data_2P2M
# 
_entry.id   2P2M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2P2M         pdb_00002p2m 10.2210/pdb2p2m/pdb 
RCSB  RCSB041888   ?            ?                   
WWPDB D_1000041888 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1PG4 . unspecified 
PDB 1RY2 . unspecified 
PDB 1T5D . unspecified 
PDB 2P20 . unspecified 
PDB 2P2B . unspecified 
PDB 2P2F . unspecified 
PDB 2P2J . unspecified 
PDB 2P2Q . unspecified 
# 
_pdbx_database_status.entry_id                        2P2M 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Reger, A.S.'  1 
'Gulick, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                6536 
_citation.page_last                 6546 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17497934 
_citation.pdbx_database_id_DOI      10.1021/bi6026506 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reger, A.S.'  1 ? 
primary 'Carney, J.M.' 2 ? 
primary 'Gulick, A.M.' 3 ? 
# 
_cell.entry_id           2P2M 
_cell.length_a           91.721 
_cell.length_b           95.499 
_cell.length_c           163.574 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2P2M 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Acetyl-coenzyme A synthetase'            72150.352 2   6.2.1.1 R194A ? ? 
2 non-polymer syn 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
389.301   2   ?       ?     ? ? 
3 water       nat water                                     18.015    626 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Acetate-CoA ligase, Acyl-activating enzyme' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGASIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGASIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   THR n 
1 5   HIS n 
1 6   LYS n 
1 7   HIS n 
1 8   ALA n 
1 9   ILE n 
1 10  PRO n 
1 11  ALA n 
1 12  ASN n 
1 13  ILE n 
1 14  ALA n 
1 15  ASP n 
1 16  ARG n 
1 17  CYS n 
1 18  LEU n 
1 19  ILE n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLN n 
1 24  TYR n 
1 25  GLU n 
1 26  THR n 
1 27  LYS n 
1 28  TYR n 
1 29  LYS n 
1 30  GLN n 
1 31  SER n 
1 32  ILE n 
1 33  ASN n 
1 34  ASP n 
1 35  PRO n 
1 36  ASP n 
1 37  THR n 
1 38  PHE n 
1 39  TRP n 
1 40  GLY n 
1 41  GLU n 
1 42  GLN n 
1 43  GLY n 
1 44  LYS n 
1 45  ILE n 
1 46  LEU n 
1 47  ASP n 
1 48  TRP n 
1 49  ILE n 
1 50  THR n 
1 51  PRO n 
1 52  TYR n 
1 53  GLN n 
1 54  LYS n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  THR n 
1 59  SER n 
1 60  PHE n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ASN n 
1 65  VAL n 
1 66  SER n 
1 67  ILE n 
1 68  LYS n 
1 69  TRP n 
1 70  TYR n 
1 71  GLU n 
1 72  ASP n 
1 73  GLY n 
1 74  THR n 
1 75  LEU n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  ASN n 
1 81  CYS n 
1 82  LEU n 
1 83  ASP n 
1 84  ARG n 
1 85  HIS n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  ASN n 
1 90  GLY n 
1 91  ASP n 
1 92  ARG n 
1 93  THR n 
1 94  ALA n 
1 95  ILE n 
1 96  ILE n 
1 97  TRP n 
1 98  GLU n 
1 99  GLY n 
1 100 ASP n 
1 101 ASP n 
1 102 THR n 
1 103 SER n 
1 104 GLN n 
1 105 SER n 
1 106 LYS n 
1 107 HIS n 
1 108 ILE n 
1 109 SER n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 LEU n 
1 114 HIS n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 CYS n 
1 119 ARG n 
1 120 PHE n 
1 121 ALA n 
1 122 ASN n 
1 123 THR n 
1 124 LEU n 
1 125 LEU n 
1 126 ASP n 
1 127 LEU n 
1 128 GLY n 
1 129 ILE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLY n 
1 133 ASP n 
1 134 VAL n 
1 135 VAL n 
1 136 ALA n 
1 137 ILE n 
1 138 TYR n 
1 139 MET n 
1 140 PRO n 
1 141 MET n 
1 142 VAL n 
1 143 PRO n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 VAL n 
1 148 ALA n 
1 149 MET n 
1 150 LEU n 
1 151 ALA n 
1 152 CYS n 
1 153 ALA n 
1 154 ARG n 
1 155 ILE n 
1 156 GLY n 
1 157 ALA n 
1 158 VAL n 
1 159 HIS n 
1 160 SER n 
1 161 VAL n 
1 162 ILE n 
1 163 PHE n 
1 164 GLY n 
1 165 GLY n 
1 166 PHE n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ALA n 
1 171 VAL n 
1 172 ALA n 
1 173 GLY n 
1 174 ARG n 
1 175 ILE n 
1 176 ILE n 
1 177 ASP n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 ARG n 
1 182 LEU n 
1 183 VAL n 
1 184 ILE n 
1 185 THR n 
1 186 ALA n 
1 187 ASP n 
1 188 GLU n 
1 189 GLY n 
1 190 VAL n 
1 191 ARG n 
1 192 ALA n 
1 193 GLY n 
1 194 ALA n 
1 195 SER n 
1 196 ILE n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 LYS n 
1 201 ASN n 
1 202 VAL n 
1 203 ASP n 
1 204 ASP n 
1 205 ALA n 
1 206 LEU n 
1 207 LYS n 
1 208 ASN n 
1 209 PRO n 
1 210 ASN n 
1 211 VAL n 
1 212 THR n 
1 213 SER n 
1 214 VAL n 
1 215 GLU n 
1 216 HIS n 
1 217 VAL n 
1 218 ILE n 
1 219 VAL n 
1 220 LEU n 
1 221 LYS n 
1 222 ARG n 
1 223 THR n 
1 224 GLY n 
1 225 SER n 
1 226 ASP n 
1 227 ILE n 
1 228 ASP n 
1 229 TRP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLY n 
1 233 ARG n 
1 234 ASP n 
1 235 LEU n 
1 236 TRP n 
1 237 TRP n 
1 238 ARG n 
1 239 ASP n 
1 240 LEU n 
1 241 ILE n 
1 242 GLU n 
1 243 LYS n 
1 244 ALA n 
1 245 SER n 
1 246 PRO n 
1 247 GLU n 
1 248 HIS n 
1 249 GLN n 
1 250 PRO n 
1 251 GLU n 
1 252 ALA n 
1 253 MET n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 LEU n 
1 260 PHE n 
1 261 ILE n 
1 262 LEU n 
1 263 TYR n 
1 264 THR n 
1 265 SER n 
1 266 GLY n 
1 267 SER n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 PRO n 
1 272 LYS n 
1 273 GLY n 
1 274 VAL n 
1 275 LEU n 
1 276 HIS n 
1 277 THR n 
1 278 THR n 
1 279 GLY n 
1 280 GLY n 
1 281 TYR n 
1 282 LEU n 
1 283 VAL n 
1 284 TYR n 
1 285 ALA n 
1 286 ALA n 
1 287 THR n 
1 288 THR n 
1 289 PHE n 
1 290 LYS n 
1 291 TYR n 
1 292 VAL n 
1 293 PHE n 
1 294 ASP n 
1 295 TYR n 
1 296 HIS n 
1 297 PRO n 
1 298 GLY n 
1 299 ASP n 
1 300 ILE n 
1 301 TYR n 
1 302 TRP n 
1 303 CYS n 
1 304 THR n 
1 305 ALA n 
1 306 ASP n 
1 307 VAL n 
1 308 GLY n 
1 309 TRP n 
1 310 VAL n 
1 311 THR n 
1 312 GLY n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 LEU n 
1 317 LEU n 
1 318 TYR n 
1 319 GLY n 
1 320 PRO n 
1 321 LEU n 
1 322 ALA n 
1 323 CYS n 
1 324 GLY n 
1 325 ALA n 
1 326 THR n 
1 327 THR n 
1 328 LEU n 
1 329 MET n 
1 330 PHE n 
1 331 GLU n 
1 332 GLY n 
1 333 VAL n 
1 334 PRO n 
1 335 ASN n 
1 336 TRP n 
1 337 PRO n 
1 338 THR n 
1 339 PRO n 
1 340 ALA n 
1 341 ARG n 
1 342 MET n 
1 343 CYS n 
1 344 GLN n 
1 345 VAL n 
1 346 VAL n 
1 347 ASP n 
1 348 LYS n 
1 349 HIS n 
1 350 GLN n 
1 351 VAL n 
1 352 ASN n 
1 353 ILE n 
1 354 LEU n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PRO n 
1 359 THR n 
1 360 ALA n 
1 361 ILE n 
1 362 ARG n 
1 363 ALA n 
1 364 LEU n 
1 365 MET n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ASP n 
1 370 LYS n 
1 371 ALA n 
1 372 ILE n 
1 373 GLU n 
1 374 GLY n 
1 375 THR n 
1 376 ASP n 
1 377 ARG n 
1 378 SER n 
1 379 SER n 
1 380 LEU n 
1 381 ARG n 
1 382 ILE n 
1 383 LEU n 
1 384 GLY n 
1 385 SER n 
1 386 VAL n 
1 387 GLY n 
1 388 GLU n 
1 389 PRO n 
1 390 ILE n 
1 391 ASN n 
1 392 PRO n 
1 393 GLU n 
1 394 ALA n 
1 395 TRP n 
1 396 GLU n 
1 397 TRP n 
1 398 TYR n 
1 399 TRP n 
1 400 LYS n 
1 401 LYS n 
1 402 ILE n 
1 403 GLY n 
1 404 LYS n 
1 405 GLU n 
1 406 LYS n 
1 407 CYS n 
1 408 PRO n 
1 409 VAL n 
1 410 VAL n 
1 411 ASP n 
1 412 THR n 
1 413 TRP n 
1 414 TRP n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 THR n 
1 419 GLY n 
1 420 GLY n 
1 421 PHE n 
1 422 MET n 
1 423 ILE n 
1 424 THR n 
1 425 PRO n 
1 426 LEU n 
1 427 PRO n 
1 428 GLY n 
1 429 ALA n 
1 430 ILE n 
1 431 GLU n 
1 432 LEU n 
1 433 LYS n 
1 434 ALA n 
1 435 GLY n 
1 436 SER n 
1 437 ALA n 
1 438 THR n 
1 439 ARG n 
1 440 PRO n 
1 441 PHE n 
1 442 PHE n 
1 443 GLY n 
1 444 VAL n 
1 445 GLN n 
1 446 PRO n 
1 447 ALA n 
1 448 LEU n 
1 449 VAL n 
1 450 ASP n 
1 451 ASN n 
1 452 GLU n 
1 453 GLY n 
1 454 HIS n 
1 455 PRO n 
1 456 GLN n 
1 457 GLU n 
1 458 GLY n 
1 459 ALA n 
1 460 THR n 
1 461 GLU n 
1 462 GLY n 
1 463 ASN n 
1 464 LEU n 
1 465 VAL n 
1 466 ILE n 
1 467 THR n 
1 468 ASP n 
1 469 SER n 
1 470 TRP n 
1 471 PRO n 
1 472 GLY n 
1 473 GLN n 
1 474 ALA n 
1 475 ARG n 
1 476 THR n 
1 477 LEU n 
1 478 PHE n 
1 479 GLY n 
1 480 ASP n 
1 481 HIS n 
1 482 GLU n 
1 483 ARG n 
1 484 PHE n 
1 485 GLU n 
1 486 GLN n 
1 487 THR n 
1 488 TYR n 
1 489 PHE n 
1 490 SER n 
1 491 THR n 
1 492 PHE n 
1 493 LYS n 
1 494 ASN n 
1 495 MET n 
1 496 TYR n 
1 497 PHE n 
1 498 SER n 
1 499 GLY n 
1 500 ASP n 
1 501 GLY n 
1 502 ALA n 
1 503 ARG n 
1 504 ARG n 
1 505 ASP n 
1 506 GLU n 
1 507 ASP n 
1 508 GLY n 
1 509 TYR n 
1 510 TYR n 
1 511 TRP n 
1 512 ILE n 
1 513 THR n 
1 514 GLY n 
1 515 ARG n 
1 516 VAL n 
1 517 ASP n 
1 518 ASP n 
1 519 VAL n 
1 520 LEU n 
1 521 ASN n 
1 522 VAL n 
1 523 SER n 
1 524 GLY n 
1 525 HIS n 
1 526 ARG n 
1 527 LEU n 
1 528 GLY n 
1 529 THR n 
1 530 ALA n 
1 531 GLU n 
1 532 ILE n 
1 533 GLU n 
1 534 SER n 
1 535 ALA n 
1 536 LEU n 
1 537 VAL n 
1 538 ALA n 
1 539 HIS n 
1 540 PRO n 
1 541 LYS n 
1 542 ILE n 
1 543 ALA n 
1 544 GLU n 
1 545 ALA n 
1 546 ALA n 
1 547 VAL n 
1 548 VAL n 
1 549 GLY n 
1 550 ILE n 
1 551 PRO n 
1 552 HIS n 
1 553 ALA n 
1 554 ILE n 
1 555 LYS n 
1 556 GLY n 
1 557 GLN n 
1 558 ALA n 
1 559 ILE n 
1 560 TYR n 
1 561 ALA n 
1 562 TYR n 
1 563 VAL n 
1 564 THR n 
1 565 LEU n 
1 566 ASN n 
1 567 HIS n 
1 568 GLY n 
1 569 GLU n 
1 570 GLU n 
1 571 PRO n 
1 572 SER n 
1 573 PRO n 
1 574 GLU n 
1 575 LEU n 
1 576 TYR n 
1 577 ALA n 
1 578 GLU n 
1 579 VAL n 
1 580 ARG n 
1 581 ASN n 
1 582 TRP n 
1 583 VAL n 
1 584 ARG n 
1 585 LYS n 
1 586 GLU n 
1 587 ILE n 
1 588 GLY n 
1 589 PRO n 
1 590 LEU n 
1 591 ALA n 
1 592 THR n 
1 593 PRO n 
1 594 ASP n 
1 595 VAL n 
1 596 LEU n 
1 597 HIS n 
1 598 TRP n 
1 599 THR n 
1 600 ASP n 
1 601 SER n 
1 602 LEU n 
1 603 PRO n 
1 604 LYS n 
1 605 THR n 
1 606 ARG n 
1 607 SER n 
1 608 GLY n 
1 609 LYS n 
1 610 ILE n 
1 611 MET n 
1 612 ARG n 
1 613 ARG n 
1 614 ILE n 
1 615 LEU n 
1 616 ARG n 
1 617 LYS n 
1 618 ILE n 
1 619 ALA n 
1 620 ALA n 
1 621 GLY n 
1 622 ASP n 
1 623 THR n 
1 624 SER n 
1 625 ASN n 
1 626 LEU n 
1 627 GLY n 
1 628 ASP n 
1 629 THR n 
1 630 SER n 
1 631 THR n 
1 632 LEU n 
1 633 ALA n 
1 634 ASP n 
1 635 PRO n 
1 636 GLY n 
1 637 VAL n 
1 638 VAL n 
1 639 GLU n 
1 640 LYS n 
1 641 LEU n 
1 642 LEU n 
1 643 GLU n 
1 644 GLU n 
1 645 LYS n 
1 646 GLN n 
1 647 ALA n 
1 648 ILE n 
1 649 ALA n 
1 650 MET n 
1 651 PRO n 
1 652 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 acs 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Typhi 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'according to Biochemistry, 41, 2379' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACSA_SALTY 
_struct_ref.pdbx_db_accession          Q8ZKF6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAAN
CLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHS
VIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP
LACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWK
KIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIY
AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEK
LLEEKQAIAMPS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2P2M A 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
2 1 2P2M B 1 ? 652 ? Q8ZKF6 1 ? 652 ? 1 652 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2P2M ALA A 194 ? UNP Q8ZKF6 ARG 194 'engineered mutation' 194 1 
2 2P2M ALA B 194 ? UNP Q8ZKF6 ARG 194 'engineered mutation' 194 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                   ?                              'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                              'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                              'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                              'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ?                              'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                              'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                              'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                              'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                              'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                     ?                              'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                              'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                              'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                              'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                ?                              'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                              'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                              'C5 H9 N O2'      115.130 
PRX non-polymer         . 
