OD2   1 
ATOM   5703  N N     . THR B 1 102 ? -5.616  65.342  16.882  1.00 22.90  ? 102  THR B N     1 
ATOM   5704  C CA    . THR B 1 102 ? -5.363  66.557  17.670  1.00 23.12  ? 102  THR B CA    1 
ATOM   5705  C C     . THR B 1 102 ? -4.304  67.532  17.090  1.00 24.07  ? 102  THR B C     1 
ATOM   5706  O O     . THR B 1 102 ? -4.332  68.738  17.399  1.00 24.17  ? 102  THR B O     1 
ATOM   5707  C CB    . THR B 1 102 ? -5.099  66.228  19.156  1.00 22.85  ? 102  THR B CB    1 
ATOM   5708  O OG1   . THR B 1 102 ? -5.247  67.422  19.932  1.00 22.55  ? 102  THR B OG1   1 
ATOM   5709  C CG2   . THR B 1 102 ? -3.723  65.606  19.371  1.00 21.58  ? 102  THR B CG2   1 
ATOM   5710  N N     . SER B 1 103 ? -3.421  67.024  16.224  1.00 24.75  ? 103  SER B N     1 
ATOM   5711  C CA    . SER B 1 103 ? -2.368  67.842  15.598  1.00 25.83  ? 103  SER B CA    1 
ATOM   5712  C C     . SER B 1 103 ? -2.919  68.750  14.487  1.00 26.63  ? 103  SER B C     1 
ATOM   5713  O O     . SER B 1 103 ? -2.204  69.609  13.979  1.00 27.02  ? 103  SER B O     1 
ATOM   5714  C CB    . SER B 1 103 ? -1.239  66.960  15.048  1.00 25.73  ? 103  SER B CB    1 
ATOM   5715  O OG    . SER B 1 103 ? -1.713  66.164  13.974  1.00 25.74  ? 103  SER B OG    1 
ATOM   5716  N N     . GLN B 1 104 ? -4.186  68.551  14.126  1.00 26.96  ? 104  GLN B N     1 
ATOM   5717  C CA    . GLN B 1 104 ? -4.892  69.422  13.199  1.00 27.62  ? 104  GLN B CA    1 
ATOM   5718  C C     . GLN B 1 104 ? -5.898  70.318  13.951  1.00 28.29  ? 104  GLN B C     1 
ATOM   5719  O O     . GLN B 1 104 ? -6.877  69.824  14.523  1.00 28.82  ? 104  GLN B O     1 
ATOM   5720  C CB    . GLN B 1 104 ? -5.658  68.590  12.167  1.00 27.20  ? 104  GLN B CB    1 
ATOM   5721  C CG    . GLN B 1 104 ? -4.852  67.584  11.379  1.00 26.85  ? 104  GLN B CG    1 
ATOM   5722  C CD    . GLN B 1 104 ? -5.610  67.066  10.152  1.00 28.25  ? 104  GLN B CD    1 
ATOM   5723  O OE1   . GLN B 1 104 ? -6.823  66.841  10.192  1.00 28.71  ? 104  GLN B OE1   1 
ATOM   5724  N NE2   . GLN B 1 104 ? -4.895  66.897  9.046   1.00 28.94  ? 104  GLN B NE2   1 
ATOM   5725  N N     . SER B 1 105 ? -5.665  71.628  13.959  1.00 28.52  ? 105  SER B N     1 
ATOM   5726  C CA    . SER B 1 105 ? -6.615  72.562  14.571  1.00 28.62  ? 105  SER B CA    1 
ATOM   5727  C C     . SER B 1 105 ? -6.446  73.971  13.991  1.00 28.59  ? 105  SER B C     1 
ATOM   5728  O O     . SER B 1 105 ? -5.377  74.302  13.481  1.00 28.74  ? 105  SER B O     1 
ATOM   5729  C CB    . SER B 1 105 ? -6.479  72.576  16.106  1.00 28.70  ? 105  SER B CB    1 
ATOM   5730  O OG    . SER B 1 105 ? -5.431  73.429  16.539  1.00 29.83  ? 105  SER B OG    1 
ATOM   5731  N N     . LYS B 1 106 ? -7.511  74.772  14.058  1.00 28.12  ? 106  LYS B N     1 
ATOM   5732  C CA    . LYS B 1 106 ? -7.534  76.140  13.539  1.00 27.99  ? 106  LYS B CA    1 
ATOM   5733  C C     . LYS B 1 106 ? -8.246  77.065  14.506  1.00 27.62  ? 106  LYS B C     1 
ATOM   5734  O O     . LYS B 1 106 ? -9.178  76.659  15.219  1.00 27.73  ? 106  LYS B O     1 
ATOM   5735  C CB    . LYS B 1 106 ? -8.311  76.236  12.217  1.00 28.16  ? 106  LYS B CB    1 
ATOM   5736  C CG    . LYS B 1 106 ? -7.712  75.563  11.020  1.00 29.81  ? 106  LYS B CG    1 
ATOM   5737  C CD    . LYS B 1 106 ? -8.588  75.845  9.827   1.00 32.35  ? 106  LYS B CD    1 
ATOM   5738  C CE    . LYS B 1 106 ? -8.060  75.212  8.552   1.00 34.16  ? 106  LYS B CE    1 
ATOM   5739  N NZ    . LYS B 1 106 ? -9.145  75.234  7.532   1.00 35.51  ? 106  LYS B NZ    1 
ATOM   5740  N N     . HIS B 1 107 ? -7.810  78.317  14.501  1.00 27.25  ? 107  HIS B N     1 
ATOM   5741  C CA    . HIS B 1 107 ? -8.555  79.407  15.098  1.00 27.05  ? 107  HIS B CA    1 
ATOM   5742  C C     . HIS B 1 107 ? -9.006  80.292  13.948  1.00 26.62  ? 107  HIS B C     1 
ATOM   5743  O O     . HIS B 1 107 ? -8.177  80.801  13.206  1.00 25.94  ? 107  HIS B O     1 
ATOM   5744  C CB    . HIS B 1 107 ? -7.663  80.190  16.040  1.00 27.29  ? 107  HIS B CB    1 
ATOM   5745  C CG    . HIS B 1 107 ? -7.450  79.521  17.356  1.00 28.69  ? 107  HIS B CG    1 
ATOM   5746  N ND1   . HIS B 1 107 ? -6.882  78.270  17.470  1.00 30.57  ? 107  HIS B ND1   1 
ATOM   5747  C CD2   . HIS B 1 107 ? -7.708  79.937  18.620  1.00 29.98  ? 107  HIS B CD2   1 
ATOM   5748  C CE1   . HIS B 1 107 ? -6.804  77.942  18.747  1.00 31.33  ? 107  HIS B CE1   1 
ATOM   5749  N NE2   . HIS B 1 107 ? -7.306  78.932  19.464  1.00 30.87  ? 107  HIS B NE2   1 
ATOM   5750  N N     . ILE B 1 108 ? -10.320 80.417  13.772  1.00 25.96  ? 108  ILE B N     1 
ATOM   5751  C CA    . ILE B 1 108 ? -10.870 81.294  12.753  1.00 25.38  ? 108  ILE B CA    1 
ATOM   5752  C C     . ILE B 1 108 ? -11.451 82.530  13.448  1.00 24.70  ? 108  ILE B C     1 
ATOM   5753  O O     . ILE B 1 108 ? -12.383 82.421  14.257  1.00 24.36  ? 108  ILE B O     1 
ATOM   5754  C CB    . ILE B 1 108 ? -11.954 80.596  11.885  1.00 25.40  ? 108  ILE B CB    1 
ATOM   5755  C CG1   . ILE B 1 108 ? -11.406 79.334  11.214  1.00 25.64  ? 108  ILE B CG1   1 
ATOM   5756  C CG2   . ILE B 1 108 ? -12.477 81.542  10.820  1.00 24.13  ? 108  ILE B CG2   1 
ATOM   5757  C CD1   . ILE B 1 108 ? -11.888 78.059  11.849  1.00 27.17  ? 108  ILE B CD1   1 
ATOM   5758  N N     . SER B 1 109 ? -10.882 83.691  13.138  1.00 23.59  ? 109  SER B N     1 
ATOM   5759  C CA    . SER B 1 109 ? -11.314 84.947  13.755  1.00 23.05  ? 109  SER B CA    1 
ATOM   5760  C C     . SER B 1 109 ? -12.658 85.367  13.156  1.00 22.54  ? 109  SER B C     1 
ATOM   5761  O O     . SER B 1 109 ? -13.060 84.834  12.114  1.00 22.37  ? 109  SER B O     1 
ATOM   5762  C CB    . SER B 1 109 ? -10.245 86.052  13.577  1.00 22.64  ? 109  SER B CB    1 
ATOM   5763  O OG    . SER B 1 109 ? -10.204 86.550  12.237  1.00 22.46  ? 109  SER B OG    1 
ATOM   5764  N N     . TYR B 1 110 ? -13.356 86.292  13.819  1.00 21.97  ? 110  TYR B N     1 
ATOM   5765  C CA    . TYR B 1 110 ? -14.577 86.883  13.258  1.00 21.56  ? 110  TYR B CA    1 
ATOM   5766  C C     . TYR B 1 110 ? -14.342 87.496  11.866  1.00 22.07  ? 110  TYR B C     1 
ATOM   5767  O O     . TYR B 1 110 ? -15.135 87.293  10.930  1.00 21.15  ? 110  TYR B O     1 
ATOM   5768  C CB    . TYR B 1 110 ? -15.197 87.897  14.242  1.00 21.15  ? 110  TYR B CB    1 
ATOM   5769  C CG    . TYR B 1 110 ? -16.099 87.210  15.233  1.00 20.23  ? 110  TYR B CG    1 
ATOM   5770  C CD1   . TYR B 1 110 ? -15.615 86.787  16.492  1.00 20.46  ? 110  TYR B CD1   1 
ATOM   5771  C CD2   . TYR B 1 110 ? -17.420 86.914  14.891  1.00 18.76  ? 110  TYR B CD2   1 
ATOM   5772  C CE1   . TYR B 1 110 ? -16.454 86.093  17.402  1.00 19.78  ? 110  TYR B CE1   1 
ATOM   5773  C CE2   . TYR B 1 110 ? -18.262 86.230  15.772  1.00 20.09  ? 110  TYR B CE2   1 
ATOM   5774  C CZ    . TYR B 1 110 ? -17.779 85.822  17.023  1.00 20.75  ? 110  TYR B CZ    1 
ATOM   5775  O OH    . TYR B 1 110 ? -18.641 85.151  17.860  1.00 19.35  ? 110  TYR B OH    1 
ATOM   5776  N N     . ARG B 1 111 ? -13.235 88.221  11.730  1.00 22.80  ? 111  ARG B N     1 
ATOM   5777  C CA    . ARG B 1 111 ? -12.827 88.789  10.442  1.00 24.04  ? 111  ARG B CA    1 
ATOM   5778  C C     . ARG B 1 111 ? -12.582 87.702  9.372   1.00 23.99  ? 111  ARG B C     1 
ATOM   5779  O O     . ARG B 1 111 ? -13.116 87.793  8.261   1.00 23.72  ? 111  ARG B O     1 
ATOM   5780  C CB    . ARG B 1 111 ? -11.622 89.707  10.650  1.00 24.06  ? 111  ARG B CB    1 
ATOM   5781  C CG    . ARG B 1 111 ? -11.003 90.289  9.411   1.00 27.66  ? 111  ARG B CG    1 
ATOM   5782  C CD    . ARG B 1 111 ? -10.184 91.544  9.763   1.00 31.58  ? 111  ARG B CD    1 
ATOM   5783  N NE    . ARG B 1 111 ? -11.068 92.705  9.944   1.00 36.03  ? 111  ARG B NE    1 
ATOM   5784  C CZ    . ARG B 1 111 ? -11.281 93.346  11.094  1.00 36.49  ? 111  ARG B CZ    1 
ATOM   5785  N NH1   . ARG B 1 111 ? -10.659 92.966  12.214  1.00 37.18  ? 111  ARG B NH1   1 
ATOM   5786  N NH2   . ARG B 1 111 ? -12.113 94.386  11.115  1.00 35.32  ? 111  ARG B NH2   1 
ATOM   5787  N N     . GLU B 1 112 ? -11.816 86.666  9.716   1.00 24.37  ? 112  GLU B N     1 
ATOM   5788  C CA    . GLU B 1 112 ? -11.583 85.535  8.799   1.00 25.30  ? 112  GLU B CA    1 
ATOM   5789  C C     . GLU B 1 112 ? -12.878 84.854  8.366   1.00 24.43  ? 112  GLU B C     1 
ATOM   5790  O O     . GLU B 1 112 ? -13.106 84.613  7.160   1.00 23.78  ? 112  GLU B O     1 
ATOM   5791  C CB    . GLU B 1 112 ? -10.638 84.504  9.426   1.00 25.44  ? 112  GLU B CB    1 
ATOM   5792  C CG    . GLU B 1 112 ? -9.180  84.957  9.415   1.00 27.36  ? 112  GLU B CG    1 
ATOM   5793  C CD    . GLU B 1 112 ? -8.257  84.177  10.366  1.00 27.98  ? 112  GLU B CD    1 
ATOM   5794  O OE1   . GLU B 1 112 ? -8.680  83.210  11.056  1.00 28.99  ? 112  GLU B OE1   1 
ATOM   5795  O OE2   . GLU B 1 112 ? -7.077  84.573  10.418  1.00 32.33  ? 112  GLU B OE2   1 
ATOM   5796  N N     . LEU B 1 113 ? -13.727 84.574  9.353   1.00 23.41  ? 113  LEU B N     1 
ATOM   5797  C CA    . LEU B 1 113 ? -14.990 83.911  9.108   1.00 23.10  ? 113  LEU B CA    1 
ATOM   5798  C C     . LEU B 1 113 ? -15.911 84.781  8.247   1.00 23.10  ? 113  LEU B C     1 
ATOM   5799  O O     . LEU B 1 113 ? -16.570 84.270  7.343   1.00 22.92  ? 113  LEU B O     1 
ATOM   5800  C CB    . LEU B 1 113 ? -15.650 83.478  10.434  1.00 22.57  ? 113  LEU B CB    1 
ATOM   5801  C CG    . LEU B 1 113 ? -16.949 82.651  10.389  1.00 23.22  ? 113  LEU B CG    1 
ATOM   5802  C CD1   . LEU B 1 113 ? -16.860 81.367  9.531   1.00 23.34  ? 113  LEU B CD1   1 
ATOM   5803  C CD2   . LEU B 1 113 ? -17.447 82.316  11.791  1.00 22.87  ? 113  LEU B CD2   1 
ATOM   5804  N N     . HIS B 1 114 ? -15.924 86.089  8.511   1.00 23.51  ? 114  HIS B N     1 
ATOM   5805  C CA    . HIS B 1 114 ? -16.772 87.037  7.777   1.00 24.11  ? 114  HIS B CA    1 
ATOM   5806  C C     . HIS B 1 114 ? -16.442 87.015  6.295   1.00 24.76  ? 114  HIS B C     1 
ATOM   5807  O O     . HIS B 1 114 ? -17.336 86.904  5.450   1.00 24.33  ? 114  HIS B O     1 
ATOM   5808  C CB    . HIS B 1 114 ? -16.604 88.453  8.337   1.00 23.69  ? 114  HIS B CB    1 
ATOM   5809  C CG    . HIS B 1 114 ? -17.364 89.514  7.587   1.00 24.17  ? 114  HIS B CG    1 
ATOM   5810  N ND1   . HIS B 1 114 ? -16.804 90.248  6.561   1.00 23.02  ? 114  HIS B ND1   1 
ATOM   5811  C CD2   . HIS B 1 114 ? -18.624 90.001  7.754   1.00 23.27  ? 114  HIS B CD2   1 
ATOM   5812  C CE1   . HIS B 1 114 ? -17.689 91.125  6.116   1.00 22.93  ? 114  HIS B CE1   1 
ATOM   5813  N NE2   . HIS B 1 114 ? -18.798 91.004  6.831   1.00 23.37  ? 114  HIS B NE2   1 
ATOM   5814  N N     . ARG B 1 115 ? -15.142 87.099  6.012   1.00 25.74  ? 115  ARG B N     1 
ATOM   5815  C CA    . ARG B 1 115 ? -14.597 87.120  4.658   1.00 27.12  ? 115  ARG B CA    1 
ATOM   5816  C C     . ARG B 1 115 ? -15.050 85.912  3.855   1.00 26.54  ? 115  ARG B C     1 
ATOM   5817  O O     . ARG B 1 115 ? -15.554 86.058  2.749   1.00 26.69  ? 115  ARG B O     1 
ATOM   5818  C CB    . ARG B 1 115 ? -13.062 87.183  4.709   1.00 26.50  ? 115  ARG B CB    1 
ATOM   5819  C CG    . ARG B 1 115 ? -12.430 87.234  3.345   1.00 29.24  ? 115  ARG B CG    1 
ATOM   5820  C CD    . ARG B 1 115 ? -10.904 87.031  3.326   1.00 30.49  ? 115  ARG B CD    1 
ATOM   5821  N NE    . ARG B 1 115 ? -10.462 86.797  1.949   1.00 37.40  ? 115  ARG B NE    1 
ATOM   5822  C CZ    . ARG B 1 115 ? -10.265 87.764  1.051   1.00 40.55  ? 115  ARG B CZ    1 
ATOM   5823  N NH1   . ARG B 1 115 ? -10.439 89.038  1.397   1.00 41.51  ? 115  ARG B NH1   1 
ATOM   5824  N NH2   . ARG B 1 115 ? -9.889  87.461  -0.193  1.00 41.93  ? 115  ARG B NH2   1 
ATOM   5825  N N     . ASP B 1 116 ? -14.868 84.725  4.428   1.00 26.89  ? 116  ASP B N     1 
ATOM   5826  C CA    . ASP B 1 116 ? -15.234 83.469  3.773   1.00 27.21  ? 116  ASP B CA    1 
ATOM   5827  C C     . ASP B 1 116 ? -16.735 83.285  3.627   1.00 26.48  ? 116  ASP B C     1 
ATOM   5828  O O     . ASP B 1 116 ? -17.178 82.715  2.631   1.00 26.35  ? 116  ASP B O     1 
ATOM   5829  C CB    . ASP B 1 116 ? -14.612 82.264  4.475   1.00 27.56  ? 116  ASP B CB    1 
ATOM   5830  C CG    . ASP B 1 116 ? -13.187 82.001  4.024   1.00 30.27  ? 116  ASP B CG    1 
ATOM   5831  O OD1   . ASP B 1 116 ? -12.811 82.410  2.893   1.00 32.92  ? 116  ASP B OD1   1 
ATOM   5832  O OD2   . ASP B 1 116 ? -12.438 81.370  4.801   1.00 33.97  ? 116  ASP B OD2   1 
ATOM   5833  N N     . VAL B 1 117 ? -17.504 83.772  4.601   1.00 25.70  ? 117  VAL B N     1 
ATOM   5834  C CA    . VAL B 1 117 ? -18.952 83.820  4.451   1.00 25.43  ? 117  VAL B CA    1 
ATOM   5835  C C     . VAL B 1 117 ? -19.348 84.713  3.260   1.00 25.17  ? 117  VAL B C     1 
ATOM   5836  O O     . VAL B 1 117 ? -20.161 84.285  2.423   1.00 25.00  ? 117  VAL B O     1 
ATOM   5837  C CB    . VAL B 1 117 ? -19.687 84.236  5.759   1.00 25.70  ? 117  VAL B CB    1 
ATOM   5838  C CG1   . VAL B 1 117 ? -21.163 84.566  5.477   1.00 25.66  ? 117  VAL B CG1   1 
ATOM   5839  C CG2   . VAL B 1 117 ? -19.592 83.117  6.808   1.00 25.22  ? 117  VAL B CG2   1 
ATOM   5840  N N     . CYS B 1 118 ? -18.755 85.916  3.174   1.00 24.50  ? 118  CYS B N     1 
ATOM   5841  C CA    . CYS B 1 118 ? -18.964 86.821  2.033   1.00 24.41  ? 118  CYS B CA    1 
ATOM   5842  C C     . CYS B 1 118 ? -18.589 86.171  0.684   1.00 24.27  ? 118  CYS B C     1 
ATOM   5843  O O     . CYS B 1 118 ? -19.409 86.130  -0.241  1.00 23.77  ? 118  CYS B O     1 
ATOM   5844  C CB    . CYS B 1 118 ? -18.216 88.141  2.224   1.00 24.02  ? 118  CYS B CB    1 
ATOM   5845  S SG    . CYS B 1 118 ? -18.871 89.222  3.526   1.00 25.17  ? 118  CYS B SG    1 
ATOM   5846  N N     . ARG B 1 119 ? -17.369 85.649  0.577   1.00 24.58  ? 119  ARG B N     1 
ATOM   5847  C CA    . ARG B 1 119 ? -16.967 84.916  -0.628  1.00 25.17  ? 119  ARG B CA    1 
ATOM   5848  C C     . ARG B 1 119 ? -17.979 83.829  -0.965  1.00 24.81  ? 119  ARG B C     1 
ATOM   5849  O O     . ARG B 1 119 ? -18.437 83.746  -2.107  1.00 25.43  ? 119  ARG B O     1 
ATOM   5850  C CB    . ARG B 1 119 ? -15.557 84.317  -0.513  1.00 24.95  ? 119  ARG B CB    1 
ATOM   5851  C CG    . ARG B 1 119 ? -14.433 85.317  -0.765  1.00 26.34  ? 119  ARG B CG    1 
ATOM   5852  C CD    . ARG B 1 119 ? -13.094 84.669  -1.180  1.00 27.22  ? 119  ARG B CD    1 
ATOM   5853  N NE    . ARG B 1 119 ? -12.492 83.902  -0.086  1.00 32.34  ? 119  ARG B NE    1 
ATOM   5854  C CZ    . ARG B 1 119 ? -11.326 83.246  -0.130  1.00 33.81  ? 119  ARG B CZ    1 
ATOM   5855  N NH1   . ARG B 1 119 ? -10.561 83.256  -1.221  1.00 33.74  ? 119  ARG B NH1   1 
ATOM   5856  N NH2   . ARG B 1 119 ? -10.912 82.581  0.947   1.00 33.98  ? 119  ARG B NH2   1 
ATOM   5857  N N     . PHE B 1 120 ? -18.348 83.014  0.020   1.00 24.19  ? 120  PHE B N     1 
ATOM   5858  C CA    . PHE B 1 120 ? -19.306 81.933  -0.222  1.00 23.97  ? 120  PHE B CA    1 
ATOM   5859  C C     . PHE B 1 120 ? -20.761 82.367  -0.539  1.00 23.65  ? 120  PHE B C     1 
ATOM   5860  O O     . PHE B 1 120 ? -21.460 81.676  -1.290  1.00 22.97  ? 120  PHE B O     1 
ATOM   5861  C CB    . PHE B 1 120 ? -19.288 80.907  0.904   1.00 23.85  ? 120  PHE B CB    1 
ATOM   5862  C CG    . PHE B 1 120 ? -19.758 79.556  0.475   1.00 23.94  ? 120  PHE B CG    1 
ATOM   5863  C CD1   . PHE B 1 120 ? -18.963 78.759  -0.337  1.00 24.59  ? 120  PHE B CD1   1 
ATOM   5864  C CD2   . PHE B 1 120 ? -21.006 79.079  0.867   1.00 24.93  ? 120  PHE B CD2   1 
ATOM   5865  C CE1   . PHE B 1 120 ? -19.407 77.499  -0.753  1.00 24.76  ? 120  PHE B CE1   1 
ATOM   5866  C CE2   . PHE B 1 120 ? -21.444 77.817  0.467   1.00 24.08  ? 120  PHE B CE2   1 
ATOM   5867  C CZ    . PHE B 1 120 ? -20.639 77.036  -0.349  1.00 23.21  ? 120  PHE B CZ    1 
ATOM   5868  N N     . ALA B 1 121 ? -21.211 83.479  0.040   1.00 23.50  ? 121  ALA B N     1 
ATOM   5869  C CA    . ALA B 1 121 ? -22.493 84.081  -0.364  1.00 24.17  ? 121  ALA B CA    1 
ATOM   5870  C C     . ALA B 1 121 ? -22.450 84.452  -1.845  1.00 24.26  ? 121  ALA B C     1 
ATOM   5871  O O     . ALA B 1 121 ? -23.423 84.217  -2.574  1.00 24.47  ? 121  ALA B O     1 
ATOM   5872  C CB    . ALA B 1 121 ? -22.835 85.311  0.483   1.00 23.51  ? 121  ALA B CB    1 
ATOM   5873  N N     . ASN B 1 122 ? -21.317 85.014  -2.282  1.00 24.52  ? 122  ASN B N     1 
ATOM   5874  C CA    . ASN B 1 122 ? -21.113 85.380  -3.696  1.00 24.17  ? 122  ASN B CA    1 
ATOM   5875  C C     . ASN B 1 122 ? -21.046 84.116  -4.558  1.00 24.52  ? 122  ASN B C     1 
ATOM   5876  O O     . ASN B 1 122 ? -21.548 84.096  -5.694  1.00 24.35  ? 122  ASN B O     1 
ATOM   5877  C CB    . ASN B 1 122 ? -19.850 86.246  -3.873  1.00 23.81  ? 122  ASN B CB    1 
ATOM   5878  C CG    . ASN B 1 122 ? -20.093 87.711  -3.532  1.00 23.07  ? 122  ASN B CG    1 
ATOM   5879  O OD1   . ASN B 1 122 ? -21.164 88.227  -3.811  1.00 23.47  ? 122  ASN B OD1   1 
ATOM   5880  N ND2   . ASN B 1 122 ? -19.104 88.382  -2.937  1.00 19.83  ? 122  ASN B ND2   1 
ATOM   5881  N N     . THR B 1 123 ? -20.445 83.064  -3.999  1.00 24.37  ? 123  THR B N     1 
ATOM   5882  C CA    . THR B 1 123 ? -20.363 81.773  -4.678  1.00 24.83  ? 123  THR B CA    1 
ATOM   5883  C C     . THR B 1 123 ? -21.768 81.248  -4.985  1.00 25.16  ? 123  THR B C     1 
ATOM   5884  O O     . THR B 1 123 ? -22.085 80.981  -6.136  1.00 25.87  ? 123  THR B O     1 
ATOM   5885  C CB    . THR B 1 123 ? -19.509 80.740  -3.880  1.00 24.44  ? 123  THR B CB    1 
ATOM   5886  O OG1   . THR B 1 123 ? -18.133 81.143  -3.906  1.00 24.95  ? 123  THR B OG1   1 
ATOM   5887  C CG2   . THR B 1 123 ? -19.608 79.354  -4.497  1.00 23.56  ? 123  THR B CG2   1 
ATOM   5888  N N     . LEU B 1 124 ? -22.602 81.123  -3.956  1.00 25.47  ? 124  LEU B N     1 
ATOM   5889  C CA    . LEU B 1 124 ? -24.000 80.705  -4.104  1.00 25.62  ? 124  LEU B CA    1 
ATOM   5890  C C     . LEU B 1 124 ? -24.729 81.587  -5.120  1.00 25.83  ? 124  LEU B C     1 
ATOM   5891  O O     . LEU B 1 124 ? -25.332 81.072  -6.063  1.00 25.91  ? 124  LEU B O     1 
ATOM   5892  C CB    . LEU B 1 124 ? -24.722 80.740  -2.747  1.00 25.61  ? 124  LEU B CB    1 
ATOM   5893  C CG    . LEU B 1 124 ? -24.206 79.821  -1.625  1.00 25.69  ? 124  LEU B CG    1 
ATOM   5894  C CD1   . LEU B 1 124 ? -24.716 80.241  -0.268  1.00 25.44  ? 124  LEU B CD1   1 
ATOM   5895  C CD2   . LEU B 1 124 ? -24.620 78.386  -1.916  1.00 27.98  ? 124  LEU B CD2   1 
ATOM   5896  N N     . LEU B 1 125 ? -24.659 82.906  -4.936  1.00 26.05  ? 125  LEU B N     1 
ATOM   5897  C CA    . LEU B 1 125 ? -25.248 83.865  -5.900  1.00 26.69  ? 125  LEU B CA    1 
ATOM   5898  C C     . LEU B 1 125 ? -24.828 83.632  -7.360  1.00 26.69  ? 125  LEU B C     1 
ATOM   5899  O O     . LEU B 1 125 ? -25.700 83.463  -8.215  1.00 26.44  ? 125  LEU B O     1 
ATOM   5900  C CB    . LEU B 1 125 ? -25.007 85.322  -5.483  1.00 26.43  ? 125  LEU B CB    1 
ATOM   5901  C CG    . LEU B 1 125 ? -25.814 85.813  -4.271  1.00 26.69  ? 125  LEU B CG    1 
ATOM   5902  C CD1   . LEU B 1 125 ? -25.257 87.143  -3.761  1.00 26.34  ? 125  LEU B CD1   1 
ATOM   5903  C CD2   . LEU B 1 125 ? -27.323 85.919  -4.555  1.00 24.36  ? 125  LEU B CD2   1 
ATOM   5904  N N     . ASP B 1 126 ? -23.515 83.589  -7.626  1.00 27.39  ? 126  ASP B N     1 
ATOM   5905  C CA    . ASP B 1 126 ? -22.971 83.328  -8.982  1.00 28.27  ? 126  ASP B CA    1 
ATOM   5906  C C     . ASP B 1 126 ? -23.356 81.957  -9.553  1.00 28.19  ? 126  ASP B C     1 
ATOM   5907  O O     . ASP B 1 126 ? -23.210 81.717  -10.750 1.00 28.21  ? 126  ASP B O     1 
ATOM   5908  C CB    . ASP B 1 126 ? -21.440 83.471  -9.023  1.00 28.76  ? 126  ASP B CB    1 
ATOM   5909  C CG    . ASP B 1 126 ? -20.957 84.843  -8.549  1.00 32.03  ? 126  ASP B CG    1 
ATOM   5910  O OD1   . ASP B 1 126 ? -21.794 85.782  -8.443  1.00 34.88  ? 126  ASP B OD1   1 
ATOM   5911  O OD2   . ASP B 1 126 ? -19.736 84.973  -8.262  1.00 34.05  ? 126  ASP B OD2   1 
ATOM   5912  N N     . LEU B 1 127 ? -23.835 81.067  -8.690  1.00 27.68  ? 127  LEU B N     1 
ATOM   5913  C CA    . LEU B 1 127 ? -24.280 79.747  -9.103  1.00 27.62  ? 127  LEU B CA    1 
ATOM   5914  C C     . LEU B 1 127 ? -25.791 79.782  -9.397  1.00 27.85  ? 127  LEU B C     1 
ATOM   5915  O O     . LEU B 1 127 ? -26.370 78.803  -9.864  1.00 27.65  ? 127  LEU B O     1 
ATOM   5916  C CB    . LEU B 1 127 ? -23.943 78.724  -7.999  1.00 27.45  ? 127  LEU B CB    1 
ATOM   5917  C CG    . LEU B 1 127 ? -23.495 77.305  -8.341  1.00 27.37  ? 127  LEU B CG    1 
ATOM   5918  C CD1   . LEU B 1 127 ? -22.332 77.302  -9.324  1.00 27.51  ? 127  LEU B CD1   1 
ATOM   5919  C CD2   . LEU B 1 127 ? -23.109 76.579  -7.079  1.00 27.60  ? 127  LEU B CD2   1 
ATOM   5920  N N     . GLY B 1 128 ? -26.422 80.919  -9.114  1.00 27.97  ? 128  GLY B N     1 
ATOM   5921  C CA    . GLY B 1 128 ? -27.836 81.098  -9.406  1.00 28.49  ? 128  GLY B CA    1 
ATOM   5922  C C     . GLY B 1 128 ? -28.772 80.840  -8.242  1.00 28.86  ? 128  GLY B C     1 
ATOM   5923  O O     . GLY B 1 128 ? -29.998 80.823  -8.424  1.00 28.55  ? 128  GLY B O     1 
ATOM   5924  N N     . ILE B 1 129 ? -28.202 80.646  -7.047  1.00 28.95  ? 129  ILE B N     1 
ATOM   5925  C CA    . ILE B 1 129 ? -29.003 80.402  -5.848  1.00 29.08  ? 129  ILE B CA    1 
ATOM   5926  C C     . ILE B 1 129 ? -29.641 81.708  -5.411  1.00 29.47  ? 129  ILE B C     1 
ATOM   5927  O O     . ILE B 1 129 ? -28.966 82.740  -5.367  1.00 29.63  ? 129  ILE B O     1 
ATOM   5928  C CB    . ILE B 1 129 ? -28.147 79.777  -4.689  1.00 29.53  ? 129  ILE B CB    1 
ATOM   5929  C CG1   . ILE B 1 129 ? -27.578 78.408  -5.097  1.00 27.94  ? 129  ILE B CG1   1 
ATOM   5930  C CG2   . ILE B 1 129 ? -28.952 79.685  -3.385  1.00 28.82  ? 129  ILE B CG2   1 
ATOM   5931  C CD1   . ILE B 1 129 ? -28.635 77.382  -5.440  1.00 26.89  ? 129  ILE B CD1   1 
ATOM   5932  N N     . LYS B 1 130 ? -30.936 81.663  -5.092  1.00 29.79  ? 130  LYS B N     1 
ATOM   5933  C CA    . LYS B 1 130 ? -31.689 82.867  -4.698  1.00 30.31  ? 130  LYS B CA    1 
ATOM   5934  C C     . LYS B 1 130 ? -32.346 82.789  -3.305  1.00 30.11  ? 130  LYS B C     1 
ATOM   5935  O O     . LYS B 1 130 ? -32.462 81.712  -2.698  1.00 29.53  ? 130  LYS B O     1 
ATOM   5936  C CB    . LYS B 1 130 ? -32.774 83.179  -5.736  1.00 30.90  ? 130  LYS B CB    1 
ATOM   5937  C CG    . LYS B 1 130 ? -32.270 83.418  -7.149  1.00 33.10  ? 130  LYS B CG    1 
ATOM   5938  C CD    . LYS B 1 130 ? -33.446 83.553  -8.109  1.00 36.72  ? 130  LYS B CD    1 
ATOM   5939  C CE    . LYS B 1 130 ? -32.974 83.925  -9.509  1.00 38.66  ? 130  LYS B CE    1 
ATOM   5940  N NZ    . LYS B 1 130 ? -31.997 82.926  -10.039 1.00 39.01  ? 130  LYS B NZ    1 
ATOM   5941  N N     . LYS B 1 131 ? -32.789 83.945  -2.814  1.00 29.73  ? 131  LYS B N     1 
ATOM   5942  C CA    . LYS B 1 131 ? -33.563 84.002  -1.586  1.00 29.91  ? 131  LYS B CA    1 
ATOM   5943  C C     . LYS B 1 131 ? -34.723 82.996  -1.649  1.00 29.51  ? 131  LYS B C     1 
ATOM   5944  O O     . LYS B 1 131 ? -35.468 82.959  -2.626  1.00 29.31  ? 131  LYS B O     1 
ATOM   5945  C CB    . LYS B 1 131 ? -34.078 85.423  -1.337  1.00 29.83  ? 131  LYS B CB    1 
ATOM   5946  C CG    . LYS B 1 131 ? -34.802 85.558  -0.004  1.00 30.81  ? 131  LYS B CG    1 
ATOM   5947  C CD    . LYS B 1 131 ? -35.379 86.950  0.216   1.00 30.19  ? 131  LYS B CD    1 
ATOM   5948  C CE    . LYS B 1 131 ? -36.177 86.978  1.502   1.00 29.98  ? 131  LYS B CE    1 
ATOM   5949  N NZ    . LYS B 1 131 ? -36.717 88.339  1.747   1.00 32.11  ? 131  LYS B NZ    1 
ATOM   5950  N N     . GLY B 1 132 ? -34.848 82.159  -0.623  1.00 29.29  ? 132  GLY B N     1 
ATOM   5951  C CA    . GLY B 1 132 ? -35.927 81.171  -0.575  1.00 29.03  ? 132  GLY B CA    1 
ATOM   5952  C C     . GLY B 1 132 ? -35.633 79.785  -1.140  1.00 29.05  ? 132  GLY B C     1 
ATOM   5953  O O     . GLY B 1 132 ? -36.370 78.835  -0.844  1.00 29.09  ? 132  GLY B O     1 
ATOM   5954  N N     . ASP B 1 133 ? -34.588 79.668  -1.968  1.00 28.64  ? 133  ASP B N     1 
ATOM   5955  C CA    . ASP B 1 133 ? -34.111 78.366  -2.450  1.00 28.58  ? 133  ASP B CA    1 
ATOM   5956  C C     . ASP B 1 133 ? -33.623 77.544  -1.270  1.00 28.44  ? 133  ASP B C     1 
ATOM   5957  O O     . ASP B 1 133 ? -33.073 78.100  -0.307  1.00 29.21  ? 133  ASP B O     1 
ATOM   5958  C CB    . ASP B 1 133 ? -32.979 78.522  -3.473  1.00 28.62  ? 133  ASP B CB    1 
ATOM   5959  C CG    . ASP B 1 133 ? -33.467 79.067  -4.812  1.00 29.54  ? 133  ASP B CG    1 
ATOM   5960  O OD1   . ASP B 1 133 ? -34.696 79.187  -5.007  1.00 31.68  ? 133  ASP B OD1   1 
ATOM   5961  O OD2   . ASP B 1 133 ? -32.624 79.394  -5.672  1.00 29.64  ? 133  ASP B OD2   1 
ATOM   5962  N N     . VAL B 1 134 ? -33.854 76.235  -1.321  1.00 27.37  ? 134  VAL B N     1 
ATOM   5963  C CA    . VAL B 1 134 ? -33.364 75.350  -0.273  1.00 26.49  ? 134  VAL B CA    1 
ATOM   5964  C C     . VAL B 1 134 ? -32.029 74.731  -0.712  1.00 26.09  ? 134  VAL B C     1 
ATOM   5965  O O     . VAL B 1 134 ? -31.887 74.250  -1.841  1.00 25.93  ? 134  VAL B O     1 
ATOM   5966  C CB    . VAL B 1 134 ? -34.387 74.242  0.117   1.00 26.59  ? 134  VAL B CB    1 
ATOM   5967  C CG1   . VAL B 1 134 ? -33.919 73.490  1.375   1.00 25.64  ? 134  VAL B CG1   1 
ATOM   5968  C CG2   . VAL B 1 134 ? -35.776 74.829  0.345   1.00 26.11  ? 134  VAL B CG2   1 
ATOM   5969  N N     . VAL B 1 135 ? -31.055 74.775  0.190   1.00 25.27  ? 135  VAL B N     1 
ATOM   5970  C CA    . VAL B 1 135 ? -29.740 74.220  -0.059  1.00 24.52  ? 135  VAL B CA    1 
ATOM   5971  C C     . VAL B 1 135 ? -29.490 73.097  0.940   1.00 24.01  ? 135  VAL B C     1 
ATOM   5972  O O     . VAL B 1 135 ? -29.549 73.314  2.163   1.00 23.78  ? 135  VAL B O     1 
ATOM   5973  C CB    . VAL B 1 135 ? -28.648 75.295  0.057   1.00 24.27  ? 135  VAL B CB    1 
ATOM   5974  C CG1   . VAL B 1 135 ? -27.258 74.666  0.002   1.00 24.21  ? 135  VAL B CG1   1 
ATOM   5975  C CG2   . VAL B 1 135 ? -28.812 76.330  -1.027  1.00 24.81  ? 135  VAL B CG2   1 
ATOM   5976  N N     . ALA B 1 136 ? -29.239 71.900  0.411   1.00 23.37  ? 136  ALA B N     1 
ATOM   5977  C CA    . ALA B 1 136 ? -28.940 70.738  1.240   1.00 22.73  ? 136  ALA B CA    1 
ATOM   5978  C C     . ALA B 1 136 ? -27.485 70.759  1.680   1.00 23.00  ? 136  ALA B C     1 
ATOM   5979  O O     . ALA B 1 136 ? -26.563 70.899  0.851   1.00 22.77  ? 136  ALA B O     1 
ATOM   5980  C CB    . ALA B 1 136 ? -29.253 69.462  0.517   1.00 22.07  ? 136  ALA B CB    1 
ATOM   5981  N N     . ILE B 1 137 ? -27.279 70.620  2.993   1.00 23.16  ? 137  ILE B N     1 
ATOM   5982  C CA    . ILE B 1 137 ? -25.929 70.603  3.552   1.00 22.81  ? 137  ILE B CA    1 
ATOM   5983  C C     . ILE B 1 137 ? -25.680 69.263  4.218   1.00 22.89  ? 137  ILE B C     1 
ATOM   5984  O O     . ILE B 1 137 ? -26.398 68.876  5.130   1.00 23.38  ? 137  ILE B O     1 
ATOM   5985  C CB    . ILE B 1 137 ? -25.673 71.804  4.495   1.00 22.91  ? 137  ILE B CB    1 
ATOM   5986  C CG1   . ILE B 1 137 ? -25.910 73.127  3.734   1.00 21.51  ? 137  ILE B CG1   1 
ATOM   5987  C CG2   . ILE B 1 137 ? -24.259 71.721  5.074   1.00 22.51  ? 137  ILE B CG2   1 
ATOM   5988  C CD1   . ILE B 1 137 ? -25.837 74.380  4.593   1.00 22.64  ? 137  ILE B CD1   1 
ATOM   5989  N N     . TYR B 1 138 ? -24.672 68.550  3.718   1.00 22.48  ? 138  TYR B N     1 
ATOM   5990  C CA    . TYR B 1 138 ? -24.345 67.197  4.143   1.00 21.51  ? 138  TYR B CA    1 
ATOM   5991  C C     . TYR B 1 138 ? -22.854 67.241  4.455   1.00 22.13  ? 138  TYR B C     1 
ATOM   5992  O O     . TYR B 1 138 ? -22.018 66.877  3.622   1.00 22.19  ? 138  TYR B O     1 
ATOM   5993  C CB    . TYR B 1 138 ? -24.661 66.227  2.985   1.00 20.79  ? 138  TYR B CB    1 
ATOM   5994  C CG    . TYR B 1 138 ? -24.591 64.733  3.299   1.00 19.84  ? 138  TYR B CG    1 
ATOM   5995  C CD1   . TYR B 1 138 ? -25.308 64.170  4.364   1.00 18.25  ? 138  TYR B CD1   1 
ATOM   5996  C CD2   . TYR B 1 138 ? -23.824 63.878  2.507   1.00 18.82  ? 138  TYR B CD2   1 
ATOM   5997  C CE1   . TYR B 1 138 ? -25.243 62.800  4.636   1.00 17.26  ? 138  TYR B CE1   1 
ATOM   5998  C CE2   . TYR B 1 138 ? -23.758 62.508  2.763   1.00 17.61  ? 138  TYR B CE2   1 
ATOM   5999  C CZ    . TYR B 1 138 ? -24.475 61.972  3.825   1.00 18.25  ? 138  TYR B CZ    1 
ATOM   6000  O OH    . TYR B 1 138 ? -24.393 60.609  4.070   1.00 18.05  ? 138  TYR B OH    1 
ATOM   6001  N N     . MET B 1 139 ? -22.521 67.718  5.653   1.00 22.22  ? 139  MET B N     1 
ATOM   6002  C CA    . MET B 1 139 ? -21.156 68.055  5.985   1.00 22.57  ? 139  MET B CA    1 
ATOM   6003  C C     . MET B 1 139 ? -20.689 67.433  7.308   1.00 22.29  ? 139  MET B C     1 
ATOM   6004  O O     . MET B 1 139 ? -21.492 67.204  8.218   1.00 22.42  ? 139  MET B O     1 
ATOM   6005  C CB    . MET B 1 139 ? -21.003 69.579  6.068   1.00 23.22  ? 139  MET B CB    1 
ATOM   6006  C CG    . MET B 1 139 ? -21.139 70.302  4.742   1.00 25.15  ? 139  MET B CG    1 
ATOM   6007  S SD    . MET B 1 139 ? -19.601 70.262  3.833   1.00 30.45  ? 139  MET B SD    1 
ATOM   6008  C CE    . MET B 1 139 ? -18.769 71.712  4.451   1.00 28.11  ? 139  MET B CE    1 
ATOM   6009  N N     . PRO B 1 140 ? -19.375 67.170  7.421   1.00 21.58  ? 140  PRO B N     1 
ATOM   6010  C CA    . PRO B 1 140 ? -18.878 66.716  8.706   1.00 21.20  ? 140  PRO B CA    1 
ATOM   6011  C C     . PRO B 1 140 ? -18.646 67.953  9.577   1.00 21.50  ? 140  PRO B C     1 
ATOM   6012  O O     . PRO B 1 140 ? -18.929 69.081  9.137   1.00 21.57  ? 140  PRO B O     1 
ATOM   6013  C CB    . PRO B 1 140 ? -17.546 66.049  8.342   1.00 20.72  ? 140  PRO B CB    1 
ATOM   6014  C CG    . PRO B 1 140 ? -17.089 66.746  7.125   1.00 20.39  ? 140  PRO B CG    1 
ATOM   6015  C CD    . PRO B 1 140 ? -18.299 67.280  6.411   1.00 20.69  ? 140  PRO B CD    1 
ATOM   6016  N N     . MET B 1 141 ? -18.111 67.749  10.780  1.00 20.99  ? 141  MET B N     1 
ATOM   6017  C CA    . MET B 1 141 ? -17.870 68.849  11.689  1.00 20.61  ? 141  MET B CA    1 
ATOM   6018  C C     . MET B 1 141 ? -16.571 69.572  11.362  1.00 20.70  ? 141  MET B C     1 
ATOM   6019  O O     . MET B 1 141 ? -15.563 69.433  12.047  1.00 21.29  ? 141  MET B O     1 
ATOM   6020  C CB    . MET B 1 141 ? -17.935 68.355  13.128  1.00 21.09  ? 141  MET B CB    1 
ATOM   6021  C CG    . MET B 1 141 ? -19.359 68.038  13.552  1.00 19.33  ? 141  MET B CG    1 
ATOM   6022  S SD    . MET B 1 141 ? -20.147 69.571  14.086  1.00 19.97  ? 141  MET B SD    1 
ATOM   6023  C CE    . MET B 1 141 ? -19.678 69.585  15.827  1.00 11.86  ? 141  MET B CE    1 
ATOM   6024  N N     . VAL B 1 142 ? -16.629 70.352  10.292  1.00 20.97  ? 142  VAL B N     1 
ATOM   6025  C CA    . VAL B 1 142 ? -15.539 71.226  9.833   1.00 21.16  ? 142  VAL B CA    1 
ATOM   6026  C C     . VAL B 1 142 ? -16.046 72.695  9.712   1.00 21.41  ? 142  VAL B C     1 
ATOM   6027  O O     . VAL B 1 142 ? -17.256 72.924  9.541   1.00 20.69  ? 142  VAL B O     1 
ATOM   6028  C CB    . VAL B 1 142 ? -14.967 70.737  8.471   1.00 21.07  ? 142  VAL B CB    1 
ATOM   6029  C CG1   . VAL B 1 142 ? -14.263 69.397  8.648   1.00 22.05  ? 142  VAL B CG1   1 
ATOM   6030  C CG2   . VAL B 1 142 ? -16.068 70.626  7.408   1.00 19.47  ? 142  VAL B CG2   1 
ATOM   6031  N N     . PRO B 1 143 ? -15.130 73.688  9.785   1.00 21.64  ? 143  PRO B N     1 
ATOM   6032  C CA    . PRO B 1 143 ? -15.587 75.089  9.789   1.00 22.23  ? 143  PRO B CA    1 
ATOM   6033  C C     . PRO B 1 143 ? -16.402 75.474  8.538   1.00 22.60  ? 143  PRO B C     1 
ATOM   6034  O O     . PRO B 1 143 ? -17.241 76.375  8.607   1.00 23.41  ? 143  PRO B O     1 
ATOM   6035  C CB    . PRO B 1 143 ? -14.273 75.889  9.855   1.00 22.24  ? 143  PRO B CB    1 
ATOM   6036  C CG    . PRO B 1 143 ? -13.263 74.916  10.416  1.00 21.59  ? 143  PRO B CG    1 
ATOM   6037  C CD    . PRO B 1 143 ? -13.659 73.596  9.847   1.00 21.33  ? 143  PRO B CD    1 
ATOM   6038  N N     . GLU B 1 144 ? -16.178 74.771  7.432   1.00 22.57  ? 144  GLU B N     1 
ATOM   6039  C CA    . GLU B 1 144 ? -16.884 75.032  6.172   1.00 22.62  ? 144  GLU B CA    1 
ATOM   6040  C C     . GLU B 1 144 ? -18.385 74.727  6.215   1.00 22.36  ? 144  GLU B C     1 
ATOM   6041  O O     . GLU B 1 144 ? -19.163 75.302  5.449   1.00 22.44  ? 144  GLU B O     1 
ATOM   6042  C CB    . GLU B 1 144 ? -16.210 74.292  5.009   1.00 22.88  ? 144  GLU B CB    1 
ATOM   6043  C CG    . GLU B 1 144 ? -14.806 74.820  4.658   1.00 23.16  ? 144  GLU B CG    1 
ATOM   6044  C CD    . GLU B 1 144 ? -13.695 74.123  5.431   1.00 25.47  ? 144  GLU B CD    1 
ATOM   6045  O OE1   . GLU B 1 144 ? -14.010 73.363  6.370   1.00 26.94  ? 144  GLU B OE1   1 
ATOM   6046  O OE2   . GLU B 1 144 ? -12.501 74.345  5.110   1.00 26.81  ? 144  GLU B OE2   1 
ATOM   6047  N N     . ALA B 1 145 ? -18.792 73.832  7.112   1.00 22.07  ? 145  ALA B N     1 
ATOM   6048  C CA    . ALA B 1 145 ? -20.213 73.647  7.395   1.00 21.98  ? 145  ALA B CA    1 
ATOM   6049  C C     . ALA B 1 145 ? -20.812 74.945  7.916   1.00 21.90  ? 145  ALA B C     1 
ATOM   6050  O O     . ALA B 1 145 ? -21.872 75.356  7.458   1.00 22.53  ? 145  ALA B O     1 
ATOM   6051  C CB    . ALA B 1 145 ? -20.439 72.510  8.399   1.00 21.76  ? 145  ALA B CB    1 
ATOM   6052  N N     . ALA B 1 146 ? -20.133 75.585  8.868   1.00 21.51  ? 146  ALA B N     1 
ATOM   6053  C CA    . ALA B 1 146 ? -20.593 76.863  9.425   1.00 21.89  ? 146  ALA B CA    1 
ATOM   6054  C C     . ALA B 1 146 ? -20.615 77.948  8.351   1.00 21.93  ? 146  ALA B C     1 
ATOM   6055  O O     . ALA B 1 146 ? -21.568 78.712  8.251   1.00 22.08  ? 146  ALA B O     1 
ATOM   6056  C CB    . ALA B 1 146 ? -19.695 77.307  10.613  1.00 21.24  ? 146  ALA B CB    1 
ATOM   6057  N N     . VAL B 1 147 ? -19.552 78.005  7.552   1.00 22.34  ? 147  VAL B N     1 
ATOM   6058  C CA    . VAL B 1 147 ? -19.458 78.972  6.473   1.00 22.66  ? 147  VAL B CA    1 
ATOM   6059  C C     . VAL B 1 147 ? -20.657 78.844  5.545   1.00 22.90  ? 147  VAL B C     1 
ATOM   6060  O O     . VAL B 1 147 ? -21.281 79.841  5.221   1.00 23.66  ? 147  VAL B O     1 
ATOM   6061  C CB    . VAL B 1 147 ? -18.116 78.849  5.698   1.00 22.85  ? 147  VAL B CB    1 
ATOM   6062  C CG1   . VAL B 1 147 ? -18.065 79.816  4.501   1.00 21.02  ? 147  VAL B CG1   1 
ATOM   6063  C CG2   . VAL B 1 147 ? -16.949 79.110  6.637   1.00 22.73  ? 147  VAL B CG2   1 
ATOM   6064  N N     . ALA B 1 148 ? -20.979 77.617  5.141   1.00 23.07  ? 148  ALA B N     1 
ATOM   6065  C CA    . ALA B 1 148 ? -22.077 77.353  4.197   1.00 22.96  ? 148  ALA B CA    1 
ATOM   6066  C C     . ALA B 1 148 ? -23.439 77.706  4.802   1.00 23.07  ? 148  ALA B C     1 
ATOM   6067  O O     . ALA B 1 148 ? -24.328 78.228  4.116   1.00 22.02  ? 148  ALA B O     1 
ATOM   6068  C CB    . ALA B 1 148 ? -22.056 75.895  3.756   1.00 22.58  ? 148  ALA B CB    1 
ATOM   6069  N N     . MET B 1 149 ? -23.593 77.420  6.090   1.00 22.86  ? 149  MET B N     1 
ATOM   6070  C CA    . MET B 1 149 ? -24.841 77.726  6.764   1.00 23.69  ? 149  MET B CA    1 
ATOM   6071  C C     . MET B 1 149 ? -25.052 79.217  6.838   1.00 24.13  ? 149  MET B C     1 
ATOM   6072  O O     . MET B 1 149 ? -26.169 79.705  6.601   1.00 24.79  ? 149  MET B O     1 
ATOM   6073  C CB    . MET B 1 149 ? -24.855 77.116  8.166   1.00 23.49  ? 149  MET B CB    1 
ATOM   6074  C CG    . MET B 1 149 ? -25.045 75.607  8.127   1.00 22.72  ? 149  MET B CG    1 
ATOM   6075  S SD    . MET B 1 149 ? -24.794 74.892  9.719   1.00 23.45  ? 149  MET B SD    1 
ATOM   6076  C CE    . MET B 1 149 ? -26.281 75.391  10.600  1.00 22.23  ? 149  MET B CE    1 
ATOM   6077  N N     . LEU B 1 150 ? -23.972 79.932  7.155   1.00 24.04  ? 150  LEU B N     1 
ATOM   6078  C CA    . LEU B 1 150 ? -24.039 81.372  7.382   1.00 24.16  ? 150  LEU B CA    1 
ATOM   6079  C C     . LEU B 1 150 ? -24.201 82.125  6.078   1.00 23.85  ? 150  LEU B C     1 
ATOM   6080  O O     . LEU B 1 150 ? -24.905 83.132  6.025   1.00 23.59  ? 150  LEU B O     1 
ATOM   6081  C CB    . LEU B 1 150 ? -22.812 81.863  8.159   1.00 23.80  ? 150  LEU B CB    1 
ATOM   6082  C CG    . LEU B 1 150 ? -22.771 81.459  9.636   1.00 24.19  ? 150  LEU B CG    1 
ATOM   6083  C CD1   . LEU B 1 150 ? -21.337 81.388  10.118  1.00 22.83  ? 150  LEU B CD1   1 
ATOM   6084  C CD2   . LEU B 1 150 ? -23.600 82.420  10.499  1.00 23.39  ? 150  LEU B CD2   1 
ATOM   6085  N N     . ALA B 1 151 ? -23.547 81.623  5.034   1.00 23.70  ? 151  ALA B N     1 
ATOM   6086  C CA    . ALA B 1 151 ? -23.652 82.205  3.707   1.00 23.72  ? 151  ALA B CA    1 
ATOM   6087  C C     . ALA B 1 151 ? -25.061 82.048  3.154   1.00 23.77  ? 151  ALA B C     1 
ATOM   6088  O O     . ALA B 1 151 ? -25.571 82.959  2.506   1.00 23.88  ? 151  ALA B O     1 
ATOM   6089  C CB    . ALA B 1 151 ? -22.627 81.587  2.765   1.00 23.66  ? 151  ALA B CB    1 
ATOM   6090  N N     . CYS B 1 152 ? -25.684 80.895  3.402   1.00 23.86  ? 152  CYS B N     1 
ATOM   6091  C CA    . CYS B 1 152 ? -27.089 80.682  3.030   1.00 23.88  ? 152  CYS B CA    1 
ATOM   6092  C C     . CYS B 1 152 ? -28.012 81.706  3.752   1.00 23.88  ? 152  CYS B C     1 
ATOM   6093  O O     . CYS B 1 152 ? -28.847 82.356  3.117   1.00 23.68  ? 152  CYS B O     1 
ATOM   6094  C CB    . CYS B 1 152 ? -27.519 79.237  3.329   1.00 23.57  ? 152  CYS B CB    1 
ATOM   6095  S SG    . CYS B 1 152 ? -26.938 77.941  2.176   1.00 23.22  ? 152  CYS B SG    1 
ATOM   6096  N N     . ALA B 1 153 ? -27.841 81.850  5.069   1.00 23.69  ? 153  ALA B N     1 
ATOM   6097  C CA    . ALA B 1 153 ? -28.585 82.849  5.856   1.00 24.00  ? 153  ALA B CA    1 
ATOM   6098  C C     . ALA B 1 153 ? -28.351 84.308  5.402   1.00 24.25  ? 153  ALA B C     1 
ATOM   6099  O O     . ALA B 1 153 ? -29.242 85.152  5.499   1.00 23.78  ? 153  ALA B O     1 
ATOM   6100  C CB    . ALA B 1 153 ? -28.251 82.708  7.334   1.00 23.94  ? 153  ALA B CB    1 
ATOM   6101  N N     . ARG B 1 154 ? -27.141 84.597  4.931   1.00 24.51  ? 154  ARG B N     1 
ATOM   6102  C CA    . ARG B 1 154 ? -26.779 85.950  4.509   1.00 24.97  ? 154  ARG B CA    1 
ATOM   6103  C C     . ARG B 1 154 ? -27.611 86.419  3.305   1.00 25.15  ? 154  ARG B C     1 
ATOM   6104  O O     . ARG B 1 154 ? -27.940 87.614  3.181   1.00 25.58  ? 154  ARG B O     1 
ATOM   6105  C CB    . ARG B 1 154 ? -25.284 86.032  4.188   1.00 24.36  ? 154  ARG B CB    1 
ATOM   6106  C CG    . ARG B 1 154 ? -24.760 87.454  4.134   1.00 24.80  ? 154  ARG B CG    1 
ATOM   6107  C CD    . ARG B 1 154 ? -23.260 87.490  3.894   1.00 23.81  ? 154  ARG B CD    1 
ATOM   6108  N NE    . ARG B 1 154 ? -22.769 88.859  3.845   1.00 24.68  ? 154  ARG B NE    1 
ATOM   6109  C CZ    . ARG B 1 154 ? -22.381 89.574  4.900   1.00 26.64  ? 154  ARG B CZ    1 
ATOM   6110  N NH1   . ARG B 1 154 ? -22.407 89.074  6.142   1.00 24.85  ? 154  ARG B NH1   1 
ATOM   6111  N NH2   . ARG B 1 154 ? -21.960 90.811  4.706   1.00 27.24  ? 154  ARG B NH2   1 
ATOM   6112  N N     . ILE B 1 155 ? -27.953 85.471  2.439   1.00 24.78  ? 155  ILE B N     1 
ATOM   6113  C CA    . ILE B 1 155 ? -28.646 85.777  1.197   1.00 24.61  ? 155  ILE B CA    1 
ATOM   6114  C C     . ILE B 1 155 ? -30.115 85.362  1.250   1.00 24.40  ? 155  ILE B C     1 
ATOM   6115  O O     . ILE B 1 155 ? -30.850 85.552  0.283   1.00 24.25  ? 155  ILE B O     1 
ATOM   6116  C CB    . ILE B 1 155 ? -27.933 85.138  -0.030  1.00 24.60  ? 155  ILE B CB    1 
ATOM   6117  C CG1   . ILE B 1 155 ? -28.005 83.610  0.030   1.00 24.65  ? 155  ILE B CG1   1 
ATOM   6118  C CG2   . ILE B 1 155 ? -26.471 85.601  -0.100  1.00 24.31  ? 155  ILE B CG2   1 
ATOM   6119  C CD1   . ILE B 1 155 ? -27.688 82.909  -1.294  1.00 24.52  ? 155  ILE B CD1   1 
ATOM   6120  N N     . GLY B 1 156 ? -30.551 84.801  2.378   1.00 24.05  ? 156  GLY B N     1 
ATOM   6121  C CA    . GLY B 1 156 ? -31.960 84.419  2.514   1.00 23.43  ? 156  GLY B CA    1 
ATOM   6122  C C     . GLY B 1 156 ? -32.296 83.082  1.854   1.00 23.27  ? 156  GLY B C     1 
ATOM   6123  O O     . GLY B 1 156 ? -33.468 82.707  1.745   1.00 22.68  ? 156  GLY B O     1 
ATOM   6124  N N     . ALA B 1 157 ? -31.274 82.360  1.407   1.00 23.00  ? 157  ALA B N     1 
ATOM   6125  C CA    . ALA B 1 157 ? -31.450 80.940  1.112   1.00 23.56  ? 157  ALA B CA    1 
ATOM   6126  C C     . ALA B 1 157 ? -31.758 80.165  2.412   1.00 23.60  ? 157  ALA B C     1 
ATOM   6127  O O     . ALA B 1 157 ? -31.361 80.570  3.513   1.00 23.83  ? 157  ALA B O     1 
ATOM   6128  C CB    . ALA B 1 157 ? -30.228 80.385  0.420   1.00 24.00  ? 157  ALA B CB    1 
ATOM   6129  N N     . VAL B 1 158 ? -32.504 79.076  2.272   1.00 23.37  ? 158  VAL B N     1 
ATOM   6130  C CA    . VAL B 1 158 ? -32.980 78.304  3.394   1.00 22.63  ? 158  VAL B CA    1 
ATOM   6131  C C     . VAL B 1 158 ? -32.213 76.992  3.447   1.00 23.14  ? 158  VAL B C     1 
ATOM   6132  O O     . VAL B 1 158 ? -32.481 76.073  2.668   1.00 23.83  ? 158  VAL B O     1 
ATOM   6133  C CB    . VAL B 1 158 ? -34.481 77.992  3.261   1.00 22.80  ? 158  VAL B CB    1 
ATOM   6134  C CG1   . VAL B 1 158 ? -34.980 77.225  4.488   1.00 22.63  ? 158  VAL B CG1   1 
ATOM   6135  C CG2   . VAL B 1 158 ? -35.277 79.266  3.049   1.00 21.90  ? 158  VAL B CG2   1 
ATOM   6136  N N     . HIS B 1 159 ? -31.256 76.897  4.366   1.00 22.71  ? 159  HIS B N     1 
ATOM   6137  C CA    . HIS B 1 159 ? -30.452 75.694  4.452   1.00 22.47  ? 159  HIS B CA    1 
ATOM   6138  C C     . HIS B 1 159 ? -31.232 74.536  5.075   1.00 22.04  ? 159  HIS B C     1 
ATOM   6139  O O     . HIS B 1 159 ? -32.055 74.726  5.963   1.00 22.20  ? 159  HIS B O     1 
ATOM   6140  C CB    . HIS B 1 159 ? -29.064 75.943  5.110   1.00 22.23  ? 159  HIS B CB    1 
ATOM   6141  C CG    . HIS B 1 159 ? -29.095 76.310  6.573   1.00 21.98  ? 159  HIS B CG    1 
ATOM   6142  N ND1   . HIS B 1 159 ? -29.665 75.512  7.544   1.00 22.59  ? 159  HIS B ND1   1 
ATOM   6143  C CD2   . HIS B 1 159 ? -28.553 77.366  7.235   1.00 22.39  ? 159  HIS B CD2   1 
ATOM   6144  C CE1   . HIS B 1 159 ? -29.498 76.071  8.732   1.00 22.13  ? 159  HIS B CE1   1 
ATOM   6145  N NE2   . HIS B 1 159 ? -28.825 77.197  8.572   1.00 22.01  ? 159  HIS B NE2   1 
ATOM   6146  N N     . SER B 1 160 ? -31.012 73.343  4.546   1.00 21.72  ? 160  SER B N     1 
ATOM   6147  C CA    . SER B 1 160 ? -31.464 72.130  5.203   1.00 21.39  ? 160  SER B CA    1 
ATOM   6148  C C     . SER B 1 160 ? -30.234 71.235  5.443   1.00 21.00  ? 160  SER B C     1 
ATOM   6149  O O     . SER B 1 160 ? -29.675 70.642  4.508   1.00 20.88  ? 160  SER B O     1 
ATOM   6150  C CB    . SER B 1 160 ? -32.544 71.437  4.384   1.00 20.84  ? 160  SER B CB    1 
ATOM   6151  O OG    . SER B 1 160 ? -32.944 70.248  5.040   1.00 22.82  ? 160  SER B OG    1 
ATOM   6152  N N     . VAL B 1 161 ? -29.773 71.205  6.686   1.00 20.55  ? 161  VAL B N     1 
ATOM   6153  C CA    . VAL B 1 161 ? -28.571 70.426  7.048   1.00 20.73  ? 161  VAL B CA    1 
ATOM   6154  C C     . VAL B 1 161 ? -28.991 68.987  7.320   1.00 20.94  ? 161  VAL B C     1 
ATOM   6155  O O     . VAL B 1 161 ? -29.958 68.755  8.051   1.00 20.91  ? 161  VAL B O     1 
ATOM   6156  C CB    . VAL B 1 161 ? -27.821 71.038  8.261   1.00 20.49  ? 161  VAL B CB    1 
ATOM   6157  C CG1   . VAL B 1 161 ? -26.572 70.227  8.622   1.00 20.85  ? 161  VAL B CG1   1 
ATOM   6158  C CG2   . VAL B 1 161 ? -27.435 72.507  7.976   1.00 20.74  ? 161  VAL B CG2   1 
ATOM   6159  N N     . ILE B 1 162 ? -28.292 68.047  6.678   1.00 20.98  ? 162  ILE B N     1 
ATOM   6160  C CA    . ILE B 1 162 ? -28.518 66.612  6.825   1.00 21.19  ? 162  ILE B CA    1 
ATOM   6161  C C     . ILE B 1 162 ? -27.337 66.000  7.560   1.00 21.39  ? 162  ILE B C     1 
ATOM   6162  O O     . ILE B 1 162 ? -26.185 66.141  7.135   1.00 21.83  ? 162  ILE B O     1 
ATOM   6163  C CB    . ILE B 1 162 ? -28.657 65.916  5.442   1.00 21.80  ? 162  ILE B CB    1 
ATOM   6164  C CG1   . ILE B 1 162 ? -29.808 66.524  4.641   1.00 20.00  ? 162  ILE B CG1   1 
ATOM   6165  C CG2   . ILE B 1 162 ? -28.813 64.388  5.590   1.00 21.12  ? 162  ILE B CG2   1 
ATOM   6166  C CD1   . ILE B 1 162 ? -29.750 66.144  3.185   1.00 20.93  ? 162  ILE B CD1   1 
ATOM   6167  N N     . PHE B 1 163 ? -27.631 65.330  8.670   1.00 21.32  ? 163  PHE B N     1 
ATOM   6168  C CA    . PHE B 1 163 ? -26.637 64.658  9.493   1.00 20.68  ? 163  PHE B CA    1 
ATOM   6169  C C     . PHE B 1 163 ? -25.766 63.697  8.669   1.00 20.48  ? 163  PHE B C     1 
ATOM   6170  O O     . PHE B 1 163 ? -26.270 62.852  7.930   1.00 20.17  ? 163  PHE B O     1 
ATOM   6171  C CB    . PHE B 1 163 ? -27.364 63.928  10.627  1.00 20.99  ? 163  PHE B CB    1 
ATOM   6172  C CG    . PHE B 1 163 ? -26.462 63.085  11.523  1.00 21.86  ? 163  PHE B CG    1 
ATOM   6173  C CD1   . PHE B 1 163 ? -25.409 63.661  12.231  1.00 20.93  ? 163  PHE B CD1   1 
ATOM   6174  C CD2   . PHE B 1 163 ? -26.703 61.709  11.676  1.00 20.98  ? 163  PHE B CD2   1 
ATOM   6175  C CE1   . PHE B 1 163 ? -24.600 62.870  13.075  1.00 20.93  ? 163  PHE B CE1   1 
ATOM   6176  C CE2   . PHE B 1 163 ? -25.912 60.929  12.508  1.00 20.28  ? 163  PHE B CE2   1 
ATOM   6177  C CZ    . PHE B 1 163 ? -24.857 61.504  13.211  1.00 20.05  ? 163  PHE B CZ    1 
ATOM   6178  N N     . GLY B 1 164 ? -24.454 63.835  8.795   1.00 20.51  ? 164  GLY B N     1 
ATOM   6179  C CA    . GLY B 1 164 ? -23.524 63.071  7.977   1.00 20.62  ? 164  GLY B CA    1 
ATOM   6180  C C     . GLY B 1 164 ? -23.634 61.574  8.191   1.00 21.03  ? 164  GLY B C     1 
ATOM   6181  O O     . GLY B 1 164 ? -23.064 60.806  7.442   1.00 21.72  ? 164  GLY B O     1 
ATOM   6182  N N     . GLY B 1 165 ? -24.358 61.164  9.229   1.00 21.26  ? 165  GLY B N     1 
ATOM   6183  C CA    . GLY B 1 165 ? -24.592 59.766  9.502   1.00 21.06  ? 165  GLY B CA    1 
ATOM   6184  C C     . GLY B 1 165 ? -25.817 59.209  8.796   1.00 21.48  ? 165  GLY B C     1 
ATOM   6185  O O     . GLY B 1 165 ? -26.100 58.017  8.904   1.00 22.12  ? 165  GLY B O     1 
ATOM   6186  N N     . PHE B 1 166 ? -26.562 60.042  8.077   1.00 20.67  ? 166  PHE B N     1 
ATOM   6187  C CA    . PHE B 1 166 ? -27.660 59.495  7.299   1.00 20.28  ? 166  PHE B CA    1 
ATOM   6188  C C     . PHE B 1 166 ? -27.172 58.741  6.053   1.00 20.39  ? 166  PHE B C     1 
ATOM   6189  O O     . PHE B 1 166 ? -26.189 59.134  5.416   1.00 19.06  ? 166  PHE B O     1 
ATOM   6190  C CB    . PHE B 1 166 ? -28.694 60.563  6.944   1.00 19.85  ? 166  PHE B CB    1 
ATOM   6191  C CG    . PHE B 1 166 ? -29.621 60.892  8.079   1.00 19.86  ? 166  PHE B CG    1 
ATOM   6192  C CD1   . PHE B 1 166 ? -30.445 59.906  8.633   1.00 18.85  ? 166  PHE B CD1   1 
ATOM   6193  C CD2   . PHE B 1 166 ? -29.680 62.182  8.597   1.00 19.19  ? 166  PHE B CD2   1 
ATOM   6194  C CE1   . PHE B 1 166 ? -31.298 60.193  9.681   1.00 17.79  ? 166  PHE B CE1   1 
ATOM   6195  C CE2   . PHE B 1 166 ? -30.550 62.477  9.647   1.00 19.92  ? 166  PHE B CE2   1 
ATOM   6196  C CZ    . PHE B 1 166 ? -31.352 61.472  10.196  1.00 17.78  ? 166  PHE B CZ    1 
ATOM   6197  N N     . SER B 1 167 ? -27.857 57.643  5.733   1.00 20.22  ? 167  SER B N     1 
ATOM   6198  C CA    . SER B 1 167 ? -27.528 56.889  4.539   1.00 21.39  ? 167  SER B CA    1 
ATOM   6199  C C     . SER B 1 167 ? -28.006 57.620  3.257   1.00 21.55  ? 167  SER B C     1 
ATOM   6200  O O     . SER B 1 167 ? -28.793 58.573  3.344   1.00 21.11  ? 167  SER B O     1 
ATOM   6201  C CB    . SER B 1 167 ? -28.166 55.518  4.612   1.00 21.39  ? 167  SER B CB    1 
ATOM   6202  O OG    . SER B 1 167 ? -29.564 55.655  4.388   1.00 22.52  ? 167  SER B OG    1 
ATOM   6203  N N     . PRO B 1 168 ? -27.512 57.183  2.076   1.00 21.61  ? 168  PRO B N     1 
ATOM   6204  C CA    . PRO B 1 168 ? -27.935 57.686  0.778   1.00 21.73  ? 168  PRO B CA    1 
ATOM   6205  C C     . PRO B 1 168 ? -29.453 57.791  0.639   1.00 22.47  ? 168  PRO B C     1 
ATOM   6206  O O     . PRO B 1 168 ? -29.953 58.823  0.177   1.00 22.22  ? 168  PRO B O     1 
ATOM   6207  C CB    . PRO B 1 168 ? -27.383 56.632  -0.186  1.00 21.36  ? 168  PRO B CB    1 
ATOM   6208  C CG    . PRO B 1 168 ? -26.147 56.203  0.449   1.00 21.58  ? 168  PRO B CG    1 
ATOM   6209  C CD    . PRO B 1 168 ? -26.444 56.173  1.925   1.00 21.76  ? 168  PRO B CD    1 
ATOM   6210  N N     . GLU B 1 169 ? -30.174 56.747  1.054   1.00 23.38  ? 169  GLU B N     1 
ATOM   6211  C CA    . GLU B 1 169 ? -31.634 56.745  0.971   1.00 24.63  ? 169  GLU B CA    1 
ATOM   6212  C C     . GLU B 1 169 ? -32.239 57.857  1.848   1.00 24.73  ? 169  GLU B C     1 
ATOM   6213  O O     . GLU B 1 169 ? -33.159 58.591  1.424   1.00 25.08  ? 169  GLU B O     1 
ATOM   6214  C CB    . GLU B 1 169 ? -32.196 55.370  1.333   1.00 24.78  ? 169  GLU B CB    1 
ATOM   6215  C CG    . GLU B 1 169 ? -33.719 55.311  1.350   1.00 28.51  ? 169  GLU B CG    1 
ATOM   6216  C CD    . GLU B 1 169 ? -34.367 55.464  -0.040  1.00 33.69  ? 169  GLU B CD    1 
ATOM   6217  O OE1   . GLU B 1 169 ? -33.840 54.906  -1.037  1.00 35.23  ? 169  GLU B OE1   1 
ATOM   6218  O OE2   . GLU B 1 169 ? -35.429 56.124  -0.127  1.00 35.76  ? 169  GLU B OE2   1 
ATOM   6219  N N     . ALA B 1 170 ? -31.703 57.995  3.054   1.00 24.63  ? 170  ALA B N     1 
ATOM   6220  C CA    . ALA B 1 170 ? -32.127 59.063  3.966   1.00 25.22  ? 170  ALA B CA    1 
ATOM   6221  C C     . ALA B 1 170 ? -31.790 60.447  3.408   1.00 24.94  ? 170  ALA B C     1 
ATOM   6222  O O     . ALA B 1 170 ? -32.538 61.390  3.603   1.00 25.28  ? 170  ALA B O     1 
ATOM   6223  C CB    . ALA B 1 170 ? -31.502 58.876  5.344   1.00 24.91  ? 170  ALA B CB    1 
ATOM   6224  N N     . VAL B 1 171 ? -30.674 60.551  2.699   1.00 24.85  ? 171  VAL B N     1 
ATOM   6225  C CA    . VAL B 1 171 ? -30.257 61.818  2.103   1.00 24.59  ? 171  VAL B CA    1 
ATOM   6226  C C     . VAL B 1 171 ? -31.198 62.205  0.971   1.00 24.83  ? 171  VAL B C     1 
ATOM   6227  O O     . VAL B 1 171 ? -31.638 63.357  0.885   1.00 24.05  ? 171  VAL B O     1 
ATOM   6228  C CB    . VAL B 1 171 ? -28.796 61.740  1.600   1.00 24.27  ? 171  VAL B CB    1 
ATOM   6229  C CG1   . VAL B 1 171 ? -28.456 62.905  0.693   1.00 23.05  ? 171  VAL B CG1   1 
ATOM   6230  C CG2   . VAL B 1 171 ? -27.855 61.686  2.772   1.00 23.75  ? 171  VAL B CG2   1 
ATOM   6231  N N     . ALA B 1 172 ? -31.489 61.227  0.110   1.00 25.72  ? 172  ALA B N     1 
ATOM   6232  C CA    . ALA B 1 172 ? -32.369 61.414  -1.037  1.00 26.26  ? 172  ALA B CA    1 
ATOM   6233  C C     . ALA B 1 172 ? -33.738 61.828  -0.547  1.00 26.74  ? 172  ALA B C     1 
ATOM   6234  O O     . ALA B 1 172 ? -34.310 62.791  -1.046  1.00 27.42  ? 172  ALA B O     1 
ATOM   6235  C CB    . ALA B 1 172 ? -32.463 60.150  -1.849  1.00 26.52  ? 172  ALA B CB    1 
ATOM   6236  N N     . GLY B 1 173 ? -34.247 61.126  0.462   1.00 27.08  ? 173  GLY B N     1 
ATOM   6237  C CA    . GLY B 1 173 ? -35.542 61.462  1.051   1.00 26.61  ? 173  GLY B CA    1 
ATOM   6238  C C     . GLY B 1 173 ? -35.657 62.936  1.363   1.00 26.48  ? 173  GLY B C     1 
ATOM   6239  O O     . GLY B 1 173 ? -36.639 63.574  1.010   1.00 27.17  ? 173  GLY B O     1 
ATOM   6240  N N     . ARG B 1 174 ? -34.646 63.482  2.025   1.00 26.16  ? 174  ARG B N     1 
ATOM   6241  C CA    . ARG B 1 174 ? -34.676 64.884  2.447   1.00 25.90  ? 174  ARG B CA    1 
ATOM   6242  C C     . ARG B 1 174 ? -34.513 65.826  1.260   1.00 26.39  ? 174  ARG B C     1 
ATOM   6243  O O     . ARG B 1 174 ? -35.092 66.918  1.246   1.00 26.12  ? 174  ARG B O     1 
ATOM   6244  C CB    . ARG B 1 174 ? -33.615 65.152  3.521   1.00 25.83  ? 174  ARG B CB    1 
ATOM   6245  C CG    . ARG B 1 174 ? -34.005 64.593  4.883   1.00 24.63  ? 174  ARG B CG    1 
ATOM   6246  C CD    . ARG B 1 174 ? -32.809 64.167  5.724   1.00 24.59  ? 174  ARG B CD    1 
ATOM   6247  N NE    . ARG B 1 174 ? -33.252 63.783  7.068   1.00 24.14  ? 174  ARG B NE    1 
ATOM   6248  C CZ    . ARG B 1 174 ? -33.726 62.575  7.395   1.00 25.39  ? 174  ARG B CZ    1 
ATOM   6249  N NH1   . ARG B 1 174 ? -33.799 61.587  6.488   1.00 24.51  ? 174  ARG B NH1   1 
ATOM   6250  N NH2   . ARG B 1 174 ? -34.105 62.340  8.643   1.00 23.48  ? 174  ARG B NH2   1 
ATOM   6251  N N     . ILE B 1 175 ? -33.730 65.402  0.260   1.00 26.51  ? 175  ILE B N     1 
ATOM   6252  C CA    . ILE B 1 175 ? -33.508 66.228  -0.920  1.00 26.22  ? 175  ILE B CA    1 
ATOM   6253  C C     . ILE B 1 175 ? -34.819 66.356  -1.701  1.00 26.89  ? 175  ILE B C     1 
ATOM   6254  O O     . ILE B 1 175 ? -35.209 67.452  -2.126  1.00 27.44  ? 175  ILE B O     1 
ATOM   6255  C CB    . ILE B 1 175 ? -32.361 65.674  -1.820  1.00 26.30  ? 175  ILE B CB    1 
ATOM   6256  C CG1   . ILE B 1 175 ? -31.001 65.929  -1.154  1.00 25.14  ? 175  ILE B CG1   1 
ATOM   6257  C CG2   . ILE B 1 175 ? -32.405 66.306  -3.215  1.00 23.32  ? 175  ILE B CG2   1 
ATOM   6258  C CD1   . ILE B 1 175 ? -29.866 65.151  -1.778  1.00 26.18  ? 175  ILE B CD1   1 
ATOM   6259  N N     . ILE B 1 176 ? -35.505 65.234  -1.858  1.00 27.17  ? 176  ILE B N     1 
ATOM   6260  C CA    . ILE B 1 176 ? -36.754 65.188  -2.600  1.00 27.29  ? 176  ILE B CA    1 
ATOM   6261  C C     . ILE B 1 176 ? -37.817 66.095  -1.948  1.00 28.09  ? 176  ILE B C     1 
ATOM   6262  O O     . ILE B 1 176 ? -38.400 66.963  -2.623  1.00 27.08  ? 176  ILE B O     1 
ATOM   6263  C CB    . ILE B 1 176 ? -37.252 63.737  -2.768  1.00 27.16  ? 176  ILE B CB    1 
ATOM   6264  C CG1   . ILE B 1 176 ? -36.184 62.899  -3.494  1.00 26.63  ? 176  ILE B CG1   1 
ATOM   6265  C CG2   . ILE B 1 176 ? -38.595 63.718  -3.502  1.00 28.07  ? 176  ILE B CG2   1 
ATOM   6266  C CD1   . ILE B 1 176 ? -36.483 61.396  -3.621  1.00 26.00  ? 176  ILE B CD1   1 
ATOM   6267  N N     . ASP B 1 177 ? -38.039 65.912  -0.643  1.00 29.14  ? 177  ASP B N     1 
ATOM   6268  C CA    . ASP B 1 177 ? -39.060 66.684  0.058   1.00 30.52  ? 177  ASP B CA    1 
ATOM   6269  C C     . ASP B 1 177 ? -38.807 68.188  -0.091  1.00 30.89  ? 177  ASP B C     1 
ATOM   6270  O O     . ASP B 1 177 ? -39.718 68.940  -0.457  1.00 31.27  ? 177  ASP B O     1 
ATOM   6271  C CB    . ASP B 1 177 ? -39.165 66.294  1.536   1.00 30.55  ? 177  ASP B CB    1 
ATOM   6272  C CG    . ASP B 1 177 ? -40.389 66.918  2.217   1.00 33.00  ? 177  ASP B CG    1 
ATOM   6273  O OD1   . ASP B 1 177 ? -40.229 67.817  3.083   1.00 34.42  ? 177  ASP B OD1   1 
ATOM   6274  O OD2   . ASP B 1 177 ? -41.532 66.527  1.871   1.00 36.84  ? 177  ASP B OD2   1 
ATOM   6275  N N     . SER B 1 178 ? -37.562 68.606  0.144   1.00 31.10  ? 178  SER B N     1 
ATOM   6276  C CA    . SER B 1 178 ? -37.228 70.025  0.184   1.00 31.78  ? 178  SER B CA    1 
ATOM   6277  C C     . SER B 1 178 ? -37.033 70.648  -1.199  1.00 32.01  ? 178  SER B C     1 
ATOM   6278  O O     . SER B 1 178 ? -37.015 71.869  -1.323  1.00 32.59  ? 178  SER B O     1 
ATOM   6279  C CB    . SER B 1 178 ? -35.992 70.271  1.067   1.00 31.56  ? 178  SER B CB    1 
ATOM   6280  O OG    . SER B 1 178 ? -34.836 69.616  0.558   1.00 31.35  ? 178  SER B OG    1 
ATOM   6281  N N     . SER B 1 179 ? -36.901 69.805  -2.222  1.00 32.59  ? 179  SER B N     1 
ATOM   6282  C CA    . SER B 1 179 ? -36.549 70.223  -3.586  1.00 32.83  ? 179  SER B CA    1 
ATOM   6283  C C     . SER B 1 179 ? -35.263 71.069  -3.627  1.00 33.29  ? 179  SER B C     1 
ATOM   6284  O O     . SER B 1 179 ? -35.219 72.113  -4.318  1.00 33.58  ? 179  SER B O     1 
ATOM   6285  C CB    . SER B 1 179 ? -37.720 70.953  -4.290  1.00 32.89  ? 179  SER B CB    1 
ATOM   6286  O OG    . SER B 1 179 ? -38.569 70.049  -4.993  1.00 32.97  ? 179  SER B OG    1 
ATOM   6287  N N     . SER B 1 180 ? -34.220 70.614  -2.916  1.00 32.94  ? 180  SER B N     1 
ATOM   6288  C CA    . SER B 1 180 ? -32.945 71.350  -2.837  1.00 32.22  ? 180  SER B CA    1 