;ADENOSINE-5'-MONOPHOSPHATE-PROPYL ESTER
;
"ADENOSINE-5'-PROPYLPHOSPHATE" 'C13 H20 N5 O7 P' 389.301 
SER 'L-peptide linking' y SERINE                                    ?                              'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                 ?                              'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                              'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                              'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                    ?                              'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2P2M 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   50.42 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;6-15% PEG 8000, 9-13% ethylene glycol, 50 mM BTP, 1 mM CoA, 1 mM Propyl-AMP, 1 mM TCEP, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4r' 
_diffrn_detector.pdbx_collection_date   2005-03-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97944 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97944 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
# 
_reflns.entry_id                     2P2M 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   77387 
_reflns.pdbx_Rmerge_I_obs            0.055 
_reflns.pdbx_netI_over_sigmaI        13.200 
_reflns.pdbx_chi_squared             0.979 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         91.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.274 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.790 
_reflns_shell.pdbx_redundancy        1.60 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4996 
_reflns_shell.percent_possible_all   60.10 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2P2M 
_refine.ls_d_res_high                            2.110 
_refine.ls_d_res_low                             47.35 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    92.620 
_refine.ls_number_reflns_obs                     76279 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.180 
_refine.ls_R_factor_R_work                       0.178 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3858 
_refine.B_iso_mean                               23.615 
_refine.aniso_B[1][1]                            -0.160 
_refine.aniso_B[2][2]                            -0.070 
_refine.aniso_B[3][3]                            0.230 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.pdbx_overall_ESU_R                       0.231 
_refine.pdbx_overall_ESU_R_Free                  0.186 
_refine.overall_SU_ML                            0.112 
_refine.overall_SU_B                             8.038 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entry IPG4' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9843 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             626 
_refine_hist.number_atoms_total               10521 
_refine_hist.d_res_high                       2.110 
_refine_hist.d_res_low                        47.35 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         10162 0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      13871 1.138  1.947  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1267  5.826  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   449   35.697 24.009 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1560  13.190 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   57    17.780 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1516  0.076  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7827  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4608  0.190  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          6847  0.301  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    692   0.129  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   35    0.211  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 31    0.297  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              6501  0.517  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             10167 0.824  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              4323  1.357  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             3704  2.190  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.11 
_refine_ls_shell.d_res_low                        2.168 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               61.020 
_refine_ls_shell.number_reflns_R_work             3173 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.203 
_refine_ls_shell.R_factor_R_free                  0.268 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             177 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3350 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2P2M 
_struct.title                     'Acetyl-CoA Synthetase, R194A mutation' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2P2M 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'Adenylate-forming enzymes, Domain Alternation, Acyl-CoA ligase, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 10  ? ASP A 15  ? PRO A 10  ASP A 15  1 ? 6  
HELX_P HELX_P2  2  ASN A 20  ? ASP A 34  ? ASN A 20  ASP A 34  1 ? 15 
HELX_P HELX_P3  3  ASP A 34  ? GLY A 43  ? ASP A 34  GLY A 43  1 ? 10 
HELX_P HELX_P4  4  LYS A 44  ? LEU A 46  ? LYS A 44  LEU A 46  5 ? 3  
HELX_P HELX_P5  5  ASN A 76  ? LEU A 82  ? ASN A 76  LEU A 82  1 ? 7  
HELX_P HELX_P6  6  HIS A 85  ? GLY A 90  ? HIS A 85  GLY A 90  1 ? 6  
HELX_P HELX_P7  7  TYR A 110 ? LEU A 127 ? TYR A 110 LEU A 127 1 ? 18 
HELX_P HELX_P8  8  VAL A 142 ? GLY A 156 ? VAL A 142 GLY A 156 1 ? 15 
HELX_P HELX_P9  9  SER A 167 ? SER A 179 ? SER A 167 SER A 179 1 ? 13 
HELX_P HELX_P10 10 PRO A 197 ? LYS A 207 ? PRO A 197 LYS A 207 1 ? 11 
HELX_P HELX_P11 11 TRP A 237 ? ALA A 244 ? TRP A 237 ALA A 244 1 ? 8  
HELX_P HELX_P12 12 THR A 278 ? PHE A 293 ? THR A 278 PHE A 293 1 ? 16 
HELX_P HELX_P13 13 TRP A 309 ? LEU A 316 ? TRP A 309 LEU A 316 1 ? 8  
HELX_P HELX_P14 14 LEU A 317 ? CYS A 323 ? LEU A 317 CYS A 323 1 ? 7  
HELX_P HELX_P15 15 ALA A 340 ? GLN A 350 ? ALA A 340 GLN A 350 1 ? 11 
HELX_P HELX_P16 16 ALA A 357 ? GLU A 367 ? ALA A 357 GLU A 367 1 ? 11 
HELX_P HELX_P17 17 GLY A 368 ? ILE A 372 ? GLY A 368 ILE A 372 5 ? 5  
HELX_P HELX_P18 18 ASN A 391 ? ILE A 402 ? ASN A 391 ILE A 402 1 ? 12 
HELX_P HELX_P19 19 GLN A 415 ? GLY A 419 ? GLN A 415 GLY A 419 5 ? 5  
HELX_P HELX_P20 20 ASP A 480 ? SER A 490 ? ASP A 480 SER A 490 1 ? 11 
HELX_P HELX_P21 21 THR A 529 ? HIS A 539 ? THR A 529 HIS A 539 1 ? 11 
HELX_P HELX_P22 22 SER A 572 ? ILE A 587 ? SER A 572 ILE A 587 1 ? 16 
HELX_P HELX_P23 23 GLY A 588 ? THR A 592 ? GLY A 588 THR A 592 5 ? 5  
HELX_P HELX_P24 24 MET A 611 ? ALA A 620 ? MET A 611 ALA A 620 1 ? 10 
HELX_P HELX_P25 25 GLY A 636 ? ALA A 647 ? GLY A 636 ALA A 647 1 ? 12 
HELX_P HELX_P26 26 PRO B 10  ? CYS B 17  ? PRO B 10  CYS B 17  1 ? 8  
HELX_P HELX_P27 27 ASN B 20  ? ASP B 34  ? ASN B 20  ASP B 34  1 ? 15 
HELX_P HELX_P28 28 ASP B 34  ? GLY B 43  ? ASP B 34  GLY B 43  1 ? 10 
HELX_P HELX_P29 29 LYS B 44  ? LEU B 46  ? LYS B 44  LEU B 46  5 ? 3  
HELX_P HELX_P30 30 ASN B 76  ? LEU B 82  ? ASN B 76  LEU B 82  1 ? 7  
HELX_P HELX_P31 31 HIS B 85  ? GLY B 90  ? HIS B 85  GLY B 90  1 ? 6  
HELX_P HELX_P32 32 TYR B 110 ? LEU B 127 ? TYR B 110 LEU B 127 1 ? 18 
HELX_P HELX_P33 33 VAL B 142 ? GLY B 156 ? VAL B 142 GLY B 156 1 ? 15 
HELX_P HELX_P34 34 SER B 167 ? SER B 179 ? SER B 167 SER B 179 1 ? 13 
HELX_P HELX_P35 35 PRO B 197 ? LYS B 207 ? PRO B 197 LYS B 207 1 ? 11 
HELX_P HELX_P36 36 TRP B 237 ? ALA B 244 ? TRP B 237 ALA B 244 1 ? 8  
HELX_P HELX_P37 37 THR B 278 ? PHE B 293 ? THR B 278 PHE B 293 1 ? 16 
HELX_P HELX_P38 38 TRP B 309 ? LEU B 316 ? TRP B 309 LEU B 316 1 ? 8  
HELX_P HELX_P39 39 LEU B 317 ? CYS B 323 ? LEU B 317 CYS B 323 1 ? 7  
HELX_P HELX_P40 40 ALA B 340 ? HIS B 349 ? ALA B 340 HIS B 349 1 ? 10 
HELX_P HELX_P41 41 ALA B 357 ? ALA B 366 ? ALA B 357 ALA B 366 1 ? 10 
HELX_P HELX_P42 42 GLU B 367 ? ILE B 372 ? GLU B 367 ILE B 372 5 ? 6  
HELX_P HELX_P43 43 ASN B 391 ? ILE B 402 ? ASN B 391 ILE B 402 1 ? 12 
HELX_P HELX_P44 44 GLN B 415 ? GLY B 419 ? GLN B 415 GLY B 419 5 ? 5  
HELX_P HELX_P45 45 ASP B 480 ? SER B 490 ? ASP B 480 SER B 490 1 ? 11 
HELX_P HELX_P46 46 THR B 529 ? HIS B 539 ? THR B 529 HIS B 539 1 ? 11 
HELX_P HELX_P47 47 SER B 572 ? ILE B 587 ? SER B 572 ILE B 587 1 ? 16 
HELX_P HELX_P48 48 GLY B 588 ? THR B 592 ? GLY B 588 THR B 592 5 ? 5  
HELX_P HELX_P49 49 MET B 611 ? GLY B 621 ? MET B 611 GLY B 621 1 ? 11 
HELX_P HELX_P50 50 GLY B 636 ? ALA B 647 ? GLY B 636 ALA B 647 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 336 A . ? TRP 336 A PRO 337 A ? PRO 337 A 1 2.66 
2 TRP 336 B . ? TRP 336 B PRO 337 B ? PRO 337 B 1 0.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 7 ? 
D ? 8 ? 
E ? 2 ? 
F ? 4 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 2 ? 
K ? 7 ? 
L ? 8 ? 
M ? 2 ? 
N ? 5 ? 
O ? 2 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? parallel      
K 4 5 ? parallel      
K 5 6 ? parallel      
K 6 7 ? parallel      
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
L 6 7 ? anti-parallel 
L 7 8 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 56  ? ALA A 61  ? LYS A 56  ALA A 61  
A 2 ASN A 64  ? TRP A 69  ? ASN A 64  TRP A 69  
B 1 THR A 74  ? LEU A 75  ? THR A 74  LEU A 75  
B 2 MET A 253 ? ASN A 254 ? MET A 253 ASN A 254 
C 1 SER A 105 ? SER A 109 ? SER A 105 SER A 109 
C 2 THR A 93  ? GLU A 98  ? THR A 93  GLU A 98  
C 3 THR A 326 ? PHE A 330 ? THR A 326 PHE A 330 
C 4 ILE A 300 ? CYS A 303 ? ILE A 300 CYS A 303 
C 5 ILE A 353 ? THR A 356 ? ILE A 353 THR A 356 
C 6 ILE A 382 ? VAL A 386 ? ILE A 382 VAL A 386 
C 7 VAL A 409 ? THR A 412 ? VAL A 409 THR A 412 
D 1 ASP A 234 ? TRP A 236 ? ASP A 234 TRP A 236 
D 2 HIS A 216 ? LEU A 220 ? HIS A 216 LEU A 220 
D 3 LEU A 182 ? ALA A 186 ? LEU A 182 ALA A 186 
D 4 VAL A 134 ? TYR A 138 ? VAL A 134 TYR A 138 
D 5 VAL A 158 ? VAL A 161 ? VAL A 158 VAL A 161 
D 6 PRO A 258 ? THR A 264 ? PRO A 258 THR A 264 
D 7 LYS A 272 ? THR A 277 ? LYS A 272 THR A 277 
D 8 THR A 476 ? LEU A 477 ? THR A 476 LEU A 477 
E 1 GLY A 189 ? ARG A 191 ? GLY A 189 ARG A 191 
E 2 ALA A 194 ? ILE A 196 ? ALA A 194 ILE A 196 
F 1 PRO A 446 ? VAL A 449 ? PRO A 446 VAL A 449 
F 2 THR A 460 ? ILE A 466 ? THR A 460 ILE A 466 
F 3 TYR A 496 ? ARG A 504 ? TYR A 496 ARG A 504 
F 4 TYR A 510 ? ARG A 515 ? TYR A 510 ARG A 515 
G 1 VAL A 519 ? VAL A 522 ? VAL A 519 VAL A 522 
G 2 HIS A 525 ? GLY A 528 ? HIS A 525 GLY A 528 
H 1 ILE A 542 ? HIS A 552 ? ILE A 542 HIS A 552 
H 2 GLY A 556 ? LEU A 565 ? GLY A 556 LEU A 565 
H 3 VAL A 595 ? TRP A 598 ? VAL A 595 TRP A 598 
I 1 LYS B 56  ? SER B 59  ? LYS B 56  SER B 59  
I 2 SER B 66  ? TRP B 69  ? SER B 66  TRP B 69  
J 1 THR B 74  ? LEU B 75  ? THR B 74  LEU B 75  
J 2 MET B 253 ? ASN B 254 ? MET B 253 ASN B 254 
K 1 SER B 105 ? SER B 109 ? SER B 105 SER B 109 
K 2 THR B 93  ? GLU B 98  ? THR B 93  GLU B 98  
K 3 THR B 326 ? PHE B 330 ? THR B 326 PHE B 330 
K 4 ILE B 300 ? CYS B 303 ? ILE B 300 CYS B 303 
K 5 ILE B 353 ? THR B 356 ? ILE B 353 THR B 356 
K 6 ILE B 382 ? VAL B 386 ? ILE B 382 VAL B 386 
K 7 VAL B 409 ? THR B 412 ? VAL B 409 THR B 412 
L 1 ASP B 234 ? TRP B 236 ? ASP B 234 TRP B 236 
L 2 HIS B 216 ? LEU B 220 ? HIS B 216 LEU B 220 
L 3 LEU B 182 ? ALA B 186 ? LEU B 182 ALA B 186 
L 4 VAL B 134 ? TYR B 138 ? VAL B 134 TYR B 138 
L 5 VAL B 158 ? VAL B 161 ? VAL B 158 VAL B 161 
L 6 PRO B 258 ? THR B 264 ? PRO B 258 THR B 264 
L 7 LYS B 272 ? THR B 277 ? LYS B 272 THR B 277 
L 8 THR B 476 ? LEU B 477 ? THR B 476 LEU B 477 
M 1 GLY B 189 ? ARG B 191 ? GLY B 189 ARG B 191 
M 2 ALA B 194 ? ILE B 196 ? ALA B 194 ILE B 196 
N 1 PRO B 455 ? GLN B 456 ? PRO B 455 GLN B 456 
N 2 PRO B 446 ? VAL B 449 ? PRO B 446 VAL B 449 
N 3 THR B 460 ? ILE B 466 ? THR B 460 ILE B 466 
N 4 TYR B 496 ? ARG B 504 ? TYR B 496 ARG B 504 
N 5 TYR B 510 ? ARG B 515 ? TYR B 510 ARG B 515 
O 1 VAL B 519 ? VAL B 522 ? VAL B 519 VAL B 522 
O 2 HIS B 525 ? GLY B 528 ? HIS B 525 GLY B 528 
P 1 ILE B 542 ? HIS B 552 ? ILE B 542 HIS B 552 
P 2 GLY B 556 ? LEU B 565 ? GLY B 556 LEU B 565 
P 3 VAL B 595 ? TRP B 598 ? VAL B 595 TRP B 598 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 61  ? N ALA A 61  O ASN A 64  ? O ASN A 64  
B 1 2 N LEU A 75  ? N LEU A 75  O MET A 253 ? O MET A 253 
C 1 2 O LYS A 106 ? O LYS A 106 N TRP A 97  ? N TRP A 97  
C 2 3 N ILE A 96  ? N ILE A 96  O MET A 329 ? O MET A 329 
C 3 4 O THR A 326 ? O THR A 326 N TYR A 301 ? N TYR A 301 
C 4 5 N TRP A 302 ? N TRP A 302 O TYR A 355 ? O TYR A 355 
C 5 6 N THR A 356 ? N THR A 356 O GLY A 384 ? O GLY A 384 
C 6 7 N SER A 385 ? N SER A 385 O THR A 412 ? O THR A 412 
D 1 2 O LEU A 235 ? O LEU A 235 N VAL A 219 ? N VAL A 219 
D 2 3 O ILE A 218 ? O ILE A 218 N VAL A 183 ? N VAL A 183 
D 3 4 O ILE A 184 ? O ILE A 184 N TYR A 138 ? N TYR A 138 
D 4 5 N VAL A 135 ? N VAL A 135 O SER A 160 ? O SER A 160 
D 5 6 N HIS A 159 ? N HIS A 159 O ILE A 261 ? O ILE A 261 
D 6 7 N LEU A 259 ? N LEU A 259 O HIS A 276 ? O HIS A 276 
D 7 8 N LEU A 275 ? N LEU A 275 O THR A 476 ? O THR A 476 
E 1 2 N ARG A 191 ? N ARG A 191 O ALA A 194 ? O ALA A 194 
F 1 2 N VAL A 449 ? N VAL A 449 O ASN A 463 ? O ASN A 463 
F 2 3 N THR A 460 ? N THR A 460 O ARG A 504 ? O ARG A 504 
F 3 4 N ARG A 503 ? N ARG A 503 O TRP A 511 ? O TRP A 511 
G 1 2 N LEU A 520 ? N LEU A 520 O LEU A 527 ? O LEU A 527 
H 1 2 N ALA A 546 ? N ALA A 546 O TYR A 562 ? O TYR A 562 
H 2 3 N ALA A 561 ? N ALA A 561 O HIS A 597 ? O HIS A 597 
I 1 2 N ASN B 57  ? N ASN B 57  O LYS B 68  ? O LYS B 68  
J 1 2 N LEU B 75  ? N LEU B 75  O MET B 253 ? O MET B 253 
K 1 2 O ILE B 108 ? O ILE B 108 N ILE B 95  ? N ILE B 95  
K 2 3 N ILE B 96  ? N ILE B 96  O MET B 329 ? O MET B 329 
K 3 4 O THR B 326 ? O THR B 326 N TYR B 301 ? N TYR B 301 
K 4 5 N TRP B 302 ? N TRP B 302 O ILE B 353 ? O ILE B 353 
K 5 6 N THR B 356 ? N THR B 356 O GLY B 384 ? O GLY B 384 
K 6 7 N LEU B 383 ? N LEU B 383 O VAL B 410 ? O VAL B 410 
L 1 2 O LEU B 235 ? O LEU B 235 N VAL B 219 ? N VAL B 219 
L 2 3 O ILE B 218 ? O ILE B 218 N THR B 185 ? N THR B 185 
L 3 4 O ILE B 184 ? O ILE B 184 N TYR B 138 ? N TYR B 138 
L 4 5 N VAL B 135 ? N VAL B 135 O SER B 160 ? O SER B 160 
L 5 6 N HIS B 159 ? N HIS B 159 O ILE B 261 ? O ILE B 261 
L 6 7 N LEU B 259 ? N LEU B 259 O HIS B 276 ? O HIS B 276 
L 7 8 N LEU B 275 ? N LEU B 275 O THR B 476 ? O THR B 476 
M 1 2 N ARG B 191 ? N ARG B 191 O ALA B 194 ? O ALA B 194 
N 1 2 O GLN B 456 ? O GLN B 456 N LEU B 448 ? N LEU B 448 
N 2 3 N VAL B 449 ? N VAL B 449 O ASN B 463 ? O ASN B 463 
N 3 4 N LEU B 464 ? N LEU B 464 O ASP B 500 ? O ASP B 500 
N 4 5 N ARG B 503 ? N ARG B 503 O TRP B 511 ? O TRP B 511 
O 1 2 N LEU B 520 ? N LEU B 520 O LEU B 527 ? O LEU B 527 
P 1 2 N ALA B 546 ? N ALA B 546 O TYR B 562 ? O TYR B 562 
P 2 3 N ALA B 561 ? N ALA B 561 O HIS B 597 ? O HIS B 597 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PRX 998 ? 17 'BINDING SITE FOR RESIDUE PRX A 998' 
AC2 Software B PRX 999 ? 17 'BINDING SITE FOR RESIDUE PRX B 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 VAL A 310 ? VAL A 310  . ? 1_555 ? 