ATOM   6289  C C     . SER B 1 180 ? -32.336 71.525  -4.209  1.00 32.10  ? 180  SER B C     1 
ATOM   6290  O O     . SER B 1 180 ? -32.205 70.553  -4.952  1.00 31.79  ? 180  SER B O     1 
ATOM   6291  C CB    . SER B 1 180 ? -31.935 70.646  -1.932  1.00 32.32  ? 180  SER B CB    1 
ATOM   6292  O OG    . SER B 1 180 ? -32.519 70.265  -0.702  1.00 31.80  ? 180  SER B OG    1 
ATOM   6293  N N     . ARG B 1 181 ? -31.982 72.769  -4.543  1.00 32.01  ? 181  ARG B N     1 
ATOM   6294  C CA    . ARG B 1 181 ? -31.319 73.084  -5.817  1.00 32.30  ? 181  ARG B CA    1 
ATOM   6295  C C     . ARG B 1 181 ? -29.826 72.727  -5.786  1.00 30.93  ? 181  ARG B C     1 
ATOM   6296  O O     . ARG B 1 181 ? -29.180 72.603  -6.848  1.00 30.73  ? 181  ARG B O     1 
ATOM   6297  C CB    . ARG B 1 181 ? -31.497 74.561  -6.185  1.00 32.21  ? 181  ARG B CB    1 
ATOM   6298  C CG    . ARG B 1 181 ? -32.925 74.914  -6.628  1.00 34.19  ? 181  ARG B CG    1 
ATOM   6299  C CD    . ARG B 1 181 ? -33.012 76.343  -7.201  1.00 34.88  ? 181  ARG B CD    1 
ATOM   6300  N NE    . ARG B 1 181 ? -32.066 76.562  -8.303  1.00 38.75  ? 181  ARG B NE    1 
ATOM   6301  C CZ    . ARG B 1 181 ? -31.609 77.750  -8.702  1.00 40.33  ? 181  ARG B CZ    1 
ATOM   6302  N NH1   . ARG B 1 181 ? -32.001 78.878  -8.108  1.00 39.04  ? 181  ARG B NH1   1 
ATOM   6303  N NH2   . ARG B 1 181 ? -30.745 77.807  -9.714  1.00 42.00  ? 181  ARG B NH2   1 
ATOM   6304  N N     . LEU B 1 182 ? -29.297 72.544  -4.572  1.00 29.04  ? 182  LEU B N     1 
ATOM   6305  C CA    . LEU B 1 182 ? -27.862 72.385  -4.368  1.00 27.45  ? 182  LEU B CA    1 
ATOM   6306  C C     . LEU B 1 182 ? -27.530 71.476  -3.183  1.00 26.52  ? 182  LEU B C     1 
ATOM   6307  O O     . LEU B 1 182 ? -28.248 71.462  -2.182  1.00 26.26  ? 182  LEU B O     1 
ATOM   6308  C CB    . LEU B 1 182 ? -27.239 73.769  -4.194  1.00 27.25  ? 182  LEU B CB    1 
ATOM   6309  C CG    . LEU B 1 182 ? -25.771 73.988  -3.840  1.00 27.26  ? 182  LEU B CG    1 
ATOM   6310  C CD1   . LEU B 1 182 ? -24.853 73.659  -4.992  1.00 26.23  ? 182  LEU B CD1   1 
ATOM   6311  C CD2   . LEU B 1 182 ? -25.614 75.438  -3.428  1.00 27.30  ? 182  LEU B CD2   1 
ATOM   6312  N N     . VAL B 1 183 ? -26.460 70.692  -3.330  1.00 25.57  ? 183  VAL B N     1 
ATOM   6313  C CA    . VAL B 1 183 ? -25.909 69.915  -2.230  1.00 24.57  ? 183  VAL B CA    1 
ATOM   6314  C C     . VAL B 1 183 ? -24.459 70.333  -1.958  1.00 23.87  ? 183  VAL B C     1 
ATOM   6315  O O     . VAL B 1 183 ? -23.633 70.318  -2.857  1.00 23.35  ? 183  VAL B O     1 
ATOM   6316  C CB    . VAL B 1 183 ? -25.943 68.395  -2.499  1.00 25.25  ? 183  VAL B CB    1 
ATOM   6317  C CG1   . VAL B 1 183 ? -25.425 67.612  -1.251  1.00 24.51  ? 183  VAL B CG1   1 
ATOM   6318  C CG2   . VAL B 1 183 ? -27.341 67.938  -2.907  1.00 24.07  ? 183  VAL B CG2   1 
ATOM   6319  N N     . ILE B 1 184 ? -24.177 70.713  -0.711  1.00 23.30  ? 184  ILE B N     1 
ATOM   6320  C CA    . ILE B 1 184 ? -22.816 71.005  -0.238  1.00 22.52  ? 184  ILE B CA    1 
ATOM   6321  C C     . ILE B 1 184 ? -22.295 69.843  0.620   1.00 22.18  ? 184  ILE B C     1 
ATOM   6322  O O     . ILE B 1 184 ? -22.931 69.429  1.596   1.00 21.81  ? 184  ILE B O     1 
ATOM   6323  C CB    . ILE B 1 184 ? -22.756 72.322  0.572   1.00 22.71  ? 184  ILE B CB    1 
ATOM   6324  C CG1   . ILE B 1 184 ? -23.423 73.457  -0.220  1.00 22.90  ? 184  ILE B CG1   1 
ATOM   6325  C CG2   . ILE B 1 184 ? -21.311 72.686  0.888   1.00 22.28  ? 184  ILE B CG2   1 
ATOM   6326  C CD1   . ILE B 1 184 ? -23.604 74.739  0.546   1.00 22.27  ? 184  ILE B CD1   1 
ATOM   6327  N N     . THR B 1 185 ? -21.151 69.297  0.234   1.00 21.59  ? 185  THR B N     1 
ATOM   6328  C CA    . THR B 1 185 ? -20.626 68.144  0.929   1.00 21.46  ? 185  THR B CA    1 
ATOM   6329  C C     . THR B 1 185 ? -19.083 68.124  0.961   1.00 21.43  ? 185  THR B C     1 
ATOM   6330  O O     . THR B 1 185 ? -18.448 69.088  0.545   1.00 21.65  ? 185  THR B O     1 
ATOM   6331  C CB    . THR B 1 185 ? -21.270 66.845  0.384   1.00 20.85  ? 185  THR B CB    1 
ATOM   6332  O OG1   . THR B 1 185 ? -21.063 65.784  1.317   1.00 20.63  ? 185  THR B OG1   1 
ATOM   6333  C CG2   . THR B 1 185 ? -20.715 66.484  -0.955  1.00 21.31  ? 185  THR B CG2   1 
ATOM   6334  N N     . ALA B 1 186 ? -18.494 67.057  1.495   1.00 20.90  ? 186  ALA B N     1 
ATOM   6335  C CA    . ALA B 1 186 ? -17.039 66.899  1.514   1.00 20.83  ? 186  ALA B CA    1 
ATOM   6336  C C     . ALA B 1 186 ? -16.729 65.589  0.815   1.00 21.04  ? 186  ALA B C     1 
ATOM   6337  O O     . ALA B 1 186 ? -17.620 64.744  0.697   1.00 21.54  ? 186  ALA B O     1 
ATOM   6338  C CB    . ALA B 1 186 ? -16.517 66.864  2.945   1.00 20.42  ? 186  ALA B CB    1 
ATOM   6339  N N     . ASP B 1 187 ? -15.497 65.408  0.337   1.00 20.66  ? 187  ASP B N     1 
ATOM   6340  C CA    . ASP B 1 187 ? -15.125 64.117  -0.222  1.00 20.77  ? 187  ASP B CA    1 
ATOM   6341  C C     . ASP B 1 187 ? -15.337 63.003  0.821   1.00 20.78  ? 187  ASP B C     1 
ATOM   6342  O O     . ASP B 1 187 ? -15.963 61.972  0.541   1.00 20.63  ? 187  ASP B O     1 
ATOM   6343  C CB    . ASP B 1 187 ? -13.697 64.120  -0.788  1.00 20.78  ? 187  ASP B CB    1 
ATOM   6344  C CG    . ASP B 1 187 ? -12.644 64.664  0.188   1.00 21.82  ? 187  ASP B CG    1 
ATOM   6345  O OD1   . ASP B 1 187 ? -12.967 65.024  1.348   1.00 21.01  ? 187  ASP B OD1   1 
ATOM   6346  O OD2   . ASP B 1 187 ? -11.465 64.725  -0.233  1.00 21.85  ? 187  ASP B OD2   1 
ATOM   6347  N N     . GLU B 1 188 ? -14.824 63.237  2.026   1.00 20.85  ? 188  GLU B N     1 
ATOM   6348  C CA    . GLU B 1 188 ? -15.047 62.360  3.172   1.00 20.80  ? 188  GLU B CA    1 
ATOM   6349  C C     . GLU B 1 188 ? -15.097 63.176  4.460   1.00 21.00  ? 188  GLU B C     1 
ATOM   6350  O O     . GLU B 1 188 ? -14.533 64.269  4.547   1.00 20.42  ? 188  GLU B O     1 
ATOM   6351  C CB    . GLU B 1 188 ? -13.932 61.321  3.314   1.00 20.76  ? 188  GLU B CB    1 
ATOM   6352  C CG    . GLU B 1 188 ? -13.918 60.222  2.274   1.00 20.38  ? 188  GLU B CG    1 
ATOM   6353  C CD    . GLU B 1 188 ? -12.630 59.425  2.306   1.00 20.33  ? 188  GLU B CD    1 
ATOM   6354  O OE1   . GLU B 1 188 ? -11.587 59.968  2.747   1.00 19.20  ? 188  GLU B OE1   1 
ATOM   6355  O OE2   . GLU B 1 188 ? -12.654 58.246  1.895   1.00 20.98  ? 188  GLU B OE2   1 
ATOM   6356  N N     . GLY B 1 189 ? -15.780 62.629  5.457   1.00 21.27  ? 189  GLY B N     1 
ATOM   6357  C CA    . GLY B 1 189 ? -15.586 63.072  6.825   1.00 22.22  ? 189  GLY B CA    1 
ATOM   6358  C C     . GLY B 1 189 ? -14.601 62.145  7.503   1.00 22.67  ? 189  GLY B C     1 
ATOM   6359  O O     . GLY B 1 189 ? -14.282 61.052  6.997   1.00 23.15  ? 189  GLY B O     1 
ATOM   6360  N N     . VAL B 1 190 ? -14.129 62.577  8.663   1.00 22.89  ? 190  VAL B N     1 
ATOM   6361  C CA    . VAL B 1 190 ? -13.136 61.844  9.437   1.00 22.85  ? 190  VAL B CA    1 
ATOM   6362  C C     . VAL B 1 190 ? -13.685 61.778  10.863  1.00 23.53  ? 190  VAL B C     1 
ATOM   6363  O O     . VAL B 1 190 ? -14.135 62.800  11.425  1.00 23.42  ? 190  VAL B O     1 
ATOM   6364  C CB    . VAL B 1 190 ? -11.752 62.588  9.396   1.00 22.88  ? 190  VAL B CB    1 
ATOM   6365  C CG1   . VAL B 1 190 ? -10.694 61.862  10.182  1.00 22.45  ? 190  VAL B CG1   1 
ATOM   6366  C CG2   . VAL B 1 190 ? -11.298 62.784  7.965   1.00 22.95  ? 190  VAL B CG2   1 
ATOM   6367  N N     . ARG B 1 191 ? -13.669 60.583  11.439  1.00 23.72  ? 191  ARG B N     1 
ATOM   6368  C CA    . ARG B 1 191 ? -14.225 60.360  12.764  1.00 24.66  ? 191  ARG B CA    1 
ATOM   6369  C C     . ARG B 1 191 ? -13.639 59.091  13.342  1.00 24.25  ? 191  ARG B C     1 
ATOM   6370  O O     . ARG B 1 191 ? -13.743 58.041  12.729  1.00 24.29  ? 191  ARG B O     1 
ATOM   6371  C CB    . ARG B 1 191 ? -15.738 60.194  12.650  1.00 25.15  ? 191  ARG B CB    1 
ATOM   6372  C CG    . ARG B 1 191 ? -16.474 60.341  13.942  1.00 27.43  ? 191  ARG B CG    1 
ATOM   6373  C CD    . ARG B 1 191 ? -17.973 60.413  13.654  1.00 33.72  ? 191  ARG B CD    1 
ATOM   6374  N NE    . ARG B 1 191 ? -18.727 60.815  14.839  1.00 36.55  ? 191  ARG B NE    1 
ATOM   6375  C CZ    . ARG B 1 191 ? -19.069 59.952  15.779  1.00 37.61  ? 191  ARG B CZ    1 
ATOM   6376  N NH1   . ARG B 1 191 ? -18.719 58.671  15.626  1.00 38.30  ? 191  ARG B NH1   1 
ATOM   6377  N NH2   . ARG B 1 191 ? -19.753 60.357  16.844  1.00 37.01  ? 191  ARG B NH2   1 
ATOM   6378  N N     . ALA B 1 192 ? -13.035 59.190  14.524  1.00 24.50  ? 192  ALA B N     1 
ATOM   6379  C CA    . ALA B 1 192 ? -12.392 58.045  15.172  1.00 24.02  ? 192  ALA B CA    1 
ATOM   6380  C C     . ALA B 1 192 ? -11.387 57.376  14.237  1.00 23.95  ? 192  ALA B C     1 
ATOM   6381  O O     . ALA B 1 192 ? -11.368 56.147  14.080  1.00 23.51  ? 192  ALA B O     1 
ATOM   6382  C CB    . ALA B 1 192 ? -13.450 57.036  15.671  1.00 24.13  ? 192  ALA B CB    1 
ATOM   6383  N N     . GLY B 1 193 ? -10.566 58.203  13.599  1.00 23.72  ? 193  GLY B N     1 
ATOM   6384  C CA    . GLY B 1 193 ? -9.489  57.719  12.748  1.00 24.02  ? 193  GLY B CA    1 
ATOM   6385  C C     . GLY B 1 193 ? -9.969  57.040  11.487  1.00 24.23  ? 193  GLY B C     1 
ATOM   6386  O O     . GLY B 1 193 ? -9.197  56.369  10.806  1.00 23.78  ? 193  GLY B O     1 
ATOM   6387  N N     . ARG B 1 194 ? -11.249 57.240  11.177  1.00 25.16  ? 194  ARG B N     1 
ATOM   6388  C CA    . ARG B 1 194 ? -11.904 56.575  10.052  1.00 25.64  ? 194  ARG B CA    1 
ATOM   6389  C C     . ARG B 1 194 ? -12.547 57.562  9.091   1.00 25.12  ? 194  ARG B C     1 
ATOM   6390  O O     . ARG B 1 194 ? -12.984 58.631  9.502   1.00 24.05  ? 194  ARG B O     1 
ATOM   6391  C CB    . ARG B 1 194 ? -13.036 55.698  10.547  1.00 25.66  ? 194  ARG B CB    1 
ATOM   6392  C CG    . ARG B 1 194 ? -12.707 54.402  11.177  1.00 28.28  ? 194  ARG B CG    1 
ATOM   6393  C CD    . ARG B 1 194 ? -14.073 53.795  11.321  1.00 34.11  ? 194  ARG B CD    1 
ATOM   6394  N NE    . ARG B 1 194 ? -14.113 52.600  12.131  1.00 39.93  ? 194  ARG B NE    1 
ATOM   6395  C CZ    . ARG B 1 194 ? -15.175 52.237  12.845  1.00 42.65  ? 194  ARG B CZ    1 
ATOM   6396  N NH1   . ARG B 1 194 ? -16.267 53.006  12.838  1.00 41.77  ? 194  ARG B NH1   1 
ATOM   6397  N NH2   . ARG B 1 194 ? -15.136 51.112  13.575  1.00 43.47  ? 194  ARG B NH2   1 
ATOM   6398  N N     . SER B 1 195 ? -12.669 57.126  7.836   1.00 25.02  ? 195  SER B N     1 
ATOM   6399  C CA    . SER B 1 195 ? -13.382 57.829  6.763   1.00 25.76  ? 195  SER B CA    1 
ATOM   6400  C C     . SER B 1 195 ? -14.897 57.675  6.776   1.00 25.30  ? 195  SER B C     1 
ATOM   6401  O O     . SER B 1 195 ? -15.383 56.567  6.832   1.00 25.45  ? 195  SER B O     1 
ATOM   6402  C CB    . SER B 1 195 ? -12.910 57.260  5.433   1.00 25.58  ? 195  SER B CB    1 
ATOM   6403  O OG    . SER B 1 195 ? -11.945 58.113  4.889   1.00 28.42  ? 195  SER B OG    1 
ATOM   6404  N N     . ILE B 1 196 ? -15.643 58.772  6.686   1.00 25.28  ? 196  ILE B N     1 
ATOM   6405  C CA    . ILE B 1 196 ? -17.054 58.676  6.290   1.00 25.32  ? 196  ILE B CA    1 
ATOM   6406  C C     . ILE B 1 196 ? -17.157 59.057  4.789   1.00 25.02  ? 196  ILE B C     1 
ATOM   6407  O O     . ILE B 1 196 ? -16.674 60.130  4.398   1.00 24.74  ? 196  ILE B O     1 
ATOM   6408  C CB    . ILE B 1 196 ? -17.989 59.612  7.118   1.00 25.69  ? 196  ILE B CB    1 
ATOM   6409  C CG1   . ILE B 1 196 ? -17.672 59.588  8.627   1.00 27.05  ? 196  ILE B CG1   1 
ATOM   6410  C CG2   . ILE B 1 196 ? -19.469 59.278  6.859   1.00 25.87  ? 196  ILE B CG2   1 
ATOM   6411  C CD1   . ILE B 1 196 ? -17.944 58.239  9.337   1.00 27.76  ? 196  ILE B CD1   1 
ATOM   6412  N N     . PRO B 1 197 ? -17.793 58.195  3.950   1.00 24.16  ? 197  PRO B N     1 
ATOM   6413  C CA    . PRO B 1 197 ? -17.837 58.494  2.516   1.00 23.75  ? 197  PRO B CA    1 
ATOM   6414  C C     . PRO B 1 197 ? -18.999 59.421  2.131   1.00 23.45  ? 197  PRO B C     1 
ATOM   6415  O O     . PRO B 1 197 ? -19.912 59.004  1.400   1.00 23.26  ? 197  PRO B O     1 
ATOM   6416  C CB    . PRO B 1 197 ? -17.993 57.107  1.872   1.00 23.46  ? 197  PRO B CB    1 
ATOM   6417  C CG    . PRO B 1 197 ? -18.675 56.273  2.903   1.00 23.33  ? 197  PRO B CG    1 
ATOM   6418  C CD    . PRO B 1 197 ? -18.496 56.939  4.261   1.00 24.04  ? 197  PRO B CD    1 
ATOM   6419  N N     . LEU B 1 198 ? -18.950 60.665  2.614   1.00 23.00  ? 198  LEU B N     1 
ATOM   6420  C CA    . LEU B 1 198 ? -19.972 61.675  2.301   1.00 23.08  ? 198  LEU B CA    1 
ATOM   6421  C C     . LEU B 1 198 ? -20.271 61.833  0.813   1.00 22.97  ? 198  LEU B C     1 
ATOM   6422  O O     . LEU B 1 198 ? -21.413 61.710  0.418   1.00 23.09  ? 198  LEU B O     1 
ATOM   6423  C CB    . LEU B 1 198 ? -19.656 63.042  2.945   1.00 22.88  ? 198  LEU B CB    1 
ATOM   6424  C CG    . LEU B 1 198 ? -19.657 63.079  4.477   1.00 23.84  ? 198  LEU B CG    1 
ATOM   6425  C CD1   . LEU B 1 198 ? -19.205 64.423  4.958   1.00 23.75  ? 198  LEU B CD1   1 
ATOM   6426  C CD2   . LEU B 1 198 ? -21.039 62.715  5.084   1.00 22.82  ? 198  LEU B CD2   1 
ATOM   6427  N N     . LYS B 1 199 ? -19.263 62.098  -0.013  1.00 23.42  ? 199  LYS B N     1 
ATOM   6428  C CA    . LYS B 1 199 ? -19.541 62.373  -1.430  1.00 24.11  ? 199  LYS B CA    1 
ATOM   6429  C C     . LYS B 1 199 ? -20.115 61.149  -2.149  1.00 24.17  ? 199  LYS B C     1 
ATOM   6430  O O     . LYS B 1 199 ? -21.124 61.282  -2.844  1.00 24.72  ? 199  LYS B O     1 
ATOM   6431  C CB    . LYS B 1 199 ? -18.319 62.965  -2.165  1.00 24.24  ? 199  LYS B CB    1 
ATOM   6432  C CG    . LYS B 1 199 ? -18.327 62.813  -3.706  1.00 24.94  ? 199  LYS B CG    1 
ATOM   6433  C CD    . LYS B 1 199 ? -19.190 63.815  -4.418  1.00 25.23  ? 199  LYS B CD    1 
ATOM   6434  C CE    . LYS B 1 199 ? -18.660 64.073  -5.833  1.00 25.09  ? 199  LYS B CE    1 
ATOM   6435  N NZ    . LYS B 1 199 ? -19.162 63.157  -6.936  1.00 25.60  ? 199  LYS B NZ    1 
ATOM   6436  N N     . LYS B 1 200 ? -19.504 59.973  -1.959  1.00 24.00  ? 200  LYS B N     1 
ATOM   6437  C CA    . LYS B 1 200 ? -20.034 58.717  -2.528  1.00 23.94  ? 200  LYS B CA    1 
ATOM   6438  C C     . LYS B 1 200 ? -21.484 58.491  -2.130  1.00 23.17  ? 200  LYS B C     1 
ATOM   6439  O O     . LYS B 1 200 ? -22.262 58.021  -2.948  1.00 23.27  ? 200  LYS B O     1 
ATOM   6440  C CB    . LYS B 1 200 ? -19.174 57.458  -2.207  1.00 23.72  ? 200  LYS B CB    1 
ATOM   6441  C CG    . LYS B 1 200 ? -19.803 56.115  -2.719  1.00 24.16  ? 200  LYS B CG    1 
ATOM   6442  C CD    . LYS B 1 200 ? -18.780 54.957  -2.972  1.00 25.43  ? 200  LYS B CD    1 
ATOM   6443  C CE    . LYS B 1 200 ? -19.431 53.537  -3.055  1.00 25.96  ? 200  LYS B CE    1 
ATOM   6444  N NZ    . LYS B 1 200 ? -20.744 53.358  -3.860  1.00 26.12  ? 200  LYS B NZ    1 
ATOM   6445  N N     . ASN B 1 201 ? -21.842 58.818  -0.891  1.00 22.76  ? 201  ASN B N     1 
ATOM   6446  C CA    . ASN B 1 201 ? -23.241 58.695  -0.437  1.00 22.64  ? 201  ASN B CA    1 
ATOM   6447  C C     . ASN B 1 201 ? -24.169 59.597  -1.242  1.00 22.81  ? 201  ASN B C     1 
ATOM   6448  O O     . ASN B 1 201 ? -25.276 59.190  -1.618  1.00 22.86  ? 201  ASN B O     1 
ATOM   6449  C CB    . ASN B 1 201 ? -23.391 59.026  1.053   1.00 21.82  ? 201  ASN B CB    1 
ATOM   6450  C CG    . ASN B 1 201 ? -22.862 57.930  1.965   1.00 22.59  ? 201  ASN B CG    1 
ATOM   6451  O OD1   . ASN B 1 201 ? -22.460 56.847  1.511   1.00 21.96  ? 201  ASN B OD1   1 
ATOM   6452  N ND2   . ASN B 1 201 ? -22.871 58.202  3.272   1.00 18.33  ? 201  ASN B ND2   1 
ATOM   6453  N N     . VAL B 1 202 ? -23.711 60.828  -1.488  1.00 23.15  ? 202  VAL B N     1 
ATOM   6454  C CA    . VAL B 1 202 ? -24.460 61.814  -2.276  1.00 23.16  ? 202  VAL B CA    1 
ATOM   6455  C C     . VAL B 1 202 ? -24.611 61.316  -3.721  1.00 23.69  ? 202  VAL B C     1 
ATOM   6456  O O     . VAL B 1 202 ? -25.702 61.367  -4.284  1.00 23.65  ? 202  VAL B O     1 
ATOM   6457  C CB    . VAL B 1 202 ? -23.789 63.211  -2.223  1.00 23.30  ? 202  VAL B CB    1 
ATOM   6458  C CG1   . VAL B 1 202 ? -24.443 64.192  -3.232  1.00 22.87  ? 202  VAL B CG1   1 
ATOM   6459  C CG2   . VAL B 1 202 ? -23.832 63.779  -0.784  1.00 21.67  ? 202  VAL B CG2   1 
ATOM   6460  N N     . ASP B 1 203 ? -23.520 60.813  -4.299  1.00 24.12  ? 203  ASP B N     1 
ATOM   6461  C CA    . ASP B 1 203 ? -23.566 60.170  -5.607  1.00 24.75  ? 203  ASP B CA    1 
ATOM   6462  C C     . ASP B 1 203 ? -24.665 59.121  -5.666  1.00 25.13  ? 203  ASP B C     1 
ATOM   6463  O O     . ASP B 1 203 ? -25.440 59.091  -6.624  1.00 24.83  ? 203  ASP B O     1 
ATOM   6464  C CB    . ASP B 1 203 ? -22.226 59.521  -5.934  1.00 24.70  ? 203  ASP B CB    1 
ATOM   6465  C CG    . ASP B 1 203 ? -21.194 60.523  -6.395  1.00 25.79  ? 203  ASP B CG    1 
ATOM   6466  O OD1   . ASP B 1 203 ? -21.543 61.707  -6.619  1.00 25.80  ? 203  ASP B OD1   1 
ATOM   6467  O OD2   . ASP B 1 203 ? -20.022 60.120  -6.538  1.00 28.02  ? 203  ASP B OD2   1 
ATOM   6468  N N     . ASP B 1 204 ? -24.727 58.275  -4.633  1.00 25.76  ? 204  ASP B N     1 
ATOM   6469  C CA    . ASP B 1 204 ? -25.732 57.215  -4.541  1.00 26.57  ? 204  ASP B CA    1 
ATOM   6470  C C     . ASP B 1 204 ? -27.145 57.778  -4.394  1.00 26.65  ? 204  ASP B C     1 
ATOM   6471  O O     . ASP B 1 204 ? -28.049 57.361  -5.106  1.00 26.35  ? 204  ASP B O     1 
ATOM   6472  C CB    . ASP B 1 204 ? -25.411 56.261  -3.394  1.00 26.53  ? 204  ASP B CB    1 
ATOM   6473  C CG    . ASP B 1 204 ? -24.178 55.408  -3.670  1.00 27.61  ? 204  ASP B CG    1 
ATOM   6474  O OD1   . ASP B 1 204 ? -23.606 54.863  -2.694  1.00 27.83  ? 204  ASP B OD1   1 
ATOM   6475  O OD2   . ASP B 1 204 ? -23.772 55.289  -4.857  1.00 28.47  ? 204  ASP B OD2   1 
ATOM   6476  N N     . ALA B 1 205 ? -27.308 58.740  -3.487  1.00 27.10  ? 205  ALA B N     1 
ATOM   6477  C CA    . ALA B 1 205 ? -28.597 59.410  -3.258  1.00 27.67  ? 205  ALA B CA    1 
ATOM   6478  C C     . ALA B 1 205 ? -29.186 60.052  -4.523  1.00 28.32  ? 205  ALA B C     1 
ATOM   6479  O O     . ALA B 1 205 ? -30.406 60.102  -4.688  1.00 28.52  ? 205  ALA B O     1 
ATOM   6480  C CB    . ALA B 1 205 ? -28.458 60.458  -2.146  1.00 26.96  ? 205  ALA B CB    1 
ATOM   6481  N N     . LEU B 1 206 ? -28.318 60.561  -5.399  1.00 29.21  ? 206  LEU B N     1 
ATOM   6482  C CA    . LEU B 1 206 ? -28.753 61.275  -6.596  1.00 29.99  ? 206  LEU B CA    1 
ATOM   6483  C C     . LEU B 1 206 ? -29.010 60.348  -7.794  1.00 30.88  ? 206  LEU B C     1 
ATOM   6484  O O     . LEU B 1 206 ? -29.509 60.794  -8.827  1.00 30.85  ? 206  LEU B O     1 
ATOM   6485  C CB    . LEU B 1 206 ? -27.780 62.412  -6.955  1.00 29.77  ? 206  LEU B CB    1 
ATOM   6486  C CG    . LEU B 1 206 ? -27.481 63.535  -5.947  1.00 29.28  ? 206  LEU B CG    1 
ATOM   6487  C CD1   . LEU B 1 206 ? -26.683 64.646  -6.603  1.00 28.81  ? 206  LEU B CD1   1 
ATOM   6488  C CD2   . LEU B 1 206 ? -28.710 64.114  -5.277  1.00 29.94  ? 206  LEU B CD2   1 
ATOM   6489  N N     . LYS B 1 207 ? -28.691 59.061  -7.641  1.00 31.91  ? 207  LYS B N     1 
ATOM   6490  C CA    . LYS B 1 207 ? -29.100 58.033  -8.603  1.00 32.74  ? 207  LYS B CA    1 
ATOM   6491  C C     . LYS B 1 207 ? -30.574 57.655  -8.407  1.00 33.30  ? 207  LYS B C     1 
ATOM   6492  O O     . LYS B 1 207 ? -31.151 56.945  -9.235  1.00 33.42  ? 207  LYS B O     1 
ATOM   6493  C CB    . LYS B 1 207 ? -28.210 56.787  -8.498  1.00 33.03  ? 207  LYS B CB    1 
ATOM   6494  C CG    . LYS B 1 207 ? -26.798 56.945  -9.083  1.00 33.89  ? 207  LYS B CG    1 
ATOM   6495  C CD    . LYS B 1 207 ? -25.833 55.920  -8.442  1.00 35.96  ? 207  LYS B CD    1 
ATOM   6496  C CE    . LYS B 1 207 ? -24.460 55.889  -9.135  1.00 36.78  ? 207  LYS B CE    1 
ATOM   6497  N NZ    . LYS B 1 207 ? -23.605 54.727  -8.713  1.00 35.94  ? 207  LYS B NZ    1 
ATOM   6498  N N     . ASN B 1 208 ? -31.171 58.113  -7.300  1.00 33.83  ? 208  ASN B N     1 
ATOM   6499  C CA    . ASN B 1 208 ? -32.614 57.999  -7.073  1.00 33.85  ? 208  ASN B CA    1 
ATOM   6500  C C     . ASN B 1 208 ? -33.338 58.766  -8.166  1.00 34.18  ? 208  ASN B C     1 
ATOM   6501  O O     . ASN B 1 208 ? -33.133 59.972  -8.309  1.00 33.79  ? 208  ASN B O     1 
ATOM   6502  C CB    . ASN B 1 208 ? -32.999 58.568  -5.702  1.00 34.07  ? 208  ASN B CB    1 
ATOM   6503  C CG    . ASN B 1 208 ? -34.392 58.113  -5.230  1.00 33.94  ? 208  ASN B CG    1 
ATOM   6504  O OD1   . ASN B 1 208 ? -35.416 58.425  -5.834  1.00 32.40  ? 208  ASN B OD1   1 
ATOM   6505  N ND2   . ASN B 1 208 ? -34.416 57.390  -4.127  1.00 34.69  ? 208  ASN B ND2   1 
ATOM   6506  N N     . PRO B 1 209 ? -34.183 58.067  -8.948  1.00 34.77  ? 209  PRO B N     1 
ATOM   6507  C CA    . PRO B 1 209 ? -34.818 58.675  -10.123 1.00 35.10  ? 209  PRO B CA    1 
ATOM   6508  C C     . PRO B 1 209 ? -35.755 59.810  -9.744  1.00 35.34  ? 209  PRO B C     1 
ATOM   6509  O O     . PRO B 1 209 ? -36.040 60.668  -10.572 1.00 35.72  ? 209  PRO B O     1 
ATOM   6510  C CB    . PRO B 1 209 ? -35.599 57.513  -10.751 1.00 35.34  ? 209  PRO B CB    1 
ATOM   6511  C CG    . PRO B 1 209 ? -35.820 56.540  -9.620  1.00 35.18  ? 209  PRO B CG    1 
ATOM   6512  C CD    . PRO B 1 209 ? -34.596 56.661  -8.759  1.00 34.80  ? 209  PRO B CD    1 
ATOM   6513  N N     . ASN B 1 210 ? -36.189 59.828  -8.486  1.00 35.41  ? 210  ASN B N     1 
ATOM   6514  C CA    . ASN B 1 210 ? -37.096 60.858  -7.988  1.00 35.37  ? 210  ASN B CA    1 
ATOM   6515  C C     . ASN B 1 210 ? -36.420 62.163  -7.532  1.00 35.12  ? 210  ASN B C     1 
ATOM   6516  O O     . ASN B 1 210 ? -37.095 63.140  -7.190  1.00 35.27  ? 210  ASN B O     1 
ATOM   6517  C CB    . ASN B 1 210 ? -37.988 60.261  -6.902  1.00 35.54  ? 210  ASN B CB    1 
ATOM   6518  C CG    . ASN B 1 210 ? -38.801 59.074  -7.419  1.00 36.61  ? 210  ASN B CG    1 
ATOM   6519  O OD1   . ASN B 1 210 ? -39.835 59.252  -8.062  1.00 36.32  ? 210  ASN B OD1   1 
ATOM   6520  N ND2   . ASN B 1 210 ? -38.313 57.857  -7.165  1.00 37.71  ? 210  ASN B ND2   1 
ATOM   6521  N N     . VAL B 1 211 ? -35.089 62.182  -7.540  1.00 34.57  ? 211  VAL B N     1 
ATOM   6522  C CA    . VAL B 1 211 ? -34.342 63.413  -7.277  1.00 34.02  ? 211  VAL B CA    1 
ATOM   6523  C C     . VAL B 1 211 ? -34.168 64.160  -8.585  1.00 33.60  ? 211  VAL B C     1 
ATOM   6524  O O     . VAL B 1 211 ? -33.470 63.685  -9.485  1.00 33.29  ? 211  VAL B O     1 
ATOM   6525  C CB    . VAL B 1 211 ? -32.951 63.135  -6.653  1.00 34.09  ? 211  VAL B CB    1 
ATOM   6526  C CG1   . VAL B 1 211 ? -32.181 64.454  -6.447  1.00 34.18  ? 211  VAL B CG1   1 
ATOM   6527  C CG2   . VAL B 1 211 ? -33.099 62.384  -5.342  1.00 33.81  ? 211  VAL B CG2   1 
ATOM   6528  N N     . THR B 1 212 ? -34.809 65.321  -8.688  1.00 33.36  ? 212  THR B N     1 
ATOM   6529  C CA    . THR B 1 212 ? -34.858 66.075  -9.948  1.00 33.36  ? 212  THR B CA    1 
ATOM   6530  C C     . THR B 1 212 ? -34.434 67.537  -9.788  1.00 33.35  ? 212  THR B C     1 
ATOM   6531  O O     . THR B 1 212 ? -34.118 68.212  -10.785 1.00 32.63  ? 212  THR B O     1 
ATOM   6532  C CB    . THR B 1 212 ? -36.279 66.034  -10.586 1.00 33.58  ? 212  THR B CB    1 
ATOM   6533  O OG1   . THR B 1 212 ? -37.247 66.512  -9.637  1.00 33.18  ? 212  THR B OG1   1 
ATOM   6534  C CG2   . THR B 1 212 ? -36.646 64.606  -11.044 1.00 32.92  ? 212  THR B CG2   1 
ATOM   6535  N N     . SER B 1 213 ? -34.426 68.007  -8.535  1.00 33.22  ? 213  SER B N     1 
ATOM   6536  C CA    . SER B 1 213 ? -34.145 69.413  -8.207  1.00 33.11  ? 213  SER B CA    1 
ATOM   6537  C C     . SER B 1 213 ? -32.674 69.849  -8.253  1.00 33.04  ? 213  SER B C     1 
ATOM   6538  O O     . SER B 1 213 ? -32.397 71.025  -8.493  1.00 33.49  ? 213  SER B O     1 
ATOM   6539  C CB    . SER B 1 213 ? -34.752 69.791  -6.848  1.00 33.11  ? 213  SER B CB    1 
ATOM   6540  O OG    . SER B 1 213 ? -34.213 69.019  -5.780  1.00 33.20  ? 213  SER B OG    1 
ATOM   6541  N N     . VAL B 1 214 ? -31.747 68.915  -8.048  1.00 32.73  ? 214  VAL B N     1 
ATOM   6542  C CA    . VAL B 1 214 ? -30.348 69.270  -7.767  1.00 32.63  ? 214  VAL B CA    1 
ATOM   6543  C C     . VAL B 1 214 ? -29.572 69.529  -9.051  1.00 32.73  ? 214  VAL B C     1 
ATOM   6544  O O     . VAL B 1 214 ? -29.527 68.669  -9.932  1.00 32.79  ? 214  VAL B O     1 
ATOM   6545  C CB    . VAL B 1 214 ? -29.631 68.169  -6.903  1.00 32.76  ? 214  VAL B CB    1 
ATOM   6546  C CG1   . VAL B 1 214 ? -28.157 68.532  -6.615  1.00 31.24  ? 214  VAL B CG1   1 
ATOM   6547  C CG2   . VAL B 1 214 ? -30.397 67.917  -5.607  1.00 31.78  ? 214  VAL B CG2   1 
ATOM   6548  N N     . GLU B 1 215 ? -28.953 70.703  -9.134  1.00 32.64  ? 215  GLU B N     1 
ATOM   6549  C CA    . GLU B 1 215 ? -28.223 71.130  -10.337 1.00 33.36  ? 215  GLU B CA    1 
ATOM   6550  C C     . GLU B 1 215 ? -26.712 71.009  -10.154 1.00 32.65  ? 215  GLU B C     1 
ATOM   6551  O O     . GLU B 1 215 ? -25.969 70.707  -11.097 1.00 32.90  ? 215  GLU B O     1 
ATOM   6552  C CB    . GLU B 1 215 ? -28.578 72.579  -10.701 1.00 33.62  ? 215  GLU B CB    1 
ATOM   6553  C CG    . GLU B 1 215 ? -30.040 72.793  -11.099 1.00 36.70  ? 215  GLU B CG    1 
ATOM   6554  C CD    . GLU B 1 215 ? -30.517 74.230  -10.867 1.00 41.45  ? 215  GLU B CD    1 
ATOM   6555  O OE1   . GLU B 1 215 ? -31.747 74.467  -10.959 1.00 42.52  ? 215  GLU B OE1   1 
ATOM   6556  O OE2   . GLU B 1 215 ? -29.669 75.120  -10.579 1.00 42.91  ? 215  GLU B OE2   1 
ATOM   6557  N N     . HIS B 1 216 ? -26.259 71.266  -8.936  1.00 31.52  ? 216  HIS B N     1 
ATOM   6558  C CA    . HIS B 1 216 ? -24.851 71.162  -8.630  1.00 30.65  ? 216  HIS B CA    1 
ATOM   6559  C C     . HIS B 1 216 ? -24.603 70.521  -7.270  1.00 29.08  ? 216  HIS B C     1 
ATOM   6560  O O     . HIS B 1 216 ? -25.471 70.511  -6.395  1.00 28.34  ? 216  HIS B O     1 
ATOM   6561  C CB    . HIS B 1 216 ? -24.188 72.548  -8.713  1.00 31.22  ? 216  HIS B CB    1 
ATOM   6562  C CG    . HIS B 1 216 ? -24.189 73.125  -10.094 1.00 33.71  ? 216  HIS B CG    1 
ATOM   6563  N ND1   . HIS B 1 216 ? -23.282 72.741  -11.060 1.00 35.34  ? 216  HIS B ND1   1 
ATOM   6564  C CD2   . HIS B 1 216 ? -25.010 74.028  -10.683 1.00 34.75  ? 216  HIS B CD2   1 
ATOM   6565  C CE1   . HIS B 1 216 ? -23.533 73.397  -12.180 1.00 36.17  ? 216  HIS B CE1   1 
ATOM   6566  N NE2   . HIS B 1 216 ? -24.576 74.184  -11.978 1.00 36.44  ? 216  HIS B NE2   1 
ATOM   6567  N N     . VAL B 1 217 ? -23.397 69.983  -7.132  1.00 28.28  ? 217  VAL B N     1 
ATOM   6568  C CA    . VAL B 1 217 ? -22.867 69.465  -5.868  1.00 27.31  ? 217  VAL B CA    1 
ATOM   6569  C C     . VAL B 1 217 ? -21.524 70.161  -5.599  1.00 26.84  ? 217  VAL B C     1 
ATOM   6570  O O     . VAL B 1 217 ? -20.580 70.053  -6.382  1.00 26.37  ? 217  VAL B O     1 
ATOM   6571  C CB    . VAL B 1 217 ? -22.701 67.912  -5.879  1.00 26.89  ? 217  VAL B CB    1 
ATOM   6572  C CG1   . VAL B 1 217 ? -22.113 67.419  -4.548  1.00 27.46  ? 217  VAL B CG1   1 
ATOM   6573  C CG2   . VAL B 1 217 ? -24.023 67.226  -6.166  1.00 25.22  ? 217  VAL B CG2   1 
ATOM   6574  N N     . ILE B 1 218 ? -21.464 70.903  -4.501  1.00 26.48  ? 218  ILE B N     1 
ATOM   6575  C CA    . ILE B 1 218 ? -20.219 71.536  -4.087  1.00 26.23  ? 218  ILE B CA    1 
ATOM   6576  C C     . ILE B 1 218 ? -19.493 70.578  -3.144  1.00 25.80  ? 218  ILE B C     1 
ATOM   6577  O O     . ILE B 1 218 ? -20.082 70.051  -2.192  1.00 25.90  ? 218  ILE B O     1 
ATOM   6578  C CB    . ILE B 1 218 ? -20.463 72.932  -3.457  1.00 26.30  ? 218  ILE B CB    1 
ATOM   6579  C CG1   . ILE B 1 218 ? -21.099 73.863  -4.495  1.00 26.40  ? 218  ILE B CG1   1 
ATOM   6580  C CG2   . ILE B 1 218 ? -19.153 73.535  -2.915  1.00 26.38  ? 218  ILE B CG2   1 
ATOM   6581  C CD1   . ILE B 1 218 ? -21.503 75.216  -3.951  1.00 26.75  ? 218  ILE B CD1   1 
ATOM   6582  N N     . VAL B 1 219 ? -18.224 70.340  -3.441  1.00 25.03  ? 219  VAL B N     1 
ATOM   6583  C CA    . VAL B 1 219 ? -17.444 69.368  -2.722  1.00 24.75  ? 219  VAL B CA    1 
ATOM   6584  C C     . VAL B 1 219 ? -16.189 69.988  -2.114  1.00 25.13  ? 219  VAL B C     1 
ATOM   6585  O O     . VAL B 1 219 ? -15.314 70.489  -2.821  1.00 24.93  ? 219  VAL B O     1 
ATOM   6586  C CB    . VAL B 1 219 ? -17.070 68.146  -3.623  1.00 24.67  ? 219  VAL B CB    1 
ATOM   6587  C CG1   . VAL B 1 219 ? -16.414 67.033  -2.781  1.00 24.80  ? 219  VAL B CG1   1 
ATOM   6588  C CG2   . VAL B 1 219 ? -18.299 67.587  -4.327  1.00 23.17  ? 219  VAL B CG2   1 
ATOM   6589  N N     . LEU B 1 220 ? -16.111 69.932  -0.789  1.00 25.28  ? 220  LEU B N     1 
ATOM   6590  C CA    . LEU B 1 220 ? -14.907 70.291  -0.071  1.00 25.31  ? 220  LEU B CA    1 
ATOM   6591  C C     . LEU B 1 220 ? -13.937 69.121  -0.079  1.00 25.76  ? 220  LEU B C     1 
ATOM   6592  O O     . LEU B 1 220 ? -14.326 67.973  0.135   1.00 25.45  ? 220  LEU B O     1 
ATOM   6593  C CB    . LEU B 1 220 ? -15.261 70.653  1.363   1.00 25.57  ? 220  LEU B CB    1 
ATOM   6594  C CG    . LEU B 1 220 ? -14.123 71.087  2.277   1.00 25.96  ? 220  LEU B CG    1 
ATOM   6595  C CD1   . LEU B 1 220 ? -13.577 72.487  1.880   1.00 24.57  ? 220  LEU B CD1   1 
ATOM   6596  C CD2   . LEU B 1 220 ? -14.603 71.034  3.740   1.00 25.59  ? 220  LEU B CD2   1 
ATOM   6597  N N     . LYS B 1 221 ? -12.671 69.419  -0.334  1.00 26.09  ? 221  LYS B N     1 
ATOM   6598  C CA    . LYS B 1 221 ? -11.623 68.417  -0.300  1.00 26.87  ? 221  LYS B CA    1 
ATOM   6599  C C     . LYS B 1 221 ? -11.072 68.355  1.123   1.00 26.69  ? 221  LYS B C     1 
ATOM   6600  O O     . LYS B 1 221 ? -10.141 69.072  1.470   1.00 27.04  ? 221  LYS B O     1 
ATOM   6601  C CB    . LYS B 1 221 ? -10.508 68.758  -1.293  1.00 26.52  ? 221  LYS B CB    1 
ATOM   6602  C CG    . LYS B 1 221 ? -9.659  67.560  -1.660  1.00 28.66  ? 221  LYS B CG    1 
ATOM   6603  C CD    . LYS B 1 221 ? -8.655  67.884  -2.750  1.00 31.43  ? 221  LYS B CD    1 
ATOM   6604  C CE    . LYS B 1 221 ? -8.000  66.590  -3.285  1.00 36.50  ? 221  LYS B CE    1 
ATOM   6605  N NZ    . LYS B 1 221 ? -8.876  65.732  -4.209  1.00 37.35  ? 221  LYS B NZ    1 
ATOM   6606  N N     . ARG B 1 222 ? -11.669 67.507  1.946   1.00 26.89  ? 222  ARG B N     1 
ATOM   6607  C CA    . ARG B 1 222 ? -11.243 67.363  3.335   1.00 26.22  ? 222  ARG B CA    1 
ATOM   6608  C C     . ARG B 1 222 ? -10.083 66.387  3.415   1.00 26.24  ? 222  ARG B C     1 
ATOM   6609  O O     . ARG B 1 222 ? -9.046  66.711  3.978   1.00 25.94  ? 222  ARG B O     1 
ATOM   6610  C CB    . ARG B 1 222 ? -12.417 66.924  4.217   1.00 25.78  ? 222  ARG B CB    1 
ATOM   6611  C CG    . ARG B 1 222 ? -12.034 66.406  5.604   1.00 26.23  ? 222  ARG B CG    1 
ATOM   6612  C CD    . ARG B 1 222 ? -11.562 67.527  6.521   1.00 25.29  ? 222  ARG B CD    1 
ATOM   6613  N NE    . ARG B 1 222 ? -11.062 67.032  7.803   1.00 24.70  ? 222  ARG B NE    1 
ATOM   6614  C CZ    . ARG B 1 222 ? -9.806  66.621  8.016   1.00 26.61  ? 222  ARG B CZ    1 
ATOM   6615  N NH1   . ARG B 1 222 ? -8.913  66.615  7.029   1.00 24.82  ? 222  ARG B NH1   1 
ATOM   6616  N NH2   . ARG B 1 222 ? -9.439  66.204  9.223   1.00 26.84  ? 222  ARG B NH2   1 
ATOM   6617  N N     . THR B 1 223 ? -10.254 65.199  2.843   1.00 26.45  ? 223  THR B N     1 
ATOM   6618  C CA    . THR B 1 223 ? -9.244  64.140  2.966   1.00 26.94  ? 223  THR B CA    1 
ATOM   6619  C C     . THR B 1 223 ? -8.355  63.967  1.733   1.00 27.30  ? 223  THR B C     1 
ATOM   6620  O O     . THR B 1 223 ? -7.251  63.412  1.835   1.00 27.44  ? 223  THR B O     1 
ATOM   6621  C CB    . THR B 1 223 ? -9.880  62.766  3.276   1.00 27.04  ? 223  THR B CB    1 
ATOM   6622  O OG1   . THR B 1 223 ? -10.606 62.303  2.123   1.00 26.91  ? 223  THR B OG1   1 
ATOM   6623  C CG2   . THR B 1 223 ? -10.806 62.859  4.471   1.00 26.21  ? 223  THR B CG2   1 
ATOM   6624  N N     . GLY B 1 224 ? -8.845  64.413  0.578   1.00 27.12  ? 224  GLY B N     1 
ATOM   6625  C CA    . GLY B 1 224 ? -8.144  64.204  -0.680  1.00 28.06  ? 224  GLY B CA    1 
ATOM   6626  C C     . GLY B 1 224 ? -8.203  62.786  -1.242  1.00 28.62  ? 224  GLY B C     1 
ATOM   6627  O O     . GLY B 1 224 ? -7.419  62.435  -2.119  1.00 28.59  ? 224  GLY B O     1 
ATOM   6628  N N     . SER B 1 225 ? -9.134  61.972  -0.751  1.00 29.23  ? 225  SER B N     1 
ATOM   6629  C CA    . SER B 1 225 ? -9.280  60.595  -1.211  1.00 29.79  ? 225  SER B CA    1 
ATOM   6630  C C     . SER B 1 225 ? -9.890  60.501  -2.609  1.00 30.33  ? 225  SER B C     1 
ATOM   6631  O O     . SER B 1 225 ? -10.532 61.447  -3.092  1.00 29.57  ? 225  SER B O     1 
ATOM   6632  C CB    . SER B 1 225 ? -10.134 59.795  -0.224  1.00 30.03  ? 225  SER B CB    1 
ATOM   6633  O OG    . SER B 1 225 ? -9.402  59.469  0.944   1.00 30.04  ? 225  SER B OG    1 
ATOM   6634  N N     . ASP B 1 226 ? -9.693  59.347  -3.247  1.00 31.07  ? 226  ASP B N     1 
ATOM   6635  C CA    . ASP B 1 226 ? -10.185 59.130  -4.603  1.00 32.04  ? 226  ASP B CA    1 
ATOM   6636  C C     . ASP B 1 226 ? -11.694 59.043  -4.607  1.00 31.83  ? 226  ASP B C     1 
ATOM   6637  O O     . ASP B 1 226 ? -12.271 58.196  -3.926  1.00 32.31  ? 226  ASP B O     1 
ATOM   6638  C CB    . ASP B 1 226 ? -9.592  57.857  -5.209  1.00 32.42  ? 226  ASP B CB    1 
ATOM   6639  C CG    . ASP B 1 226 ? -8.128  58.017  -5.588  1.00 35.16  ? 226  ASP B CG    1 
ATOM   6640  O OD1   . ASP B 1 226 ? -7.680  59.172  -5.855  1.00 36.24  ? 226  ASP B OD1   1 
ATOM   6641  O OD2   . ASP B 1 226 ? -7.424  56.978  -5.616  1.00 37.72  ? 226  ASP B OD2   1 
ATOM   6642  N N     . ILE B 1 227 ? -12.327 59.935  -5.363  1.00 31.44  ? 227  ILE B N     1 
ATOM   6643  C CA    . ILE B 1 227 ? -13.786 59.954  -5.467  1.00 30.84  ? 227  ILE B CA    1 
ATOM   6644  C C     . ILE B 1 227 ? -14.186 59.967  -6.932  1.00 30.97  ? 227  ILE B C     1 
ATOM   6645  O O     . ILE B 1 227 ? -13.373 60.323  -7.804  1.00 31.01  ? 227  ILE B O     1 
ATOM   6646  C CB    . ILE B 1 227 ? -14.453 61.158  -4.709  1.00 30.60  ? 227  ILE B CB    1 
ATOM   6647  C CG1   . ILE B 1 227 ? -13.960 62.506  -5.226  1.00 30.23  ? 227  ILE B CG1   1 
ATOM   6648  C CG2   . ILE B 1 227 ? -14.257 61.047  -3.173  1.00 30.67  ? 227  ILE B CG2   1 
ATOM   6649  C CD1   . ILE B 1 227 ? -14.928 63.650  -4.940  1.00 30.38  ? 227  ILE B CD1   1 
ATOM   6650  N N     . ASP B 1 228 ? -15.428 59.575  -7.209  1.00 30.17  ? 228  ASP B N     1 
ATOM   6651  C CA    . ASP B 1 228 ? -15.941 59.707  -8.555  1.00 29.87  ? 228  ASP B CA    1 
ATOM   6652  C C     . ASP B 1 228 ? -16.361 61.160  -8.773  1.00 29.77  ? 228  ASP B C     1 
ATOM   6653  O O     . ASP B 1 228 ? -16.855 61.818  -7.862  1.00 29.21  ? 228  ASP B O     1 
ATOM   6654  C CB    . ASP B 1 228 ? -17.078 58.705  -8.818  1.00 29.96  ? 228  ASP B CB    1 
ATOM   6655  C CG    . ASP B 1 228 ? -16.678 57.267  -8.481  1.00 30.20  ? 228  ASP B CG    1 
ATOM   6656  O OD1   . ASP B 1 228 ? -17.417 56.594  -7.740  1.00 29.96  ? 228  ASP B OD1   1 
ATOM   6657  O OD2   . ASP B 1 228 ? -15.607 56.809  -8.920  1.00 30.06  ? 228  ASP B OD2   1 
ATOM   6658  N N     . TRP B 1 229 ? -16.135 61.670  -9.980  1.00 30.05  ? 229  TRP B N     1 
ATOM   6659  C CA    . TRP B 1 229 ? -16.481 63.057  -10.288 1.00 30.34  ? 229  TRP B CA    1 
ATOM   6660  C C     . TRP B 1 229 ? -17.380 63.101  -11.505 1.00 30.63  ? 229  TRP B C     1 
ATOM   6661  O O     . TRP B 1 229 ? -17.128 62.412  -12.480 1.00 30.66  ? 229  TRP B O     1 
ATOM   6662  C CB    . TRP B 1 229 ? -15.208 63.859  -10.542 1.00 30.08  ? 229  TRP B CB    1 
ATOM   6663  C CG    . TRP B 1 229 ? -15.361 65.349  -10.446 1.00 29.72  ? 229  TRP B CG    1 
ATOM   6664  C CD1   . TRP B 1 229 ? -15.435 66.233  -11.479 1.00 28.96  ? 229  TRP B CD1   1 
ATOM   6665  C CD2   . TRP B 1 229 ? -15.432 66.129  -9.243  1.00 30.20  ? 229  TRP B CD2   1 
ATOM   6666  N NE1   . TRP B 1 229 ? -15.550 67.518  -11.001 1.00 29.88  ? 229  TRP B NE1   1 
ATOM   6667  C CE2   . TRP B 1 229 ? -15.542 67.485  -9.630  1.00 30.66  ? 229  TRP B CE2   1 
ATOM   6668  C CE3   . TRP B 1 229 ? -15.409 65.813  -7.875  1.00 29.97  ? 229  TRP B CE3   1 
ATOM   6669  C CZ2   . TRP B 1 229 ? -15.640 68.531  -8.696  1.00 30.43  ? 229  TRP B CZ2   1 
ATOM   6670  C CZ3   . TRP B 1 229 ? -15.509 66.857  -6.945  1.00 30.15  ? 229  TRP B CZ3   1 
ATOM   6671  C CH2   . TRP B 1 229 ? -15.627 68.198  -7.365  1.00 29.81  ? 229  TRP B CH2   1 
ATOM   6672  N N     . GLN B 1 230 ? -18.436 63.902  -11.440 1.00 31.27  ? 230  GLN B N     1 
ATOM   6673  C CA    . GLN B 1 230 ? -19.318 64.104  -12.587 1.00 31.79  ? 230  GLN B CA    1 
ATOM   6674  C C     . GLN B 1 230 ? -19.181 65.545  -13.078 1.00 31.73  ? 230  GLN B C     1 
ATOM   6675  O O     . GLN B 1 230 ? -19.765 66.470  -12.492 1.00 31.82  ? 230  GLN B O     1 
ATOM   6676  C CB    . GLN B 1 230 ? -20.768 63.770  -12.230 1.00 31.36  ? 230  GLN B CB    1 
ATOM   6677  C CG    . GLN B 1 230 ? -21.770 64.028  -13.350 1.00 32.87  ? 230  GLN B CG    1 
ATOM   6678  C CD    . GLN B 1 230 ? -23.132 63.412  -13.086 1.00 33.19  ? 230  GLN B CD    1 
ATOM   6679  O OE1   . GLN B 1 230 ? -23.261 62.199  -12.874 1.00 34.62  ? 230  GLN B OE1   1 
ATOM   6680  N NE2   . GLN B 1 230 ? -24.160 64.243  -13.114 1.00 34.48  ? 230  GLN B NE2   1 
ATOM   6681  N N     . GLU B 1 231 ? -18.402 65.716  -14.148 1.00 32.00  ? 231  GLU B N     1 
ATOM   6682  C CA    . GLU B 1 231 ? -18.099 67.032  -14.732 1.00 31.87  ? 231  GLU B CA    1 
ATOM   6683  C C     . GLU B 1 231 ? -19.365 67.864  -14.964 1.00 31.32  ? 231  GLU B C     1 
ATOM   6684  O O     . GLU B 1 231 ? -20.363 67.360  -15.463 1.00 31.20  ? 231  GLU B O     1 
ATOM   6685  C CB    . GLU B 1 231 ? -17.294 66.866  -16.046 1.00 32.18  ? 231  GLU B CB    1 
ATOM   6686  C CG    . GLU B 1 231 ? -16.943 68.174  -16.810 1.00 33.36  ? 231  GLU B CG    1 
ATOM   6687  C CD    . GLU B 1 231 ? -15.977 69.142  -16.049 1.00 37.46  ? 231  GLU B CD    1 
ATOM   6688  O OE1   . GLU B 1 231 ? -15.454 68.802  -14.947 1.00 37.85  ? 231  GLU B OE1   1 
ATOM   6689  O OE2   . GLU B 1 231 ? -15.736 70.261  -16.576 1.00 38.82  ? 231  GLU B OE2   1 
ATOM   6690  N N     . GLY B 1 232 ? -19.329 69.133  -14.575 1.00 30.89  ? 232  GLY B N     1 
ATOM   6691  C CA    . GLY B 1 232 ? -20.483 70.005  -14.778 1.00 30.47  ? 232  GLY B CA    1 
ATOM   6692  C C     . GLY B 1 232 ? -21.330 70.077  -13.530 1.00 29.89  ? 232  GLY B C     1 
ATOM   6693  O O     . GLY B 1 232 ? -21.546 71.163  -12.982 1.00 30.36  ? 232  GLY B O     1 
ATOM   6694  N N     . ARG B 1 233 ? -21.792 68.917  -13.069 1.00 29.26  ? 233  ARG B N     1 
ATOM   6695  C CA    . ARG B 1 233 ? -22.495 68.812  -11.785 1.00 28.07  ? 233  ARG B CA    1 
ATOM   6696  C C     . ARG B 1 233 ? -21.582 69.101  -10.592 1.00 28.03  ? 233  ARG B C     1 
ATOM   6697  O O     . ARG B 1 233 ? -21.891 69.950  -9.748  1.00 27.70  ? 233  ARG B O     1 
ATOM   6698  C CB    . ARG B 1 233 ? -23.159 67.445  -11.630 1.00 27.38  ? 233  ARG B CB    1 
ATOM   6699  C CG    . ARG B 1 233 ? -24.208 67.425  -10.524 1.00 25.83  ? 233  ARG B CG    1 
ATOM   6700  C CD    . ARG B 1 233 ? -24.545 66.004  -10.095 1.00 23.16  ? 233  ARG B CD    1 
ATOM   6701  N NE    . ARG B 1 233 ? -23.393 65.376  -9.462  1.00 20.29  ? 233  ARG B NE    1 
ATOM   6702  C CZ    . ARG B 1 233 ? -23.328 64.113  -9.058  1.00 19.33  ? 233  ARG B CZ    1 
ATOM   6703  N NH1   . ARG B 1 233 ? -24.367 63.306  -9.192  1.00 18.74  ? 233  ARG B NH1   1 
ATOM   6704  N NH2   . ARG B 1 233 ? -22.208 63.665  -8.508  1.00 17.52  ? 233  ARG B NH2   1 
ATOM   6705  N N     . ASP B 1 234 ? -20.456 68.396  -10.529 1.00 28.25  ? 234  ASP B N     1 
ATOM   6706  C CA    . ASP B 1 234 ? -19.585 68.463  -9.361  1.00 27.98  ? 234  ASP B CA    1 
ATOM   6707  C C     . ASP B 1 234 ? -18.601 69.628  -9.469  1.00 28.02  ? 234  ASP B C     1 
ATOM   6708  O O     . ASP B 1 234 ? -17.942 69.789  -10.490 1.00 28.41  ? 234  ASP B O     1 
ATOM   6709  C CB    . ASP B 1 234 ? -18.851 67.128  -9.159  1.00 27.93  ? 234  ASP B CB    1 
ATOM   6710  C CG    . ASP B 1 234 ? -19.792 65.968  -8.812  1.00 27.91  ? 234  ASP B CG    1 
ATOM   6711  O OD1   . ASP B 1 234 ? -20.948 66.201  -8.393  1.00 28.20  ? 234  ASP B OD1   1 
ATOM   6712  O OD2   . ASP B 1 234 ? -19.361 64.804  -8.954  1.00 27.10  ? 234  ASP B OD2   1 
ATOM   6713  N N     . LEU B 1 235 ? -18.504 70.421  -8.401  1.00 28.04  ? 235  LEU B N     1 
ATOM   6714  C CA    . LEU B 1 235 ? -17.596 71.582  -8.315  1.00 27.80  ? 235  LEU B CA    1 
ATOM   6715  C C     . LEU B 1 235 ? -16.800 71.627  -6.995  1.00 27.76  ? 235  LEU B C     1 
ATOM   6716  O O     . LEU B 1 235 ? -17.367 71.584  -5.907  1.00 26.76  ? 235  LEU B O     1 
ATOM   6717  C CB    . LEU B 1 235 ? -18.384 72.898  -8.460  1.00 27.42  ? 235  LEU B CB    1 
ATOM   6718  C CG    . LEU B 1 235 ? -19.451 73.036  -9.559  1.00 27.32  ? 235  LEU B CG    1 
ATOM   6719  C CD1   . LEU B 1 235 ? -20.485 74.095  -9.182  1.00 25.99  ? 235  LEU B CD1   1 
ATOM   6720  C CD2   . LEU B 1 235 ? -18.828 73.337  -10.912 1.00 25.53  ? 235  LEU B CD2   1 
ATOM   6721  N N     . TRP B 1 236 ? -15.485 71.758  -7.111  1.00 28.19  ? 236  TRP B N     1 
ATOM   6722  C CA    . TRP B 1 236 ? -14.618 71.931  -5.948  1.00 28.72  ? 236  TRP B CA    1 
ATOM   6723  C C     . TRP B 1 236 ? -14.883 73.232  -5.184  1.00 29.18  ? 236  TRP B C     1 
ATOM   6724  O O     . TRP B 1 236 ? -15.035 74.305  -5.785  1.00 28.88  ? 236  TRP B O     1 
ATOM   6725  C CB    . TRP B 1 236 ? -13.135 71.840  -6.353  1.00 28.58  ? 236  TRP B CB    1 
ATOM   6726  C CG    . TRP B 1 236 ? -12.708 70.465  -6.749  1.00 28.14  ? 236  TRP B CG    1 
ATOM   6727  C CD1   . TRP B 1 236 ? -12.326 70.044  -7.994  1.00 28.33  ? 236  TRP B CD1   1 
ATOM   6728  C CD2   . TRP B 1 236 ? -12.638 69.314  -5.897  1.00 29.01  ? 236  TRP B CD2   1 
ATOM   6729  N NE1   . TRP B 1 236 ? -12.016 68.703  -7.968  1.00 28.46  ? 236  TRP B NE1   1 
ATOM   6730  C CE2   . TRP B 1 236 ? -12.183 68.232  -6.692  1.00 28.35  ? 236  TRP B CE2   1 
ATOM   6731  C CE3   . TRP B 1 236 ? -12.902 69.092  -4.532  1.00 28.45  ? 236  TRP B CE3   1 
ATOM   6732  C CZ2   . TRP B 1 236 ? -11.999 66.944  -6.174  1.00 28.12  ? 236  TRP B CZ2   1 
ATOM   6733  C CZ3   . TRP B 1 236 ? -12.706 67.800  -4.014  1.00 29.04  ? 236  TRP B CZ3   1 
ATOM   6734  C CH2   . TRP B 1 236 ? -12.262 66.746  -4.841  1.00 28.08  ? 236  TRP B CH2   1 
ATOM   6735  N N     . TRP B 1 237 ? -14.925 73.108  -3.857  1.00 29.79  ? 237  TRP B N     1 
ATOM   6736  C CA    . TRP B 1 237 ? -15.153 74.228  -2.944  1.00 30.59  ? 237  TRP B CA    1 
ATOM   6737  C C     . TRP B 1 237 ? -14.097 75.308  -3.129  1.00 31.46  ? 237  TRP B C     1 
ATOM   6738  O O     . TRP B 1 237 ? -14.430 76.475  -3.290  1.00 31.18  ? 237  TRP B O     1 
ATOM   6739  C CB    . TRP B 1 237 ? -15.135 73.730  -1.494  1.00 29.74  ? 237  TRP B CB    1 
ATOM   6740  C CG    . TRP B 1 237 ? -15.167 74.809  -0.437  1.00 29.21  ? 237  TRP B CG    1 
ATOM   6741  C CD1   . TRP B 1 237 ? -14.145 75.667  -0.085  1.00 28.19  ? 237  TRP B CD1   1 
ATOM   6742  C CD2   . TRP B 1 237 ? -16.260 75.115  0.434   1.00 28.56  ? 237  TRP B CD2   1 
ATOM   6743  N NE1   . TRP B 1 237 ? -14.546 76.491  0.939   1.00 27.49  ? 237  TRP B NE1   1 
ATOM   6744  C CE2   . TRP B 1 237 ? -15.841 76.186  1.273   1.00 28.10  ? 237  TRP B CE2   1 
ATOM   6745  C CE3   . TRP B 1 237 ? -17.554 74.598  0.585   1.00 27.18  ? 237  TRP B CE3   1 
ATOM   6746  C CZ2   . TRP B 1 237 ? -16.670 76.742  2.248   1.00 27.53  ? 237  TRP B CZ2   1 
ATOM   6747  C CZ3   . TRP B 1 237 ? -18.378 75.155  1.551   1.00 28.30  ? 237  TRP B CZ3   1 
ATOM   6748  C CH2   . TRP B 1 237 ? -17.933 76.217  2.370   1.00 28.51  ? 237  TRP B CH2   1 
ATOM   6749  N N     . ARG B 1 238 ? -12.830 74.896  -3.105  1.00 32.94  ? 238  ARG B N     1 
ATOM   6750  C CA    . ARG B 1 238 ? -11.710 75.817  -3.230  1.00 34.64  ? 238  ARG B CA    1 
ATOM   6751  C C     . ARG B 1 238 ? -11.780 76.594  -4.551  1.00 35.25  ? 238  ARG B C     1 
ATOM   6752  O O     . ARG B 1 238 ? -11.574 77.806  -4.562  1.00 34.74  ? 238  ARG B O     1 
ATOM   6753  C CB    . ARG B 1 238 ? -10.366 75.087  -3.080  1.00 34.36  ? 238  ARG B CB    1 
ATOM   6754  C CG    . ARG B 1 238 ? -9.182  76.063  -2.878  1.00 35.48  ? 238  ARG B CG    1 
ATOM   6755  C CD    . ARG B 1 238 ? -7.831  75.404  -3.007  1.00 35.77  ? 238  ARG B CD    1 
ATOM   6756  N NE    . ARG B 1 238 ? -7.606  74.940  -4.372  1.00 39.16  ? 238  ARG B NE    1 
ATOM   6757  C CZ    . ARG B 1 238 ? -6.612  74.139  -4.747  1.00 40.44  ? 238  ARG B CZ    1 
ATOM   6758  N NH1   . ARG B 1 238 ? -5.722  73.699  -3.862  1.00 39.77  ? 238  ARG B NH1   1 
ATOM   6759  N NH2   . ARG B 1 238 ? -6.508  73.786  -6.025  1.00 42.36  ? 238  ARG B NH2   1 
ATOM   6760  N N     . ASP B 1 239 ? -12.095 75.882  -5.639  1.00 36.56  ? 239  ASP B N     1 
ATOM   6761  C CA    . ASP B 1 239 ? -12.282 76.471  -6.971  1.00 37.92  ? 239  ASP B CA    1 
ATOM   6762  C C     . ASP B 1 239 ? -13.272 77.651  -6.989  1.00 37.98  ? 239  ASP B C     1 
ATOM   6763  O O     . ASP B 1 239 ? -12.973 78.727  -7.517  1.00 37.92  ? 239  ASP B O     1 
ATOM   6764  C CB    . ASP B 1 239 ? -12.710 75.392  -7.978  1.00 38.60  ? 239  ASP B CB    1 
ATOM   6765  C CG    . ASP B 1 239 ? -11.536 74.528  -8.455  1.00 41.15  ? 239  ASP B CG    1 
ATOM   6766  O OD1   . ASP B 1 239 ? -10.479 74.509  -7.770  1.00 45.51  ? 239  ASP B OD1   1 
ATOM   6767  O OD2   . ASP B 1 239 ? -11.670 73.866  -9.515  1.00 41.61  ? 239  ASP B OD2   1 
ATOM   6768  N N     . LEU B 1 240 ? -14.434 77.454  -6.378  1.00 37.95  ? 240  LEU B N     1 
ATOM   6769  C CA    . LEU B 1 240 ? -15.471 78.487  -6.360  1.00 37.60  ? 240  LEU B CA    1 
ATOM   6770  C C     . LEU B 1 240 ? -15.157 79.637  -5.403  1.00 37.83  ? 240  LEU B C     1 
ATOM   6771  O O     . LEU B 1 240 ? -15.263 80.806  -5.780  1.00 38.14  ? 240  LEU B O     1 
ATOM   6772  C CB    . LEU B 1 240 ? -16.825 77.868  -6.019  1.00 37.13  ? 240  LEU B CB    1 
ATOM   6773  C CG    . LEU B 1 240 ? -17.259 76.696  -6.889  1.00 35.18  ? 240  LEU B CG    1 
ATOM   6774  C CD1   . LEU B 1 240 ? -18.404 75.976  -6.213  1.00 32.45  ? 240  LEU B CD1   1 
ATOM   6775  C CD2   . LEU B 1 240 ? -17.639 77.186  -8.295  1.00 33.99  ? 240  LEU B CD2   1 
ATOM   6776  N N     . ILE B 1 241 ? -14.767 79.307  -4.176  1.00 37.70  ? 241  ILE B N     1 
ATOM   6777  C CA    . ILE B 1 241 ? -14.517 80.325  -3.168  1.00 37.82  ? 241  ILE B CA    1 
ATOM   6778  C C     . ILE B 1 241 ? -13.338 81.233  -3.553  1.00 38.27  ? 241  ILE B C     1 
ATOM   6779  O O     . ILE B 1 241 ? -13.374 82.446  -3.312  1.00 37.88  ? 241  ILE B O     1 
ATOM   6780  C CB    . ILE B 1 241 ? -14.360 79.708  -1.746  1.00 37.63  ? 241  ILE B CB    1 
ATOM   6781  C CG1   . ILE B 1 241 ? -14.840 80.700  -0.681  1.00 37.48  ? 241  ILE B CG1   1 
ATOM   6782  C CG2   . ILE B 1 241 ? -12.925 79.240  -1.486  1.00 37.10  ? 241  ILE B CG2   1 
ATOM   6783  C CD1   . ILE B 1 241 ? -15.193 80.069  0.663   1.00 37.35  ? 241  ILE B CD1   1 
ATOM   6784  N N     . GLU B 1 242 ? -12.311 80.645  -4.171  1.00 38.82  ? 242  GLU B N     1 
ATOM   6785  C CA    . GLU B 1 242 ? -11.164 81.417  -4.652  1.00 39.33  ? 242  GLU B CA    1 
ATOM   6786  C C     . GLU B 1 242 ? -11.552 82.434  -5.742  1.00 38.85  ? 242  GLU B C     1 
ATOM   6787  O O     . GLU B 1 242 ? -10.940 83.497  -5.834  1.00 38.80  ? 242  GLU B O     1 
ATOM   6788  C CB    . GLU B 1 242 ? -10.020 80.498  -5.125  1.00 39.14  ? 242  GLU B CB    1 
ATOM   6789  C CG    . GLU B 1 242 ? -9.265  79.796  -3.982  1.00 39.97  ? 242  GLU B CG    1 
ATOM   6790  C CD    . GLU B 1 242 ? -7.918  79.147  -4.397  1.00 40.68  ? 242  GLU B CD    1 
ATOM   6791  O OE1   . GLU B 1 242 ? -7.591  79.048  -5.607  1.00 39.97  ? 242  GLU B OE1   1 
ATOM   6792  O OE2   . GLU B 1 242 ? -7.172  78.731  -3.478  1.00 42.66  ? 242  GLU B OE2   1 
ATOM   6793  N N     . LYS B 1 243 ? -12.571 82.109  -6.539  1.00 38.50  ? 243  LYS B N     1 
ATOM   6794  C CA    . LYS B 1 243 ? -12.995 82.954  -7.672  1.00 38.28  ? 243  LYS B CA    1 
ATOM   6795  C C     . LYS B 1 243 ? -14.003 84.069  -7.313  1.00 38.10  ? 243  LYS B C     1 
ATOM   6796  O O     . LYS B 1 243 ? -14.314 84.920  -8.154  1.00 38.48  ? 243  LYS B O     1 
ATOM   6797  C CB    . LYS B 1 243 ? -13.553 82.084  -8.815  1.00 38.07  ? 243  LYS B CB    1 
ATOM   6798  N N     . ALA B 1 244 ? -14.504 84.069  -6.079  1.00 37.51  ? 244  ALA B N     1 
ATOM   6799  C CA    . ALA B 1 244 ? -15.562 84.997  -5.669  1.00 37.23  ? 244  ALA B CA    1 
ATOM   6800  C C     . ALA B 1 244 ? -14.999 86.177  -4.896  1.00 37.17  ? 244  ALA B C     1 
ATOM   6801  O O     . ALA B 1 244 ? -13.905 86.094  -4.346  1.00 37.28  ? 244  ALA B O     1 
ATOM   6802  C CB    . ALA B 1 244 ? -16.614 84.277  -4.833  1.00 37.12  ? 244  ALA B CB    1 
ATOM   6803  N N     . SER B 1 245 ? -15.753 87.270  -4.850  1.00 37.03  ? 245  SER B N     1 
ATOM   6804  C CA    . SER B 1 245 ? -15.313 88.472  -4.154  1.00 37.17  ? 245  SER B CA    1 
ATOM   6805  C C     . SER B 1 245 ? -15.569 88.369  -2.655  1.00 37.03  ? 245  SER B C     1 
ATOM   6806  O O     . SER B 1 245 ? -16.623 87.888  -2.247  1.00 37.29  ? 245  SER B O     1 
ATOM   6807  C CB    . SER B 1 245 ? -16.032 89.702  -4.711  1.00 37.21  ? 245  SER B CB    1 
ATOM   6808  O OG    . SER B 1 245 ? -15.849 90.832  -3.870  1.00 37.59  ? 245  SER B OG    1 
ATOM   6809  N N     . PRO B 1 246 ? -14.610 88.837  -1.831  1.00 36.81  ? 246  PRO B N     1 
ATOM   6810  C CA    . PRO B 1 246 ? -14.805 88.909  -0.369  1.00 36.65  ? 246  PRO B CA    1 
ATOM   6811  C C     . PRO B 1 246 ? -15.697 90.079  0.070   1.00 36.30  ? 246  PRO B C     1 
ATOM   6812  O O     . PRO B 1 246 ? -15.979 90.230  1.262   1.00 35.95  ? 246  PRO B O     1 
ATOM   6813  C CB    . PRO B 1 246 ? -13.383 89.111  0.167   1.00 36.66  ? 246  PRO B CB    1 
ATOM   6814  C CG    . PRO B 1 246 ? -12.655 89.809  -0.955  1.00 36.69  ? 246  PRO B CG    1 
ATOM   6815  C CD    . PRO B 1 246 ? -13.273 89.314  -2.243  1.00 36.59  ? 246  PRO B CD    1 
ATOM   6816  N N     . GLU B 1 247 ? -16.108 90.913  -0.883  1.00 35.86  ? 247  GLU B N     1 
ATOM   6817  C CA    . GLU B 1 247 ? -17.027 91.999  -0.586  1.00 35.59  ? 247  GLU B CA    1 
ATOM   6818  C C     . GLU B 1 247 ? -18.448 91.488  -0.789  1.00 34.45  ? 247  GLU B C     1 
ATOM   6819  O O     . GLU B 1 247 ? -18.818 91.061  -1.887  1.00 34.27  ? 247  GLU B O     1 
ATOM   6820  C CB    . GLU B 1 247 ? -16.783 93.225  -1.487  1.00 36.00  ? 247  GLU B CB    1 
ATOM   6821  C CG    . GLU B 1 247 ? -15.340 93.448  -1.943  1.00 39.10  ? 247  GLU B CG    1 
ATOM   6822  C CD    . GLU B 1 247 ? -14.391 93.931  -0.835  1.00 42.77  ? 247  GLU B CD    1 
ATOM   6823  O OE1   . GLU B 1 247 ? -14.835 94.671  0.083   1.00 43.11  ? 247  GLU B OE1   1 
ATOM   6824  O OE2   . GLU B 1 247 ? -13.184 93.579  -0.909  1.00 43.97  ? 247  GLU B OE2   1 
ATOM   6825  N N     . HIS B 1 248 ? -19.232 91.503  0.279   1.00 33.47  ? 248  HIS B N     1 
ATOM   6826  C CA    . HIS B 1 248 ? -20.659 91.261  0.157   1.00 32.51  ? 248  HIS B CA    1 
ATOM   6827  C C     . HIS B 1 248 ? -21.446 92.086  1.163   1.00 32.62  ? 248  HIS B C     1 
ATOM   6828  O O     . HIS B 1 248 ? -21.134 92.120  2.359   1.00 32.01  ? 248  HIS B O     1 
ATOM   6829  C CB    . HIS B 1 248 ? -21.015 89.773  0.274   1.00 32.03  ? 248  HIS B CB    1 
ATOM   6830  C CG    . HIS B 1 248 ? -22.460 89.490  0.014   1.00 30.02  ? 248  HIS B CG    1 
ATOM   6831  N ND1   . HIS B 1 248 ? -23.423 89.579  0.996   1.00 29.04  ? 248  HIS B ND1   1 
ATOM   6832  C CD2   . HIS B 1 248 ? -23.112 89.152  -1.123  1.00 27.93  ? 248  HIS B CD2   1 
ATOM   6833  C CE1   . HIS B 1 248 ? -24.607 89.303  0.478   1.00 29.03  ? 248  HIS B CE1   1 
ATOM   6834  N NE2   . HIS B 1 248 ? -24.445 89.029  -0.805  1.00 28.39  ? 248  HIS B NE2   1 
ATOM   6835  N N     . GLN B 1 249 ? -22.476 92.750  0.652   1.00 32.70  ? 249  GLN B N     1 
ATOM   6836  C CA    . GLN B 1 249 ? -23.318 93.587  1.472   1.00 33.14  ? 249  GLN B CA    1 
ATOM   6837  C C     . GLN B 1 249 ? -24.585 92.821  1.804   1.00 32.45  ? 249  GLN B C     1 
ATOM   6838  O O     . GLN B 1 249 ? -25.282 92.361  0.903   1.00 32.62  ? 249  GLN B O     1 
ATOM   6839  C CB    . GLN B 1 249 ? -23.622 94.917  0.766   1.00 33.54  ? 249  GLN B CB    1 
ATOM   6840  C CG    . GLN B 1 249 ? -22.362 95.773  0.466   1.00 36.29  ? 249  GLN B CG    1 
ATOM   6841  C CD    . GLN B 1 249 ? -21.795 96.507  1.698   1.00 39.61  ? 249  GLN B CD    1 
ATOM   6842  O OE1   . GLN B 1 249 ? -20.567 96.575  1.895   1.00 38.68  ? 249  GLN B OE1   1 
ATOM   6843  N NE2   . GLN B 1 249 ? -22.691 97.067  2.524   1.00 39.74  ? 249  GLN B NE2   1 
ATOM   6844  N N     . PRO B 1 250 ? -24.889 92.684  3.105   1.00 32.20  ? 250  PRO B N     1 
ATOM   6845  C CA    . PRO B 1 250 ? -26.049 91.908  3.494   1.00 31.94  ? 250  PRO B CA    1 
ATOM   6846  C C     . PRO B 1 250 ? -27.330 92.698  3.267   1.00 32.05  ? 250  PRO B C     1 
ATOM   6847  O O     . PRO B 1 250 ? -27.387 93.908  3.543   1.00 31.83  ? 250  PRO B O     1 
ATOM   6848  C CB    . PRO B 1 250 ? -25.827 91.669  4.989   1.00 32.01  ? 250  PRO B CB    1 
ATOM   6849  C CG    . PRO B 1 250 ? -25.039 92.826  5.438   1.00 32.08  ? 250  PRO B CG    1 
ATOM   6850  C CD    . PRO B 1 250 ? -24.198 93.270  4.272   1.00 32.13  ? 250  PRO B CD    1 
ATOM   6851  N N     . GLU B 1 251 ? -28.348 92.003  2.777   1.00 32.07  ? 251  GLU B N     1 
ATOM   6852  C CA    . GLU B 1 251 ? -29.639 92.603  2.529   1.00 32.67  ? 251  GLU B CA    1 
ATOM   6853  C C     . GLU B 1 251 ? -30.530 92.363  3.720   1.00 32.02  ? 251  GLU B C     1 
ATOM   6854  O O     . GLU B 1 251 ? -30.352 91.392  4.463   1.00 32.15  ? 251  GLU B O     1 
ATOM   6855  C CB    . GLU B 1 251 ? -30.295 91.964  1.315   1.00 33.24  ? 251  GLU B CB    1 
ATOM   6856  C CG    . GLU B 1 251 ? -29.391 91.817  0.114   1.00 36.22  ? 251  GLU B CG    1 
ATOM   6857  C CD    . GLU B 1 251 ? -29.771 92.750  -0.978  1.00 39.04  ? 251  GLU B CD    1 
ATOM   6858  O OE1   . GLU B 1 251 ? -30.921 92.622  -1.469  1.00 40.13  ? 251  GLU B OE1   1 
ATOM   6859  O OE2   . GLU B 1 251 ? -28.924 93.606  -1.334  1.00 41.09  ? 251  GLU B OE2   1 
ATOM   6860  N N     . ALA B 1 252 ? -31.511 93.239  3.885   1.00 31.45  ? 252  ALA B N     1 
ATOM   6861  C CA    . ALA B 1 252 ? -32.549 93.026  4.881   1.00 30.81  ? 252  ALA B CA    1 
ATOM   6862  C C     . ALA B 1 252 ? -33.421 91.812  4.543   1.00 30.06  ? 252  ALA B C     1 
ATOM   6863  O O     . ALA B 1 252 ? -33.850 91.634  3.404   1.00 29.47  ? 252  ALA B O     1 
ATOM   6864  C CB    . ALA B 1 252 ? -33.394 94.277  5.062   1.00 30.69  ? 252  ALA B CB    1 
ATOM   6865  N N     . MET B 1 253 ? -33.618 90.971  5.557   1.00 29.42  ? 253  MET B N     1 
ATOM   6866  C CA    . MET B 1 253 ? -34.592 89.898  5.547   1.00 29.01  ? 253  MET B CA    1 
ATOM   6867  C C     . MET B 1 253 ? -35.667 90.252  6.572   1.00 29.05  ? 253  MET B C     1 
ATOM   6868  O O     . MET B 1 253 ? -35.361 90.734  7.674   1.00 29.30  ? 253  MET B O     1 
ATOM   6869  C CB    . MET B 1 253 ? -33.930 88.565  5.930   1.00 28.82  ? 253  MET B CB    1 
ATOM   6870  C CG    . MET B 1 253 ? -32.706 88.204  5.094   1.00 29.16  ? 253  MET B CG    1 
ATOM   6871  S SD    . MET B 1 253 ? -33.150 87.794  3.391   1.00 30.42  ? 253  MET B SD    1 
ATOM   6872  C CE    . MET B 1 253 ? -31.678 88.266  2.461   1.00 26.98  ? 253  MET B CE    1 
ATOM   6873  N N     . ASN B 1 254 ? -36.923 90.026  6.202   1.00 28.69  ? 254  ASN B N     1 
ATOM   6874  C CA    . ASN B 1 254 ? -38.038 90.161  7.115   1.00 28.58  ? 254  ASN B CA    1 
ATOM   6875  C C     . ASN B 1 254 ? -37.885 89.142  8.237   1.00 28.06  ? 254  ASN B C     1 
ATOM   6876  O O     . ASN B 1 254 ? -37.381 88.031  7.999   1.00 27.93  ? 254  ASN B O     1 
ATOM   6877  C CB    . ASN B 1 254 ? -39.359 89.918  6.378   1.00 28.91  ? 254  ASN B CB    1 
ATOM   6878  C CG    . ASN B 1 254 ? -40.570 90.217  7.243   1.00 31.35  ? 254  ASN B CG    1 
ATOM   6879  O OD1   . ASN B 1 254 ? -41.217 89.302  7.787   1.00 33.17  ? 254  ASN B OD1   1 
ATOM   6880  N ND2   . ASN B 1 254 ? -40.876 91.510  7.400   1.00 32.14  ? 254  ASN B ND2   1 
ATOM   6881  N N     . ALA B 1 255 ? -38.335 89.511  9.442   1.00 27.22  ? 255  ALA B N     1 
ATOM   6882  C CA    . ALA B 1 255 ? -38.278 88.622  10.619  1.00 26.69  ? 255  ALA B CA    1 
ATOM   6883  C C     . ALA B 1 255 ? -38.884 87.240  10.355  1.00 26.37  ? 255  ALA B C     1 
ATOM   6884  O O     . ALA B 1 255 ? -38.395 86.236  10.879  1.00 26.91  ? 255  ALA B O     1 
ATOM   6885  C CB    . ALA B 1 255 ? -38.944 89.267  11.828  1.00 26.08  ? 255  ALA B CB    1 
ATOM   6886  N N     . GLU B 1 256 ? -39.932 87.194  9.538   1.00 25.58  ? 256  GLU B N     1 
ATOM   6887  C CA    . GLU B 1 256 ? -40.681 85.954  9.309   1.00 25.07  ? 256  GLU B CA    1 
ATOM   6888  C C     . GLU B 1 256 ? -40.291 85.263  8.025   1.00 24.47  ? 256  GLU B C     1 
ATOM   6889  O O     . GLU B 1 256 ? -40.946 84.302  7.615   1.00 24.38  ? 256  GLU B O     1 
ATOM   6890  C CB    . GLU B 1 256 ? -42.204 86.191  9.378   1.00 25.24  ? 256  GLU B CB    1 
ATOM   6891  C CG    . GLU B 1 256 ? -42.707 86.501  10.787  1.00 24.94  ? 256  GLU B CG    1 
ATOM   6892  C CD    . GLU B 1 256 ? -42.483 85.334  11.737  1.00 26.27  ? 256  GLU B CD    1 
ATOM   6893  O OE1   . GLU B 1 256 ? -42.424 84.191  11.240  1.00 27.79  ? 256  GLU B OE1   1 
ATOM   6894  O OE2   . GLU B 1 256 ? -42.369 85.541  12.968  1.00 25.94  ? 256  GLU B OE2   1 
ATOM   6895  N N     . ASP B 1 257 ? -39.231 85.759  7.388   1.00 24.18  ? 257  ASP B N     1 
ATOM   6896  C CA    . ASP B 1 257 ? -38.591 85.048  6.283   1.00 24.27  ? 257  ASP B CA    1 
ATOM   6897  C C     . ASP B 1 257 ? -38.055 83.706  6.809   1.00 24.39  ? 257  ASP B C     1 
ATOM   6898  O O     . ASP B 1 257 ? -37.409 83.671  7.846   1.00 24.70  ? 257  ASP B O     1 
ATOM   6899  C CB    . ASP B 1 257 ? -37.427 85.871  5.715   1.00 24.26  ? 257  ASP B CB    1 
ATOM   6900  C CG    . ASP B 1 257 ? -37.872 86.917  4.697   1.00 24.15  ? 257  ASP B CG    1 
ATOM   6901  O OD1   . ASP B 1 257 ? -38.922 86.728  4.051   1.00 24.21  ? 257  ASP B OD1   1 
ATOM   6902  O OD2   . ASP B 1 257 ? -37.148 87.922  4.515   1.00 23.27  ? 257  ASP B OD2   1 
ATOM   6903  N N     . PRO B 1 258 ? -38.331 82.601  6.104   1.00 24.51  ? 258  PRO B N     1 
ATOM   6904  C CA    . PRO B 1 258 ? -37.795 81.299  6.535   1.00 24.47  ? 258  PRO B CA    1 
ATOM   6905  C C     . PRO B 1 258 ? -36.259 81.294  6.602   1.00 24.05  ? 258  PRO B C     1 
ATOM   6906  O O     . PRO B 1 258 ? -35.599 81.874  5.731   1.00 24.85  ? 258  PRO B O     1 
ATOM   6907  C CB    . PRO B 1 258 ? -38.299 80.318  5.463   1.00 24.07  ? 258  PRO B CB    1 
ATOM   6908  C CG    . PRO B 1 258 ? -38.732 81.179  4.300   1.00 25.38  ? 258  PRO B CG    1 
ATOM   6909  C CD    . PRO B 1 258 ? -39.152 82.504  4.881   1.00 24.77  ? 258  PRO B CD    1 
ATOM   6910  N N     . LEU B 1 259 ? -35.709 80.663  7.633   1.00 23.00  ? 259  LEU B N     1 
ATOM   6911  C CA    . LEU B 1 259 ? -34.258 80.624  7.845   1.00 22.63  ? 259  LEU B CA    1 
ATOM   6912  C C     . LEU B 1 259 ? -33.688 79.227  7.551   1.00 22.63  ? 259  LEU B C     1 
ATOM   6913  O O     . LEU B 1 259 ? -32.772 79.078  6.743   1.00 22.41  ? 259  LEU B O     1 
ATOM   6914  C CB    . LEU B 1 259 ? -33.900 81.068  9.281   1.00 22.17  ? 259  LEU B CB    1 
ATOM   6915  C CG    . LEU B 1 259 ? -32.437 80.875  9.706   1.00 22.87  ? 259  LEU B CG    1 
ATOM   6916  C CD1   . LEU B 1 259 ? -31.463 81.744  8.879   1.00 20.81  ? 259  LEU B CD1   1 
ATOM   6917  C CD2   . LEU B 1 259 ? -32.220 81.043  11.233  1.00 22.21  ? 259  LEU B CD2   1 
ATOM   6918  N N     . PHE B 1 260 ? -34.211 78.208  8.231   1.00 22.32  ? 260  PHE B N     1 
ATOM   6919  C CA    . PHE B 1 260 ? -33.832 76.832  7.909   1.00 22.52  ? 260  PHE B CA    1 
ATOM   6920  C C     . PHE B 1 260 ? -34.971 75.853  8.092   1.00 22.62  ? 260  PHE B C     1 
ATOM   6921  O O     . PHE B 1 260 ? -35.993 76.159  8.709   1.00 22.22  ? 260  PHE B O     1 
ATOM   6922  C CB    . PHE B 1 260 ? -32.591 76.372  8.696   1.00 22.38  ? 260  PHE B CB    1 
ATOM   6923  C CG    . PHE B 1 260 ? -32.810 76.260  10.176  1.00 21.97  ? 260  PHE B CG    1 
ATOM   6924  C CD1   . PHE B 1 260 ? -33.425 75.142  10.718  1.00 21.28  ? 260  PHE B CD1   1 
ATOM   6925  C CD2   . PHE B 1 260 ? -32.398 77.279  11.028  1.00 22.26  ? 260  PHE B CD2   1 
ATOM   6926  C CE1   . PHE B 1 260 ? -33.641 75.034  12.087  1.00 21.92  ? 260  PHE B CE1   1 
ATOM   6927  C CE2   . PHE B 1 260 ? -32.582 77.172  12.408  1.00 23.45  ? 260  PHE B CE2   1 
ATOM   6928  C CZ    . PHE B 1 260 ? -33.204 76.050  12.936  1.00 22.65  ? 260  PHE B CZ    1 
ATOM   6929  N N     . ILE B 1 261 ? -34.768 74.678  7.519   1.00 23.25  ? 261  ILE B N     1 
ATOM   6930  C CA    . ILE B 1 261 ? -35.628 73.527  7.709   1.00 24.27  ? 261  ILE B CA    1 
ATOM   6931  C C     . ILE B 1 261 ? -34.765 72.405  8.294   1.00 24.39  ? 261  ILE B C     1 
ATOM   6932  O O     . ILE B 1 261 ? -33.614 72.226  7.879   1.00 24.60  ? 261  ILE B O     1 
ATOM   6933  C CB    . ILE B 1 261 ? -36.209 73.093  6.358   1.00 24.57  ? 261  ILE B CB    1 
ATOM   6934  C CG1   . ILE B 1 261 ? -37.281 74.094  5.915   1.00 25.50  ? 261  ILE B CG1   1 
ATOM   6935  C CG2   . ILE B 1 261 ? -36.760 71.664  6.412   1.00 24.68  ? 261  ILE B CG2   1 
ATOM   6936  C CD1   . ILE B 1 261 ? -37.339 74.285  4.399   1.00 25.64  ? 261  ILE B CD1   1 
ATOM   6937  N N     . LEU B 1 262 ? -35.304 71.666  9.261   1.00 24.60  ? 262  LEU B N     1 
ATOM   6938  C CA    . LEU B 1 262 ? -34.599 70.506  9.818   1.00 24.87  ? 262  LEU B CA    1 
ATOM   6939  C C     . LEU B 1 262 ? -35.512 69.298  9.951   1.00 24.56  ? 262  LEU B C     1 
ATOM   6940  O O     . LEU B 1 262 ? -36.457 69.314  10.747  1.00 24.54  ? 262  LEU B O     1 
ATOM   6941  C CB    . LEU B 1 262 ? -33.962 70.830  11.181  1.00 25.18  ? 262  LEU B CB    1 
ATOM   6942  C CG    . LEU B 1 262 ? -32.437 70.718  11.349  1.00 25.93  ? 262  LEU B CG    1 
ATOM   6943  C CD1   . LEU B 1 262 ? -32.029 71.042  12.795  1.00 25.46  ? 262  LEU B CD1   1 
ATOM   6944  C CD2   . LEU B 1 262 ? -31.894 69.354  10.945  1.00 24.21  ? 262  LEU B CD2   1 
ATOM   6945  N N     . TYR B 1 263 ? -35.224 68.252  9.185   1.00 24.18  ? 263  TYR B N     1 
ATOM   6946  C CA    . TYR B 1 263 ? -36.046 67.036  9.228   1.00 24.19  ? 263  TYR B CA    1 
ATOM   6947  C C     . TYR B 1 263 ? -35.953 66.323  10.565  1.00 24.67  ? 263  TYR B C     1 
ATOM   6948  O O     . TYR B 1 263 ? -34.861 66.058  11.100  1.00 24.69  ? 263  TYR B O     1 
ATOM   6949  C CB    . TYR B 1 263 ? -35.763 66.098  8.046   1.00 24.23  ? 263  TYR B CB    1 
ATOM   6950  C CG    . TYR B 1 263 ? -36.321 66.688  6.783   1.00 23.39  ? 263  TYR B CG    1 
ATOM   6951  C CD1   . TYR B 1 263 ? -35.566 67.576  6.026   1.00 24.25  ? 263  TYR B CD1   1 
ATOM   6952  C CD2   . TYR B 1 263 ? -37.629 66.426  6.384   1.00 24.10  ? 263  TYR B CD2   1 
ATOM   6953  C CE1   . TYR B 1 263 ? -36.080 68.164  4.878   1.00 25.52  ? 263  TYR B CE1   1 
ATOM   6954  C CE2   . TYR B 1 263 ? -38.165 67.021  5.240   1.00 24.07  ? 263  TYR B CE2   1 
ATOM   6955  C CZ    . TYR B 1 263 ? -37.378 67.892  4.499   1.00 24.67  ? 263  TYR B CZ    1 
ATOM   6956  O OH    . TYR B 1 263 ? -37.851 68.492  3.371   1.00 24.33  ? 263  TYR B OH    1 
ATOM   6957  N N     . THR B 1 264 ? -37.126 66.031  11.103  1.00 24.46  ? 264  THR B N     1 
ATOM   6958  C CA    . THR B 1 264 ? -37.254 65.616  12.472  1.00 24.26  ? 264  THR B CA    1 
ATOM   6959  C C     . THR B 1 264 ? -38.197 64.436  12.501  1.00 24.23  ? 264  THR B C     1 
ATOM   6960  O O     . THR B 1 264 ? -39.246 64.479  11.860  1.00 24.49  ? 264  THR B O     1 
ATOM   6961  C CB    . THR B 1 264 ? -37.826 66.780  13.298  1.00 24.41  ? 264  THR B CB    1 
ATOM   6962  O OG1   . THR B 1 264 ? -37.056 67.958  13.026  1.00 23.17  ? 264  THR B OG1   1 
ATOM   6963  C CG2   . THR B 1 264 ? -37.786 66.482  14.791  1.00 23.91  ? 264  THR B CG2   1 
ATOM   6964  N N     . SER B 1 265 ? -37.811 63.394  13.237  1.00 23.90  ? 265  SER B N     1 
ATOM   6965  C CA    . SER B 1 265 ? -38.641 62.214  13.451  1.00 23.50  ? 265  SER B CA    1 
ATOM   6966  C C     . SER B 1 265 ? -39.859 62.508  14.289  1.00 23.68  ? 265  SER B C     1 
ATOM   6967  O O     . SER B 1 265 ? -39.805 63.312  15.223  1.00 23.48  ? 265  SER B O     1 
ATOM   6968  C CB    . SER B 1 265 ? -37.843 61.135  14.163  1.00 23.38  ? 265  SER B CB    1 
ATOM   6969  O OG    . SER B 1 265 ? -36.931 60.529  13.282  1.00 23.78  ? 265  SER B OG    1 
ATOM   6970  N N     . GLY B 1 266 ? -40.954 61.826  13.980  1.00 24.18  ? 266  GLY B N     1 
ATOM   6971  C CA    . GLY B 1 266 ? -42.161 61.939  14.784  1.00 24.84  ? 266  GLY B CA    1 
ATOM   6972  C C     . GLY B 1 266 ? -42.820 60.608  15.053  1.00 25.51  ? 266  GLY B C     1 
ATOM   6973  O O     . GLY B 1 266 ? -42.270 59.545  14.747  1.00 25.73  ? 266  GLY B O     1 
ATOM   6974  N N     . SER B 1 267 ? -44.011 60.685  15.628  1.00 26.19  ? 267  SER B N     1 
ATOM   6975  C CA    . SER B 1 267 ? -44.868 59.536  15.929  1.00 27.39  ? 267  SER B CA    1 
ATOM   6976  C C     . SER B 1 267 ? -45.424 58.849  14.672  1.00 27.79  ? 267  SER B C     1 
ATOM   6977  O O     . SER B 1 267 ? -45.705 57.649  14.688  1.00 28.31  ? 267  SER B O     1 
ATOM   6978  C CB    . SER B 1 267 ? -46.042 60.019  16.782  1.00 27.34  ? 267  SER B CB    1 
ATOM   6979  O OG    . SER B 1 267 ? -46.292 59.126  17.850  1.00 29.30  ? 267  SER B OG    1 
ATOM   6980  N N     . THR B 1 268 ? -45.579 59.616  13.596  1.00 28.05  ? 268  THR B N     1 
ATOM   6981  C CA    . THR B 1 268 ? -46.217 59.150  12.376  1.00 28.72  ? 268  THR B CA    1 
ATOM   6982  C C     . THR B 1 268 ? -45.324 59.368  11.146  1.00 28.71  ? 268  THR B C     1 
ATOM   6983  O O     . THR B 1 268 ? -44.818 60.475  10.910  1.00 28.39  ? 268  THR B O     1 
ATOM   6984  C CB    . THR B 1 268 ? -47.607 59.851  12.169  1.00 29.11  ? 268  THR B CB    1 
ATOM   6985  O OG1   . THR B 1 268 ? -48.527 59.446  13.200  1.00 30.55  ? 268  THR B OG1   1 
ATOM   6986  C CG2   . THR B 1 268 ? -48.225 59.500  10.803  1.00 30.22  ? 268  THR B CG2   1 
ATOM   6987  N N     . GLY B 1 269 ? -45.146 58.307  10.362  1.00 28.84  ? 269  GLY B N     1 
ATOM   6988  C CA    . GLY B 1 269 ? -44.453 58.387  9.073   1.00 29.25  ? 269  GLY B CA    1 
ATOM   6989  C C     . GLY B 1 269 ? -43.005 58.834  9.146   1.00 29.43  ? 269  GLY B C     1 
ATOM   6990  O O     . GLY B 1 269 ? -42.394 58.836  10.231  1.00 29.44  ? 269  GLY B O     1 
ATOM   6991  N N     . LYS B 1 270 ? -42.466 59.220  7.988   1.00 29.49  ? 270  LYS B N     1 
ATOM   6992  C CA    . LYS B 1 270 ? -41.069 59.672  7.857   1.00 29.87  ? 270  LYS B CA    1 
ATOM   6993  C C     . LYS B 1 270 ? -40.824 61.033  8.517   1.00 28.93  ? 270  LYS B C     1 
ATOM   6994  O O     . LYS B 1 270 ? -41.780 61.740  8.817   1.00 29.00  ? 270  LYS B O     1 
ATOM   6995  C CB    . LYS B 1 270 ? -40.670 59.749  6.384   1.00 30.65  ? 270  LYS B CB    1 
ATOM   6996  C CG    . LYS B 1 270 ? -40.743 58.438  5.618   1.00 33.50  ? 270  LYS B CG    1 
ATOM   6997  C CD    . LYS B 1 270 ? -40.244 57.228  6.432   1.00 34.93  ? 270  LYS B CD    1 
ATOM   6998  C CE    . LYS B 1 270 ? -39.765 56.121  5.494   1.00 35.80  ? 270  LYS B CE    1 
ATOM   6999  N NZ    . LYS B 1 270 ? -40.629 55.979  4.285   1.00 34.40  ? 270  LYS B NZ    1 
ATOM   7000  N N     . PRO B 1 271 ? -39.550 61.391  8.769   1.00 28.32  ? 271  PRO B N     1 
ATOM   7001  C CA    . PRO B 1 271 ? -39.239 62.692  9.365   1.00 28.30  ? 271  PRO B CA    1 
ATOM   7002  C C     . PRO B 1 271 ? -39.816 63.885  8.604   1.00 28.10  ? 271  PRO B C     1 
ATOM   7003  O O     . PRO B 1 271 ? -39.843 63.876  7.374   1.00 28.16  ? 271  PRO B O     1 
ATOM   7004  C CB    . PRO B 1 271 ? -37.705 62.728  9.335   1.00 28.38  ? 271  PRO B CB    1 
ATOM   7005  C CG    . PRO B 1 271 ? -37.322 61.301  9.481   1.00 28.29  ? 271  PRO B CG    1 
ATOM   7006  C CD    . PRO B 1 271 ? -38.325 60.592  8.589   1.00 28.44  ? 271  PRO B CD    1 
ATOM   7007  N N     . LYS B 1 272 ? -40.280 64.894  9.340   1.00 27.47  ? 272  LYS B N     1 
ATOM   7008  C CA    . LYS B 1 272 ? -40.906 66.069  8.720   1.00 27.54  ? 272  LYS B CA    1 
ATOM   7009  C C     . LYS B 1 272 ? -40.014 67.306  8.854   1.00 27.05  ? 272  LYS B C     1 
ATOM   7010  O O     . LYS B 1 272 ? -39.211 67.403  9.790   1.00 27.63  ? 272  LYS B O     1 
ATOM   7011  C CB    . LYS B 1 272 ? -42.309 66.310  9.316   1.00 27.90  ? 272  LYS B CB    1 
ATOM   7012  C CG    . LYS B 1 272 ? -43.333 65.180  9.049   1.00 28.47  ? 272  LYS B CG    1 
ATOM   7013  C CD    . LYS B 1 272 ? -43.620 64.968  7.526   1.00 31.54  ? 272  LYS B CD    1 
ATOM   7014  C CE    . LYS B 1 272 ? -43.670 63.474  7.104   1.00 33.49  ? 272  LYS B CE    1 
ATOM   7015  N NZ    . LYS B 1 272 ? -44.565 62.543  7.902   1.00 31.78  ? 272  LYS B NZ    1 
ATOM   7016  N N     . GLY B 1 273 ? -40.141 68.239  7.919   1.00 26.43  ? 273  GLY B N     1 
ATOM   7017  C CA    . GLY B 1 273 ? -39.264 69.407  7.875   1.00 26.03  ? 273  GLY B CA    1 
ATOM   7018  C C     . GLY B 1 273 ? -39.702 70.555  8.780   1.00 25.54  ? 273  GLY B C     1 
ATOM   7019  O O     . GLY B 1 273 ? -40.512 71.397  8.383   1.00 25.91  ? 273  GLY B O     1 
ATOM   7020  N N     . VAL B 1 274 ? -39.172 70.575  10.001  1.00 24.50  ? 274  VAL B N     1 
ATOM   7021  C CA    . VAL B 1 274 ? -39.483 71.620  10.972  1.00 23.58  ? 274  VAL B CA    1 
ATOM   7022  C C     . VAL B 1 274 ? -38.866 72.921  10.460  1.00 23.10  ? 274  VAL B C     1 
ATOM   7023  O O     . VAL B 1 274 ? -37.661 72.986  10.223  1.00 22.70  ? 274  VAL B O     1 
ATOM   7024  C CB    . VAL B 1 274 ? -38.953 71.248  12.400  1.00 23.54  ? 274  VAL B CB    1 
ATOM   7025  C CG1   . VAL B 1 274 ? -39.069 72.432  13.371  1.00 22.67  ? 274  VAL B CG1   1 
ATOM   7026  C CG2   . VAL B 1 274 ? -39.678 70.016  12.937  1.00 22.31  ? 274  VAL B CG2   1 
ATOM   7027  N N     . LEU B 1 275 ? -39.704 73.935  10.245  1.00 23.02  ? 275  LEU B N     1 
ATOM   7028  C CA    . LEU B 1 275 ? -39.241 75.193  9.657   1.00 22.45  ? 275  LEU B CA    1 
ATOM   7029  C C     . LEU B 1 275 ? -39.187 76.308  10.683  1.00 22.71  ? 275  LEU B C     1 
ATOM   7030  O O     . LEU B 1 275 ? -40.179 76.595  11.356  1.00 21.91  ? 275  LEU B O     1 
ATOM   7031  C CB    . LEU B 1 275 ? -40.096 75.598  8.452   1.00 22.42  ? 275  LEU B CB    1 
ATOM   7032  C CG    . LEU B 1 275 ? -39.687 76.773  7.525   1.00 22.66  ? 275  LEU B CG    1 
ATOM   7033  C CD1   . LEU B 1 275 ? -40.500 76.719  6.253   1.00 19.87  ? 275  LEU B CD1   1 
ATOM   7034  C CD2   . LEU B 1 275 ? -39.847 78.161  8.181   1.00 20.29  ? 275  LEU B CD2   1 
ATOM   7035  N N     . HIS B 1 276 ? -38.000 76.916  10.780  1.00 22.98  ? 276  HIS B N     1 
ATOM   7036  C CA    . HIS B 1 276 ? -37.746 78.108  11.591  1.00 23.09  ? 276  HIS B CA    1 
ATOM   7037  C C     . HIS B 1 276 ? -37.547 79.344  10.723  1.00 23.54  ? 276  HIS B C     1 
ATOM   7038  O O     . HIS B 1 276 ? -36.864 79.285  9.688   1.00 23.39  ? 276  HIS B O     1 
ATOM   7039  C CB    . HIS B 1 276 ? -36.513 77.891  12.472  1.00 22.52  ? 276  HIS B CB    1 
ATOM   7040  C CG    . HIS B 1 276 ? -36.792 77.007  13.640  1.00 21.92  ? 276  HIS B CG    1 
ATOM   7041  N ND1   . HIS B 1 276 ? -37.413 77.466  14.780  1.00 20.67  ? 276  HIS B ND1   1 
ATOM   7042  C CD2   . HIS B 1 276 ? -36.613 75.677  13.814  1.00 21.12  ? 276  HIS B CD2   1 
ATOM   7043  C CE1   . HIS B 1 276 ? -37.592 76.462  15.614  1.00 20.97  ? 276  HIS B CE1   1 
ATOM   7044  N NE2   . HIS B 1 276 ? -37.104 75.368  15.058  1.00 22.79  ? 276  HIS B NE2   1 
ATOM   7045  N N     . THR B 1 277 ? -38.135 80.461  11.149  1.00 23.63  ? 277  THR B N     1 
ATOM   7046  C CA    . THR B 1 277 ? -37.917 81.730  10.447  1.00 23.32  ? 277  THR B CA    1 
ATOM   7047  C C     . THR B 1 277 ? -36.761 82.491  11.128  1.00 23.66  ? 277  THR B C     1 
ATOM   7048  O O     . THR B 1 277 ? -35.958 81.870  11.857  1.00 23.24  ? 277  THR B O     1 
ATOM   7049  C CB    . THR B 1 277 ? -39.236 82.549  10.243  1.00 23.44  ? 277  THR B CB    1 
ATOM   7050  O OG1   . THR B 1 277 ? -39.755 82.974  11.498  1.00 23.09  ? 277  THR B OG1   1 
ATOM   7051  C CG2   . THR B 1 277 ? -40.293 81.702  9.517   1.00 21.87  ? 277  THR B CG2   1 
ATOM   7052  N N     . THR B 1 278 ? -36.654 83.803  10.905  1.00 23.58  ? 278  THR B N     1 
ATOM   7053  C CA    . THR B 1 278 ? -35.389 84.495  11.182  1.00 23.51  ? 278  THR B CA    1 
ATOM   7054  C C     . THR B 1 278 ? -35.276 85.251  12.509  1.00 24.04  ? 278  THR B C     1 
ATOM   7055  O O     . THR B 1 278 ? -34.395 84.921  13.315  1.00 24.34  ? 278  THR B O     1 
ATOM   7056  C CB    . THR B 1 278 ? -34.944 85.378  9.988   1.00 24.15  ? 278  THR B CB    1 
ATOM   7057  O OG1   . THR B 1 278 ? -34.899 84.583  8.788   1.00 23.58  ? 278  THR B OG1   1 
ATOM   7058  C CG2   . THR B 1 278 ? -33.570 86.022  10.244  1.00 22.06  ? 278  THR B CG2   1 
ATOM   7059  N N     . GLY B 1 279 ? -36.147 86.237  12.737  1.00 23.98  ? 279  GLY B N     1 
ATOM   7060  C CA    . GLY B 1 279 ? -36.024 87.178  13.871  1.00 23.95  ? 279  GLY B CA    1 
ATOM   7061  C C     . GLY B 1 279 ? -36.213 86.599  15.274  1.00 24.42  ? 279  GLY B C     1 
ATOM   7062  O O     . GLY B 1 279 ? -35.299 86.649  16.128  1.00 24.58  ? 279  GLY B O     1 
ATOM   7063  N N     . GLY B 1 280 ? -37.397 86.045  15.521  1.00 23.87  ? 280  GLY B N     1 
ATOM   7064  C CA    . GLY B 1 280 ? -37.715 85.468  16.818  1.00 23.56  ? 280  GLY B CA    1 
ATOM   7065  C C     . GLY B 1 280 ? -36.805 84.304  17.146  1.00 23.02  ? 280  GLY B C     1 
ATOM   7066  O O     . GLY B 1 280 ? -36.427 84.105  18.309  1.00 23.09  ? 280  GLY B O     1 
ATOM   7067  N N     . TYR B 1 281 ? -36.457 83.531  16.120  1.00 22.58  ? 281  TYR B N     1 
ATOM   7068  C CA    . TYR B 1 281 ? -35.544 82.419  16.303  1.00 22.35  ? 281  TYR B CA    1 
ATOM   7069  C C     . TYR B 1 281 ? -34.169 82.898  16.806  1.00 22.51  ? 281  TYR B C     1 
ATOM   7070  O O     . TYR B 1 281 ? -33.629 82.327  17.749  1.00 22.94  ? 281  TYR B O     1 
ATOM   7071  C CB    . TYR B 1 281 ? -35.421 81.517  15.045  1.00 21.78  ? 281  TYR B CB    1 
ATOM   7072  C CG    . TYR B 1 281 ? -34.278 80.541  15.192  1.00 22.01  ? 281  TYR B CG    1 
ATOM   7073  C CD1   . TYR B 1 281 ? -34.447 79.303  15.831  1.00 21.84  ? 281  TYR B CD1   1 
ATOM   7074  C CD2   . TYR B 1 281 ? -32.984 80.896  14.774  1.00 23.47  ? 281  TYR B CD2   1 
ATOM   7075  C CE1   . TYR B 1 281 ? -33.348 78.417  15.979  1.00 21.44  ? 281  TYR B CE1   1 
ATOM   7076  C CE2   . TYR B 1 281 ? -31.894 80.032  14.940  1.00 21.10  ? 281  TYR B CE2   1 
ATOM   7077  C CZ    . TYR B 1 281 ? -32.086 78.815  15.537  1.00 20.69  ? 281  TYR B CZ    1 
ATOM   7078  O OH    . TYR B 1 281 ? -30.994 78.019  15.686  1.00 21.62  ? 281  TYR B OH    1 
ATOM   7079  N N     . LEU B 1 282 ? -33.617 83.940  16.189  1.00 22.72  ? 282  LEU B N     1 
ATOM   7080  C CA    . LEU B 1 282 ? -32.287 84.423  16.549  1.00 23.20  ? 282  LEU B CA    1 
ATOM   7081  C C     . LEU B 1 282 ? -32.286 85.183  17.886  1.00 23.71  ? 282  LEU B C     1 
ATOM   7082  O O     . LEU B 1 282 ? -31.354 85.046  18.691  1.00 23.48  ? 282  LEU B O     1 
ATOM   7083  C CB    . LEU B 1 282 ? -31.687 85.268  15.424  1.00 23.06  ? 282  LEU B CB    1 
ATOM   7084  C CG    . LEU B 1 282 ? -30.191 85.612  15.452  1.00 23.75  ? 282  LEU B CG    1 
ATOM   7085  C CD1   . LEU B 1 282 ? -29.318 84.362  15.497  1.00 24.03  ? 282  LEU B CD1   1 
ATOM   7086  C CD2   . LEU B 1 282 ? -29.810 86.515  14.250  1.00 23.24  ? 282  LEU B CD2   1 
ATOM   7087  N N     . VAL B 1 283 ? -33.328 85.978  18.122  1.00 23.82  ? 283  VAL B N     1 
ATOM   7088  C CA    . VAL B 1 283 ? -33.524 86.591  19.441  1.00 23.90  ? 283  VAL B CA    1 
ATOM   7089  C C     . VAL B 1 283 ? -33.541 85.508  20.512  1.00 24.08  ? 283  VAL B C     1 
ATOM   7090  O O     . VAL B 1 283 ? -32.868 85.624  21.541  1.00 24.49  ? 283  VAL B O     1 
ATOM   7091  C CB    . VAL B 1 283 ? -34.836 87.432  19.521  1.00 23.77  ? 283  VAL B CB    1 
ATOM   7092  C CG1   . VAL B 1 283 ? -35.169 87.779  20.978  1.00 23.28  ? 283  VAL B CG1   1 
ATOM   7093  C CG2   . VAL B 1 283 ? -34.699 88.704  18.694  1.00 22.97  ? 283  VAL B CG2   1 
ATOM   7094  N N     . TYR B 1 284 ? -34.291 84.443  20.255  1.00 23.77  ? 284  TYR B N     1 
ATOM   7095  C CA    . TYR B 1 284 ? -34.432 83.377  21.243  1.00 23.35  ? 284  TYR B CA    1 
ATOM   7096  C C     . TYR B 1 284 ? -33.143 82.576  21.459  1.00 23.35  ? 284  TYR B C     1 
ATOM   7097  O O     . TYR B 1 284 ? -32.791 82.270  22.604  1.00 23.11  ? 284  TYR B O     1 
ATOM   7098  C CB    . TYR B 1 284 ? -35.612 82.450  20.904  1.00 23.13  ? 284  TYR B CB    1 
ATOM   7099  C CG    . TYR B 1 284 ? -36.158 81.774  22.135  1.00 21.51  ? 284  TYR B CG    1 
ATOM   7100  C CD1   . TYR B 1 284 ? -36.075 80.398  22.286  1.00 21.27  ? 284  TYR B CD1   1 
ATOM   7101  C CD2   . TYR B 1 284 ? -36.714 82.524  23.163  1.00 19.77  ? 284  TYR B CD2   1 
ATOM   7102  C CE1   . TYR B 1 284 ? -36.537 79.779  23.434  1.00 22.77  ? 284  TYR B CE1   1 
ATOM   7103  C CE2   . TYR B 1 284 ? -37.195 81.927  24.311  1.00 21.71  ? 284  TYR B CE2   1 
ATOM   7104  C CZ    . TYR B 1 284 ? -37.100 80.545  24.448  1.00 23.05  ? 284  TYR B CZ    1 
ATOM   7105  O OH    . TYR B 1 284 ? -37.580 79.935  25.585  1.00 22.84  ? 284  TYR B OH    1 
ATOM   7106  N N     . ALA B 1 285 ? -32.447 82.252  20.369  1.00 23.26  ? 285  ALA B N     1 
ATOM   7107  C CA    . ALA B 1 285 ? -31.181 81.531  20.443  1.00 23.74  ? 285  ALA B CA    1 
ATOM   7108  C C     . ALA B 1 285 ? -30.131 82.376  21.178  1.00 24.26  ? 285  ALA B C     1 
ATOM   7109  O O     . ALA B 1 285 ? -29.440 81.881  22.076  1.00 25.02  ? 285  ALA B O     1 
ATOM   7110  C CB    . ALA B 1 285 ? -30.698 81.143  19.046  1.00 23.20  ? 285  ALA B CB    1 
ATOM   7111  N N     . ALA B 1 286 ? -30.035 83.654  20.809  1.00 24.46  ? 286  ALA B N     1 
ATOM   7112  C CA    . ALA B 1 286 ? -29.093 84.607  21.429  1.00 24.16  ? 286  ALA B CA    1 
ATOM   7113  C C     . ALA B 1 286 ? -29.351 84.828  22.921  1.00 24.01  ? 286  ALA B C     1 
ATOM   7114  O O     . ALA B 1 286 ? -28.411 84.902  23.714  1.00 24.41  ? 286  ALA B O     1 
ATOM   7115  C CB    . ALA B 1 286 ? -29.118 85.946  20.678  1.00 23.61  ? 286  ALA B CB    1 
ATOM   7116  N N     . THR B 1 287 ? -30.627 84.928  23.290  1.00 23.69  ? 287  THR B N     1 
ATOM   7117  C CA    . THR B 1 287 ? -31.038 85.234  24.663  1.00 23.03  ? 287  THR B CA    1 
ATOM   7118  C C     . THR B 1 287 ? -30.794 84.047  25.584  1.00 22.49  ? 287  THR B C     1 
ATOM   7119  O O     . THR B 1 287 ? -30.177 84.187  26.650  1.00 22.62  ? 287  THR B O     1 
ATOM   7120  C CB    . THR B 1 287 ? -32.545 85.701  24.721  1.00 23.29  ? 287  THR B CB    1 
ATOM   7121  O OG1   . THR B 1 287 ? -32.685 86.962  24.041  1.00 22.67  ? 287  THR B OG1   1 
ATOM   7122  C CG2   . THR B 1 287 ? -33.015 85.871  26.147  1.00 22.53  ? 287  THR B CG2   1 
ATOM   7123  N N     . THR B 1 288 ? -31.271 82.882  25.161  1.00 21.71  ? 288  THR B N     1 
ATOM   7124  C CA    . THR B 1 288 ? -31.114 81.664  25.937  1.00 21.24  ? 288  THR B CA    1 
ATOM   7125  C C     . THR B 1 288 ? -29.638 81.321  26.113  1.00 21.81  ? 288  THR B C     1 
ATOM   7126  O O     . THR B 1 288 ? -29.213 81.012  27.236  1.00 21.47  ? 288  THR B O     1 
ATOM   7127  C CB    . THR B 1 288 ? -31.850 80.481  25.301  1.00 21.22  ? 288  THR B CB    1 
ATOM   7128  O OG1   . THR B 1 288 ? -31.542 80.448  23.908  1.00 20.66  ? 288  THR B OG1   1 
ATOM   7129  C CG2   . THR B 1 288 ? -33.382 80.599  25.494  1.00 18.93  ? 288  THR B CG2   1 
ATOM   7130  N N     . PHE B 1 289 ? -28.857 81.398  25.022  1.00 22.14  ? 289  PHE B N     1 
ATOM   7131  C CA    . PHE B 1 289 ? -27.390 81.181  25.103  1.00 22.51  ? 289  PHE B CA    1 
ATOM   7132  C C     . PHE B 1 289 ? -26.755 82.060  26.188  1.00 22.44  ? 289  PHE B C     1 
ATOM   7133  O O     . PHE B 1 289 ? -26.144 81.552  27.129  1.00 21.91  ? 289  PHE B O     1 
ATOM   7134  C CB    . PHE B 1 289 ? -26.683 81.402  23.754  1.00 21.81  ? 289  PHE B CB    1 
ATOM   7135  C CG    . PHE B 1 289 ? -25.175 81.381  23.850  1.00 22.23  ? 289  PHE B CG    1 
ATOM   7136  C CD1   . PHE B 1 289 ? -24.470 80.178  23.755  1.00 21.47  ? 289  PHE B CD1   1 
ATOM   7137  C CD2   . PHE B 1 289 ? -24.454 82.566  24.042  1.00 22.29  ? 289  PHE B CD2   1 
ATOM   7138  C CE1   . PHE B 1 289 ? -23.074 80.146  23.860  1.00 21.41  ? 289  PHE B CE1   1 
ATOM   7139  C CE2   . PHE B 1 289 ? -23.043 82.549  24.130  1.00 22.50  ? 289  PHE B CE2   1 
ATOM   7140  C CZ    . PHE B 1 289 ? -22.350 81.338  24.048  1.00 21.30  ? 289  PHE B CZ    1 
ATOM   7141  N N     . LYS B 1 290 ? -26.940 83.373  26.046  1.00 23.16  ? 290  LYS B N     1 
ATOM   7142  C CA    . LYS B 1 290 ? -26.354 84.370  26.940  1.00 23.70  ? 290  LYS B CA    1 
ATOM   7143  C C     . LYS B 1 290 ? -26.639 84.074  28.412  1.00 24.02  ? 290  LYS B C     1 
ATOM   7144  O O     . LYS B 1 290 ? -25.706 83.900  29.199  1.00 24.14  ? 290  LYS B O     1 
ATOM   7145  C CB    . LYS B 1 290 ? -26.865 85.761  26.567  1.00 23.37  ? 290  LYS B CB    1 
ATOM   7146  C CG    . LYS B 1 290 ? -26.141 86.928  27.221  1.00 24.19  ? 290  LYS B CG    1 
ATOM   7147  C CD    . LYS B 1 290 ? -26.305 88.164  26.316  1.00 25.34  ? 290  LYS B CD    1 
ATOM   7148  C CE    . LYS B 1 290 ? -26.485 89.443  27.096  1.00 27.20  ? 290  LYS B CE    1 
ATOM   7149  N NZ    . LYS B 1 290 ? -26.393 90.644  26.197  1.00 28.61  ? 290  LYS B NZ    1 
ATOM   7150  N N     . TYR B 1 291 ? -27.922 83.983  28.771  1.00 24.33  ? 291  TYR B N     1 
ATOM   7151  C CA    . TYR B 1 291 ? -28.303 83.898  30.177  1.00 24.34  ? 291  TYR B CA    1 
ATOM   7152  C C     . TYR B 1 291 ? -28.086 82.536  30.806  1.00 23.77  ? 291  TYR B C     1 
ATOM   7153  O O     . TYR B 1 291 ? -27.676 82.451  31.960  1.00 23.67  ? 291  TYR B O     1 
ATOM   7154  C CB    . TYR B 1 291 ? -29.741 84.401  30.414  1.00 25.72  ? 291  TYR B CB    1 
ATOM   7155  C CG    . TYR B 1 291 ? -29.955 85.881  30.096  1.00 26.83  ? 291  TYR B CG    1 
ATOM   7156  C CD1   . TYR B 1 291 ? -31.161 86.333  29.558  1.00 28.27  ? 291  TYR B CD1   1 
ATOM   7157  C CD2   . TYR B 1 291 ? -28.949 86.815  30.320  1.00 27.87  ? 291  TYR B CD2   1 
ATOM   7158  C CE1   . TYR B 1 291 ? -31.363 87.688  29.264  1.00 29.14  ? 291  TYR B CE1   1 
ATOM   7159  C CE2   . TYR B 1 291 ? -29.128 88.161  30.018  1.00 28.64  ? 291  TYR B CE2   1 
ATOM   7160  C CZ    . TYR B 1 291 ? -30.337 88.598  29.500  1.00 29.03  ? 291  TYR B CZ    1 
ATOM   7161  O OH    . TYR B 1 291 ? -30.512 89.949  29.225  1.00 28.78  ? 291  TYR B OH    1 
ATOM   7162  N N     . VAL B 1 292 ? -28.354 81.467  30.062  1.00 23.01  ? 292  VAL B N     1 
ATOM   7163  C CA    . VAL B 1 292 ? -28.353 80.121  30.670  1.00 21.98  ? 292  VAL B CA    1 
ATOM   7164  C C     . VAL B 1 292 ? -26.927 79.613  30.889  1.00 21.92  ? 292  VAL B C     1 
ATOM   7165  O O     . VAL B 1 292 ? -26.655 78.907  31.855  1.00 21.30  ? 292  VAL B O     1 
ATOM   7166  C CB    . VAL B 1 292 ? -29.229 79.122  29.860  1.00 22.09  ? 292  VAL B CB    1 
ATOM   7167  C CG1   . VAL B 1 292 ? -29.005 77.683  30.315  1.00 21.59  ? 292  VAL B CG1   1 
ATOM   7168  C CG2   . VAL B 1 292 ? -30.701 79.515  29.953  1.00 19.87  ? 292  VAL B CG2   1 
ATOM   7169  N N     . PHE B 1 293 ? -26.018 79.997  29.992  1.00 21.84  ? 293  PHE B N     1 
ATOM   7170  C CA    . PHE B 1 293 ? -24.605 79.654  30.120  1.00 21.63  ? 293  PHE B CA    1 
ATOM   7171  C C     . PHE B 1 293 ? -23.881 80.794  30.810  1.00 22.07  ? 293  PHE B C     1 
ATOM   7172  O O     . PHE B 1 293 ? -22.664 80.756  30.966  1.00 21.70  ? 293  PHE B O     1 
ATOM   7173  C CB    . PHE B 1 293 ? -23.965 79.396  28.752  1.00 21.06  ? 293  PHE B CB    1 
ATOM   7174  C CG    . PHE B 1 293 ? -24.509 78.191  28.028  1.00 21.13  ? 293  PHE B CG    1 
ATOM   7175  C CD1   . PHE B 1 293 ? -25.076 78.328  26.763  1.00 19.42  ? 293  PHE B CD1   1 
ATOM   7176  C CD2   . PHE B 1 293 ? -24.434 76.907  28.597  1.00 21.49  ? 293  PHE B CD2   1 
ATOM   7177  C CE1   . PHE B 1 293 ? -25.587 77.207  26.073  1.00 20.01  ? 293  PHE B CE1   1 
ATOM   7178  C CE2   . PHE B 1 293 ? -24.931 75.784  27.906  1.00 20.49  ? 293  PHE B CE2   1 
ATOM   7179  C CZ    . PHE B 1 293 ? -25.516 75.945  26.638  1.00 19.18  ? 293  PHE B CZ    1 
ATOM   7180  N N     . ASP B 1 294 ? -24.642 81.817  31.207  1.00 23.04  ? 294  ASP B N     1 
ATOM   7181  C CA    . ASP B 1 294 ? -24.106 82.980  31.916  1.00 23.41  ? 294  ASP B CA    1 
ATOM   7182  C C     . ASP B 1 294 ? -22.885 83.501  31.190  1.00 24.10  ? 294  ASP B C     1 
ATOM   7183  O O     . ASP B 1 294 ? -21.793 83.665  31.771  1.00 23.78  ? 294  ASP B O     1 
ATOM   7184  C CB    . ASP B 1 294 ? -23.765 82.644  33.370  1.00 22.90  ? 294  ASP B CB    1 
ATOM   7185  C CG    . ASP B 1 294 ? -23.664 83.878  34.232  1.00 22.03  ? 294  ASP B CG    1 
ATOM   7186  O OD1   . ASP B 1 294 ? -22.686 84.013  34.968  1.00 21.79  ? 294  ASP B OD1   1 
ATOM   7187  O OD2   . ASP B 1 294 ? -24.568 84.725  34.182  1.00 21.59  ? 294  ASP B OD2   1 
ATOM   7188  N N     . TYR B 1 295 ? -23.081 83.755  29.902  1.00 24.82  ? 295  TYR B N     1 
ATOM   7189  C CA    . TYR B 1 295 ? -21.985 84.101  29.039  1.00 25.67  ? 295  TYR B CA    1 
ATOM   7190  C C     . TYR B 1 295 ? -21.404 85.485  29.351  1.00 25.60  ? 295  TYR B C     1 
ATOM   7191  O O     . TYR B 1 295 ? -22.137 86.461  29.522  1.00 25.53  ? 295  TYR B O     1 
ATOM   7192  C CB    . TYR B 1 295 ? -22.379 83.956  27.560  1.00 26.34  ? 295  TYR B CB    1 
ATOM   7193  C CG    . TYR B 1 295 ? -21.344 84.573  26.668  1.00 27.97  ? 295  TYR B CG    1 
ATOM   7194  C CD1   . TYR B 1 295 ? -20.160 83.892  26.369  1.00 28.16  ? 295  TYR B CD1   1 
ATOM   7195  C CD2   . TYR B 1 295 ? -21.512 85.874  26.174  1.00 28.78  ? 295  TYR B CD2   1 
ATOM   7196  C CE1   . TYR B 1 295 ? -19.182 84.482  25.566  1.00 28.39  ? 295  TYR B CE1   1 
ATOM   7197  C CE2   . TYR B 1 295 ? -20.542 86.467  25.379  1.00 28.50  ? 295  TYR B CE2   1 
ATOM   7198  C CZ    . TYR B 1 295 ? -19.386 85.769  25.083  1.00 28.52  ? 295  TYR B CZ    1 
ATOM   7199  O OH    . TYR B 1 295 ? -18.425 86.373  24.295  1.00 30.07  ? 295  TYR B OH    1 
ATOM   7200  N N     . HIS B 1 296 ? -20.074 85.539  29.432  1.00 25.46  ? 296  HIS B N     1 
ATOM   7201  C CA    . HIS B 1 296 ? -19.326 86.790  29.578  1.00 24.93  ? 296  HIS B CA    1 
ATOM   7202  C C     . HIS B 1 296 ? -18.251 86.861  28.511  1.00 24.73  ? 296  HIS B C     1 
ATOM   7203  O O     . HIS B 1 296 ? -17.590 85.855  28.243  1.00 24.31  ? 296  HIS B O     1 
ATOM   7204  C CB    . HIS B 1 296 ? -18.608 86.830  30.923  1.00 24.87  ? 296  HIS B CB    1 
ATOM   7205  C CG    . HIS B 1 296 ? -19.519 86.986  32.092  1.00 25.70  ? 296  HIS B CG    1 
ATOM   7206  N ND1   . HIS B 1 296 ? -20.408 86.004  32.481  1.00 24.30  ? 296  HIS B ND1   1 
ATOM   7207  C CD2   . HIS B 1 296 ? -19.663 88.001  32.976  1.00 25.40  ? 296  HIS B CD2   1 
ATOM   7208  C CE1   . HIS B 1 296 ? -21.069 86.415  33.546  1.00 25.23  ? 296  HIS B CE1   1 
ATOM   7209  N NE2   . HIS B 1 296 ? -20.636 87.623  33.868  1.00 26.30  ? 296  HIS B NE2   1 
ATOM   7210  N N     . PRO B 1 297 ? -18.021 88.060  27.948  1.00 24.57  ? 297  PRO B N     1 
ATOM   7211  C CA    . PRO B 1 297 ? -16.915 88.277  27.000  1.00 24.45  ? 297  PRO B CA    1 
ATOM   7212  C C     . PRO B 1 297 ? -15.595 87.546  27.352  1.00 24.03  ? 297  PRO B C     1 
ATOM   7213  O O     . PRO B 1 297 ? -15.048 87.666  28.452  1.00 23.08  ? 297  PRO B O     1 
ATOM   7214  C CB    . PRO B 1 297 ? -16.736 89.801  27.021  1.00 24.23  ? 297  PRO B CB    1 
ATOM   7215  C CG    . PRO B 1 297 ? -18.144 90.307  27.237  1.00 24.35  ? 297  PRO B CG    1 
ATOM   7216  C CD    . PRO B 1 297 ? -18.786 89.304  28.187  1.00 24.97  ? 297  PRO B CD    1 
ATOM   7217  N N     . GLY B 1 298 ? -15.117 86.764  26.403  1.00 24.56  ? 298  GLY B N     1 
ATOM   7218  C CA    . GLY B 1 298 ? -13.887 86.022  26.593  1.00 25.06  ? 298  GLY B CA    1 
ATOM   7219  C C     . GLY B 1 298 ? -14.119 84.625  27.133  1.00 25.04  ? 298  GLY B C     1 
ATOM   7220  O O     . GLY B 1 298 ? -13.155 83.888  27.371  1.00 26.14  ? 298  GLY B O     1 
ATOM   7221  N N     . ASP B 1 299 ? -15.377 84.253  27.370  1.00 24.26  ? 299  ASP B N     1 
ATOM   7222  C CA    . ASP B 1 299 ? -15.653 82.854  27.680  1.00 23.61  ? 299  ASP B CA    1 
ATOM   7223  C C     . ASP B 1 299 ? -15.470 82.032  26.409  1.00 22.77  ? 299  ASP B C     1 
ATOM   7224  O O     . ASP B 1 299 ? -15.955 82.404  25.337  1.00 23.13  ? 299  ASP B O     1 
ATOM   7225  C CB    . ASP B 1 299 ? -17.032 82.652  28.320  1.00 23.20  ? 299  ASP B CB    1 
ATOM   7226  C CG    . ASP B 1 299 ? -17.145 83.316  29.709  1.00 23.41  ? 299  ASP B CG    1 
ATOM   7227  O OD1   . ASP B 1 299 ? -16.119 83.745  30.301  1.00 22.00  ? 299  ASP B OD1   1 
ATOM   7228  O OD2   . ASP B 1 299 ? -18.276 83.422  30.204  1.00 21.79  ? 299  ASP B OD2   1 
ATOM   7229  N N     . ILE B 1 300 ? -14.675 80.978  26.531  1.00 22.04  ? 300  ILE B N     1 
ATOM   7230  C CA    . ILE B 1 300 ? -14.525 79.962  25.492  1.00 21.20  ? 300  ILE B CA    1 
ATOM   7231  C C     . ILE B 1 300 ? -15.615 78.914  25.741  1.00 20.77  ? 300  ILE B C     1 
ATOM   7232  O O     . ILE B 1 300 ? -15.727 78.353  26.855  1.00 20.53  ? 300  ILE B O     1 
ATOM   7233  C CB    . ILE B 1 300 ? -13.125 79.303  25.552  1.00 21.77  ? 300  ILE B CB    1 
ATOM   7234  C CG1   . ILE B 1 300 ? -12.015 80.368  25.531  1.00 22.23  ? 300  ILE B CG1   1 
ATOM   7235  C CG2   . ILE B 1 300 ? -12.945 78.281  24.445  1.00 20.77  ? 300  ILE B CG2   1 
ATOM   7236  C CD1   . ILE B 1 300 ? -11.750 80.946  24.188  1.00 23.49  ? 300  ILE B CD1   1 
ATOM   7237  N N     . TYR B 1 301 ? -16.425 78.673  24.714  1.00 19.46  ? 301  TYR B N     1 
ATOM   7238  C CA    . TYR B 1 301 ? -17.622 77.867  24.851  1.00 18.57  ? 301  TYR B CA    1 
ATOM   7239  C C     . TYR B 1 301 ? -17.535 76.674  23.918  1.00 18.14  ? 301  TYR B C     1 
ATOM   7240  O O     . TYR B 1 301 ? -17.150 76.836  22.750  1.00 17.44  ? 301  TYR B O     1 
ATOM   7241  C CB    . TYR B 1 301 ? -18.856 78.720  24.516  1.00 18.36  ? 301  TYR B CB    1 
ATOM   7242  C CG    . TYR B 1 301 ? -20.110 77.929  24.242  1.00 18.19  ? 301  TYR B CG    1 
ATOM   7243  C CD1   . TYR B 1 301 ? -20.474 77.589  22.927  1.00 19.37  ? 301  TYR B CD1   1 
ATOM   7244  C CD2   . TYR B 1 301 ? -20.936 77.515  25.282  1.00 18.13  ? 301  TYR B CD2   1 
ATOM   7245  C CE1   . TYR B 1 301 ? -21.633 76.866  22.665  1.00 17.69  ? 301  TYR B CE1   1 
ATOM   7246  C CE2   . TYR B 1 301 ? -22.095 76.776  25.031  1.00 18.50  ? 301  TYR B CE2   1 
ATOM   7247  C CZ    . TYR B 1 301 ? -22.435 76.459  23.721  1.00 18.54  ? 301  TYR B CZ    1 
ATOM   7248  O OH    . TYR B 1 301 ? -23.572 75.726  23.461  1.00 19.47  ? 301  TYR B OH    1 
ATOM   7249  N N     . TRP B 1 302 ? -17.900 75.495  24.438  1.00 17.74  ? 302  TRP B N     1 
ATOM   7250  C CA    . TRP B 1 302 ? -17.901 74.243  23.654  1.00 17.77  ? 302  TRP B CA    1 
ATOM   7251  C C     . TRP B 1 302 ? -19.188 73.412  23.755  1.00 17.99  ? 302  TRP B C     1 
ATOM   7252  O O     . TRP B 1 302 ? -19.472 72.770  24.757  1.00 18.13  ? 302  TRP B O     1 
ATOM   7253  C CB    . TRP B 1 302 ? -16.667 73.377  23.959  1.00 16.83  ? 302  TRP B CB    1 
ATOM   7254  C CG    . TRP B 1 302 ? -16.584 72.136  23.107  1.00 16.49  ? 302  TRP B CG    1 
ATOM   7255  C CD1   . TRP B 1 302 ? -17.125 71.964  21.861  1.00 16.08  ? 302  TRP B CD1   1 
ATOM   7256  C CD2   . TRP B 1 302 ? -15.906 70.903  23.425  1.00 14.74  ? 302  TRP B CD2   1 
ATOM   7257  N NE1   . TRP B 1 302 ? -16.836 70.712  21.389  1.00 15.72  ? 302  TRP B NE1   1 
ATOM   7258  C CE2   . TRP B 1 302 ? -16.099 70.030  22.324  1.00 13.92  ? 302  TRP B CE2   1 
ATOM   7259  C CE3   . TRP B 1 302 ? -15.155 70.456  24.534  1.00 13.52  ? 302  TRP B CE3   1 
ATOM   7260  C CZ2   . TRP B 1 302 ? -15.568 68.722  22.282  1.00 13.47  ? 302  TRP B CZ2   1 
ATOM   7261  C CZ3   . TRP B 1 302 ? -14.647 69.154  24.517  1.00 15.93  ? 302  TRP B CZ3   1 
ATOM   7262  C CH2   . TRP B 1 302 ? -14.850 68.295  23.378  1.00 16.43  ? 302  TRP B CH2   1 
ATOM   7263  N N     . CYS B 1 303 ? -19.947 73.411  22.675  1.00 19.18  ? 303  CYS B N     1 
ATOM   7264  C CA    . CYS B 1 303 ? -21.086 72.515  22.523  1.00 19.46  ? 303  CYS B CA    1 
ATOM   7265  C C     . CYS B 1 303 ? -20.645 71.327  21.668  1.00 19.34  ? 303  CYS B C     1 
ATOM   7266  O O     . CYS B 1 303 ? -20.134 71.525  20.566  1.00 18.86  ? 303  CYS B O     1 
ATOM   7267  C CB    . CYS B 1 303 ? -22.248 73.272  21.864  1.00 20.00  ? 303  CYS B CB    1 
ATOM   7268  S SG    . CYS B 1 303 ? -23.583 72.222  21.239  1.00 20.63  ? 303  CYS B SG    1 
ATOM   7269  N N     . THR B 1 304 ? -20.833 70.107  22.191  1.00 19.50  ? 304  THR B N     1 
ATOM   7270  C CA    . THR B 1 304 ? -20.379 68.871  21.523  1.00 20.07  ? 304  THR B CA    1 
ATOM   7271  C C     . THR B 1 304 ? -21.315 68.368  20.428  1.00 20.70  ? 304  THR B C     1 
ATOM   7272  O O     . THR B 1 304 ? -20.949 67.475  19.644  1.00 20.31  ? 304  THR B O     1 
ATOM   7273  C CB    . THR B 1 304 ? -20.167 67.681  22.498  1.00 19.97  ? 304  THR B CB    1 
ATOM   7274  O OG1   . THR B 1 304 ? -21.418 67.321  23.082  1.00 20.16  ? 304  THR B OG1   1 
ATOM   7275  C CG2   . THR B 1 304 ? -19.154 68.002  23.574  1.00 18.43  ? 304  THR B CG2   1 
ATOM   7276  N N     . ALA B 1 305 ? -22.513 68.946  20.378  1.00 21.44  ? 305  ALA B N     1 
ATOM   7277  C CA    . ALA B 1 305 ? -23.543 68.502  19.448  1.00 22.11  ? 305  ALA B CA    1 
ATOM   7278  C C     . ALA B 1 305 ? -23.138 68.701  17.994  1.00 22.79  ? 305  ALA B C     1 
ATOM   7279  O O     . ALA B 1 305 ? -22.602 69.757  17.610  1.00 23.04  ? 305  ALA B O     1 
ATOM   7280  C CB    . ALA B 1 305 ? -24.833 69.231  19.720  1.00 22.02  ? 305  ALA B CB    1 
ATOM   7281  N N     . ASP B 1 306 ? -23.424 67.689  17.185  1.00 22.78  ? 306  ASP B N     1 
ATOM   7282  C CA    . ASP B 1 306 ? -23.234 67.774  15.750  1.00 23.27  ? 306  ASP B CA    1 
ATOM   7283  C C     . ASP B 1 306 ? -24.045 68.916  15.112  1.00 23.16  ? 306  ASP B C     1 
ATOM   7284  O O     . ASP B 1 306 ? -25.199 69.200  15.496  1.00 23.60  ? 306  ASP B O     1 
ATOM   7285  C CB    . ASP B 1 306 ? -23.587 66.434  15.094  1.00 22.99  ? 306  ASP B CB    1 
ATOM   7286  C CG    . ASP B 1 306 ? -23.049 66.327  13.685  1.00 23.77  ? 306  ASP B CG    1 
ATOM   7287  O OD1   . ASP B 1 306 ? -23.731 66.756  12.742  1.00 25.95  ? 306  ASP B OD1   1 
ATOM   7288  O OD2   . ASP B 1 306 ? -21.929 65.826  13.513  1.00 24.85  ? 306  ASP B OD2   1 
ATOM   7289  N N     . VAL B 1 307 ? -23.423 69.569  14.138  1.00 22.82  ? 307  VAL B N     1 
ATOM   7290  C CA    . VAL B 1 307 ? -24.075 70.610  13.321  1.00 22.73  ? 307  VAL B CA    1 
ATOM   7291  C C     . VAL B 1 307 ? -25.346 70.113  12.570  1.00 22.46  ? 307  VAL B C     1 
ATOM   7292  O O     . VAL B 1 307 ? -26.216 70.914  12.197  1.00 21.84  ? 307  VAL B O     1 
ATOM   7293  C CB    . VAL B 1 307 ? -23.034 71.248  12.346  1.00 22.88  ? 307  VAL B CB    1 
ATOM   7294  C CG1   . VAL B 1 307 ? -22.726 70.324  11.166  1.00 22.97  ? 307  VAL B CG1   1 
ATOM   7295  C CG2   . VAL B 1 307 ? -23.483 72.593  11.882  1.00 23.47  ? 307  VAL B CG2   1 
ATOM   7296  N N     . GLY B 1 308 ? -25.456 68.792  12.383  1.00 21.86  ? 308  GLY B N     1 
ATOM   7297  C CA    . GLY B 1 308 ? -26.623 68.197  11.747  1.00 21.74  ? 308  GLY B CA    1 
ATOM   7298  C C     . GLY B 1 308 ? -27.910 68.241  12.553  1.00 22.24  ? 308  GLY B C     1 
ATOM   7299  O O     . GLY B 1 308 ? -28.971 67.903  12.032  1.00 22.73  ? 308  GLY B O     1 
ATOM   7300  N N     . TRP B 1 309 ? -27.831 68.638  13.824  1.00 22.00  ? 309  TRP B N     1 
ATOM   7301  C CA    . TRP B 1 309 ? -28.995 68.607  14.716  1.00 22.04  ? 309  TRP B CA    1 
ATOM   7302  C C     . TRP B 1 309 ? -29.292 70.006  15.241  1.00 22.06  ? 309  TRP B C     1 
ATOM   7303  O O     . TRP B 1 309 ? -28.446 70.904  15.141  1.00 21.78  ? 309  TRP B O     1 
ATOM   7304  C CB    . TRP B 1 309 ? -28.766 67.658  15.908  1.00 22.18  ? 309  TRP B CB    1 
ATOM   7305  C CG    . TRP B 1 309 ? -28.336 66.261  15.554  1.00 22.36  ? 309  TRP B CG    1 
ATOM   7306  C CD1   . TRP B 1 309 ? -27.196 65.619  15.966  1.00 22.14  ? 309  TRP B CD1   1 
ATOM   7307  C CD2   . TRP B 1 309 ? -29.045 65.325  14.717  1.00 22.61  ? 309  TRP B CD2   1 
ATOM   7308  N NE1   . TRP B 1 309 ? -27.156 64.344  15.442  1.00 22.58  ? 309  TRP B NE1   1 
ATOM   7309  C CE2   . TRP B 1 309 ? -28.280 64.142  14.674  1.00 22.11  ? 309  TRP B CE2   1 
ATOM   7310  C CE3   . TRP B 1 309 ? -30.251 65.382  13.996  1.00 21.89  ? 309  TRP B CE3   1 
ATOM   7311  C CZ2   . TRP B 1 309 ? -28.681 63.024  13.946  1.00 22.73  ? 309  TRP B CZ2   1 
ATOM   7312  C CZ3   . TRP B 1 309 ? -30.648 64.272  13.264  1.00 22.51  ? 309  TRP B CZ3   1 
ATOM   7313  C CH2   . TRP B 1 309 ? -29.864 63.106  13.245  1.00 22.78  ? 309  TRP B CH2   1 
ATOM   7314  N N     . VAL B 1 310 ? -30.474 70.173  15.839  1.00 22.23  ? 310  VAL B N     1 
ATOM   7315  C CA    . VAL B 1 310 ? -30.940 71.501  16.266  1.00 21.89  ? 310  VAL B CA    1 
ATOM   7316  C C     . VAL B 1 310 ? -30.025 72.126  17.306  1.00 21.53  ? 310  VAL B C     1 
ATOM   7317  O O     . VAL B 1 310 ? -29.813 73.337  17.298  1.00 20.82  ? 310  VAL B O     1 
ATOM   7318  C CB    . VAL B 1 310 ? -32.411 71.500  16.739  1.00 21.99  ? 310  VAL B CB    1 
ATOM   7319  C CG1   . VAL B 1 310 ? -32.592 70.718  18.070  1.00 21.24  ? 310  VAL B CG1   1 
ATOM   7320  C CG2   . VAL B 1 310 ? -32.939 72.945  16.817  1.00 22.39  ? 310  VAL B CG2   1 
ATOM   7321  N N     . THR B 1 311 ? -29.444 71.285  18.161  1.00 21.77  ? 311  THR B N     1 
ATOM   7322  C CA    . THR B 1 311 ? -28.487 71.760  19.168  1.00 21.76  ? 311  THR B CA    1 
ATOM   7323  C C     . THR B 1 311 ? -27.293 72.428  18.517  1.00 22.07  ? 311  THR B C     1 
ATOM   7324  O O     . THR B 1 311 ? -26.830 73.465  18.991  1.00 22.10  ? 311  THR B O     1 
ATOM   7325  C CB    . THR B 1 311 ? -28.026 70.652  20.108  1.00 21.16  ? 311  THR B CB    1 
ATOM   7326  O OG1   . THR B 1 311 ? -29.177 69.974  20.610  1.00 20.93  ? 311  THR B OG1   1 
ATOM   7327  C CG2   . THR B 1 311 ? -27.263 71.235  21.279  1.00 20.92  ? 311  THR B CG2   1 
ATOM   7328  N N     . GLY B 1 312 ? -26.818 71.836  17.427  1.00 22.30  ? 312  GLY B N     1 
ATOM   7329  C CA    . GLY B 1 312 ? -25.709 72.393  16.663  1.00 23.06  ? 312  GLY B CA    1 
ATOM   7330  C C     . GLY B 1 312 ? -26.095 73.641  15.874  1.00 23.42  ? 312  GLY B C     1 
ATOM   7331  O O     . GLY B 1 312 ? -25.231 74.473  15.564  1.00 24.62  ? 312  GLY B O     1 
ATOM   7332  N N     . HIS B 1 313 ? -27.375 73.777  15.532  1.00 22.34  ? 313  HIS B N     1 
ATOM   7333  C CA    . HIS B 1 313 ? -27.850 74.998  14.888  1.00 21.82  ? 313  HIS B CA    1 
ATOM   7334  C C     . HIS B 1 313 ? -27.881 76.149  15.892  1.00 21.73  ? 313  HIS B C     1 
ATOM   7335  O O     . HIS B 1 313 ? -27.232 77.179  15.696  1.00 22.23  ? 313  HIS B O     1 
ATOM   7336  C CB    . HIS B 1 313 ? -29.236 74.790  14.292  1.00 21.17  ? 313  HIS B CB    1 
ATOM   7337  C CG    . HIS B 1 313 ? -29.245 74.058  12.980  1.00 20.70  ? 313  HIS B CG    1 
ATOM   7338  N ND1   . HIS B 1 313 ? -28.569 72.877  12.775  1.00 18.60  ? 313  HIS B ND1   1 
ATOM   7339  C CD2   . HIS B 1 313 ? -29.912 74.312  11.823  1.00 21.00  ? 313  HIS B CD2   1 
ATOM   7340  C CE1   . HIS B 1 313 ? -28.792 72.449  11.545  1.00 19.80  ? 313  HIS B CE1   1 
ATOM   7341  N NE2   . HIS B 1 313 ? -29.604 73.301  10.944  1.00 20.11  ? 313  HIS B NE2   1 
ATOM   7342  N N     . SER B 1 314 ? -28.620 75.959  16.974  1.00 21.35  ? 314  SER B N     1 
ATOM   7343  C CA    . SER B 1 314 ? -28.872 77.022  17.937  1.00 21.45  ? 314  SER B CA    1 
ATOM   7344  C C     . SER B 1 314 ? -27.690 77.349  18.834  1.00 21.30  ? 314  SER B C     1 
ATOM   7345  O O     . SER B 1 314 ? -27.491 78.509  19.198  1.00 20.97  ? 314  SER B O     1 
ATOM   7346  C CB    . SER B 1 314 ? -30.079 76.679  18.814  1.00 21.25  ? 314  SER B CB    1 
ATOM   7347  O OG    . SER B 1 314 ? -31.256 76.458  18.066  1.00 22.12  ? 314  SER B OG    1 
ATOM   7348  N N     . TYR B 1 315 ? -26.921 76.327  19.207  1.00 21.26  ? 315  TYR B N     1 
ATOM   7349  C CA    . TYR B 1 315 ? -25.964 76.470  20.297  1.00 21.02  ? 315  TYR B CA    1 
ATOM   7350  C C     . TYR B 1 315 ? -24.518 76.118  19.994  1.00 22.05  ? 315  TYR B C     1 
ATOM   7351  O O     . TYR B 1 315 ? -23.650 76.407  20.808  1.00 23.64  ? 315  TYR B O     1 
ATOM   7352  C CB    . TYR B 1 315 ? -26.475 75.756  21.560  1.00 19.95  ? 315  TYR B CB    1 
ATOM   7353  C CG    . TYR B 1 315 ? -27.790 76.336  22.022  1.00 18.44  ? 315  TYR B CG    1 
ATOM   7354  C CD1   . TYR B 1 315 ? -28.983 75.655  21.801  1.00 16.83  ? 315  TYR B CD1   1 
ATOM   7355  C CD2   . TYR B 1 315 ? -27.846 77.603  22.626  1.00 16.28  ? 315  TYR B CD2   1 
ATOM   7356  C CE1   . TYR B 1 315 ? -30.196 76.197  22.191  1.00 18.21  ? 315  TYR B CE1   1 
ATOM   7357  C CE2   . TYR B 1 315 ? -29.059 78.160  23.008  1.00 16.87  ? 315  TYR B CE2   1 
ATOM   7358  C CZ    . TYR B 1 315 ? -30.236 77.444  22.794  1.00 17.60  ? 315  TYR B CZ    1 
ATOM   7359  O OH    . TYR B 1 315 ? -31.454 77.949  23.183  1.00 16.94  ? 315  TYR B OH    1 
ATOM   7360  N N     . LEU B 1 316 ? -24.234 75.520  18.845  1.00 22.95  ? 316  LEU B N     1 
ATOM   7361  C CA    . LEU B 1 316 ? -22.847 75.456  18.380  1.00 23.31  ? 316  LEU B CA    1 
ATOM   7362  C C     . LEU B 1 316 ? -22.586 76.755  17.639  1.00 23.84  ? 316  LEU B C     1 
ATOM   7363  O O     . LEU B 1 316 ? -21.555 77.418  17.848  1.00 24.07  ? 316  LEU B O     1 
ATOM   7364  C CB    . LEU B 1 316 ? -22.628 74.255  17.456  1.00 23.63  ? 316  LEU B CB    1 
ATOM   7365  C CG    . LEU B 1 316 ? -21.273 73.767  16.897  1.00 24.37  ? 316  LEU B CG    1 
ATOM   7366  C CD1   . LEU B 1 316 ? -20.397 74.850  16.277  1.00 25.70  ? 316  LEU B CD1   1 
ATOM   7367  C CD2   . LEU B 1 316 ? -20.477 73.017  17.951  1.00 27.00  ? 316  LEU B CD2   1 
ATOM   7368  N N     . LEU B 1 317 ? -23.564 77.126  16.811  1.00 23.93  ? 317  LEU B N     1 
ATOM   7369  C CA    . LEU B 1 317 ? -23.440 78.197  15.835  1.00 24.03  ? 317  LEU B CA    1 
ATOM   7370  C C     . LEU B 1 317 ? -24.116 79.512  16.184  1.00 23.50  ? 317  LEU B C     1 
ATOM   7371  O O     . LEU B 1 317 ? -23.452 80.466  16.545  1.00 23.40  ? 317  LEU B O     1 
ATOM   7372  C CB    . LEU B 1 317 ? -24.001 77.731  14.498  1.00 24.32  ? 317  LEU B CB    1 
ATOM   7373  C CG    . LEU B 1 317 ? -23.031 77.173  13.469  1.00 26.60  ? 317  LEU B CG    1 
ATOM   7374  C CD1   . LEU B 1 317 ? -23.585 77.604  12.096  1.00 27.84  ? 317  LEU B CD1   1 
ATOM   7375  C CD2   . LEU B 1 317 ? -21.610 77.735  13.692  1.00 27.28  ? 317  LEU B CD2   1 
ATOM   7376  N N     . TYR B 1 318 ? -25.438 79.546  16.067  1.00 23.17  ? 318  TYR B N     1 
ATOM   7377  C CA    . TYR B 1 318 ? -26.186 80.803  15.970  1.00 23.18  ? 318  TYR B CA    1 
ATOM   7378  C C     . TYR B 1 318 ? -26.271 81.663  17.229  1.00 22.70  ? 318  TYR B C     1 
ATOM   7379  O O     . TYR B 1 318 ? -25.998 82.860  17.170  1.00 23.22  ? 318  TYR B O     1 
ATOM   7380  C CB    . TYR B 1 318 ? -27.581 80.549  15.387  1.00 22.98  ? 318  TYR B CB    1 
ATOM   7381  C CG    . TYR B 1 318 ? -27.541 80.168  13.923  1.00 23.56  ? 318  TYR B CG    1 
ATOM   7382  C CD1   . TYR B 1 318 ? -26.628 80.784  13.046  1.00 24.11  ? 318  TYR B CD1   1 
ATOM   7383  C CD2   . TYR B 1 318 ? -28.412 79.209  13.400  1.00 21.13  ? 318  TYR B CD2   1 
ATOM   7384  C CE1   . TYR B 1 318 ? -26.589 80.448  11.686  1.00 22.89  ? 318  TYR B CE1   1 
ATOM   7385  C CE2   . TYR B 1 318 ? -28.365 78.869  12.052  1.00 22.10  ? 318  TYR B CE2   1 
ATOM   7386  C CZ    . TYR B 1 318 ? -27.456 79.500  11.203  1.00 22.58  ? 318  TYR B CZ    1 
ATOM   7387  O OH    . TYR B 1 318 ? -27.400 79.183  9.862   1.00 24.30  ? 318  TYR B OH    1 
ATOM   7388  N N     . GLY B 1 319 ? -26.654 81.059  18.346  1.00 22.19  ? 319  GLY B N     1 
ATOM   7389  C CA    . GLY B 1 319 ? -26.665 81.744  19.633  1.00 21.93  ? 319  GLY B CA    1 
ATOM   7390  C C     . GLY B 1 319 ? -25.293 82.278  20.019  1.00 21.76  ? 319  GLY B C     1 
ATOM   7391  O O     . GLY B 1 319 ? -25.156 83.470  20.257  1.00 22.09  ? 319  GLY B O     1 
ATOM   7392  N N     . PRO B 1 320 ? -24.274 81.396  20.109  1.00 21.70  ? 320  PRO B N     1 
ATOM   7393  C CA    . PRO B 1 320 ? -22.925 81.883  20.469  1.00 21.78  ? 320  PRO B CA    1 
ATOM   7394  C C     . PRO B 1 320 ? -22.381 83.003  19.573  1.00 21.23  ? 320  PRO B C     1 
ATOM   7395  O O     . PRO B 1 320 ? -21.931 84.032  20.092  1.00 21.42  ? 320  PRO B O     1 
ATOM   7396  C CB    . PRO B 1 320 ? -22.028 80.617  20.397  1.00 21.62  ? 320  PRO B CB    1 
ATOM   7397  C CG    . PRO B 1 320 ? -22.890 79.512  19.938  1.00 21.60  ? 320  PRO B CG    1 
ATOM   7398  C CD    . PRO B 1 320 ? -24.322 79.924  19.967  1.00 21.42  ? 320  PRO B CD    1 
ATOM   7399  N N     . LEU B 1 321 ? -22.429 82.806  18.256  1.00 20.54  ? 321  LEU B N     1 
ATOM   7400  C CA    . LEU B 1 321 ? -21.943 83.809  17.300  1.00 20.03  ? 321  LEU B CA    1 
ATOM   7401  C C     . LEU B 1 321 ? -22.734 85.125  17.353  1.00 20.20  ? 321  LEU B C     1 
ATOM   7402  O O     . LEU B 1 321 ? -22.163 86.213  17.257  1.00 19.51  ? 321  LEU B O     1 
ATOM   7403  C CB    . LEU B 1 321 ? -21.923 83.242  15.875  1.00 19.66  ? 321  LEU B CB    1 
ATOM   7404  C CG    . LEU B 1 321 ? -20.882 82.159  15.556  1.00 19.96  ? 321  LEU B CG    1 
ATOM   7405  C CD1   . LEU B 1 321 ? -20.850 81.827  14.078  1.00 19.27  ? 321  LEU B CD1   1 
ATOM   7406  C CD2   . LEU B 1 321 ? -19.501 82.576  16.027  1.00 20.13  ? 321  LEU B CD2   1 
ATOM   7407  N N     . ALA B 1 322 ? -24.051 85.032  17.510  1.00 20.47  ? 322  ALA B N     1 
ATOM   7408  C CA    . ALA B 1 322 ? -24.846 86.244  17.695  1.00 21.16  ? 322  ALA B CA    1 
ATOM   7409  C C     . ALA B 1 322 ? -24.303 87.077  18.877  1.00 21.58  ? 322  ALA B C     1 
ATOM   7410  O O     . ALA B 1 322 ? -24.284 88.311  18.818  1.00 21.56  ? 322  ALA B O     1 
ATOM   7411  C CB    . ALA B 1 322 ? -26.349 85.902  17.882  1.00 20.82  ? 322  ALA B CB    1 
ATOM   7412  N N     . CYS B 1 323 ? -23.830 86.392  19.922  1.00 21.79  ? 323  CYS B N     1 
ATOM   7413  C CA    . CYS B 1 323 ? -23.346 87.050  21.145  1.00 22.21  ? 323  CYS B CA    1 
ATOM   7414  C C     . CYS B 1 323 ? -21.869 87.420  21.088  1.00 21.96  ? 323  CYS B C     1 
ATOM   7415  O O     . CYS B 1 323 ? -21.352 88.060  22.007  1.00 21.84  ? 323  CYS B O     1 
ATOM   7416  C CB    . CYS B 1 323 ? -23.618 86.171  22.381  1.00 22.38  ? 323  CYS B CB    1 
ATOM   7417  S SG    . CYS B 1 323 ? -25.375 85.874  22.656  1.00 24.25  ? 323  CYS B SG    1 
ATOM   7418  N N     . GLY B 1 324 ? -21.188 87.011  20.020  1.00 21.58  ? 324  GLY B N     1 
ATOM   7419  C CA    . GLY B 1 324 ? -19.796 87.394  19.816  1.00 20.81  ? 324  GLY B CA    1 
ATOM   7420  C C     . GLY B 1 324 ? -18.832 86.477  20.523  1.00 20.76  ? 324  GLY B C     1 
ATOM   7421  O O     . GLY B 1 324 ? -17.677 86.832  20.740  1.00 20.85  ? 324  GLY B O     1 
ATOM   7422  N N     . ALA B 1 325 ? -19.297 85.275  20.850  1.00 21.22  ? 325  ALA B N     1 
ATOM   7423  C CA    . ALA B 1 325 ? -18.495 84.292  21.594  1.00 21.29  ? 325  ALA B CA    1 
ATOM   7424  C C     . ALA B 1 325 ? -17.499 83.511  20.735  1.00 21.64  ? 325  ALA B C     1 
ATOM   7425  O O     . ALA B 1 325 ? -17.658 83.352  19.521  1.00 21.45  ? 325  ALA B O     1 
ATOM   7426  C CB    . ALA B 1 325 ? -19.415 83.308  22.321  1.00 21.25  ? 325  ALA B CB    1 
ATOM   7427  N N     . THR B 1 326 ? -16.470 82.999  21.387  1.00 21.85  ? 326  THR B N     1 
ATOM   7428  C CA    . THR B 1 326 ? -15.664 81.951  20.800  1.00 21.95  ? 326  THR B CA    1 
ATOM   7429  C C     . THR B 1 326 ? -16.343 80.626  21.045  1.00 21.82  ? 326  THR B C     1 
ATOM   7430  O O     . THR B 1 326 ? -16.563 80.222  22.187  1.00 22.56  ? 326  THR B O     1 
ATOM   7431  C CB    . THR B 1 326 ? -14.284 81.927  21.411  1.00 22.23  ? 326  THR B CB    1 
ATOM   7432  O OG1   . THR B 1 326 ? -13.684 83.219  21.214  1.00 21.90  ? 326  THR B OG1   1 
ATOM   7433  C CG2   . THR B 1 326 ? -13.436 80.800  20.791  1.00 21.25  ? 326  THR B CG2   1 
ATOM   7434  N N     . THR B 1 327 ? -16.686 79.960  19.950  1.00 21.92  ? 327  THR B N     1 
ATOM   7435  C CA    . THR B 1 327 ? -17.333 78.667  19.987  1.00 20.97  ? 327  THR B CA    1 
ATOM   7436  C C     . THR B 1 327 ? -16.418 77.587  19.410  1.00 21.00  ? 327  THR B C     1 
ATOM   7437  O O     . THR B 1 327 ? -15.665 77.832  18.462  1.00 20.52  ? 327  THR B O     1 
ATOM   7438  C CB    . THR B 1 327 ? -18.689 78.697  19.273  1.00 21.02  ? 327  THR B CB    1 
ATOM   7439  O OG1   . THR B 1 327 ? -19.337 77.429  19.455  1.00 21.21  ? 327  THR B OG1   1 
ATOM   7440  C CG2   . THR B 1 327 ? -18.543 79.021  17.769  1.00 19.83  ? 327  THR B CG2   1 
ATOM   7441  N N     . LEU B 1 328 ? -16.472 76.395  19.999  1.00 21.13  ? 328  LEU B N     1 
ATOM   7442  C CA    . LEU B 1 328 ? -15.529 75.335  19.635  1.00 21.03  ? 328  LEU B CA    1 
ATOM   7443  C C     . LEU B 1 328 ? -16.253 74.311  18.804  1.00 20.79  ? 328  LEU B C     1 
ATOM   7444  O O     . LEU B 1 328 ? -17.293 73.771  19.217  1.00 20.41  ? 328  LEU B O     1 
ATOM   7445  C CB    . LEU B 1 328 ? -14.895 74.684  20.872  1.00 20.72  ? 328  LEU B CB    1 
ATOM   7446  C CG    . LEU B 1 328 ? -13.560 73.931  20.681  1.00 21.93  ? 328  LEU B CG    1 
ATOM   7447  C CD1   . LEU B 1 328 ? -12.780 73.918  21.975  1.00 21.53  ? 328  LEU B CD1   1 
ATOM   7448  C CD2   . LEU B 1 328 ? -13.703 72.469  20.118  1.00 21.61  ? 328  LEU B CD2   1 
ATOM   7449  N N     . MET B 1 329 ? -15.717 74.061  17.615  1.00 20.83  ? 329  MET B N     1 
ATOM   7450  C CA    . MET B 1 329 ? -16.226 72.965  16.795  1.00 21.83  ? 329  MET B CA    1 
ATOM   7451  C C     . MET B 1 329 ? -15.272 71.777  16.792  1.00 20.58  ? 329  MET B C     1 
ATOM   7452  O O     . MET B 1 329 ? -14.152 71.862  16.281  1.00 20.87  ? 329  MET B O     1 
ATOM   7453  C CB    . MET B 1 329 ? -16.550 73.418  15.377  1.00 21.23  ? 329  MET B CB    1 
ATOM   7454  C CG    . MET B 1 329 ? -16.943 72.251  14.474  1.00 22.98  ? 329  MET B CG    1 
ATOM   7455  S SD    . MET B 1 329 ? -17.149 72.793  12.769  1.00 26.16  ? 329  MET B SD    1 
ATOM   7456  C CE    . MET B 1 329 ? -18.731 73.657  12.820  1.00 22.44  ? 329  MET B CE    1 
ATOM   7457  N N     . PHE B 1 330 ? -15.722 70.679  17.384  1.00 19.47  ? 330  PHE B N     1 
ATOM   7458  C CA    . PHE B 1 330 ? -14.929 69.457  17.452  1.00 18.97  ? 330  PHE B CA    1 
ATOM   7459  C C     . PHE B 1 330 ? -15.323 68.487  16.337  1.00 19.49  ? 330  PHE B C     1 