2  AC1 17 THR A 311 ? THR A 311  . ? 1_555 ? 
3  AC1 17 GLY A 387 ? GLY A 387  . ? 1_555 ? 
4  AC1 17 GLU A 388 ? GLU A 388  . ? 1_555 ? 
5  AC1 17 PRO A 389 ? PRO A 389  . ? 1_555 ? 
6  AC1 17 ASP A 411 ? ASP A 411  . ? 1_555 ? 
7  AC1 17 THR A 412 ? THR A 412  . ? 1_555 ? 
8  AC1 17 TRP A 413 ? TRP A 413  . ? 1_555 ? 
9  AC1 17 TRP A 414 ? TRP A 414  . ? 1_555 ? 
10 AC1 17 GLN A 415 ? GLN A 415  . ? 1_555 ? 
11 AC1 17 THR A 416 ? THR A 416  . ? 1_555 ? 
12 AC1 17 ASP A 500 ? ASP A 500  . ? 1_555 ? 
13 AC1 17 ILE A 512 ? ILE A 512  . ? 1_555 ? 
14 AC1 17 ARG A 515 ? ARG A 515  . ? 1_555 ? 
15 AC1 17 ARG A 526 ? ARG A 526  . ? 1_555 ? 
16 AC1 17 HOH E .   ? HOH A 1134 . ? 1_555 ? 
17 AC1 17 HOH E .   ? HOH A 1248 . ? 1_555 ? 
18 AC2 17 THR B 311 ? THR B 311  . ? 1_555 ? 
19 AC2 17 VAL B 386 ? VAL B 386  . ? 1_555 ? 
20 AC2 17 GLY B 387 ? GLY B 387  . ? 1_555 ? 
21 AC2 17 GLU B 388 ? GLU B 388  . ? 1_555 ? 
22 AC2 17 PRO B 389 ? PRO B 389  . ? 1_555 ? 
23 AC2 17 ASP B 411 ? ASP B 411  . ? 1_555 ? 
24 AC2 17 THR B 412 ? THR B 412  . ? 1_555 ? 
25 AC2 17 TRP B 413 ? TRP B 413  . ? 1_555 ? 
26 AC2 17 TRP B 414 ? TRP B 414  . ? 1_555 ? 
27 AC2 17 GLN B 415 ? GLN B 415  . ? 1_555 ? 
28 AC2 17 THR B 416 ? THR B 416  . ? 1_555 ? 
29 AC2 17 ASP B 500 ? ASP B 500  . ? 1_555 ? 
30 AC2 17 ILE B 512 ? ILE B 512  . ? 1_555 ? 
31 AC2 17 ARG B 515 ? ARG B 515  . ? 1_555 ? 
32 AC2 17 ARG B 526 ? ARG B 526  . ? 1_555 ? 
33 AC2 17 HOH F .   ? HOH B 1049 . ? 1_555 ? 
34 AC2 17 HOH F .   ? HOH B 1081 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2P2M 
_atom_sites.fract_transf_matrix[1][1]   0.010903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010471 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006113 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . HIS A 1 5   ? -23.906 17.072  9.635   1.00 32.97  ? 5    HIS A N     1 
ATOM   2     C CA    . HIS A 1 5   ? -23.587 16.836  8.190   1.00 32.72  ? 5    HIS A CA    1 
ATOM   3     C C     . HIS A 1 5   ? -22.128 17.139  7.871   1.00 32.28  ? 5    HIS A C     1 
ATOM   4     O O     . HIS A 1 5   ? -21.541 18.058  8.431   1.00 32.74  ? 5    HIS A O     1 
ATOM   5     C CB    . HIS A 1 5   ? -24.495 17.686  7.301   1.00 32.87  ? 5    HIS A CB    1 
ATOM   6     N N     . LYS A 1 6   ? -21.555 16.371  6.954   1.00 31.89  ? 6    LYS A N     1 
ATOM   7     C CA    . LYS A 1 6   ? -20.155 16.520  6.586   1.00 31.46  ? 6    LYS A CA    1 
ATOM   8     C C     . LYS A 1 6   ? -19.991 17.336  5.305   1.00 30.49  ? 6    LYS A C     1 
ATOM   9     O O     . LYS A 1 6   ? -20.783 17.202  4.371   1.00 30.49  ? 6    LYS A O     1 
ATOM   10    C CB    . LYS A 1 6   ? -19.499 15.140  6.425   1.00 31.39  ? 6    LYS A CB    1 
ATOM   11    C CG    . LYS A 1 6   ? -19.389 14.351  7.730   1.00 32.85  ? 6    LYS A CG    1 
ATOM   12    C CD    . LYS A 1 6   ? -19.090 12.856  7.513   1.00 32.72  ? 6    LYS A CD    1 
ATOM   13    C CE    . LYS A 1 6   ? -17.662 12.498  7.924   1.00 34.85  ? 6    LYS A CE    1 
ATOM   14    N NZ    . LYS A 1 6   ? -17.338 11.029  7.840   1.00 34.55  ? 6    LYS A NZ    1 
ATOM   15    N N     . HIS A 1 7   ? -18.966 18.186  5.273   1.00 29.00  ? 7    HIS A N     1 
ATOM   16    C CA    . HIS A 1 7   ? -18.499 18.774  4.021   1.00 28.03  ? 7    HIS A CA    1 
ATOM   17    C C     . HIS A 1 7   ? -17.474 17.840  3.382   1.00 27.36  ? 7    HIS A C     1 
ATOM   18    O O     . HIS A 1 7   ? -16.462 17.506  3.999   1.00 27.16  ? 7    HIS A O     1 
ATOM   19    C CB    . HIS A 1 7   ? -17.884 20.159  4.255   1.00 27.65  ? 7    HIS A CB    1 
ATOM   20    C CG    . HIS A 1 7   ? -18.888 21.202  4.615   1.00 27.58  ? 7    HIS A CG    1 
ATOM   21    N ND1   . HIS A 1 7   ? -19.441 22.054  3.683   1.00 29.30  ? 7    HIS A ND1   1 
ATOM   22    C CD2   . HIS A 1 7   ? -19.474 21.505  5.795   1.00 27.40  ? 7    HIS A CD2   1 
ATOM   23    C CE1   . HIS A 1 7   ? -20.306 22.855  4.279   1.00 28.45  ? 7    HIS A CE1   1 
ATOM   24    N NE2   . HIS A 1 7   ? -20.344 22.544  5.561   1.00 29.17  ? 7    HIS A NE2   1 
ATOM   25    N N     . ALA A 1 8   ? -17.750 17.412  2.154   1.00 26.45  ? 8    ALA A N     1 
ATOM   26    C CA    . ALA A 1 8   ? -16.812 16.591  1.389   1.00 25.75  ? 8    ALA A CA    1 
ATOM   27    C C     . ALA A 1 8   ? -15.585 17.393  0.966   1.00 25.14  ? 8    ALA A C     1 
ATOM   28    O O     . ALA A 1 8   ? -15.630 18.626  0.865   1.00 24.75  ? 8    ALA A O     1 
ATOM   29    C CB    . ALA A 1 8   ? -17.503 15.994  0.152   1.00 25.90  ? 8    ALA A CB    1 
ATOM   30    N N     . ILE A 1 9   ? -14.494 16.676  0.720   1.00 24.56  ? 9    ILE A N     1 
ATOM   31    C CA    . ILE A 1 9   ? -13.256 17.262  0.221   1.00 23.61  ? 9    ILE A CA    1 
ATOM   32    C C     . ILE A 1 9   ? -13.459 17.617  -1.248  1.00 23.25  ? 9    ILE A C     1 
ATOM   33    O O     . ILE A 1 9   ? -13.817 16.748  -2.045  1.00 23.23  ? 9    ILE A O     1 
ATOM   34    C CB    . ILE A 1 9   ? -12.078 16.267  0.373   1.00 23.96  ? 9    ILE A CB    1 
ATOM   35    C CG1   . ILE A 1 9   ? -11.857 15.942  1.855   1.00 23.79  ? 9    ILE A CG1   1 
ATOM   36    C CG2   . ILE A 1 9   ? -10.796 16.818  -0.275  1.00 22.51  ? 9    ILE A CG2   1 
ATOM   37    C CD1   . ILE A 1 9   ? -11.168 14.644  2.104   1.00 22.09  ? 9    ILE A CD1   1 
ATOM   38    N N     . PRO A 1 10  ? -13.238 18.895  -1.612  1.00 22.62  ? 10   PRO A N     1 
ATOM   39    C CA    . PRO A 1 10  ? -13.455 19.345  -2.992  1.00 22.17  ? 10   PRO A CA    1 
ATOM   40    C C     . PRO A 1 10  ? -12.369 18.860  -3.945  1.00 21.95  ? 10   PRO A C     1 
ATOM   41    O O     . PRO A 1 10  ? -11.231 18.633  -3.515  1.00 21.64  ? 10   PRO A O     1 
ATOM   42    C CB    . PRO A 1 10  ? -13.417 20.871  -2.879  1.00 22.25  ? 10   PRO A CB    1 
ATOM   43    C CG    . PRO A 1 10  ? -12.560 21.145  -1.678  1.00 22.35  ? 10   PRO A CG    1 
ATOM   44    C CD    . PRO A 1 10  ? -12.769 19.984  -0.733  1.00 22.99  ? 10   PRO A CD    1 
ATOM   45    N N     . ALA A 1 11  ? -12.724 18.727  -5.226  1.00 21.39  ? 11   ALA A N     1 
ATOM   46    C CA    . ALA A 1 11  ? -11.831 18.183  -6.257  1.00 21.36  ? 11   ALA A CA    1 
ATOM   47    C C     . ALA A 1 11  ? -10.493 18.905  -6.393  1.00 21.40  ? 11   ALA A C     1 
ATOM   48    O O     . ALA A 1 11  ? -9.456  18.256  -6.554  1.00 21.43  ? 11   ALA A O     1 
ATOM   49    C CB    . ALA A 1 11  ? -12.541 18.116  -7.617  1.00 21.47  ? 11   ALA A CB    1 
ATOM   50    N N     . ASN A 1 12  ? -10.510 20.236  -6.330  1.00 21.16  ? 12   ASN A N     1 
ATOM   51    C CA    . ASN A 1 12  ? -9.276  21.012  -6.448  1.00 21.18  ? 12   ASN A CA    1 
ATOM   52    C C     . ASN A 1 12  ? -8.280  20.690  -5.333  1.00 21.26  ? 12   ASN A C     1 
ATOM   53    O O     . ASN A 1 12  ? -7.075  20.629  -5.570  1.00 21.60  ? 12   ASN A O     1 
ATOM   54    C CB    . ASN A 1 12  ? -9.572  22.522  -6.513  1.00 21.07  ? 12   ASN A CB    1 
ATOM   55    C CG    . ASN A 1 12  ? -10.103 23.084  -5.191  1.00 20.79  ? 12   ASN A CG    1 
ATOM   56    O OD1   . ASN A 1 12  ? -11.110 22.617  -4.655  1.00 18.94  ? 12   ASN A OD1   1 
ATOM   57    N ND2   . ASN A 1 12  ? -9.417  24.098  -4.663  1.00 20.48  ? 12   ASN A ND2   1 
ATOM   58    N N     . ILE A 1 13  ? -8.788  20.485  -4.118  1.00 21.44  ? 13   ILE A N     1 
ATOM   59    C CA    . ILE A 1 13  ? -7.936  20.128  -2.973  1.00 21.60  ? 13   ILE A CA    1 
ATOM   60    C C     . ILE A 1 13  ? -7.472  18.673  -3.084  1.00 21.28  ? 13   ILE A C     1 
ATOM   61    O O     . ILE A 1 13  ? -6.293  18.382  -2.873  1.00 21.51  ? 13   ILE A O     1 
ATOM   62    C CB    . ILE A 1 13  ? -8.625  20.420  -1.606  1.00 21.51  ? 13   ILE A CB    1 
ATOM   63    C CG1   . ILE A 1 13  ? -8.932  21.916  -1.460  1.00 22.32  ? 13   ILE A CG1   1 
ATOM   64    C CG2   . ILE A 1 13  ? -7.760  19.943  -0.419  1.00 21.85  ? 13   ILE A CG2   1 
ATOM   65    C CD1   . ILE A 1 13  ? -7.697  22.851  -1.507  1.00 22.40  ? 13   ILE A CD1   1 
ATOM   66    N N     . ALA A 1 14  ? -8.389  17.771  -3.426  1.00 21.00  ? 14   ALA A N     1 
ATOM   67    C CA    . ALA A 1 14  ? -8.028  16.380  -3.719  1.00 21.33  ? 14   ALA A CA    1 
ATOM   68    C C     . ALA A 1 14  ? -6.873  16.278  -4.717  1.00 21.40  ? 14   ALA A C     1 
ATOM   69    O O     . ALA A 1 14  ? -5.998  15.421  -4.574  1.00 21.28  ? 14   ALA A O     1 
ATOM   70    C CB    . ALA A 1 14  ? -9.244  15.585  -4.229  1.00 20.91  ? 14   ALA A CB    1 
ATOM   71    N N     . ASP A 1 15  ? -6.874  17.166  -5.711  1.00 21.63  ? 15   ASP A N     1 
ATOM   72    C CA    . ASP A 1 15  ? -5.897  17.132  -6.795  1.00 22.18  ? 15   ASP A CA    1 
ATOM   73    C C     . ASP A 1 15  ? -4.494  17.584  -6.398  1.00 21.93  ? 15   ASP A C     1 
ATOM   74    O O     . ASP A 1 15  ? -3.530  17.264  -7.085  1.00 21.61  ? 15   ASP A O     1 
ATOM   75    C CB    . ASP A 1 15  ? -6.397  17.951  -7.993  1.00 22.56  ? 15   ASP A CB    1 
ATOM   76    C CG    . ASP A 1 15  ? -7.491  17.237  -8.778  1.00 24.59  ? 15   ASP A CG    1 
ATOM   77    O OD1   . ASP A 1 15  ? -7.792  16.059  -8.479  1.00 26.49  ? 15   ASP A OD1   1 
ATOM   78    O OD2   . ASP A 1 15  ? -8.061  17.862  -9.702  1.00 27.96  ? 15   ASP A OD2   1 
ATOM   79    N N     . ARG A 1 16  ? -4.385  18.321  -5.296  1.00 21.86  ? 16   ARG A N     1 
ATOM   80    C CA    . ARG A 1 16  ? -3.114  18.911  -4.903  1.00 22.31  ? 16   ARG A CA    1 
ATOM   81    C C     . ARG A 1 16  ? -2.626  18.511  -3.510  1.00 21.55  ? 16   ARG A C     1 
ATOM   82    O O     . ARG A 1 16  ? -1.446  18.682  -3.210  1.00 21.64  ? 16   ARG A O     1 
ATOM   83    C CB    . ARG A 1 16  ? -3.176  20.444  -5.021  1.00 22.32  ? 16   ARG A CB    1 
ATOM   84    C CG    . ARG A 1 16  ? -4.091  21.128  -4.017  1.00 23.73  ? 16   ARG A CG    1 
ATOM   85    C CD    . ARG A 1 16  ? -4.365  22.594  -4.410  1.00 24.39  ? 16   ARG A CD    1 
ATOM   86    N NE    . ARG A 1 16  ? -3.426  23.519  -3.788  1.00 26.78  ? 16   ARG A NE    1 
ATOM   87    C CZ    . ARG A 1 16  ? -2.500  24.223  -4.434  1.00 29.09  ? 16   ARG A CZ    1 
ATOM   88    N NH1   . ARG A 1 16  ? -2.372  24.139  -5.762  1.00 28.36  ? 16   ARG A NH1   1 
ATOM   89    N NH2   . ARG A 1 16  ? -1.699  25.023  -3.736  1.00 29.37  ? 16   ARG A NH2   1 
ATOM   90    N N     . CYS A 1 17  ? -3.528  17.986  -2.678  1.00 20.74  ? 17   CYS A N     1 
ATOM   91    C CA    . CYS A 1 17  ? -3.253  17.788  -1.254  1.00 20.42  ? 17   CYS A CA    1 
ATOM   92    C C     . CYS A 1 17  ? -2.034  16.919  -0.974  1.00 20.11  ? 17   CYS A C     1 
ATOM   93    O O     . CYS A 1 17  ? -1.832  15.876  -1.604  1.00 19.73  ? 17   CYS A O     1 
ATOM   94    C CB    . CYS A 1 17  ? -4.478  17.241  -0.509  1.00 20.34  ? 17   CYS A CB    1 
ATOM   95    S SG    . CYS A 1 17  ? -4.962  15.593  -1.016  1.00 20.65  ? 17   CYS A SG    1 
ATOM   96    N N     . LEU A 1 18  ? -1.238  17.367  -0.007  1.00 19.65  ? 18   LEU A N     1 
ATOM   97    C CA    . LEU A 1 18  ? -0.051  16.643  0.421   1.00 19.33  ? 18   LEU A CA    1 
ATOM   98    C C     . LEU A 1 18  ? -0.417  15.375  1.190   1.00 19.25  ? 18   LEU A C     1 
ATOM   99    O O     . LEU A 1 18  ? 0.298   14.376  1.125   1.00 19.30  ? 18   LEU A O     1 
ATOM   100   C CB    . LEU A 1 18  ? 0.839   17.548  1.277   1.00 18.74  ? 18   LEU A CB    1 
ATOM   101   C CG    . LEU A 1 18  ? 1.336   18.855  0.639   1.00 19.39  ? 18   LEU A CG    1 
ATOM   102   C CD1   . LEU A 1 18  ? 2.059   19.749  1.669   1.00 18.52  ? 18   LEU A CD1   1 
ATOM   103   C CD2   . LEU A 1 18  ? 2.203   18.608  -0.601  1.00 17.40  ? 18   LEU A CD2   1 
ATOM   104   N N     . ILE A 1 19  ? -1.522  15.431  1.928   1.00 19.12  ? 19   ILE A N     1 
ATOM   105   C CA    . ILE A 1 19  ? -2.011  14.281  2.682   1.00 18.80  ? 19   ILE A CA    1 
ATOM   106   C C     . ILE A 1 19  ? -3.456  13.983  2.285   1.00 18.77  ? 19   ILE A C     1 
ATOM   107   O O     . ILE A 1 19  ? -4.352  14.828  2.489   1.00 18.63  ? 19   ILE A O     1 
ATOM   108   C CB    . ILE A 1 19  ? -1.968  14.518  4.226   1.00 19.18  ? 19   ILE A CB    1 
ATOM   109   C CG1   . ILE A 1 19  ? -0.591  15.027  4.719   1.00 18.73  ? 19   ILE A CG1   1 
ATOM   110   C CG2   . ILE A 1 19  ? -2.434  13.260  4.979   1.00 18.71  ? 19   ILE A CG2   1 
ATOM   111   C CD1   . ILE A 1 19  ? 0.594   14.068  4.486   1.00 21.49  ? 19   ILE A CD1   1 
ATOM   112   N N     . ASN A 1 20  ? -3.676  12.790  1.732   1.00 18.45  ? 20   ASN A N     1 
ATOM   113   C CA    . ASN A 1 20  ? -5.022  12.284  1.441   1.00 18.69  ? 20   ASN A CA    1 
ATOM   114   C C     . ASN A 1 20  ? -5.576  11.423  2.600   1.00 18.90  ? 20   ASN A C     1 
ATOM   115   O O     . ASN A 1 20  ? -4.875  11.206  3.591   1.00 18.98  ? 20   ASN A O     1 
ATOM   116   C CB    . ASN A 1 20  ? -5.061  11.552  0.081   1.00 18.24  ? 20   ASN A CB    1 
ATOM   117   C CG    . ASN A 1 20  ? -4.286  10.233  0.067   1.00 18.96  ? 20   ASN A CG    1 
ATOM   118   O OD1   . ASN A 1 20  ? -4.152  9.545   1.079   1.00 18.66  ? 20   ASN A OD1   1 
ATOM   119   N ND2   . ASN A 1 20  ? -3.796  9.863   -1.112  1.00 18.44  ? 20   ASN A ND2   1 
ATOM   120   N N     . PRO A 1 21  ? -6.841  10.962  2.511   1.00 19.37  ? 21   PRO A N     1 
ATOM   121   C CA    . PRO A 1 21  ? -7.392  10.184  3.644   1.00 19.86  ? 21   PRO A CA    1 
ATOM   122   C C     . PRO A 1 21  ? -6.579  8.945   4.017   1.00 20.41  ? 21   PRO A C     1 
ATOM   123   O O     . PRO A 1 21  ? -6.427  8.638   5.203   1.00 20.27  ? 21   PRO A O     1 
ATOM   124   C CB    . PRO A 1 21  ? -8.783  9.778   3.142   1.00 20.22  ? 21   PRO A CB    1 
ATOM   125   C CG    . PRO A 1 21  ? -9.142  10.840  2.152   1.00 19.76  ? 21   PRO A CG    1 
ATOM   126   C CD    . PRO A 1 21  ? -7.847  11.155  1.449   1.00 18.99  ? 21   PRO A CD    1 
ATOM   127   N N     . GLU A 1 22  ? -6.068  8.245   3.005   1.00 21.11  ? 22   GLU A N     1 
ATOM   128   C CA    . GLU A 1 22  ? -5.274  7.032   3.193   1.00 21.88  ? 22   GLU A CA    1 
ATOM   129   C C     . GLU A 1 22  ? -3.941  7.342   3.866   1.00 21.43  ? 22   GLU A C     1 
ATOM   130   O O     . GLU A 1 22  ? -3.503  6.633   4.783   1.00 21.27  ? 22   GLU A O     1 
ATOM   131   C CB    . GLU A 1 22  ? -5.035  6.332   1.842   1.00 22.12  ? 22   GLU A CB    1 
ATOM   132   C CG    . GLU A 1 22  ? -6.306  5.808   1.129   1.00 26.18  ? 22   GLU A CG    1 
ATOM   133   C CD    . GLU A 1 22  ? -7.348  6.891   0.757   1.00 30.10  ? 22   GLU A CD    1 
ATOM   134   O OE1   . GLU A 1 22  ? -8.560  6.648   1.019   1.00 31.40  ? 22   GLU A OE1   1 
ATOM   135   O OE2   . GLU A 1 22  ? -6.968  7.962   0.207   1.00 29.85  ? 22   GLU A OE2   1 
ATOM   136   N N     . GLN A 1 23  ? -3.292  8.399   3.397   1.00 21.22  ? 23   GLN A N     1 
ATOM   137   C CA    . GLN A 1 23  ? -2.018  8.829   3.963   1.00 21.26  ? 23   GLN A CA    1 
ATOM   138   C C     . GLN A 1 23  ? -2.144  9.315   5.412   1.00 21.13  ? 23   GLN A C     1 
ATOM   139   O O     . GLN A 1 23  ? -1.244  9.080   6.222   1.00 20.95  ? 23   GLN A O     1 
ATOM   140   C CB    . GLN A 1 23  ? -1.390  9.911   3.090   1.00 21.37  ? 23   GLN A CB    1 
ATOM   141   C CG    . GLN A 1 23  ? -0.981  9.421   1.710   1.00 21.70  ? 23   GLN A CG    1 
ATOM   142   C CD    . GLN A 1 23  ? -0.563  10.562  0.799   1.00 22.88  ? 23   GLN A CD    1 
ATOM   143   O OE1   . GLN A 1 23  ? -1.275  11.563  0.658   1.00 20.10  ? 23   GLN A OE1   1 
ATOM   144   N NE2   . GLN A 1 23  ? 0.603   10.418  0.179   1.00 23.59  ? 23   GLN A NE2   1 
ATOM   145   N N     . TYR A 1 24  ? -3.248  9.984   5.745   1.00 21.19  ? 24   TYR A N     1 
ATOM   146   C CA    . TYR A 1 24  ? -3.475  10.399  7.141   1.00 21.24  ? 24   TYR A CA    1 
ATOM   147   C C     . TYR A 1 24  ? -3.556  9.185   8.057   1.00 21.34  ? 24   TYR A C     1 
ATOM   148   O O     . TYR A 1 24  ? -2.961  9.173   9.133   1.00 21.69  ? 24   TYR A O     1 
ATOM   149   C CB    . TYR A 1 24  ? -4.744  11.253  7.317   1.00 21.14  ? 24   TYR A CB    1 
ATOM   150   C CG    . TYR A 1 24  ? -5.126  11.364  8.779   1.00 21.18  ? 24   TYR A CG    1 
ATOM   151   C CD1   . TYR A 1 24  ? -4.513  12.302  9.604   1.00 20.71  ? 24   TYR A CD1   1 
ATOM   152   C CD2   . TYR A 1 24  ? -6.064  10.494  9.350   1.00 19.83  ? 24   TYR A CD2   1 
ATOM   153   C CE1   . TYR A 1 24  ? -4.833  12.385  10.955  1.00 21.13  ? 24   TYR A CE1   1 
ATOM   154   C CE2   . TYR A 1 24  ? -6.381  10.561  10.699  1.00 19.89  ? 24   TYR A CE2   1 
ATOM   155   C CZ    . TYR A 1 24  ? -5.758  11.509  11.495  1.00 20.72  ? 24   TYR A CZ    1 
ATOM   156   O OH    . TYR A 1 24  ? -6.061  11.595  12.831  1.00 21.37  ? 24   TYR A OH    1 
ATOM   157   N N     . GLU A 1 25  ? -4.304  8.173   7.625   1.00 21.55  ? 25   GLU A N     1 
ATOM   158   C CA    . GLU A 1 25  ? -4.504  6.963   8.410   1.00 22.08  ? 25   GLU A CA    1 
ATOM   159   C C     . GLU A 1 25  ? -3.191  6.195   8.605   1.00 21.55  ? 25   GLU A C     1 
ATOM   160   O O     . GLU A 1 25  ? -2.868  5.786   9.725   1.00 21.07  ? 25   GLU A O     1 
ATOM   161   C CB    . GLU A 1 25  ? -5.570  6.059   7.758   1.00 22.61  ? 25   GLU A CB    1 
ATOM   162   C CG    . GLU A 1 25  ? -7.019  6.611   7.825   1.00 25.13  ? 25   GLU A CG    1 
ATOM   163   C CD    . GLU A 1 25  ? -7.544  6.816   9.256   1.00 29.51  ? 25   GLU A CD    1 
ATOM   164   O OE1   . GLU A 1 25  ? -7.069  6.117   10.187  1.00 31.50  ? 25   GLU A OE1   1 
ATOM   165   O OE2   . GLU A 1 25  ? -8.437  7.680   9.453   1.00 30.27  ? 25   GLU A OE2   1 
ATOM   166   N N     . THR A 1 26  ? -2.452  6.016   7.509   1.00 21.01  ? 26   THR A N     1 
ATOM   167   C CA    . THR A 1 26  ? -1.144  5.366   7.526   1.00 20.91  ? 26   THR A CA    1 
ATOM   168   C C     . THR A 1 26  ? -0.164  6.105   8.430   1.00 20.65  ? 26   THR A C     1 
ATOM   169   O O     . THR A 1 26  ? 0.421   5.500   9.324   1.00 20.43  ? 26   THR A O     1 
ATOM   170   C CB    . THR A 1 26  ? -0.540  5.214   6.098   1.00 20.74  ? 26   THR A CB    1 
ATOM   171   O OG1   . THR A 1 26  ? -1.489  4.583   5.227   1.00 21.65  ? 26   THR A OG1   1 
ATOM   172   C CG2   . THR A 1 26  ? 0.716   4.355   6.132   1.00 21.23  ? 26   THR A CG2   1 
ATOM   173   N N     . LYS A 1 27  ? 0.015   7.406   8.193   1.00 20.50  ? 27   LYS A N     1 
ATOM   174   C CA    . LYS A 1 27  ? 0.962   8.197   8.977   1.00 20.87  ? 27   LYS A CA    1 
ATOM   175   C C     . LYS A 1 27  ? 0.552   8.292   10.448  1.00 20.67  ? 27   LYS A C     1 
ATOM   176   O O     . LYS A 1 27  ? 1.403   8.181   11.337  1.00 20.34  ? 27   LYS A O     1 
ATOM   177   C CB    . LYS A 1 27  ? 1.134   9.605   8.393   1.00 21.33  ? 27   LYS A CB    1 
ATOM   178   C CG    . LYS A 1 27  ? 1.943   9.658   7.084   1.00 21.13  ? 27   LYS A CG    1 
ATOM   179   C CD    . LYS A 1 27  ? 2.147   11.128  6.652   1.00 21.79  ? 27   LYS A CD    1 
ATOM   180   C CE    . LYS A 1 27  ? 3.029   11.226  5.393   1.00 23.20  ? 27   LYS A CE    1 
ATOM   181   N NZ    . LYS A 1 27  ? 4.444   10.790  5.608   1.00 21.31  ? 27   LYS A NZ    1 
ATOM   182   N N     . TYR A 1 28  ? -0.739  8.505   10.710  1.00 20.27  ? 28   TYR A N     1 
ATOM   183   C CA    . TYR A 1 28  ? -1.203  8.547   12.092  1.00 20.25  ? 28   TYR A CA    1 
ATOM   184   C C     . TYR A 1 28  ? -0.864  7.252   12.827  1.00 20.34  ? 28   TYR A C     1 
ATOM   185   O O     . TYR A 1 28  ? -0.366  7.293   13.957  1.00 20.60  ? 28   TYR A O     1 
ATOM   186   C CB    . TYR A 1 28  ? -2.705  8.818   12.217  1.00 20.34  ? 28   TYR A CB    1 
ATOM   187   C CG    . TYR A 1 28  ? -3.094  8.957   13.671  1.00 20.31  ? 28   TYR A CG    1 
ATOM   188   C CD1   . TYR A 1 28  ? -2.840  10.144  14.364  1.00 20.70  ? 28   TYR A CD1   1 
ATOM   189   C CD2   . TYR A 1 28  ? -3.647  7.883   14.374  1.00 20.92  ? 28   TYR A CD2   1 
ATOM   190   C CE1   . TYR A 1 28  ? -3.157  10.277  15.707  1.00 20.81  ? 28   TYR A CE1   1 
ATOM   191   C CE2   . TYR A 1 28  ? -3.976  8.005   15.724  1.00 21.33  ? 28   TYR A CE2   1 
ATOM   192   C CZ    . TYR A 1 28  ? -3.727  9.208   16.380  1.00 20.86  ? 28   TYR A CZ    1 
ATOM   193   O OH    . TYR A 1 28  ? -4.032  9.345   17.712  1.00 20.14  ? 28   TYR A OH    1 
ATOM   194   N N     . LYS A 1 29  ? -1.145  6.117   12.184  1.00 19.97  ? 29   LYS A N     1 
ATOM   195   C CA    . LYS A 1 29  ? -0.868  4.798   12.757  1.00 20.01  ? 29   LYS A CA    1 
ATOM   196   C C     . LYS A 1 29  ? 0.617   4.591   13.068  1.00 20.10  ? 29   LYS A C     1 
ATOM   197   O O     . LYS A 1 29  ? 0.957   4.126   14.143  1.00 19.94  ? 29   LYS A O     1 
ATOM   198   C CB    . LYS A 1 29  ? -1.398  3.683   11.844  1.00 20.00  ? 29   LYS A CB    1 
ATOM   199   N N     . GLN A 1 30  ? 1.500   4.948   12.141  1.00 20.78  ? 30   GLN A N     1 
ATOM   200   C CA    . GLN A 1 30  ? 2.941   4.852   12.397  1.00 21.44  ? 30   GLN A CA    1 
ATOM   201   C C     . GLN A 1 30  ? 3.396   5.771   13.553  1.00 21.71  ? 30   GLN A C     1 
ATOM   202   O O     . GLN A 1 30  ? 4.177   5.356   14.424  1.00 20.87  ? 30   GLN A O     1 
ATOM   203   C CB    . GLN A 1 30  ? 3.740   5.165   11.130  1.00 21.40  ? 30   GLN A CB    1 
ATOM   204   C CG    . GLN A 1 30  ? 5.129   4.524   11.125  1.00 22.34  ? 30   GLN A CG    1 
ATOM   205   C CD    . GLN A 1 30  ? 6.037   5.037   10.010  1.00 22.24  ? 30   GLN A CD    1 
ATOM   206   O OE1   . GLN A 1 30  ? 5.814   6.113   9.442   1.00 22.51  ? 30   GLN A OE1   1 
ATOM   207   N NE2   . GLN A 1 30  ? 7.075   4.269   9.704   1.00 21.97  ? 30   GLN A NE2   1 
ATOM   208   N N     . SER A 1 31  ? 2.897   7.012   13.556  1.00 21.94  ? 31   SER A N     1 
ATOM   209   C CA    . SER A 1 31  ? 3.250   7.997   14.583  1.00 22.39  ? 31   SER A CA    1 
ATOM   210   C C     . SER A 1 31  ? 2.962   7.488   15.998  1.00 23.17  ? 31   SER A C     1 
ATOM   211   O O     . SER A 1 31  ? 3.679   7.816   16.936  1.00 23.70  ? 31   SER A O     1 
ATOM   212   C CB    . SER A 1 31  ? 2.528   9.330   14.333  1.00 22.22  ? 31   SER A CB    1 
ATOM   213   O OG    . SER A 1 31  ? 1.140   9.257   14.644  1.00 20.75  ? 31   SER A OG    1 
ATOM   214   N N     . ILE A 1 32  ? 1.917   6.679   16.142  1.00 23.84  ? 32   ILE A N     1 
ATOM   215   C CA    . ILE A 1 32  ? 1.527   6.130   17.449  1.00 24.59  ? 32   ILE A CA    1 
ATOM   216   C C     . ILE A 1 32  ? 2.269   4.833   17.754  1.00 24.65  ? 32   ILE A C     1 
ATOM   217   O O     . ILE A 1 32  ? 2.784   4.637   18.862  1.00 24.98  ? 32   ILE A O     1 
ATOM   218   C CB    . ILE A 1 32  ? -0.011  5.881   17.525  1.00 24.55  ? 32   ILE A CB    1 
ATOM   219   C CG1   . ILE A 1 32  ? -0.785  7.180   17.271  1.00 24.60  ? 32   ILE A CG1   1 
ATOM   220   C CG2   . ILE A 1 32  ? -0.410  5.238   18.872  1.00 25.93  ? 32   ILE A CG2   1 
ATOM   221   C CD1   . ILE A 1 32  ? -0.198  8.434   17.931  1.00 23.01  ? 32   ILE A CD1   1 
ATOM   222   N N     . ASN A 1 33  ? 2.327   3.965   16.753  1.00 24.72  ? 33   ASN A N     1 
ATOM   223   C CA    . ASN A 1 33  ? 2.907   2.637   16.886  1.00 25.09  ? 33   ASN A CA    1 
ATOM   224   C C     . ASN A 1 33  ? 4.431   2.628   16.872  1.00 24.56  ? 33   ASN A C     1 
ATOM   225   O O     . ASN A 1 33  ? 5.049   1.733   17.452  1.00 24.24  ? 33   ASN A O     1 
ATOM   226   C CB    . ASN A 1 33  ? 2.369   1.719   15.783  1.00 25.43  ? 33   ASN A CB    1 
ATOM   227   C CG    . ASN A 1 33  ? 0.887   1.398   15.954  1.00 28.45  ? 33   ASN A CG    1 
ATOM   228   O OD1   . ASN A 1 33  ? 0.293   1.637   17.020  1.00 30.82  ? 33   ASN A OD1   1 
ATOM   229   N ND2   . ASN A 1 33  ? 0.280   0.848   14.901  1.00 30.47  ? 33   ASN A ND2   1 
ATOM   230   N N     . ASP A 1 34  ? 5.028   3.613   16.196  1.00 23.89  ? 34   ASP A N     1 
ATOM   231   C CA    . ASP A 1 34  ? 6.488   3.704   16.075  1.00 23.18  ? 34   ASP A CA    1 
ATOM   232   C C     . ASP A 1 34  ? 6.966   5.167   15.970  1.00 22.46  ? 34   ASP A C     1 
ATOM   233   O O     . ASP A 1 34  ? 7.451   5.596   14.920  1.00 21.50  ? 34   ASP A O     1 
ATOM   234   C CB    . ASP A 1 34  ? 6.975   2.870   14.886  1.00 23.20  ? 34   ASP A CB    1 
ATOM   235   C CG    . ASP A 1 34  ? 8.492   2.729   14.844  1.00 24.70  ? 34   ASP A CG    1 
ATOM   236   O OD1   . ASP A 1 34  ? 9.183   3.231   15.764  1.00 25.42  ? 34   ASP A OD1   1 
ATOM   237   O OD2   . ASP A 1 34  ? 9.001   2.109   13.879  1.00 25.26  ? 34   ASP A OD2   1 
ATOM   238   N N     . PRO A 1 35  ? 6.856   5.927   17.078  1.00 22.21  ? 35   PRO A N     1 
ATOM   239   C CA    . PRO A 1 35  ? 7.199   7.344   17.066  1.00 22.07  ? 35   PRO A CA    1 
ATOM   240   C C     . PRO A 1 35  ? 8.637   7.607   16.650  1.00 22.21  ? 35   PRO A C     1 
ATOM   241   O O     . PRO A 1 35  ? 8.905   8.625   16.022  1.00 22.20  ? 35   PRO A O     1 
ATOM   242   C CB    . PRO A 1 35  ? 6.979   7.778   18.521  1.00 22.01  ? 35   PRO A CB    1 
ATOM   243   C CG    . PRO A 1 35  ? 6.978   6.523   19.314  1.00 22.57  ? 35   PRO A CG    1 
ATOM   244   C CD    . PRO A 1 35  ? 6.393   5.495   18.410  1.00 22.32  ? 35   PRO A CD    1 
ATOM   245   N N     . ASP A 1 36  ? 9.548   6.696   16.987  1.00 22.14  ? 36   ASP A N     1 
ATOM   246   C CA    . ASP A 1 36  ? 10.962  6.876   16.669  1.00 22.38  ? 36   ASP A CA    1 
ATOM   247   C C     . ASP A 1 36  ? 11.246  6.865   15.173  1.00 22.09  ? 36   ASP A C     1 
ATOM   248   O O     . ASP A 1 36  ? 11.903  7.769   14.677  1.00 22.91  ? 36   ASP A O     1 
ATOM   249   C CB    . ASP A 1 36  ? 11.830  5.846   17.402  1.00 22.93  ? 36   ASP A CB    1 
ATOM   250   C CG    . ASP A 1 36  ? 12.109  6.239   18.846  1.00 23.92  ? 36   ASP A CG    1 
ATOM   251   O OD1   . ASP A 1 36  ? 12.536  5.361   19.628  1.00 26.99  ? 36   ASP A OD1   1 
ATOM   252   O OD2   . ASP A 1 36  ? 11.910  7.419   19.203  1.00 23.99  ? 36   ASP A OD2   1 
ATOM   253   N N     . THR A 1 37  ? 10.764  5.846   14.462  1.00 21.42  ? 37   THR A N     1 
ATOM   254   C CA    . THR A 1 37  ? 10.822  5.838   12.995  1.00 20.87  ? 37   THR A CA    1 
ATOM   255   C C     . THR A 1 37  ? 10.045  7.019   12.397  1.00 20.24  ? 37   THR A C     1 