ATOM   7460  O O     . PHE B 1 330 ? -16.503 68.134  16.189  1.00 19.37  ? 330  PHE B O     1 
ATOM   7461  C CB    . PHE B 1 330 ? -15.125 68.791  18.815  1.00 17.77  ? 330  PHE B CB    1 
ATOM   7462  C CG    . PHE B 1 330 ? -14.335 67.519  19.012  1.00 16.64  ? 330  PHE B CG    1 
ATOM   7463  C CD1   . PHE B 1 330 ? -12.978 67.452  18.682  1.00 14.18  ? 330  PHE B CD1   1 
ATOM   7464  C CD2   . PHE B 1 330 ? -14.946 66.397  19.572  1.00 14.91  ? 330  PHE B CD2   1 
ATOM   7465  C CE1   . PHE B 1 330 ? -12.254 66.301  18.885  1.00 12.06  ? 330  PHE B CE1   1 
ATOM   7466  C CE2   . PHE B 1 330 ? -14.231 65.242  19.786  1.00 13.13  ? 330  PHE B CE2   1 
ATOM   7467  C CZ    . PHE B 1 330 ? -12.879 65.188  19.439  1.00 14.75  ? 330  PHE B CZ    1 
ATOM   7468  N N     . GLU B 1 331 ? -14.326 68.059  15.571  1.00 19.86  ? 331  GLU B N     1 
ATOM   7469  C CA    . GLU B 1 331 ? -14.518 67.133  14.462  1.00 20.55  ? 331  GLU B CA    1 
ATOM   7470  C C     . GLU B 1 331 ? -14.812 65.676  14.870  1.00 20.87  ? 331  GLU B C     1 
ATOM   7471  O O     . GLU B 1 331 ? -15.523 64.955  14.151  1.00 20.28  ? 331  GLU B O     1 
ATOM   7472  C CB    . GLU B 1 331 ? -13.281 67.174  13.560  1.00 20.55  ? 331  GLU B CB    1 
ATOM   7473  C CG    . GLU B 1 331 ? -13.354 66.284  12.318  1.00 21.03  ? 331  GLU B CG    1 
ATOM   7474  C CD    . GLU B 1 331 ? -12.067 66.286  11.511  1.00 21.15  ? 331  GLU B CD    1 
ATOM   7475  O OE1   . GLU B 1 331 ? -10.970 66.215  12.116  1.00 21.53  ? 331  GLU B OE1   1 
ATOM   7476  O OE2   . GLU B 1 331 ? -12.152 66.351  10.266  1.00 21.49  ? 331  GLU B OE2   1 
ATOM   7477  N N     . GLY B 1 332 ? -14.242 65.232  15.990  1.00 21.18  ? 332  GLY B N     1 
ATOM   7478  C CA    . GLY B 1 332 ? -14.250 63.802  16.319  1.00 22.04  ? 332  GLY B CA    1 
ATOM   7479  C C     . GLY B 1 332 ? -15.305 63.358  17.317  1.00 22.79  ? 332  GLY B C     1 
ATOM   7480  O O     . GLY B 1 332 ? -16.454 63.764  17.242  1.00 23.41  ? 332  GLY B O     1 
ATOM   7481  N N     . VAL B 1 333 ? -14.902 62.524  18.266  1.00 23.06  ? 333  VAL B N     1 
ATOM   7482  C CA    . VAL B 1 333 ? -15.833 61.937  19.215  1.00 23.38  ? 333  VAL B CA    1 
ATOM   7483  C C     . VAL B 1 333 ? -15.163 61.926  20.603  1.00 23.02  ? 333  VAL B C     1 
ATOM   7484  O O     . VAL B 1 333 ? -13.988 61.606  20.715  1.00 23.25  ? 333  VAL B O     1 
ATOM   7485  C CB    . VAL B 1 333 ? -16.385 60.553  18.676  1.00 23.85  ? 333  VAL B CB    1 
ATOM   7486  C CG1   . VAL B 1 333 ? -15.289 59.698  18.142  1.00 23.73  ? 333  VAL B CG1   1 
ATOM   7487  C CG2   . VAL B 1 333 ? -17.230 59.801  19.705  1.00 23.94  ? 333  VAL B CG2   1 
ATOM   7488  N N     . PRO B 1 334 ? -15.908 62.326  21.654  1.00 22.96  ? 334  PRO B N     1 
ATOM   7489  C CA    . PRO B 1 334 ? -15.371 62.748  22.960  1.00 22.71  ? 334  PRO B CA    1 
ATOM   7490  C C     . PRO B 1 334 ? -14.553 61.706  23.710  1.00 22.39  ? 334  PRO B C     1 
ATOM   7491  O O     . PRO B 1 334 ? -13.954 62.021  24.731  1.00 22.27  ? 334  PRO B O     1 
ATOM   7492  C CB    . PRO B 1 334 ? -16.632 63.055  23.777  1.00 23.03  ? 334  PRO B CB    1 
ATOM   7493  C CG    . PRO B 1 334 ? -17.706 63.273  22.767  1.00 23.34  ? 334  PRO B CG    1 
ATOM   7494  C CD    . PRO B 1 334 ? -17.382 62.372  21.638  1.00 22.95  ? 334  PRO B CD    1 
ATOM   7495  N N     . ASN B 1 335 ? -14.547 60.473  23.216  1.00 22.07  ? 335  ASN B N     1 
ATOM   7496  C CA    . ASN B 1 335 ? -13.790 59.417  23.843  1.00 21.67  ? 335  ASN B CA    1 
ATOM   7497  C C     . ASN B 1 335 ? -12.848 58.719  22.877  1.00 21.25  ? 335  ASN B C     1 
ATOM   7498  O O     . ASN B 1 335 ? -12.449 57.569  23.123  1.00 21.34  ? 335  ASN B O     1 
ATOM   7499  C CB    . ASN B 1 335 ? -14.720 58.408  24.519  1.00 22.03  ? 335  ASN B CB    1 
ATOM   7500  C CG    . ASN B 1 335 ? -15.630 57.664  23.533  1.00 23.22  ? 335  ASN B CG    1 
ATOM   7501  O OD1   . ASN B 1 335 ? -16.336 56.741  23.943  1.00 25.07  ? 335  ASN B OD1   1 
ATOM   7502  N ND2   . ASN B 1 335 ? -15.622 58.054  22.250  1.00 20.87  ? 335  ASN B ND2   1 
ATOM   7503  N N     . TRP B 1 336 ? -12.498 59.400  21.783  1.00 19.70  ? 336  TRP B N     1 
ATOM   7504  C CA    . TRP B 1 336 ? -11.521 58.849  20.866  1.00 18.53  ? 336  TRP B CA    1 
ATOM   7505  C C     . TRP B 1 336 ? -10.360 59.806  20.674  1.00 18.42  ? 336  TRP B C     1 
ATOM   7506  O O     . TRP B 1 336 ? -10.571 60.993  20.401  1.00 18.62  ? 336  TRP B O     1 
ATOM   7507  C CB    . TRP B 1 336 ? -12.148 58.449  19.516  1.00 17.90  ? 336  TRP B CB    1 
ATOM   7508  C CG    . TRP B 1 336 ? -11.211 57.539  18.707  1.00 16.44  ? 336  TRP B CG    1 
ATOM   7509  C CD1   . TRP B 1 336 ? -11.158 56.173  18.743  1.00 15.94  ? 336  TRP B CD1   1 
ATOM   7510  C CD2   . TRP B 1 336 ? -10.182 57.956  17.809  1.00 14.93  ? 336  TRP B CD2   1 
ATOM   7511  N NE1   . TRP B 1 336 ? -10.159 55.712  17.914  1.00 14.26  ? 336  TRP B NE1   1 
ATOM   7512  C CE2   . TRP B 1 336 ? -9.545  56.787  17.327  1.00 15.47  ? 336  TRP B CE2   1 
ATOM   7513  C CE3   . TRP B 1 336 ? -9.721  59.209  17.368  1.00 15.23  ? 336  TRP B CE3   1 
ATOM   7514  C CZ2   . TRP B 1 336 ? -8.486  56.832  16.398  1.00 15.29  ? 336  TRP B CZ2   1 
ATOM   7515  C CZ3   . TRP B 1 336 ? -8.652  59.250  16.453  1.00 15.77  ? 336  TRP B CZ3   1 
ATOM   7516  C CH2   . TRP B 1 336 ? -8.062  58.068  15.972  1.00 15.24  ? 336  TRP B CH2   1 
ATOM   7517  N N     . PRO B 1 337 ? -9.122  59.295  20.765  1.00 18.35  ? 337  PRO B N     1 
ATOM   7518  C CA    . PRO B 1 337 ? -8.696  57.892  20.955  1.00 18.27  ? 337  PRO B CA    1 
ATOM   7519  C C     . PRO B 1 337 ? -8.763  57.325  22.377  1.00 18.45  ? 337  PRO B C     1 
ATOM   7520  O O     . PRO B 1 337 ? -8.589  56.112  22.546  1.00 19.06  ? 337  PRO B O     1 
ATOM   7521  C CB    . PRO B 1 337 ? -7.231  57.881  20.469  1.00 17.88  ? 337  PRO B CB    1 
ATOM   7522  C CG    . PRO B 1 337 ? -6.805  59.297  20.386  1.00 17.68  ? 337  PRO B CG    1 
ATOM   7523  C CD    . PRO B 1 337 ? -7.973  60.216  20.647  1.00 18.02  ? 337  PRO B CD    1 
ATOM   7524  N N     . THR B 1 338 ? -8.965  58.172  23.388  1.00 18.00  ? 338  THR B N     1 
ATOM   7525  C CA    . THR B 1 338 ? -9.110  57.675  24.757  1.00 17.19  ? 338  THR B CA    1 
ATOM   7526  C C     . THR B 1 338 ? -10.301 58.354  25.440  1.00 17.03  ? 338  THR B C     1 
ATOM   7527  O O     . THR B 1 338 ? -10.747 59.426  24.996  1.00 17.21  ? 338  THR B O     1 
ATOM   7528  C CB    . THR B 1 338 ? -7.819  57.863  25.633  1.00 17.49  ? 338  THR B CB    1 
ATOM   7529  O OG1   . THR B 1 338 ? -7.636  59.248  25.969  1.00 16.89  ? 338  THR B OG1   1 
ATOM   7530  C CG2   . THR B 1 338 ? -6.537  57.283  24.956  1.00 16.77  ? 338  THR B CG2   1 
ATOM   7531  N N     . PRO B 1 339 ? -10.829 57.738  26.523  1.00 16.70  ? 339  PRO B N     1 
ATOM   7532  C CA    . PRO B 1 339 ? -11.898 58.390  27.297  1.00 16.20  ? 339  PRO B CA    1 
ATOM   7533  C C     . PRO B 1 339 ? -11.571 59.820  27.773  1.00 16.32  ? 339  PRO B C     1 
ATOM   7534  O O     . PRO B 1 339 ? -12.494 60.623  27.955  1.00 16.59  ? 339  PRO B O     1 
ATOM   7535  C CB    . PRO B 1 339 ? -12.091 57.439  28.478  1.00 15.61  ? 339  PRO B CB    1 
ATOM   7536  C CG    . PRO B 1 339 ? -11.659 56.112  27.961  1.00 15.18  ? 339  PRO B CG    1 
ATOM   7537  C CD    . PRO B 1 339 ? -10.493 56.405  27.081  1.00 16.16  ? 339  PRO B CD    1 
ATOM   7538  N N     . ALA B 1 340 ? -10.287 60.141  27.949  1.00 15.88  ? 340  ALA B N     1 
ATOM   7539  C CA    . ALA B 1 340 ? -9.883  61.475  28.395  1.00 16.05  ? 340  ALA B CA    1 
ATOM   7540  C C     . ALA B 1 340 ? -9.955  62.523  27.306  1.00 16.36  ? 340  ALA B C     1 
ATOM   7541  O O     . ALA B 1 340 ? -9.657  63.689  27.565  1.00 16.75  ? 340  ALA B O     1 
ATOM   7542  C CB    . ALA B 1 340 ? -8.470  61.452  28.993  1.00 15.22  ? 340  ALA B CB    1 
ATOM   7543  N N     . ARG B 1 341 ? -10.346 62.140  26.094  1.00 16.61  ? 341  ARG B N     1 
ATOM   7544  C CA    . ARG B 1 341 ? -10.295 63.085  24.980  1.00 17.36  ? 341  ARG B CA    1 
ATOM   7545  C C     . ARG B 1 341 ? -11.070 64.384  25.244  1.00 17.52  ? 341  ARG B C     1 
ATOM   7546  O O     . ARG B 1 341 ? -10.531 65.478  25.076  1.00 17.55  ? 341  ARG B O     1 
ATOM   7547  C CB    . ARG B 1 341 ? -10.764 62.447  23.664  1.00 17.70  ? 341  ARG B CB    1 
ATOM   7548  C CG    . ARG B 1 341 ? -10.645 63.392  22.467  1.00 18.35  ? 341  ARG B CG    1 
ATOM   7549  C CD    . ARG B 1 341 ? -9.159  63.611  22.126  1.00 19.58  ? 341  ARG B CD    1 
ATOM   7550  N NE    . ARG B 1 341 ? -8.902  64.771  21.277  1.00 19.70  ? 341  ARG B NE    1 
ATOM   7551  C CZ    . ARG B 1 341 ? -9.018  64.766  19.955  1.00 19.10  ? 341  ARG B CZ    1 
ATOM   7552  N NH1   . ARG B 1 341 ? -9.414  63.668  19.334  1.00 18.91  ? 341  ARG B NH1   1 
ATOM   7553  N NH2   . ARG B 1 341 ? -8.747  65.861  19.253  1.00 18.67  ? 341  ARG B NH2   1 
ATOM   7554  N N     . MET B 1 342 ? -12.332 64.263  25.648  1.00 17.78  ? 342  MET B N     1 
ATOM   7555  C CA    . MET B 1 342 ? -13.170 65.436  25.851  1.00 18.06  ? 342  MET B CA    1 
ATOM   7556  C C     . MET B 1 342 ? -12.523 66.430  26.804  1.00 18.30  ? 342  MET B C     1 
ATOM   7557  O O     . MET B 1 342 ? -12.539 67.639  26.556  1.00 19.00  ? 342  MET B O     1 
ATOM   7558  C CB    . MET B 1 342 ? -14.547 65.049  26.394  1.00 17.78  ? 342  MET B CB    1 
ATOM   7559  C CG    . MET B 1 342 ? -15.449 66.261  26.593  1.00 15.40  ? 342  MET B CG    1 
ATOM   7560  S SD    . MET B 1 342 ? -17.040 65.852  27.305  1.00 19.49  ? 342  MET B SD    1 
ATOM   7561  C CE    . MET B 1 342 ? -16.581 65.690  29.037  1.00 16.01  ? 342  MET B CE    1 
ATOM   7562  N N     . CYS B 1 343 ? -11.971 65.905  27.894  1.00 17.96  ? 343  CYS B N     1 
ATOM   7563  C CA    . CYS B 1 343 ? -11.292 66.716  28.891  1.00 18.41  ? 343  CYS B CA    1 
ATOM   7564  C C     . CYS B 1 343 ? -9.929  67.235  28.419  1.00 18.72  ? 343  CYS B C     1 
ATOM   7565  O O     . CYS B 1 343 ? -9.460  68.277  28.892  1.00 18.31  ? 343  CYS B O     1 
ATOM   7566  C CB    . CYS B 1 343 ? -11.162 65.930  30.196  1.00 17.79  ? 343  CYS B CB    1 
ATOM   7567  S SG    . CYS B 1 343 ? -12.774 65.751  31.019  1.00 19.41  ? 343  CYS B SG    1 
ATOM   7568  N N     . GLN B 1 344 ? -9.289  66.487  27.517  1.00 18.78  ? 344  GLN B N     1 
ATOM   7569  C CA    . GLN B 1 344 ? -8.062  66.929  26.872  1.00 19.35  ? 344  GLN B CA    1 
ATOM   7570  C C     . GLN B 1 344 ? -8.351  68.140  25.980  1.00 19.45  ? 344  GLN B C     1 
ATOM   7571  O O     . GLN B 1 344 ? -7.528  69.036  25.862  1.00 20.06  ? 344  GLN B O     1 
ATOM   7572  C CB    . GLN B 1 344 ? -7.435  65.789  26.060  1.00 19.45  ? 344  GLN B CB    1 
ATOM   7573  C CG    . GLN B 1 344 ? -6.679  64.774  26.950  1.00 19.57  ? 344  GLN B CG    1 
ATOM   7574  C CD    . GLN B 1 344 ? -6.329  63.471  26.222  1.00 19.88  ? 344  GLN B CD    1 
ATOM   7575  O OE1   . GLN B 1 344 ? -5.719  62.586  26.814  1.00 20.79  ? 344  GLN B OE1   1 
ATOM   7576  N NE2   . GLN B 1 344 ? -6.695  63.360  24.936  1.00 18.93  ? 344  GLN B NE2   1 
ATOM   7577  N N     . VAL B 1 345 ? -9.530  68.165  25.375  1.00 19.41  ? 345  VAL B N     1 
ATOM   7578  C CA    . VAL B 1 345 ? -9.950  69.290  24.523  1.00 19.34  ? 345  VAL B CA    1 
ATOM   7579  C C     . VAL B 1 345 ? -10.232 70.527  25.380  1.00 19.47  ? 345  VAL B C     1 
ATOM   7580  O O     . VAL B 1 345 ? -9.850  71.641  25.009  1.00 19.15  ? 345  VAL B O     1 
ATOM   7581  C CB    . VAL B 1 345 ? -11.164 68.911  23.643  1.00 19.29  ? 345  VAL B CB    1 
ATOM   7582  C CG1   . VAL B 1 345 ? -11.614 70.098  22.771  1.00 19.68  ? 345  VAL B CG1   1 
ATOM   7583  C CG2   . VAL B 1 345 ? -10.809 67.700  22.762  1.00 18.28  ? 345  VAL B CG2   1 
ATOM   7584  N N     . VAL B 1 346 ? -10.850 70.305  26.547  1.00 19.84  ? 346  VAL B N     1 
ATOM   7585  C CA    . VAL B 1 346 ? -11.102 71.370  27.524  1.00 19.24  ? 346  VAL B CA    1 
ATOM   7586  C C     . VAL B 1 346 ? -9.801  72.022  27.985  1.00 19.50  ? 346  VAL B C     1 
ATOM   7587  O O     . VAL B 1 346 ? -9.685  73.254  28.005  1.00 19.96  ? 346  VAL B O     1 
ATOM   7588  C CB    . VAL B 1 346 ? -11.881 70.858  28.765  1.00 19.67  ? 346  VAL B CB    1 
ATOM   7589  C CG1   . VAL B 1 346 ? -11.892 71.939  29.868  1.00 18.47  ? 346  VAL B CG1   1 
ATOM   7590  C CG2   . VAL B 1 346 ? -13.300 70.426  28.390  1.00 16.56  ? 346  VAL B CG2   1 
ATOM   7591  N N     . ASP B 1 347 ? -8.825  71.193  28.342  1.00 19.06  ? 347  ASP B N     1 
ATOM   7592  C CA    . ASP B 1 347 ? -7.489  71.667  28.694  1.00 18.83  ? 347  ASP B CA    1 
ATOM   7593  C C     . ASP B 1 347 ? -6.793  72.434  27.562  1.00 18.50  ? 347  ASP B C     1 
ATOM   7594  O O     . ASP B 1 347 ? -6.317  73.560  27.752  1.00 17.21  ? 347  ASP B O     1 
ATOM   7595  C CB    . ASP B 1 347 ? -6.618  70.500  29.156  1.00 18.15  ? 347  ASP B CB    1 
ATOM   7596  C CG    . ASP B 1 347 ? -6.940  70.071  30.578  1.00 19.57  ? 347  ASP B CG    1 
ATOM   7597  O OD1   . ASP B 1 347 ? -7.827  70.696  31.206  1.00 18.72  ? 347  ASP B OD1   1 
ATOM   7598  O OD2   . ASP B 1 347 ? -6.297  69.117  31.079  1.00 20.92  ? 347  ASP B OD2   1 
ATOM   7599  N N     . LYS B 1 348 ? -6.745  71.806  26.395  1.00 18.65  ? 348  LYS B N     1 
ATOM   7600  C CA    . LYS B 1 348 ? -6.022  72.354  25.255  1.00 19.35  ? 348  LYS B CA    1 
ATOM   7601  C C     . LYS B 1 348 ? -6.551  73.727  24.870  1.00 19.26  ? 348  LYS B C     1 
ATOM   7602  O O     . LYS B 1 348 ? -5.774  74.627  24.591  1.00 18.48  ? 348  LYS B O     1 
ATOM   7603  C CB    . LYS B 1 348 ? -6.100  71.388  24.057  1.00 19.64  ? 348  LYS B CB    1 
ATOM   7604  C CG    . LYS B 1 348 ? -5.471  71.921  22.782  1.00 20.55  ? 348  LYS B CG    1 
ATOM   7605  C CD    . LYS B 1 348 ? -5.400  70.854  21.728  1.00 21.72  ? 348  LYS B CD    1 
ATOM   7606  C CE    . LYS B 1 348 ? -4.745  71.383  20.468  1.00 22.33  ? 348  LYS B CE    1 
ATOM   7607  N NZ    . LYS B 1 348 ? -4.850  70.374  19.365  1.00 23.46  ? 348  LYS B NZ    1 
ATOM   7608  N N     . HIS B 1 349 ? -7.875  73.885  24.853  1.00 19.78  ? 349  HIS B N     1 
ATOM   7609  C CA    . HIS B 1 349 ? -8.452  75.153  24.402  1.00 20.75  ? 349  HIS B CA    1 
ATOM   7610  C C     . HIS B 1 349 ? -8.992  76.047  25.521  1.00 21.02  ? 349  HIS B C     1 
ATOM   7611  O O     . HIS B 1 349 ? -9.628  77.053  25.262  1.00 21.50  ? 349  HIS B O     1 
ATOM   7612  C CB    . HIS B 1 349 ? -9.480  74.897  23.301  1.00 20.61  ? 349  HIS B CB    1 
ATOM   7613  C CG    . HIS B 1 349 ? -8.884  74.275  22.078  1.00 21.18  ? 349  HIS B CG    1 
ATOM   7614  N ND1   . HIS B 1 349 ? -7.908  74.900  21.331  1.00 22.45  ? 349  HIS B ND1   1 
ATOM   7615  C CD2   . HIS B 1 349 ? -9.072  73.060  21.511  1.00 21.68  ? 349  HIS B CD2   1 
ATOM   7616  C CE1   . HIS B 1 349 ? -7.543  74.106  20.339  1.00 23.24  ? 349  HIS B CE1   1 
ATOM   7617  N NE2   . HIS B 1 349 ? -8.244  72.989  20.420  1.00 22.62  ? 349  HIS B NE2   1 
ATOM   7618  N N     . GLN B 1 350 ? -8.716  75.656  26.756  1.00 21.44  ? 350  GLN B N     1 
ATOM   7619  C CA    . GLN B 1 350 ? -9.154  76.360  27.947  1.00 22.11  ? 350  GLN B CA    1 
ATOM   7620  C C     . GLN B 1 350 ? -10.647 76.686  27.905  1.00 22.32  ? 350  GLN B C     1 
ATOM   7621  O O     . GLN B 1 350 ? -11.053 77.820  28.152  1.00 23.37  ? 350  GLN B O     1 
ATOM   7622  C CB    . GLN B 1 350 ? -8.303  77.605  28.188  1.00 22.10  ? 350  GLN B CB    1 
ATOM   7623  C CG    . GLN B 1 350 ? -6.813  77.317  28.408  1.00 22.98  ? 350  GLN B CG    1 
ATOM   7624  C CD    . GLN B 1 350 ? -6.513  76.765  29.788  1.00 24.39  ? 350  GLN B CD    1 
ATOM   7625  O OE1   . GLN B 1 350 ? -6.217  75.576  29.941  1.00 25.45  ? 350  GLN B OE1   1 
ATOM   7626  N NE2   . GLN B 1 350 ? -6.594  77.625  30.807  1.00 23.39  ? 350  GLN B NE2   1 
ATOM   7627  N N     . VAL B 1 351 ? -11.459 75.680  27.580  1.00 22.21  ? 351  VAL B N     1 
ATOM   7628  C CA    . VAL B 1 351 ? -12.924 75.813  27.602  1.00 21.23  ? 351  VAL B CA    1 
ATOM   7629  C C     . VAL B 1 351 ? -13.441 76.196  28.987  1.00 20.45  ? 351  VAL B C     1 
ATOM   7630  O O     . VAL B 1 351 ? -13.024 75.638  29.994  1.00 20.30  ? 351  VAL B O     1 
ATOM   7631  C CB    . VAL B 1 351 ? -13.598 74.532  27.111  1.00 21.45  ? 351  VAL B CB    1 
ATOM   7632  C CG1   . VAL B 1 351 ? -15.104 74.631  27.239  1.00 21.14  ? 351  VAL B CG1   1 
ATOM   7633  C CG2   . VAL B 1 351 ? -13.199 74.272  25.657  1.00 21.41  ? 351  VAL B CG2   1 
ATOM   7634  N N     . ASN B 1 352 ? -14.329 77.183  29.018  1.00 19.92  ? 352  ASN B N     1 
ATOM   7635  C CA    . ASN B 1 352 ? -14.925 77.677  30.266  1.00 18.81  ? 352  ASN B CA    1 
ATOM   7636  C C     . ASN B 1 352 ? -16.356 77.169  30.467  1.00 18.49  ? 352  ASN B C     1 
ATOM   7637  O O     . ASN B 1 352 ? -16.853 77.127  31.598  1.00 18.48  ? 352  ASN B O     1 
ATOM   7638  C CB    . ASN B 1 352 ? -14.908 79.196  30.282  1.00 18.44  ? 352  ASN B CB    1 
ATOM   7639  C CG    . ASN B 1 352 ? -13.510 79.771  30.114  1.00 18.04  ? 352  ASN B CG    1 
ATOM   7640  O OD1   . ASN B 1 352 ? -13.272 80.577  29.229  1.00 16.36  ? 352  ASN B OD1   1 
ATOM   7641  N ND2   . ASN B 1 352 ? -12.587 79.368  30.981  1.00 17.20  ? 352  ASN B ND2   1 
ATOM   7642  N N     . ILE B 1 353 ? -16.986 76.752  29.371  1.00 17.93  ? 353  ILE B N     1 
ATOM   7643  C CA    . ILE B 1 353 ? -18.383 76.339  29.348  1.00 18.12  ? 353  ILE B CA    1 
ATOM   7644  C C     . ILE B 1 353 ? -18.474 75.076  28.508  1.00 18.83  ? 353  ILE B C     1 
ATOM   7645  O O     . ILE B 1 353 ? -18.110 75.077  27.324  1.00 19.00  ? 353  ILE B O     1 
ATOM   7646  C CB    . ILE B 1 353 ? -19.325 77.408  28.680  1.00 18.21  ? 353  ILE B CB    1 
ATOM   7647  C CG1   . ILE B 1 353 ? -19.180 78.794  29.336  1.00 18.78  ? 353  ILE B CG1   1 
ATOM   7648  C CG2   . ILE B 1 353 ? -20.800 76.928  28.733  1.00 18.09  ? 353  ILE B CG2   1 
ATOM   7649  C CD1   . ILE B 1 353 ? -19.787 79.972  28.539  1.00 17.85  ? 353  ILE B CD1   1 
ATOM   7650  N N     . LEU B 1 354 ? -18.992 74.001  29.095  1.00 19.34  ? 354  LEU B N     1 
ATOM   7651  C CA    . LEU B 1 354 ? -19.135 72.752  28.356  1.00 19.23  ? 354  LEU B CA    1 
ATOM   7652  C C     . LEU B 1 354 ? -20.588 72.292  28.317  1.00 19.71  ? 354  LEU B C     1 
ATOM   7653  O O     . LEU B 1 354 ? -21.249 72.186  29.354  1.00 19.93  ? 354  LEU B O     1 
ATOM   7654  C CB    . LEU B 1 354 ? -18.240 71.669  28.982  1.00 19.03  ? 354  LEU B CB    1 
ATOM   7655  C CG    . LEU B 1 354 ? -18.217 70.235  28.424  1.00 19.52  ? 354  LEU B CG    1 
ATOM   7656  C CD1   . LEU B 1 354 ? -17.678 70.160  26.990  1.00 18.26  ? 354  LEU B CD1   1 
ATOM   7657  C CD2   . LEU B 1 354 ? -17.429 69.296  29.355  1.00 18.54  ? 354  LEU B CD2   1 
ATOM   7658  N N     . TYR B 1 355 ? -21.060 71.962  27.119  1.00 19.97  ? 355  TYR B N     1 
ATOM   7659  C CA    . TYR B 1 355 ? -22.448 71.560  26.903  1.00 19.32  ? 355  TYR B CA    1 
ATOM   7660  C C     . TYR B 1 355 ? -22.443 70.254  26.112  1.00 19.49  ? 355  TYR B C     1 
ATOM   7661  O O     . TYR B 1 355 ? -22.032 70.215  24.953  1.00 19.68  ? 355  TYR B O     1 
ATOM   7662  C CB    . TYR B 1 355 ? -23.150 72.682  26.144  1.00 18.87  ? 355  TYR B CB    1 
ATOM   7663  C CG    . TYR B 1 355 ? -24.640 72.578  25.935  1.00 17.83  ? 355  TYR B CG    1 
ATOM   7664  C CD1   . TYR B 1 355 ? -25.504 72.114  26.942  1.00 17.66  ? 355  TYR B CD1   1 
ATOM   7665  C CD2   . TYR B 1 355 ? -25.193 73.023  24.742  1.00 18.78  ? 355  TYR B CD2   1 
ATOM   7666  C CE1   . TYR B 1 355 ? -26.897 72.069  26.740  1.00 18.01  ? 355  TYR B CE1   1 
ATOM   7667  C CE2   . TYR B 1 355 ? -26.572 72.982  24.512  1.00 19.54  ? 355  TYR B CE2   1 
ATOM   7668  C CZ    . TYR B 1 355 ? -27.411 72.507  25.503  1.00 18.89  ? 355  TYR B CZ    1 
ATOM   7669  O OH    . TYR B 1 355 ? -28.746 72.477  25.221  1.00 17.79  ? 355  TYR B OH    1 
ATOM   7670  N N     . THR B 1 356 ? -22.877 69.177  26.748  1.00 19.37  ? 356  THR B N     1 
ATOM   7671  C CA    . THR B 1 356 ? -22.847 67.887  26.105  1.00 19.99  ? 356  THR B CA    1 
ATOM   7672  C C     . THR B 1 356 ? -24.116 67.085  26.391  1.00 20.03  ? 356  THR B C     1 
ATOM   7673  O O     . THR B 1 356 ? -25.133 67.653  26.802  1.00 21.02  ? 356  THR B O     1 
ATOM   7674  C CB    . THR B 1 356 ? -21.534 67.113  26.425  1.00 20.02  ? 356  THR B CB    1 
ATOM   7675  O OG1   . THR B 1 356 ? -21.424 65.979  25.555  1.00 21.40  ? 356  THR B OG1   1 
ATOM   7676  C CG2   . THR B 1 356 ? -21.455 66.670  27.904  1.00 19.52  ? 356  THR B CG2   1 
ATOM   7677  N N     . ALA B 1 357 ? -24.045 65.772  26.175  1.00 19.55  ? 357  ALA B N     1 
ATOM   7678  C CA    . ALA B 1 357 ? -25.200 64.883  26.217  1.00 18.69  ? 357  ALA B CA    1 
ATOM   7679  C C     . ALA B 1 357 ? -24.989 63.800  27.252  1.00 18.88  ? 357  ALA B C     1 
ATOM   7680  O O     . ALA B 1 357 ? -23.870 63.300  27.404  1.00 18.32  ? 357  ALA B O     1 
ATOM   7681  C CB    . ALA B 1 357 ? -25.374 64.238  24.851  1.00 18.37  ? 357  ALA B CB    1 
ATOM   7682  N N     . PRO B 1 358 ? -26.070 63.387  27.933  1.00 18.96  ? 358  PRO B N     1 
ATOM   7683  C CA    . PRO B 1 358 ? -26.016 62.264  28.869  1.00 19.12  ? 358  PRO B CA    1 
ATOM   7684  C C     . PRO B 1 358 ? -25.460 60.936  28.271  1.00 19.29  ? 358  PRO B C     1 
ATOM   7685  O O     . PRO B 1 358 ? -24.781 60.185  28.984  1.00 19.42  ? 358  PRO B O     1 
ATOM   7686  C CB    . PRO B 1 358 ? -27.480 62.107  29.281  1.00 19.07  ? 358  PRO B CB    1 
ATOM   7687  C CG    . PRO B 1 358 ? -28.058 63.465  29.105  1.00 18.49  ? 358  PRO B CG    1 
ATOM   7688  C CD    . PRO B 1 358 ? -27.428 63.956  27.859  1.00 19.18  ? 358  PRO B CD    1 
ATOM   7689  N N     . THR B 1 359 ? -25.733 60.635  26.999  1.00 19.00  ? 359  THR B N     1 
ATOM   7690  C CA    . THR B 1 359 ? -25.134 59.425  26.407  1.00 19.58  ? 359  THR B CA    1 
ATOM   7691  C C     . THR B 1 359 ? -23.597 59.510  26.409  1.00 19.50  ? 359  THR B C     1 
ATOM   7692  O O     . THR B 1 359 ? -22.932 58.535  26.757  1.00 19.38  ? 359  THR B O     1 
ATOM   7693  C CB    . THR B 1 359 ? -25.688 59.060  24.987  1.00 19.72  ? 359  THR B CB    1 
ATOM   7694  O OG1   . THR B 1 359 ? -27.062 58.675  25.099  1.00 20.54  ? 359  THR B OG1   1 
ATOM   7695  C CG2   . THR B 1 359 ? -24.911 57.861  24.396  1.00 18.83  ? 359  THR B CG2   1 
ATOM   7696  N N     . ALA B 1 360 ? -23.048 60.675  26.035  1.00 19.60  ? 360  ALA B N     1 
ATOM   7697  C CA    . ALA B 1 360 ? -21.608 60.920  26.147  1.00 19.90  ? 360  ALA B CA    1 
ATOM   7698  C C     . ALA B 1 360 ? -21.118 60.818  27.595  1.00 20.34  ? 360  ALA B C     1 
ATOM   7699  O O     . ALA B 1 360 ? -20.089 60.192  27.874  1.00 20.99  ? 360  ALA B O     1 
ATOM   7700  C CB    . ALA B 1 360 ? -21.244 62.259  25.560  1.00 20.28  ? 360  ALA B CB    1 
ATOM   7701  N N     . ILE B 1 361 ? -21.857 61.433  28.512  1.00 20.30  ? 361  ILE B N     1 
ATOM   7702  C CA    . ILE B 1 361 ? -21.520 61.405  29.931  1.00 19.88  ? 361  ILE B CA    1 
ATOM   7703  C C     . ILE B 1 361 ? -21.500 59.967  30.462  1.00 19.44  ? 361  ILE B C     1 
ATOM   7704  O O     . ILE B 1 361 ? -20.517 59.562  31.102  1.00 19.45  ? 361  ILE B O     1 
ATOM   7705  C CB    . ILE B 1 361 ? -22.473 62.298  30.750  1.00 20.09  ? 361  ILE B CB    1 
ATOM   7706  C CG1   . ILE B 1 361 ? -22.217 63.770  30.419  1.00 20.51  ? 361  ILE B CG1   1 
ATOM   7707  C CG2   . ILE B 1 361 ? -22.322 62.033  32.263  1.00 20.46  ? 361  ILE B CG2   1 
ATOM   7708  C CD1   . ILE B 1 361 ? -23.371 64.714  30.782  1.00 19.93  ? 361  ILE B CD1   1 
ATOM   7709  N N     . ARG B 1 362 ? -22.553 59.195  30.178  1.00 18.62  ? 362  ARG B N     1 
ATOM   7710  C CA    . ARG B 1 362 ? -22.605 57.791  30.597  1.00 18.00  ? 362  ARG B CA    1 
ATOM   7711  C C     . ARG B 1 362 ? -21.474 56.964  29.991  1.00 18.27  ? 362  ARG B C     1 
ATOM   7712  O O     . ARG B 1 362 ? -20.905 56.119  30.675  1.00 18.12  ? 362  ARG B O     1 
ATOM   7713  C CB    . ARG B 1 362 ? -23.955 57.151  30.295  1.00 17.90  ? 362  ARG B CB    1 
ATOM   7714  C CG    . ARG B 1 362 ? -25.089 57.636  31.201  1.00 18.42  ? 362  ARG B CG    1 
ATOM   7715  C CD    . ARG B 1 362 ? -26.400 56.904  30.916  1.00 17.68  ? 362  ARG B CD    1 
ATOM   7716  N NE    . ARG B 1 362 ? -26.846 57.094  29.533  1.00 20.65  ? 362  ARG B NE    1 
ATOM   7717  C CZ    . ARG B 1 362 ? -27.762 57.984  29.147  1.00 19.54  ? 362  ARG B CZ    1 
ATOM   7718  N NH1   . ARG B 1 362 ? -28.364 58.781  30.027  1.00 17.62  ? 362  ARG B NH1   1 
ATOM   7719  N NH2   . ARG B 1 362 ? -28.074 58.075  27.868  1.00 21.63  ? 362  ARG B NH2   1 
ATOM   7720  N N     . ALA B 1 363 ? -21.137 57.224  28.724  1.00 17.98  ? 363  ALA B N     1 
ATOM   7721  C CA    . ALA B 1 363 ? -20.011 56.539  28.083  1.00 18.27  ? 363  ALA B CA    1 
ATOM   7722  C C     . ALA B 1 363 ? -18.684 56.828  28.809  1.00 18.36  ? 363  ALA B C     1 
ATOM   7723  O O     . ALA B 1 363 ? -17.855 55.933  28.998  1.00 18.43  ? 363  ALA B O     1 
ATOM   7724  C CB    . ALA B 1 363 ? -19.918 56.893  26.586  1.00 17.20  ? 363  ALA B CB    1 
ATOM   7725  N N     . LEU B 1 364 ? -18.496 58.071  29.228  1.00 18.45  ? 364  LEU B N     1 
ATOM   7726  C CA    . LEU B 1 364 ? -17.294 58.443  29.973  1.00 19.19  ? 364  LEU B CA    1 
ATOM   7727  C C     . LEU B 1 364 ? -17.279 57.835  31.376  1.00 18.92  ? 364  LEU B C     1 
ATOM   7728  O O     . LEU B 1 364 ? -16.255 57.320  31.815  1.00 19.39  ? 364  LEU B O     1 
ATOM   7729  C CB    . LEU B 1 364 ? -17.124 59.969  30.032  1.00 19.07  ? 364  LEU B CB    1 
ATOM   7730  C CG    . LEU B 1 364 ? -16.936 60.659  28.671  1.00 20.16  ? 364  LEU B CG    1 
ATOM   7731  C CD1   . LEU B 1 364 ? -16.729 62.138  28.873  1.00 18.21  ? 364  LEU B CD1   1 
ATOM   7732  C CD2   . LEU B 1 364 ? -15.788 60.018  27.828  1.00 20.34  ? 364  LEU B CD2   1 
ATOM   7733  N N     . MET B 1 365 ? -18.424 57.889  32.046  1.00 19.13  ? 365  MET B N     1 
ATOM   7734  C CA    . MET B 1 365 ? -18.603 57.414  33.418  1.00 19.75  ? 365  MET B CA    1 
ATOM   7735  C C     . MET B 1 365 ? -18.284 55.921  33.535  1.00 19.32  ? 365  MET B C     1 
ATOM   7736  O O     . MET B 1 365 ? -17.687 55.480  34.537  1.00 19.28  ? 365  MET B O     1 
ATOM   7737  C CB    . MET B 1 365 ? -20.047 57.725  33.873  1.00 19.96  ? 365  MET B CB    1 
ATOM   7738  C CG    . MET B 1 365 ? -20.377 57.392  35.320  1.00 20.71  ? 365  MET B CG    1 
ATOM   7739  S SD    . MET B 1 365 ? -22.004 57.974  35.906  1.00 22.76  ? 365  MET B SD    1 
ATOM   7740  C CE    . MET B 1 365 ? -23.169 57.128  34.811  1.00 25.87  ? 365  MET B CE    1 
ATOM   7741  N N     . ALA B 1 366 ? -18.654 55.146  32.512  1.00 18.66  ? 366  ALA B N     1 
ATOM   7742  C CA    . ALA B 1 366 ? -18.385 53.711  32.513  1.00 18.72  ? 366  ALA B CA    1 
ATOM   7743  C C     . ALA B 1 366 ? -16.888 53.431  32.631  1.00 18.69  ? 366  ALA B C     1 
ATOM   7744  O O     . ALA B 1 366 ? -16.493 52.420  33.193  1.00 18.38  ? 366  ALA B O     1 
ATOM   7745  C CB    . ALA B 1 366 ? -18.967 53.035  31.281  1.00 18.77  ? 366  ALA B CB    1 
ATOM   7746  N N     . GLU B 1 367 ? -16.082 54.364  32.126  1.00 18.77  ? 367  GLU B N     1 
ATOM   7747  C CA    . GLU B 1 367 ? -14.604 54.315  32.161  1.00 19.19  ? 367  GLU B CA    1 
ATOM   7748  C C     . GLU B 1 367 ? -13.979 54.929  33.428  1.00 18.76  ? 367  GLU B C     1 
ATOM   7749  O O     . GLU B 1 367 ? -12.761 54.944  33.584  1.00 18.30  ? 367  GLU B O     1 
ATOM   7750  C CB    . GLU B 1 367 ? -14.029 55.011  30.909  1.00 18.94  ? 367  GLU B CB    1 
ATOM   7751  C CG    . GLU B 1 367 ? -14.539 54.444  29.576  1.00 21.17  ? 367  GLU B CG    1 
ATOM   7752  C CD    . GLU B 1 367 ? -14.463 52.909  29.500  1.00 26.35  ? 367  GLU B CD    1 
ATOM   7753  O OE1   . GLU B 1 367 ? -13.541 52.305  30.101  1.00 26.08  ? 367  GLU B OE1   1 
ATOM   7754  O OE2   . GLU B 1 367 ? -15.353 52.295  28.857  1.00 30.78  ? 367  GLU B OE2   1 
ATOM   7755  N N     . GLY B 1 368 ? -14.820 55.440  34.318  1.00 18.96  ? 368  GLY B N     1 
ATOM   7756  C CA    . GLY B 1 368 ? -14.364 56.047  35.558  1.00 19.55  ? 368  GLY B CA    1 
ATOM   7757  C C     . GLY B 1 368 ? -13.329 57.128  35.323  1.00 20.22  ? 368  GLY B C     1 
ATOM   7758  O O     . GLY B 1 368 ? -13.453 57.956  34.403  1.00 20.66  ? 368  GLY B O     1 
ATOM   7759  N N     . ASP B 1 369 ? -12.273 57.074  36.119  1.00 20.64  ? 369  ASP B N     1 
ATOM   7760  C CA    . ASP B 1 369 ? -11.252 58.109  36.147  1.00 20.51  ? 369  ASP B CA    1 
ATOM   7761  C C     . ASP B 1 369 ? -10.354 58.122  34.924  1.00 20.20  ? 369  ASP B C     1 
ATOM   7762  O O     . ASP B 1 369 ? -9.577  59.050  34.748  1.00 20.75  ? 369  ASP B O     1 
ATOM   7763  C CB    . ASP B 1 369 ? -10.440 58.017  37.442  1.00 20.58  ? 369  ASP B CB    1 
ATOM   7764  C CG    . ASP B 1 369 ? -11.253 58.432  38.675  1.00 21.55  ? 369  ASP B CG    1 
ATOM   7765  O OD1   . ASP B 1 369 ? -12.406 58.933  38.533  1.00 18.62  ? 369  ASP B OD1   1 
ATOM   7766  O OD2   . ASP B 1 369 ? -10.718 58.250  39.788  1.00 23.18  ? 369  ASP B OD2   1 
ATOM   7767  N N     . LYS B 1 370 ? -10.471 57.115  34.071  1.00 19.86  ? 370  LYS B N     1 
ATOM   7768  C CA    . LYS B 1 370 ? -9.844  57.169  32.751  1.00 20.13  ? 370  LYS B CA    1 
ATOM   7769  C C     . LYS B 1 370 ? -10.392 58.327  31.900  1.00 19.49  ? 370  LYS B C     1 
ATOM   7770  O O     . LYS B 1 370 ? -9.735  58.772  30.960  1.00 19.14  ? 370  LYS B O     1 
ATOM   7771  C CB    . LYS B 1 370 ? -10.007 55.838  32.002  1.00 20.45  ? 370  LYS B CB    1 
ATOM   7772  C CG    . LYS B 1 370 ? -9.443  54.639  32.767  1.00 21.57  ? 370  LYS B CG    1 
ATOM   7773  C CD    . LYS B 1 370 ? -8.030  54.861  33.297  1.00 24.44  ? 370  LYS B CD    1 
ATOM   7774  C CE    . LYS B 1 370 ? -6.932  54.348  32.374  1.00 25.66  ? 370  LYS B CE    1 
ATOM   7775  N NZ    . LYS B 1 370 ? -5.611  54.300  33.103  1.00 25.77  ? 370  LYS B NZ    1 
ATOM   7776  N N     . ALA B 1 371 ? -11.586 58.801  32.252  1.00 19.16  ? 371  ALA B N     1 
ATOM   7777  C CA    . ALA B 1 371 ? -12.192 59.974  31.627  1.00 19.16  ? 371  ALA B CA    1 
ATOM   7778  C C     . ALA B 1 371 ? -11.472 61.291  31.980  1.00 19.13  ? 371  ALA B C     1 
ATOM   7779  O O     . ALA B 1 371 ? -11.577 62.256  31.226  1.00 18.98  ? 371  ALA B O     1 
ATOM   7780  C CB    . ALA B 1 371 ? -13.677 60.059  31.977  1.00 18.52  ? 371  ALA B CB    1 
ATOM   7781  N N     . ILE B 1 372 ? -10.723 61.308  33.093  1.00 18.79  ? 372  ILE B N     1 
ATOM   7782  C CA    . ILE B 1 372 ? -10.068 62.538  33.577  1.00 18.88  ? 372  ILE B CA    1 
ATOM   7783  C C     . ILE B 1 372 ? -8.552  62.441  33.831  1.00 19.01  ? 372  ILE B C     1 
ATOM   7784  O O     . ILE B 1 372 ? -7.886  63.468  34.054  1.00 18.17  ? 372  ILE B O     1 
ATOM   7785  C CB    . ILE B 1 372 ? -10.756 63.132  34.873  1.00 19.00  ? 372  ILE B CB    1 
ATOM   7786  C CG1   . ILE B 1 372 ? -10.664 62.151  36.064  1.00 18.33  ? 372  ILE B CG1   1 
ATOM   7787  C CG2   . ILE B 1 372 ? -12.194 63.628  34.549  1.00 18.75  ? 372  ILE B CG2   1 
ATOM   7788  C CD1   . ILE B 1 372 ? -11.038 62.754  37.434  1.00 18.28  ? 372  ILE B CD1   1 
ATOM   7789  N N     . GLU B 1 373 ? -8.031  61.216  33.806  1.00 19.64  ? 373  GLU B N     1 
ATOM   7790  C CA    . GLU B 1 373 ? -6.611  60.937  34.044  1.00 20.69  ? 373  GLU B CA    1 
ATOM   7791  C C     . GLU B 1 373 ? -5.729  61.841  33.195  1.00 20.34  ? 373  GLU B C     1 
ATOM   7792  O O     . GLU B 1 373 ? -5.906  61.935  31.967  1.00 20.32  ? 373  GLU B O     1 
ATOM   7793  C CB    . GLU B 1 373 ? -6.302  59.482  33.708  1.00 20.17  ? 373  GLU B CB    1 
ATOM   7794  C CG    . GLU B 1 373 ? -4.864  59.039  34.022  1.00 21.56  ? 373  GLU B CG    1 
ATOM   7795  C CD    . GLU B 1 373 ? -4.637  57.597  33.597  1.00 23.35  ? 373  GLU B CD    1 
ATOM   7796  O OE1   . GLU B 1 373 ? -4.759  56.711  34.456  1.00 26.32  ? 373  GLU B OE1   1 
ATOM   7797  O OE2   . GLU B 1 373 ? -4.409  57.334  32.384  1.00 29.56  ? 373  GLU B OE2   1 
ATOM   7798  N N     . GLY B 1 374 ? -4.793  62.515  33.851  1.00 20.65  ? 374  GLY B N     1 
ATOM   7799  C CA    . GLY B 1 374 ? -3.859  63.405  33.161  1.00 21.06  ? 374  GLY B CA    1 
ATOM   7800  C C     . GLY B 1 374 ? -4.499  64.673  32.613  1.00 21.72  ? 374  GLY B C     1 
ATOM   7801  O O     . GLY B 1 374 ? -3.892  65.354  31.793  1.00 22.06  ? 374  GLY B O     1 
ATOM   7802  N N     . THR B 1 375 ? -5.728  64.992  33.028  1.00 21.58  ? 375  THR B N     1 
ATOM   7803  C CA    . THR B 1 375 ? -6.322  66.251  32.615  1.00 21.67  ? 375  THR B CA    1 
ATOM   7804  C C     . THR B 1 375 ? -6.522  67.131  33.816  1.00 21.92  ? 375  THR B C     1 
ATOM   7805  O O     . THR B 1 375 ? -6.576  66.658  34.954  1.00 22.35  ? 375  THR B O     1 
ATOM   7806  C CB    . THR B 1 375 ? -7.677  66.089  31.915  1.00 21.99  ? 375  THR B CB    1 
ATOM   7807  O OG1   . THR B 1 375 ? -8.618  65.532  32.847  1.00 22.51  ? 375  THR B OG1   1 
ATOM   7808  C CG2   . THR B 1 375 ? -7.553  65.222  30.626  1.00 20.28  ? 375  THR B CG2   1 
ATOM   7809  N N     . ASP B 1 376 ? -6.673  68.414  33.554  1.00 22.22  ? 376  ASP B N     1 
ATOM   7810  C CA    . ASP B 1 376 ? -6.765  69.397  34.613  1.00 22.74  ? 376  ASP B CA    1 
ATOM   7811  C C     . ASP B 1 376 ? -8.206  69.924  34.846  1.00 22.50  ? 376  ASP B C     1 
ATOM   7812  O O     . ASP B 1 376 ? -8.693  69.930  35.990  1.00 22.46  ? 376  ASP B O     1 
ATOM   7813  C CB    . ASP B 1 376 ? -5.790  70.515  34.307  1.00 23.23  ? 376  ASP B CB    1 
ATOM   7814  C CG    . ASP B 1 376 ? -5.712  71.517  35.401  1.00 25.51  ? 376  ASP B CG    1 
ATOM   7815  O OD1   . ASP B 1 376 ? -6.626  72.373  35.488  1.00 28.53  ? 376  ASP B OD1   1 
ATOM   7816  O OD2   . ASP B 1 376 ? -4.738  71.438  36.171  1.00 26.99  ? 376  ASP B OD2   1 
ATOM   7817  N N     . ARG B 1 377 ? -8.877  70.355  33.772  1.00 21.75  ? 377  ARG B N     1 
ATOM   7818  C CA    . ARG B 1 377 ? -10.303 70.754  33.818  1.00 20.55  ? 377  ARG B CA    1 
ATOM   7819  C C     . ARG B 1 377 ? -10.617 72.048  34.589  1.00 20.73  ? 377  ARG B C     1 
ATOM   7820  O O     . ARG B 1 377 ? -11.795 72.424  34.702  1.00 20.24  ? 377  ARG B O     1 
ATOM   7821  C CB    . ARG B 1 377 ? -11.182 69.610  34.362  1.00 20.43  ? 377  ARG B CB    1 
ATOM   7822  C CG    . ARG B 1 377 ? -11.417 68.440  33.395  1.00 17.86  ? 377  ARG B CG    1 
ATOM   7823  C CD    . ARG B 1 377 ? -11.569 67.120  34.168  1.00 16.85  ? 377  ARG B CD    1 
ATOM   7824  N NE    . ARG B 1 377 ? -10.331 66.738  34.854  1.00 13.29  ? 377  ARG B NE    1 
ATOM   7825  C CZ    . ARG B 1 377 ? -10.209 66.597  36.178  1.00 15.17  ? 377  ARG B CZ    1 
ATOM   7826  N NH1   . ARG B 1 377 ? -11.259 66.761  36.998  1.00 12.82  ? 377  ARG B NH1   1 
ATOM   7827  N NH2   . ARG B 1 377 ? -9.021  66.283  36.685  1.00 12.56  ? 377  ARG B NH2   1 
ATOM   7828  N N     . SER B 1 378 ? -9.581  72.726  35.099  1.00 20.51  ? 378  SER B N     1 
ATOM   7829  C CA    . SER B 1 378 ? -9.746  73.938  35.921  1.00 21.02  ? 378  SER B CA    1 
ATOM   7830  C C     . SER B 1 378 ? -10.338 75.140  35.200  1.00 20.55  ? 378  SER B C     1 
ATOM   7831  O O     . SER B 1 378 ? -10.753 76.095  35.856  1.00 20.14  ? 378  SER B O     1 
ATOM   7832  C CB    . SER B 1 378 ? -8.412  74.376  36.555  1.00 20.96  ? 378  SER B CB    1 
ATOM   7833  O OG    . SER B 1 378 ? -8.002  73.430  37.528  1.00 24.87  ? 378  SER B OG    1 
ATOM   7834  N N     . SER B 1 379 ? -10.347 75.133  33.875  1.00 20.45  ? 379  SER B N     1 
ATOM   7835  C CA    . SER B 1 379 ? -10.906 76.289  33.152  1.00 21.50  ? 379  SER B CA    1 
ATOM   7836  C C     . SER B 1 379 ? -12.445 76.346  33.177  1.00 21.21  ? 379  SER B C     1 
ATOM   7837  O O     . SER B 1 379 ? -13.034 77.419  32.988  1.00 21.34  ? 379  SER B O     1 
ATOM   7838  C CB    . SER B 1 379 ? -10.370 76.367  31.717  1.00 21.44  ? 379  SER B CB    1 
ATOM   7839  O OG    . SER B 1 379 ? -10.634 75.157  31.009  1.00 23.98  ? 379  SER B OG    1 
ATOM   7840  N N     . LEU B 1 380 ? -13.093 75.210  33.441  1.00 21.00  ? 380  LEU B N     1 
ATOM   7841  C CA    . LEU B 1 380 ? -14.557 75.156  33.396  1.00 21.24  ? 380  LEU B CA    1 
ATOM   7842  C C     . LEU B 1 380 ? -15.184 75.941  34.541  1.00 21.76  ? 380  LEU B C     1 
ATOM   7843  O O     . LEU B 1 380 ? -14.734 75.820  35.691  1.00 21.07  ? 380  LEU B O     1 
ATOM   7844  C CB    . LEU B 1 380 ? -15.096 73.713  33.394  1.00 20.77  ? 380  LEU B CB    1 
ATOM   7845  C CG    . LEU B 1 380 ? -14.738 72.798  32.209  1.00 21.16  ? 380  LEU B CG    1 
ATOM   7846  C CD1   . LEU B 1 380 ? -15.031 71.331  32.553  1.00 19.97  ? 380  LEU B CD1   1 
ATOM   7847  C CD2   . LEU B 1 380 ? -15.428 73.228  30.901  1.00 18.95  ? 380  LEU B CD2   1 
ATOM   7848  N N     . ARG B 1 381 ? -16.206 76.735  34.192  1.00 22.02  ? 381  ARG B N     1 
ATOM   7849  C CA    . ARG B 1 381 ? -17.056 77.456  35.130  1.00 23.45  ? 381  ARG B CA    1 
ATOM   7850  C C     . ARG B 1 381 ? -18.506 76.971  35.064  1.00 22.71  ? 381  ARG B C     1 
ATOM   7851  O O     . ARG B 1 381 ? -19.214 76.990  36.078  1.00 22.43  ? 381  ARG B O     1 
ATOM   7852  C CB    . ARG B 1 381 ? -17.040 78.958  34.837  1.00 23.66  ? 381  ARG B CB    1 
ATOM   7853  C CG    . ARG B 1 381 ? -15.796 79.692  35.313  1.00 26.06  ? 381  ARG B CG    1 
ATOM   7854  C CD    . ARG B 1 381 ? -15.915 81.209  35.083  1.00 26.47  ? 381  ARG B CD    1 
ATOM   7855  N NE    . ARG B 1 381 ? -15.833 81.601  33.662  1.00 34.46  ? 381  ARG B NE    1 
ATOM   7856  C CZ    . ARG B 1 381 ? -14.706 81.890  32.997  1.00 34.55  ? 381  ARG B CZ    1 
ATOM   7857  N NH1   . ARG B 1 381 ? -13.508 81.831  33.588  1.00 34.98  ? 381  ARG B NH1   1 
ATOM   7858  N NH2   . ARG B 1 381 ? -14.781 82.247  31.726  1.00 33.64  ? 381  ARG B NH2   1 
ATOM   7859  N N     . ILE B 1 382 ? -18.938 76.563  33.864  1.00 22.23  ? 382  ILE B N     1 
ATOM   7860  C CA    . ILE B 1 382 ? -20.329 76.159  33.581  1.00 21.74  ? 382  ILE B CA    1 
ATOM   7861  C C     . ILE B 1 382 ? -20.404 74.859  32.745  1.00 22.23  ? 382  ILE B C     1 
ATOM   7862  O O     . ILE B 1 382 ? -19.717 74.712  31.710  1.00 21.41  ? 382  ILE B O     1 
ATOM   7863  C CB    . ILE B 1 382 ? -21.131 77.264  32.829  1.00 21.61  ? 382  ILE B CB    1 
ATOM   7864  C CG1   . ILE B 1 382 ? -21.131 78.594  33.599  1.00 20.79  ? 382  ILE B CG1   1 
ATOM   7865  C CG2   . ILE B 1 382 ? -22.555 76.770  32.467  1.00 20.62  ? 382  ILE B CG2   1 
ATOM   7866  C CD1   . ILE B 1 382 ? -21.985 78.609  34.881  1.00 19.10  ? 382  ILE B CD1   1 
ATOM   7867  N N     . LEU B 1 383 ? -21.249 73.931  33.226  1.00 21.93  ? 383  LEU B N     1 
ATOM   7868  C CA    . LEU B 1 383 ? -21.569 72.692  32.539  1.00 21.42  ? 383  LEU B CA    1 
ATOM   7869  C C     . LEU B 1 383 ? -23.021 72.695  32.062  1.00 21.49  ? 383  LEU B C     1 
ATOM   7870  O O     . LEU B 1 383 ? -23.915 73.253  32.709  1.00 21.05  ? 383  LEU B O     1 
ATOM   7871  C CB    . LEU B 1 383 ? -21.341 71.482  33.454  1.00 21.07  ? 383  LEU B CB    1 
ATOM   7872  C CG    . LEU B 1 383 ? -19.928 71.222  33.978  1.00 21.43  ? 383  LEU B CG    1 
ATOM   7873  C CD1   . LEU B 1 383 ? -19.958 69.995  34.840  1.00 19.58  ? 383  LEU B CD1   1 
ATOM   7874  C CD2   . LEU B 1 383 ? -18.896 71.064  32.844  1.00 19.32  ? 383  LEU B CD2   1 
ATOM   7875  N N     . GLY B 1 384 ? -23.251 72.034  30.936  1.00 21.37  ? 384  GLY B N     1 
ATOM   7876  C CA    . GLY B 1 384 ? -24.592 71.871  30.402  1.00 21.08  ? 384  GLY B CA    1 
ATOM   7877  C C     . GLY B 1 384 ? -24.867 70.433  30.031  1.00 20.64  ? 384  GLY B C     1 
ATOM   7878  O O     . GLY B 1 384 ? -23.941 69.652  29.833  1.00 20.56  ? 384  GLY B O     1 
ATOM   7879  N N     . SER B 1 385 ? -26.152 70.099  29.965  1.00 20.09  ? 385  SER B N     1 
ATOM   7880  C CA    . SER B 1 385 ? -26.619 68.798  29.532  1.00 19.88  ? 385  SER B CA    1 
ATOM   7881  C C     . SER B 1 385 ? -27.895 68.975  28.693  1.00 20.15  ? 385  SER B C     1 
ATOM   7882  O O     . SER B 1 385 ? -28.792 69.717  29.078  1.00 19.85  ? 385  SER B O     1 
ATOM   7883  C CB    . SER B 1 385 ? -26.931 67.892  30.736  1.00 19.71  ? 385  SER B CB    1 
ATOM   7884  O OG    . SER B 1 385 ? -27.250 66.577  30.293  1.00 18.27  ? 385  SER B OG    1 
ATOM   7885  N N     . VAL B 1 386 ? -27.976 68.262  27.576  1.00 19.96  ? 386  VAL B N     1 
ATOM   7886  C CA    . VAL B 1 386 ? -29.099 68.392  26.666  1.00 20.46  ? 386  VAL B CA    1 
ATOM   7887  C C     . VAL B 1 386 ? -29.414 67.050  26.024  1.00 21.24  ? 386  VAL B C     1 
ATOM   7888  O O     . VAL B 1 386 ? -28.517 66.217  25.835  1.00 21.08  ? 386  VAL B O     1 
ATOM   7889  C CB    . VAL B 1 386 ? -28.784 69.432  25.546  1.00 20.35  ? 386  VAL B CB    1 
ATOM   7890  C CG1   . VAL B 1 386 ? -27.540 69.031  24.722  1.00 19.02  ? 386  VAL B CG1   1 
ATOM   7891  C CG2   . VAL B 1 386 ? -29.998 69.707  24.656  1.00 20.09  ? 386  VAL B CG2   1 
ATOM   7892  N N     . GLY B 1 387 ? -30.688 66.844  25.698  1.00 21.43  ? 387  GLY B N     1 
ATOM   7893  C CA    . GLY B 1 387 ? -31.049 65.813  24.736  1.00 22.41  ? 387  GLY B CA    1 
ATOM   7894  C C     . GLY B 1 387 ? -31.798 64.603  25.241  1.00 22.80  ? 387  GLY B C     1 
ATOM   7895  O O     . GLY B 1 387 ? -32.454 63.938  24.457  1.00 23.52  ? 387  GLY B O     1 
ATOM   7896  N N     . GLU B 1 388 ? -31.705 64.316  26.533  1.00 22.96  ? 388  GLU B N     1 
ATOM   7897  C CA    . GLU B 1 388 ? -32.283 63.114  27.109  1.00 24.00  ? 388  GLU B CA    1 
ATOM   7898  C C     . GLU B 1 388 ? -32.380 63.265  28.618  1.00 24.07  ? 388  GLU B C     1 
ATOM   7899  O O     . GLU B 1 388 ? -31.766 64.174  29.188  1.00 23.77  ? 388  GLU B O     1 
ATOM   7900  C CB    . GLU B 1 388 ? -31.482 61.851  26.738  1.00 23.72  ? 388  GLU B CB    1 
ATOM   7901  C CG    . GLU B 1 388 ? -30.001 62.074  26.702  1.00 25.82  ? 388  GLU B CG    1 
ATOM   7902  C CD    . GLU B 1 388 ? -29.173 60.932  26.084  1.00 25.88  ? 388  GLU B CD    1 
ATOM   7903  O OE1   . GLU B 1 388 ? -29.508 59.729  26.283  1.00 26.71  ? 388  GLU B OE1   1 
ATOM   7904  O OE2   . GLU B 1 388 ? -28.159 61.279  25.428  1.00 26.28  ? 388  GLU B OE2   1 
ATOM   7905  N N     . PRO B 1 389 ? -33.204 62.413  29.267  1.00 24.29  ? 389  PRO B N     1 
ATOM   7906  C CA    . PRO B 1 389 ? -33.190 62.420  30.722  1.00 24.37  ? 389  PRO B CA    1 
ATOM   7907  C C     . PRO B 1 389 ? -31.774 62.132  31.191  1.00 24.79  ? 389  PRO B C     1 
ATOM   7908  O O     . PRO B 1 389 ? -31.016 61.457  30.490  1.00 24.60  ? 389  PRO B O     1 
ATOM   7909  C CB    . PRO B 1 389 ? -34.129 61.272  31.093  1.00 24.29  ? 389  PRO B CB    1 
ATOM   7910  C CG    . PRO B 1 389 ? -35.065 61.141  29.888  1.00 24.71  ? 389  PRO B CG    1 
ATOM   7911  C CD    . PRO B 1 389 ? -34.174 61.441  28.715  1.00 23.86  ? 389  PRO B CD    1 
ATOM   7912  N N     . ILE B 1 390 ? -31.410 62.681  32.347  1.00 25.34  ? 390  ILE B N     1 
ATOM   7913  C CA    . ILE B 1 390 ? -30.146 62.341  32.993  1.00 25.45  ? 390  ILE B CA    1 
ATOM   7914  C C     . ILE B 1 390 ? -30.430 61.862  34.408  1.00 26.06  ? 390  ILE B C     1 
ATOM   7915  O O     . ILE B 1 390 ? -31.111 62.549  35.186  1.00 26.19  ? 390  ILE B O     1 
ATOM   7916  C CB    . ILE B 1 390 ? -29.096 63.506  32.917  1.00 25.60  ? 390  ILE B CB    1 
ATOM   7917  C CG1   . ILE B 1 390 ? -27.721 63.036  33.431  1.00 25.57  ? 390  ILE B CG1   1 
ATOM   7918  C CG2   . ILE B 1 390 ? -29.591 64.796  33.615  1.00 25.15  ? 390  ILE B CG2   1 
ATOM   7919  C CD1   . ILE B 1 390 ? -26.579 64.025  33.185  1.00 24.83  ? 390  ILE B CD1   1 
ATOM   7920  N N     . ASN B 1 391 ? -29.953 60.666  34.738  1.00 26.60  ? 391  ASN B N     1 
ATOM   7921  C CA    . ASN B 1 391 ? -30.217 60.138  36.061  1.00 27.53  ? 391  ASN B CA    1 
ATOM   7922  C C     . ASN B 1 391 ? -29.331 60.880  37.062  1.00 27.37  ? 391  ASN B C     1 
ATOM   7923  O O     . ASN B 1 391 ? -28.323 61.493  36.663  1.00 27.64  ? 391  ASN B O     1 
ATOM   7924  C CB    . ASN B 1 391 ? -30.120 58.590  36.115  1.00 28.59  ? 391  ASN B CB    1 
ATOM   7925  C CG    . ASN B 1 391 ? -29.022 58.075  37.051  1.00 32.33  ? 391  ASN B CG    1 
ATOM   7926  O OD1   . ASN B 1 391 ? -27.822 58.210  36.764  1.00 36.92  ? 391  ASN B OD1   1 
ATOM   7927  N ND2   . ASN B 1 391 ? -29.431 57.471  38.174  1.00 35.13  ? 391  ASN B ND2   1 
ATOM   7928  N N     . PRO B 1 392 ? -29.748 60.905  38.343  1.00 26.87  ? 392  PRO B N     1 
ATOM   7929  C CA    . PRO B 1 392 ? -28.999 61.616  39.379  1.00 26.42  ? 392  PRO B CA    1 
ATOM   7930  C C     . PRO B 1 392 ? -27.539 61.203  39.508  1.00 25.91  ? 392  PRO B C     1 
ATOM   7931  O O     . PRO B 1 392 ? -26.684 62.069  39.670  1.00 25.62  ? 392  PRO B O     1 
ATOM   7932  C CB    . PRO B 1 392 ? -29.794 61.304  40.656  1.00 26.22  ? 392  PRO B CB    1 
ATOM   7933  C CG    . PRO B 1 392 ? -31.215 61.134  40.136  1.00 26.87  ? 392  PRO B CG    1 
ATOM   7934  C CD    . PRO B 1 392 ? -31.002 60.334  38.874  1.00 26.50  ? 392  PRO B CD    1 
ATOM   7935  N N     . GLU B 1 393 ? -27.271 59.901  39.427  1.00 25.98  ? 393  GLU B N     1 
ATOM   7936  C CA    . GLU B 1 393 ? -25.921 59.339  39.549  1.00 26.34  ? 393  GLU B CA    1 
ATOM   7937  C C     . GLU B 1 393 ? -25.022 59.836  38.429  1.00 25.30  ? 393  GLU B C     1 
ATOM   7938  O O     . GLU B 1 393 ? -23.860 60.175  38.658  1.00 25.83  ? 393  GLU B O     1 
ATOM   7939  C CB    . GLU B 1 393 ? -25.962 57.817  39.520  1.00 25.89  ? 393  GLU B CB    1 
ATOM   7940  C CG    . GLU B 1 393 ? -26.588 57.165  40.772  1.00 29.29  ? 393  GLU B CG    1 
ATOM   7941  C CD    . GLU B 1 393 ? -26.713 55.634  40.639  1.00 29.83  ? 393  GLU B CD    1 
ATOM   7942  O OE1   . GLU B 1 393 ? -26.806 54.942  41.694  1.00 33.10  ? 393  GLU B OE1   1 
ATOM   7943  O OE2   . GLU B 1 393 ? -26.713 55.125  39.474  1.00 33.85  ? 393  GLU B OE2   1 
ATOM   7944  N N     . ALA B 1 394 ? -25.568 59.883  37.216  1.00 23.90  ? 394  ALA B N     1 
ATOM   7945  C CA    . ALA B 1 394 ? -24.839 60.427  36.088  1.00 22.47  ? 394  ALA B CA    1 
ATOM   7946  C C     . ALA B 1 394 ? -24.592 61.927  36.271  1.00 21.43  ? 394  ALA B C     1 
ATOM   7947  O O     . ALA B 1 394 ? -23.490 62.412  36.022  1.00 21.39  ? 394  ALA B O     1 
ATOM   7948  C CB    . ALA B 1 394 ? -25.580 60.146  34.782  1.00 22.01  ? 394  ALA B CB    1 
ATOM   7949  N N     . TRP B 1 395 ? -25.618 62.649  36.704  1.00 20.02  ? 395  TRP B N     1 
ATOM   7950  C CA    . TRP B 1 395 ? -25.520 64.089  36.928  1.00 19.74  ? 395  TRP B CA    1 
ATOM   7951  C C     . TRP B 1 395 ? -24.443 64.388  37.986  1.00 19.80  ? 395  TRP B C     1 
ATOM   7952  O O     . TRP B 1 395 ? -23.603 65.263  37.813  1.00 19.38  ? 395  TRP B O     1 
ATOM   7953  C CB    . TRP B 1 395 ? -26.909 64.624  37.318  1.00 19.09  ? 395  TRP B CB    1 
ATOM   7954  C CG    . TRP B 1 395 ? -27.059 66.118  37.433  1.00 18.52  ? 395  TRP B CG    1 
ATOM   7955  C CD1   . TRP B 1 395 ? -27.767 66.958  36.594  1.00 17.52  ? 395  TRP B CD1   1 
ATOM   7956  C CD2   . TRP B 1 395 ? -26.522 66.954  38.470  1.00 16.44  ? 395  TRP B CD2   1 
ATOM   7957  N NE1   . TRP B 1 395 ? -27.690 68.259  37.052  1.00 15.97  ? 395  TRP B NE1   1 
ATOM   7958  C CE2   . TRP B 1 395 ? -26.925 68.280  38.192  1.00 16.79  ? 395  TRP B CE2   1 
ATOM   7959  C CE3   . TRP B 1 395 ? -25.725 66.709  39.594  1.00 16.62  ? 395  TRP B CE3   1 
ATOM   7960  C CZ2   . TRP B 1 395 ? -26.563 69.349  39.005  1.00 18.98  ? 395  TRP B CZ2   1 
ATOM   7961  C CZ3   . TRP B 1 395 ? -25.360 67.776  40.401  1.00 17.90  ? 395  TRP B CZ3   1 
ATOM   7962  C CH2   . TRP B 1 395 ? -25.783 69.078  40.103  1.00 18.23  ? 395  TRP B CH2   1 
ATOM   7963  N N     . GLU B 1 396 ? -24.465 63.633  39.075  1.00 20.58  ? 396  GLU B N     1 
ATOM   7964  C CA    . GLU B 1 396 ? -23.505 63.804  40.152  1.00 21.13  ? 396  GLU B CA    1 
ATOM   7965  C C     . GLU B 1 396 ? -22.066 63.534  39.697  1.00 21.09  ? 396  GLU B C     1 
ATOM   7966  O O     . GLU B 1 396 ? -21.151 64.271  40.083  1.00 21.70  ? 396  GLU B O     1 
ATOM   7967  C CB    . GLU B 1 396 ? -23.877 62.906  41.340  1.00 21.45  ? 396  GLU B CB    1 
ATOM   7968  C CG    . GLU B 1 396 ? -25.051 63.421  42.169  1.00 23.73  ? 396  GLU B CG    1 
ATOM   7969  C CD    . GLU B 1 396 ? -24.725 64.729  42.893  1.00 26.54  ? 396  GLU B CD    1 
ATOM   7970  O OE1   . GLU B 1 396 ? -23.517 65.012  43.120  1.00 28.13  ? 396  GLU B OE1   1 
ATOM   7971  O OE2   . GLU B 1 396 ? -25.677 65.473  43.235  1.00 27.50  ? 396  GLU B OE2   1 
ATOM   7972  N N     . TRP B 1 397 ? -21.872 62.484  38.889  1.00 20.04  ? 397  TRP B N     1 
ATOM   7973  C CA    . TRP B 1 397 ? -20.550 62.147  38.353  1.00 19.28  ? 397  TRP B CA    1 
ATOM   7974  C C     . TRP B 1 397 ? -20.035 63.253  37.416  1.00 18.99  ? 397  TRP B C     1 
ATOM   7975  O O     . TRP B 1 397 ? -18.891 63.676  37.511  1.00 20.27  ? 397  TRP B O     1 
ATOM   7976  C CB    . TRP B 1 397 ? -20.594 60.787  37.642  1.00 18.68  ? 397  TRP B CB    1 
ATOM   7977  C CG    . TRP B 1 397 ? -19.252 60.308  37.165  1.00 18.39  ? 397  TRP B CG    1 
ATOM   7978  C CD1   . TRP B 1 397 ? -18.397 59.473  37.826  1.00 18.15  ? 397  TRP B CD1   1 
ATOM   7979  C CD2   . TRP B 1 397 ? -18.613 60.634  35.924  1.00 18.53  ? 397  TRP B CD2   1 
ATOM   7980  N NE1   . TRP B 1 397 ? -17.262 59.261  37.080  1.00 16.71  ? 397  TRP B NE1   1 
ATOM   7981  C CE2   . TRP B 1 397 ? -17.363 59.963  35.910  1.00 17.63  ? 397  TRP B CE2   1 
ATOM   7982  C CE3   . TRP B 1 397 ? -18.966 61.441  34.828  1.00 16.50  ? 397  TRP B CE3   1 
ATOM   7983  C CZ2   . TRP B 1 397 ? -16.472 60.069  34.848  1.00 16.82  ? 397  TRP B CZ2   1 
ATOM   7984  C CZ3   . TRP B 1 397 ? -18.088 61.545  33.782  1.00 17.81  ? 397  TRP B CZ3   1 
ATOM   7985  C CH2   . TRP B 1 397 ? -16.844 60.867  33.797  1.00 17.91  ? 397  TRP B CH2   1 
ATOM   7986  N N     . TYR B 1 398 ? -20.876 63.721  36.513  1.00 18.14  ? 398  TYR B N     1 
ATOM   7987  C CA    . TYR B 1 398 ? -20.546 64.872  35.674  1.00 18.30  ? 398  TYR B CA    1 
ATOM   7988  C C     . TYR B 1 398 ? -20.136 66.087  36.535  1.00 18.62  ? 398  TYR B C     1 
ATOM   7989  O O     . TYR B 1 398 ? -19.085 66.707  36.321  1.00 19.07  ? 398  TYR B O     1 
ATOM   7990  C CB    . TYR B 1 398 ? -21.773 65.202  34.824  1.00 17.78  ? 398  TYR B CB    1 
ATOM   7991  C CG    . TYR B 1 398 ? -21.628 66.224  33.717  1.00 17.07  ? 398  TYR B CG    1 
ATOM   7992  C CD1   . TYR B 1 398 ? -20.526 66.240  32.868  1.00 16.94  ? 398  TYR B CD1   1 
ATOM   7993  C CD2   . TYR B 1 398 ? -22.655 67.125  33.472  1.00 17.06  ? 398  TYR B CD2   1 
ATOM   7994  C CE1   . TYR B 1 398 ? -20.426 67.187  31.829  1.00 16.72  ? 398  TYR B CE1   1 
ATOM   7995  C CE2   . TYR B 1 398 ? -22.581 68.054  32.446  1.00 17.35  ? 398  TYR B CE2   1 
ATOM   7996  C CZ    . TYR B 1 398 ? -21.470 68.083  31.626  1.00 16.62  ? 398  TYR B CZ    1 
ATOM   7997  O OH    . TYR B 1 398 ? -21.437 69.019  30.626  1.00 15.68  ? 398  TYR B OH    1 
ATOM   7998  N N     . TRP B 1 399 ? -20.971 66.409  37.513  1.00 18.61  ? 399  TRP B N     1 
ATOM   7999  C CA    . TRP B 1 399 ? -20.769 67.558  38.385  1.00 18.56  ? 399  TRP B CA    1 
ATOM   8000  C C     . TRP B 1 399 ? -19.471 67.451  39.172  1.00 18.76  ? 399  TRP B C     1 
ATOM   8001  O O     . TRP B 1 399 ? -18.780 68.450  39.347  1.00 19.38  ? 399  TRP B O     1 
ATOM   8002  C CB    . TRP B 1 399 ? -21.947 67.681  39.356  1.00 18.31  ? 399  TRP B CB    1 
ATOM   8003  C CG    . TRP B 1 399 ? -21.905 68.904  40.221  1.00 18.28  ? 399  TRP B CG    1 
ATOM   8004  C CD1   . TRP B 1 399 ? -22.225 70.165  39.844  1.00 18.36  ? 399  TRP B CD1   1 
ATOM   8005  C CD2   . TRP B 1 399 ? -21.549 68.975  41.616  1.00 17.34  ? 399  TRP B CD2   1 
ATOM   8006  N NE1   . TRP B 1 399 ? -22.082 71.023  40.895  1.00 19.55  ? 399  TRP B NE1   1 
ATOM   8007  C CE2   . TRP B 1 399 ? -21.676 70.326  42.003  1.00 17.47  ? 399  TRP B CE2   1 
ATOM   8008  C CE3   . TRP B 1 399 ? -21.139 68.025  42.575  1.00 17.02  ? 399  TRP B CE3   1 
ATOM   8009  C CZ2   . TRP B 1 399 ? -21.388 70.779  43.312  1.00 17.71  ? 399  TRP B CZ2   1 
ATOM   8010  C CZ3   . TRP B 1 399 ? -20.861 68.469  43.890  1.00 18.68  ? 399  TRP B CZ3   1 
ATOM   8011  C CH2   . TRP B 1 399 ? -20.991 69.840  44.240  1.00 17.47  ? 399  TRP B CH2   1 
ATOM   8012  N N     . LYS B 1 400 ? -19.143 66.247  39.639  1.00 18.16  ? 400  LYS B N     1 
ATOM   8013  C CA    . LYS B 1 400 ? -17.925 66.035  40.406  1.00 18.42  ? 400  LYS B CA    1 
ATOM   8014  C C     . LYS B 1 400 ? -16.654 65.827  39.548  1.00 18.33  ? 400  LYS B C     1 
ATOM   8015  O O     . LYS B 1 400 ? -15.598 66.431  39.816  1.00 17.81  ? 400  LYS B O     1 
ATOM   8016  C CB    . LYS B 1 400 ? -18.105 64.862  41.382  1.00 18.17  ? 400  LYS B CB    1 
ATOM   8017  C CG    . LYS B 1 400 ? -16.797 64.407  42.042  1.00 18.98  ? 400  LYS B CG    1 
ATOM   8018  C CD    . LYS B 1 400 ? -17.035 63.322  43.098  1.00 20.02  ? 400  LYS B CD    1 
ATOM   8019  C CE    . LYS B 1 400 ? -15.789 63.153  43.956  1.00 21.04  ? 400  LYS B CE    1 
ATOM   8020  N NZ    . LYS B 1 400 ? -16.124 62.587  45.288  1.00 24.92  ? 400  LYS B NZ    1 
ATOM   8021  N N     . LYS B 1 401 ? -16.753 64.970  38.534  1.00 18.07  ? 401  LYS B N     1 
ATOM   8022  C CA    . LYS B 1 401 ? -15.564 64.521  37.803  1.00 18.48  ? 401  LYS B CA    1 
ATOM   8023  C C     . LYS B 1 401 ? -15.151 65.515  36.735  1.00 18.67  ? 401  LYS B C     1 
ATOM   8024  O O     . LYS B 1 401 ? -13.970 65.828  36.574  1.00 19.13  ? 401  LYS B O     1 
ATOM   8025  C CB    . LYS B 1 401 ? -15.802 63.137  37.166  1.00 18.14  ? 401  LYS B CB    1 
ATOM   8026  C CG    . LYS B 1 401 ? -15.989 62.033  38.186  1.00 17.01  ? 401  LYS B CG    1 
ATOM   8027  C CD    . LYS B 1 401 ? -14.738 61.831  38.979  1.00 14.93  ? 401  LYS B CD    1 
ATOM   8028  C CE    . LYS B 1 401 ? -14.979 60.915  40.177  1.00 14.87  ? 401  LYS B CE    1 
ATOM   8029  N NZ    . LYS B 1 401 ? -13.655 60.545  40.784  1.00 13.54  ? 401  LYS B NZ    1 
ATOM   8030  N N     . ILE B 1 402 ? -16.132 66.019  36.005  1.00 18.83  ? 402  ILE B N     1 
ATOM   8031  C CA    . ILE B 1 402 ? -15.829 66.976  34.968  1.00 18.97  ? 402  ILE B CA    1 
ATOM   8032  C C     . ILE B 1 402 ? -15.802 68.391  35.551  1.00 19.35  ? 402  ILE B C     1 
ATOM   8033  O O     . ILE B 1 402 ? -14.899 69.171  35.247  1.00 19.14  ? 402  ILE B O     1 
ATOM   8034  C CB    . ILE B 1 402 ? -16.805 66.871  33.778  1.00 18.48  ? 402  ILE B CB    1 
ATOM   8035  C CG1   . ILE B 1 402 ? -16.873 65.428  33.256  1.00 17.89  ? 402  ILE B CG1   1 
ATOM   8036  C CG2   . ILE B 1 402 ? -16.402 67.877  32.679  1.00 18.11  ? 402  ILE B CG2   1 
ATOM   8037  C CD1   . ILE B 1 402 ? -15.512 64.802  32.873  1.00 15.46  ? 402  ILE B CD1   1 
ATOM   8038  N N     . GLY B 1 403 ? -16.778 68.696  36.400  1.00 19.57  ? 403  GLY B N     1 
ATOM   8039  C CA    . GLY B 1 403 ? -16.920 70.038  36.941  1.00 20.76  ? 403  GLY B CA    1 
ATOM   8040  C C     . GLY B 1 403 ? -16.127 70.314  38.199  1.00 21.46  ? 403  GLY B C     1 
ATOM   8041  O O     . GLY B 1 403 ? -16.061 71.471  38.650  1.00 22.31  ? 403  GLY B O     1 
ATOM   8042  N N     . LYS B 1 404 ? -15.517 69.266  38.764  1.00 21.35  ? 404  LYS B N     1 
ATOM   8043  C CA    . LYS B 1 404 ? -14.757 69.377  40.015  1.00 21.27  ? 404  LYS B CA    1 
ATOM   8044  C C     . LYS B 1 404 ? -15.588 70.011  41.144  1.00 21.72  ? 404  LYS B C     1 
ATOM   8045  O O     . LYS B 1 404 ? -15.051 70.699  42.029  1.00 21.71  ? 404  LYS B O     1 
ATOM   8046  C CB    . LYS B 1 404 ? -13.432 70.115  39.800  1.00 21.20  ? 404  LYS B CB    1 
ATOM   8047  C CG    . LYS B 1 404 ? -12.457 69.380  38.886  1.00 20.86  ? 404  LYS B CG    1 
ATOM   8048  C CD    . LYS B 1 404 ? -11.232 70.223  38.508  1.00 20.86  ? 404  LYS B CD    1 
ATOM   8049  C CE    . LYS B 1 404 ? -10.153 70.111  39.554  1.00 21.77  ? 404  LYS B CE    1 
ATOM   8050  N NZ    . LYS B 1 404 ? -8.801  70.368  38.987  1.00 22.66  ? 404  LYS B NZ    1 
ATOM   8051  N N     . GLU B 1 405 ? -16.900 69.772  41.095  1.00 21.78  ? 405  GLU B N     1 
ATOM   8052  C CA    . GLU B 1 405 ? -17.817 70.206  42.133  1.00 22.96  ? 405  GLU B CA    1 
ATOM   8053  C C     . GLU B 1 405 ? -17.880 71.725  42.210  1.00 22.96  ? 405  GLU B C     1 
ATOM   8054  O O     . GLU B 1 405 ? -18.314 72.285  43.208  1.00 22.35  ? 405  GLU B O     1 
ATOM   8055  C CB    . GLU B 1 405 ? -17.393 69.637  43.497  1.00 23.58  ? 405  GLU B CB    1 
ATOM   8056  C CG    . GLU B 1 405 ? -17.195 68.134  43.518  1.00 26.00  ? 405  GLU B CG    1 
ATOM   8057  C CD    . GLU B 1 405 ? -16.651 67.660  44.840  1.00 30.06  ? 405  GLU B CD    1 
ATOM   8058  O OE1   . GLU B 1 405 ? -15.466 67.261  44.906  1.00 31.50  ? 405  GLU B OE1   1 
ATOM   8059  O OE2   . GLU B 1 405 ? -17.407 67.716  45.828  1.00 32.72  ? 405  GLU B OE2   1 
ATOM   8060  N N     . LYS B 1 406 ? -17.453 72.391  41.142  1.00 23.26  ? 406  LYS B N     1 
ATOM   8061  C CA    . LYS B 1 406 ? -17.361 73.842  41.150  1.00 23.43  ? 406  LYS B CA    1 
ATOM   8062  C C     . LYS B 1 406 ? -18.336 74.443  40.151  1.00 22.03  ? 406  LYS B C     1 
ATOM   8063  O O     . LYS B 1 406 ? -18.508 75.649  40.104  1.00 21.56  ? 406  LYS B O     1 
ATOM   8064  C CB    . LYS B 1 406 ? -15.917 74.287  40.801  1.00 23.83  ? 406  LYS B CB    1 
ATOM   8065  C CG    . LYS B 1 406 ? -14.901 74.249  41.959  1.00 25.87  ? 406  LYS B CG    1 
ATOM   8066  C CD    . LYS B 1 406 ? -13.495 74.699  41.494  1.00 25.06  ? 406  LYS B CD    1 
ATOM   8067  C CE    . LYS B 1 406 ? -12.696 75.334  42.647  1.00 30.00  ? 406  LYS B CE    1 
ATOM   8068  N NZ    . LYS B 1 406 ? -11.164 75.397  42.481  1.00 29.82  ? 406  LYS B NZ    1 
ATOM   8069  N N     . CYS B 1 407 ? -18.953 73.600  39.332  1.00 21.49  ? 407  CYS B N     1 
ATOM   8070  C CA    . CYS B 1 407 ? -19.656 74.092  38.147  1.00 20.76  ? 407  CYS B CA    1 
ATOM   8071  C C     . CYS B 1 407 ? -21.122 73.758  38.141  1.00 20.69  ? 407  CYS B C     1 
ATOM   8072  O O     . CYS B 1 407 ? -21.483 72.582  38.158  1.00 21.01  ? 407  CYS B O     1 
ATOM   8073  C CB    . CYS B 1 407 ? -19.038 73.536  36.879  1.00 20.67  ? 407  CYS B CB    1 
ATOM   8074  S SG    . CYS B 1 407 ? -17.353 74.014  36.625  1.00 20.29  ? 407  CYS B SG    1 
ATOM   8075  N N     . PRO B 1 408 ? -21.976 74.794  38.118  1.00 20.28  ? 408  PRO B N     1 
ATOM   8076  C CA    . PRO B 1 408 ? -23.410 74.571  37.874  1.00 20.14  ? 408  PRO B CA    1 
ATOM   8077  C C     . PRO B 1 408 ? -23.625 73.711  36.622  1.00 20.10  ? 408  PRO B C     1 
ATOM   8078  O O     . PRO B 1 408 ? -22.923 73.877  35.619  1.00 20.20  ? 408  PRO B O     1 
ATOM   8079  C CB    . PRO B 1 408 ? -23.957 75.990  37.646  1.00 19.56  ? 408  PRO B CB    1 
ATOM   8080  C CG    . PRO B 1 408 ? -22.998 76.889  38.412  1.00 20.49  ? 408  PRO B CG    1 
ATOM   8081  C CD    . PRO B 1 408 ? -21.643 76.219  38.319  1.00 19.91  ? 408  PRO B CD    1 
ATOM   8082  N N     . VAL B 1 409 ? -24.581 72.797  36.689  1.00 19.78  ? 409  VAL B N     1 
ATOM   8083  C CA    . VAL B 1 409 ? -24.983 72.029  35.525  1.00 19.45  ? 409  VAL B CA    1 
ATOM   8084  C C     . VAL B 1 409 ? -26.322 72.529  35.038  1.00 19.82  ? 409  VAL B C     1 
ATOM   8085  O O     . VAL B 1 409 ? -27.322 72.451  35.767  1.00 19.79  ? 409  VAL B O     1 
ATOM   8086  C CB    . VAL B 1 409 ? -25.117 70.518  35.861  1.00 19.69  ? 409  VAL B CB    1 
ATOM   8087  C CG1   . VAL B 1 409 ? -25.669 69.770  34.661  1.00 17.92  ? 409  VAL B CG1   1 
ATOM   8088  C CG2   . VAL B 1 409 ? -23.758 69.919  36.342  1.00 18.51  ? 409  VAL B CG2   1 
ATOM   8089  N N     . VAL B 1 410 ? -26.367 73.043  33.810  1.00 20.46  ? 410  VAL B N     1 
ATOM   8090  C CA    . VAL B 1 410 ? -27.661 73.402  33.216  1.00 20.58  ? 410  VAL B CA    1 
ATOM   8091  C C     . VAL B 1 410 ? -28.225 72.291  32.324  1.00 21.01  ? 410  VAL B C     1 
ATOM   8092  O O     . VAL B 1 410 ? -27.775 72.088  31.183  1.00 21.28  ? 410  VAL B O     1 
ATOM   8093  C CB    . VAL B 1 410 ? -27.662 74.794  32.513  1.00 20.74  ? 410  VAL B CB    1 
ATOM   8094  C CG1   . VAL B 1 410 ? -27.379 75.909  33.540  1.00 20.38  ? 410  VAL B CG1   1 
ATOM   8095  C CG2   . VAL B 1 410 ? -26.675 74.851  31.341  1.00 19.70  ? 410  VAL B CG2   1 
ATOM   8096  N N     . ASP B 1 411 ? -29.196 71.568  32.885  1.00 21.01  ? 411  ASP B N     1 
ATOM   8097  C CA    . ASP B 1 411 ? -29.994 70.571  32.176  1.00 20.97  ? 411  ASP B CA    1 
ATOM   8098  C C     . ASP B 1 411 ? -31.092 71.250  31.348  1.00 20.73  ? 411  ASP B C     1 
ATOM   8099  O O     . ASP B 1 411 ? -32.127 71.630  31.877  1.00 19.70  ? 411  ASP B O     1 
ATOM   8100  C CB    . ASP B 1 411 ? -30.634 69.602  33.180  1.00 21.12  ? 411  ASP B CB    1 
ATOM   8101  C CG    . ASP B 1 411 ? -31.222 68.364  32.506  1.00 22.42  ? 411  ASP B CG    1 
ATOM   8102  O OD1   . ASP B 1 411 ? -31.249 68.316  31.246  1.00 20.56  ? 411  ASP B OD1   1 
ATOM   8103  O OD2   . ASP B 1 411 ? -31.651 67.437  33.237  1.00 24.13  ? 411  ASP B OD2   1 
ATOM   8104  N N     . THR B 1 412 ? -30.863 71.385  30.046  1.00 20.94  ? 412  THR B N     1 
ATOM   8105  C CA    . THR B 1 412 ? -31.748 72.185  29.200  1.00 21.15  ? 412  THR B CA    1 
ATOM   8106  C C     . THR B 1 412 ? -32.711 71.291  28.469  1.00 21.23  ? 412  THR B C     1 
ATOM   8107  O O     . THR B 1 412 ? -32.289 70.487  27.614  1.00 22.05  ? 412  THR B O     1 
ATOM   8108  C CB    . THR B 1 412 ? -30.973 73.005  28.146  1.00 21.24  ? 412  THR B CB    1 
ATOM   8109  O OG1   . THR B 1 412 ? -30.269 72.117  27.260  1.00 20.57  ? 412  THR B OG1   1 
ATOM   8110  C CG2   . THR B 1 412 ? -29.978 73.975  28.825  1.00 21.29  ? 412  THR B CG2   1 
ATOM   8111  N N     . TRP B 1 413 ? -33.990 71.405  28.825  1.00 20.58  ? 413  TRP B N     1 
ATOM   8112  C CA    . TRP B 1 413 ? -35.043 70.729  28.095  1.00 20.77  ? 413  TRP B CA    1 
ATOM   8113  C C     . TRP B 1 413 ? -35.598 71.638  27.001  1.00 20.67  ? 413  TRP B C     1 
ATOM   8114  O O     . TRP B 1 413 ? -35.950 72.789  27.266  1.00 20.91  ? 413  TRP B O     1 
ATOM   8115  C CB    . TRP B 1 413 ? -36.176 70.196  28.997  1.00 21.02  ? 413  TRP B CB    1 
ATOM   8116  C CG    . TRP B 1 413 ? -37.224 69.558  28.143  1.00 21.93  ? 413  TRP B CG    1 
ATOM   8117  C CD1   . TRP B 1 413 ? -37.227 68.275  27.678  1.00 22.59  ? 413  TRP B CD1   1 
ATOM   8118  C CD2   . TRP B 1 413 ? -38.371 70.198  27.558  1.00 23.05  ? 413  TRP B CD2   1 
ATOM   8119  N NE1   . TRP B 1 413 ? -38.309 68.067  26.867  1.00 22.35  ? 413  TRP B NE1   1 
ATOM   8120  C CE2   . TRP B 1 413 ? -39.025 69.231  26.764  1.00 23.13  ? 413  TRP B CE2   1 
ATOM   8121  C CE3   . TRP B 1 413 ? -38.915 71.497  27.633  1.00 23.64  ? 413  TRP B CE3   1 
ATOM   8122  C CZ2   . TRP B 1 413 ? -40.209 69.518  26.041  1.00 23.23  ? 413  TRP B CZ2   1 
ATOM   8123  C CZ3   . TRP B 1 413 ? -40.101 71.778  26.922  1.00 21.82  ? 413  TRP B CZ3   1 
ATOM   8124  C CH2   . TRP B 1 413 ? -40.724 70.793  26.137  1.00 22.51  ? 413  TRP B CH2   1 
ATOM   8125  N N     . TRP B 1 414 ? -35.677 71.087  25.787  1.00 20.27  ? 414  TRP B N     1 
ATOM   8126  C CA    . TRP B 1 414 ? -36.278 71.726  24.630  1.00 20.84  ? 414  TRP B CA    1 
ATOM   8127  C C     . TRP B 1 414 ? -36.309 70.732  23.445  1.00 21.34  ? 414  TRP B C     1 
ATOM   8128  O O     . TRP B 1 414 ? -35.929 69.557  23.592  1.00 20.85  ? 414  TRP B O     1 
ATOM   8129  C CB    . TRP B 1 414 ? -35.543 73.024  24.258  1.00 20.67  ? 414  TRP B CB    1 
ATOM   8130  C CG    . TRP B 1 414 ? -34.087 72.838  23.912  1.00 21.16  ? 414  TRP B CG    1 
ATOM   8131  C CD1   . TRP B 1 414 ? -33.082 72.406  24.753  1.00 21.14  ? 414  TRP B CD1   1 
ATOM   8132  C CD2   . TRP B 1 414 ? -33.458 73.085  22.640  1.00 21.68  ? 414  TRP B CD2   1 
ATOM   8133  N NE1   . TRP B 1 414 ? -31.876 72.379  24.082  1.00 20.99  ? 414  TRP B NE1   1 
ATOM   8134  C CE2   . TRP B 1 414 ? -32.072 72.789  22.790  1.00 20.44  ? 414  TRP B CE2   1 
ATOM   8135  C CE3   . TRP B 1 414 ? -33.924 73.533  21.395  1.00 21.15  ? 414  TRP B CE3   1 
ATOM   8136  C CZ2   . TRP B 1 414 ? -31.160 72.916  21.742  1.00 21.04  ? 414  TRP B CZ2   1 
ATOM   8137  C CZ3   . TRP B 1 414 ? -33.008 73.669  20.349  1.00 21.41  ? 414  TRP B CZ3   1 
ATOM   8138  C CH2   . TRP B 1 414 ? -31.639 73.365  20.532  1.00 21.64  ? 414  TRP B CH2   1 
ATOM   8139  N N     . GLN B 1 415 ? -36.765 71.201  22.274  1.00 21.73  ? 415  GLN B N     1 
ATOM   8140  C CA    . GLN B 1 415 ? -36.953 70.323  21.105  1.00 21.84  ? 415  GLN B CA    1 
ATOM   8141  C C     . GLN B 1 415 ? -36.676 71.105  19.838  1.00 21.90  ? 415  GLN B C     1 
ATOM   8142  O O     . GLN B 1 415 ? -36.596 72.347  19.865  1.00 22.20  ? 415  GLN B O     1 
ATOM   8143  C CB    . GLN B 1 415 ? -38.397 69.810  21.021  1.00 21.81  ? 415  GLN B CB    1 
ATOM   8144  C CG    . GLN B 1 415 ? -39.048 69.377  22.310  1.00 21.97  ? 415  GLN B CG    1 
ATOM   8145  C CD    . GLN B 1 415 ? -40.512 69.007  22.108  1.00 22.51  ? 415  GLN B CD    1 
ATOM   8146  O OE1   . GLN B 1 415 ? -41.338 69.867  21.802  1.00 21.43  ? 415  GLN B OE1   1 
ATOM   8147  N NE2   . GLN B 1 415 ? -40.833 67.722  22.269  1.00 21.60  ? 415  GLN B NE2   1 
ATOM   8148  N N     . THR B 1 416 ? -36.570 70.384  18.722  1.00 21.88  ? 416  THR B N     1 
ATOM   8149  C CA    . THR B 1 416 ? -36.325 70.992  17.416  1.00 22.00  ? 416  THR B CA    1 
ATOM   8150  C C     . THR B 1 416 ? -37.398 72.031  17.195  1.00 22.20  ? 416  THR B C     1 
ATOM   8151  O O     . THR B 1 416 ? -37.102 73.127  16.714  1.00 21.92  ? 416  THR B O     1 
ATOM   8152  C CB    . THR B 1 416 ? -36.334 69.938  16.270  1.00 22.02  ? 416  THR B CB    1 
ATOM   8153  O OG1   . THR B 1 416 ? -35.450 68.862  16.613  1.00 22.29  ? 416  THR B OG1   1 
ATOM   8154  C CG2   . THR B 1 416 ? -35.881 70.532  14.951  1.00 20.49  ? 416  THR B CG2   1 
ATOM   8155  N N     . GLU B 1 417 ? -38.627 71.705  17.609  1.00 21.97  ? 417  GLU B N     1 
ATOM   8156  C CA    . GLU B 1 417 ? -39.778 72.569  17.327  1.00 22.51  ? 417  GLU B CA    1 
ATOM   8157  C C     . GLU B 1 417 ? -39.828 73.838  18.201  1.00 22.80  ? 417  GLU B C     1 
ATOM   8158  O O     . GLU B 1 417 ? -40.684 74.700  17.995  1.00 23.71  ? 417  GLU B O     1 
ATOM   8159  C CB    . GLU B 1 417 ? -41.108 71.790  17.437  1.00 22.40  ? 417  GLU B CB    1 
ATOM   8160  C CG    . GLU B 1 417 ? -41.226 70.569  16.524  1.00 22.80  ? 417  GLU B CG    1 
ATOM   8161  C CD    . GLU B 1 417 ? -40.689 69.268  17.151  1.00 25.41  ? 417  GLU B CD    1 
ATOM   8162  O OE1   . GLU B 1 417 ? -39.811 69.329  18.069  1.00 24.39  ? 417  GLU B OE1   1 
ATOM   8163  O OE2   . GLU B 1 417 ? -41.163 68.176  16.720  1.00 24.10  ? 417  GLU B OE2   1 
ATOM   8164  N N     . THR B 1 418 ? -38.935 73.946  19.179  1.00 22.13  ? 418  THR B N     1 
ATOM   8165  C CA    . THR B 1 418 ? -38.952 75.087  20.081  1.00 21.73  ? 418  THR B CA    1 
ATOM   8166  C C     . THR B 1 418 ? -37.780 76.049  19.832  1.00 21.90  ? 418  THR B C     1 
ATOM   8167  O O     . THR B 1 418 ? -37.714 77.118  20.449  1.00 21.77  ? 418  THR B O     1 
ATOM   8168  C CB    . THR B 1 418 ? -38.988 74.661  21.570  1.00 21.55  ? 418  THR B CB    1 
ATOM   8169  O OG1   . THR B 1 418 ? -37.694 74.212  21.984  1.00 21.93  ? 418  THR B OG1   1 
ATOM   8170  C CG2   . THR B 1 418 ? -40.031 73.566  21.811  1.00 20.67  ? 418  THR B CG2   1 
ATOM   8171  N N     . GLY B 1 419 ? -36.872 75.666  18.932  1.00 21.47  ? 419  GLY B N     1 
ATOM   8172  C CA    . GLY B 1 419 ? -35.767 76.517  18.521  1.00 21.64  ? 419  GLY B CA    1 
ATOM   8173  C C     . GLY B 1 419 ? -34.707 76.784  19.587  1.00 22.12  ? 419  GLY B C     1 
ATOM   8174  O O     . GLY B 1 419 ? -33.515 76.910  19.251  1.00 21.99  ? 419  GLY B O     1 
ATOM   8175  N N     . GLY B 1 420 ? -35.135 76.889  20.858  1.00 21.80  ? 420  GLY B N     1 
ATOM   8176  C CA    . GLY B 1 420 ? -34.234 77.136  21.977  1.00 21.43  ? 420  GLY B CA    1 
ATOM   8177  C C     . GLY B 1 420 ? -34.732 76.612  23.308  1.00 21.67  ? 420  GLY B C     1 
ATOM   8178  O O     . GLY B 1 420 ? -35.860 76.143  23.431  1.00 21.68  ? 420  GLY B O     1 
ATOM   8179  N N     . PHE B 1 421 ? -33.874 76.717  24.320  1.00 22.07  ? 421  PHE B N     1 
ATOM   8180  C CA    . PHE B 1 421 ? -34.169 76.273  25.698  1.00 21.73  ? 421  PHE B CA    1 
ATOM   8181  C C     . PHE B 1 421 ? -35.552 76.668  26.181  1.00 22.18  ? 421  PHE B C     1 
ATOM   8182  O O     . PHE B 1 421 ? -36.032 77.773  25.917  1.00 22.34  ? 421  PHE B O     1 
ATOM   8183  C CB    . PHE B 1 421 ? -33.129 76.790  26.689  1.00 20.74  ? 421  PHE B CB    1 
ATOM   8184  C CG    . PHE B 1 421 ? -31.707 76.471  26.308  1.00 19.96  ? 421  PHE B CG    1 
ATOM   8185  C CD1   . PHE B 1 421 ? -30.658 77.289  26.753  1.00 17.79  ? 421  PHE B CD1   1 
ATOM   8186  C CD2   . PHE B 1 421 ? -31.408 75.375  25.504  1.00 18.46  ? 421  PHE B CD2   1 
ATOM   8187  C CE1   . PHE B 1 421 ? -29.348 77.008  26.431  1.00 16.05  ? 421  PHE B CE1   1 
ATOM   8188  C CE2   . PHE B 1 421 ? -30.076 75.086  25.172  1.00 18.16  ? 421  PHE B CE2   1 
ATOM   8189  C CZ    . PHE B 1 421 ? -29.052 75.902  25.638  1.00 17.54  ? 421  PHE B CZ    1 
ATOM   8190  N N     . MET B 1 422 ? -36.181 75.747  26.905  1.00 22.76  ? 422  MET B N     1 
ATOM   8191  C CA    . MET B 1 422 ? -37.553 75.910  27.327  1.00 22.65  ? 422  MET B CA    1 
ATOM   8192  C C     . MET B 1 422 ? -37.658 75.783  28.828  1.00 22.51  ? 422  MET B C     1 
ATOM   8193  O O     . MET B 1 422 ? -38.233 76.659  29.493  1.00 22.86  ? 422  MET B O     1 
ATOM   8194  C CB    . MET B 1 422 ? -38.444 74.876  26.643  1.00 22.79  ? 422  MET B CB    1 
ATOM   8195  C CG    . MET B 1 422 ? -38.530 75.061  25.156  1.00 23.24  ? 422  MET B CG    1 
ATOM   8196  S SD    . MET B 1 422 ? -39.289 76.626  24.690  1.00 25.90  ? 422  MET B SD    1 
ATOM   8197  C CE    . MET B 1 422 ? -41.030 76.136  24.812  1.00 22.14  ? 422  MET B CE    1 
ATOM   8198  N N     . ILE B 1 423 ? -37.150 74.671  29.355  1.00 22.15  ? 423  ILE B N     1 
ATOM   8199  C CA    . ILE B 1 423 ? -37.100 74.474  30.795  1.00 21.17  ? 423  ILE B CA    1 
ATOM   8200  C C     . ILE B 1 423 ? -35.660 74.178  31.114  1.00 21.76  ? 423  ILE B C     1 
ATOM   8201  O O     . ILE B 1 423 ? -35.057 73.250  30.563  1.00 21.70  ? 423  ILE B O     1 
ATOM   8202  C CB    . ILE B 1 423 ? -38.018 73.336  31.294  1.00 21.46  ? 423  ILE B CB    1 
ATOM   8203  C CG1   . ILE B 1 423 ? -39.461 73.527  30.765  1.00 20.92  ? 423  ILE B CG1   1 
ATOM   8204  C CG2   . ILE B 1 423 ? -37.949 73.256  32.830  1.00 19.31  ? 423  ILE B CG2   1 
ATOM   8205  C CD1   . ILE B 1 423 ? -40.471 72.444  31.187  1.00 20.01  ? 423  ILE B CD1   1 
ATOM   8206  N N     . THR B 1 424 ? -35.106 74.988  32.001  1.00 22.10  ? 424  THR B N     1 
ATOM   8207  C CA    . THR B 1 424 ? -33.684 75.011  32.224  1.00 22.31  ? 424  THR B CA    1 
ATOM   8208  C C     . THR B 1 424 ? -33.350 75.773  33.522  1.00 23.01  ? 424  THR B C     1 
ATOM   8209  O O     . THR B 1 424 ? -34.063 76.695  33.914  1.00 22.91  ? 424  THR B O     1 
ATOM   8210  C CB    . THR B 1 424 ? -32.960 75.614  30.974  1.00 22.30  ? 424  THR B CB    1 
ATOM   8211  O OG1   . THR B 1 424 ? -31.556 75.766  31.236  1.00 23.07  ? 424  THR B OG1   1 
ATOM   8212  C CG2   . THR B 1 424 ? -33.569 76.946  30.559  1.00 20.21  ? 424  THR B CG2   1 
ATOM   8213  N N     . PRO B 1 425 ? -32.266 75.370  34.210  1.00 23.61  ? 425  PRO B N     1 
ATOM   8214  C CA    . PRO B 1 425 ? -31.791 76.253  35.279  1.00 23.66  ? 425  PRO B CA    1 
ATOM   8215  C C     . PRO B 1 425 ? -31.076 77.444  34.657  1.00 23.93  ? 425  PRO B C     1 
ATOM   8216  O O     . PRO B 1 425 ? -30.699 77.401  33.468  1.00 23.58  ? 425  PRO B O     1 
ATOM   8217  C CB    . PRO B 1 425 ? -30.775 75.382  36.046  1.00 23.72  ? 425  PRO B CB    1 
ATOM   8218  C CG    . PRO B 1 425 ? -30.890 73.973  35.446  1.00 23.15  ? 425  PRO B CG    1 
ATOM   8219  C CD    . PRO B 1 425 ? -31.448 74.148  34.081  1.00 23.26  ? 425  PRO B CD    1 
ATOM   8220  N N     . LEU B 1 426 ? -30.927 78.504  35.443  1.00 23.75  ? 426  LEU B N     1 
ATOM   8221  C CA    . LEU B 1 426 ? -30.007 79.580  35.120  1.00 23.72  ? 426  LEU B CA    1 
ATOM   8222  C C     . LEU B 1 426 ? -28.982 79.514  36.236  1.00 23.81  ? 426  LEU B C     1 
ATOM   8223  O O     . LEU B 1 426 ? -29.352 79.343  37.408  1.00 23.80  ? 426  LEU B O     1 
ATOM   8224  C CB    . LEU B 1 426 ? -30.718 80.939  35.072  1.00 23.91  ? 426  LEU B CB    1 
ATOM   8225  C CG    . LEU B 1 426 ? -31.305 81.402  33.720  1.00 24.32  ? 426  LEU B CG    1 
ATOM   8226  C CD1   . LEU B 1 426 ? -32.526 80.597  33.263  1.00 22.54  ? 426  LEU B CD1   1 
ATOM   8227  C CD2   . LEU B 1 426 ? -31.651 82.874  33.763  1.00 23.82  ? 426  LEU B CD2   1 
ATOM   8228  N N     . PRO B 1 427 ? -27.688 79.622  35.887  1.00 23.88  ? 427  PRO B N     1 
ATOM   8229  C CA    . PRO B 1 427 ? -26.622 79.275  36.841  1.00 23.88  ? 427  PRO B CA    1 
ATOM   8230  C C     . PRO B 1 427 ? -26.597 80.125  38.111  1.00 24.11  ? 427  PRO B C     1 
ATOM   8231  O O     . PRO B 1 427 ? -26.301 79.595  39.184  1.00 24.46  ? 427  PRO B O     1 
ATOM   8232  C CB    . PRO B 1 427 ? -25.341 79.473  36.028  1.00 23.83  ? 427  PRO B CB    1 
ATOM   8233  C CG    . PRO B 1 427 ? -25.779 79.466  34.616  1.00 23.61  ? 427  PRO B CG    1 
ATOM   8234  C CD    . PRO B 1 427 ? -27.138 80.061  34.596  1.00 23.19  ? 427  PRO B CD    1 
ATOM   8235  N N     . GLY B 1 428 ? -26.918 81.413  38.003  1.00 23.73  ? 428  GLY B N     1 
ATOM   8236  C CA    . GLY B 1 428 ? -26.866 82.300  39.167  1.00 24.35  ? 428  GLY B CA    1 
ATOM   8237  C C     . GLY B 1 428 ? -28.210 82.615  39.804  1.00 24.73  ? 428  GLY B C     1 
ATOM   8238  O O     . GLY B 1 428 ? -28.281 83.465  40.692  1.00 24.88  ? 428  GLY B O     1 
ATOM   8239  N N     . ALA B 1 429 ? -29.266 81.934  39.347  1.00 24.67  ? 429  ALA B N     1 
ATOM   8240  C CA    . ALA B 1 429 ? -30.629 82.202  39.796  1.00 24.71  ? 429  ALA B CA    1 
ATOM   8241  C C     . ALA B 1 429 ? -31.336 80.999  40.406  1.00 24.94  ? 429  ALA B C     1 
ATOM   8242  O O     . ALA B 1 429 ? -32.175 81.156  41.302  1.00 25.75  ? 429  ALA B O     1 
ATOM   8243  C CB    . ALA B 1 429 ? -31.451 82.754  38.664  1.00 24.39  ? 429  ALA B CB    1 
ATOM   8244  N N     . ILE B 1 430 ? -31.006 79.804  39.930  1.00 24.71  ? 430  ILE B N     1 
ATOM   8245  C CA    . ILE B 1 430 ? -31.781 78.606  40.283  1.00 24.44  ? 430  ILE B CA    1 
ATOM   8246  C C     . ILE B 1 430 ? -30.921 77.535  40.943  1.00 24.50  ? 430  ILE B C     1 
ATOM   8247  O O     . ILE B 1 430 ? -29.949 77.063  40.345  1.00 24.90  ? 430  ILE B O     1 
ATOM   8248  C CB    . ILE B 1 430 ? -32.524 78.013  39.028  1.00 24.35  ? 430  ILE B CB    1 
ATOM   8249  C CG1   . ILE B 1 430 ? -33.567 79.022  38.516  1.00 24.49  ? 430  ILE B CG1   1 
ATOM   8250  C CG2   . ILE B 1 430 ? -33.176 76.677  39.349  1.00 22.80  ? 430  ILE B CG2   1 
ATOM   8251  C CD1   . ILE B 1 430 ? -34.021 78.825  37.076  1.00 23.97  ? 430  ILE B CD1   1 
ATOM   8252  N N     . GLU B 1 431 ? -31.292 77.166  42.168  1.00 23.78  ? 431  GLU B N     1 
ATOM   8253  C CA    . GLU B 1 431 ? -30.693 76.042  42.878  1.00 24.06  ? 431  GLU B CA    1 
ATOM   8254  C C     . GLU B 1 431 ? -30.996 74.730  42.166  1.00 23.37  ? 431  GLU B C     1 
ATOM   8255  O O     . GLU B 1 431 ? -32.102 74.519  41.682  1.00 23.71  ? 431  GLU B O     1 
ATOM   8256  C CB    . GLU B 1 431 ? -31.170 75.990  44.337  1.00 23.59  ? 431  GLU B CB    1 
ATOM   8257  C CG    . GLU B 1 431 ? -30.937 77.301  45.098  1.00 27.08  ? 431  GLU B CG    1 
ATOM   8258  C CD    . GLU B 1 431 ? -30.751 77.104  46.589  1.00 29.09  ? 431  GLU B CD    1 
ATOM   8259  O OE1   . GLU B 1 431 ? -31.556 76.384  47.206  1.00 31.10  ? 431  GLU B OE1   1 
ATOM   8260  O OE2   . GLU B 1 431 ? -29.784 77.662  47.145  1.00 31.69  ? 431  GLU B OE2   1 
ATOM   8261  N N     . LEU B 1 432 ? -30.018 73.836  42.148  1.00 23.10  ? 432  LEU B N     1 
ATOM   8262  C CA    . LEU B 1 432 ? -30.040 72.688  41.250  1.00 22.30  ? 432  LEU B CA    1 
ATOM   8263  C C     . LEU B 1 432 ? -30.438 71.410  41.931  1.00 22.24  ? 432  LEU B C     1 
ATOM   8264  O O     . LEU B 1 432 ? -30.036 71.155  43.056  1.00 22.19  ? 432  LEU B O     1 
ATOM   8265  C CB    . LEU B 1 432 ? -28.657 72.490  40.638  1.00 21.68  ? 432  LEU B CB    1 
ATOM   8266  C CG    . LEU B 1 432 ? -27.986 73.589  39.814  1.00 21.37  ? 432  LEU B CG    1 
ATOM   8267  C CD1   . LEU B 1 432 ? -26.708 73.015  39.168  1.00 17.70  ? 432  LEU B CD1   1 
ATOM   8268  C CD2   . LEU B 1 432 ? -28.941 74.194  38.760  1.00 20.80  ? 432  LEU B CD2   1 
ATOM   8269  N N     . LYS B 1 433 ? -31.211 70.590  41.230  1.00 22.32  ? 433  LYS B N     1 
ATOM   8270  C CA    . LYS B 1 433 ? -31.488 69.229  41.687  1.00 22.31  ? 433  LYS B CA    1 
ATOM   8271  C C     . LYS B 1 433 ? -31.012 68.237  40.614  1.00 22.40  ? 433  LYS B C     1 
ATOM   8272  O O     . LYS B 1 433 ? -31.265 68.426  39.433  1.00 21.94  ? 433  LYS B O     1 
ATOM   8273  C CB    . LYS B 1 433 ? -32.982 69.053  41.986  1.00 22.70  ? 433  LYS B CB    1 
ATOM   8274  C CG    . LYS B 1 433 ? -33.585 70.026  43.026  1.00 22.87  ? 433  LYS B CG    1 
ATOM   8275  C CD    . LYS B 1 433 ? -35.052 69.690  43.303  1.00 22.28  ? 433  LYS B CD    1 
ATOM   8276  C CE    . LYS B 1 433 ? -35.750 70.778  44.107  1.00 22.49  ? 433  LYS B CE    1 
ATOM   8277  N NZ    . LYS B 1 433 ? -37.097 70.310  44.627  1.00 22.69  ? 433  LYS B NZ    1 
ATOM   8278  N N     . ALA B 1 434 ? -30.309 67.187  41.022  1.00 22.78  ? 434  ALA B N     1 
ATOM   8279  C CA    . ALA B 1 434 ? -29.709 66.266  40.058  1.00 22.98  ? 434  ALA B CA    1 
ATOM   8280  C C     . ALA B 1 434 ? -30.799 65.490  39.277  1.00 23.13  ? 434  ALA B C     1 
ATOM   8281  O O     . ALA B 1 434 ? -31.517 64.653  39.849  1.00 23.76  ? 434  ALA B O     1 
ATOM   8282  C CB    . ALA B 1 434 ? -28.752 65.323  40.764  1.00 22.31  ? 434  ALA B CB    1 
ATOM   8283  N N     . GLY B 1 435 ? -30.939 65.792  37.985  1.00 22.95  ? 435  GLY B N     1 
ATOM   8284  C CA    . GLY B 1 435 ? -31.963 65.162  37.140  1.00 22.77  ? 435  GLY B CA    1 
ATOM   8285  C C     . GLY B 1 435 ? -33.121 66.059  36.709  1.00 22.98  ? 435  GLY B C     1 
ATOM   8286  O O     . GLY B 1 435 ? -33.888 65.690  35.807  1.00 23.00  ? 435  GLY B O     1 
ATOM   8287  N N     . SER B 1 436 ? -33.239 67.235  37.339  1.00 22.81  ? 436  SER B N     1 
ATOM   8288  C CA    . SER B 1 436 ? -34.302 68.208  37.060  1.00 22.66  ? 436  SER B CA    1 
ATOM   8289  C C     . SER B 1 436 ? -33.860 69.323  36.098  1.00 22.76  ? 436  SER B C     1 
ATOM   8290  O O     . SER B 1 436 ? -32.837 69.978  36.306  1.00 22.43  ? 436  SER B O     1 
ATOM   8291  C CB    . SER B 1 436 ? -34.804 68.825  38.381  1.00 23.08  ? 436  SER B CB    1 
ATOM   8292  O OG    . SER B 1 436 ? -35.914 69.694  38.192  1.00 22.86  ? 436  SER B OG    1 
ATOM   8293  N N     . ALA B 1 437 ? -34.641 69.529  35.036  1.00 22.94  ? 437  ALA B N     1 
ATOM   8294  C CA    . ALA B 1 437 ? -34.462 70.683  34.145  1.00 22.45  ? 437  ALA B CA    1 
ATOM   8295  C C     . ALA B 1 437 ? -34.802 71.970  34.902  1.00 22.32  ? 437  ALA B C     1 
ATOM   8296  O O     . ALA B 1 437 ? -34.406 73.060  34.481  1.00 22.24  ? 437  ALA B O     1 
ATOM   8297  C CB    . ALA B 1 437 ? -35.332 70.550  32.909  1.00 22.24  ? 437  ALA B CB    1 
ATOM   8298  N N     . THR B 1 438 ? -35.516 71.810  36.021  1.00 21.40  ? 438  THR B N     1 
ATOM   8299  C CA    . THR B 1 438 ? -35.933 72.895  36.924  1.00 21.46  ? 438  THR B CA    1 
ATOM   8300  C C     . THR B 1 438 ? -37.139 73.690  36.389  1.00 21.63  ? 438  THR B C     1 
ATOM   8301  O O     . THR B 1 438 ? -38.231 73.141  36.285  1.00 21.50  ? 438  THR B O     1 
ATOM   8302  C CB    . THR B 1 438 ? -34.744 73.825  37.460  1.00 21.84  ? 438  THR B CB    1 
ATOM   8303  O OG1   . THR B 1 438 ? -34.249 74.681  36.422  1.00 21.22  ? 438  THR B OG1   1 
ATOM   8304  C CG2   . THR B 1 438 ? -33.587 72.999  38.058  1.00 21.28  ? 438  THR B CG2   1 
ATOM   8305  N N     . ARG B 1 439 ? -36.916 74.953  36.022  1.00 22.07  ? 439  ARG B N     1 
ATOM   8306  C CA    . ARG B 1 439 ? -37.974 75.944  35.820  1.00 22.64  ? 439  ARG B CA    1 
ATOM   8307  C C     . ARG B 1 439 ? -38.030 76.474  34.372  1.00 22.65  ? 439  ARG B C     1 
ATOM   8308  O O     . ARG B 1 439 ? -37.003 76.510  33.679  1.00 22.44  ? 439  ARG B O     1 
ATOM   8309  C CB    . ARG B 1 439 ? -37.738 77.135  36.759  1.00 22.66  ? 439  ARG B CB    1 
ATOM   8310  C CG    . ARG B 1 439 ? -37.658 76.816  38.244  1.00 24.55  ? 439  ARG B CG    1 
ATOM   8311  C CD    . ARG B 1 439 ? -38.071 78.077  39.043  1.00 27.65  ? 439  ARG B CD    1 
ATOM   8312  N NE    . ARG B 1 439 ? -38.031 77.939  40.507  1.00 28.48  ? 439  ARG B NE    1 
ATOM   8313  C CZ    . ARG B 1 439 ? -39.026 77.446  41.243  1.00 29.19  ? 439  ARG B CZ    1 
ATOM   8314  N NH1   . ARG B 1 439 ? -40.135 77.001  40.661  1.00 27.63  ? 439  ARG B NH1   1 
ATOM   8315  N NH2   . ARG B 1 439 ? -38.910 77.386  42.562  1.00 28.14  ? 439  ARG B NH2   1 
ATOM   8316  N N     . PRO B 1 440 ? -39.216 76.945  33.930  1.00 22.56  ? 440  PRO B N     1 
ATOM   8317  C CA    . PRO B 1 440 ? -39.354 77.436  32.542  1.00 22.39  ? 440  PRO B CA    1 
ATOM   8318  C C     . PRO B 1 440 ? -38.486 78.654  32.255  1.00 22.41  ? 440  PRO B C     1 
ATOM   8319  O O     . PRO B 1 440 ? -38.256 79.468  33.140  1.00 22.74  ? 440  PRO B O     1 
ATOM   8320  C CB    . PRO B 1 440 ? -40.837 77.823  32.442  1.00 22.28  ? 440  PRO B CB    1 
ATOM   8321  C CG    . PRO B 1 440 ? -41.280 78.075  33.888  1.00 22.80  ? 440  PRO B CG    1 
ATOM   8322  C CD    . PRO B 1 440 ? -40.482 77.054  34.690  1.00 22.83  ? 440  PRO B CD    1 
ATOM   8323  N N     . PHE B 1 441 ? -37.989 78.776  31.033  1.00 22.07  ? 441  PHE B N     1 
ATOM   8324  C CA    . PHE B 1 441 ? -37.332 80.002  30.636  1.00 22.10  ? 441  PHE B CA    1 
ATOM   8325  C C     . PHE B 1 441 ? -38.333 81.176  30.473  1.00 22.37  ? 441  PHE B C     1 
ATOM   8326  O O     . PHE B 1 441 ? -39.551 80.973  30.433  1.00 22.32  ? 441  PHE B O     1 
ATOM   8327  C CB    . PHE B 1 441 ? -36.549 79.792  29.344  1.00 21.99  ? 441  PHE B CB    1 
ATOM   8328  C CG    . PHE B 1 441 ? -35.584 80.897  29.049  1.00 21.61  ? 441  PHE B CG    1 
ATOM   8329  C CD1   . PHE B 1 441 ? -34.410 81.015  29.771  1.00 21.68  ? 441  PHE B CD1   1 
ATOM   8330  C CD2   . PHE B 1 441 ? -35.856 81.828  28.054  1.00 21.24  ? 441  PHE B CD2   1 
ATOM   8331  C CE1   . PHE B 1 441 ? -33.498 82.055  29.499  1.00 22.60  ? 441  PHE B CE1   1 
ATOM   8332  C CE2   . PHE B 1 441 ? -34.966 82.869  27.780  1.00 22.99  ? 441  PHE B CE2   1 
ATOM   8333  C CZ    . PHE B 1 441 ? -33.781 82.984  28.507  1.00 22.25  ? 441  PHE B CZ    1 
ATOM   8334  N N     . PHE B 1 442 ? -37.796 82.398  30.389  1.00 22.36  ? 442  PHE B N     1 
ATOM   8335  C CA    . PHE B 1 442 ? -38.568 83.585  30.082  1.00 22.04  ? 442  PHE B CA    1 
ATOM   8336  C C     . PHE B 1 442 ? -39.397 83.392  28.839  1.00 22.46  ? 442  PHE B C     1 
ATOM   8337  O O     . PHE B 1 442 ? -38.878 83.062  27.773  1.00 21.52  ? 442  PHE B O     1 
ATOM   8338  C CB    . PHE B 1 442 ? -37.660 84.800  29.895  1.00 21.50  ? 442  PHE B CB    1 
ATOM   8339  C CG    . PHE B 1 442 ? -36.692 85.010  31.018  1.00 21.00  ? 442  PHE B CG    1 
ATOM   8340  C CD1   . PHE B 1 442 ? -35.363 85.333  30.751  1.00 20.72  ? 442  PHE B CD1   1 
ATOM   8341  C CD2   . PHE B 1 442 ? -37.094 84.865  32.344  1.00 20.29  ? 442  PHE B CD2   1 
ATOM   8342  C CE1   . PHE B 1 442 ? -34.457 85.528  31.778  1.00 20.06  ? 442  PHE B CE1   1 
ATOM   8343  C CE2   . PHE B 1 442 ? -36.189 85.049  33.380  1.00 19.65  ? 442  PHE B CE2   1 
ATOM   8344  C CZ    . PHE B 1 442 ? -34.866 85.383  33.094  1.00 20.30  ? 442  PHE B CZ    1 
ATOM   8345  N N     . GLY B 1 443 ? -40.699 83.603  28.992  1.00 23.26  ? 443  GLY B N     1 
ATOM   8346  C CA    . GLY B 1 443 ? -41.615 83.536  27.870  1.00 24.45  ? 443  GLY B CA    1 
ATOM   8347  C C     . GLY B 1 443 ? -42.295 82.192  27.761  1.00 25.03  ? 443  GLY B C     1 
ATOM   8348  O O     . GLY B 1 443 ? -43.235 82.035  26.975  1.00 25.60  ? 443  GLY B O     1 
ATOM   8349  N N     . VAL B 1 444 ? -41.839 81.231  28.566  1.00 25.28  ? 444  VAL B N     1 
ATOM   8350  C CA    . VAL B 1 444 ? -42.266 79.833  28.442  1.00 25.32  ? 444  VAL B CA    1 
ATOM   8351  C C     . VAL B 1 444 ? -43.331 79.467  29.478  1.00 25.78  ? 444  VAL B C     1 
ATOM   8352  O O     . VAL B 1 444 ? -43.099 79.562  30.689  1.00 25.17  ? 444  VAL B O     1 
ATOM   8353  C CB    . VAL B 1 444 ? -41.042 78.846  28.518  1.00 25.42  ? 444  VAL B CB    1 
ATOM   8354  C CG1   . VAL B 1 444 ? -41.485 77.396  28.317  1.00 24.38  ? 444  VAL B CG1   1 
ATOM   8355  C CG2   . VAL B 1 444 ? -39.963 79.234  27.495  1.00 24.18  ? 444  VAL B CG2   1 
ATOM   8356  N N     . GLN B 1 445 ? -44.488 79.020  28.988  1.00 26.62  ? 445  GLN B N     1 
ATOM   8357  C CA    . GLN B 1 445 ? -45.630 78.721  29.857  1.00 27.64  ? 445  GLN B CA    1 
ATOM   8358  C C     . GLN B 1 445 ? -46.018 77.255  29.857  1.00 27.73  ? 445  GLN B C     1 
ATOM   8359  O O     . GLN B 1 445 ? -46.945 76.852  29.142  1.00 28.36  ? 445  GLN B O     1 
ATOM   8360  C CB    . GLN B 1 445 ? -46.828 79.600  29.504  1.00 27.71  ? 445  GLN B CB    1 
ATOM   8361  C CG    . GLN B 1 445 ? -46.647 81.054  29.944  1.00 29.90  ? 445  GLN B CG    1 
ATOM   8362  C CD    . GLN B 1 445 ? -47.922 81.871  29.810  1.00 32.00  ? 445  GLN B CD    1 
ATOM   8363  O OE1   . GLN B 1 445 ? -48.871 81.691  30.584  1.00 32.24  ? 445  GLN B OE1   1 
ATOM   8364  N NE2   . GLN B 1 445 ? -47.950 82.778  28.826  1.00 31.73  ? 445  GLN B NE2   1 
ATOM   8365  N N     . PRO B 1 446 ? -45.310 76.441  30.659  1.00 27.73  ? 446  PRO B N     1 
ATOM   8366  C CA    . PRO B 1 446 ? -45.601 75.013  30.606  1.00 27.75  ? 446  PRO B CA    1 
ATOM   8367  C C     . PRO B 1 446 ? -46.822 74.667  31.436  1.00 27.69  ? 446  PRO B C     1 
ATOM   8368  O O     . PRO B 1 446 ? -47.182 75.419  32.349  1.00 28.06  ? 446  PRO B O     1 
ATOM   8369  C CB    . PRO B 1 446 ? -44.344 74.367  31.203  1.00 27.52  ? 446  PRO B CB    1 
ATOM   8370  C CG    . PRO B 1 446 ? -43.731 75.407  32.069  1.00 27.70  ? 446  PRO B CG    1 
ATOM   8371  C CD    . PRO B 1 446 ? -44.235 76.759  31.620  1.00 27.68  ? 446  PRO B CD    1 
ATOM   8372  N N     . ALA B 1 447 ? -47.450 73.545  31.100  1.00 27.38  ? 447  ALA B N     1 
ATOM   8373  C CA    . ALA B 1 447 ? -48.475 72.947  31.942  1.00 27.33  ? 447  ALA B CA    1 
ATOM   8374  C C     . ALA B 1 447 ? -48.423 71.416  31.803  1.00 27.34  ? 447  ALA B C     1 
ATOM   8375  O O     . ALA B 1 447 ? -47.824 70.890  30.848  1.00 27.24  ? 447  ALA B O     1 
ATOM   8376  C CB    . ALA B 1 447 ? -49.847 73.497  31.587  1.00 26.83  ? 447  ALA B CB    1 
ATOM   8377  N N     . LEU B 1 448 ? -49.027 70.720  32.768  1.00 27.27  ? 448  LEU B N     1 
ATOM   8378  C CA    . LEU B 1 448 ? -49.159 69.250  32.740  1.00 27.62  ? 448  LEU B CA    1 
ATOM   8379  C C     . LEU B 1 448 ? -50.629 68.838  32.648  1.00 27.82  ? 448  LEU B C     1 
ATOM   8380  O O     . LEU B 1 448 ? -51.422 69.170  33.525  1.00 27.80  ? 448  LEU B O     1 
ATOM   8381  C CB    . LEU B 1 448 ? -48.464 68.588  33.959  1.00 27.22  ? 448  LEU B CB    1 
ATOM   8382  C CG    . LEU B 1 448 ? -46.945 68.829  34.047  1.00 26.87  ? 448  LEU B CG    1 
ATOM   8383  C CD1   . LEU B 1 448 ? -46.376 68.339  35.332  1.00 25.85  ? 448  LEU B CD1   1 
ATOM   8384  C CD2   . LEU B 1 448 ? -46.200 68.206  32.855  1.00 26.47  ? 448  LEU B CD2   1 
ATOM   8385  N N     . VAL B 1 449 ? -50.987 68.136  31.577  1.00 28.12  ? 449  VAL B N     1 
ATOM   8386  C CA    . VAL B 1 449 ? -52.377 67.752  31.346  1.00 28.73  ? 449  VAL B CA    1 
ATOM   8387  C C     . VAL B 1 449 ? -52.521 66.232  31.388  1.00 29.86  ? 449  VAL B C     1 
ATOM   8388  O O     . VAL B 1 449 ? -51.574 65.500  31.055  1.00 29.70  ? 449  VAL B O     1 
ATOM   8389  C CB    . VAL B 1 449 ? -52.964 68.338  30.013  1.00 28.16  ? 449  VAL B CB    1 
ATOM   8390  C CG1   . VAL B 1 449 ? -52.951 69.846  30.023  1.00 27.48  ? 449  VAL B CG1   1 
ATOM   8391  C CG2   . VAL B 1 449 ? -52.219 67.840  28.809  1.00 28.28  ? 449  VAL B CG2   1 
ATOM   8392  N N     . ASP B 1 450 ? -53.686 65.741  31.814  1.00 30.82  ? 450  ASP B N     1 
ATOM   8393  C CA    . ASP B 1 450 ? -53.921 64.299  31.716  1.00 32.09  ? 450  ASP B CA    1 
ATOM   8394  C C     . ASP B 1 450 ? -54.296 63.938  30.282  1.00 32.40  ? 450  ASP B C     1 
ATOM   8395  O O     . ASP B 1 450 ? -54.326 64.815  29.408  1.00 32.02  ? 450  ASP B O     1 
ATOM   8396  C CB    . ASP B 1 450 ? -54.952 63.795  32.734  1.00 32.50  ? 450  ASP B CB    1 
ATOM   8397  C CG    . ASP B 1 450 ? -56.310 64.460  32.598  1.00 33.48  ? 450  ASP B CG    1 
ATOM   8398  O OD1   . ASP B 1 450 ? -56.643 65.018  31.518  1.00 33.19  ? 450  ASP B OD1   1 
ATOM   8399  O OD2   . ASP B 1 450 ? -57.052 64.408  33.609  1.00 35.87  ? 450  ASP B OD2   1 
ATOM   8400  N N     . ASN B 1 451 ? -54.572 62.659  30.038  1.00 33.38  ? 451  ASN B N     1 
ATOM   8401  C CA    . ASN B 1 451 ? -54.877 62.196  28.679  1.00 34.62  ? 451  ASN B CA    1 
ATOM   8402  C C     . ASN B 1 451 ? -56.149 62.813  28.062  1.00 35.70  ? 451  ASN B C     1 
ATOM   8403  O O     . ASN B 1 451 ? -56.391 62.669  26.847  1.00 35.78  ? 451  ASN B O     1 
ATOM   8404  C CB    . ASN B 1 451 ? -54.877 60.661  28.603  1.00 34.70  ? 451  ASN B CB    1 
ATOM   8405  C CG    . ASN B 1 451 ? -53.462 60.063  28.713  1.00 34.13  ? 451  ASN B CG    1 
ATOM   8406  O OD1   . ASN B 1 451 ? -52.477 60.701  28.347  1.00 32.96  ? 451  ASN B OD1   1 
ATOM   8407  N ND2   . ASN B 1 451 ? -53.369 58.833  29.209  1.00 32.74  ? 451  ASN B ND2   1 
ATOM   8408  N N     . GLU B 1 452 ? -56.941 63.499  28.896  1.00 36.58  ? 452  GLU B N     1 
ATOM   8409  C CA    . GLU B 1 452 ? -58.120 64.240  28.433  1.00 37.72  ? 452  GLU B CA    1 
ATOM   8410  C C     . GLU B 1 452 ? -57.880 65.745  28.343  1.00 38.22  ? 452  GLU B C     1 
ATOM   8411  O O     . GLU B 1 452 ? -58.803 66.527  28.069  1.00 38.49  ? 452  GLU B O     1 
ATOM   8412  C CB    . GLU B 1 452 ? -59.346 63.946  29.298  1.00 37.78  ? 452  GLU B CB    1 
ATOM   8413  C CG    . GLU B 1 452 ? -59.974 62.598  29.009  1.00 39.10  ? 452  GLU B CG    1 
ATOM   8414  C CD    . GLU B 1 452 ? -59.116 61.452  29.514  1.00 41.59  ? 452  GLU B CD    1 
ATOM   8415  O OE1   . GLU B 1 452 ? -58.719 61.481  30.706  1.00 42.62  ? 452  GLU B OE1   1 
ATOM   8416  O OE2   . GLU B 1 452 ? -58.834 60.529  28.718  1.00 42.43  ? 452  GLU B OE2   1 
ATOM   8417  N N     . GLY B 1 453 ? -56.631 66.145  28.556  1.00 38.47  ? 453  GLY B N     1 
ATOM   8418  C CA    . GLY B 1 453 ? -56.255 67.542  28.455  1.00 38.47  ? 453  GLY B CA    1 
ATOM   8419  C C     . GLY B 1 453 ? -56.629 68.384  29.657  1.00 38.31  ? 453  GLY B C     1 
ATOM   8420  O O     . GLY B 1 453 ? -56.610 69.609  29.566  1.00 37.91  ? 453  GLY B O     1 
ATOM   8421  N N     . HIS B 1 454 ? -56.961 67.736  30.776  1.00 38.46  ? 454  HIS B N     1 
ATOM   8422  C CA    . HIS B 1 454 ? -57.207 68.456  32.032  1.00 38.85  ? 454  HIS B CA    1 
ATOM   8423  C C     . HIS B 1 454 ? -55.869 68.845  32.640  1.00 38.67  ? 454  HIS B C     1 
ATOM   8424  O O     . HIS B 1 454 ? -55.049 67.966  32.941  1.00 38.57  ? 454  HIS B O     1 
ATOM   8425  C CB    . HIS B 1 454 ? -57.999 67.606  33.039  1.00 39.01  ? 454  HIS B CB    1 
ATOM   8426  C CG    . HIS B 1 454 ? -59.281 67.042  32.494  1.00 40.74  ? 454  HIS B CG    1 
ATOM   8427  N ND1   . HIS B 1 454 ? -59.557 65.689  32.485  1.00 40.93  ? 454  HIS B ND1   1 
ATOM   8428  C CD2   . HIS B 1 454 ? -60.361 67.650  31.941  1.00 40.77  ? 454  HIS B CD2   1 
ATOM   8429  C CE1   . HIS B 1 454 ? -60.751 65.489  31.953  1.00 41.51  ? 454  HIS B CE1   1 
ATOM   8430  N NE2   . HIS B 1 454 ? -61.257 66.661  31.611  1.00 40.59  ? 454  HIS B NE2   1 
ATOM   8431  N N     . PRO B 1 455 ? -55.622 70.163  32.793  1.00 38.59  ? 455  PRO B N     1 
ATOM   8432  C CA    . PRO B 1 455 ? -54.420 70.601  33.504  1.00 38.32  ? 455  PRO B CA    1 
ATOM   8433  C C     . PRO B 1 455 ? -54.372 70.097  34.950  1.00 38.10  ? 455  PRO B C     1 
ATOM   8434  O O     . PRO B 1 455 ? -55.369 70.186  35.685  1.00 37.78  ? 455  PRO B O     1 
ATOM   8435  C CB    . PRO B 1 455 ? -54.498 72.138  33.453  1.00 38.48  ? 455  PRO B CB    1 
ATOM   8436  C CG    . PRO B 1 455 ? -55.908 72.456  33.110  1.00 38.89  ? 455  PRO B CG    1 
ATOM   8437  C CD    . PRO B 1 455 ? -56.407 71.304  32.283  1.00 38.52  ? 455  PRO B CD    1 
ATOM   8438  N N     . GLN B 1 456 ? -53.212 69.559  35.323  1.00 37.55  ? 456  GLN B N     1 
ATOM   8439  C CA    . GLN B 1 456 ? -52.960 69.035  36.656  1.00 37.15  ? 456  GLN B CA    1 
ATOM   8440  C C     . GLN B 1 456 ? -52.225 70.087  37.471  1.00 36.99  ? 456  GLN B C     1 
ATOM   8441  O O     . GLN B 1 456 ? -51.196 70.598  37.043  1.00 37.22  ? 456  GLN B O     1 
ATOM   8442  C CB    . GLN B 1 456 ? -52.120 67.760  36.579  1.00 37.12  ? 456  GLN B CB    1 
ATOM   8443  C CG    . GLN B 1 456 ? -52.719 66.645  35.741  1.00 37.13  ? 456  GLN B CG    1 
ATOM   8444  C CD    . GLN B 1 456 ? -54.130 66.297  36.160  1.00 37.21  ? 456  GLN B CD    1 
ATOM   8445  O OE1   . GLN B 1 456 ? -55.088 66.630  35.464  1.00 37.53  ? 456  GLN B OE1   1 
ATOM   8446  N NE2   . GLN B 1 456 ? -54.269 65.642  37.305  1.00 35.86  ? 456  GLN B NE2   1 
ATOM   8447  N N     . GLU B 1 457 ? -52.747 70.389  38.654  1.00 36.66  ? 457  GLU B N     1 
ATOM   8448  C CA    . GLU B 1 457 ? -52.197 71.443  39.496  1.00 36.38  ? 457  GLU B CA    1 
ATOM   8449  C C     . GLU B 1 457 ? -51.303 70.885  40.615  1.00 36.13  ? 457  GLU B C     1 
ATOM   8450  O O     . GLU B 1 457 ? -51.504 69.758  41.088  1.00 35.70  ? 457  GLU B O     1 
ATOM   8451  C CB    . GLU B 1 457 ? -53.342 72.280  40.086  1.00 36.64  ? 457  GLU B CB    1 
ATOM   8452  N N     . GLY B 1 458 ? -50.316 71.682  41.023  1.00 35.78  ? 458  GLY B N     1 
ATOM   8453  C CA    . GLY B 1 458 ? -49.405 71.319  42.122  1.00 35.64  ? 458  GLY B CA    1 
ATOM   8454  C C     . GLY B 1 458 ? -48.454 70.193  41.759  1.00 35.45  ? 458  GLY B C     1 
ATOM   8455  O O     . GLY B 1 458 ? -48.157 69.986  40.584  1.00 35.24  ? 458  GLY B O     1 
ATOM   8456  N N     . ALA B 1 459 ? -47.994 69.462  42.777  1.00 35.11  ? 459  ALA B N     1 
ATOM   8457  C CA    . ALA B 1 459 ? -47.122 68.313  42.592  1.00 34.71  ? 459  ALA B CA    1 
ATOM   8458  C C     . ALA B 1 459 ? -47.891 67.178  41.931  1.00 34.99  ? 459  ALA B C     1 
ATOM   8459  O O     . ALA B 1 459 ? -48.790 66.580  42.536  1.00 35.29  ? 459  ALA B O     1 
ATOM   8460  C CB    . ALA B 1 459 ? -46.548 67.867  43.911  1.00 34.61  ? 459  ALA B CB    1 
ATOM   8461  N N     . THR B 1 460 ? -47.515 66.878  40.689  1.00 34.69  ? 460  THR B N     1 
ATOM   8462  C CA    . THR B 1 460 ? -48.292 66.001  39.825  1.00 34.23  ? 460  THR B CA    1 
ATOM   8463  C C     . THR B 1 460 ? -47.423 65.510  38.668  1.00 33.97  ? 460  THR B C     1 
ATOM   8464  O O     . THR B 1 460 ? -46.262 65.886  38.559  1.00 33.87  ? 460  THR B O     1 
ATOM   8465  C CB    . THR B 1 460 ? -49.521 66.777  39.265  1.00 34.50  ? 460  THR B CB    1 
ATOM   8466  O OG1   . THR B 1 460 ? -50.457 65.864  38.694  1.00 33.60  ? 460  THR B OG1   1 
ATOM   8467  C CG2   . THR B 1 460 ? -49.094 67.821  38.215  1.00 34.09  ? 460  THR B CG2   1 
ATOM   8468  N N     . GLU B 1 461 ? -47.977 64.645  37.828  1.00 33.59  ? 461  GLU B N     1 
ATOM   8469  C CA    . GLU B 1 461 ? -47.370 64.338  36.542  1.00 33.67  ? 461  GLU B CA    1 
ATOM   8470  C C     . GLU B 1 461 ? -48.407 64.277  35.434  1.00 32.23  ? 461  GLU B C     1 
ATOM   8471  O O     . GLU B 1 461 ? -49.590 64.075  35.697  1.00 32.61  ? 461  GLU B O     1 
ATOM   8472  C CB    . GLU B 1 461 ? -46.491 63.078  36.580  1.00 33.55  ? 461  GLU B CB    1 
ATOM   8473  C CG    . GLU B 1 461 ? -47.121 61.782  37.036  1.00 35.44  ? 461  GLU B CG    1 
ATOM   8474  C CD    . GLU B 1 461 ? -46.063 60.678  37.175  1.00 36.83  ? 461  GLU B CD    1 
ATOM   8475  O OE1   . GLU B 1 461 ? -46.071 59.731  36.343  1.00 39.32  ? 461  GLU B OE1   1 
ATOM   8476  O OE2   . GLU B 1 461 ? -45.210 60.774  38.107  1.00 41.09  ? 461  GLU B OE2   1 
ATOM   8477  N N     . GLY B 1 462 ? -47.949 64.469  34.201  1.00 30.69  ? 462  GLY B N     1 
ATOM   8478  C CA    . GLY B 1 462 ? -48.797 64.395  33.035  1.00 28.73  ? 462  GLY B CA    1 
ATOM   8479  C C     . GLY B 1 462 ? -48.080 64.735  31.737  1.00 27.72  ? 462  GLY B C     1 
ATOM   8480  O O     . GLY B 1 462 ? -46.845 64.792  31.675  1.00 27.15  ? 462  GLY B O     1 
ATOM   8481  N N     . ASN B 1 463 ? -48.889 64.943  30.702  1.00 26.22  ? 463  ASN B N     1 
ATOM   8482  C CA    . ASN B 1 463 ? -48.442 65.305  29.376  1.00 25.25  ? 463  ASN B CA    1 
ATOM   8483  C C     . ASN B 1 463 ? -47.981 66.745  29.410  1.00 24.89  ? 463  ASN B C     1 
ATOM   8484  O O     . ASN B 1 463 ? -48.687 67.612  29.932  1.00 24.82  ? 463  ASN B O     1 
ATOM   8485  C CB    . ASN B 1 463 ? -49.592 65.138  28.377  1.00 24.70  ? 463  ASN B CB    1 
ATOM   8486  C CG    . ASN B 1 463 ? -50.112 63.703  28.320  1.00 24.50  ? 463  ASN B CG    1 
ATOM   8487  O OD1   . ASN B 1 463 ? -49.363 62.774  27.983  1.00 21.93  ? 463  ASN B OD1   1 
ATOM   8488  N ND2   . ASN B 1 463 ? -51.398 63.514  28.663  1.00 21.46  ? 463  ASN B ND2   1 
ATOM   8489  N N     . LEU B 1 464 ? -46.790 66.987  28.870  1.00 24.27  ? 464  LEU B N     1 
ATOM   8490  C CA    . LEU B 1 464 ? -46.186 68.301  28.898  1.00 24.03  ? 464  LEU B CA    1 
ATOM   8491  C C     . LEU B 1 464 ? -46.574 69.128  27.669  1.00 24.41  ? 464  LEU B C     1 
ATOM   8492  O O     . LEU B 1 464 ? -46.184 68.816  26.531  1.00 24.38  ? 464  LEU B O     1 
ATOM   8493  C CB    . LEU B 1 464 ? -44.667 68.182  29.027  1.00 24.03  ? 464  LEU B CB    1 
ATOM   8494  C CG    . LEU B 1 464 ? -43.788 69.434  28.888  1.00 24.06  ? 464  LEU B CG    1 
ATOM   8495  C CD1   . LEU B 1 464 ? -44.077 70.477  29.972  1.00 20.92  ? 464  LEU B CD1   1 
ATOM   8496  C CD2   . LEU B 1 464 ? -42.309 69.019  28.894  1.00 23.44  ? 464  LEU B CD2   1 
ATOM   8497  N N     . VAL B 1 465 ? -47.351 70.177  27.928  1.00 24.24  ? 465  VAL B N     1 
ATOM   8498  C CA    . VAL B 1 465 ? -47.780 71.123  26.915  1.00 24.24  ? 465  VAL B CA    1 
ATOM   8499  C C     . VAL B 1 465 ? -47.227 72.519  27.228  1.00 24.37  ? 465  VAL B C     1 
ATOM   8500  O O     . VAL B 1 465 ? -46.865 72.813  28.355  1.00 25.09  ? 465  VAL B O     1 
ATOM   8501  C CB    . VAL B 1 465 ? -49.345 71.191  26.807  1.00 24.51  ? 465  VAL B CB    1 
ATOM   8502  C CG1   . VAL B 1 465 ? -49.931 69.863  26.350  1.00 23.96  ? 465  VAL B CG1   1 
ATOM   8503  C CG2   . VAL B 1 465 ? -49.981 71.613  28.119  1.00 23.43  ? 465  VAL B CG2   1 
ATOM   8504  N N     . ILE B 1 466 ? -47.156 73.373  26.221  1.00 24.66  ? 466  ILE B N     1 
ATOM   8505  C CA    . ILE B 1 466 ? -46.832 74.780  26.417  1.00 24.39  ? 466  ILE B CA    1 
ATOM   8506  C C     . ILE B 1 466 ? -48.085 75.563  26.000  1.00 24.46  ? 466  ILE B C     1 
ATOM   8507  O O     . ILE B 1 466 ? -48.601 75.359  24.903  1.00 24.08  ? 466  ILE B O     1 
ATOM   8508  C CB    . ILE B 1 466 ? -45.592 75.198  25.572  1.00 24.09  ? 466  ILE B CB    1 
ATOM   8509  C CG1   . ILE B 1 466 ? -44.430 74.201  25.742  1.00 23.27  ? 466  ILE B CG1   1 
ATOM   8510  C CG2   . ILE B 1 466 ? -45.193 76.649  25.847  1.00 24.16  ? 466  ILE B CG2   1 
ATOM   8511  C CD1   . ILE B 1 466 ? -43.846 74.047  27.140  1.00 19.80  ? 466  ILE B CD1   1 
ATOM   8512  N N     . THR B 1 467 ? -48.568 76.454  26.871  1.00 24.87  ? 467  THR B N     1 
ATOM   8513  C CA    . THR B 1 467 ? -49.918 77.045  26.699  1.00 25.16  ? 467  THR B CA    1 
ATOM   8514  C C     . THR B 1 467 ? -49.983 78.317  25.843  1.00 25.35  ? 467  THR B C     1 
ATOM   8515  O O     . THR B 1 467 ? -51.081 78.776  25.491  1.00 25.23  ? 467  THR B O     1 
ATOM   8516  C CB    . THR B 1 467 ? -50.579 77.363  28.050  1.00 25.27  ? 467  THR B CB    1 
ATOM   8517  O OG1   . THR B 1 467 ? -49.824 78.394  28.712  1.00 25.40  ? 467  THR B OG1   1 
ATOM   8518  C CG2   . THR B 1 467 ? -50.677 76.101  28.933  1.00 24.90  ? 467  THR B CG2   1 
ATOM   8519  N N     . ASP B 1 468 ? -48.817 78.892  25.553  1.00 25.40  ? 468  ASP B N     1 
ATOM   8520  C CA    . ASP B 1 468 ? -48.698 80.101  24.756  1.00 25.89  ? 468  ASP B CA    1 
ATOM   8521  C C     . ASP B 1 468 ? -47.361 80.065  23.985  1.00 25.88  ? 468  ASP B C     1 
ATOM   8522  O O     . ASP B 1 468 ? -46.508 79.233  24.271  1.00 25.87  ? 468  ASP B O     1 
ATOM   8523  C CB    . ASP B 1 468 ? -48.780 81.330  25.681  1.00 26.13  ? 468  ASP B CB    1 
ATOM   8524  C CG    . ASP B 1 468 ? -49.234 82.622  24.955  1.00 26.42  ? 468  ASP B CG    1 
ATOM   8525  O OD1   . ASP B 1 468 ? -48.960 82.812  23.747  1.00 24.64  ? 468  ASP B OD1   1 
ATOM   8526  O OD2   . ASP B 1 468 ? -49.848 83.475  25.634  1.00 29.29  ? 468  ASP B OD2   1 
ATOM   8527  N N     . SER B 1 469 ? -47.191 80.966  23.016  1.00 25.86  ? 469  SER B N     1 
ATOM   8528  C CA    . SER B 1 469 ? -46.012 80.979  22.156  1.00 25.72  ? 469  SER B CA    1 
ATOM   8529  C C     . SER B 1 469 ? -44.811 81.667  22.810  1.00 25.62  ? 469  SER B C     1 
ATOM   8530  O O     . SER B 1 469 ? -44.935 82.300  23.864  1.00 25.46  ? 469  SER B O     1 
ATOM   8531  C CB    . SER B 1 469 ? -46.349 81.614  20.806  1.00 25.90  ? 469  SER B CB    1 
ATOM   8532  O OG    . SER B 1 469 ? -45.218 81.675  19.940  1.00 27.57  ? 469  SER B OG    1 
ATOM   8533  N N     . TRP B 1 470 ? -43.648 81.493  22.183  1.00 25.24  ? 470  TRP B N     1 
ATOM   8534  C CA    . TRP B 1 470 ? -42.376 82.062  22.618  1.00 24.70  ? 470  TRP B CA    1 
ATOM   8535  C C     . TRP B 1 470 ? -41.647 82.351  21.315  1.00 24.59  ? 470  TRP B C     1 
ATOM   8536  O O     . TRP B 1 470 ? -41.927 81.699  20.304  1.00 25.04  ? 470  TRP B O     1 
ATOM   8537  C CB    . TRP B 1 470 ? -41.582 81.078  23.507  1.00 24.09  ? 470  TRP B CB    1 
ATOM   8538  C CG    . TRP B 1 470 ? -41.277 79.792  22.798  1.00 23.83  ? 470  TRP B CG    1 
ATOM   8539  C CD1   . TRP B 1 470 ? -40.112 79.449  22.158  1.00 23.06  ? 470  TRP B CD1   1 
ATOM   8540  C CD2   . TRP B 1 470 ? -42.176 78.703  22.604  1.00 24.12  ? 470  TRP B CD2   1 
ATOM   8541  N NE1   . TRP B 1 470 ? -40.230 78.205  21.594  1.00 22.93  ? 470  TRP B NE1   1 
ATOM   8542  C CE2   . TRP B 1 470 ? -41.487 77.721  21.856  1.00 24.09  ? 470  TRP B CE2   1 
ATOM   8543  C CE3   . TRP B 1 470 ? -43.503 78.452  23.001  1.00 23.72  ? 470  TRP B CE3   1 
ATOM   8544  C CZ2   . TRP B 1 470 ? -42.085 76.508  21.493  1.00 23.73  ? 470  TRP B CZ2   1 
ATOM   8545  C CZ3   . TRP B 1 470 ? -44.089 77.258  22.641  1.00 22.81  ? 470  TRP B CZ3   1 
ATOM   8546  C CH2   . TRP B 1 470 ? -43.378 76.297  21.896  1.00 23.58  ? 470  TRP B CH2   1 
ATOM   8547  N N     . PRO B 1 471 ? -40.741 83.347  21.315  1.00 24.65  ? 471  PRO B N     1 
ATOM   8548  C CA    . PRO B 1 471 ? -40.129 83.844  20.077  1.00 24.53  ? 471  PRO B CA    1 
ATOM   8549  C C     . PRO B 1 471 ? -39.482 82.803  19.156  1.00 24.16  ? 471  PRO B C     1 
ATOM   8550  O O     . PRO B 1 471 ? -39.474 82.994  17.942  1.00 24.54  ? 471  PRO B O     1 
ATOM   8551  C CB    . PRO B 1 471 ? -39.070 84.821  20.589  1.00 24.43  ? 471  PRO B CB    1 
ATOM   8552  C CG    . PRO B 1 471 ? -39.644 85.310  21.891  1.00 25.19  ? 471  PRO B CG    1 
ATOM   8553  C CD    . PRO B 1 471 ? -40.280 84.111  22.491  1.00 24.90  ? 471  PRO B CD    1 
ATOM   8554  N N     . GLY B 1 472 ? -38.912 81.740  19.718  1.00 23.23  ? 472  GLY B N     1 
ATOM   8555  C CA    . GLY B 1 472 ? -38.110 80.814  18.928  1.00 22.10  ? 472  GLY B CA    1 
ATOM   8556  C C     . GLY B 1 472 ? -38.881 79.640  18.371  1.00 21.63  ? 472  GLY B C     1 
ATOM   8557  O O     . GLY B 1 472 ? -38.297 78.768  17.725  1.00 21.04  ? 472  GLY B O     1 
ATOM   8558  N N     . GLN B 1 473 ? -40.189 79.620  18.621  1.00 21.66  ? 473  GLN B N     1 
ATOM   8559  C CA    . GLN B 1 473 ? -41.059 78.512  18.218  1.00 22.21  ? 473  GLN B CA    1 
ATOM   8560  C C     . GLN B 1 473 ? -41.002 78.275  16.711  1.00 22.60  ? 473  GLN B C     1 
ATOM   8561  O O     . GLN B 1 473 ? -40.991 79.236  15.921  1.00 22.40  ? 473  GLN B O     1 
ATOM   8562  C CB    . GLN B 1 473 ? -42.507 78.752  18.669  1.00 21.67  ? 473  GLN B CB    1 
ATOM   8563  C CG    . GLN B 1 473 ? -43.442 77.554  18.415  1.00 22.21  ? 473  GLN B CG    1 
ATOM   8564  C CD    . GLN B 1 473 ? -44.808 77.638  19.124  1.00 22.63  ? 473  GLN B CD    1 
ATOM   8565  O OE1   . GLN B 1 473 ? -45.178 78.674  19.671  1.00 21.98  ? 473  GLN B OE1   1 
ATOM   8566  N NE2   . GLN B 1 473 ? -45.554 76.522  19.122  1.00 23.20  ? 473  GLN B NE2   1 
ATOM   8567  N N     . ALA B 1 474 ? -40.944 77.000  16.319  1.00 23.31  ? 474  ALA B N     1 
ATOM   8568  C CA    . ALA B 1 474 ? -41.002 76.634  14.902  1.00 24.11  ? 474  ALA B CA    1 
ATOM   8569  C C     . ALA B 1 474 ? -42.326 77.125  14.361  1.00 24.50  ? 474  ALA B C     1 
ATOM   8570  O O     . ALA B 1 474 ? -43.342 77.035  15.045  1.00 25.07  ? 474  ALA B O     1 
ATOM   8571  C CB    . ALA B 1 474 ? -40.886 75.130  14.720  1.00 24.05  ? 474  ALA B CB    1 
ATOM   8572  N N     . ARG B 1 475 ? -42.326 77.641  13.140  1.00 24.91  ? 475  ARG B N     1 
ATOM   8573  C CA    . ARG B 1 475 ? -43.523 78.298  12.612  1.00 25.19  ? 475  ARG B CA    1 
ATOM   8574  C C     . ARG B 1 475 ? -44.443 77.338  11.877  1.00 25.59  ? 475  ARG B C     1 
ATOM   8575  O O     . ARG B 1 475 ? -45.651 77.589  11.764  1.00 25.39  ? 475  ARG B O     1 
ATOM   8576  C CB    . ARG B 1 475 ? -43.138 79.466  11.697  1.00 24.85  ? 475  ARG B CB    1 
ATOM   8577  C CG    . ARG B 1 475 ? -42.245 80.512  12.353  1.00 24.40  ? 475  ARG B CG    1 
ATOM   8578  C CD    . ARG B 1 475 ? -42.936 81.195  13.531  1.00 22.14  ? 475  ARG B CD    1 
ATOM   8579  N NE    . ARG B 1 475 ? -42.394 82.527  13.780  1.00 22.56  ? 475  ARG B NE    1 
ATOM   8580  C CZ    . ARG B 1 475 ? -41.674 82.879  14.852  1.00 22.95  ? 475  ARG B CZ    1 
ATOM   8581  N NH1   . ARG B 1 475 ? -41.390 82.001  15.819  1.00 21.56  ? 475  ARG B NH1   1 
ATOM   8582  N NH2   . ARG B 1 475 ? -41.231 84.126  14.955  1.00 21.58  ? 475  ARG B NH2   1 
ATOM   8583  N N     . THR B 1 476 ? -43.875 76.244  11.370  1.00 26.00  ? 476  THR B N     1 
ATOM   8584  C CA    . THR B 1 476 ? -44.606 75.358  10.474  1.00 26.43  ? 476  THR B CA    1 
ATOM   8585  C C     . THR B 1 476 ? -43.809 74.113  10.126  1.00 27.03  ? 476  THR B C     1 
ATOM   8586  O O     . THR B 1 476 ? -42.636 73.999  10.488  1.00 27.69  ? 476  THR B O     1 
ATOM   8587  C CB    . THR B 1 476 ? -44.991 76.094  9.155   1.00 26.29  ? 476  THR B CB    1 
ATOM   8588  O OG1   . THR B 1 476 ? -46.080 75.403  8.517   1.00 28.43  ? 476  THR B OG1   1 
ATOM   8589  C CG2   . THR B 1 476 ? -43.805 76.200  8.206   1.00 24.19  ? 476  THR B CG2   1 
ATOM   8590  N N     . LEU B 1 477 ? -44.453 73.181  9.425   1.00 27.54  ? 477  LEU B N     1 
ATOM   8591  C CA    . LEU B 1 477 ? -43.759 72.081  8.768   1.00 27.91  ? 477  LEU B CA    1 
ATOM   8592  C C     . LEU B 1 477 ? -43.669 72.391  7.285   1.00 28.74  ? 477  LEU B C     1 
ATOM   8593  O O     . LEU B 1 477 ? -44.673 72.716  6.650   1.00 28.62  ? 477  LEU B O     1 
ATOM   8594  C CB    . LEU B 1 477 ? -44.487 70.753  8.976   1.00 27.75  ? 477  LEU B CB    1 
ATOM   8595  C CG    . LEU B 1 477 ? -44.461 70.164  10.386  1.00 27.20  ? 477  LEU B CG    1 
ATOM   8596  C CD1   . LEU B 1 477 ? -45.015 68.741  10.372  1.00 26.54  ? 477  LEU B CD1   1 
ATOM   8597  C CD2   . LEU B 1 477 ? -43.064 70.196  10.996  1.00 26.23  ? 477  LEU B CD2   1 
ATOM   8598  N N     . PHE B 1 478 ? -42.465 72.280  6.739   1.00 29.72  ? 478  PHE B N     1 
ATOM   8599  C CA    . PHE B 1 478 ? -42.201 72.709  5.374   1.00 30.98  ? 478  PHE B CA    1 
ATOM   8600  C C     . PHE B 1 478 ? -43.264 72.259  4.390   1.00 31.50  ? 478  PHE B C     1 
ATOM   8601  O O     . PHE B 1 478 ? -43.445 71.060  4.163   1.00 31.30  ? 478  PHE B O     1 
ATOM   8602  C CB    . PHE B 1 478 ? -40.817 72.267  4.881   1.00 31.19  ? 478  PHE B CB    1 
ATOM   8603  C CG    . PHE B 1 478 ? -40.528 72.687  3.467   1.00 31.85  ? 478  PHE B CG    1 
ATOM   8604  C CD1   . PHE B 1 478 ? -40.517 74.038  3.118   1.00 33.15  ? 478  PHE B CD1   1 
ATOM   8605  C CD2   . PHE B 1 478 ? -40.303 71.742  2.481   1.00 31.85  ? 478  PHE B CD2   1 
ATOM   8606  C CE1   . PHE B 1 478 ? -40.263 74.432  1.802   1.00 33.00  ? 478  PHE B CE1   1 
ATOM   8607  C CE2   . PHE B 1 478 ? -40.053 72.126  1.177   1.00 32.85  ? 478  PHE B CE2   1 
ATOM   8608  C CZ    . PHE B 1 478 ? -40.030 73.475  0.835   1.00 32.34  ? 478  PHE B CZ    1 
ATOM   8609  N N     . GLY B 1 479 ? -43.954 73.247  3.820   1.00 32.20  ? 479  GLY B N     1 
ATOM   8610  C CA    . GLY B 1 479 ? -44.956 73.028  2.786   1.00 32.90  ? 479  GLY B CA    1 
ATOM   8611  C C     . GLY B 1 479 ? -46.144 72.191  3.229   1.00 33.56  ? 479  GLY B C     1 
ATOM   8612  O O     . GLY B 1 479 ? -46.724 71.465  2.415   1.00 33.86  ? 479  GLY B O     1 
ATOM   8613  N N     . ASP B 1 480 ? -46.515 72.293  4.505   1.00 33.41  ? 480  ASP B N     1 
ATOM   8614  C CA    . ASP B 1 480 ? -47.632 71.524  5.031   1.00 33.87  ? 480  ASP B CA    1 
ATOM   8615  C C     . ASP B 1 480 ? -48.054 72.029  6.405   1.00 33.86  ? 480  ASP B C     1 
ATOM   8616  O O     . ASP B 1 480 ? -47.856 71.346  7.426   1.00 33.53  ? 480  ASP B O     1 
ATOM   8617  C CB    . ASP B 1 480 ? -47.272 70.040  5.095   1.00 34.36  ? 480  ASP B CB    1 
ATOM   8618  C CG    . ASP B 1 480 ? -48.486 69.153  5.241   1.00 36.11  ? 480  ASP B CG    1 
ATOM   8619  O OD1   . ASP B 1 480 ? -49.594 69.702  5.472   1.00 36.18  ? 480  ASP B OD1   1 
ATOM   8620  O OD2   . ASP B 1 480 ? -48.320 67.906  5.130   1.00 37.58  ? 480  ASP B OD2   1 
ATOM   8621  N N     . HIS B 1 481 ? -48.649 73.222  6.429   1.00 33.61  ? 481  HIS B N     1 
ATOM   8622  C CA    . HIS B 1 481 ? -49.065 73.820  7.690   1.00 33.57  ? 481  HIS B CA    1 
ATOM   8623  C C     . HIS B 1 481 ? -50.126 73.001  8.421   1.00 33.46  ? 481  HIS B C     1 
ATOM   8624  O O     . HIS B 1 481 ? -50.193 73.038  9.640   1.00 33.56  ? 481  HIS B O     1 
ATOM   8625  C CB    . HIS B 1 481 ? -49.556 75.248  7.482   1.00 33.77  ? 481  HIS B CB    1 
ATOM   8626  C CG    . HIS B 1 481 ? -49.710 76.018  8.756   1.00 33.75  ? 481  HIS B CG    1 
ATOM   8627  N ND1   . HIS B 1 481 ? -48.636 76.366  9.550   1.00 33.99  ? 481  HIS B ND1   1 
ATOM   8628  C CD2   . HIS B 1 481 ? -50.812 76.499  9.377   1.00 32.68  ? 481  HIS B CD2   1 
ATOM   8629  C CE1   . HIS B 1 481 ? -49.071 77.035  10.603  1.00 32.82  ? 481  HIS B CE1   1 
ATOM   8630  N NE2   . HIS B 1 481 ? -50.387 77.130  10.521  1.00 33.05  ? 481  HIS B NE2   1 
ATOM   8631  N N     . GLU B 1 482 ? -50.941 72.256  7.675   1.00 33.58  ? 482  GLU B N     1 