ATOM   256   O O     . THR A 1 37  ? 10.571  7.734   11.549  1.00 20.04  ? 37   THR A O     1 
ATOM   257   C CB    . THR A 1 37  ? 10.276  4.522   12.384  1.00 20.46  ? 37   THR A CB    1 
ATOM   258   O OG1   . THR A 1 37  ? 10.939  3.396   12.973  1.00 21.39  ? 37   THR A OG1   1 
ATOM   259   C CG2   . THR A 1 37  ? 10.484  4.488   10.877  1.00 20.99  ? 37   THR A CG2   1 
ATOM   260   N N     . PHE A 1 38  ? 8.802   7.222   12.833  1.00 19.56  ? 38   PHE A N     1 
ATOM   261   C CA    . PHE A 1 38  ? 7.999   8.312   12.273  1.00 19.32  ? 38   PHE A CA    1 
ATOM   262   C C     . PHE A 1 38  ? 8.655   9.689   12.421  1.00 19.11  ? 38   PHE A C     1 
ATOM   263   O O     . PHE A 1 38  ? 8.936   10.366  11.419  1.00 19.24  ? 38   PHE A O     1 
ATOM   264   C CB    . PHE A 1 38  ? 6.567   8.351   12.830  1.00 18.89  ? 38   PHE A CB    1 
ATOM   265   C CG    . PHE A 1 38  ? 5.732   9.445   12.216  1.00 18.66  ? 38   PHE A CG    1 
ATOM   266   C CD1   . PHE A 1 38  ? 5.072   9.233   11.006  1.00 19.33  ? 38   PHE A CD1   1 
ATOM   267   C CD2   . PHE A 1 38  ? 5.641   10.699  12.820  1.00 18.32  ? 38   PHE A CD2   1 
ATOM   268   C CE1   . PHE A 1 38  ? 4.313   10.247  10.412  1.00 18.88  ? 38   PHE A CE1   1 
ATOM   269   C CE2   . PHE A 1 38  ? 4.888   11.734  12.230  1.00 19.18  ? 38   PHE A CE2   1 
ATOM   270   C CZ    . PHE A 1 38  ? 4.222   11.502  11.029  1.00 18.98  ? 38   PHE A CZ    1 
ATOM   271   N N     . TRP A 1 39  ? 8.869   10.106  13.665  1.00 18.85  ? 39   TRP A N     1 
ATOM   272   C CA    . TRP A 1 39  ? 9.504   11.398  13.963  1.00 18.91  ? 39   TRP A CA    1 
ATOM   273   C C     . TRP A 1 39  ? 10.993  11.454  13.612  1.00 19.14  ? 39   TRP A C     1 
ATOM   274   O O     . TRP A 1 39  ? 11.528  12.530  13.387  1.00 18.71  ? 39   TRP A O     1 
ATOM   275   C CB    . TRP A 1 39  ? 9.262   11.798  15.420  1.00 18.66  ? 39   TRP A CB    1 
ATOM   276   C CG    . TRP A 1 39  ? 7.834   12.148  15.664  1.00 18.61  ? 39   TRP A CG    1 
ATOM   277   C CD1   . TRP A 1 39  ? 6.931   11.452  16.416  1.00 18.19  ? 39   TRP A CD1   1 
ATOM   278   C CD2   . TRP A 1 39  ? 7.124   13.269  15.112  1.00 17.03  ? 39   TRP A CD2   1 
ATOM   279   N NE1   . TRP A 1 39  ? 5.706   12.086  16.384  1.00 18.25  ? 39   TRP A NE1   1 
ATOM   280   C CE2   . TRP A 1 39  ? 5.799   13.199  15.588  1.00 17.22  ? 39   TRP A CE2   1 
ATOM   281   C CE3   . TRP A 1 39  ? 7.487   14.329  14.268  1.00 16.74  ? 39   TRP A CE3   1 
ATOM   282   C CZ2   . TRP A 1 39  ? 4.833   14.148  15.253  1.00 18.25  ? 39   TRP A CZ2   1 
ATOM   283   C CZ3   . TRP A 1 39  ? 6.534   15.266  13.928  1.00 17.81  ? 39   TRP A CZ3   1 
ATOM   284   C CH2   . TRP A 1 39  ? 5.217   15.171  14.421  1.00 19.08  ? 39   TRP A CH2   1 
ATOM   285   N N     . GLY A 1 40  ? 11.653  10.294  13.554  1.00 20.05  ? 40   GLY A N     1 
ATOM   286   C CA    . GLY A 1 40  ? 13.025  10.209  13.017  1.00 20.33  ? 40   GLY A CA    1 
ATOM   287   C C     . GLY A 1 40  ? 13.098  10.662  11.567  1.00 20.87  ? 40   GLY A C     1 
ATOM   288   O O     . GLY A 1 40  ? 13.987  11.426  11.181  1.00 21.10  ? 40   GLY A O     1 
ATOM   289   N N     . GLU A 1 41  ? 12.149  10.207  10.753  1.00 21.12  ? 41   GLU A N     1 
ATOM   290   C CA    . GLU A 1 41  ? 12.103  10.616  9.347   1.00 21.47  ? 41   GLU A CA    1 
ATOM   291   C C     . GLU A 1 41  ? 11.567  12.040  9.212   1.00 20.77  ? 41   GLU A C     1 
ATOM   292   O O     . GLU A 1 41  ? 12.147  12.875  8.505   1.00 20.53  ? 41   GLU A O     1 
ATOM   293   C CB    . GLU A 1 41  ? 11.274  9.629   8.514   1.00 21.45  ? 41   GLU A CB    1 
ATOM   294   C CG    . GLU A 1 41  ? 11.965  8.274   8.251   1.00 22.91  ? 41   GLU A CG    1 
ATOM   295   C CD    . GLU A 1 41  ? 11.026  7.221   7.646   1.00 23.76  ? 41   GLU A CD    1 
ATOM   296   O OE1   . GLU A 1 41  ? 11.428  6.040   7.527   1.00 27.99  ? 41   GLU A OE1   1 
ATOM   297   O OE2   . GLU A 1 41  ? 9.879   7.566   7.297   1.00 27.78  ? 41   GLU A OE2   1 
ATOM   298   N N     . GLN A 1 42  ? 10.478  12.329  9.918   1.00 20.65  ? 42   GLN A N     1 
ATOM   299   C CA    . GLN A 1 42  ? 9.856   13.652  9.848   1.00 20.55  ? 42   GLN A CA    1 
ATOM   300   C C     . GLN A 1 42  ? 10.760  14.800  10.329  1.00 20.33  ? 42   GLN A C     1 
ATOM   301   O O     . GLN A 1 42  ? 10.661  15.920  9.802   1.00 20.56  ? 42   GLN A O     1 
ATOM   302   C CB    . GLN A 1 42  ? 8.491   13.678  10.559  1.00 20.67  ? 42   GLN A CB    1 
ATOM   303   C CG    . GLN A 1 42  ? 7.649   14.942  10.265  1.00 21.33  ? 42   GLN A CG    1 
ATOM   304   C CD    . GLN A 1 42  ? 7.561   15.292  8.766   1.00 23.13  ? 42   GLN A CD    1 
ATOM   305   O OE1   . GLN A 1 42  ? 7.756   16.446  8.368   1.00 24.97  ? 42   GLN A OE1   1 
ATOM   306   N NE2   . GLN A 1 42  ? 7.273   14.299  7.943   1.00 23.05  ? 42   GLN A NE2   1 
ATOM   307   N N     . GLY A 1 43  ? 11.638  14.523  11.297  1.00 19.70  ? 43   GLY A N     1 
ATOM   308   C CA    . GLY A 1 43  ? 12.609  15.510  11.792  1.00 19.82  ? 43   GLY A CA    1 
ATOM   309   C C     . GLY A 1 43  ? 13.537  16.078  10.716  1.00 20.40  ? 43   GLY A C     1 
ATOM   310   O O     . GLY A 1 43  ? 14.132  17.139  10.900  1.00 20.29  ? 43   GLY A O     1 
ATOM   311   N N     . LYS A 1 44  ? 13.637  15.382  9.580   1.00 20.43  ? 44   LYS A N     1 
ATOM   312   C CA    . LYS A 1 44  ? 14.458  15.827  8.452   1.00 20.59  ? 44   LYS A CA    1 
ATOM   313   C C     . LYS A 1 44  ? 13.833  17.003  7.673   1.00 20.32  ? 44   LYS A C     1 
ATOM   314   O O     . LYS A 1 44  ? 14.406  17.485  6.691   1.00 19.61  ? 44   LYS A O     1 
ATOM   315   C CB    . LYS A 1 44  ? 14.778  14.644  7.513   1.00 21.51  ? 44   LYS A CB    1 
ATOM   316   C CG    . LYS A 1 44  ? 15.528  13.459  8.174   1.00 21.79  ? 44   LYS A CG    1 
ATOM   317   C CD    . LYS A 1 44  ? 16.963  13.829  8.594   1.00 25.11  ? 44   LYS A CD    1 
ATOM   318   C CE    . LYS A 1 44  ? 17.681  12.698  9.368   1.00 25.50  ? 44   LYS A CE    1 
ATOM   319   N NZ    . LYS A 1 44  ? 17.923  11.456  8.553   1.00 27.67  ? 44   LYS A NZ    1 
ATOM   320   N N     . ILE A 1 45  ? 12.667  17.476  8.122   1.00 20.18  ? 45   ILE A N     1 
ATOM   321   C CA    . ILE A 1 45  ? 12.093  18.722  7.592   1.00 19.40  ? 45   ILE A CA    1 
ATOM   322   C C     . ILE A 1 45  ? 13.021  19.911  7.917   1.00 19.49  ? 45   ILE A C     1 
ATOM   323   O O     . ILE A 1 45  ? 13.013  20.929  7.221   1.00 19.51  ? 45   ILE A O     1 
ATOM   324   C CB    . ILE A 1 45  ? 10.630  18.956  8.086   1.00 19.61  ? 45   ILE A CB    1 
ATOM   325   C CG1   . ILE A 1 45  ? 9.927   20.044  7.240   1.00 19.64  ? 45   ILE A CG1   1 
ATOM   326   C CG2   . ILE A 1 45  ? 10.593  19.240  9.601   1.00 18.49  ? 45   ILE A CG2   1 
ATOM   327   C CD1   . ILE A 1 45  ? 8.414   20.148  7.447   1.00 19.02  ? 45   ILE A CD1   1 
ATOM   328   N N     . LEU A 1 46  ? 13.840  19.748  8.956   1.00 19.31  ? 46   LEU A N     1 
ATOM   329   C CA    . LEU A 1 46  ? 14.853  20.736  9.332   1.00 19.61  ? 46   LEU A CA    1 
ATOM   330   C C     . LEU A 1 46  ? 16.262  20.299  8.958   1.00 19.60  ? 46   LEU A C     1 
ATOM   331   O O     . LEU A 1 46  ? 16.541  19.100  8.845   1.00 19.28  ? 46   LEU A O     1 
ATOM   332   C CB    . LEU A 1 46  ? 14.814  20.996  10.844  1.00 19.25  ? 46   LEU A CB    1 
ATOM   333   C CG    . LEU A 1 46  ? 13.507  21.370  11.540  1.00 19.83  ? 46   LEU A CG    1 
ATOM   334   C CD1   . LEU A 1 46  ? 13.788  21.662  13.026  1.00 18.62  ? 46   LEU A CD1   1 
ATOM   335   C CD2   . LEU A 1 46  ? 12.834  22.562  10.856  1.00 17.71  ? 46   LEU A CD2   1 
ATOM   336   N N     . ASP A 1 47  ? 17.147  21.283  8.775   1.00 20.14  ? 47   ASP A N     1 
ATOM   337   C CA    . ASP A 1 47  ? 18.584  21.034  8.653   1.00 20.64  ? 47   ASP A CA    1 
ATOM   338   C C     . ASP A 1 47  ? 19.156  20.917  10.055  1.00 20.54  ? 47   ASP A C     1 
ATOM   339   O O     . ASP A 1 47  ? 18.857  21.745  10.925  1.00 20.77  ? 47   ASP A O     1 
ATOM   340   C CB    . ASP A 1 47  ? 19.305  22.198  7.954   1.00 21.06  ? 47   ASP A CB    1 
ATOM   341   C CG    . ASP A 1 47  ? 18.990  22.309  6.469   1.00 22.53  ? 47   ASP A CG    1 
ATOM   342   O OD1   . ASP A 1 47  ? 19.570  23.217  5.837   1.00 25.04  ? 47   ASP A OD1   1 
ATOM   343   O OD2   . ASP A 1 47  ? 18.182  21.520  5.929   1.00 23.52  ? 47   ASP A OD2   1 
ATOM   344   N N     . TRP A 1 48  ? 19.983  19.899  10.261  1.00 20.52  ? 48   TRP A N     1 
ATOM   345   C CA    . TRP A 1 48  ? 20.642  19.657  11.535  1.00 20.60  ? 48   TRP A CA    1 
ATOM   346   C C     . TRP A 1 48  ? 22.158  19.819  11.357  1.00 21.41  ? 48   TRP A C     1 
ATOM   347   O O     . TRP A 1 48  ? 22.716  19.360  10.354  1.00 21.27  ? 48   TRP A O     1 
ATOM   348   C CB    . TRP A 1 48  ? 20.283  18.252  12.051  1.00 20.28  ? 48   TRP A CB    1 
ATOM   349   C CG    . TRP A 1 48  ? 18.831  18.134  12.435  1.00 19.38  ? 48   TRP A CG    1 
ATOM   350   C CD1   . TRP A 1 48  ? 17.784  17.932  11.595  1.00 19.79  ? 48   TRP A CD1   1 
ATOM   351   C CD2   . TRP A 1 48  ? 18.271  18.257  13.754  1.00 19.32  ? 48   TRP A CD2   1 
ATOM   352   N NE1   . TRP A 1 48  ? 16.598  17.918  12.302  1.00 20.13  ? 48   TRP A NE1   1 
ATOM   353   C CE2   . TRP A 1 48  ? 16.871  18.113  13.629  1.00 19.49  ? 48   TRP A CE2   1 
ATOM   354   C CE3   . TRP A 1 48  ? 18.819  18.460  15.030  1.00 18.15  ? 48   TRP A CE3   1 
ATOM   355   C CZ2   . TRP A 1 48  ? 16.002  18.168  14.735  1.00 19.52  ? 48   TRP A CZ2   1 
ATOM   356   C CZ3   . TRP A 1 48  ? 17.951  18.518  16.128  1.00 18.91  ? 48   TRP A CZ3   1 
ATOM   357   C CH2   . TRP A 1 48  ? 16.562  18.372  15.969  1.00 18.95  ? 48   TRP A CH2   1 
ATOM   358   N N     . ILE A 1 49  ? 22.814  20.482  12.313  1.00 21.56  ? 49   ILE A N     1 
ATOM   359   C CA    . ILE A 1 49  ? 24.269  20.646  12.275  1.00 21.83  ? 49   ILE A CA    1 
ATOM   360   C C     . ILE A 1 49  ? 24.975  19.338  12.668  1.00 22.44  ? 49   ILE A C     1 
ATOM   361   O O     . ILE A 1 49  ? 25.788  18.817  11.903  1.00 22.66  ? 49   ILE A O     1 
ATOM   362   C CB    . ILE A 1 49  ? 24.741  21.860  13.114  1.00 21.95  ? 49   ILE A CB    1 
ATOM   363   C CG1   . ILE A 1 49  ? 24.206  23.153  12.490  1.00 20.64  ? 49   ILE A CG1   1 
ATOM   364   C CG2   . ILE A 1 49  ? 26.290  21.902  13.202  1.00 21.29  ? 49   ILE A CG2   1 
ATOM   365   C CD1   . ILE A 1 49  ? 24.081  24.341  13.450  1.00 19.50  ? 49   ILE A CD1   1 
ATOM   366   N N     . THR A 1 50  ? 24.663  18.801  13.847  1.00 22.96  ? 50   THR A N     1 
ATOM   367   C CA    . THR A 1 50  ? 24.972  17.394  14.124  1.00 23.20  ? 50   THR A CA    1 
ATOM   368   C C     . THR A 1 50  ? 23.664  16.607  14.206  1.00 22.87  ? 50   THR A C     1 
ATOM   369   O O     . THR A 1 50  ? 22.757  16.985  14.957  1.00 22.62  ? 50   THR A O     1 
ATOM   370   C CB    . THR A 1 50  ? 25.870  17.165  15.379  1.00 23.67  ? 50   THR A CB    1 
ATOM   371   O OG1   . THR A 1 50  ? 25.069  17.007  16.553  1.00 25.82  ? 50   THR A OG1   1 
ATOM   372   C CG2   . THR A 1 50  ? 26.851  18.301  15.583  1.00 23.65  ? 50   THR A CG2   1 
ATOM   373   N N     . PRO A 1 51  ? 23.546  15.526  13.407  1.00 22.79  ? 51   PRO A N     1 
ATOM   374   C CA    . PRO A 1 51  ? 22.303  14.751  13.342  1.00 22.46  ? 51   PRO A CA    1 
ATOM   375   C C     . PRO A 1 51  ? 21.950  14.122  14.689  1.00 21.91  ? 51   PRO A C     1 
ATOM   376   O O     . PRO A 1 51  ? 22.848  13.797  15.467  1.00 22.27  ? 51   PRO A O     1 
ATOM   377   C CB    . PRO A 1 51  ? 22.625  13.661  12.303  1.00 22.38  ? 51   PRO A CB    1 
ATOM   378   C CG    . PRO A 1 51  ? 24.131  13.540  12.346  1.00 22.92  ? 51   PRO A CG    1 
ATOM   379   C CD    . PRO A 1 51  ? 24.584  14.958  12.525  1.00 22.94  ? 51   PRO A CD    1 
ATOM   380   N N     . TYR A 1 52  ? 20.655  13.996  14.973  1.00 21.40  ? 52   TYR A N     1 
ATOM   381   C CA    . TYR A 1 52  ? 20.191  13.253  16.146  1.00 21.40  ? 52   TYR A CA    1 
ATOM   382   C C     . TYR A 1 52  ? 20.264  11.753  15.884  1.00 21.75  ? 52   TYR A C     1 
ATOM   383   O O     . TYR A 1 52  ? 20.262  11.303  14.736  1.00 21.73  ? 52   TYR A O     1 
ATOM   384   C CB    . TYR A 1 52  ? 18.757  13.647  16.547  1.00 20.41  ? 52   TYR A CB    1 
ATOM   385   C CG    . TYR A 1 52  ? 17.778  13.599  15.400  1.00 19.68  ? 52   TYR A CG    1 
ATOM   386   C CD1   . TYR A 1 52  ? 17.215  12.392  14.973  1.00 17.81  ? 52   TYR A CD1   1 
ATOM   387   C CD2   . TYR A 1 52  ? 17.425  14.769  14.722  1.00 18.83  ? 52   TYR A CD2   1 
ATOM   388   C CE1   . TYR A 1 52  ? 16.329  12.359  13.889  1.00 17.78  ? 52   TYR A CE1   1 
ATOM   389   C CE2   . TYR A 1 52  ? 16.536  14.745  13.671  1.00 18.25  ? 52   TYR A CE2   1 
ATOM   390   C CZ    . TYR A 1 52  ? 16.001  13.545  13.257  1.00 18.52  ? 52   TYR A CZ    1 
ATOM   391   O OH    . TYR A 1 52  ? 15.140  13.560  12.199  1.00 19.60  ? 52   TYR A OH    1 