ATOM   8632  C CA    . GLU B 1 482 ? -52.036 71.469  8.256   1.00 33.43  ? 482  GLU B CA    1 
ATOM   8633  C C     . GLU B 1 482 ? -51.521 70.278  9.052   1.00 32.91  ? 482  GLU B C     1 
ATOM   8634  O O     . GLU B 1 482 ? -52.012 69.998  10.151  1.00 33.01  ? 482  GLU B O     1 
ATOM   8635  C CB    . GLU B 1 482 ? -53.029 71.030  7.175   1.00 33.82  ? 482  GLU B CB    1 
ATOM   8636  C CG    . GLU B 1 482 ? -53.972 72.144  6.695   1.00 35.41  ? 482  GLU B CG    1 
ATOM   8637  C CD    . GLU B 1 482 ? -53.229 73.345  6.086   1.00 38.47  ? 482  GLU B CD    1 
ATOM   8638  O OE1   . GLU B 1 482 ? -52.216 73.123  5.364   1.00 38.56  ? 482  GLU B OE1   1 
ATOM   8639  O OE2   . GLU B 1 482 ? -53.659 74.505  6.336   1.00 38.28  ? 482  GLU B OE2   1 
ATOM   8640  N N     . ARG B 1 483 ? -50.518 69.595  8.502   1.00 32.40  ? 483  ARG B N     1 
ATOM   8641  C CA    . ARG B 1 483 ? -49.818 68.527  9.218   1.00 31.80  ? 483  ARG B CA    1 
ATOM   8642  C C     . ARG B 1 483 ? -49.254 69.108  10.501  1.00 31.43  ? 483  ARG B C     1 
ATOM   8643  O O     . ARG B 1 483 ? -49.404 68.518  11.571  1.00 31.55  ? 483  ARG B O     1 
ATOM   8644  C CB    . ARG B 1 483 ? -48.699 67.934  8.363   1.00 31.77  ? 483  ARG B CB    1 
ATOM   8645  C CG    . ARG B 1 483 ? -48.083 66.656  8.941   1.00 32.95  ? 483  ARG B CG    1 
ATOM   8646  N N     . PHE B 1 484 ? -48.637 70.284  10.381  1.00 30.92  ? 484  PHE B N     1 
ATOM   8647  C CA    . PHE B 1 484 ? -48.074 71.017  11.513  1.00 30.45  ? 484  PHE B CA    1 
ATOM   8648  C C     . PHE B 1 484 ? -49.121 71.242  12.624  1.00 30.34  ? 484  PHE B C     1 
ATOM   8649  O O     . PHE B 1 484 ? -48.899 70.836  13.773  1.00 29.92  ? 484  PHE B O     1 
ATOM   8650  C CB    . PHE B 1 484 ? -47.427 72.334  11.028  1.00 29.86  ? 484  PHE B CB    1 
ATOM   8651  C CG    . PHE B 1 484 ? -46.895 73.203  12.136  1.00 29.87  ? 484  PHE B CG    1 
ATOM   8652  C CD1   . PHE B 1 484 ? -45.760 72.822  12.856  1.00 28.66  ? 484  PHE B CD1   1 
ATOM   8653  C CD2   . PHE B 1 484 ? -47.539 74.402  12.470  1.00 29.49  ? 484  PHE B CD2   1 
ATOM   8654  C CE1   . PHE B 1 484 ? -45.268 73.619  13.883  1.00 28.01  ? 484  PHE B CE1   1 
ATOM   8655  C CE2   . PHE B 1 484 ? -47.058 75.216  13.496  1.00 29.16  ? 484  PHE B CE2   1 
ATOM   8656  C CZ    . PHE B 1 484 ? -45.910 74.822  14.205  1.00 29.38  ? 484  PHE B CZ    1 
ATOM   8657  N N     . GLU B 1 485 ? -50.258 71.858  12.278  1.00 30.44  ? 485  GLU B N     1 
ATOM   8658  C CA    . GLU B 1 485 ? -51.382 72.026  13.224  1.00 31.03  ? 485  GLU B CA    1 
ATOM   8659  C C     . GLU B 1 485 ? -51.872 70.698  13.808  1.00 30.86  ? 485  GLU B C     1 
ATOM   8660  O O     . GLU B 1 485 ? -52.210 70.620  14.992  1.00 30.97  ? 485  GLU B O     1 
ATOM   8661  C CB    . GLU B 1 485 ? -52.560 72.769  12.580  1.00 30.96  ? 485  GLU B CB    1 
ATOM   8662  C CG    . GLU B 1 485 ? -53.802 72.867  13.492  1.00 31.74  ? 485  GLU B CG    1 
ATOM   8663  C CD    . GLU B 1 485 ? -54.944 73.767  12.946  1.00 32.05  ? 485  GLU B CD    1 
ATOM   8664  O OE1   . GLU B 1 485 ? -54.743 74.535  11.956  1.00 31.74  ? 485  GLU B OE1   1 
ATOM   8665  O OE2   . GLU B 1 485 ? -56.046 73.695  13.544  1.00 31.53  ? 485  GLU B OE2   1 
ATOM   8666  N N     . GLN B 1 486 ? -51.904 69.662  12.973  1.00 30.77  ? 486  GLN B N     1 
ATOM   8667  C CA    . GLN B 1 486 ? -52.398 68.354  13.389  1.00 31.26  ? 486  GLN B CA    1 
ATOM   8668  C C     . GLN B 1 486 ? -51.419 67.663  14.352  1.00 30.46  ? 486  GLN B C     1 
ATOM   8669  O O     . GLN B 1 486 ? -51.823 67.109  15.380  1.00 30.25  ? 486  GLN B O     1 
ATOM   8670  C CB    . GLN B 1 486 ? -52.686 67.503  12.148  1.00 30.89  ? 486  GLN B CB    1 
ATOM   8671  C CG    . GLN B 1 486 ? -53.047 66.055  12.406  1.00 31.97  ? 486  GLN B CG    1 
ATOM   8672  C CD    . GLN B 1 486 ? -53.349 65.310  11.100  1.00 33.55  ? 486  GLN B CD    1 
ATOM   8673  O OE1   . GLN B 1 486 ? -54.452 65.432  10.542  1.00 36.70  ? 486  GLN B OE1   1 
ATOM   8674  N NE2   . GLN B 1 486 ? -52.362 64.554  10.594  1.00 34.26  ? 486  GLN B NE2   1 
ATOM   8675  N N     . THR B 1 487 ? -50.133 67.732  14.022  1.00 29.86  ? 487  THR B N     1 
ATOM   8676  C CA    . THR B 1 487 ? -49.084 67.071  14.790  1.00 29.35  ? 487  THR B CA    1 
ATOM   8677  C C     . THR B 1 487 ? -48.955 67.636  16.214  1.00 29.12  ? 487  THR B C     1 
ATOM   8678  O O     . THR B 1 487 ? -48.820 66.875  17.167  1.00 29.51  ? 487  THR B O     1 
ATOM   8679  C CB    . THR B 1 487 ? -47.705 67.094  14.028  1.00 29.50  ? 487  THR B CB    1 
ATOM   8680  O OG1   . THR B 1 487 ? -47.869 66.571  12.701  1.00 28.41  ? 487  THR B OG1   1 
ATOM   8681  C CG2   . THR B 1 487 ? -46.613 66.280  14.766  1.00 29.57  ? 487  THR B CG2   1 
ATOM   8682  N N     . TYR B 1 488 ? -49.031 68.952  16.378  1.00 28.54  ? 488  TYR B N     1 
ATOM   8683  C CA    . TYR B 1 488 ? -48.724 69.538  17.690  1.00 28.04  ? 488  TYR B CA    1 
ATOM   8684  C C     . TYR B 1 488 ? -49.859 70.256  18.422  1.00 28.04  ? 488  TYR B C     1 
ATOM   8685  O O     . TYR B 1 488 ? -49.788 70.439  19.642  1.00 28.00  ? 488  TYR B O     1 
ATOM   8686  C CB    . TYR B 1 488 ? -47.529 70.495  17.580  1.00 27.71  ? 488  TYR B CB    1 
ATOM   8687  C CG    . TYR B 1 488 ? -46.351 69.914  16.870  1.00 26.47  ? 488  TYR B CG    1 
ATOM   8688  C CD1   . TYR B 1 488 ? -46.114 70.203  15.524  1.00 25.67  ? 488  TYR B CD1   1 
ATOM   8689  C CD2   . TYR B 1 488 ? -45.456 69.081  17.542  1.00 26.44  ? 488  TYR B CD2   1 
ATOM   8690  C CE1   . TYR B 1 488 ? -44.990 69.665  14.845  1.00 27.05  ? 488  TYR B CE1   1 
ATOM   8691  C CE2   . TYR B 1 488 ? -44.337 68.534  16.882  1.00 27.46  ? 488  TYR B CE2   1 
ATOM   8692  C CZ    . TYR B 1 488 ? -44.114 68.825  15.533  1.00 27.10  ? 488  TYR B CZ    1 
ATOM   8693  O OH    . TYR B 1 488 ? -43.026 68.277  14.887  1.00 27.53  ? 488  TYR B OH    1 
ATOM   8694  N N     . PHE B 1 489 ? -50.884 70.679  17.687  1.00 28.28  ? 489  PHE B N     1 
ATOM   8695  C CA    . PHE B 1 489 ? -51.937 71.519  18.262  1.00 28.58  ? 489  PHE B CA    1 
ATOM   8696  C C     . PHE B 1 489 ? -53.335 70.950  18.155  1.00 28.81  ? 489  PHE B C     1 
ATOM   8697  O O     . PHE B 1 489 ? -54.305 71.699  18.250  1.00 29.35  ? 489  PHE B O     1 
ATOM   8698  C CB    . PHE B 1 489 ? -51.939 72.906  17.607  1.00 28.65  ? 489  PHE B CB    1 
ATOM   8699  C CG    . PHE B 1 489 ? -50.605 73.586  17.612  1.00 28.12  ? 489  PHE B CG    1 
ATOM   8700  C CD1   . PHE B 1 489 ? -49.676 73.330  16.602  1.00 27.98  ? 489  PHE B CD1   1 
ATOM   8701  C CD2   . PHE B 1 489 ? -50.287 74.492  18.609  1.00 27.55  ? 489  PHE B CD2   1 
ATOM   8702  C CE1   . PHE B 1 489 ? -48.437 73.959  16.598  1.00 28.85  ? 489  PHE B CE1   1 
ATOM   8703  C CE2   . PHE B 1 489 ? -49.053 75.127  18.622  1.00 27.90  ? 489  PHE B CE2   1 
ATOM   8704  C CZ    . PHE B 1 489 ? -48.121 74.859  17.615  1.00 28.32  ? 489  PHE B CZ    1 
ATOM   8705  N N     . SER B 1 490 ? -53.458 69.643  17.952  1.00 29.32  ? 490  SER B N     1 
ATOM   8706  C CA    . SER B 1 490 ? -54.783 69.041  17.821  1.00 29.92  ? 490  SER B CA    1 
ATOM   8707  C C     . SER B 1 490 ? -55.118 68.093  18.963  1.00 29.77  ? 490  SER B C     1 
ATOM   8708  O O     . SER B 1 490 ? -56.285 67.912  19.287  1.00 30.10  ? 490  SER B O     1 
ATOM   8709  C CB    . SER B 1 490 ? -54.947 68.331  16.473  1.00 29.89  ? 490  SER B CB    1 
ATOM   8710  O OG    . SER B 1 490 ? -54.233 67.110  16.474  1.00 31.73  ? 490  SER B OG    1 
ATOM   8711  N N     . THR B 1 491 ? -54.093 67.492  19.561  1.00 29.92  ? 491  THR B N     1 
ATOM   8712  C CA    . THR B 1 491 ? -54.262 66.562  20.687  1.00 29.51  ? 491  THR B CA    1 
ATOM   8713  C C     . THR B 1 491 ? -54.820 67.250  21.935  1.00 29.53  ? 491  THR B C     1 
ATOM   8714  O O     . THR B 1 491 ? -55.759 66.749  22.565  1.00 30.01  ? 491  THR B O     1 
ATOM   8715  C CB    . THR B 1 491 ? -52.941 65.831  21.026  1.00 29.55  ? 491  THR B CB    1 
ATOM   8716  O OG1   . THR B 1 491 ? -52.417 65.207  19.837  1.00 29.09  ? 491  THR B OG1   1 
ATOM   8717  C CG2   . THR B 1 491 ? -53.179 64.771  22.089  1.00 29.12  ? 491  THR B CG2   1 
ATOM   8718  N N     . PHE B 1 492 ? -54.242 68.391  22.298  1.00 29.29  ? 492  PHE B N     1 
ATOM   8719  C CA    . PHE B 1 492 ? -54.759 69.183  23.406  1.00 29.03  ? 492  PHE B CA    1 
ATOM   8720  C C     . PHE B 1 492 ? -55.006 70.574  22.870  1.00 29.49  ? 492  PHE B C     1 
ATOM   8721  O O     . PHE B 1 492 ? -54.071 71.334  22.651  1.00 29.92  ? 492  PHE B O     1 
ATOM   8722  C CB    . PHE B 1 492 ? -53.785 69.193  24.598  1.00 28.62  ? 492  PHE B CB    1 
ATOM   8723  C CG    . PHE B 1 492 ? -53.358 67.809  25.061  1.00 27.76  ? 492  PHE B CG    1 
ATOM   8724  C CD1   . PHE B 1 492 ? -52.019 67.415  24.986  1.00 26.57  ? 492  PHE B CD1   1 
ATOM   8725  C CD2   . PHE B 1 492 ? -54.291 66.897  25.564  1.00 26.14  ? 492  PHE B CD2   1 
ATOM   8726  C CE1   . PHE B 1 492 ? -51.618 66.141  25.423  1.00 24.51  ? 492  PHE B CE1   1 
ATOM   8727  C CE2   . PHE B 1 492 ? -53.897 65.624  25.994  1.00 25.00  ? 492  PHE B CE2   1 
ATOM   8728  C CZ    . PHE B 1 492 ? -52.560 65.248  25.927  1.00 24.89  ? 492  PHE B CZ    1 
ATOM   8729  N N     . LYS B 1 493 ? -56.279 70.876  22.638  1.00 29.91  ? 493  LYS B N     1 
ATOM   8730  C CA    . LYS B 1 493 ? -56.725 72.078  21.933  1.00 30.41  ? 493  LYS B CA    1 
ATOM   8731  C C     . LYS B 1 493 ? -56.204 73.402  22.505  1.00 30.17  ? 493  LYS B C     1 
ATOM   8732  O O     . LYS B 1 493 ? -56.219 73.615  23.721  1.00 30.32  ? 493  LYS B O     1 
ATOM   8733  C CB    . LYS B 1 493 ? -58.262 72.085  21.830  1.00 30.93  ? 493  LYS B CB    1 
ATOM   8734  C CG    . LYS B 1 493 ? -58.830 70.935  20.961  1.00 32.58  ? 493  LYS B CG    1 
ATOM   8735  C CD    . LYS B 1 493 ? -58.729 71.250  19.467  1.00 33.83  ? 493  LYS B CD    1 
ATOM   8736  C CE    . LYS B 1 493 ? -58.412 70.017  18.603  1.00 34.31  ? 493  LYS B CE    1 
ATOM   8737  N NZ    . LYS B 1 493 ? -59.429 68.931  18.649  1.00 34.92  ? 493  LYS B NZ    1 
ATOM   8738  N N     . ASN B 1 494 ? -55.738 74.275  21.605  1.00 29.83  ? 494  ASN B N     1 
ATOM   8739  C CA    . ASN B 1 494 ? -55.164 75.582  21.960  1.00 29.86  ? 494  ASN B CA    1 
ATOM   8740  C C     . ASN B 1 494 ? -53.811 75.481  22.683  1.00 29.99  ? 494  ASN B C     1 
ATOM   8741  O O     . ASN B 1 494 ? -53.354 76.448  23.318  1.00 29.95  ? 494  ASN B O     1 
ATOM   8742  C CB    . ASN B 1 494 ? -56.159 76.437  22.780  1.00 29.74  ? 494  ASN B CB    1 
ATOM   8743  N N     . MET B 1 495 ? -53.181 74.311  22.606  1.00 29.44  ? 495  MET B N     1 
ATOM   8744  C CA    . MET B 1 495 ? -51.953 74.082  23.359  1.00 30.05  ? 495  MET B CA    1 
ATOM   8745  C C     . MET B 1 495 ? -50.881 73.422  22.510  1.00 27.98  ? 495  MET B C     1 
ATOM   8746  O O     . MET B 1 495 ? -51.177 72.565  21.666  1.00 27.59  ? 495  MET B O     1 
ATOM   8747  C CB    . MET B 1 495 ? -52.241 73.259  24.620  1.00 29.73  ? 495  MET B CB    1 
ATOM   8748  C CG    . MET B 1 495 ? -52.886 74.063  25.737  1.00 31.68  ? 495  MET B CG    1 
ATOM   8749  S SD    . MET B 1 495 ? -53.304 73.047  27.173  1.00 35.42  ? 495  MET B SD    1 
ATOM   8750  C CE    . MET B 1 495 ? -54.866 72.297  26.654  1.00 35.87  ? 495  MET B CE    1 
ATOM   8751  N N     . TYR B 1 496 ? -49.634 73.839  22.716  1.00 26.49  ? 496  TYR B N     1 
ATOM   8752  C CA    . TYR B 1 496 ? -48.530 73.172  22.041  1.00 25.43  ? 496  TYR B CA    1 
ATOM   8753  C C     . TYR B 1 496 ? -48.177 71.909  22.812  1.00 24.80  ? 496  TYR B C     1 
ATOM   8754  O O     . TYR B 1 496 ? -47.806 71.990  23.975  1.00 24.94  ? 496  TYR B O     1 
ATOM   8755  C CB    . TYR B 1 496 ? -47.292 74.078  21.861  1.00 25.05  ? 496  TYR B CB    1 
ATOM   8756  C CG    . TYR B 1 496 ? -46.104 73.277  21.347  1.00 24.45  ? 496  TYR B CG    1 
ATOM   8757  C CD1   . TYR B 1 496 ? -45.998 72.939  19.997  1.00 23.51  ? 496  TYR B CD1   1 
ATOM   8758  C CD2   . TYR B 1 496 ? -45.127 72.797  22.224  1.00 24.99  ? 496  TYR B CD2   1 
ATOM   8759  C CE1   . TYR B 1 496 ? -44.926 72.166  19.521  1.00 23.61  ? 496  TYR B CE1   1 
ATOM   8760  C CE2   . TYR B 1 496 ? -44.041 72.008  21.757  1.00 24.68  ? 496  TYR B CE2   1 
ATOM   8761  C CZ    . TYR B 1 496 ? -43.952 71.710  20.403  1.00 23.79  ? 496  TYR B CZ    1 
ATOM   8762  O OH    . TYR B 1 496 ? -42.909 70.952  19.934  1.00 22.99  ? 496  TYR B OH    1 
ATOM   8763  N N     . PHE B 1 497 ? -48.300 70.752  22.166  1.00 24.11  ? 497  PHE B N     1 
ATOM   8764  C CA    . PHE B 1 497 ? -47.978 69.466  22.803  1.00 23.70  ? 497  PHE B CA    1 
ATOM   8765  C C     . PHE B 1 497 ? -46.578 68.958  22.408  1.00 23.38  ? 497  PHE B C     1 
ATOM   8766  O O     . PHE B 1 497 ? -46.278 68.791  21.225  1.00 23.21  ? 497  PHE B O     1 
ATOM   8767  C CB    . PHE B 1 497 ? -49.068 68.408  22.507  1.00 23.45  ? 497  PHE B CB    1 
ATOM   8768  C CG    . PHE B 1 497 ? -48.801 67.051  23.147  1.00 23.57  ? 497  PHE B CG    1 
ATOM   8769  C CD1   . PHE B 1 497 ? -48.252 66.957  24.436  1.00 22.44  ? 497  PHE B CD1   1 
ATOM   8770  C CD2   . PHE B 1 497 ? -49.108 65.866  22.462  1.00 21.90  ? 497  PHE B CD2   1 
ATOM   8771  C CE1   . PHE B 1 497 ? -47.994 65.701  25.013  1.00 23.84  ? 497  PHE B CE1   1 
ATOM   8772  C CE2   . PHE B 1 497 ? -48.872 64.611  23.038  1.00 22.03  ? 497  PHE B CE2   1 
ATOM   8773  C CZ    . PHE B 1 497 ? -48.308 64.529  24.307  1.00 23.42  ? 497  PHE B CZ    1 
ATOM   8774  N N     . SER B 1 498 ? -45.739 68.704  23.406  1.00 23.00  ? 498  SER B N     1 
ATOM   8775  C CA    . SER B 1 498 ? -44.329 68.408  23.179  1.00 22.64  ? 498  SER B CA    1 
ATOM   8776  C C     . SER B 1 498 ? -44.086 66.965  22.761  1.00 22.67  ? 498  SER B C     1 
ATOM   8777  O O     . SER B 1 498 ? -43.082 66.647  22.099  1.00 22.67  ? 498  SER B O     1 
ATOM   8778  C CB    . SER B 1 498 ? -43.511 68.700  24.432  1.00 22.37  ? 498  SER B CB    1 
ATOM   8779  O OG    . SER B 1 498 ? -43.771 67.729  25.423  1.00 22.14  ? 498  SER B OG    1 
ATOM   8780  N N     . GLY B 1 499 ? -44.995 66.093  23.154  1.00 22.24  ? 499  GLY B N     1 
ATOM   8781  C CA    . GLY B 1 499 ? -44.815 64.680  22.907  1.00 22.06  ? 499  GLY B CA    1 
ATOM   8782  C C     . GLY B 1 499 ? -44.150 64.049  24.104  1.00 21.87  ? 499  GLY B C     1 
ATOM   8783  O O     . GLY B 1 499 ? -44.014 62.838  24.149  1.00 22.17  ? 499  GLY B O     1 
ATOM   8784  N N     . ASP B 1 500 ? -43.766 64.871  25.084  1.00 21.94  ? 500  ASP B N     1 
ATOM   8785  C CA    . ASP B 1 500 ? -43.135 64.399  26.332  1.00 22.46  ? 500  ASP B CA    1 
ATOM   8786  C C     . ASP B 1 500 ? -44.075 64.324  27.533  1.00 22.72  ? 500  ASP B C     1 
ATOM   8787  O O     . ASP B 1 500 ? -45.062 65.056  27.599  1.00 22.38  ? 500  ASP B O     1 
ATOM   8788  C CB    . ASP B 1 500 ? -41.965 65.310  26.739  1.00 21.97  ? 500  ASP B CB    1 
ATOM   8789  C CG    . ASP B 1 500 ? -40.766 65.143  25.852  1.00 22.42  ? 500  ASP B CG    1 
ATOM   8790  O OD1   . ASP B 1 500 ? -40.313 63.997  25.696  1.00 23.20  ? 500  ASP B OD1   1 
ATOM   8791  O OD2   . ASP B 1 500 ? -40.271 66.154  25.319  1.00 21.59  ? 500  ASP B OD2   1 
ATOM   8792  N N     . GLY B 1 501 ? -43.710 63.468  28.492  1.00 23.01  ? 501  GLY B N     1 
ATOM   8793  C CA    . GLY B 1 501 ? -44.294 63.466  29.827  1.00 23.78  ? 501  GLY B CA    1 
ATOM   8794  C C     . GLY B 1 501 ? -43.324 64.043  30.839  1.00 24.30  ? 501  GLY B C     1 
ATOM   8795  O O     . GLY B 1 501 ? -42.110 64.046  30.619  1.00 24.53  ? 501  GLY B O     1 
ATOM   8796  N N     . ALA B 1 502 ? -43.852 64.554  31.948  1.00 24.75  ? 502  ALA B N     1 
ATOM   8797  C CA    . ALA B 1 502 ? -43.009 65.126  33.001  1.00 25.45  ? 502  ALA B CA    1 
ATOM   8798  C C     . ALA B 1 502 ? -43.716 65.088  34.344  1.00 25.90  ? 502  ALA B C     1 
ATOM   8799  O O     . ALA B 1 502 ? -44.935 64.948  34.417  1.00 25.82  ? 502  ALA B O     1 
ATOM   8800  C CB    . ALA B 1 502 ? -42.582 66.574  32.654  1.00 24.79  ? 502  ALA B CB    1 
ATOM   8801  N N     . ARG B 1 503 ? -42.949 65.213  35.412  1.00 26.45  ? 503  ARG B N     1 
ATOM   8802  C CA    . ARG B 1 503 ? -43.558 65.486  36.693  1.00 27.28  ? 503  ARG B CA    1 
ATOM   8803  C C     . ARG B 1 503 ? -43.105 66.831  37.232  1.00 27.03  ? 503  ARG B C     1 
ATOM   8804  O O     . ARG B 1 503 ? -42.000 67.283  36.939  1.00 27.20  ? 503  ARG B O     1 
ATOM   8805  C CB    . ARG B 1 503 ? -43.333 64.330  37.676  1.00 27.74  ? 503  ARG B CB    1 
ATOM   8806  C CG    . ARG B 1 503 ? -42.020 64.277  38.370  1.00 31.08  ? 503  ARG B CG    1 
ATOM   8807  C CD    . ARG B 1 503 ? -42.119 63.366  39.597  1.00 35.26  ? 503  ARG B CD    1 
ATOM   8808  N NE    . ARG B 1 503 ? -41.600 64.038  40.797  1.00 39.50  ? 503  ARG B NE    1 
ATOM   8809  C CZ    . ARG B 1 503 ? -40.341 63.983  41.234  1.00 40.26  ? 503  ARG B CZ    1 
ATOM   8810  N NH1   . ARG B 1 503 ? -39.419 63.277  40.591  1.00 40.72  ? 503  ARG B NH1   1 
ATOM   8811  N NH2   . ARG B 1 503 ? -40.006 64.645  42.331  1.00 40.77  ? 503  ARG B NH2   1 
ATOM   8812  N N     . ARG B 1 504 ? -43.980 67.486  37.989  1.00 27.11  ? 504  ARG B N     1 
ATOM   8813  C CA    . ARG B 1 504 ? -43.650 68.745  38.659  1.00 26.88  ? 504  ARG B CA    1 
ATOM   8814  C C     . ARG B 1 504 ? -43.636 68.467  40.149  1.00 26.66  ? 504  ARG B C     1 
ATOM   8815  O O     . ARG B 1 504 ? -44.546 67.814  40.669  1.00 26.48  ? 504  ARG B O     1 
ATOM   8816  C CB    . ARG B 1 504 ? -44.687 69.818  38.323  1.00 27.21  ? 504  ARG B CB    1 
ATOM   8817  C CG    . ARG B 1 504 ? -44.314 71.235  38.779  1.00 27.70  ? 504  ARG B CG    1 
ATOM   8818  C CD    . ARG B 1 504 ? -45.298 72.304  38.241  1.00 27.02  ? 504  ARG B CD    1 
ATOM   8819  N NE    . ARG B 1 504 ? -46.689 71.955  38.539  1.00 27.23  ? 504  ARG B NE    1 
ATOM   8820  C CZ    . ARG B 1 504 ? -47.668 71.844  37.643  1.00 26.53  ? 504  ARG B CZ    1 
ATOM   8821  N NH1   . ARG B 1 504 ? -47.471 72.096  36.349  1.00 26.64  ? 504  ARG B NH1   1 
ATOM   8822  N NH2   . ARG B 1 504 ? -48.870 71.506  38.052  1.00 27.24  ? 504  ARG B NH2   1 
ATOM   8823  N N     . ASP B 1 505 ? -42.595 68.933  40.839  1.00 26.54  ? 505  ASP B N     1 
ATOM   8824  C CA    . ASP B 1 505 ? -42.524 68.740  42.287  1.00 25.61  ? 505  ASP B CA    1 
ATOM   8825  C C     . ASP B 1 505 ? -43.112 69.902  43.098  1.00 25.83  ? 505  ASP B C     1 
ATOM   8826  O O     . ASP B 1 505 ? -43.652 70.857  42.526  1.00 25.66  ? 505  ASP B O     1 
ATOM   8827  C CB    . ASP B 1 505 ? -41.110 68.377  42.725  1.00 25.05  ? 505  ASP B CB    1 
ATOM   8828  C CG    . ASP B 1 505 ? -40.124 69.519  42.605  1.00 24.31  ? 505  ASP B CG    1 
ATOM   8829  O OD1   . ASP B 1 505 ? -40.510 70.710  42.498  1.00 22.14  ? 505  ASP B OD1   1 
ATOM   8830  O OD2   . ASP B 1 505 ? -38.919 69.198  42.642  1.00 24.27  ? 505  ASP B OD2   1 
ATOM   8831  N N     . GLU B 1 506 ? -43.011 69.814  44.425  1.00 25.73  ? 506  GLU B N     1 
ATOM   8832  C CA    . GLU B 1 506 ? -43.579 70.834  45.315  1.00 25.85  ? 506  GLU B CA    1 
ATOM   8833  C C     . GLU B 1 506 ? -42.989 72.243  45.133  1.00 25.39  ? 506  GLU B C     1 
ATOM   8834  O O     . GLU B 1 506 ? -43.657 73.233  45.417  1.00 25.63  ? 506  GLU B O     1 
ATOM   8835  C CB    . GLU B 1 506 ? -43.460 70.387  46.785  1.00 26.51  ? 506  GLU B CB    1 
ATOM   8836  N N     . ASP B 1 507 ? -41.739 72.325  44.673  1.00 25.02  ? 507  ASP B N     1 
ATOM   8837  C CA    . ASP B 1 507 ? -41.059 73.615  44.423  1.00 24.05  ? 507  ASP B CA    1 
ATOM   8838  C C     . ASP B 1 507 ? -41.298 74.108  43.007  1.00 23.37  ? 507  ASP B C     1 
ATOM   8839  O O     . ASP B 1 507 ? -40.772 75.140  42.615  1.00 22.79  ? 507  ASP B O     1 
ATOM   8840  C CB    . ASP B 1 507 ? -39.549 73.512  44.695  1.00 24.21  ? 507  ASP B CB    1 
ATOM   8841  C CG    . ASP B 1 507 ? -39.236 73.002  46.104  1.00 25.88  ? 507  ASP B CG    1 
ATOM   8842  O OD1   . ASP B 1 507 ? -39.923 73.419  47.068  1.00 26.90  ? 507  ASP B OD1   1 
ATOM   8843  O OD2   . ASP B 1 507 ? -38.312 72.166  46.248  1.00 27.05  ? 507  ASP B OD2   1 
ATOM   8844  N N     . GLY B 1 508 ? -42.089 73.358  42.240  1.00 22.80  ? 508  GLY B N     1 
ATOM   8845  C CA    . GLY B 1 508 ? -42.432 73.754  40.889  1.00 22.65  ? 508  GLY B CA    1 
ATOM   8846  C C     . GLY B 1 508 ? -41.359 73.356  39.887  1.00 22.77  ? 508  GLY B C     1 
ATOM   8847  O O     . GLY B 1 508 ? -41.415 73.773  38.731  1.00 22.75  ? 508  GLY B O     1 
ATOM   8848  N N     . TYR B 1 509 ? -40.394 72.543  40.324  1.00 22.80  ? 509  TYR B N     1 
ATOM   8849  C CA    . TYR B 1 509 ? -39.361 71.983  39.430  1.00 23.21  ? 509  TYR B CA    1 
ATOM   8850  C C     . TYR B 1 509 ? -39.935 70.904  38.508  1.00 22.89  ? 509  TYR B C     1 
ATOM   8851  O O     . TYR B 1 509 ? -40.688 70.052  38.946  1.00 22.13  ? 509  TYR B O     1 
ATOM   8852  C CB    . TYR B 1 509 ? -38.193 71.402  40.243  1.00 23.33  ? 509  TYR B CB    1 
ATOM   8853  C CG    . TYR B 1 509 ? -37.222 72.435  40.771  1.00 23.19  ? 509  TYR B CG    1 
ATOM   8854  C CD1   . TYR B 1 509 ? -37.682 73.634  41.336  1.00 24.17  ? 509  TYR B CD1   1 
ATOM   8855  C CD2   . TYR B 1 509 ? -35.842 72.211  40.720  1.00 23.36  ? 509  TYR B CD2   1 
ATOM   8856  C CE1   . TYR B 1 509 ? -36.794 74.593  41.822  1.00 24.95  ? 509  TYR B CE1   1 
ATOM   8857  C CE2   . TYR B 1 509 ? -34.939 73.157  41.205  1.00 23.69  ? 509  TYR B CE2   1 
ATOM   8858  C CZ    . TYR B 1 509 ? -35.427 74.346  41.763  1.00 24.35  ? 509  TYR B CZ    1 
ATOM   8859  O OH    . TYR B 1 509 ? -34.566 75.294  42.243  1.00 24.01  ? 509  TYR B OH    1 
ATOM   8860  N N     . TYR B 1 510 ? -39.565 70.955  37.233  1.00 23.16  ? 510  TYR B N     1 
ATOM   8861  C CA    . TYR B 1 510 ? -39.957 69.912  36.274  1.00 23.41  ? 510  TYR B CA    1 
ATOM   8862  C C     . TYR B 1 510 ? -38.904 68.814  36.124  1.00 23.19  ? 510  TYR B C     1 
ATOM   8863  O O     . TYR B 1 510 ? -37.703 69.082  36.129  1.00 23.16  ? 510  TYR B O     1 
ATOM   8864  C CB    . TYR B 1 510 ? -40.277 70.529  34.914  1.00 23.46  ? 510  TYR B CB    1 
ATOM   8865  C CG    . TYR B 1 510 ? -41.576 71.318  34.893  1.00 23.07  ? 510  TYR B CG    1 
ATOM   8866  C CD1   . TYR B 1 510 ? -41.605 72.673  35.233  1.00 23.87  ? 510  TYR B CD1   1 
ATOM   8867  C CD2   . TYR B 1 510 ? -42.774 70.702  34.531  1.00 22.05  ? 510  TYR B CD2   1 
ATOM   8868  C CE1   . TYR B 1 510 ? -42.812 73.399  35.205  1.00 23.14  ? 510  TYR B CE1   1 
ATOM   8869  C CE2   . TYR B 1 510 ? -43.971 71.401  34.501  1.00 22.52  ? 510  TYR B CE2   1 
ATOM   8870  C CZ    . TYR B 1 510 ? -43.988 72.749  34.834  1.00 23.85  ? 510  TYR B CZ    1 
ATOM   8871  O OH    . TYR B 1 510 ? -45.194 73.428  34.785  1.00 24.33  ? 510  TYR B OH    1 
ATOM   8872  N N     . TRP B 1 511 ? -39.376 67.579  36.011  1.00 22.98  ? 511  TRP B N     1 
ATOM   8873  C CA    . TRP B 1 511 ? -38.531 66.416  35.813  1.00 23.12  ? 511  TRP B CA    1 
ATOM   8874  C C     . TRP B 1 511 ? -39.086 65.744  34.568  1.00 23.83  ? 511  TRP B C     1 
ATOM   8875  O O     . TRP B 1 511 ? -40.177 65.158  34.616  1.00 24.59  ? 511  TRP B O     1 
ATOM   8876  C CB    . TRP B 1 511 ? -38.616 65.456  37.018  1.00 23.02  ? 511  TRP B CB    1 
ATOM   8877  C CG    . TRP B 1 511 ? -38.206 66.075  38.352  1.00 22.53  ? 511  TRP B CG    1 
ATOM   8878  C CD1   . TRP B 1 511 ? -38.932 66.963  39.121  1.00 21.29  ? 511  TRP B CD1   1 
ATOM   8879  C CD2   . TRP B 1 511 ? -36.973 65.851  39.054  1.00 22.18  ? 511  TRP B CD2   1 
ATOM   8880  N NE1   . TRP B 1 511 ? -38.224 67.295  40.256  1.00 21.40  ? 511  TRP B NE1   1 
ATOM   8881  C CE2   . TRP B 1 511 ? -37.018 66.633  40.242  1.00 22.52  ? 511  TRP B CE2   1 
ATOM   8882  C CE3   . TRP B 1 511 ? -35.834 65.064  38.797  1.00 21.81  ? 511  TRP B CE3   1 
ATOM   8883  C CZ2   . TRP B 1 511 ? -35.959 66.652  41.173  1.00 23.06  ? 511  TRP B CZ2   1 
ATOM   8884  C CZ3   . TRP B 1 511 ? -34.780 65.073  39.726  1.00 22.48  ? 511  TRP B CZ3   1 
ATOM   8885  C CH2   . TRP B 1 511 ? -34.850 65.871  40.901  1.00 22.76  ? 511  TRP B CH2   1 
ATOM   8886  N N     . ILE B 1 512 ? -38.367 65.864  33.451  1.00 23.78  ? 512  ILE B N     1 
ATOM   8887  C CA    . ILE B 1 512 ? -38.822 65.341  32.171  1.00 24.21  ? 512  ILE B CA    1 
ATOM   8888  C C     . ILE B 1 512 ? -38.516 63.846  32.089  1.00 24.32  ? 512  ILE B C     1 
ATOM   8889  O O     . ILE B 1 512 ? -37.348 63.437  32.196  1.00 23.62  ? 512  ILE B O     1 
ATOM   8890  C CB    . ILE B 1 512 ? -38.177 66.110  30.953  1.00 24.55  ? 512  ILE B CB    1 
ATOM   8891  C CG1   . ILE B 1 512 ? -38.735 67.535  30.829  1.00 25.85  ? 512  ILE B CG1   1 
ATOM   8892  C CG2   . ILE B 1 512 ? -38.473 65.386  29.624  1.00 25.61  ? 512  ILE B CG2   1 
ATOM   8893  C CD1   . ILE B 1 512 ? -38.166 68.537  31.802  1.00 26.90  ? 512  ILE B CD1   1 
ATOM   8894  N N     . THR B 1 513 ? -39.558 63.037  31.891  1.00 24.63  ? 513  THR B N     1 
ATOM   8895  C CA    . THR B 1 513 ? -39.378 61.583  31.892  1.00 25.37  ? 513  THR B CA    1 
ATOM   8896  C C     . THR B 1 513 ? -39.253 60.950  30.506  1.00 25.80  ? 513  THR B C     1 
ATOM   8897  O O     . THR B 1 513 ? -38.800 59.818  30.389  1.00 26.44  ? 513  THR B O     1 
ATOM   8898  C CB    . THR B 1 513 ? -40.415 60.836  32.767  1.00 25.22  ? 513  THR B CB    1 
ATOM   8899  O OG1   . THR B 1 513 ? -41.739 61.172  32.355  1.00 25.30  ? 513  THR B OG1   1 
ATOM   8900  C CG2   . THR B 1 513 ? -40.225 61.221  34.231  1.00 26.80  ? 513  THR B CG2   1 
ATOM   8901  N N     . GLY B 1 514 ? -39.613 61.686  29.455  1.00 26.16  ? 514  GLY B N     1 
ATOM   8902  C CA    . GLY B 1 514 ? -39.337 61.234  28.099  1.00 25.53  ? 514  GLY B CA    1 
ATOM   8903  C C     . GLY B 1 514 ? -40.596 61.267  27.277  1.00 25.64  ? 514  GLY B C     1 
ATOM   8904  O O     . GLY B 1 514 ? -41.612 61.780  27.740  1.00 25.86  ? 514  GLY B O     1 
ATOM   8905  N N     . ARG B 1 515 ? -40.525 60.732  26.058  1.00 25.21  ? 515  ARG B N     1 
ATOM   8906  C CA    . ARG B 1 515 ? -41.647 60.759  25.126  1.00 25.17  ? 515  ARG B CA    1 
ATOM   8907  C C     . ARG B 1 515 ? -42.799 59.871  25.595  1.00 25.61  ? 515  ARG B C     1 
ATOM   8908  O O     . ARG B 1 515 ? -42.571 58.773  26.125  1.00 25.29  ? 515  ARG B O     1 
ATOM   8909  C CB    . ARG B 1 515 ? -41.198 60.312  23.729  1.00 24.77  ? 515  ARG B CB    1 
ATOM   8910  C CG    . ARG B 1 515 ? -40.025 61.105  23.151  1.00 23.82  ? 515  ARG B CG    1 
ATOM   8911  C CD    . ARG B 1 515 ? -40.374 62.569  22.890  1.00 21.62  ? 515  ARG B CD    1 
ATOM   8912  N NE    . ARG B 1 515 ? -41.342 62.716  21.811  1.00 20.58  ? 515  ARG B NE    1 
ATOM   8913  C CZ    . ARG B 1 515 ? -41.396 63.760  20.987  1.00 21.55  ? 515  ARG B CZ    1 
ATOM   8914  N NH1   . ARG B 1 515 ? -40.532 64.776  21.113  1.00 19.33  ? 515  ARG B NH1   1 
ATOM   8915  N NH2   . ARG B 1 515 ? -42.323 63.795  20.030  1.00 19.87  ? 515  ARG B NH2   1 
ATOM   8916  N N     . VAL B 1 516 ? -44.024 60.353  25.395  1.00 25.41  ? 516  VAL B N     1 
ATOM   8917  C CA    . VAL B 1 516 ? -45.220 59.566  25.684  1.00 26.32  ? 516  VAL B CA    1 
ATOM   8918  C C     . VAL B 1 516 ? -45.834 59.015  24.393  1.00 26.72  ? 516  VAL B C     1 
ATOM   8919  O O     . VAL B 1 516 ? -46.785 58.235  24.436  1.00 27.48  ? 516  VAL B O     1 
ATOM   8920  C CB    . VAL B 1 516 ? -46.321 60.376  26.505  1.00 26.37  ? 516  VAL B CB    1 
ATOM   8921  C CG1   . VAL B 1 516 ? -45.817 60.752  27.895  1.00 25.67  ? 516  VAL B CG1   1 
ATOM   8922  C CG2   . VAL B 1 516 ? -46.811 61.626  25.736  1.00 25.92  ? 516  VAL B CG2   1 
ATOM   8923  N N     . ASP B 1 517 ? -45.293 59.444  23.257  1.00 26.70  ? 517  ASP B N     1 
ATOM   8924  C CA    . ASP B 1 517 ? -45.743 59.008  21.940  1.00 26.86  ? 517  ASP B CA    1 
ATOM   8925  C C     . ASP B 1 517 ? -44.763 57.952  21.410  1.00 27.06  ? 517  ASP B C     1 
ATOM   8926  O O     . ASP B 1 517 ? -43.911 57.472  22.154  1.00 27.44  ? 517  ASP B O     1 
ATOM   8927  C CB    . ASP B 1 517 ? -45.852 60.215  20.986  1.00 26.89  ? 517  ASP B CB    1 
ATOM   8928  C CG    . ASP B 1 517 ? -44.532 60.993  20.838  1.00 27.14  ? 517  ASP B CG    1 
ATOM   8929  O OD1   . ASP B 1 517 ? -44.511 62.010  20.104  1.00 27.54  ? 517  ASP B OD1   1 
ATOM   8930  O OD2   . ASP B 1 517 ? -43.514 60.601  21.446  1.00 27.64  ? 517  ASP B OD2   1 
ATOM   8931  N N     . ASP B 1 518 ? -44.867 57.591  20.137  1.00 26.73  ? 518  ASP B N     1 
ATOM   8932  C CA    . ASP B 1 518 ? -44.076 56.474  19.632  1.00 26.72  ? 518  ASP B CA    1 
ATOM   8933  C C     . ASP B 1 518 ? -42.769 56.939  18.982  1.00 25.91  ? 518  ASP B C     1 
ATOM   8934  O O     . ASP B 1 518 ? -42.503 56.697  17.800  1.00 25.73  ? 518  ASP B O     1 
ATOM   8935  C CB    . ASP B 1 518 ? -44.918 55.566  18.730  1.00 27.00  ? 518  ASP B CB    1 
ATOM   8936  C CG    . ASP B 1 518 ? -46.064 54.891  19.491  1.00 29.46  ? 518  ASP B CG    1 
ATOM   8937  O OD1   . ASP B 1 518 ? -45.808 54.152  20.485  1.00 30.73  ? 518  ASP B OD1   1 
ATOM   8938  O OD2   . ASP B 1 518 ? -47.234 55.116  19.092  1.00 31.23  ? 518  ASP B OD2   1 
ATOM   8939  N N     . VAL B 1 519 ? -41.966 57.612  19.802  1.00 25.21  ? 519  VAL B N     1 
ATOM   8940  C CA    . VAL B 1 519 ? -40.702 58.200  19.390  1.00 24.43  ? 519  VAL B CA    1 
ATOM   8941  C C     . VAL B 1 519 ? -39.646 57.733  20.383  1.00 24.72  ? 519  VAL B C     1 
ATOM   8942  O O     . VAL B 1 519 ? -39.872 57.778  21.598  1.00 25.26  ? 519  VAL B O     1 
ATOM   8943  C CB    . VAL B 1 519 ? -40.779 59.765  19.394  1.00 24.19  ? 519  VAL B CB    1 
ATOM   8944  C CG1   . VAL B 1 519 ? -39.422 60.403  19.030  1.00 22.48  ? 519  VAL B CG1   1 
ATOM   8945  C CG2   . VAL B 1 519 ? -41.876 60.273  18.446  1.00 23.03  ? 519  VAL B CG2   1 
ATOM   8946  N N     . LEU B 1 520 ? -38.496 57.312  19.879  1.00 24.35  ? 520  LEU B N     1 
ATOM   8947  C CA    . LEU B 1 520 ? -37.419 56.828  20.736  1.00 24.78  ? 520  LEU B CA    1 
ATOM   8948  C C     . LEU B 1 520 ? -36.309 57.846  20.941  1.00 24.75  ? 520  LEU B C     1 
ATOM   8949  O O     . LEU B 1 520 ? -36.086 58.731  20.101  1.00 23.74  ? 520  LEU B O     1 
ATOM   8950  C CB    . LEU B 1 520 ? -36.779 55.577  20.137  1.00 25.20  ? 520  LEU B CB    1 
ATOM   8951  C CG    . LEU B 1 520 ? -37.680 54.429  19.682  1.00 27.22  ? 520  LEU B CG    1 
ATOM   8952  C CD1   . LEU B 1 520 ? -36.887 53.537  18.756  1.00 29.11  ? 520  LEU B CD1   1 
ATOM   8953  C CD2   . LEU B 1 520 ? -38.214 53.660  20.898  1.00 27.76  ? 520  LEU B CD2   1 
ATOM   8954  N N     . ASN B 1 521 ? -35.603 57.691  22.059  1.00 24.84  ? 521  ASN B N     1 
ATOM   8955  C CA    . ASN B 1 521 ? -34.302 58.323  22.239  1.00 25.27  ? 521  ASN B CA    1 
ATOM   8956  C C     . ASN B 1 521 ? -33.185 57.297  22.290  1.00 24.23  ? 521  ASN B C     1 
ATOM   8957  O O     . ASN B 1 521 ? -32.956 56.643  23.310  1.00 23.35  ? 521  ASN B O     1 
ATOM   8958  C CB    . ASN B 1 521 ? -34.241 59.202  23.490  1.00 26.09  ? 521  ASN B CB    1 
ATOM   8959  C CG    . ASN B 1 521 ? -32.866 59.813  23.679  1.00 29.47  ? 521  ASN B CG    1 
ATOM   8960  O OD1   . ASN B 1 521 ? -32.535 60.789  23.019  1.00 32.03  ? 521  ASN B OD1   1 
ATOM   8961  N ND2   . ASN B 1 521 ? -32.035 59.206  24.557  1.00 33.55  ? 521  ASN B ND2   1 
ATOM   8962  N N     . VAL B 1 522 ? -32.482 57.174  21.181  1.00 23.54  ? 522  VAL B N     1 
ATOM   8963  C CA    . VAL B 1 522 ? -31.407 56.216  21.080  1.00 23.11  ? 522  VAL B CA    1 
ATOM   8964  C C     . VAL B 1 522 ? -30.100 57.000  21.014  1.00 23.31  ? 522  VAL B C     1 
ATOM   8965  O O     . VAL B 1 522 ? -29.807 57.629  19.998  1.00 23.73  ? 522  VAL B O     1 
ATOM   8966  C CB    . VAL B 1 522 ? -31.612 55.289  19.841  1.00 23.07  ? 522  VAL B CB    1 
ATOM   8967  C CG1   . VAL B 1 522 ? -30.517 54.205  19.759  1.00 23.07  ? 522  VAL B CG1   1 
ATOM   8968  C CG2   . VAL B 1 522 ? -32.972 54.655  19.896  1.00 20.98  ? 522  VAL B CG2   1 
ATOM   8969  N N     . SER B 1 523 ? -29.332 56.980  22.103  1.00 23.22  ? 523  SER B N     1 
ATOM   8970  C CA    . SER B 1 523 ? -28.068 57.723  22.207  1.00 24.05  ? 523  SER B CA    1 
ATOM   8971  C C     . SER B 1 523 ? -28.274 59.210  21.938  1.00 24.81  ? 523  SER B C     1 
ATOM   8972  O O     . SER B 1 523 ? -27.452 59.834  21.269  1.00 25.66  ? 523  SER B O     1 
ATOM   8973  C CB    . SER B 1 523 ? -26.976 57.182  21.254  1.00 23.89  ? 523  SER B CB    1 
ATOM   8974  O OG    . SER B 1 523 ? -26.769 55.787  21.395  1.00 23.72  ? 523  SER B OG    1 
ATOM   8975  N N     . GLY B 1 524 ? -29.375 59.764  22.433  1.00 24.97  ? 524  GLY B N     1 
ATOM   8976  C CA    . GLY B 1 524 ? -29.705 61.151  22.190  1.00 25.52  ? 524  GLY B CA    1 
ATOM   8977  C C     . GLY B 1 524 ? -30.288 61.399  20.802  1.00 26.40  ? 524  GLY B C     1 
ATOM   8978  O O     . GLY B 1 524 ? -30.508 62.546  20.419  1.00 27.00  ? 524  GLY B O     1 
ATOM   8979  N N     . HIS B 1 525 ? -30.523 60.345  20.028  1.00 25.97  ? 525  HIS B N     1 
ATOM   8980  C CA    . HIS B 1 525 ? -31.135 60.532  18.724  1.00 25.99  ? 525  HIS B CA    1 
ATOM   8981  C C     . HIS B 1 525 ? -32.626 60.207  18.776  1.00 25.41  ? 525  HIS B C     1 
ATOM   8982  O O     . HIS B 1 525 ? -33.036 59.165  19.308  1.00 24.20  ? 525  HIS B O     1 
ATOM   8983  C CB    . HIS B 1 525 ? -30.402 59.747  17.630  1.00 26.51  ? 525  HIS B CB    1 
ATOM   8984  C CG    . HIS B 1 525 ? -28.946 60.086  17.526  1.00 28.60  ? 525  HIS B CG    1 
ATOM   8985  N ND1   . HIS B 1 525 ? -27.956 59.285  18.057  1.00 31.22  ? 525  HIS B ND1   1 
ATOM   8986  C CD2   . HIS B 1 525 ? -28.312 61.156  16.984  1.00 30.42  ? 525  HIS B CD2   1 
ATOM   8987  C CE1   . HIS B 1 525 ? -26.774 59.836  17.827  1.00 30.96  ? 525  HIS B CE1   1 
ATOM   8988  N NE2   . HIS B 1 525 ? -26.961 60.968  17.170  1.00 30.71  ? 525  HIS B NE2   1 
ATOM   8989  N N     . ARG B 1 526 ? -33.412 61.137  18.229  1.00 24.63  ? 526  ARG B N     1 
ATOM   8990  C CA    . ARG B 1 526 ? -34.858 61.055  18.196  1.00 24.20  ? 526  ARG B CA    1 
ATOM   8991  C C     . ARG B 1 526 ? -35.276 60.321  16.920  1.00 24.01  ? 526  ARG B C     1 
ATOM   8992  O O     . ARG B 1 526 ? -34.997 60.765  15.805  1.00 24.26  ? 526  ARG B O     1 
ATOM   8993  C CB    . ARG B 1 526 ? -35.435 62.474  18.287  1.00 24.38  ? 526  ARG B CB    1 
ATOM   8994  C CG    . ARG B 1 526 ? -36.938 62.620  18.189  1.00 23.76  ? 526  ARG B CG    1 
ATOM   8995  C CD    . ARG B 1 526 ? -37.331 64.110  18.260  1.00 24.26  ? 526  ARG B CD    1 
ATOM   8996  N NE    . ARG B 1 526 ? -38.623 64.360  17.618  1.00 21.63  ? 526  ARG B NE    1 
ATOM   8997  C CZ    . ARG B 1 526 ? -39.246 65.530  17.574  1.00 20.15  ? 526  ARG B CZ    1 
ATOM   8998  N NH1   . ARG B 1 526 ? -38.707 66.615  18.138  1.00 19.66  ? 526  ARG B NH1   1 
ATOM   8999  N NH2   . ARG B 1 526 ? -40.419 65.613  16.954  1.00 17.64  ? 526  ARG B NH2   1 
ATOM   9000  N N     . LEU B 1 527 ? -35.928 59.181  17.096  1.00 23.62  ? 527  LEU B N     1 
ATOM   9001  C CA    . LEU B 1 527 ? -36.283 58.299  15.980  1.00 23.33  ? 527  LEU B CA    1 
ATOM   9002  C C     . LEU B 1 527 ? -37.709 57.771  16.158  1.00 22.64  ? 527  LEU B C     1 
ATOM   9003  O O     . LEU B 1 527 ? -38.107 57.412  17.262  1.00 22.72  ? 527  LEU B O     1 
ATOM   9004  C CB    . LEU B 1 527 ? -35.308 57.109  15.909  1.00 23.45  ? 527  LEU B CB    1 
ATOM   9005  C CG    . LEU B 1 527 ? -33.827 57.282  15.537  1.00 24.70  ? 527  LEU B CG    1 
ATOM   9006  C CD1   . LEU B 1 527 ? -33.096 55.958  15.729  1.00 26.33  ? 527  LEU B CD1   1 
ATOM   9007  C CD2   . LEU B 1 527 ? -33.613 57.815  14.098  1.00 26.09  ? 527  LEU B CD2   1 
ATOM   9008  N N     . GLY B 1 528 ? -38.473 57.710  15.081  1.00 21.98  ? 528  GLY B N     1 
ATOM   9009  C CA    . GLY B 1 528 ? -39.823 57.176  15.174  1.00 21.89  ? 528  GLY B CA    1 
ATOM   9010  C C     . GLY B 1 528 ? -39.818 55.658  15.134  1.00 21.76  ? 528  GLY B C     1 
ATOM   9011  O O     . GLY B 1 528 ? -39.066 55.063  14.367  1.00 21.59  ? 528  GLY B O     1 
ATOM   9012  N N     . THR B 1 529 ? -40.656 55.017  15.947  1.00 21.48  ? 529  THR B N     1 
ATOM   9013  C CA    . THR B 1 529 ? -40.836 53.561  15.792  1.00 21.01  ? 529  THR B CA    1 
ATOM   9014  C C     . THR B 1 529 ? -41.421 53.216  14.415  1.00 20.50  ? 529  THR B C     1 
ATOM   9015  O O     . THR B 1 529 ? -40.985 52.264  13.772  1.00 20.43  ? 529  THR B O     1 
ATOM   9016  C CB    . THR B 1 529 ? -41.633 52.869  16.960  1.00 20.96  ? 529  THR B CB    1 
ATOM   9017  O OG1   . THR B 1 529 ? -43.017 53.256  16.950  1.00 21.69  ? 529  THR B OG1   1 
ATOM   9018  C CG2   . THR B 1 529 ? -41.008 53.171  18.311  1.00 18.95  ? 529  THR B CG2   1 
ATOM   9019  N N     . ALA B 1 530 ? -42.366 54.018  13.944  1.00 20.45  ? 530  ALA B N     1 
ATOM   9020  C CA    . ALA B 1 530 ? -43.014 53.732  12.661  1.00 21.08  ? 530  ALA B CA    1 
ATOM   9021  C C     . ALA B 1 530 ? -42.042 53.755  11.493  1.00 21.09  ? 530  ALA B C     1 
ATOM   9022  O O     . ALA B 1 530 ? -42.133 52.915  10.588  1.00 21.65  ? 530  ALA B O     1 
ATOM   9023  C CB    . ALA B 1 530 ? -44.188 54.650  12.412  1.00 20.60  ? 530  ALA B CB    1 
ATOM   9024  N N     . GLU B 1 531 ? -41.096 54.689  11.526  1.00 21.48  ? 531  GLU B N     1 
ATOM   9025  C CA    . GLU B 1 531 ? -40.105 54.802  10.450  1.00 21.82  ? 531  GLU B CA    1 
ATOM   9026  C C     . GLU B 1 531 ? -39.127 53.614  10.395  1.00 21.35  ? 531  GLU B C     1 
ATOM   9027  O O     . GLU B 1 531 ? -38.674 53.219  9.326   1.00 21.07  ? 531  GLU B O     1 
ATOM   9028  C CB    . GLU B 1 531 ? -39.384 56.169  10.490  1.00 21.80  ? 531  GLU B CB    1 
ATOM   9029  C CG    . GLU B 1 531 ? -38.229 56.298  11.460  1.00 22.13  ? 531  GLU B CG    1 
ATOM   9030  C CD    . GLU B 1 531 ? -37.638 57.710  11.461  1.00 23.21  ? 531  GLU B CD    1 
ATOM   9031  O OE1   . GLU B 1 531 ? -36.851 58.059  10.537  1.00 24.63  ? 531  GLU B OE1   1 
ATOM   9032  O OE2   . GLU B 1 531 ? -37.981 58.482  12.382  1.00 24.85  ? 531  GLU B OE2   1 
ATOM   9033  N N     . ILE B 1 532 ? -38.814 53.040  11.548  1.00 21.71  ? 532  ILE B N     1 
ATOM   9034  C CA    . ILE B 1 532 ? -37.984 51.835  11.594  1.00 21.36  ? 532  ILE B CA    1 
ATOM   9035  C C     . ILE B 1 532 ? -38.787 50.622  11.107  1.00 21.71  ? 532  ILE B C     1 
ATOM   9036  O O     . ILE B 1 532 ? -38.268 49.792  10.343  1.00 22.00  ? 532  ILE B O     1 
ATOM   9037  C CB    . ILE B 1 532 ? -37.392 51.611  13.004  1.00 22.04  ? 532  ILE B CB    1 
ATOM   9038  C CG1   . ILE B 1 532 ? -36.591 52.860  13.434  1.00 20.61  ? 532  ILE B CG1   1 
ATOM   9039  C CG2   . ILE B 1 532 ? -36.520 50.352  13.038  1.00 20.53  ? 532  ILE B CG2   1 
ATOM   9040  C CD1   . ILE B 1 532 ? -36.290 52.903  14.887  1.00 20.17  ? 532  ILE B CD1   1 
ATOM   9041  N N     . GLU B 1 533 ? -40.061 50.554  11.503  1.00 21.38  ? 533  GLU B N     1 
ATOM   9042  C CA    . GLU B 1 533 ? -40.990 49.517  11.010  1.00 21.22  ? 533  GLU B CA    1 
ATOM   9043  C C     . GLU B 1 533 ? -41.154 49.539  9.509   1.00 21.34  ? 533  GLU B C     1 
ATOM   9044  O O     . GLU B 1 533 ? -41.244 48.477  8.870   1.00 21.58  ? 533  GLU B O     1 
ATOM   9045  C CB    . GLU B 1 533 ? -42.357 49.622  11.687  1.00 20.79  ? 533  GLU B CB    1 
ATOM   9046  C CG    . GLU B 1 533 ? -42.318 49.203  13.153  1.00 20.99  ? 533  GLU B CG    1 
ATOM   9047  C CD    . GLU B 1 533 ? -43.577 49.549  13.923  1.00 21.58  ? 533  GLU B CD    1 
ATOM   9048  O OE1   . GLU B 1 533 ? -44.609 49.846  13.305  1.00 23.51  ? 533  GLU B OE1   1 
ATOM   9049  O OE2   . GLU B 1 533 ? -43.550 49.498  15.167  1.00 21.26  ? 533  GLU B OE2   1 
ATOM   9050  N N     . SER B 1 534 ? -41.186 50.742  8.944   1.00 21.22  ? 534  SER B N     1 
ATOM   9051  C CA    . SER B 1 534 ? -41.255 50.913  7.492   1.00 21.45  ? 534  SER B CA    1 
ATOM   9052  C C     . SER B 1 534 ? -40.007 50.380  6.821   1.00 20.82  ? 534  SER B C     1 
ATOM   9053  O O     . SER B 1 534 ? -40.073 49.653  5.819   1.00 20.66  ? 534  SER B O     1 
ATOM   9054  C CB    . SER B 1 534 ? -41.351 52.400  7.137   1.00 21.52  ? 534  SER B CB    1 
ATOM   9055  O OG    . SER B 1 534 ? -42.685 52.746  6.932   1.00 24.39  ? 534  SER B OG    1 
ATOM   9056  N N     . ALA B 1 535 ? -38.861 50.776  7.359   1.00 19.90  ? 535  ALA B N     1 
ATOM   9057  C CA    . ALA B 1 535 ? -37.606 50.321  6.806   1.00 19.77  ? 535  ALA B CA    1 
ATOM   9058  C C     . ALA B 1 535 ? -37.563 48.801  6.845   1.00 19.23  ? 535  ALA B C     1 
ATOM   9059  O O     . ALA B 1 535 ? -37.231 48.183  5.855   1.00 20.24  ? 535  ALA B O     1 
ATOM   9060  C CB    . ALA B 1 535 ? -36.422 50.949  7.536   1.00 19.35  ? 535  ALA B CB    1 
ATOM   9061  N N     . LEU B 1 536 ? -37.955 48.202  7.964   1.00 19.20  ? 536  LEU B N     1 
ATOM   9062  C CA    . LEU B 1 536 ? -37.943 46.754  8.089   1.00 19.70  ? 536  LEU B CA    1 
ATOM   9063  C C     . LEU B 1 536 ? -38.832 46.083  7.056   1.00 20.29  ? 536  LEU B C     1 
ATOM   9064  O O     . LEU B 1 536 ? -38.335 45.345  6.203   1.00 20.86  ? 536  LEU B O     1 
ATOM   9065  C CB    . LEU B 1 536 ? -38.348 46.327  9.488   1.00 19.06  ? 536  LEU B CB    1 
ATOM   9066  C CG    . LEU B 1 536 ? -37.277 46.578  10.540  1.00 19.23  ? 536  LEU B CG    1 
ATOM   9067  C CD1   . LEU B 1 536 ? -37.856 46.512  11.938  1.00 18.93  ? 536  LEU B CD1   1 
ATOM   9068  C CD2   . LEU B 1 536 ? -36.118 45.606  10.400  1.00 17.72  ? 536  LEU B CD2   1 
ATOM   9069  N N     . VAL B 1 537 ? -40.142 46.353  7.127   1.00 20.54  ? 537  VAL B N     1 
ATOM   9070  C CA    . VAL B 1 537 ? -41.138 45.813  6.187   1.00 20.36  ? 537  VAL B CA    1 
ATOM   9071  C C     . VAL B 1 537 ? -40.759 45.993  4.692   1.00 20.48  ? 537  VAL B C     1 
ATOM   9072  O O     . VAL B 1 537 ? -41.181 45.199  3.837   1.00 20.78  ? 537  VAL B O     1 
ATOM   9073  C CB    . VAL B 1 537 ? -42.540 46.378  6.512   1.00 20.53  ? 537  VAL B CB    1 
ATOM   9074  C CG1   . VAL B 1 537 ? -43.552 45.992  5.480   1.00 21.00  ? 537  VAL B CG1   1 
ATOM   9075  C CG2   . VAL B 1 537 ? -42.992 45.889  7.901   1.00 21.58  ? 537  VAL B CG2   1 
ATOM   9076  N N     . ALA B 1 538 ? -39.942 46.997  4.373   1.00 19.77  ? 538  ALA B N     1 
ATOM   9077  C CA    . ALA B 1 538 ? -39.489 47.160  2.985   1.00 19.69  ? 538  ALA B CA    1 
ATOM   9078  C C     . ALA B 1 538 ? -38.516 46.065  2.543   1.00 19.67  ? 538  ALA B C     1 
ATOM   9079  O O     . ALA B 1 538 ? -38.323 45.862  1.337   1.00 19.68  ? 538  ALA B O     1 
ATOM   9080  C CB    . ALA B 1 538 ? -38.881 48.530  2.760   1.00 19.32  ? 538  ALA B CB    1 
ATOM   9081  N N     . HIS B 1 539 ? -37.911 45.362  3.504   1.00 19.62  ? 539  HIS B N     1 
ATOM   9082  C CA    . HIS B 1 539 ? -37.000 44.252  3.183   1.00 19.51  ? 539  HIS B CA    1 
ATOM   9083  C C     . HIS B 1 539 ? -37.797 43.122  2.516   1.00 19.70  ? 539  HIS B C     1 
ATOM   9084  O O     . HIS B 1 539 ? -38.852 42.753  3.001   1.00 19.08  ? 539  HIS B O     1 
ATOM   9085  C CB    . HIS B 1 539 ? -36.272 43.746  4.440   1.00 19.07  ? 539  HIS B CB    1 
ATOM   9086  C CG    . HIS B 1 539 ? -35.263 42.678  4.151   1.00 18.49  ? 539  HIS B CG    1 
ATOM   9087  N ND1   . HIS B 1 539 ? -35.620 41.383  3.837   1.00 17.36  ? 539  HIS B ND1   1 
ATOM   9088  C CD2   . HIS B 1 539 ? -33.910 42.722  4.083   1.00 17.41  ? 539  HIS B CD2   1 
ATOM   9089  C CE1   . HIS B 1 539 ? -34.534 40.675  3.583   1.00 19.62  ? 539  HIS B CE1   1 
ATOM   9090  N NE2   . HIS B 1 539 ? -33.481 41.463  3.731   1.00 19.86  ? 539  HIS B NE2   1 
ATOM   9091  N N     . PRO B 1 540 ? -37.293 42.561  1.402   1.00 20.46  ? 540  PRO B N     1 
ATOM   9092  C CA    . PRO B 1 540 ? -38.143 41.660  0.597   1.00 20.88  ? 540  PRO B CA    1 
ATOM   9093  C C     . PRO B 1 540 ? -38.560 40.373  1.304   1.00 21.00  ? 540  PRO B C     1 
ATOM   9094  O O     . PRO B 1 540 ? -39.351 39.626  0.764   1.00 21.95  ? 540  PRO B O     1 
ATOM   9095  C CB    . PRO B 1 540 ? -37.266 41.302  -0.615  1.00 20.55  ? 540  PRO B CB    1 
ATOM   9096  C CG    . PRO B 1 540 ? -36.113 42.193  -0.574  1.00 21.27  ? 540  PRO B CG    1 
ATOM   9097  C CD    . PRO B 1 540 ? -35.950 42.717  0.825   1.00 20.84  ? 540  PRO B CD    1 
ATOM   9098  N N     . LYS B 1 541 ? -38.025 40.105  2.483   1.00 20.92  ? 541  LYS B N     1 
ATOM   9099  C CA    . LYS B 1 541 ? -38.331 38.860  3.188   1.00 20.91  ? 541  LYS B CA    1 
ATOM   9100  C C     . LYS B 1 541 ? -39.162 39.092  4.449   1.00 20.24  ? 541  LYS B C     1 
ATOM   9101  O O     . LYS B 1 541 ? -39.571 38.142  5.088   1.00 19.66  ? 541  LYS B O     1 
ATOM   9102  C CB    . LYS B 1 541 ? -37.044 38.106  3.548   1.00 21.33  ? 541  LYS B CB    1 
ATOM   9103  C CG    . LYS B 1 541 ? -36.333 37.487  2.377   1.00 21.31  ? 541  LYS B CG    1 
ATOM   9104  C CD    . LYS B 1 541 ? -35.058 36.845  2.835   1.00 23.23  ? 541  LYS B CD    1 
ATOM   9105  C CE    . LYS B 1 541 ? -34.644 35.745  1.878   1.00 26.20  ? 541  LYS B CE    1 
ATOM   9106  N NZ    . LYS B 1 541 ? -33.158 35.706  1.665   1.00 27.69  ? 541  LYS B NZ    1 
ATOM   9107  N N     . ILE B 1 542 ? -39.395 40.359  4.794   1.00 20.01  ? 542  ILE B N     1 
ATOM   9108  C CA    . ILE B 1 542 ? -40.176 40.723  5.973   1.00 19.41  ? 542  ILE B CA    1 
ATOM   9109  C C     . ILE B 1 542 ? -41.626 41.041  5.579   1.00 20.41  ? 542  ILE B C     1 
ATOM   9110  O O     . ILE B 1 542 ? -41.877 41.828  4.648   1.00 18.97  ? 542  ILE B O     1 
ATOM   9111  C CB    . ILE B 1 542 ? -39.523 41.920  6.728   1.00 19.72  ? 542  ILE B CB    1 
ATOM   9112  C CG1   . ILE B 1 542 ? -38.113 41.530  7.207   1.00 18.80  ? 542  ILE B CG1   1 
ATOM   9113  C CG2   . ILE B 1 542 ? -40.413 42.426  7.870   1.00 18.13  ? 542  ILE B CG2   1 
ATOM   9114  C CD1   . ILE B 1 542 ? -37.428 42.583  8.048   1.00 19.30  ? 542  ILE B CD1   1 
ATOM   9115  N N     . ALA B 1 543 ? -42.559 40.392  6.284   1.00 20.75  ? 543  ALA B N     1 
ATOM   9116  C CA    . ALA B 1 543 ? -43.992 40.659  6.146   1.00 22.19  ? 543  ALA B CA    1 
ATOM   9117  C C     . ALA B 1 543 ? -44.474 41.815  7.031   1.00 22.76  ? 543  ALA B C     1 
ATOM   9118  O O     . ALA B 1 543 ? -45.350 42.587  6.656   1.00 23.03  ? 543  ALA B O     1 
ATOM   9119  C CB    . ALA B 1 543 ? -44.806 39.382  6.465   1.00 21.85  ? 543  ALA B CB    1 
ATOM   9120  N N     . GLU B 1 544 ? -43.862 41.941  8.197   1.00 23.67  ? 544  GLU B N     1 
ATOM   9121  C CA    . GLU B 1 544 ? -44.466 42.634  9.299   1.00 24.39  ? 544  GLU B CA    1 
ATOM   9122  C C     . GLU B 1 544 ? -43.395 42.921  10.361  1.00 24.35  ? 544  GLU B C     1 
ATOM   9123  O O     . GLU B 1 544 ? -42.533 42.071  10.644  1.00 24.27  ? 544  GLU B O     1 
ATOM   9124  C CB    . GLU B 1 544 ? -45.502 41.681  9.864   1.00 25.11  ? 544  GLU B CB    1 
ATOM   9125  C CG    . GLU B 1 544 ? -46.628 42.303  10.569  1.00 28.24  ? 544  GLU B CG    1 
ATOM   9126  C CD    . GLU B 1 544 ? -47.938 41.509  10.444  1.00 29.57  ? 544  GLU B CD    1 
ATOM   9127  O OE1   . GLU B 1 544 ? -47.944 40.298  10.104  1.00 27.68  ? 544  GLU B OE1   1 
ATOM   9128  O OE2   . GLU B 1 544 ? -48.970 42.139  10.714  1.00 30.35  ? 544  GLU B OE2   1 
ATOM   9129  N N     . ALA B 1 545 ? -43.448 44.110  10.954  1.00 23.86  ? 545  ALA B N     1 
ATOM   9130  C CA    . ALA B 1 545 ? -42.547 44.441  12.043  1.00 23.81  ? 545  ALA B CA    1 
ATOM   9131  C C     . ALA B 1 545 ? -43.204 45.355  13.062  1.00 23.94  ? 545  ALA B C     1 
ATOM   9132  O O     . ALA B 1 545 ? -43.990 46.253  12.708  1.00 25.01  ? 545  ALA B O     1 
ATOM   9133  C CB    . ALA B 1 545 ? -41.250 45.075  11.509  1.00 23.43  ? 545  ALA B CB    1 
ATOM   9134  N N     . ALA B 1 546 ? -42.882 45.133  14.331  1.00 23.29  ? 546  ALA B N     1 
ATOM   9135  C CA    . ALA B 1 546 ? -43.212 46.107  15.381  1.00 22.44  ? 546  ALA B CA    1 
ATOM   9136  C C     . ALA B 1 546 ? -41.947 46.435  16.171  1.00 22.02  ? 546  ALA B C     1 
ATOM   9137  O O     . ALA B 1 546 ? -41.208 45.547  16.629  1.00 21.64  ? 546  ALA B O     1 
ATOM   9138  C CB    . ALA B 1 546 ? -44.314 45.589  16.291  1.00 21.80  ? 546  ALA B CB    1 
ATOM   9139  N N     . VAL B 1 547 ? -41.700 47.729  16.305  1.00 21.69  ? 547  VAL B N     1 
ATOM   9140  C CA    . VAL B 1 547 ? -40.494 48.221  16.939  1.00 20.70  ? 547  VAL B CA    1 
ATOM   9141  C C     . VAL B 1 547 ? -40.850 48.935  18.225  1.00 20.72  ? 547  VAL B C     1 
ATOM   9142  O O     . VAL B 1 547 ? -41.682 49.853  18.221  1.00 20.43  ? 547  VAL B O     1 
ATOM   9143  C CB    . VAL B 1 547 ? -39.733 49.196  16.015  1.00 20.53  ? 547  VAL B CB    1 
ATOM   9144  C CG1   . VAL B 1 547 ? -38.551 49.830  16.758  1.00 19.94  ? 547  VAL B CG1   1 
ATOM   9145  C CG2   . VAL B 1 547 ? -39.282 48.485  14.763  1.00 19.95  ? 547  VAL B CG2   1 
ATOM   9146  N N     . VAL B 1 548 ? -40.209 48.501  19.319  1.00 21.01  ? 548  VAL B N     1 
ATOM   9147  C CA    . VAL B 1 548 ? -40.313 49.169  20.623  1.00 20.30  ? 548  VAL B CA    1 
ATOM   9148  C C     . VAL B 1 548 ? -38.941 49.604  21.142  1.00 20.56  ? 548  VAL B C     1 
ATOM   9149  O O     . VAL B 1 548 ? -37.906 49.072  20.738  1.00 20.48  ? 548  VAL B O     1 
ATOM   9150  C CB    . VAL B 1 548 ? -41.033 48.281  21.689  1.00 20.48  ? 548  VAL B CB    1 
ATOM   9151  C CG1   . VAL B 1 548 ? -42.467 47.890  21.221  1.00 19.93  ? 548  VAL B CG1   1 
ATOM   9152  C CG2   . VAL B 1 548 ? -40.211 47.040  22.018  1.00 19.15  ? 548  VAL B CG2   1 
ATOM   9153  N N     . GLY B 1 549 ? -38.959 50.576  22.048  1.00 20.80  ? 549  GLY B N     1 
ATOM   9154  C CA    . GLY B 1 549 ? -37.793 50.966  22.820  1.00 21.50  ? 549  GLY B CA    1 
ATOM   9155  C C     . GLY B 1 549 ? -37.712 50.251  24.160  1.00 22.46  ? 549  GLY B C     1 
ATOM   9156  O O     . GLY B 1 549 ? -38.723 50.074  24.853  1.00 21.65  ? 549  GLY B O     1 
ATOM   9157  N N     . ILE B 1 550 ? -36.501 49.813  24.497  1.00 23.07  ? 550  ILE B N     1 
ATOM   9158  C CA    . ILE B 1 550 ? -36.210 49.236  25.805  1.00 24.22  ? 550  ILE B CA    1 
ATOM   9159  C C     . ILE B 1 550 ? -35.120 50.068  26.497  1.00 24.45  ? 550  ILE B C     1 
ATOM   9160  O O     . ILE B 1 550 ? -34.333 50.751  25.813  1.00 24.55  ? 550  ILE B O     1 
ATOM   9161  C CB    . ILE B 1 550 ? -35.783 47.745  25.719  1.00 24.02  ? 550  ILE B CB    1 
ATOM   9162  C CG1   . ILE B 1 550 ? -34.439 47.595  24.979  1.00 25.67  ? 550  ILE B CG1   1 
ATOM   9163  C CG2   . ILE B 1 550 ? -36.910 46.906  25.082  1.00 24.04  ? 550  ILE B CG2   1 
ATOM   9164  C CD1   . ILE B 1 550 ? -33.738 46.187  25.142  1.00 25.27  ? 550  ILE B CD1   1 
ATOM   9165  N N     . PRO B 1 551 ? -35.085 50.022  27.847  1.00 24.33  ? 551  PRO B N     1 
ATOM   9166  C CA    . PRO B 1 551 ? -34.032 50.660  28.634  1.00 24.39  ? 551  PRO B CA    1 
ATOM   9167  C C     . PRO B 1 551 ? -32.647 50.180  28.205  1.00 24.20  ? 551  PRO B C     1 
ATOM   9168  O O     . PRO B 1 551 ? -32.482 49.007  27.923  1.00 24.34  ? 551  PRO B O     1 
ATOM   9169  C CB    . PRO B 1 551 ? -34.337 50.192  30.070  1.00 24.63  ? 551  PRO B CB    1 
ATOM   9170  C CG    . PRO B 1 551 ? -35.816 49.884  30.065  1.00 23.80  ? 551  PRO B CG    1 
ATOM   9171  C CD    . PRO B 1 551 ? -36.081 49.338  28.704  1.00 24.14  ? 551  PRO B CD    1 
ATOM   9172  N N     . HIS B 1 552 ? -31.682 51.090  28.118  1.00 24.07  ? 552  HIS B N     1 
ATOM   9173  C CA    . HIS B 1 552 ? -30.297 50.720  27.823  1.00 24.40  ? 552  HIS B CA    1 
ATOM   9174  C C     . HIS B 1 552 ? -29.363 51.587  28.649  1.00 24.38  ? 552  HIS B C     1 
ATOM   9175  O O     . HIS B 1 552 ? -29.539 52.807  28.714  1.00 23.71  ? 552  HIS B O     1 
ATOM   9176  C CB    . HIS B 1 552 ? -29.958 50.860  26.333  1.00 24.51  ? 552  HIS B CB    1 
ATOM   9177  C CG    . HIS B 1 552 ? -28.624 50.281  25.973  1.00 25.14  ? 552  HIS B CG    1 
ATOM   9178  N ND1   . HIS B 1 552 ? -28.480 49.013  25.448  1.00 25.85  ? 552  HIS B ND1   1 
ATOM   9179  C CD2   . HIS B 1 552 ? -27.367 50.778  26.107  1.00 26.75  ? 552  HIS B CD2   1 
ATOM   9180  C CE1   . HIS B 1 552 ? -27.198 48.764  25.248  1.00 27.82  ? 552  HIS B CE1   1 
ATOM   9181  N NE2   . HIS B 1 552 ? -26.500 49.815  25.649  1.00 27.21  ? 552  HIS B NE2   1 
ATOM   9182  N N     . ALA B 1 553 ? -28.366 50.948  29.269  1.00 24.66  ? 553  ALA B N     1 
ATOM   9183  C CA    . ALA B 1 553 ? -27.518 51.610  30.276  1.00 24.59  ? 553  ALA B CA    1 
ATOM   9184  C C     . ALA B 1 553 ? -26.683 52.755  29.722  1.00 24.47  ? 553  ALA B C     1 
ATOM   9185  O O     . ALA B 1 553 ? -26.414 53.725  30.429  1.00 24.94  ? 553  ALA B O     1 
ATOM   9186  C CB    . ALA B 1 553 ? -26.638 50.598  31.020  1.00 24.41  ? 553  ALA B CB    1 
ATOM   9187  N N     . ILE B 1 554 ? -26.276 52.653  28.466  1.00 24.65  ? 554  ILE B N     1 
ATOM   9188  C CA    . ILE B 1 554 ? -25.456 53.705  27.892  1.00 24.73  ? 554  ILE B CA    1 
ATOM   9189  C C     . ILE B 1 554 ? -26.303 54.582  26.982  1.00 24.44  ? 554  ILE B C     1 
ATOM   9190  O O     . ILE B 1 554 ? -26.395 55.818  27.176  1.00 24.66  ? 554  ILE B O     1 
ATOM   9191  C CB    . ILE B 1 554 ? -24.228 53.135  27.142  1.00 25.12  ? 554  ILE B CB    1 
ATOM   9192  C CG1   . ILE B 1 554 ? -23.481 52.105  28.013  1.00 25.49  ? 554  ILE B CG1   1 
ATOM   9193  C CG2   . ILE B 1 554 ? -23.293 54.285  26.672  1.00 25.98  ? 554  ILE B CG2   1 
ATOM   9194  C CD1   . ILE B 1 554 ? -22.980 52.644  29.376  1.00 24.68  ? 554  ILE B CD1   1 
ATOM   9195  N N     . LYS B 1 555 ? -26.960 53.913  26.035  1.00 24.00  ? 555  LYS B N     1 
ATOM   9196  C CA    . LYS B 1 555 ? -27.769 54.539  25.001  1.00 23.48  ? 555  LYS B CA    1 
ATOM   9197  C C     . LYS B 1 555 ? -29.024 55.266  25.488  1.00 23.23  ? 555  LYS B C     1 
ATOM   9198  O O     . LYS B 1 555 ? -29.577 56.067  24.752  1.00 24.15  ? 555  LYS B O     1 
ATOM   9199  C CB    . LYS B 1 555 ? -28.206 53.487  24.010  1.00 23.57  ? 555  LYS B CB    1 
ATOM   9200  C CG    . LYS B 1 555 ? -27.107 52.805  23.241  1.00 24.94  ? 555  LYS B CG    1 
ATOM   9201  C CD    . LYS B 1 555 ? -27.749 51.750  22.338  1.00 27.12  ? 555  LYS B CD    1 
ATOM   9202  C CE    . LYS B 1 555 ? -26.725 50.917  21.633  1.00 29.34  ? 555  LYS B CE    1 
ATOM   9203  N NZ    . LYS B 1 555 ? -27.040 50.916  20.185  1.00 31.28  ? 555  LYS B NZ    1 
ATOM   9204  N N     . GLY B 1 556 ? -29.496 54.982  26.696  1.00 22.54  ? 556  GLY B N     1 
ATOM   9205  C CA    . GLY B 1 556 ? -30.770 55.523  27.155  1.00 22.00  ? 556  GLY B CA    1 
ATOM   9206  C C     . GLY B 1 556 ? -31.828 54.519  26.764  1.00 22.39  ? 556  GLY B C     1 
ATOM   9207  O O     . GLY B 1 556 ? -32.377 53.809  27.627  1.00 22.87  ? 556  GLY B O     1 
ATOM   9208  N N     . GLN B 1 557 ? -32.095 54.430  25.461  1.00 21.73  ? 557  GLN B N     1 
ATOM   9209  C CA    . GLN B 1 557 ? -32.937 53.357  24.919  1.00 21.93  ? 557  GLN B CA    1 
ATOM   9210  C C     . GLN B 1 557 ? -32.253 52.591  23.802  1.00 21.75  ? 557  GLN B C     1 
ATOM   9211  O O     . GLN B 1 557 ? -31.456 53.157  23.055  1.00 21.43  ? 557  GLN B O     1 
ATOM   9212  C CB    . GLN B 1 557 ? -34.244 53.890  24.355  1.00 21.80  ? 557  GLN B CB    1 
ATOM   9213  C CG    . GLN B 1 557 ? -35.216 54.424  25.353  1.00 22.51  ? 557  GLN B CG    1 
ATOM   9214  C CD    . GLN B 1 557 ? -36.488 54.871  24.665  1.00 24.41  ? 557  GLN B CD    1 
ATOM   9215  O OE1   . GLN B 1 557 ? -36.454 55.731  23.783  1.00 24.07  ? 557  GLN B OE1   1 
ATOM   9216  N NE2   . GLN B 1 557 ? -37.623 54.289  25.067  1.00 23.33  ? 557  GLN B NE2   1 
ATOM   9217  N N     . ALA B 1 558 ? -32.583 51.302  23.702  1.00 21.93  ? 558  ALA B N     1 
ATOM   9218  C CA    . ALA B 1 558 ? -32.155 50.447  22.594  1.00 21.58  ? 558  ALA B CA    1 
ATOM   9219  C C     . ALA B 1 558 ? -33.353 50.152  21.678  1.00 22.04  ? 558  ALA B C     1 
ATOM   9220  O O     . ALA B 1 558 ? -34.515 50.311  22.087  1.00 22.75  ? 558  ALA B O     1 
ATOM   9221  C CB    . ALA B 1 558 ? -31.554 49.154  23.135  1.00 21.69  ? 558  ALA B CB    1 
ATOM   9222  N N     . ILE B 1 559 ? -33.081 49.746  20.438  1.00 21.91  ? 559  ILE B N     1 
ATOM   9223  C CA    . ILE B 1 559 ? -34.141 49.470  19.475  1.00 21.15  ? 559  ILE B CA    1 
ATOM   9224  C C     . ILE B 1 559 ? -34.411 47.961  19.395  1.00 21.08  ? 559  ILE B C     1 
ATOM   9225  O O     . ILE B 1 559 ? -33.556 47.181  18.953  1.00 20.47  ? 559  ILE B O     1 
ATOM   9226  C CB    . ILE B 1 559 ? -33.820 50.037  18.071  1.00 21.42  ? 559  ILE B CB    1 
ATOM   9227  C CG1   . ILE B 1 559 ? -33.706 51.554  18.117  1.00 21.52  ? 559  ILE B CG1   1 
ATOM   9228  C CG2   . ILE B 1 559 ? -34.909 49.643  17.064  1.00 20.31  ? 559  ILE B CG2   1 
ATOM   9229  C CD1   . ILE B 1 559 ? -33.062 52.162  16.839  1.00 20.55  ? 559  ILE B CD1   1 
ATOM   9230  N N     . TYR B 1 560 ? -35.605 47.570  19.840  1.00 20.44  ? 560  TYR B N     1 
ATOM   9231  C CA    . TYR B 1 560 ? -35.994 46.175  19.916  1.00 19.88  ? 560  TYR B CA    1 
ATOM   9232  C C     . TYR B 1 560 ? -37.099 45.939  18.884  1.00 20.08  ? 560  TYR B C     1 
ATOM   9233  O O     . TYR B 1 560 ? -38.190 46.523  18.956  1.00 20.52  ? 560  TYR B O     1 
ATOM   9234  C CB    . TYR B 1 560 ? -36.452 45.856  21.331  1.00 19.74  ? 560  TYR B CB    1 
ATOM   9235  C CG    . TYR B 1 560 ? -36.755 44.399  21.639  1.00 19.88  ? 560  TYR B CG    1 
ATOM   9236  C CD1   . TYR B 1 560 ? -37.838 43.736  21.037  1.00 19.07  ? 560  TYR B CD1   1 
ATOM   9237  C CD2   . TYR B 1 560 ? -35.999 43.700  22.590  1.00 20.38  ? 560  TYR B CD2   1 
ATOM   9238  C CE1   . TYR B 1 560 ? -38.130 42.403  21.340  1.00 19.06  ? 560  TYR B CE1   1 
ATOM   9239  C CE2   . TYR B 1 560 ? -36.287 42.369  22.918  1.00 20.33  ? 560  TYR B CE2   1 
ATOM   9240  C CZ    . TYR B 1 560 ? -37.354 41.726  22.293  1.00 20.59  ? 560  TYR B CZ    1 
ATOM   9241  O OH    . TYR B 1 560 ? -37.625 40.401  22.602  1.00 20.91  ? 560  TYR B OH    1 
ATOM   9242  N N     . ALA B 1 561 ? -36.798 45.097  17.905  1.00 19.88  ? 561  ALA B N     1 
ATOM   9243  C CA    . ALA B 1 561 ? -37.664 44.927  16.749  1.00 19.22  ? 561  ALA B CA    1 
ATOM   9244  C C     . ALA B 1 561 ? -38.221 43.517  16.692  1.00 19.11  ? 561  ALA B C     1 
ATOM   9245  O O     . ALA B 1 561 ? -37.466 42.532  16.594  1.00 18.89  ? 561  ALA B O     1 
ATOM   9246  C CB    . ALA B 1 561 ? -36.887 45.250  15.469  1.00 19.09  ? 561  ALA B CB    1 
ATOM   9247  N N     . TYR B 1 562 ? -39.543 43.420  16.769  1.00 19.41  ? 562  TYR B N     1 
ATOM   9248  C CA    . TYR B 1 562 ? -40.232 42.146  16.522  1.00 20.26  ? 562  TYR B CA    1 
ATOM   9249  C C     . TYR B 1 562 ? -40.452 41.979  15.023  1.00 20.38  ? 562  TYR B C     1 
ATOM   9250  O O     . TYR B 1 562 ? -41.003 42.876  14.372  1.00 20.64  ? 562  TYR B O     1 
ATOM   9251  C CB    . TYR B 1 562 ? -41.585 42.095  17.227  1.00 20.04  ? 562  TYR B CB    1 
ATOM   9252  C CG    . TYR B 1 562 ? -41.565 42.108  18.739  1.00 20.45  ? 562  TYR B CG    1 
ATOM   9253  C CD1   . TYR B 1 562 ? -41.466 43.312  19.445  1.00 20.93  ? 562  TYR B CD1   1 
ATOM   9254  C CD2   . TYR B 1 562 ? -41.707 40.933  19.466  1.00 20.42  ? 562  TYR B CD2   1 
ATOM   9255  C CE1   . TYR B 1 562 ? -41.493 43.345  20.838  1.00 19.72  ? 562  TYR B CE1   1 
ATOM   9256  C CE2   . TYR B 1 562 ? -41.735 40.956  20.877  1.00 21.24  ? 562  TYR B CE2   1 
ATOM   9257  C CZ    . TYR B 1 562 ? -41.624 42.169  21.550  1.00 20.81  ? 562  TYR B CZ    1 
ATOM   9258  O OH    . TYR B 1 562 ? -41.642 42.207  22.930  1.00 20.35  ? 562  TYR B OH    1 
ATOM   9259  N N     . VAL B 1 563 ? -40.031 40.846  14.473  1.00 20.39  ? 563  VAL B N     1 
ATOM   9260  C CA    . VAL B 1 563 ? -40.093 40.669  13.018  1.00 21.22  ? 563  VAL B CA    1 
ATOM   9261  C C     . VAL B 1 563 ? -40.754 39.362  12.605  1.00 21.12  ? 563  VAL B C     1 
ATOM   9262  O O     . VAL B 1 563 ? -40.329 38.279  13.027  1.00 21.77  ? 563  VAL B O     1 
ATOM   9263  C CB    . VAL B 1 563 ? -38.690 40.816  12.351  1.00 20.89  ? 563  VAL B CB    1 
ATOM   9264  C CG1   . VAL B 1 563 ? -38.748 40.518  10.871  1.00 20.75  ? 563  VAL B CG1   1 
ATOM   9265  C CG2   . VAL B 1 563 ? -38.151 42.227  12.542  1.00 22.19  ? 563  VAL B CG2   1 
ATOM   9266  N N     . THR B 1 564 ? -41.791 39.494  11.779  1.00 20.84  ? 564  THR B N     1 
ATOM   9267  C CA    . THR B 1 564 ? -42.470 38.375  11.143  1.00 20.30  ? 564  THR B CA    1 
ATOM   9268  C C     . THR B 1 564 ? -42.033 38.285  9.684   1.00 20.42  ? 564  THR B C     1 
ATOM   9269  O O     . THR B 1 564 ? -42.148 39.247  8.923   1.00 20.61  ? 564  THR B O     1 
ATOM   9270  C CB    . THR B 1 564 ? -44.004 38.517  11.215  1.00 20.00  ? 564  THR B CB    1 
ATOM   9271  O OG1   . THR B 1 564 ? -44.408 38.516  12.584  1.00 19.45  ? 564  THR B OG1   1 
ATOM   9272  C CG2   . THR B 1 564 ? -44.713 37.350  10.476  1.00 19.36  ? 564  THR B CG2   1 
ATOM   9273  N N     . LEU B 1 565 ? -41.541 37.112  9.308   1.00 20.43  ? 565  LEU B N     1 
ATOM   9274  C CA    . LEU B 1 565 ? -41.020 36.879  7.968   1.00 20.19  ? 565  LEU B CA    1 
ATOM   9275  C C     . LEU B 1 565 ? -42.129 36.433  7.018   1.00 20.00  ? 565  LEU B C     1 
ATOM   9276  O O     . LEU B 1 565 ? -43.139 35.898  7.457   1.00 19.53  ? 565  LEU B O     1 
ATOM   9277  C CB    . LEU B 1 565 ? -39.914 35.821  8.030   1.00 19.78  ? 565  LEU B CB    1 
ATOM   9278  C CG    . LEU B 1 565 ? -38.610 36.162  8.746   1.00 19.71  ? 565  LEU B CG    1 
ATOM   9279  C CD1   . LEU B 1 565 ? -37.668 34.967  8.641   1.00 18.10  ? 565  LEU B CD1   1 
ATOM   9280  C CD2   . LEU B 1 565 ? -37.933 37.453  8.205   1.00 17.62  ? 565  LEU B CD2   1 
ATOM   9281  N N     . ASN B 1 566 ? -41.938 36.651  5.717   1.00 20.62  ? 566  ASN B N     1 
ATOM   9282  C CA    . ASN B 1 566 ? -42.892 36.147  4.711   1.00 21.27  ? 566  ASN B CA    1 
ATOM   9283  C C     . ASN B 1 566 ? -42.970 34.636  4.784   1.00 21.41  ? 566  ASN B C     1 
ATOM   9284  O O     . ASN B 1 566 ? -42.014 33.992  5.236   1.00 21.67  ? 566  ASN B O     1 
ATOM   9285  C CB    . ASN B 1 566 ? -42.503 36.577  3.294   1.00 20.84  ? 566  ASN B CB    1 
ATOM   9286  C CG    . ASN B 1 566 ? -42.775 38.035  3.038   1.00 21.11  ? 566  ASN B CG    1 
ATOM   9287  O OD1   . ASN B 1 566 ? -43.773 38.572  3.495   1.00 21.64  ? 566  ASN B OD1   1 
ATOM   9288  N ND2   . ASN B 1 566 ? -41.884 38.687  2.305   1.00 22.33  ? 566  ASN B ND2   1 
ATOM   9289  N N     . HIS B 1 567 ? -44.099 34.070  4.365   1.00 21.68  ? 567  HIS B N     1 
ATOM   9290  C CA    . HIS B 1 567 ? -44.221 32.630  4.321   1.00 22.17  ? 567  HIS B CA    1 
ATOM   9291  C C     . HIS B 1 567 ? -43.136 32.096  3.404   1.00 23.05  ? 567  HIS B C     1 
ATOM   9292  O O     . HIS B 1 567 ? -42.878 32.667  2.325   1.00 22.72  ? 567  HIS B O     1 
ATOM   9293  C CB    . HIS B 1 567 ? -45.579 32.203  3.781   1.00 22.09  ? 567  HIS B CB    1 
ATOM   9294  C CG    . HIS B 1 567 ? -46.734 32.643  4.616   1.00 20.84  ? 567  HIS B CG    1 
ATOM   9295  N ND1   . HIS B 1 567 ? -48.008 32.748  4.107   1.00 20.05  ? 567  HIS B ND1   1 
ATOM   9296  C CD2   . HIS B 1 567 ? -46.814 33.003  5.921   1.00 20.28  ? 567  HIS B CD2   1 
ATOM   9297  C CE1   . HIS B 1 567 ? -48.828 33.153  5.063   1.00 20.00  ? 567  HIS B CE1   1 
ATOM   9298  N NE2   . HIS B 1 567 ? -48.129 33.318  6.172   1.00 18.88  ? 567  HIS B NE2   1 
ATOM   9299  N N     . GLY B 1 568 ? -42.508 31.005  3.839   1.00 23.56  ? 568  GLY B N     1 
ATOM   9300  C CA    . GLY B 1 568 ? -41.413 30.409  3.092   1.00 24.47  ? 568  GLY B CA    1 
ATOM   9301  C C     . GLY B 1 568 ? -40.044 30.859  3.562   1.00 25.03  ? 568  GLY B C     1 
ATOM   9302  O O     . GLY B 1 568 ? -39.068 30.163  3.341   1.00 25.41  ? 568  GLY B O     1 
ATOM   9303  N N     . GLU B 1 569 ? -39.965 32.023  4.204   1.00 25.82  ? 569  GLU B N     1 
ATOM   9304  C CA    . GLU B 1 569 ? -38.689 32.555  4.685   1.00 26.59  ? 569  GLU B CA    1 
ATOM   9305  C C     . GLU B 1 569 ? -38.365 32.052  6.078   1.00 27.18  ? 569  GLU B C     1 
ATOM   9306  O O     . GLU B 1 569 ? -39.263 31.683  6.832   1.00 27.27  ? 569  GLU B O     1 
ATOM   9307  C CB    . GLU B 1 569 ? -38.697 34.075  4.654   1.00 26.46  ? 569  GLU B CB    1 
ATOM   9308  C CG    . GLU B 1 569 ? -39.066 34.649  3.291   1.00 28.36  ? 569  GLU B CG    1 
ATOM   9309  C CD    . GLU B 1 569 ? -38.107 34.254  2.147   1.00 30.28  ? 569  GLU B CD    1 
ATOM   9310  O OE1   . GLU B 1 569 ? -37.089 33.553  2.368   1.00 29.43  ? 569  GLU B OE1   1 
ATOM   9311  O OE2   . GLU B 1 569 ? -38.381 34.679  1.002   1.00 32.53  ? 569  GLU B OE2   1 
ATOM   9312  N N     . GLU B 1 570 ? -37.078 32.034  6.418   1.00 27.93  ? 570  GLU B N     1 
ATOM   9313  C CA    . GLU B 1 570 ? -36.628 31.359  7.632   1.00 28.63  ? 570  GLU B CA    1 
ATOM   9314  C C     . GLU B 1 570 ? -35.486 32.111  8.311   1.00 27.87  ? 570  GLU B C     1 
ATOM   9315  O O     . GLU B 1 570 ? -34.581 32.592  7.623   1.00 27.94  ? 570  GLU B O     1 
ATOM   9316  C CB    . GLU B 1 570 ? -36.206 29.928  7.285   1.00 29.17  ? 570  GLU B CB    1 
ATOM   9317  C CG    . GLU B 1 570 ? -36.190 28.999  8.440   1.00 32.89  ? 570  GLU B CG    1 
ATOM   9318  C CD    . GLU B 1 570 ? -37.005 27.757  8.178   1.00 38.09  ? 570  GLU B CD    1 
ATOM   9319  O OE1   . GLU B 1 570 ? -38.250 27.876  8.037   1.00 38.86  ? 570  GLU B OE1   1 
ATOM   9320  O OE2   . GLU B 1 570 ? -36.396 26.658  8.136   1.00 39.99  ? 570  GLU B OE2   1 
ATOM   9321  N N     . PRO B 1 571 ? -35.529 32.214  9.662   1.00 27.36  ? 571  PRO B N     1 
ATOM   9322  C CA    . PRO B 1 571 ? -34.477 32.905  10.414  1.00 26.93  ? 571  PRO B CA    1 
ATOM   9323  C C     . PRO B 1 571 ? -33.128 32.201  10.325  1.00 26.71  ? 571  PRO B C     1 
ATOM   9324  O O     . PRO B 1 571 ? -33.063 30.973  10.228  1.00 26.97  ? 571  PRO B O     1 
ATOM   9325  C CB    . PRO B 1 571 ? -34.966 32.868  11.874  1.00 27.05  ? 571  PRO B CB    1 
ATOM   9326  C CG    . PRO B 1 571 ? -36.319 32.313  11.868  1.00 27.14  ? 571  PRO B CG    1 
ATOM   9327  C CD    . PRO B 1 571 ? -36.580 31.667  10.542  1.00 27.35  ? 571  PRO B CD    1 
ATOM   9328  N N     . SER B 1 572 ? -32.059 32.987  10.366  1.00 26.24  ? 572  SER B N     1 
ATOM   9329  C CA    . SER B 1 572 ? -30.697 32.469  10.408  1.00 25.47  ? 572  SER B CA    1 
ATOM   9330  C C     . SER B 1 572 ? -29.838 33.631  10.860  1.00 25.61  ? 572  SER B C     1 
ATOM   9331  O O     . SER B 1 572 ? -30.260 34.787  10.719  1.00 25.49  ? 572  SER B O     1 
ATOM   9332  C CB    . SER B 1 572 ? -30.242 32.004  9.019   1.00 25.25  ? 572  SER B CB    1 
ATOM   9333  O OG    . SER B 1 572 ? -30.105 33.107  8.130   1.00 23.21  ? 572  SER B OG    1 
ATOM   9334  N N     . PRO B 1 573 ? -28.644 33.341  11.424  1.00 25.36  ? 573  PRO B N     1 
ATOM   9335  C CA    . PRO B 1 573 ? -27.632 34.365  11.679  1.00 25.02  ? 573  PRO B CA    1 
ATOM   9336  C C     . PRO B 1 573 ? -27.304 35.218  10.453  1.00 25.03  ? 573  PRO B C     1 
ATOM   9337  O O     . PRO B 1 573 ? -27.141 36.428  10.588  1.00 25.44  ? 573  PRO B O     1 
ATOM   9338  C CB    . PRO B 1 573 ? -26.415 33.548  12.114  1.00 24.89  ? 573  PRO B CB    1 
ATOM   9339  C CG    . PRO B 1 573 ? -26.985 32.341  12.718  1.00 24.67  ? 573  PRO B CG    1 
ATOM   9340  C CD    . PRO B 1 573 ? -28.214 32.022  11.919  1.00 25.47  ? 573  PRO B CD    1 
ATOM   9341  N N     . GLU B 1 574 ? -27.204 34.604  9.280   1.00 24.84  ? 574  GLU B N     1 
ATOM   9342  C CA    . GLU B 1 574 ? -27.023 35.347  8.037   1.00 25.23  ? 574  GLU B CA    1 
ATOM   9343  C C     . GLU B 1 574 ? -28.109 36.423  7.847   1.00 24.61  ? 574  GLU B C     1 
ATOM   9344  O O     . GLU B 1 574 ? -27.815 37.591  7.581   1.00 24.53  ? 574  GLU B O     1 
ATOM   9345  C CB    . GLU B 1 574 ? -27.013 34.391  6.838   1.00 25.20  ? 574  GLU B CB    1 
ATOM   9346  C CG    . GLU B 1 574 ? -26.207 34.862  5.637   1.00 26.71  ? 574  GLU B CG    1 
ATOM   9347  C CD    . GLU B 1 574 ? -26.363 33.964  4.402   1.00 27.01  ? 574  GLU B CD    1 
ATOM   9348  O OE1   . GLU B 1 574 ? -26.064 32.749  4.477   1.00 27.99  ? 574  GLU B OE1   1 
ATOM   9349  O OE2   . GLU B 1 574 ? -26.764 34.491  3.336   1.00 30.13  ? 574  GLU B OE2   1 
ATOM   9350  N N     . LEU B 1 575 ? -29.365 36.028  7.998   1.00 23.88  ? 575  LEU B N     1 
ATOM   9351  C CA    . LEU B 1 575 ? -30.463 36.932  7.728   1.00 23.13  ? 575  LEU B CA    1 
ATOM   9352  C C     . LEU B 1 575 ? -30.581 37.994  8.821   1.00 22.78  ? 575  LEU B C     1 
ATOM   9353  O O     . LEU B 1 575 ? -30.996 39.119  8.561   1.00 22.70  ? 575  LEU B O     1 
ATOM   9354  C CB    . LEU B 1 575 ? -31.763 36.142  7.566   1.00 23.00  ? 575  LEU B CB    1 
ATOM   9355  C CG    . LEU B 1 575 ? -33.047 36.928  7.307   1.00 23.25  ? 575  LEU B CG    1 
ATOM   9356  C CD1   . LEU B 1 575 ? -33.047 37.581  5.908   1.00 19.12  ? 575  LEU B CD1   1 
ATOM   9357  C CD2   . LEU B 1 575 ? -34.238 36.005  7.514   1.00 23.83  ? 575  LEU B CD2   1 
ATOM   9358  N N     . TYR B 1 576 ? -30.207 37.630  10.041  1.00 22.30  ? 576  TYR B N     1 
ATOM   9359  C CA    . TYR B 1 576 ? -30.214 38.541  11.169  1.00 21.76  ? 576  TYR B CA    1 
ATOM   9360  C C     . TYR B 1 576 ? -29.292 39.737  10.884  1.00 21.50  ? 576  TYR B C     1 
ATOM   9361  O O     . TYR B 1 576 ? -29.669 40.894  11.105  1.00 21.12  ? 576  TYR B O     1 
ATOM   9362  C CB    . TYR B 1 576 ? -29.760 37.785  12.415  1.00 22.40  ? 576  TYR B CB    1 
ATOM   9363  C CG    . TYR B 1 576 ? -29.829 38.576  13.701  1.00 23.94  ? 576  TYR B CG    1 
ATOM   9364  C CD1   . TYR B 1 576 ? -30.872 38.379  14.612  1.00 24.20  ? 576  TYR B CD1   1 
ATOM   9365  C CD2   . TYR B 1 576 ? -28.835 39.510  14.026  1.00 24.81  ? 576  TYR B CD2   1 
ATOM   9366  C CE1   . TYR B 1 576 ? -30.922 39.091  15.809  1.00 25.63  ? 576  TYR B CE1   1 
ATOM   9367  C CE2   . TYR B 1 576 ? -28.895 40.252  15.212  1.00 24.48  ? 576  TYR B CE2   1 
ATOM   9368  C CZ    . TYR B 1 576 ? -29.935 40.031  16.097  1.00 25.57  ? 576  TYR B CZ    1 
ATOM   9369  O OH    . TYR B 1 576 ? -29.985 40.751  17.281  1.00 27.47  ? 576  TYR B OH    1 
ATOM   9370  N N     . ALA B 1 577 ? -28.091 39.448  10.374  1.00 20.68  ? 577  ALA B N     1 
ATOM   9371  C CA    . ALA B 1 577 ? -27.122 40.477  10.013  1.00 20.10  ? 577  ALA B CA    1 
ATOM   9372  C C     . ALA B 1 577 ? -27.602 41.276  8.794   1.00 19.55  ? 577  ALA B C     1 
ATOM   9373  O O     . ALA B 1 577 ? -27.463 42.491  8.733   1.00 19.32  ? 577  ALA B O     1 
ATOM   9374  C CB    . ALA B 1 577 ? -25.774 39.847  9.750   1.00 19.99  ? 577  ALA B CB    1 
ATOM   9375  N N     . GLU B 1 578 ? -28.199 40.579  7.844   1.00 19.62  ? 578  GLU B N     1 
ATOM   9376  C CA    . GLU B 1 578 ? -28.788 41.206  6.672   1.00 20.05  ? 578  GLU B CA    1 
ATOM   9377  C C     . GLU B 1 578 ? -29.856 42.247  7.021   1.00 20.40  ? 578  GLU B C     1 
ATOM   9378  O O     . GLU B 1 578 ? -29.777 43.395  6.571   1.00 20.64  ? 578  GLU B O     1 
ATOM   9379  C CB    . GLU B 1 578 ? -29.388 40.141  5.771   1.00 19.54  ? 578  GLU B CB    1 
ATOM   9380  C CG    . GLU B 1 578 ? -29.713 40.638  4.397   1.00 20.12  ? 578  GLU B CG    1 
ATOM   9381  C CD    . GLU B 1 578 ? -30.139 39.519  3.492   1.00 20.28  ? 578  GLU B CD    1 
ATOM   9382  O OE1   . GLU B 1 578 ? -29.305 38.602  3.257   1.00 19.85  ? 578  GLU B OE1   1 
ATOM   9383  O OE2   . GLU B 1 578 ? -31.308 39.555  3.044   1.00 17.96  ? 578  GLU B OE2   1 
ATOM   9384  N N     . VAL B 1 579 ? -30.864 41.828  7.789   1.00 20.71  ? 579  VAL B N     1 
ATOM   9385  C CA    . VAL B 1 579 ? -31.930 42.721  8.249   1.00 20.77  ? 579  VAL B CA    1 
ATOM   9386  C C     . VAL B 1 579 ? -31.387 43.961  9.013   1.00 20.88  ? 579  VAL B C     1 
ATOM   9387  O O     . VAL B 1 579 ? -31.835 45.105  8.777   1.00 21.08  ? 579  VAL B O     1 
ATOM   9388  C CB    . VAL B 1 579 ? -32.985 41.939  9.093   1.00 21.13  ? 579  VAL B CB    1 
ATOM   9389  C CG1   . VAL B 1 579 ? -34.043 42.887  9.729   1.00 19.41  ? 579  VAL B CG1   1 
ATOM   9390  C CG2   . VAL B 1 579 ? -33.653 40.847  8.245   1.00 19.71  ? 579  VAL B CG2   1 
ATOM   9391  N N     . ARG B 1 580 ? -30.432 43.745  9.916   1.00 20.57  ? 580  ARG B N     1 
ATOM   9392  C CA    . ARG B 1 580 ? -29.776 44.881  10.570  1.00 20.58  ? 580  ARG B CA    1 
ATOM   9393  C C     . ARG B 1 580 ? -29.107 45.821  9.568   1.00 20.22  ? 580  ARG B C     1 
ATOM   9394  O O     . ARG B 1 580 ? -29.271 47.040  9.665   1.00 20.22  ? 580  ARG B O     1 
ATOM   9395  C CB    . ARG B 1 580 ? -28.761 44.421  11.628  1.00 21.04  ? 580  ARG B CB    1 
ATOM   9396  C CG    . ARG B 1 580 ? -29.378 43.596  12.775  1.00 22.35  ? 580  ARG B CG    1 
ATOM   9397  C CD    . ARG B 1 580 ? -28.624 43.789  14.083  1.00 26.22  ? 580  ARG B CD    1 
ATOM   9398  N NE    . ARG B 1 580 ? -27.231 44.193  13.872  1.00 30.53  ? 580  ARG B NE    1 
ATOM   9399  C CZ    . ARG B 1 580 ? -26.522 44.931  14.724  1.00 31.55  ? 580  ARG B CZ    1 
ATOM   9400  N NH1   . ARG B 1 580 ? -27.084 45.363  15.843  1.00 31.97  ? 580  ARG B NH1   1 
ATOM   9401  N NH2   . ARG B 1 580 ? -25.253 45.256  14.449  1.00 31.82  ? 580  ARG B NH2   1 
ATOM   9402  N N     . ASN B 1 581 ? -28.365 45.264  8.602   1.00 19.82  ? 581  ASN B N     1 
ATOM   9403  C CA    . ASN B 1 581 ? -27.693 46.073  7.575   1.00 19.52  ? 581  ASN B CA    1 
ATOM   9404  C C     . ASN B 1 581 ? -28.690 46.796  6.678   1.00 19.82  ? 581  ASN B C     1 
ATOM   9405  O O     . ASN B 1 581 ? -28.395 47.862  6.133   1.00 20.53  ? 581  ASN B O     1 
ATOM   9406  C CB    . ASN B 1 581 ? -26.707 45.228  6.728   1.00 19.47  ? 581  ASN B CB    1 
ATOM   9407  C CG    . ASN B 1 581 ? -25.387 44.935  7.462   1.00 18.42  ? 581  ASN B CG    1 
ATOM   9408  O OD1   . ASN B 1 581 ? -24.882 45.770  8.197   1.00 21.73  ? 581  ASN B OD1   1 
ATOM   9409  N ND2   . ASN B 1 581 ? -24.846 43.750  7.269   1.00 15.74  ? 581  ASN B ND2   1 
ATOM   9410  N N     . TRP B 1 582 ? -29.866 46.206  6.516   1.00 19.80  ? 582  TRP B N     1 
ATOM   9411  C CA    . TRP B 1 582 ? -30.915 46.795  5.709   1.00 20.31  ? 582  TRP B CA    1 
ATOM   9412  C C     . TRP B 1 582 ? -31.367 48.116  6.352   1.00 20.93  ? 582  TRP B C     1 
ATOM   9413  O O     . TRP B 1 582 ? -31.501 49.136  5.677   1.00 21.06  ? 582  TRP B O     1 
ATOM   9414  C CB    . TRP B 1 582 ? -32.090 45.817  5.562   1.00 19.52  ? 582  TRP B CB    1 
ATOM   9415  C CG    . TRP B 1 582 ? -33.242 46.354  4.746   1.00 19.15  ? 582  TRP B CG    1 
ATOM   9416  C CD1   . TRP B 1 582 ? -34.362 46.979  5.226   1.00 19.10  ? 582  TRP B CD1   1 
ATOM   9417  C CD2   . TRP B 1 582 ? -33.392 46.308  3.306   1.00 18.20  ? 582  TRP B CD2   1 
ATOM   9418  N NE1   . TRP B 1 582 ? -35.197 47.319  4.181   1.00 18.99  ? 582  TRP B NE1   1 
ATOM   9419  C CE2   . TRP B 1 582 ? -34.627 46.920  2.996   1.00 18.38  ? 582  TRP B CE2   1 
ATOM   9420  C CE3   . TRP B 1 582 ? -32.604 45.798  2.255   1.00 18.59  ? 582  TRP B CE3   1 
ATOM   9421  C CZ2   . TRP B 1 582 ? -35.106 47.039  1.670   1.00 19.78  ? 582  TRP B CZ2   1 
ATOM   9422  C CZ3   . TRP B 1 582 ? -33.069 45.931  0.935   1.00 19.69  ? 582  TRP B CZ3   1 
ATOM   9423  C CH2   . TRP B 1 582 ? -34.319 46.543  0.658   1.00 19.67  ? 582  TRP B CH2   1 
ATOM   9424  N N     . VAL B 1 583 ? -31.594 48.100  7.660   1.00 21.36  ? 583  VAL B N     1 
ATOM   9425  C CA    . VAL B 1 583 ? -31.973 49.335  8.355   1.00 21.28  ? 583  VAL B CA    1 
ATOM   9426  C C     . VAL B 1 583 ? -30.823 50.353  8.328   1.00 22.17  ? 583  VAL B C     1 
ATOM   9427  O O     . VAL B 1 583 ? -31.061 51.548  8.139   1.00 22.19  ? 583  VAL B O     1 
ATOM   9428  C CB    . VAL B 1 583 ? -32.468 49.047  9.787   1.00 21.14  ? 583  VAL B CB    1 
ATOM   9429  C CG1   . VAL B 1 583 ? -32.938 50.339  10.480  1.00 20.24  ? 583  VAL B CG1   1 
ATOM   9430  C CG2   . VAL B 1 583 ? -33.612 48.003  9.748   1.00 19.24  ? 583  VAL B CG2   1 
ATOM   9431  N N     . ARG B 1 584 ? -29.579 49.885  8.496   1.00 22.89  ? 584  ARG B N     1 
ATOM   9432  C CA    . ARG B 1 584 ? -28.399 50.757  8.331   1.00 23.71  ? 584  ARG B CA    1 
ATOM   9433  C C     . ARG B 1 584 ? -28.435 51.510  7.012   1.00 23.21  ? 584  ARG B C     1 
ATOM   9434  O O     . ARG B 1 584 ? -28.101 52.691  6.943   1.00 23.55  ? 584  ARG B O     1 
ATOM   9435  C CB    . ARG B 1 584 ? -27.109 49.951  8.363   1.00 23.93  ? 584  ARG B CB    1 
ATOM   9436  C CG    . ARG B 1 584 ? -26.717 49.500  9.738   1.00 28.83  ? 584  ARG B CG    1 
ATOM   9437  C CD    . ARG B 1 584 ? -25.317 48.895  9.769   1.00 33.12  ? 584  ARG B CD    1 
ATOM   9438  N NE    . ARG B 1 584 ? -24.669 49.319  11.006  1.00 36.39  ? 584  ARG B NE    1 
ATOM   9439  C CZ    . ARG B 1 584 ? -23.587 50.090  11.060  1.00 37.71  ? 584  ARG B CZ    1 
ATOM   9440  N NH1   . ARG B 1 584 ? -23.110 50.421  12.242  1.00 40.36  ? 584  ARG B NH1   1 
ATOM   9441  N NH2   . ARG B 1 584 ? -22.971 50.513  9.953   1.00 35.67  ? 584  ARG B NH2   1 
ATOM   9442  N N     . LYS B 1 585 ? -28.824 50.818  5.957   1.00 22.77  ? 585  LYS B N     1 
ATOM   9443  C CA    . LYS B 1 585 ? -28.791 51.426  4.646   1.00 23.12  ? 585  LYS B CA    1 
ATOM   9444  C C     . LYS B 1 585 ? -30.054 52.244  4.301   1.00 22.19  ? 585  LYS B C     1 
ATOM   9445  O O     . LYS B 1 585 ? -29.973 53.236  3.585   1.00 21.41  ? 585  LYS B O     1 
ATOM   9446  C CB    . LYS B 1 585 ? -28.390 50.379  3.591   1.00 23.73  ? 585  LYS B CB    1 
ATOM   9447  C CG    . LYS B 1 585 ? -28.991 50.548  2.228   1.00 26.41  ? 585  LYS B CG    1 
ATOM   9448  C CD    . LYS B 1 585 ? -29.981 49.421  2.030   1.00 32.10  ? 585  LYS B CD    1 
ATOM   9449  C CE    . LYS B 1 585 ? -31.272 49.914  1.421   1.00 34.39  ? 585  LYS B CE    1 
ATOM   9450  N NZ    . LYS B 1 585 ? -32.265 48.846  1.625   1.00 33.72  ? 585  LYS B NZ    1 
ATOM   9451  N N     . GLU B 1 586 ? -31.203 51.843  4.837   1.00 21.44  ? 586  GLU B N     1 
ATOM   9452  C CA    . GLU B 1 586 ? -32.439 52.587  4.633   1.00 21.75  ? 586  GLU B CA    1 
ATOM   9453  C C     . GLU B 1 586 ? -32.438 53.948  5.330   1.00 21.24  ? 586  GLU B C     1 
ATOM   9454  O O     . GLU B 1 586 ? -32.942 54.933  4.771   1.00 21.37  ? 586  GLU B O     1 
ATOM   9455  C CB    . GLU B 1 586 ? -33.651 51.776  5.115   1.00 22.23  ? 586  GLU B CB    1 
ATOM   9456  C CG    . GLU B 1 586 ? -34.084 50.657  4.180   1.00 25.20  ? 586  GLU B CG    1 
ATOM   9457  C CD    . GLU B 1 586 ? -34.577 51.193  2.845   1.00 28.63  ? 586  GLU B CD    1 
ATOM   9458  O OE1   . GLU B 1 586 ? -35.719 51.706  2.828   1.00 30.44  ? 586  GLU B OE1   1 
ATOM   9459  O OE2   . GLU B 1 586 ? -33.822 51.113  1.837   1.00 27.87  ? 586  GLU B OE2   1 
ATOM   9460  N N     . ILE B 1 587 ? -31.881 53.994  6.547   1.00 20.63  ? 587  ILE B N     1 
ATOM   9461  C CA    . ILE B 1 587 ? -31.909 55.195  7.400   1.00 19.85  ? 587  ILE B CA    1 
ATOM   9462  C C     . ILE B 1 587 ? -30.483 55.633  7.771   1.00 20.18  ? 587  ILE B C     1 
ATOM   9463  O O     . ILE B 1 587 ? -30.044 56.726  7.438   1.00 19.67  ? 587  ILE B O     1 
ATOM   9464  C CB    . ILE B 1 587 ? -32.753 54.937  8.669   1.00 19.85  ? 587  ILE B CB    1 
ATOM   9465  C CG1   . ILE B 1 587 ? -34.176 54.516  8.284   1.00 19.86  ? 587  ILE B CG1   1 
ATOM   9466  C CG2   . ILE B 1 587 ? -32.785 56.160  9.607   1.00 18.78  ? 587  ILE B CG2   1 
ATOM   9467  C CD1   . ILE B 1 587 ? -35.024 54.162  9.476   1.00 21.30  ? 587  ILE B CD1   1 
ATOM   9468  N N     . GLY B 1 588 ? -29.765 54.753  8.453   1.00 20.66  ? 588  GLY B N     1 
ATOM   9469  C CA    . GLY B 1 588 ? -28.428 55.036  8.942   1.00 20.77  ? 588  GLY B CA    1 
ATOM   9470  C C     . GLY B 1 588 ? -28.082 54.135  10.122  1.00 21.03  ? 588  GLY B C     1 
ATOM   9471  O O     . GLY B 1 588 ? -28.977 53.547  10.754  1.00 20.75  ? 588  GLY B O     1 
ATOM   9472  N N     . PRO B 1 589 ? -26.780 54.010  10.417  1.00 20.96  ? 589  PRO B N     1 
ATOM   9473  C CA    . PRO B 1 589 ? -26.261 53.298  11.590  1.00 21.58  ? 589  PRO B CA    1 
ATOM   9474  C C     . PRO B 1 589 ? -27.004 53.624  12.904  1.00 22.42  ? 589  PRO B C     1 
ATOM   9475  O O     . PRO B 1 589 ? -27.235 52.723  13.728  1.00 22.38  ? 589  PRO B O     1 
ATOM   9476  C CB    . PRO B 1 589 ? -24.803 53.765  11.655  1.00 21.09  ? 589  PRO B CB    1 
ATOM   9477  C CG    . PRO B 1 589 ? -24.439 53.987  10.207  1.00 21.41  ? 589  PRO B CG    1 
ATOM   9478  C CD    . PRO B 1 589 ? -25.698 54.578  9.591   1.00 20.93  ? 589  PRO B CD    1 
ATOM   9479  N N     . LEU B 1 590 ? -27.397 54.886  13.075  1.00 23.20  ? 590  LEU B N     1 
ATOM   9480  C CA    . LEU B 1 590 ? -28.127 55.338  14.267  1.00 24.26  ? 590  LEU B CA    1 
ATOM   9481  C C     . LEU B 1 590 ? -29.446 54.588  14.510  1.00 24.39  ? 590  LEU B C     1 
ATOM   9482  O O     . LEU B 1 590 ? -29.872 54.431  15.661  1.00 24.34  ? 590  LEU B O     1 
ATOM   9483  C CB    . LEU B 1 590 ? -28.374 56.858  14.216  1.00 24.74  ? 590  LEU B CB    1 
ATOM   9484  C CG    . LEU B 1 590 ? -29.480 57.440  13.308  1.00 27.33  ? 590  LEU B CG    1 
ATOM   9485  C CD1   . LEU B 1 590 ? -29.828 58.865  13.740  1.00 28.98  ? 590  LEU B CD1   1 
ATOM   9486  C CD2   . LEU B 1 590 ? -29.133 57.422  11.805  1.00 28.27  ? 590  LEU B CD2   1 
ATOM   9487  N N     . ALA B 1 591 ? -30.072 54.108  13.431  1.00 24.48  ? 591  ALA B N     1 
ATOM   9488  C CA    . ALA B 1 591 ? -31.345 53.374  13.518  1.00 23.90  ? 591  ALA B CA    1 
ATOM   9489  C C     . ALA B 1 591 ? -31.220 51.847  13.562  1.00 23.83  ? 591  ALA B C     1 
ATOM   9490  O O     . ALA B 1 591 ? -32.234 51.156  13.500  1.00 22.94  ? 591  ALA B O     1 
ATOM   9491  C CB    . ALA B 1 591 ? -32.270 53.787  12.374  1.00 23.92  ? 591  ALA B CB    1 
ATOM   9492  N N     . THR B 1 592 ? -29.997 51.328  13.657  1.00 24.07  ? 592  THR B N     1 
ATOM   9493  C CA    . THR B 1 592 ? -29.778 49.868  13.689  1.00 25.66  ? 592  THR B CA    1 
ATOM   9494  C C     . THR B 1 592 ? -30.481 49.210  14.897  1.00 24.92  ? 592  THR B C     1 
ATOM   9495  O O     . THR B 1 592 ? -30.253 49.612  16.047  1.00 24.60  ? 592  THR B O     1 
ATOM   9496  C CB    . THR B 1 592 ? -28.259 49.507  13.753  1.00 26.16  ? 592  THR B CB    1 
ATOM   9497  O OG1   . THR B 1 592 ? -27.532 50.275  12.779  1.00 29.74  ? 592  THR B OG1   1 
ATOM   9498  C CG2   . THR B 1 592 ? -28.041 48.007  13.480  1.00 27.19  ? 592  THR B CG2   1 
ATOM   9499  N N     . PRO B 1 593 ? -31.346 48.214  14.641  1.00 24.60  ? 593  PRO B N     1 
ATOM   9500  C CA    . PRO B 1 593 ? -31.933 47.492  15.760  1.00 24.79  ? 593  PRO B CA    1 
ATOM   9501  C C     . PRO B 1 593 ? -30.858 46.801  16.587  1.00 24.87  ? 593  PRO B C     1 
ATOM   9502  O O     . PRO B 1 593 ? -29.925 46.189  16.045  1.00 24.90  ? 593  PRO B O     1 
ATOM   9503  C CB    . PRO B 1 593 ? -32.808 46.443  15.080  1.00 24.59  ? 593  PRO B CB    1 
ATOM   9504  C CG    . PRO B 1 593 ? -33.095 47.002  13.744  1.00 24.22  ? 593  PRO B CG    1 
ATOM   9505  C CD    . PRO B 1 593 ? -31.865 47.722  13.350  1.00 24.69  ? 593  PRO B CD    1 
ATOM   9506  N N     . ASP B 1 594 ? -30.995 46.931  17.895  1.00 24.47  ? 594  ASP B N     1 
ATOM   9507  C CA    . ASP B 1 594 ? -30.144 46.251  18.833  1.00 24.88  ? 594  ASP B CA    1 
ATOM   9508  C C     . ASP B 1 594 ? -30.586 44.790  18.980  1.00 24.20  ? 594  ASP B C     1 
ATOM   9509  O O     . ASP B 1 594 ? -29.749 43.895  19.082  1.00 24.51  ? 594  ASP B O     1 
ATOM   9510  C CB    . ASP B 1 594 ? -30.171 47.018  20.153  1.00 25.44  ? 594  ASP B CB    1 
ATOM   9511  C CG    . ASP B 1 594 ? -29.613 48.427  19.997  1.00 27.95  ? 594  ASP B CG    1 
ATOM   9512  O OD1   . ASP B 1 594 ? -28.361 48.550  19.992  1.00 28.51  ? 594  ASP B OD1   1 
ATOM   9513  O OD2   . ASP B 1 594 ? -30.417 49.399  19.834  1.00 28.91  ? 594  ASP B OD2   1 
ATOM   9514  N N     . VAL B 1 595 ? -31.895 44.556  18.943  1.00 23.16  ? 595  VAL B N     1 
ATOM   9515  C CA    . VAL B 1 595 ? -32.440 43.210  19.026  1.00 23.30  ? 595  VAL B CA    1 
ATOM   9516  C C     . VAL B 1 595 ? -33.387 42.962  17.876  1.00 23.24  ? 595  VAL B C     1 
ATOM   9517  O O     . VAL B 1 595 ? -34.265 43.778  17.616  1.00 23.54  ? 595  VAL B O     1 
ATOM   9518  C CB    . VAL B 1 595 ? -33.235 42.991  20.351  1.00 23.19  ? 595  VAL B CB    1 
ATOM   9519  C CG1   . VAL B 1 595 ? -33.846 41.595  20.398  1.00 23.27  ? 595  VAL B CG1   1 
ATOM   9520  C CG2   . VAL B 1 595 ? -32.334 43.228  21.582  1.00 23.95  ? 595  VAL B CG2   1 
ATOM   9521  N N     . LEU B 1 596 ? -33.228 41.833  17.200  1.00 23.20  ? 596  LEU B N     1 
ATOM   9522  C CA    . LEU B 1 596 ? -34.275 41.356  16.306  1.00 23.38  ? 596  LEU B CA    1 
ATOM   9523  C C     . LEU B 1 596 ? -34.926 40.140  16.938  1.00 23.14  ? 596  LEU B C     1 
ATOM   9524  O O     . LEU B 1 596 ? -34.259 39.166  17.266  1.00 23.65  ? 596  LEU B O     1 
ATOM   9525  C CB    . LEU B 1 596 ? -33.755 41.020  14.897  1.00 23.42  ? 596  LEU B CB    1 
ATOM   9526  C CG    . LEU B 1 596 ? -32.988 42.041  14.045  1.00 23.57  ? 596  LEU B CG    1 
ATOM   9527  C CD1   . LEU B 1 596 ? -32.537 41.337  12.756  1.00 24.28  ? 596  LEU B CD1   1 
ATOM   9528  C CD2   . LEU B 1 596 ? -33.803 43.281  13.723  1.00 22.53  ? 596  LEU B CD2   1 
ATOM   9529  N N     . HIS B 1 597 ? -36.234 40.219  17.124  1.00 22.89  ? 597  HIS B N     1 
ATOM   9530  C CA    . HIS B 1 597 ? -37.003 39.160  17.754  1.00 22.51  ? 597  HIS B CA    1 
ATOM   9531  C C     . HIS B 1 597 ? -37.873 38.532  16.664  1.00 22.17  ? 597  HIS B C     1 
ATOM   9532  O O     . HIS B 1 597 ? -38.874 39.133  16.261  1.00 22.45  ? 597  HIS B O     1 
ATOM   9533  C CB    . HIS B 1 597 ? -37.873 39.765  18.865  1.00 22.32  ? 597  HIS B CB    1 
ATOM   9534  C CG    . HIS B 1 597 ? -38.784 38.785  19.543  1.00 22.84  ? 597  HIS B CG    1 
ATOM   9535  N ND1   . HIS B 1 597 ? -38.889 38.699  20.916  1.00 22.43  ? 597  HIS B ND1   1 
ATOM   9536  C CD2   . HIS B 1 597 ? -39.650 37.873  19.042  1.00 22.14  ? 597  HIS B CD2   1 
ATOM   9537  C CE1   . HIS B 1 597 ? -39.766 37.763  21.228  1.00 22.79  ? 597  HIS B CE1   1 
ATOM   9538  N NE2   . HIS B 1 597 ? -40.238 37.243  20.110  1.00 23.51  ? 597  HIS B NE2   1 
ATOM   9539  N N     . TRP B 1 598 ? -37.485 37.353  16.181  1.00 21.58  ? 598  TRP B N     1 
ATOM   9540  C CA    . TRP B 1 598 ? -38.241 36.658  15.136  1.00 21.57  ? 598  TRP B CA    1 
ATOM   9541  C C     . TRP B 1 598 ? -39.445 36.033  15.777  1.00 21.11  ? 598  TRP B C     1 
ATOM   9542  O O     . TRP B 1 598 ? -39.312 35.342  16.780  1.00 20.74  ? 598  TRP B O     1 
ATOM   9543  C CB    . TRP B 1 598 ? -37.455 35.504  14.519  1.00 21.28  ? 598  TRP B CB    1 
ATOM   9544  C CG    . TRP B 1 598 ? -36.068 35.792  14.016  1.00 21.84  ? 598  TRP B CG    1 
ATOM   9545  C CD1   . TRP B 1 598 ? -34.905 35.220  14.471  1.00 20.11  ? 598  TRP B CD1   1 
ATOM   9546  C CD2   . TRP B 1 598 ? -35.696 36.667  12.937  1.00 20.90  ? 598  TRP B CD2   1 
ATOM   9547  N NE1   . TRP B 1 598 ? -33.838 35.691  13.746  1.00 21.62  ? 598  TRP B NE1   1 
ATOM   9548  C CE2   . TRP B 1 598 ? -34.285 36.582  12.802  1.00 21.93  ? 598  TRP B CE2   1 
ATOM   9549  C CE3   . TRP B 1 598 ? -36.410 37.523  12.080  1.00 21.27  ? 598  TRP B CE3   1 
ATOM   9550  C CZ2   . TRP B 1 598 ? -33.571 37.312  11.829  1.00 20.29  ? 598  TRP B CZ2   1 
ATOM   9551  C CZ3   . TRP B 1 598 ? -35.704 38.256  11.117  1.00 19.91  ? 598  TRP B CZ3   1 
ATOM   9552  C CH2   . TRP B 1 598 ? -34.294 38.144  11.006  1.00 20.94  ? 598  TRP B CH2   1 
ATOM   9553  N N     . THR B 1 599 ? -40.610 36.252  15.188  1.00 21.10  ? 599  THR B N     1 
ATOM   9554  C CA    . THR B 1 599 ? -41.844 35.694  15.729  1.00 21.73  ? 599  THR B CA    1 
ATOM   9555  C C     . THR B 1 599 ? -42.923 35.571  14.658  1.00 22.50  ? 599  THR B C     1 
ATOM   9556  O O     . THR B 1 599 ? -42.913 36.323  13.683  1.00 22.28  ? 599  THR B O     1 
ATOM   9557  C CB    . THR B 1 599 ? -42.389 36.561  16.894  1.00 21.58  ? 599  THR B CB    1 
ATOM   9558  O OG1   . THR B 1 599 ? -43.515 35.908  17.499  1.00 21.18  ? 599  THR B OG1   1 
ATOM   9559  C CG2   . THR B 1 599 ? -42.799 37.943  16.387  1.00 20.34  ? 599  THR B CG2   1 
ATOM   9560  N N     . ASP B 1 600 ? -43.828 34.607  14.844  1.00 23.52  ? 600  ASP B N     1 
ATOM   9561  C CA    . ASP B 1 600 ? -45.097 34.566  14.126  1.00 25.17  ? 600  ASP B CA    1 
ATOM   9562  C C     . ASP B 1 600 ? -46.280 34.923  15.031  1.00 25.60  ? 600  ASP B C     1 
ATOM   9563  O O     . ASP B 1 600 ? -47.440 34.697  14.666  1.00 25.63  ? 600  ASP B O     1 
ATOM   9564  C CB    . ASP B 1 600 ? -45.315 33.175  13.542  1.00 25.90  ? 600  ASP B CB    1 
ATOM   9565  C CG    . ASP B 1 600 ? -44.225 32.784  12.576  1.00 29.32  ? 600  ASP B CG    1 
ATOM   9566  O OD1   . ASP B 1 600 ? -44.003 33.552  11.597  1.00 29.75  ? 600  ASP B OD1   1 
ATOM   9567  O OD2   . ASP B 1 600 ? -43.589 31.719  12.818  1.00 33.03  ? 600  ASP B OD2   1 
ATOM   9568  N N     . SER B 1 601 ? -45.995 35.493  16.202  1.00 25.73  ? 601  SER B N     1 
ATOM   9569  C CA    . SER B 1 601 ? -47.040 35.709  17.198  1.00 25.85  ? 601  SER B CA    1 
ATOM   9570  C C     . SER B 1 601 ? -47.249 37.162  17.571  1.00 25.47  ? 601  SER B C     1 
ATOM   9571  O O     . SER B 1 601 ? -47.423 37.472  18.747  1.00 25.45  ? 601  SER B O     1 
ATOM   9572  C CB    . SER B 1 601 ? -46.757 34.874  18.459  1.00 26.02  ? 601  SER B CB    1 
ATOM   9573  O OG    . SER B 1 601 ? -46.394 33.550  18.100  1.00 28.11  ? 601  SER B OG    1 
ATOM   9574  N N     . LEU B 1 602 ? -47.233 38.062  16.590  1.00 25.05  ? 602  LEU B N     1 
ATOM   9575  C CA    . LEU B 1 602 ? -47.496 39.456  16.914  1.00 24.82  ? 602  LEU B CA    1 
ATOM   9576  C C     . LEU B 1 602 ? -48.891 39.527  17.527  1.00 24.72  ? 602  LEU B C     1 
ATOM   9577  O O     . LEU B 1 602 ? -49.830 38.975  16.970  1.00 25.23  ? 602  LEU B O     1 
ATOM   9578  C CB    . LEU B 1 602 ? -47.362 40.384  15.691  1.00 24.61  ? 602  LEU B CB    1 
ATOM   9579  C CG    . LEU B 1 602 ? -45.949 40.685  15.144  1.00 23.91  ? 602  LEU B CG    1 
ATOM   9580  C CD1   . LEU B 1 602 ? -46.049 41.364  13.803  1.00 22.06  ? 602  LEU B CD1   1 
ATOM   9581  C CD2   . LEU B 1 602 ? -45.088 41.510  16.103  1.00 21.09  ? 602  LEU B CD2   1 
ATOM   9582  N N     . PRO B 1 603 ? -49.027 40.178  18.695  1.00 25.16  ? 603  PRO B N     1 
ATOM   9583  C CA    . PRO B 1 603 ? -50.327 40.192  19.337  1.00 24.98  ? 603  PRO B CA    1 
ATOM   9584  C C     . PRO B 1 603 ? -51.195 41.205  18.598  1.00 25.27  ? 603  PRO B C     1 
ATOM   9585  O O     . PRO B 1 603 ? -50.756 42.330  18.354  1.00 25.94  ? 603  PRO B O     1 
ATOM   9586  C CB    . PRO B 1 603 ? -50.003 40.657  20.751  1.00 24.71  ? 603  PRO B CB    1 
ATOM   9587  C CG    . PRO B 1 603 ? -48.830 41.547  20.579  1.00 24.51  ? 603  PRO B CG    1 
ATOM   9588  C CD    . PRO B 1 603 ? -48.026 40.953  19.460  1.00 25.05  ? 603  PRO B CD    1 
ATOM   9589  N N     . LYS B 1 604 ? -52.387 40.797  18.199  1.00 25.36  ? 604  LYS B N     1 
ATOM   9590  C CA    . LYS B 1 604 ? -53.266 41.680  17.445  1.00 26.01  ? 604  LYS B CA    1 
ATOM   9591  C C     . LYS B 1 604 ? -54.708 41.661  17.924  1.00 25.67  ? 604  LYS B C     1 
ATOM   9592  O O     . LYS B 1 604 ? -55.203 40.670  18.481  1.00 25.11  ? 604  LYS B O     1 
ATOM   9593  C CB    . LYS B 1 604 ? -53.238 41.334  15.954  1.00 26.50  ? 604  LYS B CB    1 
ATOM   9594  C CG    . LYS B 1 604 ? -51.957 41.740  15.231  1.00 28.99  ? 604  LYS B CG    1 
ATOM   9595  C CD    . LYS B 1 604 ? -52.034 41.303  13.784  1.00 33.54  ? 604  LYS B CD    1 
ATOM   9596  C CE    . LYS B 1 604 ? -50.657 40.917  13.251  1.00 36.25  ? 604  LYS B CE    1 
ATOM   9597  N NZ    . LYS B 1 604 ? -50.797 39.988  12.086  1.00 37.25  ? 604  LYS B NZ    1 
ATOM   9598  N N     . THR B 1 605 ? -55.382 42.780  17.682  1.00 25.93  ? 605  THR B N     1 
ATOM   9599  C CA    . THR B 1 605 ? -56.809 42.876  17.883  1.00 25.65  ? 605  THR B CA    1 
ATOM   9600  C C     . THR B 1 605 ? -57.501 42.069  16.795  1.00 25.70  ? 605  THR B C     1 
ATOM   9601  O O     . THR B 1 605 ? -56.877 41.661  15.803  1.00 24.77  ? 605  THR B O     1 
ATOM   9602  C CB    . THR B 1 605 ? -57.279 44.327  17.820  1.00 25.80  ? 605  THR B CB    1 
ATOM   9603  O OG1   . THR B 1 605 ? -57.053 44.835  16.502  1.00 27.11  ? 605  THR B OG1   1 
ATOM   9604  C CG2   . THR B 1 605 ? -56.546 45.183  18.852  1.00 25.59  ? 605  THR B CG2   1 
ATOM   9605  N N     . ARG B 1 606 ? -58.799 41.842  16.980  1.00 26.10  ? 606  ARG B N     1 
ATOM   9606  C CA    . ARG B 1 606 ? -59.573 41.053  16.028  1.00 26.16  ? 606  ARG B CA    1 
ATOM   9607  C C     . ARG B 1 606 ? -59.702 41.758  14.680  1.00 26.42  ? 606  ARG B C     1 
ATOM   9608  O O     . ARG B 1 606 ? -59.928 41.113  13.656  1.00 26.04  ? 606  ARG B O     1 
ATOM   9609  C CB    . ARG B 1 606 ? -60.922 40.656  16.626  1.00 25.88  ? 606  ARG B CB    1 
ATOM   9610  C CG    . ARG B 1 606 ? -60.764 39.601  17.692  1.00 25.51  ? 606  ARG B CG    1 
ATOM   9611  C CD    . ARG B 1 606 ? -62.084 39.167  18.289  1.00 23.90  ? 606  ARG B CD    1 
ATOM   9612  N NE    . ARG B 1 606 ? -61.901 38.114  19.291  1.00 22.52  ? 606  ARG B NE    1 
ATOM   9613  C CZ    . ARG B 1 606 ? -61.703 38.338  20.589  1.00 21.50  ? 606  ARG B CZ    1 
ATOM   9614  N NH1   . ARG B 1 606 ? -61.675 39.587  21.063  1.00 18.69  ? 606  ARG B NH1   1 
ATOM   9615  N NH2   . ARG B 1 606 ? -61.557 37.305  21.415  1.00 19.94  ? 606  ARG B NH2   1 
ATOM   9616  N N     . SER B 1 607 ? -59.523 43.079  14.696  1.00 27.16  ? 607  SER B N     1 
ATOM   9617  C CA    . SER B 1 607 ? -59.477 43.886  13.473  1.00 28.23  ? 607  SER B CA    1 
ATOM   9618  C C     . SER B 1 607 ? -58.063 44.040  12.921  1.00 28.69  ? 607  SER B C     1 
ATOM   9619  O O     . SER B 1 607 ? -57.880 44.700  11.899  1.00 29.45  ? 607  SER B O     1 
ATOM   9620  C CB    . SER B 1 607 ? -60.090 45.260  13.706  1.00 28.00  ? 607  SER B CB    1 
ATOM   9621  O OG    . SER B 1 607 ? -59.392 45.910  14.736  1.00 28.34  ? 607  SER B OG    1 
ATOM   9622  N N     . GLY B 1 608 ? -57.074 43.452  13.603  1.00 29.06  ? 608  GLY B N     1 
ATOM   9623  C CA    . GLY B 1 608 ? -55.711 43.326  13.079  1.00 28.80  ? 608  GLY B CA    1 
ATOM   9624  C C     . GLY B 1 608 ? -54.696 44.373  13.521  1.00 28.89  ? 608  GLY B C     1 
ATOM   9625  O O     . GLY B 1 608 ? -53.553 44.367  13.059  1.00 28.66  ? 608  GLY B O     1 
ATOM   9626  N N     . ALA B 1 609 ? -55.098 45.277  14.406  1.00 28.93  ? 609  ALA B N     1 
ATOM   9627  C CA    . ALA B 1 609 ? -54.172 46.267  14.955  1.00 29.02  ? 609  ALA B CA    1 
ATOM   9628  C C     . ALA B 1 609 ? -53.204 45.592  15.926  1.00 29.56  ? 609  ALA B C     1 
ATOM   9629  O O     . ALA B 1 609 ? -53.606 44.746  16.726  1.00 29.43  ? 609  ALA B O     1 
ATOM   9630  C CB    . ALA B 1 609 ? -54.928 47.390  15.653  1.00 28.76  ? 609  ALA B CB    1 
ATOM   9631  N N     . ILE B 1 610 ? -51.926 45.963  15.849  1.00 30.18  ? 610  ILE B N     1 
ATOM   9632  C CA    . ILE B 1 610 ? -50.930 45.425  16.759  1.00 30.24  ? 610  ILE B CA    1 
ATOM   9633  C C     . ILE B 1 610 ? -51.091 46.074  18.121  1.00 30.58  ? 610  ILE B C     1 
ATOM   9634  O O     . ILE B 1 610 ? -51.240 47.287  18.235  1.00 30.53  ? 610  ILE B O     1 
ATOM   9635  C CB    . ILE B 1 610 ? -49.495 45.611  16.233  1.00 30.39  ? 610  ILE B CB    1 
ATOM   9636  C CG1   . ILE B 1 610 ? -49.286 44.790  14.960  1.00 31.12  ? 610  ILE B CG1   1 
ATOM   9637  C CG2   . ILE B 1 610 ? -48.459 45.177  17.294  1.00 30.23  ? 610  ILE B CG2   1 
ATOM   9638  C CD1   . ILE B 1 610 ? -47.949 45.044  14.299  1.00 35.14  ? 610  ILE B CD1   1 
ATOM   9639  N N     . MET B 1 611 ? -51.068 45.240  19.151  1.00 30.98  ? 611  MET B N     1 
ATOM   9640  C CA    . MET B 1 611 ? -51.176 45.692  20.516  1.00 31.60  ? 611  MET B CA    1 
ATOM   9641  C C     . MET B 1 611 ? -49.779 45.987  21.054  1.00 30.98  ? 611  MET B C     1 
ATOM   9642  O O     . MET B 1 611 ? -49.075 45.096  21.516  1.00 30.85  ? 611  MET B O     1 
ATOM   9643  C CB    . MET B 1 611 ? -51.902 44.638  21.334  1.00 31.17  ? 611  MET B CB    1 
ATOM   9644  C CG    . MET B 1 611 ? -53.334 44.424  20.866  1.00 32.80  ? 611  MET B CG    1 
ATOM   9645  S SD    . MET B 1 611 ? -54.298 43.278  21.884  1.00 34.94  ? 611  MET B SD    1 
ATOM   9646  C CE    . MET B 1 611 ? -53.592 41.716  21.355  1.00 37.60  ? 611  MET B CE    1 
ATOM   9647  N N     . ARG B 1 612 ? -49.383 47.258  20.970  1.00 30.90  ? 612  ARG B N     1 
ATOM   9648  C CA    . ARG B 1 612 ? -48.011 47.690  21.280  1.00 30.59  ? 612  ARG B CA    1 
ATOM   9649  C C     . ARG B 1 612 ? -47.610 47.652  22.761  1.00 30.17  ? 612  ARG B C     1 
ATOM   9650  O O     . ARG B 1 612 ? -46.446 47.384  23.070  1.00 30.30  ? 612  ARG B O     1 
ATOM   9651  C CB    . ARG B 1 612 ? -47.751 49.081  20.709  1.00 30.54  ? 612  ARG B CB    1 
ATOM   9652  C CG    . ARG B 1 612 ? -48.097 49.212  19.220  1.00 31.77  ? 612  ARG B CG    1 
ATOM   9653  C CD    . ARG B 1 612 ? -47.613 50.534  18.662  1.00 32.72  ? 612  ARG B CD    1 
ATOM   9654  N NE    . ARG B 1 612 ? -46.273 50.811  19.171  1.00 34.62  ? 612  ARG B NE    1 
ATOM   9655  C CZ    . ARG B 1 612 ? -45.155 50.430  18.562  1.00 35.77  ? 612  ARG B CZ    1 
ATOM   9656  N NH1   . ARG B 1 612 ? -45.225 49.778  17.395  1.00 33.90  ? 612  ARG B NH1   1 
ATOM   9657  N NH2   . ARG B 1 612 ? -43.975 50.719  19.118  1.00 34.41  ? 612  ARG B NH2   1 
ATOM   9658  N N     . ARG B 1 613 ? -48.553 47.929  23.664  1.00 29.81  ? 613  ARG B N     1 
ATOM   9659  C CA    . ARG B 1 613 ? -48.293 47.888  25.118  1.00 29.17  ? 613  ARG B CA    1 
ATOM   9660  C C     . ARG B 1 613 ? -47.753 46.527  25.563  1.00 28.88  ? 613  ARG B C     1 
ATOM   9661  O O     . ARG B 1 613 ? -46.782 46.448  26.346  1.00 28.85  ? 613  ARG B O     1 
ATOM   9662  C CB    . ARG B 1 613 ? -49.544 48.256  25.919  1.00 29.04  ? 613  ARG B CB    1 
ATOM   9663  N N     . ILE B 1 614 ? -48.345 45.459  25.031  1.00 28.03  ? 614  ILE B N     1 
ATOM   9664  C CA    . ILE B 1 614 ? -47.861 44.113  25.319  1.00 28.02  ? 614  ILE B CA    1 
ATOM   9665  C C     . ILE B 1 614 ? -46.422 43.862  24.820  1.00 27.35  ? 614  ILE B C     1 
ATOM   9666  O O     . ILE B 1 614 ? -45.617 43.301  25.555  1.00 26.68  ? 614  ILE B O     1 
ATOM   9667  C CB    . ILE B 1 614 ? -48.856 43.023  24.844  1.00 28.47  ? 614  ILE B CB    1 
ATOM   9668  C CG1   . ILE B 1 614 ? -48.321 41.606  25.092  1.00 29.46  ? 614  ILE B CG1   1 
ATOM   9669  C CG2   . ILE B 1 614 ? -49.215 43.206  23.399  1.00 29.65  ? 614  ILE B CG2   1 
ATOM   9670  C CD1   . ILE B 1 614 ? -48.990 40.925  26.270  1.00 30.89  ? 614  ILE B CD1   1 
ATOM   9671  N N     . LEU B 1 615 ? -46.105 44.286  23.595  1.00 26.97  ? 615  LEU B N     1 
ATOM   9672  C CA    . LEU B 1 615 ? -44.746 44.128  23.046  1.00 27.11  ? 615  LEU B CA    1 
ATOM   9673  C C     . LEU B 1 615 ? -43.707 44.949  23.829  1.00 27.76  ? 615  LEU B C     1 
ATOM   9674  O O     . LEU B 1 615 ? -42.580 44.493  24.045  1.00 27.83  ? 615  LEU B O     1 
ATOM   9675  C CB    . LEU B 1 615 ? -44.702 44.498  21.558  1.00 26.24  ? 615  LEU B CB    1 
ATOM   9676  C CG    . LEU B 1 615 ? -45.577 43.642  20.632  1.00 25.68  ? 615  LEU B CG    1 
ATOM   9677  C CD1   . LEU B 1 615 ? -45.501 44.148  19.218  1.00 24.91  ? 615  LEU B CD1   1 
ATOM   9678  C CD2   . LEU B 1 615 ? -45.208 42.172  20.685  1.00 21.96  ? 615  LEU B CD2   1 
ATOM   9679  N N     . ARG B 1 616 ? -44.115 46.142  24.256  1.00 28.08  ? 616  ARG B N     1 
ATOM   9680  C CA    . ARG B 1 616 ? -43.276 47.066  24.998  1.00 29.65  ? 616  ARG B CA    1 
ATOM   9681  C C     . ARG B 1 616 ? -42.923 46.459  26.351  1.00 29.39  ? 616  ARG B C     1 
ATOM   9682  O O     . ARG B 1 616 ? -41.758 46.495  26.777  1.00 29.52  ? 616  ARG B O     1 
ATOM   9683  C CB    . ARG B 1 616 ? -44.042 48.378  25.174  1.00 29.64  ? 616  ARG B CB    1 
ATOM   9684  C CG    . ARG B 1 616 ? -43.215 49.603  25.485  1.00 32.19  ? 616  ARG B CG    1 
ATOM   9685  C CD    . ARG B 1 616 ? -44.104 50.860  25.515  1.00 32.27  ? 616  ARG B CD    1 
ATOM   9686  N NE    . ARG B 1 616 ? -44.615 51.226  24.192  1.00 36.70  ? 616  ARG B NE    1 
ATOM   9687  C CZ    . ARG B 1 616 ? -45.909 51.310  23.871  1.00 39.40  ? 616  ARG B CZ    1 
ATOM   9688  N NH1   . ARG B 1 616 ? -46.852 51.048  24.783  1.00 38.93  ? 616  ARG B NH1   1 
ATOM   9689  N NH2   . ARG B 1 616 ? -46.264 51.670  22.631  1.00 39.39  ? 616  ARG B NH2   1 
ATOM   9690  N N     . LYS B 1 617 ? -43.937 45.879  26.998  1.00 29.45  ? 617  LYS B N     1 
ATOM   9691  C CA    . LYS B 1 617 ? -43.793 45.213  28.288  1.00 29.40  ? 617  LYS B CA    1 
ATOM   9692  C C     . LYS B 1 617 ? -42.890 43.998  28.208  1.00 28.65  ? 617  LYS B C     1 
ATOM   9693  O O     . LYS B 1 617 ? -41.949 43.884  28.990  1.00 27.89  ? 617  LYS B O     1 
ATOM   9694  C CB    . LYS B 1 617 ? -45.167 44.830  28.863  1.00 29.68  ? 617  LYS B CB    1 
ATOM   9695  C CG    . LYS B 1 617 ? -45.911 46.004  29.556  1.00 30.82  ? 617  LYS B CG    1 
ATOM   9696  C CD    . LYS B 1 617 ? -47.142 45.512  30.332  1.00 30.64  ? 617  LYS B CD    1 
ATOM   9697  C CE    . LYS B 1 617 ? -47.873 46.651  31.040  1.00 32.43  ? 617  LYS B CE    1 
ATOM   9698  N NZ    . LYS B 1 617 ? -49.125 47.021  30.321  1.00 33.70  ? 617  LYS B NZ    1 
ATOM   9699  N N     . ILE B 1 618 ? -43.173 43.103  27.260  1.00 28.46  ? 618  ILE B N     1 
ATOM   9700  C CA    . ILE B 1 618 ? -42.399 41.868  27.096  1.00 28.54  ? 618  ILE B CA    1 
ATOM   9701  C C     . ILE B 1 618 ? -40.927 42.151  26.774  1.00 29.19  ? 618  ILE B C     1 
ATOM   9702  O O     . ILE B 1 618 ? -40.035 41.509  27.324  1.00 29.71  ? 618  ILE B O     1 
ATOM   9703  C CB    . ILE B 1 618 ? -43.023 40.924  26.033  1.00 28.25  ? 618  ILE B CB    1 
ATOM   9704  C CG1   . ILE B 1 618 ? -44.318 40.304  26.569  1.00 28.49  ? 618  ILE B CG1   1 
ATOM   9705  C CG2   . ILE B 1 618 ? -42.056 39.815  25.647  1.00 27.24  ? 618  ILE B CG2   1 
ATOM   9706  C CD1   . ILE B 1 618 ? -45.101 39.519  25.552  1.00 28.38  ? 618  ILE B CD1   1 
ATOM   9707  N N     . ALA B 1 619 ? -40.680 43.123  25.898  1.00 29.94  ? 619  ALA B N     1 
ATOM   9708  C CA    . ALA B 1 619 ? -39.325 43.448  25.467  1.00 30.45  ? 619  ALA B CA    1 
ATOM   9709  C C     . ALA B 1 619 ? -38.497 43.984  26.630  1.00 31.19  ? 619  ALA B C     1 
ATOM   9710  O O     . ALA B 1 619 ? -37.288 43.767  26.683  1.00 30.64  ? 619  ALA B O     1 
ATOM   9711  C CB    . ALA B 1 619 ? -39.365 44.445  24.339  1.00 30.08  ? 619  ALA B CB    1 
ATOM   9712  N N     . ALA B 1 620 ? -39.167 44.679  27.553  1.00 32.27  ? 620  ALA B N     1 
ATOM   9713  C CA    . ALA B 1 620 ? -38.547 45.196  28.776  1.00 33.59  ? 620  ALA B CA    1 
ATOM   9714  C C     . ALA B 1 620 ? -38.392 44.139  29.878  1.00 34.29  ? 620  ALA B C     1 
ATOM   9715  O O     . ALA B 1 620 ? -37.872 44.435  30.944  1.00 34.64  ? 620  ALA B O     1 
ATOM   9716  C CB    . ALA B 1 620 ? -39.323 46.426  29.305  1.00 33.16  ? 620  ALA B CB    1 
ATOM   9717  N N     . GLY B 1 621 ? -38.839 42.915  29.622  1.00 35.32  ? 621  GLY B N     1 
ATOM   9718  C CA    . GLY B 1 621 ? -38.751 41.836  30.613  1.00 37.01  ? 621  GLY B CA    1 
ATOM   9719  C C     . GLY B 1 621 ? -39.761 41.931  31.751  1.00 38.09  ? 621  GLY B C     1 
ATOM   9720  O O     . GLY B 1 621 ? -39.775 41.068  32.629  1.00 38.62  ? 621  GLY B O     1 
ATOM   9721  N N     . ASP B 1 622 ? -40.585 42.988  31.742  1.00 38.70  ? 622  ASP B N     1 
ATOM   9722  C CA    . ASP B 1 622 ? -41.675 43.210  32.721  1.00 38.88  ? 622  ASP B CA    1 
ATOM   9723  C C     . ASP B 1 622 ? -42.811 42.205  32.553  1.00 39.19  ? 622  ASP B C     1 
ATOM   9724  O O     . ASP B 1 622 ? -42.771 41.337  31.671  1.00 39.90  ? 622  ASP B O     1 
ATOM   9725  C CB    . ASP B 1 622 ? -42.245 44.631  32.595  1.00 38.68  ? 622  ASP B CB    1 
ATOM   9726  N N     . LEU B 1 632 ? -55.613 39.843  22.944  1.00 38.36  ? 632  LEU B N     1 
ATOM   9727  C CA    . LEU B 1 632 ? -56.909 39.716  22.273  1.00 38.36  ? 632  LEU B CA    1 
ATOM   9728  C C     . LEU B 1 632 ? -56.725 38.693  21.151  1.00 38.56  ? 632  LEU B C     1 
ATOM   9729  O O     . LEU B 1 632 ? -55.660 38.069  21.070  1.00 39.98  ? 632  LEU B O     1 
ATOM   9730  C CB    . LEU B 1 632 ? -57.334 41.071  21.714  1.00 37.98  ? 632  LEU B CB    1 
ATOM   9731  C CG    . LEU B 1 632 ? -58.789 41.502  21.788  1.00 38.05  ? 632  LEU B CG    1 
ATOM   9732  C CD1   . LEU B 1 632 ? -59.095 42.355  23.053  1.00 37.64  ? 632  LEU B CD1   1 
ATOM   9733  C CD2   . LEU B 1 632 ? -59.144 42.267  20.508  1.00 38.51  ? 632  LEU B CD2   1 
ATOM   9734  N N     . ALA B 1 633 ? -57.739 38.517  20.306  1.00 38.15  ? 633  ALA B N     1 
ATOM   9735  C CA    . ALA B 1 633 ? -57.733 37.590  19.149  1.00 37.60  ? 633  ALA B CA    1 
ATOM   9736  C C     . ALA B 1 633 ? -57.167 36.185  19.408  1.00 37.48  ? 633  ALA B C     1 
ATOM   9737  O O     . ALA B 1 633 ? -57.932 35.227  19.510  1.00 37.25  ? 633  ALA B O     1 
ATOM   9738  C CB    . ALA B 1 633 ? -57.093 38.237  17.911  1.00 37.43  ? 633  ALA B CB    1 
ATOM   9739  N N     . ASP B 1 634 ? -55.835 36.068  19.476  1.00 37.22  ? 634  ASP B N     1 
ATOM   9740  C CA    . ASP B 1 634 ? -55.179 34.828  19.881  1.00 36.97  ? 634  ASP B CA    1 
ATOM   9741  C C     . ASP B 1 634 ? -54.373 35.037  21.166  1.00 36.63  ? 634  ASP B C     1 
ATOM   9742  O O     . ASP B 1 634 ? -53.252 35.534  21.128  1.00 37.34  ? 634  ASP B O     1 
ATOM   9743  C CB    . ASP B 1 634 ? -54.299 34.273  18.760  1.00 37.12  ? 634  ASP B CB    1 
ATOM   9744  C CG    . ASP B 1 634 ? -53.615 32.959  19.144  1.00 37.67  ? 634  ASP B CG    1 
ATOM   9745  O OD1   . ASP B 1 634 ? -54.033 32.340  20.153  1.00 37.41  ? 634  ASP B OD1   1 
ATOM   9746  O OD2   . ASP B 1 634 ? -52.653 32.559  18.438  1.00 37.27  ? 634  ASP B OD2   1 
ATOM   9747  N N     . PRO B 1 635 ? -54.943 34.650  22.319  1.00 36.03  ? 635  PRO B N     1 
ATOM   9748  C CA    . PRO B 1 635 ? -54.269 34.930  23.591  1.00 35.11  ? 635  PRO B CA    1 
ATOM   9749  C C     . PRO B 1 635 ? -53.040 34.037  23.869  1.00 34.23  ? 635  PRO B C     1 
ATOM   9750  O O     . PRO B 1 635 ? -52.301 34.289  24.824  1.00 33.77  ? 635  PRO B O     1 
ATOM   9751  C CB    . PRO B 1 635 ? -55.375 34.699  24.635  1.00 35.16  ? 635  PRO B CB    1 
ATOM   9752  C CG    . PRO B 1 635 ? -56.658 34.437  23.837  1.00 35.67  ? 635  PRO B CG    1 
ATOM   9753  C CD    . PRO B 1 635 ? -56.219 33.936  22.515  1.00 35.85  ? 635  PRO B CD    1 
ATOM   9754  N N     . GLY B 1 636 ? -52.832 33.014  23.039  1.00 33.47  ? 636  GLY B N     1 
ATOM   9755  C CA    . GLY B 1 636 ? -51.674 32.125  23.158  1.00 32.35  ? 636  GLY B CA    1 
ATOM   9756  C C     . GLY B 1 636 ? -50.359 32.724  22.659  1.00 31.60  ? 636  GLY B C     1 
ATOM   9757  O O     . GLY B 1 636 ? -49.286 32.131  22.847  1.00 30.93  ? 636  GLY B O     1 
ATOM   9758  N N     . VAL B 1 637 ? -50.444 33.883  22.005  1.00 30.85  ? 637  VAL B N     1 
ATOM   9759  C CA    . VAL B 1 637 ? -49.252 34.612  21.551  1.00 30.53  ? 637  VAL B CA    1 
ATOM   9760  C C     . VAL B 1 637 ? -48.390 35.109  22.727  1.00 30.55  ? 637  VAL B C     1 
ATOM   9761  O O     . VAL B 1 637 ? -47.164 35.161  22.621  1.00 30.48  ? 637  VAL B O     1 
ATOM   9762  C CB    . VAL B 1 637 ? -49.577 35.799  20.569  1.00 30.26  ? 637  VAL B CB    1 
ATOM   9763  C CG1   . VAL B 1 637 ? -50.204 35.302  19.284  1.00 30.43  ? 637  VAL B CG1   1 
ATOM   9764  C CG2   . VAL B 1 637 ? -50.456 36.879  21.215  1.00 30.45  ? 637  VAL B CG2   1 
ATOM   9765  N N     . VAL B 1 638 ? -49.022 35.465  23.843  1.00 30.33  ? 638  VAL B N     1 
ATOM   9766  C CA    . VAL B 1 638 ? -48.281 35.992  24.989  1.00 30.55  ? 638  VAL B CA    1 
ATOM   9767  C C     . VAL B 1 638 ? -47.214 34.986  25.464  1.00 30.84  ? 638  VAL B C     1 
ATOM   9768  O O     . VAL B 1 638 ? -46.016 35.314  25.536  1.00 30.71  ? 638  VAL B O     1 
ATOM   9769  C CB    . VAL B 1 638 ? -49.230 36.410  26.144  1.00 30.71  ? 638  VAL B CB    1 
ATOM   9770  C CG1   . VAL B 1 638 ? -48.449 37.055  27.293  1.00 29.76  ? 638  VAL B CG1   1 
ATOM   9771  C CG2   . VAL B 1 638 ? -50.306 37.373  25.619  1.00 30.27  ? 638  VAL B CG2   1 
ATOM   9772  N N     . GLU B 1 639 ? -47.656 33.762  25.752  1.00 30.95  ? 639  GLU B N     1 
ATOM   9773  C CA    . GLU B 1 639 ? -46.761 32.653  26.101  1.00 30.78  ? 639  GLU B CA    1 
ATOM   9774  C C     . GLU B 1 639 ? -45.662 32.440  25.048  1.00 30.14  ? 639  GLU B C     1 
ATOM   9775  O O     . GLU B 1 639 ? -44.500 32.265  25.403  1.00 29.99  ? 639  GLU B O     1 
ATOM   9776  C CB    . GLU B 1 639 ? -47.558 31.355  26.305  1.00 31.02  ? 639  GLU B CB    1 
ATOM   9777  C CG    . GLU B 1 639 ? -46.770 30.203  26.942  1.00 32.33  ? 639  GLU B CG    1 
ATOM   9778  N N     . LYS B 1 640 ? -46.022 32.450  23.766  1.00 29.41  ? 640  LYS B N     1 
ATOM   9779  C CA    . LYS B 1 640 ? -45.015 32.253  22.714  1.00 29.35  ? 640  LYS B CA    1 
ATOM   9780  C C     . LYS B 1 640 ? -43.991 33.402  22.703  1.00 28.81  ? 640  LYS B C     1 
ATOM   9781  O O     . LYS B 1 640 ? -42.780 33.163  22.743  1.00 28.58  ? 640  LYS B O     1 
ATOM   9782  C CB    . LYS B 1 640 ? -45.653 32.023  21.334  1.00 29.19  ? 640  LYS B CB    1 
ATOM   9783  N N     . LEU B 1 641 ? -44.487 34.639  22.700  1.00 28.56  ? 641  LEU B N     1 
ATOM   9784  C CA    . LEU B 1 641 ? -43.636 35.823  22.758  1.00 28.42  ? 641  LEU B CA    1 
ATOM   9785  C C     . LEU B 1 641 ? -42.667 35.810  23.953  1.00 29.26  ? 641  LEU B C     1 
ATOM   9786  O O     . LEU B 1 641 ? -41.497 36.159  23.800  1.00 28.78  ? 641  LEU B O     1 
ATOM   9787  C CB    . LEU B 1 641 ? -44.485 37.093  22.764  1.00 28.01  ? 641  LEU B CB    1 
ATOM   9788  C CG    . LEU B 1 641 ? -45.139 37.526  21.443  1.00 27.28  ? 641  LEU B CG    1 
ATOM   9789  C CD1   . LEU B 1 641 ? -46.257 38.529  21.697  1.00 25.64  ? 641  LEU B CD1   1 
ATOM   9790  C CD2   . LEU B 1 641 ? -44.105 38.116  20.504  1.00 25.98  ? 641  LEU B CD2   1 
ATOM   9791  N N     . LEU B 1 642 ? -43.165 35.398  25.127  1.00 30.09  ? 642  LEU B N     1 
ATOM   9792  C CA    . LEU B 1 642 ? -42.357 35.275  26.346  1.00 30.52  ? 642  LEU B CA    1 
ATOM   9793  C C     . LEU B 1 642 ? -41.270 34.214  26.218  1.00 31.08  ? 642  LEU B C     1 
ATOM   9794  O O     . LEU B 1 642 ? -40.099 34.471  26.513  1.00 30.81  ? 642  LEU B O     1 
ATOM   9795  C CB    . LEU B 1 642 ? -43.242 34.971  27.557  1.00 30.30  ? 642  LEU B CB    1 
ATOM   9796  C CG    . LEU B 1 642 ? -43.937 36.138  28.261  1.00 30.75  ? 642  LEU B CG    1 
ATOM   9797  C CD1   . LEU B 1 642 ? -45.054 35.644  29.207  1.00 31.62  ? 642  LEU B CD1   1 
ATOM   9798  C CD2   . LEU B 1 642 ? -42.932 36.981  29.036  1.00 31.13  ? 642  LEU B CD2   1 
ATOM   9799  N N     . GLU B 1 643 ? -41.661 33.020  25.781  1.00 32.11  ? 643  GLU B N     1 
ATOM   9800  C CA    . GLU B 1 643 ? -40.710 31.959  25.481  1.00 33.26  ? 643  GLU B CA    1 
ATOM   9801  C C     . GLU B 1 643 ? -39.581 32.464  24.582  1.00 33.32  ? 643  GLU B C     1 
ATOM   9802  O O     . GLU B 1 643 ? -38.402 32.282  24.884  1.00 33.34  ? 643  GLU B O     1 
ATOM   9803  C CB    . GLU B 1 643 ? -41.428 30.791  24.815  1.00 33.74  ? 643  GLU B CB    1 