ATOM   392   N N     . GLN A 1 53  ? 20.346  10.987  16.963  1.00 22.59  ? 53   GLN A N     1 
ATOM   393   C CA    . GLN A 1 53  ? 20.251  9.542   16.890  1.00 23.24  ? 53   GLN A CA    1 
ATOM   394   C C     . GLN A 1 53  ? 19.023  9.138   17.693  1.00 23.14  ? 53   GLN A C     1 
ATOM   395   O O     . GLN A 1 53  ? 18.181  8.381   17.211  1.00 23.66  ? 53   GLN A O     1 
ATOM   396   C CB    . GLN A 1 53  ? 21.528  8.885   17.424  1.00 23.70  ? 53   GLN A CB    1 
ATOM   397   C CG    . GLN A 1 53  ? 22.761  9.190   16.571  1.00 26.61  ? 53   GLN A CG    1 
ATOM   398   C CD    . GLN A 1 53  ? 24.066  8.837   17.259  1.00 30.18  ? 53   GLN A CD    1 
ATOM   399   O OE1   . GLN A 1 53  ? 24.750  9.713   17.801  1.00 31.63  ? 53   GLN A OE1   1 
ATOM   400   N NE2   . GLN A 1 53  ? 24.423  7.548   17.243  1.00 30.80  ? 53   GLN A NE2   1 
ATOM   401   N N     . LYS A 1 54  ? 18.929  9.663   18.912  1.00 22.67  ? 54   LYS A N     1 
ATOM   402   C CA    . LYS A 1 54  ? 17.756  9.499   19.758  1.00 22.46  ? 54   LYS A CA    1 
ATOM   403   C C     . LYS A 1 54  ? 16.632  10.365  19.210  1.00 21.95  ? 54   LYS A C     1 
ATOM   404   O O     . LYS A 1 54  ? 16.869  11.467  18.705  1.00 21.90  ? 54   LYS A O     1 
ATOM   405   C CB    . LYS A 1 54  ? 18.077  9.923   21.200  1.00 22.51  ? 54   LYS A CB    1 
ATOM   406   C CG    . LYS A 1 54  ? 19.214  9.137   21.855  1.00 23.30  ? 54   LYS A CG    1 
ATOM   407   C CD    . LYS A 1 54  ? 19.519  9.653   23.256  1.00 23.35  ? 54   LYS A CD    1 
ATOM   408   C CE    . LYS A 1 54  ? 20.719  8.932   23.871  1.00 24.32  ? 54   LYS A CE    1 
ATOM   409   N N     . VAL A 1 55  ? 15.409  9.867   19.295  1.00 21.61  ? 55   VAL A N     1 
ATOM   410   C CA    . VAL A 1 55  ? 14.255  10.645  18.870  1.00 21.34  ? 55   VAL A CA    1 
ATOM   411   C C     . VAL A 1 55  ? 13.352  10.905  20.090  1.00 21.24  ? 55   VAL A C     1 
ATOM   412   O O     . VAL A 1 55  ? 13.432  11.980  20.699  1.00 20.22  ? 55   VAL A O     1 
ATOM   413   C CB    . VAL A 1 55  ? 13.494  9.974   17.680  1.00 21.65  ? 55   VAL A CB    1 
ATOM   414   C CG1   . VAL A 1 55  ? 12.213  10.728  17.363  1.00 21.55  ? 55   VAL A CG1   1 
ATOM   415   C CG2   . VAL A 1 55  ? 14.384  9.906   16.436  1.00 21.27  ? 55   VAL A CG2   1 
ATOM   416   N N     . LYS A 1 56  ? 12.519  9.921   20.450  1.00 20.94  ? 56   LYS A N     1 
ATOM   417   C CA    . LYS A 1 56  ? 11.583  10.078  21.563  1.00 20.79  ? 56   LYS A CA    1 
ATOM   418   C C     . LYS A 1 56  ? 12.172  9.601   22.882  1.00 20.44  ? 56   LYS A C     1 
ATOM   419   O O     . LYS A 1 56  ? 12.581  8.443   23.008  1.00 20.23  ? 56   LYS A O     1 
ATOM   420   C CB    . LYS A 1 56  ? 10.264  9.352   21.284  1.00 21.19  ? 56   LYS A CB    1 
ATOM   421   C CG    . LYS A 1 56  ? 9.184   9.620   22.334  1.00 21.61  ? 56   LYS A CG    1 
ATOM   422   C CD    . LYS A 1 56  ? 7.878   8.902   21.993  1.00 21.20  ? 56   LYS A CD    1 
ATOM   423   C CE    . LYS A 1 56  ? 6.750   9.309   22.938  1.00 20.82  ? 56   LYS A CE    1 
ATOM   424   N NZ    . LYS A 1 56  ? 6.874   8.686   24.274  1.00 20.03  ? 56   LYS A NZ    1 
ATOM   425   N N     . ASN A 1 57  ? 12.208  10.498  23.866  1.00 20.32  ? 57   ASN A N     1 
ATOM   426   C CA    . ASN A 1 57  ? 12.649  10.142  25.217  1.00 20.73  ? 57   ASN A CA    1 
ATOM   427   C C     . ASN A 1 57  ? 11.838  10.894  26.271  1.00 20.68  ? 57   ASN A C     1 
ATOM   428   O O     . ASN A 1 57  ? 12.288  11.907  26.823  1.00 20.87  ? 57   ASN A O     1 
ATOM   429   C CB    . ASN A 1 57  ? 14.146  10.417  25.378  1.00 20.91  ? 57   ASN A CB    1 
ATOM   430   C CG    . ASN A 1 57  ? 14.687  9.984   26.736  1.00 22.66  ? 57   ASN A CG    1 
ATOM   431   O OD1   . ASN A 1 57  ? 14.012  9.282   27.498  1.00 23.10  ? 57   ASN A OD1   1 
ATOM   432   N ND2   . ASN A 1 57  ? 15.915  10.401  27.041  1.00 21.94  ? 57   ASN A ND2   1 
ATOM   433   N N     . THR A 1 58  ? 10.632  10.400  26.547  1.00 20.26  ? 58   THR A N     1 
ATOM   434   C CA    . THR A 1 58  ? 9.674   11.166  27.350  1.00 19.79  ? 58   THR A CA    1 
ATOM   435   C C     . THR A 1 58  ? 8.996   10.340  28.438  1.00 20.11  ? 58   THR A C     1 
ATOM   436   O O     . THR A 1 58  ? 8.861   9.119   28.315  1.00 20.15  ? 58   THR A O     1 
ATOM   437   C CB    . THR A 1 58  ? 8.581   11.821  26.470  1.00 19.18  ? 58   THR A CB    1 
ATOM   438   O OG1   . THR A 1 58  ? 7.774   10.804  25.866  1.00 19.10  ? 58   THR A OG1   1 
ATOM   439   C CG2   . THR A 1 58  ? 9.200   12.692  25.373  1.00 18.67  ? 58   THR A CG2   1 
ATOM   440   N N     . SER A 1 59  ? 8.570   11.026  29.498  1.00 19.98  ? 59   SER A N     1 
ATOM   441   C CA    . SER A 1 59  ? 7.813   10.416  30.584  1.00 20.40  ? 59   SER A CA    1 
ATOM   442   C C     . SER A 1 59  ? 6.851   11.421  31.212  1.00 20.12  ? 59   SER A C     1 
ATOM   443   O O     . SER A 1 59  ? 7.215   12.581  31.457  1.00 20.04  ? 59   SER A O     1 
ATOM   444   C CB    . SER A 1 59  ? 8.762   9.863   31.657  1.00 20.60  ? 59   SER A CB    1 
ATOM   445   O OG    . SER A 1 59  ? 8.038   9.231   32.698  1.00 21.79  ? 59   SER A OG    1 
ATOM   446   N N     . PHE A 1 60  ? 5.634   10.964  31.481  1.00 19.91  ? 60   PHE A N     1 
ATOM   447   C CA    . PHE A 1 60  ? 4.653   11.744  32.236  1.00 20.23  ? 60   PHE A CA    1 
ATOM   448   C C     . PHE A 1 60  ? 4.497   11.236  33.672  1.00 20.56  ? 60   PHE A C     1 
ATOM   449   O O     . PHE A 1 60  ? 3.529   11.595  34.355  1.00 20.56  ? 60   PHE A O     1 
ATOM   450   C CB    . PHE A 1 60  ? 3.276   11.713  31.546  1.00 19.77  ? 60   PHE A CB    1 
ATOM   451   C CG    . PHE A 1 60  ? 3.198   12.488  30.249  1.00 19.31  ? 60   PHE A CG    1 
ATOM   452   C CD1   . PHE A 1 60  ? 2.060   12.371  29.441  1.00 17.92  ? 60   PHE A CD1   1 
ATOM   453   C CD2   . PHE A 1 60  ? 4.239   13.320  29.826  1.00 18.43  ? 60   PHE A CD2   1 
ATOM   454   C CE1   . PHE A 1 60  ? 1.946   13.071  28.253  1.00 18.27  ? 60   PHE A CE1   1 
ATOM   455   C CE2   . PHE A 1 60  ? 4.145   14.024  28.622  1.00 17.59  ? 60   PHE A CE2   1 
ATOM   456   C CZ    . PHE A 1 60  ? 2.991   13.902  27.833  1.00 18.91  ? 60   PHE A CZ    1 
ATOM   457   N N     . ALA A 1 61  ? 5.424   10.391  34.132  1.00 21.26  ? 61   ALA A N     1 
ATOM   458   C CA    . ALA A 1 61  ? 5.270   9.722   35.431  1.00 22.04  ? 61   ALA A CA    1 
ATOM   459   C C     . ALA A 1 61  ? 5.327   10.692  36.615  1.00 22.82  ? 61   ALA A C     1 
ATOM   460   O O     . ALA A 1 61  ? 6.100   11.657  36.582  1.00 22.73  ? 61   ALA A O     1 
ATOM   461   C CB    . ALA A 1 61  ? 6.306   8.586   35.603  1.00 21.64  ? 61   ALA A CB    1 
ATOM   462   N N     . PRO A 1 62  ? 4.501   10.448  37.661  1.00 23.55  ? 62   PRO A N     1 
ATOM   463   C CA    . PRO A 1 62  ? 4.596   11.228  38.900  1.00 24.21  ? 62   PRO A CA    1 
ATOM   464   C C     . PRO A 1 62  ? 6.035   11.333  39.378  1.00 24.72  ? 62   PRO A C     1 
ATOM   465   O O     . PRO A 1 62  ? 6.731   10.318  39.456  1.00 24.88  ? 62   PRO A O     1 
ATOM   466   C CB    . PRO A 1 62  ? 3.774   10.408  39.894  1.00 24.12  ? 62   PRO A CB    1 
ATOM   467   C CG    . PRO A 1 62  ? 2.731   9.763   39.041  1.00 23.92  ? 62   PRO A CG    1 
ATOM   468   C CD    . PRO A 1 62  ? 3.422   9.443   37.735  1.00 23.55  ? 62   PRO A CD    1 
ATOM   469   N N     . GLY A 1 63  ? 6.472   12.562  39.660  1.00 25.34  ? 63   GLY A N     1 
ATOM   470   C CA    . GLY A 1 63  ? 7.831   12.837  40.131  1.00 25.83  ? 63   GLY A CA    1 
ATOM   471   C C     . GLY A 1 63  ? 8.918   12.690  39.080  1.00 26.18  ? 63   GLY A C     1 
ATOM   472   O O     . GLY A 1 63  ? 10.098  12.931  39.355  1.00 26.57  ? 63   GLY A O     1 
ATOM   473   N N     . ASN A 1 64  ? 8.532   12.289  37.874  1.00 26.11  ? 64   ASN A N     1 
ATOM   474   C CA    . ASN A 1 64  ? 9.498   12.055  36.806  1.00 26.21  ? 64   ASN A CA    1 
ATOM   475   C C     . ASN A 1 64  ? 9.003   12.552  35.456  1.00 25.10  ? 64   ASN A C     1 
ATOM   476   O O     . ASN A 1 64  ? 9.161   11.876  34.441  1.00 25.39  ? 64   ASN A O     1 
ATOM   477   C CB    . ASN A 1 64  ? 9.847   10.569  36.718  1.00 26.90  ? 64   ASN A CB    1 
ATOM   478   C CG    . ASN A 1 64  ? 10.661  10.090  37.903  1.00 29.75  ? 64   ASN A CG    1 
ATOM   479   O OD1   . ASN A 1 64  ? 11.886  10.256  37.939  1.00 32.42  ? 64   ASN A OD1   1 
ATOM   480   N ND2   . ASN A 1 64  ? 9.987   9.475   38.880  1.00 32.28  ? 64   ASN A ND2   1 
ATOM   481   N N     . VAL A 1 65  ? 8.391   13.729  35.444  1.00 23.81  ? 65   VAL A N     1 
ATOM   482   C CA    . VAL A 1 65  ? 7.966   14.331  34.187  1.00 22.31  ? 65   VAL A CA    1 
ATOM   483   C C     . VAL A 1 65  ? 9.210   14.828  33.444  1.00 22.11  ? 65   VAL A C     1 
ATOM   484   O O     . VAL A 1 65  ? 9.915   15.724  33.916  1.00 21.88  ? 65   VAL A O     1 
ATOM   485   C CB    . VAL A 1 65  ? 6.931   15.448  34.413  1.00 22.34  ? 65   VAL A CB    1 
ATOM   486   C CG1   . VAL A 1 65  ? 6.598   16.160  33.095  1.00 20.84  ? 65   VAL A CG1   1 
ATOM   487   C CG2   . VAL A 1 65  ? 5.673   14.877  35.076  1.00 21.80  ? 65   VAL A CG2   1 
ATOM   488   N N     . SER A 1 66  ? 9.490   14.221  32.295  1.00 21.76  ? 66   SER A N     1 
ATOM   489   C CA    . SER A 1 66  ? 10.704  14.528  31.554  1.00 21.77  ? 66   SER A CA    1 
ATOM   490   C C     . SER A 1 66  ? 10.456  14.389  30.056  1.00 21.48  ? 66   SER A C     1 
ATOM   491   O O     . SER A 1 66  ? 10.152  13.307  29.567  1.00 21.26  ? 66   SER A O     1 
ATOM   492   C CB    . SER A 1 66  ? 11.853  13.621  32.025  1.00 22.18  ? 66   SER A CB    1 
ATOM   493   O OG    . SER A 1 66  ? 13.039  13.885  31.300  1.00 23.05  ? 66   SER A OG    1 
ATOM   494   N N     . ILE A 1 67  ? 10.568  15.502  29.333  1.00 21.17  ? 67   ILE A N     1 
ATOM   495   C CA    . ILE A 1 67  ? 10.216  15.535  27.918  1.00 20.82  ? 67   ILE A CA    1 
ATOM   496   C C     . ILE A 1 67  ? 11.444  15.926  27.085  1.00 20.86  ? 67   ILE A C     1 
ATOM   497   O O     . ILE A 1 67  ? 11.944  17.049  27.177  1.00 20.72  ? 67   ILE A O     1 
ATOM   498   C CB    . ILE A 1 67  ? 9.016   16.499  27.657  1.00 21.15  ? 67   ILE A CB    1 
ATOM   499   C CG1   . ILE A 1 67  ? 7.796   16.089  28.500  1.00 20.44  ? 67   ILE A CG1   1 
ATOM   500   C CG2   . ILE A 1 67  ? 8.655   16.529  26.169  1.00 19.93  ? 67   ILE A CG2   1 
ATOM   501   C CD1   . ILE A 1 67  ? 6.935   17.249  28.962  1.00 21.59  ? 67   ILE A CD1   1 
ATOM   502   N N     . LYS A 1 68  ? 11.932  14.987  26.282  1.00 20.37  ? 68   LYS A N     1 
ATOM   503   C CA    . LYS A 1 68  ? 13.095  15.230  25.429  1.00 20.37  ? 68   LYS A CA    1 
ATOM   504   C C     . LYS A 1 68  ? 12.872  14.623  24.062  1.00 20.00  ? 68   LYS A C     1 
ATOM   505   O O     . LYS A 1 68  ? 12.486  13.454  23.954  1.00 20.54  ? 68   LYS A O     1 
ATOM   506   C CB    . LYS A 1 68  ? 14.374  14.644  26.052  1.00 19.99  ? 68   LYS A CB    1 
ATOM   507   C CG    . LYS A 1 68  ? 14.874  15.366  27.293  1.00 20.39  ? 68   LYS A CG    1 
ATOM   508   C CD    . LYS A 1 68  ? 16.209  14.800  27.770  1.00 21.53  ? 68   LYS A CD    1 
ATOM   509   C CE    . LYS A 1 68  ? 16.552  15.299  29.184  1.00 24.13  ? 68   LYS A CE    1 
ATOM   510   N NZ    . LYS A 1 68  ? 17.938  14.888  29.578  1.00 26.33  ? 68   LYS A NZ    1 
ATOM   511   N N     . TRP A 1 69  ? 13.117  15.421  23.025  1.00 19.47  ? 69   TRP A N     1 
ATOM   512   C CA    . TRP A 1 69  ? 13.024  14.975  21.639  1.00 18.64  ? 69   TRP A CA    1 
ATOM   513   C C     . TRP A 1 69  ? 14.282  15.369  20.872  1.00 18.98  ? 69   TRP A C     1 
ATOM   514   O O     . TRP A 1 69  ? 14.787  16.497  21.025  1.00 18.91  ? 69   TRP A O     1 
ATOM   515   C CB    . TRP A 1 69  ? 11.798  15.589  20.952  1.00 18.54  ? 69   TRP A CB    1 
ATOM   516   C CG    . TRP A 1 69  ? 10.484  15.003  21.385  1.00 17.83  ? 69   TRP A CG    1 
ATOM   517   C CD1   . TRP A 1 69  ? 9.750   15.358  22.477  1.00 17.61  ? 69   TRP A CD1   1 
ATOM   518   C CD2   . TRP A 1 69  ? 9.737   13.964  20.717  1.00 17.98  ? 69   TRP A CD2   1 
ATOM   519   N NE1   . TRP A 1 69  ? 8.597   14.605  22.538  1.00 17.34  ? 69   TRP A NE1   1 
ATOM   520   C CE2   . TRP A 1 69  ? 8.566   13.741  21.472  1.00 17.10  ? 69   TRP A CE2   1 
ATOM   521   C CE3   . TRP A 1 69  ? 9.951   13.204  19.554  1.00 17.80  ? 69   TRP A CE3   1 
ATOM   522   C CZ2   . TRP A 1 69  ? 7.596   12.787  21.101  1.00 17.14  ? 69   TRP A CZ2   1 
ATOM   523   C CZ3   . TRP A 1 69  ? 8.994   12.241  19.190  1.00 17.73  ? 69   TRP A CZ3   1 
ATOM   524   C CH2   . TRP A 1 69  ? 7.826   12.052  19.960  1.00 17.11  ? 69   TRP A CH2   1 
ATOM   525   N N     . TYR A 1 70  ? 14.791  14.438  20.056  1.00 18.58  ? 70   TYR A N     1 
ATOM   526   C CA    . TYR A 1 70  ? 15.963  14.678  19.225  1.00 18.09  ? 70   TYR A CA    1 
ATOM   527   C C     . TYR A 1 70  ? 17.157  15.164  20.042  1.00 18.10  ? 70   TYR A C     1 
ATOM   528   O O     . TYR A 1 70  ? 17.945  15.979  19.565  1.00 17.69  ? 70   TYR A O     1 
ATOM   529   C CB    . TYR A 1 70  ? 15.629  15.740  18.170  1.00 17.98  ? 70   TYR A CB    1 
ATOM   530   C CG    . TYR A 1 70  ? 14.429  15.442  17.298  1.00 18.27  ? 70   TYR A CG    1 
ATOM   531   C CD1   . TYR A 1 70  ? 13.307  16.279  17.316  1.00 16.93  ? 70   TYR A CD1   1 
ATOM   532   C CD2   . TYR A 1 70  ? 14.419  14.335  16.444  1.00 17.50  ? 70   TYR A CD2   1 
ATOM   533   C CE1   . TYR A 1 70  ? 12.203  16.023  16.501  1.00 17.58  ? 70   TYR A CE1   1 
ATOM   534   C CE2   . TYR A 1 70  ? 13.321  14.069  15.626  1.00 18.42  ? 70   TYR A CE2   1 
ATOM   535   C CZ    . TYR A 1 70  ? 12.220  14.915  15.660  1.00 18.04  ? 70   TYR A CZ    1 
ATOM   536   O OH    . TYR A 1 70  ? 11.139  14.650  14.851  1.00 18.38  ? 70   TYR A OH    1 
ATOM   537   N N     . GLU A 1 71  ? 17.297  14.656  21.264  1.00 18.52  ? 71   GLU A N     1 
ATOM   538   C CA    . GLU A 1 71  ? 18.116  15.329  22.282  1.00 19.17  ? 71   GLU A CA    1 
ATOM   539   C C     . GLU A 1 71  ? 19.616  15.441  21.988  1.00 19.10  ? 71   GLU A C     1 
ATOM   540   O O     . GLU A 1 71  ? 20.278  16.351  22.503  1.00 18.82  ? 71   GLU A O     1 
ATOM   541   C CB    . GLU A 1 71  ? 17.878  14.716  23.670  1.00 19.44  ? 71   GLU A CB    1 
ATOM   542   C CG    . GLU A 1 71  ? 18.584  13.398  23.887  1.00 21.41  ? 71   GLU A CG    1 
ATOM   543   C CD    . GLU A 1 71  ? 18.108  12.681  25.132  1.00 25.25  ? 71   GLU A CD    1 
ATOM   544   O OE1   . GLU A 1 71  ? 16.966  12.167  25.118  1.00 24.18  ? 71   GLU A OE1   1 
ATOM   545   O OE2   . GLU A 1 71  ? 18.888  12.615  26.113  1.00 26.48  ? 71   GLU A OE2   1 
ATOM   546   N N     . ASP A 1 72  ? 20.150  14.524  21.185  1.00 19.33  ? 72   ASP A N     1 
ATOM   547   C CA    . ASP A 1 72  ? 21.583  14.542  20.874  1.00 19.95  ? 72   ASP A CA    1 
ATOM   548   C C     . ASP A 1 72  ? 21.912  15.266  19.562  1.00 19.83  ? 72   ASP A C     1 
ATOM   549   O O     . ASP A 1 72  ? 23.063  15.262  19.115  1.00 20.27  ? 72   ASP A O     1 
ATOM   550   C CB    . ASP A 1 72  ? 22.178  13.125  20.896  1.00 20.20  ? 72   ASP A CB    1 
ATOM   551   C CG    . ASP A 1 72  ? 21.392  12.128  20.045  1.00 21.70  ? 72   ASP A CG    1 
ATOM   552   O OD1   . ASP A 1 72  ? 20.365  12.490  19.431  1.00 23.63  ? 72   ASP A OD1   1 
ATOM   553   O OD2   . ASP A 1 72  ? 21.817  10.960  19.988  1.00 24.02  ? 72   ASP A OD2   1 
ATOM   554   N N     . GLY A 1 73  ? 20.897  15.882  18.960  1.00 19.37  ? 73   GLY A N     1 
ATOM   555   C CA    . GLY A 1 73  ? 21.056  16.639  17.723  1.00 18.74  ? 73   GLY A CA    1 
ATOM   556   C C     . GLY A 1 73  ? 21.312  18.110  18.004  1.00 18.73  ? 73   GLY A C     1 
ATOM   557   O O     . GLY A 1 73  ? 20.947  18.629  19.064  1.00 18.14  ? 73   GLY A O     1 
ATOM   558   N N     . THR A 1 74  ? 21.971  18.789  17.071  1.00 18.72  ? 74   THR A N     1 
ATOM   559   C CA    . THR A 1 74  ? 22.138  20.234  17.204  1.00 18.96  ? 74   THR A CA    1 
ATOM   560   C C     . THR A 1 74  ? 21.648  20.925  15.946  1.00 19.04  ? 74   THR A C     1 
ATOM   561   O O     . THR A 1 74  ? 21.598  20.318  14.872  1.00 19.10  ? 74   THR A O     1 
ATOM   562   C CB    . THR A 1 74  ? 23.581  20.649  17.495  1.00 18.76  ? 74   THR A CB    1 
ATOM   563   O OG1   . THR A 1 74  ? 24.378  20.453  16.325  1.00 18.39  ? 74   THR A OG1   1 
ATOM   564   C CG2   . THR A 1 74  ? 24.160  19.860  18.681  1.00 20.54  ? 74   THR A CG2   1 
ATOM   565   N N     . LEU A 1 75  ? 21.290  22.198  16.093  1.00 19.17  ? 75   LEU A N     1 
ATOM   566   C CA    . LEU A 1 75  ? 20.668  22.952  15.032  1.00 19.20  ? 75   LEU A CA    1 
ATOM   567   C C     . LEU A 1 75  ? 20.643  24.433  15.377  1.00 19.67  ? 75   LEU A C     1 
ATOM   568   O O     . LEU A 1 75  ? 20.961  24.833  16.498  1.00 19.45  ? 75   LEU A O     1 
ATOM   569   C CB    . LEU A 1 75  ? 19.236  22.443  14.791  1.00 18.99  ? 75   LEU A CB    1 
ATOM   570   C CG    . LEU A 1 75  ? 18.065  22.889  15.693  1.00 19.34  ? 75   LEU A CG    1 
ATOM   571   C CD1   . LEU A 1 75  ? 16.714  22.624  15.003  1.00 17.52  ? 75   LEU A CD1   1 
ATOM   572   C CD2   . LEU A 1 75  ? 18.105  22.237  17.091  1.00 18.23  ? 75   LEU A CD2   1 
ATOM   573   N N     . ASN A 1 76  ? 20.243  25.244  14.405  1.00 19.81  ? 76   ASN A N     1 
ATOM   574   C CA    . ASN A 1 76  ? 19.966  26.646  14.656  1.00 19.79  ? 76   ASN A CA    1 
ATOM   575   C C     . ASN A 1 76  ? 18.616  26.978  14.013  1.00 19.62  ? 76   ASN A C     1 
ATOM   576   O O     . ASN A 1 76  ? 18.418  26.725  12.819  1.00 19.68  ? 76   ASN A O     1 
ATOM   577   C CB    . ASN A 1 76  ? 21.106  27.512  14.093  1.00 19.65  ? 76   ASN A CB    1 
ATOM   578   C CG    . ASN A 1 76  ? 21.077  28.939  14.625  1.00 20.63  ? 76   ASN A CG    1 
ATOM   579   O OD1   . ASN A 1 76  ? 21.845  29.303  15.530  1.00 23.09  ? 76   ASN A OD1   1 
ATOM   580   N ND2   . ASN A 1 76  ? 20.191  29.750  14.077  1.00 17.65  ? 76   ASN A ND2   1 
ATOM   581   N N     . LEU A 1 77  ? 17.680  27.502  14.804  1.00 19.22  ? 77   LEU A N     1 
ATOM   582   C CA    . LEU A 1 77  ? 16.362  27.853  14.284  1.00 19.15  ? 77   LEU A CA    1 
ATOM   583   C C     . LEU A 1 77  ? 16.462  28.930  13.211  1.00 19.20  ? 77   LEU A C     1 
ATOM   584   O O     . LEU A 1 77  ? 15.773  28.861  12.188  1.00 19.64  ? 77   LEU A O     1 
ATOM   585   C CB    . LEU A 1 77  ? 15.413  28.304  15.409  1.00 19.35  ? 77   LEU A CB    1 
ATOM   586   C CG    . LEU A 1 77  ? 14.037  28.869  15.024  1.00 19.35  ? 77   LEU A CG    1 
ATOM   587   C CD1   . LEU A 1 77  ? 12.967  28.514  16.050  1.00 17.45  ? 77   LEU A CD1   1 
ATOM   588   C CD2   . LEU A 1 77  ? 14.100  30.384  14.800  1.00 18.05  ? 77   LEU A CD2   1 
ATOM   589   N N     . ALA A 1 78  ? 17.315  29.924  13.442  1.00 18.70  ? 78   ALA A N     1 
ATOM   590   C CA    . ALA A 1 78  ? 17.436  31.026  12.495  1.00 18.90  ? 78   ALA A CA    1 
ATOM   591   C C     . ALA A 1 78  ? 18.021  30.584  11.145  1.00 18.66  ? 78   ALA A C     1 
ATOM   592   O O     . ALA A 1 78  ? 17.611  31.096  10.108  1.00 17.89  ? 78   ALA A O     1 
ATOM   593   C CB    . ALA A 1 78  ? 18.214  32.188  13.094  1.00 18.52  ? 78   ALA A CB    1 
ATOM   594   N N     . ALA A 1 79  ? 18.947  29.622  11.164  1.00 18.61  ? 79   ALA A N     1 
ATOM   595   C CA    . ALA A 1 79  ? 19.479  29.023  9.928   1.00 18.85  ? 79   ALA A CA    1 
ATOM   596   C C     . ALA A 1 79  ? 18.401  28.245  9.160   1.00 19.08  ? 79   ALA A C     1 
ATOM   597   O O     . ALA A 1 79  ? 18.415  28.187  7.933   1.00 19.22  ? 79   ALA A O     1 
ATOM   598   C CB    . ALA A 1 79  ? 20.675  28.103  10.233  1.00 18.60  ? 79   ALA A CB    1 
ATOM   599   N N     . ASN A 1 80  ? 17.471  27.642  9.893   1.00 19.55  ? 80   ASN A N     1 
ATOM   600   C CA    . ASN A 1 80  ? 16.376  26.893  9.283   1.00 19.35  ? 80   ASN A CA    1 
ATOM   601   C C     . ASN A 1 80  ? 15.285  27.791  8.707   1.00 19.20  ? 80   ASN A C     1 
ATOM   602   O O     . ASN A 1 80  ? 14.601  27.428  7.739   1.00 19.35  ? 80   ASN A O     1 
ATOM   603   C CB    . ASN A 1 80  ? 15.797  25.906  10.301  1.00 19.68  ? 80   ASN A CB    1 
ATOM   604   C CG    . ASN A 1 80  ? 16.553  24.595  10.317  1.00 20.70  ? 80   ASN A CG    1 
ATOM   605   O OD1   . ASN A 1 80  ? 16.322  23.738  9.470   1.00 20.81  ? 80   ASN A OD1   1 
ATOM   606   N ND2   . ASN A 1 80  ? 17.482  24.443  11.267  1.00 20.34  ? 80   ASN A ND2   1 
ATOM   607   N N     . CYS A 1 81  ? 15.153  28.973  9.295   1.00 18.81  ? 81   CYS A N     1 
ATOM   608   C CA    . CYS A 1 81  ? 14.108  29.918  8.936   1.00 19.11  ? 81   CYS A CA    1 
ATOM   609   C C     . CYS A 1 81  ? 14.621  30.955  7.952   1.00 19.12  ? 81   CYS A C     1 
ATOM   610   O O     . CYS A 1 81  ? 13.825  31.690  7.375   1.00 19.05  ? 81   CYS A O     1 
ATOM   611   C CB    . CYS A 1 81  ? 13.564  30.620  10.197  1.00 18.89  ? 81   CYS A CB    1 
ATOM   612   S SG    . CYS A 1 81  ? 12.544  29.567  11.282  1.00 20.46  ? 81   CYS A SG    1 
ATOM   613   N N     . LEU A 1 82  ? 15.946  31.018  7.767   1.00 19.16  ? 82   LEU A N     1 
ATOM   614   C CA    . LEU A 1 82  ? 16.560  32.080  6.957   1.00 19.20  ? 82   LEU A CA    1 
ATOM   615   C C     . LEU A 1 82  ? 17.677  31.591  6.039   1.00 19.36  ? 82   LEU A C     1 
ATOM   616   O O     . LEU A 1 82  ? 17.491  31.527  4.819   1.00 18.66  ? 82   LEU A O     1 
ATOM   617   C CB    . LEU A 1 82  ? 17.076  33.230  7.851   1.00 19.27  ? 82   LEU A CB    1 
ATOM   618   C CG    . LEU A 1 82  ? 16.111  33.862  8.864   1.00 19.23  ? 82   LEU A CG    1 
ATOM   619   C CD1   . LEU A 1 82  ? 16.860  34.704  9.899   1.00 17.72  ? 82   LEU A CD1   1 
ATOM   620   C CD2   . LEU A 1 82  ? 15.042  34.686  8.158   1.00 17.91  ? 82   LEU A CD2   1 
ATOM   621   N N     . ASP A 1 83  ? 18.828  31.257  6.637   1.00 19.32  ? 83   ASP A N     1 
ATOM   622   C CA    . ASP A 1 83  ? 20.051  30.919  5.905   1.00 19.48  ? 83   ASP A CA    1 
ATOM   623   C C     . ASP A 1 83  ? 19.869  29.869  4.819   1.00 19.63  ? 83   ASP A C     1 
ATOM   624   O O     . ASP A 1 83  ? 20.345  30.057  3.702   1.00 19.47  ? 83   ASP A O     1 
ATOM   625   C CB    . ASP A 1 83  ? 21.170  30.495  6.868   1.00 19.34  ? 83   ASP A CB    1 
ATOM   626   C CG    . ASP A 1 83  ? 21.476  31.564  7.899   1.00 20.29  ? 83   ASP A CG    1 
ATOM   627   O OD1   . ASP A 1 83  ? 22.644  31.964  8.006   1.00 20.56  ? 83   ASP A OD1   1 
ATOM   628   O OD2   . ASP A 1 83  ? 20.534  32.034  8.581   1.00 20.88  ? 83   ASP A OD2   1 
ATOM   629   N N     . ARG A 1 84  ? 19.170  28.779  5.136   1.00 19.68  ? 84   ARG A N     1 
ATOM   630   C CA    . ARG A 1 84  ? 19.050  27.657  4.196   1.00 19.86  ? 84   ARG A CA    1 
ATOM   631   C C     . ARG A 1 84  ? 18.157  27.955  2.987   1.00 20.10  ? 84   ARG A C     1 
ATOM   632   O O     . ARG A 1 84  ? 18.197  27.231  1.993   1.00 20.53  ? 84   ARG A O     1 
ATOM   633   C CB    . ARG A 1 84  ? 18.583  26.390  4.910   1.00 19.92  ? 84   ARG A CB    1 
ATOM   634   C CG    . ARG A 1 84  ? 17.147  26.427  5.421   1.00 18.67  ? 84   ARG A CG    1 
ATOM   635   C CD    . ARG A 1 84  ? 16.777  25.064  5.957   1.00 18.14  ? 84   ARG A CD    1 
ATOM   636   N NE    . ARG A 1 84  ? 15.409  25.005  6.452   1.00 18.69  ? 84   ARG A NE    1 
ATOM   637   C CZ    . ARG A 1 84  ? 14.692  23.886  6.547   1.00 18.94  ? 84   ARG A CZ    1 
ATOM   638   N NH1   . ARG A 1 84  ? 15.201  22.711  6.182   1.00 17.72  ? 84   ARG A NH1   1 
ATOM   639   N NH2   . ARG A 1 84  ? 13.457  23.941  7.012   1.00 18.31  ? 84   ARG A NH2   1 
ATOM   640   N N     . HIS A 1 85  ? 17.366  29.020  3.069   1.00 20.11  ? 85   HIS A N     1 
ATOM   641   C CA    . HIS A 1 85  ? 16.545  29.447  1.938   1.00 20.33  ? 85   HIS A CA    1 
ATOM   642   C C     . HIS A 1 85  ? 17.262  30.414  0.987   1.00 20.68  ? 85   HIS A C     1 
ATOM   643   O O     . HIS A 1 85  ? 16.772  30.691  -0.099  1.00 20.44  ? 85   HIS A O     1 
ATOM   644   C CB    . HIS A 1 85  ? 15.233  30.066  2.437   1.00 20.00  ? 85   HIS A CB    1 
ATOM   645   C CG    . HIS A 1 85  ? 14.496  29.207  3.414   1.00 19.55  ? 85   HIS A CG    1 
ATOM   646   N ND1   . HIS A 1 85  ? 14.029  27.951  3.097   1.00 17.79  ? 85   HIS A ND1   1 
ATOM   647   C CD2   . HIS A 1 85  ? 14.153  29.421  4.707   1.00 19.80  ? 85   HIS A CD2   1 
ATOM   648   C CE1   . HIS A 1 85  ? 13.422  27.429  4.147   1.00 18.93  ? 85   HIS A CE1   1 
ATOM   649   N NE2   . HIS A 1 85  ? 13.487  28.299  5.140   1.00 20.18  ? 85   HIS A NE2   1 
ATOM   650   N N     . LEU A 1 86  ? 18.427  30.910  1.385   1.00 21.47  ? 86   LEU A N     1 
ATOM   651   C CA    . LEU A 1 86  ? 19.080  31.999  0.646   1.00 22.34  ? 86   LEU A CA    1 
ATOM   652   C C     . LEU A 1 86  ? 19.570  31.645  -0.769  1.00 22.94  ? 86   LEU A C     1 
ATOM   653   O O     . LEU A 1 86  ? 19.373  32.413  -1.718  1.00 22.52  ? 86   LEU A O     1 
ATOM   654   C CB    . LEU A 1 86  ? 20.234  32.592  1.470   1.00 22.56  ? 86   LEU A CB    1 
ATOM   655   C CG    . LEU A 1 86  ? 19.858  33.382  2.732   1.00 23.10  ? 86   LEU A CG    1 
ATOM   656   C CD1   . LEU A 1 86  ? 21.100  33.974  3.363   1.00 23.71  ? 86   LEU A CD1   1 
ATOM   657   C CD2   . LEU A 1 86  ? 18.850  34.487  2.401   1.00 24.11  ? 86   LEU A CD2   1 
ATOM   658   N N     . GLN A 1 87  ? 20.221  30.497  -0.911  1.00 23.17  ? 87   GLN A N     1 
ATOM   659   C CA    . GLN A 1 87  ? 20.871  30.180  -2.179  1.00 23.98  ? 87   GLN A CA    1 
ATOM   660   C C     . GLN A 1 87  ? 19.893  30.192  -3.350  1.00 23.85  ? 87   GLN A C     1 
ATOM   661   O O     . GLN A 1 87  ? 20.181  30.783  -4.397  1.00 24.07  ? 87   GLN A O     1 
ATOM   662   C CB    . GLN A 1 87  ? 21.577  28.835  -2.109  1.00 24.23  ? 87   GLN A CB    1 
ATOM   663   C CG    . GLN A 1 87  ? 22.388  28.535  -3.351  1.00 26.98  ? 87   GLN A CG    1 
ATOM   664   C CD    . GLN A 1 87  ? 23.095  27.221  -3.249  1.00 30.02  ? 87   GLN A CD    1 
ATOM   665   O OE1   . GLN A 1 87  ? 24.080  27.087  -2.515  1.00 32.54  ? 87   GLN A OE1   1 