ATOM   9804  C CG    . GLU B 1 643 ? -41.537 29.580  25.699  1.00 37.10  ? 643  GLU B CG    1 
ATOM   9805  C CD    . GLU B 1 643 ? -42.842 28.835  25.514  1.00 41.48  ? 643  GLU B CD    1 
ATOM   9806  O OE1   . GLU B 1 643 ? -43.490 28.532  26.552  1.00 41.73  ? 643  GLU B OE1   1 
ATOM   9807  O OE2   . GLU B 1 643 ? -43.216 28.573  24.338  1.00 43.56  ? 643  GLU B OE2   1 
ATOM   9808  N N     . GLU B 1 644 ? -39.966 33.116  23.487  1.00 33.69  ? 644  GLU B N     1 
ATOM   9809  C CA    . GLU B 1 644 ? -39.022 33.657  22.518  1.00 33.58  ? 644  GLU B CA    1 
ATOM   9810  C C     . GLU B 1 644 ? -38.102 34.729  23.135  1.00 34.40  ? 644  GLU B C     1 
ATOM   9811  O O     . GLU B 1 644 ? -36.907 34.754  22.832  1.00 33.82  ? 644  GLU B O     1 
ATOM   9812  C CB    . GLU B 1 644 ? -39.782 34.199  21.308  1.00 33.29  ? 644  GLU B CB    1 
ATOM   9813  C CG    . GLU B 1 644 ? -40.541 33.127  20.525  1.00 32.51  ? 644  GLU B CG    1 
ATOM   9814  C CD    . GLU B 1 644 ? -41.568 33.696  19.541  1.00 32.40  ? 644  GLU B CD    1 
ATOM   9815  O OE1   . GLU B 1 644 ? -41.850 34.920  19.581  1.00 30.79  ? 644  GLU B OE1   1 
ATOM   9816  O OE2   . GLU B 1 644 ? -42.098 32.908  18.727  1.00 29.31  ? 644  GLU B OE2   1 
ATOM   9817  N N     . LYS B 1 645 ? -38.665 35.587  23.998  1.00 35.09  ? 645  LYS B N     1 
ATOM   9818  C CA    . LYS B 1 645 ? -37.916 36.629  24.709  1.00 36.63  ? 645  LYS B CA    1 
ATOM   9819  C C     . LYS B 1 645 ? -36.770 36.005  25.507  1.00 37.62  ? 645  LYS B C     1 
ATOM   9820  O O     . LYS B 1 645 ? -35.653 36.530  25.512  1.00 37.34  ? 645  LYS B O     1 
ATOM   9821  C CB    . LYS B 1 645 ? -38.831 37.385  25.685  1.00 36.79  ? 645  LYS B CB    1 
ATOM   9822  C CG    . LYS B 1 645 ? -38.553 38.890  25.888  1.00 37.07  ? 645  LYS B CG    1 
ATOM   9823  C CD    . LYS B 1 645 ? -37.078 39.260  25.933  1.00 37.66  ? 645  LYS B CD    1 
ATOM   9824  C CE    . LYS B 1 645 ? -36.844 40.458  26.831  1.00 37.49  ? 645  LYS B CE    1 
ATOM   9825  N NZ    . LYS B 1 645 ? -35.737 40.173  27.794  1.00 36.37  ? 645  LYS B NZ    1 
ATOM   9826  N N     . GLN B 1 646 ? -37.072 34.879  26.164  1.00 38.65  ? 646  GLN B N     1 
ATOM   9827  C CA    . GLN B 1 646 ? -36.142 34.165  27.041  1.00 39.17  ? 646  GLN B CA    1 
ATOM   9828  C C     . GLN B 1 646 ? -34.976 33.506  26.300  1.00 39.66  ? 646  GLN B C     1 
ATOM   9829  O O     . GLN B 1 646 ? -33.911 33.291  26.883  1.00 39.81  ? 646  GLN B O     1 
ATOM   9830  C CB    . GLN B 1 646 ? -36.894 33.111  27.849  1.00 39.26  ? 646  GLN B CB    1 
ATOM   9831  C CG    . GLN B 1 646 ? -37.841 33.675  28.913  1.00 39.91  ? 646  GLN B CG    1 
ATOM   9832  N N     . ALA B 1 647 ? -35.179 33.172  25.028  1.00 40.01  ? 647  ALA B N     1 
ATOM   9833  C CA    . ALA B 1 647 ? -34.123 32.562  24.219  1.00 40.03  ? 647  ALA B CA    1 
ATOM   9834  C C     . ALA B 1 647 ? -33.278 33.605  23.474  1.00 40.14  ? 647  ALA B C     1 
ATOM   9835  O O     . ALA B 1 647 ? -33.350 34.811  23.755  1.00 40.31  ? 647  ALA B O     1 
ATOM   9836  C CB    . ALA B 1 647 ? -34.718 31.568  23.255  1.00 39.79  ? 647  ALA B CB    1 
HETATM 9837  N N1A   . COA C 2 .   ? -1.777  45.198  22.114  1.00 31.22  ? 990  COA A N1A   1 
HETATM 9838  C C2A   . COA C 2 .   ? -2.325  46.175  22.930  1.00 31.65  ? 990  COA A C2A   1 
HETATM 9839  N N3A   . COA C 2 .   ? -3.681  46.209  23.204  1.00 29.95  ? 990  COA A N3A   1 
HETATM 9840  C C4A   . COA C 2 .   ? -4.488  45.280  22.659  1.00 31.56  ? 990  COA A C4A   1 
HETATM 9841  C C5A   . COA C 2 .   ? -3.971  44.284  21.831  1.00 31.28  ? 990  COA A C5A   1 
HETATM 9842  C C6A   . COA C 2 .   ? -2.601  44.244  21.556  1.00 29.68  ? 990  COA A C6A   1 
HETATM 9843  N N6A   . COA C 2 .   ? -2.102  43.377  20.685  1.00 27.10  ? 990  COA A N6A   1 
HETATM 9844  N N7A   . COA C 2 .   ? -5.003  43.494  21.451  1.00 32.07  ? 990  COA A N7A   1 
HETATM 9845  C C8A   . COA C 2 .   ? -6.144  43.967  21.999  1.00 33.01  ? 990  COA A C8A   1 
HETATM 9846  N N9A   . COA C 2 .   ? -5.836  45.074  22.745  1.00 34.18  ? 990  COA A N9A   1 
HETATM 9847  C C1B   . COA C 2 .   ? -6.778  45.874  23.539  1.00 38.62  ? 990  COA A C1B   1 
HETATM 9848  C C2B   . COA C 2 .   ? -7.810  46.565  22.656  1.00 40.81  ? 990  COA A C2B   1 
HETATM 9849  O O2B   . COA C 2 .   ? -7.320  47.776  22.107  1.00 40.48  ? 990  COA A O2B   1 
HETATM 9850  C C3B   . COA C 2 .   ? -8.934  46.756  23.651  1.00 41.85  ? 990  COA A C3B   1 
HETATM 9851  O O3B   . COA C 2 .   ? -8.575  47.823  24.491  1.00 42.06  ? 990  COA A O3B   1 
HETATM 9852  P P3B   . COA C 2 .   ? -9.623  48.922  25.007  1.00 43.17  ? 990  COA A P3B   1 
HETATM 9853  O O7A   . COA C 2 .   ? -8.827  49.938  25.797  1.00 41.05  ? 990  COA A O7A   1 
HETATM 9854  O O8A   . COA C 2 .   ? -10.298 49.558  23.802  1.00 41.80  ? 990  COA A O8A   1 
HETATM 9855  O O9A   . COA C 2 .   ? -10.653 48.252  25.893  1.00 41.90  ? 990  COA A O9A   1 
HETATM 9856  C C4B   . COA C 2 .   ? -8.859  45.522  24.531  1.00 43.22  ? 990  COA A C4B   1 
HETATM 9857  O O4B   . COA C 2 .   ? -7.521  45.045  24.420  1.00 41.69  ? 990  COA A O4B   1 
HETATM 9858  C C5B   . COA C 2 .   ? -9.899  44.452  24.176  1.00 45.01  ? 990  COA A C5B   1 
HETATM 9859  O O5B   . COA C 2 .   ? -9.497  43.721  23.028  1.00 48.01  ? 990  COA A O5B   1 
HETATM 9860  P P1A   . COA C 2 .   ? -10.503 42.732  22.225  1.00 48.01  ? 990  COA A P1A   1 
HETATM 9861  O O1A   . COA C 2 .   ? -11.613 42.197  23.113  1.00 48.55  ? 990  COA A O1A   1 
HETATM 9862  O O2A   . COA C 2 .   ? -9.719  41.617  21.587  1.00 46.59  ? 990  COA A O2A   1 
HETATM 9863  O O3A   . COA C 2 .   ? -11.190 43.707  21.149  1.00 49.89  ? 990  COA A O3A   1 
HETATM 9864  P P2A   . COA C 2 .   ? -10.528 43.982  19.713  1.00 52.00  ? 990  COA A P2A   1 
HETATM 9865  O O4A   . COA C 2 .   ? -9.238  44.713  19.955  1.00 50.31  ? 990  COA A O4A   1 
HETATM 9866  O O5A   . COA C 2 .   ? -11.489 44.765  18.838  1.00 51.95  ? 990  COA A O5A   1 
HETATM 9867  O O6A   . COA C 2 .   ? -10.227 42.530  19.072  1.00 53.90  ? 990  COA A O6A   1 
HETATM 9868  C CBP   . COA C 2 .   ? -10.708 40.341  18.107  1.00 59.07  ? 990  COA A CBP   1 
HETATM 9869  C CCP   . COA C 2 .   ? -11.267 41.659  18.662  1.00 56.93  ? 990  COA A CCP   1 
HETATM 9870  C CDP   . COA C 2 .   ? -10.124 40.638  16.723  1.00 58.87  ? 990  COA A CDP   1 
HETATM 9871  C CEP   . COA C 2 .   ? -11.889 39.398  17.915  1.00 59.01  ? 990  COA A CEP   1 
HETATM 9872  C CAP   . COA C 2 .   ? -9.657  39.735  19.076  1.00 60.33  ? 990  COA A CAP   1 
HETATM 9873  O OAP   . COA C 2 .   ? -10.149 39.648  20.403  1.00 60.06  ? 990  COA A OAP   1 
HETATM 9874  C C9P   . COA C 2 .   ? -9.003  38.428  18.675  1.00 60.97  ? 990  COA A C9P   1 
HETATM 9875  O O9P   . COA C 2 .   ? -8.321  38.300  17.450  1.00 61.25  ? 990  COA A O9P   1 
HETATM 9876  N N8P   . COA C 2 .   ? -9.077  37.418  19.548  1.00 62.06  ? 990  COA A N8P   1 
HETATM 9877  C C7P   . COA C 2 .   ? -8.712  36.053  19.206  1.00 62.64  ? 990  COA A C7P   1 
HETATM 9878  C C6P   . COA C 2 .   ? -7.477  35.540  19.948  1.00 63.43  ? 990  COA A C6P   1 
HETATM 9879  C C5P   . COA C 2 .   ? -6.694  34.613  19.039  1.00 64.63  ? 990  COA A C5P   1 
HETATM 9880  O O5P   . COA C 2 .   ? -6.036  35.086  18.087  1.00 65.08  ? 990  COA A O5P   1 
HETATM 9881  N N4P   . COA C 2 .   ? -6.754  33.303  19.314  1.00 64.35  ? 990  COA A N4P   1 
HETATM 9882  C C3P   . COA C 2 .   ? -5.599  32.420  19.237  1.00 64.64  ? 990  COA A C3P   1 
HETATM 9883  C C2P   . COA C 2 .   ? -4.360  33.018  19.903  1.00 65.21  ? 990  COA A C2P   1 
HETATM 9884  S S1P   . COA C 2 .   ? -3.305  31.793  20.717  1.00 66.52  ? 990  COA A S1P   1 
HETATM 9885  O "O2'" . PRX D 3 .   ? -9.868  24.994  25.976  1.00 12.03  ? 999  PRX A "O2'" 1 
HETATM 9886  C "C2'" . PRX D 3 .   ? -9.034  24.776  24.825  1.00 15.82  ? 999  PRX A "C2'" 1 
HETATM 9887  C "C1'" . PRX D 3 .   ? -9.100  26.027  23.979  1.00 15.55  ? 999  PRX A "C1'" 1 
HETATM 9888  O "O4'" . PRX D 3 .   ? -7.943  26.804  24.318  1.00 16.50  ? 999  PRX A "O4'" 1 
HETATM 9889  C "C4'" . PRX D 3 .   ? -7.170  26.150  25.327  1.00 15.46  ? 999  PRX A "C4'" 1 
HETATM 9890  C "C5'" . PRX D 3 .   ? -5.682  26.325  25.101  1.00 14.98  ? 999  PRX A "C5'" 1 
HETATM 9891  O "O5'" . PRX D 3 .   ? -5.363  27.702  25.233  1.00 15.85  ? 999  PRX A "O5'" 1 
HETATM 9892  P P     . PRX D 3 .   ? -3.887  28.214  24.873  1.00 13.47  ? 999  PRX A P     1 
HETATM 9893  O O1P   . PRX D 3 .   ? -2.943  27.311  25.619  1.00 16.97  ? 999  PRX A O1P   1 
HETATM 9894  O O2P   . PRX D 3 .   ? -3.900  29.691  25.143  1.00 15.89  ? 999  PRX A O2P   1 
HETATM 9895  O O3P   . PRX D 3 .   ? -3.660  27.929  23.314  1.00 14.87  ? 999  PRX A O3P   1 
HETATM 9896  C C1P   . PRX D 3 .   ? -4.538  28.451  22.324  1.00 15.72  ? 999  PRX A C1P   1 
HETATM 9897  C C2P   . PRX D 3 .   ? -3.993  28.099  20.950  1.00 15.00  ? 999  PRX A C2P   1 
HETATM 9898  C C3P   . PRX D 3 .   ? -4.424  26.694  20.551  1.00 15.95  ? 999  PRX A C3P   1 
HETATM 9899  C "C3'" . PRX D 3 .   ? -7.550  24.696  25.168  1.00 15.38  ? 999  PRX A "C3'" 1 
HETATM 9900  O "O3'" . PRX D 3 .   ? -7.233  23.934  26.340  1.00 16.43  ? 999  PRX A "O3'" 1 
HETATM 9901  N N9    . PRX D 3 .   ? -9.015  25.661  22.547  1.00 16.64  ? 999  PRX A N9    1 
HETATM 9902  C C8    . PRX D 3 .   ? -7.956  25.858  21.743  1.00 15.52  ? 999  PRX A C8    1 
HETATM 9903  N N7    . PRX D 3 .   ? -8.263  25.404  20.509  1.00 15.90  ? 999  PRX A N7    1 
HETATM 9904  C C5    . PRX D 3 .   ? -9.522  24.931  20.548  1.00 15.73  ? 999  PRX A C5    1 
HETATM 9905  C C4    . PRX D 3 .   ? -9.991  25.089  21.840  1.00 16.72  ? 999  PRX A C4    1 
HETATM 9906  N N3    . PRX D 3 .   ? -11.257 24.684  22.159  1.00 16.73  ? 999  PRX A N3    1 
HETATM 9907  C C2    . PRX D 3 .   ? -12.033 24.127  21.212  1.00 15.76  ? 999  PRX A C2    1 
HETATM 9908  N N1    . PRX D 3 .   ? -11.608 23.972  19.952  1.00 14.81  ? 999  PRX A N1    1 
HETATM 9909  C C6    . PRX D 3 .   ? -10.361 24.357  19.598  1.00 15.53  ? 999  PRX A C6    1 
HETATM 9910  N N6    . PRX D 3 .   ? -9.927  24.189  18.331  1.00 16.15  ? 999  PRX A N6    1 
HETATM 9911  N N1A   . COA E 2 .   ? -21.189 61.304  10.762  1.00 38.86  ? 991  COA B N1A   1 
HETATM 9912  C C2A   . COA E 2 .   ? -21.120 60.046  10.195  1.00 38.95  ? 991  COA B C2A   1 
HETATM 9913  N N3A   . COA E 2 .   ? -21.295 58.910  10.968  1.00 38.71  ? 991  COA B N3A   1 
HETATM 9914  C C4A   . COA E 2 .   ? -21.523 59.020  12.295  1.00 39.46  ? 991  COA B C4A   1 
HETATM 9915  C C5A   . COA E 2 .   ? -21.589 60.270  12.894  1.00 38.90  ? 991  COA B C5A   1 
HETATM 9916  C C6A   . COA E 2 .   ? -21.427 61.417  12.121  1.00 39.72  ? 991  COA B C6A   1 
HETATM 9917  N N6A   . COA E 2 .   ? -21.491 62.618  12.693  1.00 39.98  ? 991  COA B N6A   1 
HETATM 9918  N N7A   . COA E 2 .   ? -21.833 60.088  14.209  1.00 39.09  ? 991  COA B N7A   1 
HETATM 9919  C C8A   . COA E 2 .   ? -21.917 58.766  14.462  1.00 39.30  ? 991  COA B C8A   1 
HETATM 9920  N N9A   . COA E 2 .   ? -21.717 58.088  13.284  1.00 41.30  ? 991  COA B N9A   1 
HETATM 9921  C C1B   . COA E 2 .   ? -21.664 56.625  13.110  1.00 43.57  ? 991  COA B C1B   1 
HETATM 9922  C C2B   . COA E 2 .   ? -20.521 55.983  13.893  1.00 44.80  ? 991  COA B C2B   1 
HETATM 9923  O O2B   . COA E 2 .   ? -19.320 55.917  13.151  1.00 44.77  ? 991  COA B O2B   1 
HETATM 9924  C C3B   . COA E 2 .   ? -21.078 54.596  14.155  1.00 46.78  ? 991  COA B C3B   1 
HETATM 9925  O O3B   . COA E 2 .   ? -20.787 53.794  13.025  1.00 45.67  ? 991  COA B O3B   1 
HETATM 9926  P P3B   . COA E 2 .   ? -20.627 52.190  13.077  1.00 45.53  ? 991  COA B P3B   1 
HETATM 9927  O O7A   . COA E 2 .   ? -21.747 51.610  13.919  1.00 44.38  ? 991  COA B O7A   1 
HETATM 9928  O O8A   . COA E 2 .   ? -19.274 51.817  13.660  1.00 44.67  ? 991  COA B O8A   1 
HETATM 9929  O O9A   . COA E 2 .   ? -20.739 51.680  11.660  1.00 44.63  ? 991  COA B O9A   1 
HETATM 9930  C C4B   . COA E 2 .   ? -22.591 54.796  14.237  1.00 47.31  ? 991  COA B C4B   1 
HETATM 9931  O O4B   . COA E 2 .   ? -22.861 56.035  13.597  1.00 45.38  ? 991  COA B O4B   1 
HETATM 9932  C C5B   . COA E 2 .   ? -23.151 54.770  15.666  1.00 50.58  ? 991  COA B C5B   1 
HETATM 9933  O O5B   . COA E 2 .   ? -22.693 55.889  16.407  1.00 55.01  ? 991  COA B O5B   1 
HETATM 9934  P P1A   . COA E 2 .   ? -22.951 56.120  17.992  1.00 57.59  ? 991  COA B P1A   1 
HETATM 9935  O O1A   . COA E 2 .   ? -23.970 55.163  18.574  1.00 58.61  ? 991  COA B O1A   1 
HETATM 9936  O O2A   . COA E 2 .   ? -23.371 57.551  18.237  1.00 57.42  ? 991  COA B O2A   1 
HETATM 9937  O O3A   . COA E 2 .   ? -21.535 55.771  18.658  1.00 59.97  ? 991  COA B O3A   1 
HETATM 9938  P P2A   . COA E 2 .   ? -20.358 56.863  18.622  1.00 62.84  ? 991  COA B P2A   1 
HETATM 9939  O O4A   . COA E 2 .   ? -20.190 57.331  17.195  1.00 61.97  ? 991  COA B O4A   1 
HETATM 9940  O O5A   . COA E 2 .   ? -19.083 56.291  19.213  1.00 62.09  ? 991  COA B O5A   1 
HETATM 9941  O O6A   . COA E 2 .   ? -20.912 58.087  19.509  1.00 63.21  ? 991  COA B O6A   1 
HETATM 9942  C CBP   . COA E 2 .   ? -21.525 59.315  21.478  1.00 66.23  ? 991  COA B CBP   1 
HETATM 9943  C CCP   . COA E 2 .   ? -20.866 58.053  20.920  1.00 65.22  ? 991  COA B CCP   1 
HETATM 9944  C CDP   . COA E 2 .   ? -20.432 60.368  21.651  1.00 66.59  ? 991  COA B CDP   1 
HETATM 9945  C CEP   . COA E 2 .   ? -22.074 58.974  22.861  1.00 65.85  ? 991  COA B CEP   1 
HETATM 9946  C CAP   . COA E 2 .   ? -22.620 59.798  20.496  1.00 66.34  ? 991  COA B CAP   1 
HETATM 9947  O OAP   . COA E 2 .   ? -23.561 58.786  20.208  1.00 67.61  ? 991  COA B OAP   1 
HETATM 9948  C C9P   . COA E 2 .   ? -23.330 61.089  20.812  1.00 65.70  ? 991  COA B C9P   1 
HETATM 9949  O O9P   . COA E 2 .   ? -22.642 62.317  20.714  1.00 66.08  ? 991  COA B O9P   1 
HETATM 9950  N N8P   . COA E 2 .   ? -24.618 60.997  21.150  1.00 64.37  ? 991  COA B N8P   1 
HETATM 9951  C C7P   . COA E 2 .   ? -25.333 62.077  21.799  1.00 63.73  ? 991  COA B C7P   1 
HETATM 9952  C C6P   . COA E 2 .   ? -26.266 62.799  20.831  1.00 63.98  ? 991  COA B C6P   1 
HETATM 9953  C C5P   . COA E 2 .   ? -26.353 64.262  21.198  1.00 64.11  ? 991  COA B C5P   1 
HETATM 9954  O O5P   . COA E 2 .   ? -25.351 65.000  21.078  1.00 64.34  ? 991  COA B O5P   1 
HETATM 9955  N N4P   . COA E 2 .   ? -27.554 64.663  21.636  1.00 64.28  ? 991  COA B N4P   1 
HETATM 9956  C C3P   . COA E 2 .   ? -27.852 65.965  22.220  1.00 64.23  ? 991  COA B C3P   1 
HETATM 9957  C C2P   . COA E 2 .   ? -27.639 67.148  21.279  1.00 64.47  ? 991  COA B C2P   1 
HETATM 9958  S S1P   . COA E 2 .   ? -28.399 66.961  19.640  1.00 64.97  ? 991  COA B S1P   1 
HETATM 9959  O "O2'" . PRX F 3 .   ? -37.875 63.798  24.761  1.00 18.12  ? 998  PRX B "O2'" 1 
HETATM 9960  C "C2'" . PRX F 3 .   ? -37.218 65.083  24.838  1.00 18.56  ? 998  PRX B "C2'" 1 
HETATM 9961  C "C1'" . PRX F 3 .   ? -35.720 64.852  24.675  1.00 17.90  ? 998  PRX B "C1'" 1 
HETATM 9962  O "O4'" . PRX F 3 .   ? -35.434 65.147  23.296  1.00 18.17  ? 998  PRX B "O4'" 1 
HETATM 9963  C "C4'" . PRX F 3 .   ? -36.630 65.486  22.571  1.00 17.85  ? 998  PRX B "C4'" 1 
HETATM 9964  C "C5'" . PRX F 3 .   ? -36.358 66.540  21.504  1.00 19.20  ? 998  PRX B "C5'" 1 
HETATM 9965  O "O5'" . PRX F 3 .   ? -35.365 66.075  20.578  1.00 20.95  ? 998  PRX B "O5'" 1 
HETATM 9966  P P     . PRX F 3 .   ? -34.874 66.936  19.314  1.00 19.77  ? 998  PRX B P     1 
HETATM 9967  O O1P   . PRX F 3 .   ? -36.079 67.564  18.650  1.00 20.58  ? 998  PRX B O1P   1 
HETATM 9968  O O2P   . PRX F 3 .   ? -33.975 66.023  18.518  1.00 22.38  ? 998  PRX B O2P   1 
HETATM 9969  O O3P   . PRX F 3 .   ? -33.966 68.093  19.955  1.00 20.93  ? 998  PRX B O3P   1 
HETATM 9970  C C1P   . PRX F 3 .   ? -32.916 67.720  20.860  1.00 21.05  ? 998  PRX B C1P   1 
HETATM 9971  C C2P   . PRX F 3 .   ? -32.341 68.974  21.487  1.00 21.20  ? 998  PRX B C2P   1 
HETATM 9972  C C3P   . PRX F 3 .   ? -33.129 69.357  22.708  1.00 21.53  ? 998  PRX B C3P   1 
HETATM 9973  C "C3'" . PRX F 3 .   ? -37.571 65.981  23.658  1.00 18.64  ? 998  PRX B "C3'" 1 
HETATM 9974  O "O3'" . PRX F 3 .   ? -38.936 65.879  23.262  1.00 17.71  ? 998  PRX B "O3'" 1 
HETATM 9975  N N9    . PRX F 3 .   ? -34.995 65.788  25.554  1.00 18.77  ? 998  PRX B N9    1 
HETATM 9976  C C8    . PRX F 3 .   ? -34.363 66.891  25.111  1.00 19.10  ? 998  PRX B C8    1 
HETATM 9977  N N7    . PRX F 3 .   ? -33.808 67.538  26.144  1.00 19.89  ? 998  PRX B N7    1 
HETATM 9978  C C5    . PRX F 3 .   ? -34.101 66.821  27.257  1.00 18.98  ? 998  PRX B C5    1 
HETATM 9979  C C4    . PRX F 3 .   ? -34.854 65.721  26.893  1.00 18.16  ? 998  PRX B C4    1 
HETATM 9980  N N3    . PRX F 3 .   ? -35.268 64.849  27.847  1.00 16.64  ? 998  PRX B N3    1 
HETATM 9981  C C2    . PRX F 3 .   ? -34.960 65.038  29.134  1.00 18.03  ? 998  PRX B C2    1 
HETATM 9982  N N1    . PRX F 3 .   ? -34.225 66.104  29.502  1.00 19.35  ? 998  PRX B N1    1 
HETATM 9983  C C6    . PRX F 3 .   ? -33.793 67.011  28.589  1.00 18.60  ? 998  PRX B C6    1 
HETATM 9984  N N6    . PRX F 3 .   ? -33.046 68.082  28.935  1.00 17.57  ? 998  PRX B N6    1 
HETATM 9985  O O     . HOH G 4 .   ? 15.475  11.559  22.536  1.00 21.30  ? 1000 HOH A O     1 
HETATM 9986  O O     . HOH G 4 .   ? 18.284  27.482  17.860  1.00 11.53  ? 1001 HOH A O     1 
HETATM 9987  O O     . HOH G 4 .   ? 0.320   51.123  9.977   1.00 13.37  ? 1002 HOH A O     1 
HETATM 9988  O O     . HOH G 4 .   ? -5.986  51.069  6.776   1.00 14.20  ? 1003 HOH A O     1 
HETATM 9989  O O     . HOH G 4 .   ? 1.663   41.028  -1.487  1.00 17.60  ? 1004 HOH A O     1 
HETATM 9990  O O     . HOH G 4 .   ? 16.532  39.594  -1.437  1.00 24.35  ? 1005 HOH A O     1 
HETATM 9991  O O     . HOH G 4 .   ? 21.485  37.774  4.481   1.00 22.22  ? 1006 HOH A O     1 
HETATM 9992  O O     . HOH G 4 .   ? 27.521  37.844  24.901  1.00 26.10  ? 1007 HOH A O     1 
HETATM 9993  O O     . HOH G 4 .   ? 19.099  27.467  25.082  1.00 21.82  ? 1008 HOH A O     1 
HETATM 9994  O O     . HOH G 4 .   ? 20.501  26.787  27.641  1.00 22.13  ? 1009 HOH A O     1 
HETATM 9995  O O     . HOH G 4 .   ? 17.048  28.882  30.590  1.00 27.74  ? 1010 HOH A O     1 
HETATM 9996  O O     . HOH G 4 .   ? 17.947  35.097  32.566  1.00 14.33  ? 1011 HOH A O     1 
HETATM 9997  O O     . HOH G 4 .   ? -18.980 20.137  1.215   1.00 32.41  ? 1012 HOH A O     1 
HETATM 9998  O O     . HOH G 4 .   ? 2.247   48.378  15.731  1.00 15.90  ? 1013 HOH A O     1 
HETATM 9999  O O     . HOH G 4 .   ? 0.506   45.923  16.380  1.00 25.24  ? 1014 HOH A O     1 
HETATM 10000 O O     . HOH G 4 .   ? 6.057   34.920  28.134  1.00 17.71  ? 1015 HOH A O     1 
HETATM 10001 O O     . HOH G 4 .   ? 8.121   33.333  24.287  1.00 12.20  ? 1016 HOH A O     1 
HETATM 10002 O O     . HOH G 4 .   ? 2.518   36.289  26.227  1.00 13.41  ? 1017 HOH A O     1 
HETATM 10003 O O     . HOH G 4 .   ? 2.336   35.785  28.849  1.00 21.63  ? 1018 HOH A O     1 
HETATM 10004 O O     . HOH G 4 .   ? 4.216   47.497  38.586  1.00 26.22  ? 1019 HOH A O     1 
HETATM 10005 O O     . HOH G 4 .   ? 5.008   54.328  25.428  1.00 17.24  ? 1020 HOH A O     1 
HETATM 10006 O O     . HOH G 4 .   ? -3.732  24.621  34.613  1.00 28.27  ? 1021 HOH A O     1 
HETATM 10007 O O     . HOH G 4 .   ? 16.235  55.883  16.482  1.00 26.65  ? 1022 HOH A O     1 
HETATM 10008 O O     . HOH G 4 .   ? 9.966   57.630  20.057  1.00 22.62  ? 1023 HOH A O     1 
HETATM 10009 O O     . HOH G 4 .   ? 7.756   48.592  11.912  1.00 19.82  ? 1024 HOH A O     1 
HETATM 10010 O O     . HOH G 4 .   ? 21.285  55.238  26.693  1.00 21.69  ? 1025 HOH A O     1 
HETATM 10011 O O     . HOH G 4 .   ? 20.529  54.274  21.414  1.00 22.73  ? 1026 HOH A O     1 
HETATM 10012 O O     . HOH G 4 .   ? -3.056  31.594  36.055  1.00 16.93  ? 1027 HOH A O     1 
HETATM 10013 O O     . HOH G 4 .   ? -8.331  29.565  38.168  1.00 23.42  ? 1028 HOH A O     1 
HETATM 10014 O O     . HOH G 4 .   ? 3.672   35.757  36.877  1.00 30.30  ? 1029 HOH A O     1 
HETATM 10015 O O     . HOH G 4 .   ? 9.040   21.281  23.544  1.00 13.84  ? 1030 HOH A O     1 
HETATM 10016 O O     . HOH G 4 .   ? 10.967  20.245  21.829  1.00 12.61  ? 1031 HOH A O     1 
HETATM 10017 O O     . HOH G 4 .   ? 5.280   22.216  17.994  1.00 13.14  ? 1032 HOH A O     1 
HETATM 10018 O O     . HOH G 4 .   ? 6.338   30.626  -0.987  1.00 29.93  ? 1033 HOH A O     1 
HETATM 10019 O O     . HOH G 4 .   ? 1.076   34.314  9.053   1.00 11.13  ? 1034 HOH A O     1 
HETATM 10020 O O     . HOH G 4 .   ? -1.254  38.483  11.255  1.00 12.21  ? 1035 HOH A O     1 
HETATM 10021 O O     . HOH G 4 .   ? -2.501  41.894  14.594  1.00 11.68  ? 1036 HOH A O     1 
HETATM 10022 O O     . HOH G 4 .   ? -4.217  36.984  18.771  1.00 13.94  ? 1037 HOH A O     1 
HETATM 10023 O O     . HOH G 4 .   ? 5.903   34.842  -1.935  1.00 20.71  ? 1038 HOH A O     1 
HETATM 10024 O O     . HOH G 4 .   ? -11.313 48.281  5.619   1.00 11.92  ? 1039 HOH A O     1 
HETATM 10025 O O     . HOH G 4 .   ? -17.386 46.601  4.996   1.00 15.22  ? 1040 HOH A O     1 
HETATM 10026 O O     . HOH G 4 .   ? -13.367 40.703  6.067   1.00 14.21  ? 1041 HOH A O     1 
HETATM 10027 O O     . HOH G 4 .   ? -5.751  45.740  3.531   1.00 13.06  ? 1042 HOH A O     1 
HETATM 10028 O O     . HOH G 4 .   ? -7.855  44.492  -1.073  1.00 17.40  ? 1043 HOH A O     1 
HETATM 10029 O O     . HOH G 4 .   ? -8.239  36.575  -3.036  1.00 15.95  ? 1044 HOH A O     1 
HETATM 10030 O O     . HOH G 4 .   ? -22.160 36.647  15.460  1.00 16.68  ? 1045 HOH A O     1 
HETATM 10031 O O     . HOH G 4 .   ? -21.868 32.766  15.982  1.00 28.64  ? 1046 HOH A O     1 
HETATM 10032 O O     . HOH G 4 .   ? -24.461 36.598  14.035  1.00 33.24  ? 1047 HOH A O     1 
HETATM 10033 O O     . HOH G 4 .   ? -11.741 26.631  16.458  1.00 9.33   ? 1048 HOH A O     1 
HETATM 10034 O O     . HOH G 4 .   ? -14.978 27.375  2.184   1.00 9.56   ? 1049 HOH A O     1 
HETATM 10035 O O     . HOH G 4 .   ? -14.918 21.951  1.989   1.00 16.30  ? 1050 HOH A O     1 
HETATM 10036 O O     . HOH G 4 .   ? -13.271 21.784  10.773  1.00 21.34  ? 1051 HOH A O     1 
HETATM 10037 O O     . HOH G 4 .   ? -14.410 19.445  11.221  1.00 12.55  ? 1052 HOH A O     1 
HETATM 10038 O O     . HOH G 4 .   ? -15.025 22.517  13.422  1.00 19.31  ? 1053 HOH A O     1 
HETATM 10039 O O     . HOH G 4 .   ? -5.387  14.712  12.575  1.00 26.81  ? 1054 HOH A O     1 
HETATM 10040 O O     . HOH G 4 .   ? -11.881 18.233  4.104   1.00 20.10  ? 1055 HOH A O     1 
HETATM 10041 O O     . HOH G 4 .   ? -21.118 19.651  8.969   1.00 11.52  ? 1056 HOH A O     1 
HETATM 10042 O O     . HOH G 4 .   ? 0.289   10.978  22.141  1.00 13.73  ? 1057 HOH A O     1 
HETATM 10043 O O     . HOH G 4 .   ? 11.987  22.972  35.128  1.00 19.09  ? 1058 HOH A O     1 
HETATM 10044 O O     . HOH G 4 .   ? 6.995   29.988  35.772  1.00 20.98  ? 1059 HOH A O     1 
HETATM 10045 O O     . HOH G 4 .   ? -3.118  13.894  34.840  1.00 14.07  ? 1060 HOH A O     1 
HETATM 10046 O O     . HOH G 4 .   ? -8.674  43.847  49.801  1.00 10.27  ? 1061 HOH A O     1 
HETATM 10047 O O     . HOH G 4 .   ? -20.780 43.865  49.195  1.00 27.22  ? 1062 HOH A O     1 
HETATM 10048 O O     . HOH G 4 .   ? -0.226  27.139  34.320  1.00 35.04  ? 1063 HOH A O     1 
HETATM 10049 O O     . HOH G 4 .   ? -17.379 50.008  29.800  1.00 18.63  ? 1064 HOH A O     1 
HETATM 10050 O O     . HOH G 4 .   ? -3.026  35.256  30.581  1.00 16.83  ? 1065 HOH A O     1 
HETATM 10051 O O     . HOH G 4 .   ? -12.867 23.405  -3.873  1.00 19.84  ? 1066 HOH A O     1 
HETATM 10052 O O     . HOH G 4 .   ? -10.169 24.831  -1.848  1.00 14.58  ? 1067 HOH A O     1 
HETATM 10053 O O     . HOH G 4 .   ? -1.752  12.441  -1.635  1.00 15.77  ? 1068 HOH A O     1 
HETATM 10054 O O     . HOH G 4 .   ? -4.626  16.336  3.751   1.00 16.67  ? 1069 HOH A O     1 
HETATM 10055 O O     . HOH G 4 .   ? -2.229  17.558  3.454   1.00 15.67  ? 1070 HOH A O     1 
HETATM 10056 O O     . HOH G 4 .   ? 7.594   1.027   11.272  1.00 30.01  ? 1071 HOH A O     1 
HETATM 10057 O O     . HOH G 4 .   ? 9.311   2.843   18.390  1.00 28.80  ? 1072 HOH A O     1 
HETATM 10058 O O     . HOH G 4 .   ? 7.345   9.606   8.968   1.00 32.59  ? 1073 HOH A O     1 
HETATM 10059 O O     . HOH G 4 .   ? 15.698  19.021  5.943   1.00 20.62  ? 1074 HOH A O     1 
HETATM 10060 O O     . HOH G 4 .   ? 20.524  22.744  12.195  1.00 16.29  ? 1075 HOH A O     1 
HETATM 10061 O O     . HOH G 4 .   ? 13.595  10.594  29.364  1.00 29.43  ? 1076 HOH A O     1 
HETATM 10062 O O     . HOH G 4 .   ? 4.645   7.024   31.010  1.00 26.52  ? 1077 HOH A O     1 
HETATM 10063 O O     . HOH G 4 .   ? -20.197 17.185  1.093   1.00 22.21  ? 1078 HOH A O     1 
HETATM 10064 O O     . HOH G 4 .   ? -14.891 13.168  0.815   1.00 21.22  ? 1079 HOH A O     1 
HETATM 10065 O O     . HOH G 4 .   ? -15.342 18.611  -5.633  1.00 26.68  ? 1080 HOH A O     1 
HETATM 10066 O O     . HOH G 4 .   ? -3.828  11.329  -2.933  1.00 10.81  ? 1081 HOH A O     1 
HETATM 10067 O O     . HOH G 4 .   ? 0.848   18.677  -5.233  1.00 26.66  ? 1082 HOH A O     1 
HETATM 10068 O O     . HOH G 4 .   ? 1.596   12.655  -0.804  1.00 20.10  ? 1083 HOH A O     1 
HETATM 10069 O O     . HOH G 4 .   ? 3.557   4.201   21.106  1.00 34.61  ? 1084 HOH A O     1 
HETATM 10070 O O     . HOH G 4 .   ? 12.181  4.835   21.853  1.00 24.03  ? 1085 HOH A O     1 
HETATM 10071 O O     . HOH G 4 .   ? 19.204  13.459  12.051  1.00 16.76  ? 1086 HOH A O     1 
HETATM 10072 O O     . HOH G 4 .   ? 3.991   6.820   28.580  1.00 21.78  ? 1087 HOH A O     1 
HETATM 10073 O O     . HOH G 4 .   ? 1.991   10.684  36.327  1.00 30.69  ? 1088 HOH A O     1 
HETATM 10074 O O     . HOH G 4 .   ? 2.116   12.372  39.215  1.00 25.43  ? 1089 HOH A O     1 
HETATM 10075 O O     . HOH G 4 .   ? 8.467   14.306  37.774  1.00 22.48  ? 1090 HOH A O     1 
HETATM 10076 O O     . HOH G 4 .   ? 10.115  16.669  31.113  1.00 28.20  ? 1091 HOH A O     1 
HETATM 10077 O O     . HOH G 4 .   ? 13.888  17.836  21.141  1.00 19.11  ? 1092 HOH A O     1 
HETATM 10078 O O     . HOH G 4 .   ? 15.632  23.635  2.486   1.00 26.64  ? 1093 HOH A O     1 
HETATM 10079 O O     . HOH G 4 .   ? -0.395  53.498  10.911  1.00 22.28  ? 1094 HOH A O     1 
HETATM 10080 O O     . HOH G 4 .   ? -4.680  54.730  9.651   1.00 22.41  ? 1095 HOH A O     1 
HETATM 10081 O O     . HOH G 4 .   ? -6.429  53.519  7.646   1.00 19.33  ? 1096 HOH A O     1 
HETATM 10082 O O     . HOH G 4 .   ? -7.694  49.937  5.105   1.00 14.40  ? 1097 HOH A O     1 
HETATM 10083 O O     . HOH G 4 .   ? 2.606   45.221  -0.268  1.00 22.94  ? 1098 HOH A O     1 
HETATM 10084 O O     . HOH G 4 .   ? 28.523  43.263  15.270  1.00 21.83  ? 1099 HOH A O     1 
HETATM 10085 O O     . HOH G 4 .   ? 19.293  27.226  29.818  1.00 27.05  ? 1100 HOH A O     1 
HETATM 10086 O O     . HOH G 4 .   ? 2.142   41.525  21.359  1.00 20.61  ? 1101 HOH A O     1 
HETATM 10087 O O     . HOH G 4 .   ? 5.071   41.094  22.261  1.00 14.76  ? 1102 HOH A O     1 
HETATM 10088 O O     . HOH G 4 .   ? -3.009  39.682  13.006  1.00 19.41  ? 1103 HOH A O     1 
HETATM 10089 O O     . HOH G 4 .   ? 17.329  28.705  22.306  1.00 16.45  ? 1104 HOH A O     1 
HETATM 10090 O O     . HOH G 4 .   ? 17.439  26.663  20.391  1.00 19.18  ? 1105 HOH A O     1 
HETATM 10091 O O     . HOH G 4 .   ? -5.373  43.158  27.316  1.00 28.74  ? 1106 HOH A O     1 
HETATM 10092 O O     . HOH G 4 .   ? -0.266  48.000  35.951  1.00 23.41  ? 1107 HOH A O     1 
HETATM 10093 O O     . HOH G 4 .   ? 13.584  40.934  38.338  1.00 19.81  ? 1108 HOH A O     1 
HETATM 10094 O O     . HOH G 4 .   ? 13.559  38.350  39.528  1.00 12.32  ? 1109 HOH A O     1 
HETATM 10095 O O     . HOH G 4 .   ? 16.121  37.588  39.669  1.00 19.79  ? 1110 HOH A O     1 
HETATM 10096 O O     . HOH G 4 .   ? 22.999  38.928  31.148  1.00 32.43  ? 1111 HOH A O     1 
HETATM 10097 O O     . HOH G 4 .   ? -6.357  47.329  11.446  1.00 14.64  ? 1112 HOH A O     1 
HETATM 10098 O O     . HOH G 4 .   ? -10.100 53.054  16.938  1.00 20.91  ? 1113 HOH A O     1 
HETATM 10099 O O     . HOH G 4 .   ? 8.066   56.377  28.144  1.00 20.58  ? 1114 HOH A O     1 
HETATM 10100 O O     . HOH G 4 .   ? -1.025  51.058  30.175  1.00 20.59  ? 1115 HOH A O     1 
HETATM 10101 O O     . HOH G 4 .   ? 5.878   56.289  33.170  1.00 24.53  ? 1116 HOH A O     1 
HETATM 10102 O O     . HOH G 4 .   ? 7.865   56.985  31.772  1.00 21.61  ? 1117 HOH A O     1 
HETATM 10103 O O     . HOH G 4 .   ? 11.759  52.849  34.546  1.00 15.82  ? 1118 HOH A O     1 
HETATM 10104 O O     . HOH G 4 .   ? 21.485  49.271  33.358  1.00 26.38  ? 1119 HOH A O     1 
HETATM 10105 O O     . HOH G 4 .   ? 11.853  61.225  23.201  1.00 30.21  ? 1120 HOH A O     1 
HETATM 10106 O O     . HOH G 4 .   ? 25.392  22.017  22.115  1.00 34.64  ? 1121 HOH A O     1 
HETATM 10107 O O     . HOH G 4 .   ? -2.833  32.260  29.344  1.00 19.78  ? 1122 HOH A O     1 
HETATM 10108 O O     . HOH G 4 .   ? -2.407  31.257  26.742  1.00 18.66  ? 1123 HOH A O     1 
HETATM 10109 O O     . HOH G 4 .   ? -2.853  36.841  32.830  1.00 18.51  ? 1124 HOH A O     1 
HETATM 10110 O O     . HOH G 4 .   ? 1.154   26.816  -4.836  1.00 24.08  ? 1125 HOH A O     1 
HETATM 10111 O O     . HOH G 4 .   ? 4.453   33.118  -3.620  1.00 18.93  ? 1126 HOH A O     1 
HETATM 10112 O O     . HOH G 4 .   ? -4.669  38.426  20.970  1.00 16.00  ? 1127 HOH A O     1 
HETATM 10113 O O     . HOH G 4 .   ? -15.646 48.030  11.990  1.00 34.64  ? 1128 HOH A O     1 
HETATM 10114 O O     . HOH G 4 .   ? -6.502  44.110  -3.709  1.00 29.72  ? 1129 HOH A O     1 
HETATM 10115 O O     . HOH G 4 .   ? -25.366 43.471  11.005  1.00 22.18  ? 1130 HOH A O     1 
HETATM 10116 O O     . HOH G 4 .   ? -25.981 40.917  13.630  1.00 25.25  ? 1131 HOH A O     1 
HETATM 10117 O O     . HOH G 4 .   ? -21.430 41.775  -0.304  1.00 24.19  ? 1132 HOH A O     1 
HETATM 10118 O O     . HOH G 4 .   ? -12.647 31.992  -0.926  1.00 28.39  ? 1133 HOH A O     1 
HETATM 10119 O O     . HOH G 4 .   ? -8.575  37.711  -5.593  1.00 26.52  ? 1134 HOH A O     1 
HETATM 10120 O O     . HOH G 4 .   ? -10.175 27.413  -4.258  1.00 26.48  ? 1135 HOH A O     1 
HETATM 10121 O O     . HOH G 4 .   ? -6.884  28.862  -5.934  1.00 24.60  ? 1136 HOH A O     1 
HETATM 10122 O O     . HOH G 4 .   ? -13.130 22.648  18.102  1.00 20.94  ? 1137 HOH A O     1 
HETATM 10123 O O     . HOH G 4 .   ? -19.048 30.214  17.510  1.00 22.22  ? 1138 HOH A O     1 
HETATM 10124 O O     . HOH G 4 .   ? -14.043 19.520  2.882   1.00 16.35  ? 1139 HOH A O     1 
HETATM 10125 O O     . HOH G 4 .   ? -17.322 11.745  35.845  1.00 27.51  ? 1140 HOH A O     1 
HETATM 10126 O O     . HOH G 4 .   ? -11.294 7.127   25.555  1.00 22.03  ? 1141 HOH A O     1 
HETATM 10127 O O     . HOH G 4 .   ? -8.738  4.796   25.286  1.00 26.39  ? 1142 HOH A O     1 
HETATM 10128 O O     . HOH G 4 .   ? 10.937  21.628  40.717  1.00 15.36  ? 1143 HOH A O     1 
HETATM 10129 O O     . HOH G 4 .   ? -16.567 29.631  35.020  1.00 26.45  ? 1144 HOH A O     1 
HETATM 10130 O O     . HOH G 4 .   ? -13.474 26.732  27.621  1.00 16.62  ? 1145 HOH A O     1 
HETATM 10131 O O     . HOH G 4 .   ? -19.890 29.803  29.958  1.00 23.69  ? 1146 HOH A O     1 
HETATM 10132 O O     . HOH G 4 .   ? -14.339 55.615  39.404  1.00 17.62  ? 1147 HOH A O     1 
HETATM 10133 O O     . HOH G 4 .   ? -20.239 36.804  50.511  1.00 30.65  ? 1148 HOH A O     1 
HETATM 10134 O O     . HOH G 4 .   ? -5.450  57.444  13.526  1.00 16.78  ? 1149 HOH A O     1 
HETATM 10135 O O     . HOH G 4 .   ? -13.155 54.172  21.027  1.00 28.25  ? 1150 HOH A O     1 
HETATM 10136 O O     . HOH G 4 .   ? 13.329  26.472  0.722   1.00 24.55  ? 1151 HOH A O     1 
HETATM 10137 O O     . HOH G 4 .   ? 21.130  28.273  2.085   1.00 31.49  ? 1152 HOH A O     1 
HETATM 10138 O O     . HOH G 4 .   ? 17.976  26.962  -0.566  1.00 28.46  ? 1153 HOH A O     1 
HETATM 10139 O O     . HOH G 4 .   ? 10.959  39.257  -1.253  1.00 23.50  ? 1154 HOH A O     1 
HETATM 10140 O O     . HOH G 4 .   ? 8.131   35.655  -2.966  1.00 15.76  ? 1155 HOH A O     1 
HETATM 10141 O O     . HOH G 4 .   ? -3.189  53.333  11.564  1.00 17.26  ? 1156 HOH A O     1 
HETATM 10142 O O     . HOH G 4 .   ? -6.102  21.445  -7.800  1.00 29.08  ? 1157 HOH A O     1 
HETATM 10143 O O     . HOH G 4 .   ? -8.253  13.223  -1.053  1.00 21.68  ? 1158 HOH A O     1 
HETATM 10144 O O     . HOH G 4 .   ? -6.101  12.657  -3.084  1.00 28.41  ? 1159 HOH A O     1 
HETATM 10145 O O     . HOH G 4 .   ? 1.813   7.501   3.836   1.00 29.58  ? 1160 HOH A O     1 
HETATM 10146 O O     . HOH G 4 .   ? 17.957  15.947  8.059   1.00 29.49  ? 1161 HOH A O     1 
HETATM 10147 O O     . HOH G 4 .   ? 7.771   16.486  5.435   1.00 17.93  ? 1162 HOH A O     1 
HETATM 10148 O O     . HOH G 4 .   ? 21.929  23.653  10.095  1.00 22.46  ? 1163 HOH A O     1 
HETATM 10149 O O     . HOH G 4 .   ? 27.053  19.774  17.167  1.00 31.59  ? 1164 HOH A O     1 
HETATM 10150 O O     . HOH G 4 .   ? -7.970  48.217  3.070   1.00 24.13  ? 1165 HOH A O     1 
HETATM 10151 O O     . HOH G 4 .   ? 6.332   51.882  8.753   1.00 36.37  ? 1166 HOH A O     1 
HETATM 10152 O O     . HOH G 4 .   ? 24.990  45.902  21.021  1.00 32.50  ? 1167 HOH A O     1 
HETATM 10153 O O     . HOH G 4 .   ? 16.513  33.222  33.848  1.00 22.84  ? 1168 HOH A O     1 
HETATM 10154 O O     . HOH G 4 .   ? -2.491  47.169  29.212  1.00 31.11  ? 1169 HOH A O     1 
HETATM 10155 O O     . HOH G 4 .   ? -3.624  48.331  31.738  1.00 31.36  ? 1170 HOH A O     1 
HETATM 10156 O O     . HOH G 4 .   ? 6.581   36.939  39.567  1.00 33.27  ? 1171 HOH A O     1 
HETATM 10157 O O     . HOH G 4 .   ? 20.572  43.427  28.856  1.00 35.22  ? 1172 HOH A O     1 
HETATM 10158 O O     . HOH G 4 .   ? -3.434  57.451  19.748  1.00 26.84  ? 1173 HOH A O     1 
HETATM 10159 O O     . HOH G 4 .   ? 3.979   56.962  25.690  1.00 27.69  ? 1174 HOH A O     1 
HETATM 10160 O O     . HOH G 4 .   ? 1.931   53.134  31.269  1.00 25.92  ? 1175 HOH A O     1 
HETATM 10161 O O     . HOH G 4 .   ? 4.217   62.335  21.022  1.00 31.52  ? 1176 HOH A O     1 
HETATM 10162 O O     . HOH G 4 .   ? 5.849   58.159  27.603  1.00 35.15  ? 1177 HOH A O     1 
HETATM 10163 O O     . HOH G 4 .   ? 13.415  61.281  30.193  1.00 31.27  ? 1178 HOH A O     1 
HETATM 10164 O O     . HOH G 4 .   ? 24.333  52.154  27.315  1.00 25.24  ? 1179 HOH A O     1 
HETATM 10165 O O     . HOH G 4 .   ? -0.209  31.096  24.479  1.00 19.24  ? 1180 HOH A O     1 
HETATM 10166 O O     . HOH G 4 .   ? -5.742  31.246  38.281  1.00 28.03  ? 1181 HOH A O     1 
HETATM 10167 O O     . HOH G 4 .   ? -2.475  37.162  36.978  1.00 29.75  ? 1182 HOH A O     1 
HETATM 10168 O O     . HOH G 4 .   ? -1.288  33.661  -4.036  1.00 20.89  ? 1183 HOH A O     1 
HETATM 10169 O O     . HOH G 4 .   ? -2.504  41.271  17.213  1.00 12.49  ? 1184 HOH A O     1 
HETATM 10170 O O     . HOH G 4 .   ? -19.058 42.701  15.421  1.00 23.65  ? 1185 HOH A O     1 
HETATM 10171 O O     . HOH G 4 .   ? -23.569 37.280  5.719   1.00 20.49  ? 1186 HOH A O     1 
HETATM 10172 O O     . HOH G 4 .   ? -25.542 41.249  5.411   1.00 14.20  ? 1187 HOH A O     1 
HETATM 10173 O O     . HOH G 4 .   ? -13.829 46.320  -4.668  1.00 31.54  ? 1188 HOH A O     1 
HETATM 10174 O O     . HOH G 4 .   ? -19.939 26.134  20.260  1.00 31.63  ? 1189 HOH A O     1 
HETATM 10175 O O     . HOH G 4 .   ? -22.288 19.869  13.323  1.00 20.97  ? 1190 HOH A O     1 
HETATM 10176 O O     . HOH G 4 .   ? -14.388 20.327  18.505  1.00 16.11  ? 1191 HOH A O     1 
HETATM 10177 O O     . HOH G 4 .   ? -9.964  4.522   37.969  1.00 42.47  ? 1192 HOH A O     1 
HETATM 10178 O O     . HOH G 4 .   ? 2.338   16.084  41.941  1.00 35.75  ? 1193 HOH A O     1 
HETATM 10179 O O     . HOH G 4 .   ? 0.549   25.260  37.232  1.00 20.08  ? 1194 HOH A O     1 
HETATM 10180 O O     . HOH G 4 .   ? -3.198  16.584  36.505  1.00 28.42  ? 1195 HOH A O     1 
HETATM 10181 O O     . HOH G 4 .   ? -5.857  8.113   38.499  1.00 26.64  ? 1196 HOH A O     1 
HETATM 10182 O O     . HOH G 4 .   ? -11.237 8.312   17.931  1.00 24.07  ? 1197 HOH A O     1 
HETATM 10183 O O     . HOH G 4 .   ? -12.334 5.877   17.279  1.00 26.24  ? 1198 HOH A O     1 
HETATM 10184 O O     . HOH G 4 .   ? -16.144 20.715  28.888  1.00 28.55  ? 1199 HOH A O     1 
HETATM 10185 O O     . HOH G 4 .   ? -3.683  38.513  39.215  1.00 30.79  ? 1200 HOH A O     1 
HETATM 10186 O O     . HOH G 4 .   ? -8.957  44.606  52.320  1.00 24.84  ? 1201 HOH A O     1 
HETATM 10187 O O     . HOH G 4 .   ? -22.960 49.533  40.705  1.00 30.34  ? 1202 HOH A O     1 
HETATM 10188 O O     . HOH G 4 .   ? -15.340 43.751  29.887  1.00 21.78  ? 1203 HOH A O     1 
HETATM 10189 O O     . HOH G 4 .   ? -28.317 36.506  32.304  1.00 28.08  ? 1204 HOH A O     1 
HETATM 10190 O O     . HOH G 4 .   ? -6.626  36.256  15.726  1.00 22.75  ? 1205 HOH A O     1 
HETATM 10191 O O     . HOH G 4 .   ? -4.382  33.843  25.981  1.00 27.16  ? 1206 HOH A O     1 
HETATM 10192 O O     . HOH G 4 .   ? -4.435  35.106  28.410  1.00 21.98  ? 1207 HOH A O     1 
HETATM 10193 O O     . HOH H 4 .   ? -48.012 92.043  26.129  1.00 25.40  ? 999  HOH B O     1 
HETATM 10194 O O     . HOH H 4 .   ? -30.958 93.627  25.428  1.00 34.12  ? 1000 HOH B O     1 
HETATM 10195 O O     . HOH H 4 .   ? -35.472 96.764  5.536   1.00 26.97  ? 1001 HOH B O     1 
HETATM 10196 O O     . HOH H 4 .   ? -44.997 82.546  10.614  1.00 35.46  ? 1002 HOH B O     1 
HETATM 10197 O O     . HOH H 4 .   ? -45.141 90.076  15.204  1.00 33.07  ? 1003 HOH B O     1 
HETATM 10198 O O     . HOH H 4 .   ? -10.041 85.184  20.748  1.00 19.11  ? 1004 HOH B O     1 
HETATM 10199 O O     . HOH H 4 .   ? -8.288  65.592  12.205  1.00 16.70  ? 1005 HOH B O     1 
HETATM 10200 O O     . HOH H 4 .   ? -7.785  60.866  12.620  1.00 16.21  ? 1006 HOH B O     1 
HETATM 10201 O O     . HOH H 4 .   ? -12.108 62.075  18.000  1.00 15.60  ? 1007 HOH B O     1 
HETATM 10202 O O     . HOH H 4 .   ? -11.023 71.714  7.857   1.00 24.08  ? 1008 HOH B O     1 
HETATM 10203 O O     . HOH H 4 .   ? -10.426 70.775  4.211   1.00 23.78  ? 1009 HOH B O     1 
HETATM 10204 O O     . HOH H 4 .   ? -8.528  84.474  16.007  1.00 20.35  ? 1010 HOH B O     1 
HETATM 10205 O O     . HOH H 4 .   ? -9.633  88.013  6.945   1.00 30.61  ? 1011 HOH B O     1 
HETATM 10206 O O     . HOH H 4 .   ? -16.804 64.874  11.430  1.00 24.58  ? 1012 HOH B O     1 
HETATM 10207 O O     . HOH H 4 .   ? -14.620 65.254  9.391   1.00 18.84  ? 1013 HOH B O     1 
HETATM 10208 O O     . HOH H 4 .   ? -27.672 89.718  1.631   1.00 24.27  ? 1014 HOH B O     1 
HETATM 10209 O O     . HOH H 4 .   ? -35.314 83.220  3.130   1.00 20.22  ? 1015 HOH B O     1 
HETATM 10210 O O     . HOH H 4 .   ? -31.001 73.090  8.392   1.00 14.55  ? 1016 HOH B O     1 
HETATM 10211 O O     . HOH H 4 .   ? -32.444 65.701  9.146   1.00 22.32  ? 1017 HOH B O     1 
HETATM 10212 O O     . HOH H 4 .   ? -31.706 56.210  -2.927  1.00 29.75  ? 1018 HOH B O     1 
HETATM 10213 O O     . HOH H 4 .   ? -29.110 54.162  1.401   1.00 14.37  ? 1019 HOH B O     1 
HETATM 10214 O O     . HOH H 4 .   ? -8.616  58.787  7.927   1.00 30.89  ? 1020 HOH B O     1 
HETATM 10215 O O     . HOH H 4 .   ? -25.027 60.421  -8.971  1.00 25.81  ? 1021 HOH B O     1 
HETATM 10216 O O     . HOH H 4 .   ? -31.484 66.587  -9.830  1.00 28.56  ? 1022 HOH B O     1 
HETATM 10217 O O     . HOH H 4 .   ? -35.824 66.488  -6.086  1.00 20.47  ? 1023 HOH B O     1 
HETATM 10218 O O     . HOH H 4 .   ? -7.940  57.332  -1.890  1.00 31.16  ? 1024 HOH B O     1 
HETATM 10219 O O     . HOH H 4 .   ? -10.702 62.453  -6.683  1.00 23.21  ? 1025 HOH B O     1 
HETATM 10220 O O     . HOH H 4 .   ? -14.359 72.662  -9.822  1.00 20.72  ? 1026 HOH B O     1 
HETATM 10221 O O     . HOH H 4 .   ? -32.984 82.689  5.080   1.00 17.27  ? 1027 HOH B O     1 
HETATM 10222 O O     . HOH H 4 .   ? -40.083 60.042  11.687  1.00 19.75  ? 1028 HOH B O     1 
HETATM 10223 O O     . HOH H 4 .   ? -42.187 57.449  12.798  1.00 22.04  ? 1029 HOH B O     1 
HETATM 10224 O O     . HOH H 4 .   ? -38.911 79.970  14.199  1.00 19.46  ? 1030 HOH B O     1 
HETATM 10225 O O     . HOH H 4 .   ? -34.200 79.851  19.057  1.00 20.82  ? 1031 HOH B O     1 
HETATM 10226 O O     . HOH H 4 .   ? -27.851 83.046  36.133  1.00 19.33  ? 1032 HOH B O     1 
HETATM 10227 O O     . HOH H 4 .   ? -19.403 74.986  20.592  1.00 15.22  ? 1033 HOH B O     1 
HETATM 10228 O O     . HOH H 4 .   ? -18.163 70.162  18.819  1.00 15.81  ? 1034 HOH B O     1 
HETATM 10229 O O     . HOH H 4 .   ? -18.457 67.469  18.912  1.00 15.65  ? 1035 HOH B O     1 
HETATM 10230 O O     . HOH H 4 .   ? -24.462 65.233  18.368  1.00 15.92  ? 1036 HOH B O     1 
HETATM 10231 O O     . HOH H 4 .   ? -19.170 92.290  19.384  1.00 27.45  ? 1037 HOH B O     1 
HETATM 10232 O O     . HOH H 4 .   ? -7.342  60.849  23.952  1.00 18.89  ? 1038 HOH B O     1 
HETATM 10233 O O     . HOH H 4 .   ? -7.786  57.849  29.428  1.00 13.96  ? 1039 HOH B O     1 
HETATM 10234 O O     . HOH H 4 .   ? -12.913 63.043  28.952  1.00 15.04  ? 1040 HOH B O     1 
HETATM 10235 O O     . HOH H 4 .   ? -8.831  73.316  31.909  1.00 18.59  ? 1041 HOH B O     1 
HETATM 10236 O O     . HOH H 4 .   ? -28.432 63.583  24.038  1.00 37.52  ? 1042 HOH B O     1 
HETATM 10237 O O     . HOH H 4 .   ? -29.929 66.351  29.908  1.00 10.51  ? 1043 HOH B O     1 
HETATM 10238 O O     . HOH H 4 .   ? -22.124 54.632  32.576  1.00 28.81  ? 1044 HOH B O     1 
HETATM 10239 O O     . HOH H 4 .   ? -17.734 53.401  27.759  1.00 24.44  ? 1045 HOH B O     1 
HETATM 10240 O O     . HOH H 4 .   ? -17.976 50.275  34.244  1.00 17.49  ? 1046 HOH B O     1 
HETATM 10241 O O     . HOH H 4 .   ? -11.118 52.389  31.066  1.00 24.17  ? 1047 HOH B O     1 
HETATM 10242 O O     . HOH H 4 .   ? -14.229 51.249  33.947  1.00 29.72  ? 1048 HOH B O     1 
HETATM 10243 O O     . HOH H 4 .   ? -14.930 57.943  38.255  1.00 13.39  ? 1049 HOH B O     1 
HETATM 10244 O O     . HOH H 4 .   ? -13.963 71.613  36.133  1.00 19.35  ? 1050 HOH B O     1 
HETATM 10245 O O     . HOH H 4 .   ? -18.066 77.632  38.526  1.00 18.38  ? 1051 HOH B O     1 
HETATM 10246 O O     . HOH H 4 .   ? -19.385 71.012  38.754  1.00 13.45  ? 1052 HOH B O     1 
HETATM 10247 O O     . HOH H 4 .   ? -29.277 70.697  36.103  1.00 24.71  ? 1053 HOH B O     1 
HETATM 10248 O O     . HOH H 4 .   ? -30.625 67.868  35.877  1.00 18.37  ? 1054 HOH B O     1 
HETATM 10249 O O     . HOH H 4 .   ? -18.963 68.083  34.676  1.00 260.72 ? 1055 HOH B O     1 
HETATM 10250 O O     . HOH H 4 .   ? -31.254 70.732  38.142  1.00 19.66  ? 1056 HOH B O     1 
HETATM 10251 O O     . HOH H 4 .   ? -35.175 79.109  33.292  1.00 26.57  ? 1057 HOH B O     1 
HETATM 10252 O O     . HOH H 4 .   ? -26.936 77.095  39.935  1.00 17.00  ? 1058 HOH B O     1 
HETATM 10253 O O     . HOH H 4 .   ? -27.082 84.246  33.905  1.00 19.99  ? 1059 HOH B O     1 
HETATM 10254 O O     . HOH H 4 .   ? -26.673 84.284  42.656  1.00 21.74  ? 1060 HOH B O     1 
HETATM 10255 O O     . HOH H 4 .   ? -29.553 67.253  43.738  1.00 19.40  ? 1061 HOH B O     1 
HETATM 10256 O O     . HOH H 4 .   ? -45.124 79.973  26.484  1.00 28.42  ? 1062 HOH B O     1 
HETATM 10257 O O     . HOH H 4 .   ? -54.455 60.549  32.378  1.00 36.03  ? 1063 HOH B O     1 
HETATM 10258 O O     . HOH H 4 .   ? -43.879 55.768  15.649  1.00 25.54  ? 1064 HOH B O     1 
HETATM 10259 O O     . HOH H 4 .   ? -37.917 59.469  25.556  1.00 13.85  ? 1065 HOH B O     1 
HETATM 10260 O O     . HOH H 4 .   ? -35.256 63.483  14.542  1.00 15.18  ? 1066 HOH B O     1 
HETATM 10261 O O     . HOH H 4 .   ? -32.418 61.103  14.472  1.00 19.36  ? 1067 HOH B O     1 
HETATM 10262 O O     . HOH H 4 .   ? -41.500 43.016  2.668   1.00 9.78   ? 1068 HOH B O     1 
HETATM 10263 O O     . HOH H 4 .   ? -40.583 44.376  0.283   1.00 20.20  ? 1069 HOH B O     1 
HETATM 10264 O O     . HOH H 4 .   ? -41.285 34.669  11.369  1.00 25.37  ? 1070 HOH B O     1 
HETATM 10265 O O     . HOH H 4 .   ? -45.936 36.016  3.293   1.00 19.90  ? 1071 HOH B O     1 
HETATM 10266 O O     . HOH H 4 .   ? -35.178 36.470  17.613  1.00 20.94  ? 1072 HOH B O     1 
HETATM 10267 O O     . HOH H 4 .   ? -46.855 37.561  13.664  1.00 18.43  ? 1073 HOH B O     1 
HETATM 10268 O O     . HOH H 4 .   ? -43.944 32.699  17.014  1.00 24.14  ? 1074 HOH B O     1 
HETATM 10269 O O     . HOH H 4 .   ? -11.820 53.741  15.009  1.00 17.24  ? 1075 HOH B O     1 
HETATM 10270 O O     . HOH H 4 .   ? -14.348 48.605  14.209  1.00 27.84  ? 1076 HOH B O     1 
HETATM 10271 O O     . HOH H 4 .   ? -8.903  54.531  8.409   1.00 16.73  ? 1077 HOH B O     1 
HETATM 10272 O O     . HOH H 4 .   ? -10.865 54.878  6.875   1.00 25.91  ? 1078 HOH B O     1 
HETATM 10273 O O     . HOH H 4 .   ? -11.953 54.785  38.066  1.00 17.75  ? 1079 HOH B O     1 
HETATM 10274 O O     . HOH H 4 .   ? -22.927 73.821  41.557  1.00 20.02  ? 1080 HOH B O     1 
HETATM 10275 O O     . HOH H 4 .   ? -29.645 92.930  10.978  1.00 21.25  ? 1081 HOH B O     1 
HETATM 10276 O O     . HOH H 4 .   ? -50.673 87.155  20.280  1.00 25.42  ? 1082 HOH B O     1 
HETATM 10277 O O     . HOH H 4 .   ? -23.805 95.408  8.581   1.00 21.25  ? 1083 HOH B O     1 
HETATM 10278 O O     . HOH H 4 .   ? -23.007 95.269  11.048  1.00 30.83  ? 1084 HOH B O     1 
HETATM 10279 O O     . HOH H 4 .   ? -7.592  67.293  22.195  1.00 16.36  ? 1085 HOH B O     1 
HETATM 10280 O O     . HOH H 4 .   ? -6.310  62.770  18.017  1.00 23.25  ? 1086 HOH B O     1 
HETATM 10281 O O     . HOH H 4 .   ? -2.895  71.598  16.958  1.00 30.86  ? 1087 HOH B O     1 
HETATM 10282 O O     . HOH H 4 .   ? -2.832  72.154  12.477  1.00 27.40  ? 1088 HOH B O     1 
HETATM 10283 O O     . HOH H 4 .   ? -17.325 81.496  -7.191  1.00 28.97  ? 1089 HOH B O     1 
HETATM 10284 O O     . HOH H 4 .   ? -27.282 76.251  -9.570  1.00 35.25  ? 1090 HOH B O     1 
HETATM 10285 O O     . HOH H 4 .   ? -17.834 65.896  16.442  1.00 12.94  ? 1091 HOH B O     1 
HETATM 10286 O O     . HOH H 4 .   ? -12.948 78.250  7.002   1.00 32.30  ? 1092 HOH B O     1 
HETATM 10287 O O     . HOH H 4 .   ? -32.857 68.759  7.441   1.00 30.60  ? 1093 HOH B O     1 
HETATM 10288 O O     . HOH H 4 .   ? -23.267 66.100  9.865   1.00 21.16  ? 1094 HOH B O     1 
HETATM 10289 O O     . HOH H 4 .   ? -26.105 57.106  11.736  1.00 32.95  ? 1095 HOH B O     1 
HETATM 10290 O O     . HOH H 4 .   ? -23.864 56.203  6.762   1.00 33.56  ? 1096 HOH B O     1 
HETATM 10291 O O     . HOH H 4 .   ? -25.496 53.122  -1.694  1.00 28.36  ? 1097 HOH B O     1 
HETATM 10292 O O     . HOH H 4 .   ? -35.116 58.756  6.618   1.00 22.65  ? 1098 HOH B O     1 
HETATM 10293 O O     . HOH H 4 .   ? -39.303 61.915  -0.167  1.00 23.77  ? 1099 HOH B O     1 
HETATM 10294 O O     . HOH H 4 .   ? -38.270 67.152  -5.416  1.00 25.75  ? 1100 HOH B O     1 
HETATM 10295 O O     . HOH H 4 .   ? -11.052 64.119  -2.883  1.00 23.00  ? 1101 HOH B O     1 
HETATM 10296 O O     . HOH H 4 .   ? -6.385  56.716  11.292  1.00 15.88  ? 1102 HOH B O     1 
HETATM 10297 O O     . HOH H 4 .   ? -16.976 59.593  -0.445  1.00 25.59  ? 1103 HOH B O     1 
HETATM 10298 O O     . HOH H 4 .   ? -17.687 59.687  -5.200  1.00 25.48  ? 1104 HOH B O     1 
HETATM 10299 O O     . HOH H 4 .   ? -31.909 61.762  -10.304 1.00 24.09  ? 1105 HOH B O     1 
HETATM 10300 O O     . HOH H 4 .   ? -16.680 70.521  -12.920 1.00 23.49  ? 1106 HOH B O     1 
HETATM 10301 O O     . HOH H 4 .   ? -9.649  71.670  -10.126 1.00 28.13  ? 1107 HOH B O     1 
HETATM 10302 O O     . HOH H 4 .   ? -38.577 82.828  14.269  1.00 27.18  ? 1108 HOH B O     1 
HETATM 10303 O O     . HOH H 4 .   ? -14.940 84.730  23.718  1.00 47.07  ? 1109 HOH B O     1 
HETATM 10304 O O     . HOH H 4 .   ? -34.109 65.424  15.967  1.00 17.43  ? 1110 HOH B O     1 
HETATM 10305 O O     . HOH H 4 .   ? -19.343 88.777  23.504  1.00 20.96  ? 1111 HOH B O     1 
HETATM 10306 O O     . HOH H 4 .   ? -6.387  73.813  32.516  1.00 23.62  ? 1112 HOH B O     1 
HETATM 10307 O O     . HOH H 4 .   ? -4.256  72.613  31.481  1.00 24.70  ? 1113 HOH B O     1 
HETATM 10308 O O     . HOH H 4 .   ? -6.746  77.348  21.920  1.00 24.88  ? 1114 HOH B O     1 
HETATM 10309 O O     . HOH H 4 .   ? -26.332 56.440  34.379  1.00 36.10  ? 1115 HOH B O     1 
HETATM 10310 O O     . HOH H 4 .   ? -9.949  73.448  39.882  1.00 24.27  ? 1116 HOH B O     1 
HETATM 10311 O O     . HOH H 4 .   ? -14.061 74.106  37.547  1.00 17.19  ? 1117 HOH B O     1 
HETATM 10312 O O     . HOH H 4 .   ? -28.549 59.164  32.621  1.00 29.81  ? 1118 HOH B O     1 
HETATM 10313 O O     . HOH H 4 .   ? -17.482 77.345  42.481  1.00 24.57  ? 1119 HOH B O     1 
HETATM 10314 O O     . HOH H 4 .   ? -20.301 74.474  43.271  1.00 36.57  ? 1120 HOH B O     1 
HETATM 10315 O O     . HOH H 4 .   ? -32.241 64.153  42.496  1.00 29.94  ? 1121 HOH B O     1 
HETATM 10316 O O     . HOH H 4 .   ? -35.570 66.805  34.005  1.00 14.02  ? 1122 HOH B O     1 
HETATM 10317 O O     . HOH H 4 .   ? -33.781 65.988  32.149  1.00 26.06  ? 1123 HOH B O     1 
HETATM 10318 O O     . HOH H 4 .   ? -44.743 76.158  35.680  1.00 21.87  ? 1124 HOH B O     1 
HETATM 10319 O O     . HOH H 4 .   ? -51.956 69.726  21.240  1.00 24.43  ? 1125 HOH B O     1 
HETATM 10320 O O     . HOH H 4 .   ? -42.323 66.722  19.730  1.00 27.19  ? 1126 HOH B O     1 
HETATM 10321 O O     . HOH H 4 .   ? -46.507 65.431  19.383  1.00 31.04  ? 1127 HOH B O     1 
HETATM 10322 O O     . HOH H 4 .   ? -38.540 66.287  43.497  1.00 23.22  ? 1128 HOH B O     1 
HETATM 10323 O O     . HOH H 4 .   ? -38.584 57.508  23.964  1.00 18.47  ? 1129 HOH B O     1 
HETATM 10324 O O     . HOH H 4 .   ? -25.089 62.934  16.722  1.00 25.40  ? 1130 HOH B O     1 
HETATM 10325 O O     . HOH H 4 .   ? -46.327 55.995  10.272  1.00 33.20  ? 1131 HOH B O     1 
HETATM 10326 O O     . HOH H 4 .   ? -42.016 49.737  3.704   1.00 31.93  ? 1132 HOH B O     1 
HETATM 10327 O O     . HOH H 4 .   ? -39.999 36.689  0.600   1.00 19.18  ? 1133 HOH B O     1 
HETATM 10328 O O     . HOH H 4 .   ? -45.696 43.152  3.996   1.00 28.65  ? 1134 HOH B O     1 
HETATM 10329 O O     . HOH H 4 .   ? -46.543 45.209  7.224   1.00 27.81  ? 1135 HOH B O     1 
HETATM 10330 O O     . HOH H 4 .   ? -48.362 44.548  11.289  1.00 33.12  ? 1136 HOH B O     1 
HETATM 10331 O O     . HOH H 4 .   ? -45.713 45.839  9.942   1.00 25.38  ? 1137 HOH B O     1 
HETATM 10332 O O     . HOH H 4 .   ? -45.865 35.811  7.758   1.00 31.31  ? 1138 HOH B O     1 
HETATM 10333 O O     . HOH H 4 .   ? -35.177 33.180  4.353   1.00 37.99  ? 1139 HOH B O     1 
HETATM 10334 O O     . HOH H 4 .   ? -25.905 48.655  5.329   1.00 24.12  ? 1140 HOH B O     1 
HETATM 10335 O O     . HOH H 4 .   ? -24.730 46.260  11.895  1.00 34.87  ? 1141 HOH B O     1 
HETATM 10336 O O     . HOH H 4 .   ? -50.436 31.622  19.764  1.00 28.72  ? 1142 HOH B O     1 
HETATM 10337 O O     . HOH H 4 .   ? -25.967 38.468  6.059   1.00 18.75  ? 1143 HOH B O     1 
HETATM 10338 O O     . HOH H 4 .   ? -42.052 91.695  36.773  1.00 23.84  ? 1144 HOH B O     1 
HETATM 10339 O O     . HOH H 4 .   ? -27.926 94.669  19.514  1.00 26.66  ? 1145 HOH B O     1 
HETATM 10340 O O     . HOH H 4 .   ? -47.490 79.910  11.918  1.00 34.50  ? 1146 HOH B O     1 
HETATM 10341 O O     . HOH H 4 .   ? -39.551 86.334  13.903  1.00 30.50  ? 1147 HOH B O     1 
HETATM 10342 O O     . HOH H 4 .   ? -5.650  62.721  20.724  1.00 23.12  ? 1148 HOH B O     1 
HETATM 10343 O O     . HOH H 4 .   ? -24.281 68.039  7.765   1.00 32.36  ? 1149 HOH B O     1 
HETATM 10344 O O     . HOH H 4 .   ? -15.824 56.469  12.313  1.00 37.42  ? 1150 HOH B O     1 
HETATM 10345 O O     . HOH H 4 .   ? -19.861 57.344  -6.677  1.00 31.16  ? 1151 HOH B O     1 
HETATM 10346 O O     . HOH H 4 .   ? -42.953 61.848  11.276  1.00 22.51  ? 1152 HOH B O     1 
HETATM 10347 O O     . HOH H 4 .   ? -29.369 90.709  26.323  1.00 17.50  ? 1153 HOH B O     1 
HETATM 10348 O O     . HOH H 4 .   ? -22.456 89.334  29.069  1.00 22.05  ? 1154 HOH B O     1 
HETATM 10349 O O     . HOH H 4 .   ? -17.653 63.512  13.363  1.00 30.55  ? 1155 HOH B O     1 
HETATM 10350 O O     . HOH H 4 .   ? -10.270 80.460  28.717  1.00 27.23  ? 1156 HOH B O     1 
HETATM 10351 O O     . HOH H 4 .   ? -14.073 54.237  25.950  1.00 19.90  ? 1157 HOH B O     1 
HETATM 10352 O O     . HOH H 4 .   ? -5.118  62.523  36.867  1.00 28.47  ? 1158 HOH B O     1 
HETATM 10353 O O     . HOH H 4 .   ? -11.792 74.929  38.587  1.00 27.92  ? 1159 HOH B O     1 
HETATM 10354 O O     . HOH H 4 .   ? -25.308 75.490  41.443  1.00 29.64  ? 1160 HOH B O     1 
HETATM 10355 O O     . HOH H 4 .   ? -32.303 80.558  43.793  1.00 25.97  ? 1161 HOH B O     1 
HETATM 10356 O O     . HOH H 4 .   ? -50.039 64.186  11.920  1.00 28.47  ? 1162 HOH B O     1 
HETATM 10357 O O     . HOH H 4 .   ? -39.632 61.920  38.056  1.00 38.28  ? 1163 HOH B O     1 
HETATM 10358 O O     . HOH H 4 .   ? -25.929 32.139  8.250   1.00 32.44  ? 1164 HOH B O     1 
HETATM 10359 O O     . HOH H 4 .   ? -25.022 44.556  3.505   1.00 16.84  ? 1165 HOH B O     1 
HETATM 10360 O O     . HOH H 4 .   ? -29.023 43.780  4.003   1.00 23.88  ? 1166 HOH B O     1 
HETATM 10361 O O     . HOH H 4 .   ? -26.764 42.811  3.467   1.00 17.52  ? 1167 HOH B O     1 
HETATM 10362 O O     . HOH H 4 .   ? -36.906 34.338  18.607  1.00 35.19  ? 1168 HOH B O     1 
HETATM 10363 O O     . HOH H 4 .   ? -50.276 32.595  26.559  1.00 33.93  ? 1169 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLN 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   HIS 7   7   7   HIS HIS A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  PHE 38  38  38  PHE PHE A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  TRP 48  48  48  TRP TRP A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  TRP 69  69  69  TRP TRP A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  GLU 88  88  88  GLU GLU A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  TRP 97  97  97  TRP TRP A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 THR 102 102 102 THR THR A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 HIS 114 114 114 HIS HIS A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 CYS 118 118 118 CYS CYS A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 TYR 138 138 138 TYR TYR A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 PHE 163 163 163 PHE PHE A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 SER 178 178 178 SER SER A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLU 188 188 188 GLU GLU A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PRO 197 197 197 PRO PRO A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASN 210 210 210 ASN ASN A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 THR 212 212 212 THR THR A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 GLU 215 215 215 GLU GLU A . n 
A 1 216 HIS 216 216 216 HIS HIS A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 LYS 221 221 221 LYS LYS A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 ASP 226 226 226 ASP ASP A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 GLU 231 231 231 GLU GLU A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 LEU 235 235 235 LEU LEU A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 LYS 243 243 243 LYS LYS A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 PRO 250 250 250 PRO PRO A . n 
A 1 251 GLU 251 251 251 GLU GLU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 ASN 254 254 254 ASN ASN A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 PHE 260 260 260 PHE PHE A . n 
A 1 261 ILE 261 261 261 ILE ILE A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 TYR 263 263 263 TYR TYR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 THR 268 268 268 THR THR A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 TYR 281 281 281 TYR TYR A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 VAL 283 283 283 VAL VAL