ATOM   666   N NE2   . GLN A 1 87  ? 22.599  26.231  -3.978  1.00 30.23  ? 87   GLN A NE2   1 
ATOM   667   N N     . GLU A 1 88  ? 18.748  29.542  -3.157  1.00 23.37  ? 88   GLU A N     1 
ATOM   668   C CA    . GLU A 1 88  ? 17.764  29.346  -4.212  1.00 23.58  ? 88   GLU A CA    1 
ATOM   669   C C     . GLU A 1 88  ? 16.586  30.295  -4.098  1.00 23.15  ? 88   GLU A C     1 
ATOM   670   O O     . GLU A 1 88  ? 15.979  30.640  -5.106  1.00 23.09  ? 88   GLU A O     1 
ATOM   671   C CB    . GLU A 1 88  ? 17.272  27.894  -4.220  1.00 23.97  ? 88   GLU A CB    1 
ATOM   672   C CG    . GLU A 1 88  ? 18.389  26.872  -4.488  1.00 26.92  ? 88   GLU A CG    1 
ATOM   673   C CD    . GLU A 1 88  ? 19.067  27.082  -5.833  1.00 30.86  ? 88   GLU A CD    1 
ATOM   674   O OE1   . GLU A 1 88  ? 20.307  27.258  -5.856  1.00 34.23  ? 88   GLU A OE1   1 
ATOM   675   O OE2   . GLU A 1 88  ? 18.360  27.087  -6.870  1.00 31.98  ? 88   GLU A OE2   1 
ATOM   676   N N     . ASN A 1 89  ? 16.274  30.728  -2.872  1.00 22.51  ? 89   ASN A N     1 
ATOM   677   C CA    . ASN A 1 89  ? 15.097  31.558  -2.646  1.00 21.97  ? 89   ASN A CA    1 
ATOM   678   C C     . ASN A 1 89  ? 15.332  32.904  -1.948  1.00 21.46  ? 89   ASN A C     1 
ATOM   679   O O     . ASN A 1 89  ? 14.404  33.510  -1.426  1.00 21.03  ? 89   ASN A O     1 
ATOM   680   C CB    . ASN A 1 89  ? 13.995  30.721  -1.981  1.00 21.87  ? 89   ASN A CB    1 
ATOM   681   C CG    . ASN A 1 89  ? 13.386  29.711  -2.959  1.00 23.01  ? 89   ASN A CG    1 
ATOM   682   O OD1   . ASN A 1 89  ? 13.610  28.499  -2.853  1.00 23.61  ? 89   ASN A OD1   1 
ATOM   683   N ND2   . ASN A 1 89  ? 12.675  30.222  -3.958  1.00 21.45  ? 89   ASN A ND2   1 
ATOM   684   N N     . GLY A 1 90  ? 16.571  33.381  -1.983  1.00 20.93  ? 90   GLY A N     1 
ATOM   685   C CA    . GLY A 1 90  ? 16.915  34.673  -1.399  1.00 21.03  ? 90   GLY A CA    1 
ATOM   686   C C     . GLY A 1 90  ? 16.026  35.832  -1.825  1.00 20.89  ? 90   GLY A C     1 
ATOM   687   O O     . GLY A 1 90  ? 15.713  36.699  -1.016  1.00 20.63  ? 90   GLY A O     1 
ATOM   688   N N     . ASP A 1 91  ? 15.613  35.837  -3.090  1.00 20.86  ? 91   ASP A N     1 
ATOM   689   C CA    . ASP A 1 91  ? 14.789  36.917  -3.640  1.00 21.37  ? 91   ASP A CA    1 
ATOM   690   C C     . ASP A 1 91  ? 13.309  36.779  -3.278  1.00 20.98  ? 91   ASP A C     1 
ATOM   691   O O     . ASP A 1 91  ? 12.551  37.748  -3.392  1.00 20.84  ? 91   ASP A O     1 
ATOM   692   C CB    . ASP A 1 91  ? 14.959  37.031  -5.160  1.00 21.79  ? 91   ASP A CB    1 
ATOM   693   C CG    . ASP A 1 91  ? 16.381  37.405  -5.571  1.00 25.25  ? 91   ASP A CG    1 
ATOM   694   O OD1   . ASP A 1 91  ? 17.108  38.050  -4.771  1.00 27.31  ? 91   ASP A OD1   1 
ATOM   695   O OD2   . ASP A 1 91  ? 16.775  37.058  -6.707  1.00 28.52  ? 91   ASP A OD2   1 
ATOM   696   N N     . ARG A 1 92  ? 12.903  35.590  -2.836  1.00 20.71  ? 92   ARG A N     1 
ATOM   697   C CA    . ARG A 1 92  ? 11.515  35.363  -2.436  1.00 21.26  ? 92   ARG A CA    1 
ATOM   698   C C     . ARG A 1 92  ? 11.176  36.208  -1.202  1.00 20.47  ? 92   ARG A C     1 
ATOM   699   O O     . ARG A 1 92  ? 12.006  36.359  -0.303  1.00 20.35  ? 92   ARG A O     1 
ATOM   700   C CB    . ARG A 1 92  ? 11.256  33.871  -2.172  1.00 21.11  ? 92   ARG A CB    1 
ATOM   701   C CG    . ARG A 1 92  ? 9.838   33.542  -1.689  1.00 23.23  ? 92   ARG A CG    1 
ATOM   702   C CD    . ARG A 1 92  ? 9.684   32.066  -1.335  1.00 23.14  ? 92   ARG A CD    1 
ATOM   703   N NE    . ARG A 1 92  ? 9.738   31.214  -2.522  1.00 28.06  ? 92   ARG A NE    1 
ATOM   704   C CZ    . ARG A 1 92  ? 9.931   29.895  -2.502  1.00 31.94  ? 92   ARG A CZ    1 
ATOM   705   N NH1   . ARG A 1 92  ? 10.116  29.253  -1.346  1.00 32.84  ? 92   ARG A NH1   1 
ATOM   706   N NH2   . ARG A 1 92  ? 9.957   29.215  -3.649  1.00 32.18  ? 92   ARG A NH2   1 
ATOM   707   N N     . THR A 1 93  ? 9.964   36.759  -1.182  1.00 19.89  ? 93   THR A N     1 
ATOM   708   C CA    . THR A 1 93  ? 9.456   37.526  -0.039  1.00 19.76  ? 93   THR A CA    1 
ATOM   709   C C     . THR A 1 93  ? 9.265   36.596  1.144   1.00 19.36  ? 93   THR A C     1 
ATOM   710   O O     . THR A 1 93  ? 8.555   35.598  1.046   1.00 19.67  ? 93   THR A O     1 
ATOM   711   C CB    . THR A 1 93  ? 8.125   38.234  -0.388  1.00 19.83  ? 93   THR A CB    1 
ATOM   712   O OG1   . THR A 1 93  ? 8.303   38.981  -1.597  1.00 20.31  ? 93   THR A OG1   1 
ATOM   713   C CG2   . THR A 1 93  ? 7.674   39.180  0.736   1.00 20.53  ? 93   THR A CG2   1 
ATOM   714   N N     . ALA A 1 94  ? 9.952   36.894  2.243   1.00 19.02  ? 94   ALA A N     1 
ATOM   715   C CA    . ALA A 1 94  ? 9.752   36.165  3.483   1.00 18.28  ? 94   ALA A CA    1 
ATOM   716   C C     . ALA A 1 94  ? 8.555   36.750  4.213   1.00 18.18  ? 94   ALA A C     1 
ATOM   717   O O     . ALA A 1 94  ? 7.669   36.003  4.659   1.00 17.79  ? 94   ALA A O     1 
ATOM   718   C CB    . ALA A 1 94  ? 10.991  36.219  4.359   1.00 18.04  ? 94   ALA A CB    1 
ATOM   719   N N     . ILE A 1 95  ? 8.526   38.080  4.332   1.00 17.63  ? 95   ILE A N     1 
ATOM   720   C CA    . ILE A 1 95  ? 7.437   38.758  5.045   1.00 17.42  ? 95   ILE A CA    1 
ATOM   721   C C     . ILE A 1 95  ? 6.825   39.848  4.167   1.00 17.54  ? 95   ILE A C     1 
ATOM   722   O O     . ILE A 1 95  ? 7.535   40.733  3.677   1.00 17.25  ? 95   ILE A O     1 
ATOM   723   C CB    . ILE A 1 95  ? 7.922   39.383  6.395   1.00 17.66  ? 95   ILE A CB    1 
ATOM   724   C CG1   . ILE A 1 95  ? 8.406   38.302  7.369   1.00 17.84  ? 95   ILE A CG1   1 
ATOM   725   C CG2   . ILE A 1 95  ? 6.815   40.233  7.064   1.00 16.78  ? 95   ILE A CG2   1 
ATOM   726   C CD1   . ILE A 1 95  ? 9.157   38.883  8.616   1.00 17.70  ? 95   ILE A CD1   1 
ATOM   727   N N     . ILE A 1 96  ? 5.521   39.754  3.930   1.00 17.43  ? 96   ILE A N     1 
ATOM   728   C CA    . ILE A 1 96  ? 4.758   40.896  3.428   1.00 17.77  ? 96   ILE A CA    1 
ATOM   729   C C     . ILE A 1 96  ? 4.241   41.643  4.653   1.00 17.86  ? 96   ILE A C     1 
ATOM   730   O O     . ILE A 1 96  ? 3.528   41.060  5.474   1.00 17.68  ? 96   ILE A O     1 
ATOM   731   C CB    . ILE A 1 96  ? 3.539   40.473  2.566   1.00 17.81  ? 96   ILE A CB    1 
ATOM   732   C CG1   . ILE A 1 96  ? 3.979   39.723  1.299   1.00 17.92  ? 96   ILE A CG1   1 
ATOM   733   C CG2   . ILE A 1 96  ? 2.673   41.699  2.232   1.00 18.03  ? 96   ILE A CG2   1 
ATOM   734   C CD1   . ILE A 1 96  ? 2.837   39.047  0.528   1.00 17.22  ? 96   ILE A CD1   1 
ATOM   735   N N     . TRP A 1 97  ? 4.595   42.920  4.786   1.00 17.95  ? 97   TRP A N     1 
ATOM   736   C CA    . TRP A 1 97  ? 4.067   43.723  5.887   1.00 18.39  ? 97   TRP A CA    1 
ATOM   737   C C     . TRP A 1 97  ? 3.039   44.712  5.351   1.00 18.90  ? 97   TRP A C     1 
ATOM   738   O O     . TRP A 1 97  ? 3.319   45.469  4.423   1.00 18.85  ? 97   TRP A O     1 
ATOM   739   C CB    . TRP A 1 97  ? 5.182   44.438  6.671   1.00 18.30  ? 97   TRP A CB    1 
ATOM   740   C CG    . TRP A 1 97  ? 4.663   45.323  7.793   1.00 18.11  ? 97   TRP A CG    1 
ATOM   741   C CD1   . TRP A 1 97  ? 4.194   44.916  9.017   1.00 18.46  ? 97   TRP A CD1   1 
ATOM   742   C CD2   . TRP A 1 97  ? 4.563   46.755  7.780   1.00 18.34  ? 97   TRP A CD2   1 
ATOM   743   N NE1   . TRP A 1 97  ? 3.805   46.012  9.762   1.00 19.64  ? 97   TRP A NE1   1 
ATOM   744   C CE2   . TRP A 1 97  ? 4.021   47.149  9.026   1.00 18.51  ? 97   TRP A CE2   1 
ATOM   745   C CE3   . TRP A 1 97  ? 4.869   47.746  6.826   1.00 19.36  ? 97   TRP A CE3   1 
ATOM   746   C CZ2   . TRP A 1 97  ? 3.779   48.493  9.349   1.00 18.94  ? 97   TRP A CZ2   1 
ATOM   747   C CZ3   . TRP A 1 97  ? 4.629   49.088  7.150   1.00 19.26  ? 97   TRP A CZ3   1 
ATOM   748   C CH2   . TRP A 1 97  ? 4.093   49.446  8.402   1.00 18.25  ? 97   TRP A CH2   1 
ATOM   749   N N     . GLU A 1 98  ? 1.840   44.673  5.932   1.00 19.48  ? 98   GLU A N     1 
ATOM   750   C CA    . GLU A 1 98  ? 0.745   45.575  5.568   1.00 19.58  ? 98   GLU A CA    1 
ATOM   751   C C     . GLU A 1 98  ? 0.480   46.494  6.759   1.00 19.79  ? 98   GLU A C     1 
ATOM   752   O O     . GLU A 1 98  ? 0.150   46.022  7.852   1.00 19.61  ? 98   GLU A O     1 
ATOM   753   C CB    . GLU A 1 98  ? -0.517  44.771  5.200   1.00 19.35  ? 98   GLU A CB    1 
ATOM   754   C CG    . GLU A 1 98  ? -1.808  45.597  5.070   1.00 20.25  ? 98   GLU A CG    1 
ATOM   755   C CD    . GLU A 1 98  ? -1.936  46.344  3.740   1.00 21.36  ? 98   GLU A CD    1 
ATOM   756   O OE1   . GLU A 1 98  ? -1.035  46.216  2.880   1.00 20.76  ? 98   GLU A OE1   1 
ATOM   757   O OE2   . GLU A 1 98  ? -2.958  47.055  3.552   1.00 21.13  ? 98   GLU A OE2   1 
ATOM   758   N N     . GLY A 1 99  ? 0.647   47.800  6.551   1.00 19.85  ? 99   GLY A N     1 
ATOM   759   C CA    . GLY A 1 99  ? 0.442   48.776  7.614   1.00 19.83  ? 99   GLY A CA    1 
ATOM   760   C C     . GLY A 1 99  ? -1.023  48.978  7.976   1.00 20.49  ? 99   GLY A C     1 
ATOM   761   O O     . GLY A 1 99  ? -1.938  48.662  7.192   1.00 20.15  ? 99   GLY A O     1 
ATOM   762   N N     . ASP A 1 100 ? -1.242  49.500  9.182   1.00 20.41  ? 100  ASP A N     1 
ATOM   763   C CA    . ASP A 1 100 ? -2.563  49.915  9.626   1.00 21.00  ? 100  ASP A CA    1 
ATOM   764   C C     . ASP A 1 100 ? -3.111  50.856  8.554   1.00 21.29  ? 100  ASP A C     1 
ATOM   765   O O     . ASP A 1 100 ? -4.284  50.768  8.159   1.00 21.41  ? 100  ASP A O     1 
ATOM   766   C CB    . ASP A 1 100 ? -2.435  50.614  10.977  1.00 20.68  ? 100  ASP A CB    1 
ATOM   767   C CG    . ASP A 1 100 ? -3.769  50.991  11.582  1.00 20.94  ? 100  ASP A CG    1 
ATOM   768   O OD1   . ASP A 1 100 ? -4.622  50.099  11.773  1.00 21.76  ? 100  ASP A OD1   1 
ATOM   769   O OD2   . ASP A 1 100 ? -3.947  52.188  11.893  1.00 20.52  ? 100  ASP A OD2   1 
ATOM   770   N N     . ASP A 1 101 ? -2.227  51.728  8.073   1.00 21.36  ? 101  ASP A N     1 
ATOM   771   C CA    . ASP A 1 101 ? -2.469  52.599  6.928   1.00 21.56  ? 101  ASP A CA    1 
ATOM   772   C C     . ASP A 1 101 ? -2.053  51.825  5.684   1.00 21.27  ? 101  ASP A C     1 
ATOM   773   O O     . ASP A 1 101 ? -0.873  51.504  5.507   1.00 20.63  ? 101  ASP A O     1 
ATOM   774   C CB    . ASP A 1 101 ? -1.637  53.881  7.089   1.00 21.92  ? 101  ASP A CB    1 
ATOM   775   C CG    . ASP A 1 101 ? -1.804  54.862  5.941   1.00 24.29  ? 101  ASP A CG    1 
ATOM   776   O OD1   . ASP A 1 101 ? -2.410  54.511  4.901   1.00 26.39  ? 101  ASP A OD1   1 
ATOM   777   O OD2   . ASP A 1 101 ? -1.303  56.004  6.085   1.00 25.45  ? 101  ASP A OD2   1 
ATOM   778   N N     . THR A 1 102 ? -3.024  51.517  4.825   1.00 21.09  ? 102  THR A N     1 
ATOM   779   C CA    . THR A 1 102 ? -2.764  50.657  3.676   1.00 21.57  ? 102  THR A CA    1 
ATOM   780   C C     . THR A 1 102 ? -1.737  51.223  2.687   1.00 22.06  ? 102  THR A C     1 
ATOM   781   O O     . THR A 1 102 ? -1.097  50.464  1.957   1.00 22.00  ? 102  THR A O     1 
ATOM   782   C CB    . THR A 1 102 ? -4.059  50.187  2.951   1.00 21.60  ? 102  THR A CB    1 
ATOM   783   O OG1   . THR A 1 102 ? -3.705  49.183  1.996   1.00 21.78  ? 102  THR A OG1   1 
ATOM   784   C CG2   . THR A 1 102 ? -4.783  51.343  2.242   1.00 21.88  ? 102  THR A CG2   1 
ATOM   785   N N     . SER A 1 103 ? -1.555  52.544  2.708   1.00 22.60  ? 103  SER A N     1 
ATOM   786   C CA    . SER A 1 103 ? -0.528  53.202  1.889   1.00 23.66  ? 103  SER A CA    1 
ATOM   787   C C     . SER A 1 103 ? 0.885   52.757  2.273   1.00 23.71  ? 103  SER A C     1 
ATOM   788   O O     . SER A 1 103 ? 1.828   52.940  1.495   1.00 23.71  ? 103  SER A O     1 
ATOM   789   C CB    . SER A 1 103 ? -0.649  54.734  1.973   1.00 23.85  ? 103  SER A CB    1 
ATOM   790   O OG    . SER A 1 103 ? -0.204  55.221  3.235   1.00 24.90  ? 103  SER A OG    1 
ATOM   791   N N     . GLN A 1 104 ? 1.008   52.170  3.468   1.00 23.89  ? 104  GLN A N     1 
ATOM   792   C CA    . GLN A 1 104 ? 2.280   51.694  4.004   1.00 24.46  ? 104  GLN A CA    1 
ATOM   793   C C     . GLN A 1 104 ? 2.395   50.157  3.951   1.00 24.48  ? 104  GLN A C     1 
ATOM   794   O O     . GLN A 1 104 ? 1.643   49.443  4.628   1.00 23.52  ? 104  GLN A O     1 
ATOM   795   C CB    . GLN A 1 104 ? 2.485   52.199  5.447   1.00 24.29  ? 104  GLN A CB    1 
ATOM   796   C CG    . GLN A 1 104 ? 2.600   53.740  5.585   1.00 24.91  ? 104  GLN A CG    1 
ATOM   797   C CD    . GLN A 1 104 ? 3.027   54.193  6.988   1.00 25.58  ? 104  GLN A CD    1 
ATOM   798   O OE1   . GLN A 1 104 ? 2.727   53.542  8.000   1.00 27.29  ? 104  GLN A OE1   1 
ATOM   799   N NE2   . GLN A 1 104 ? 3.728   55.315  7.048   1.00 26.54  ? 104  GLN A NE2   1 
ATOM   800   N N     . SER A 1 105 ? 3.345   49.662  3.154   1.00 24.52  ? 105  SER A N     1 
ATOM   801   C CA    . SER A 1 105 ? 3.636   48.221  3.084   1.00 25.23  ? 105  SER A CA    1 
ATOM   802   C C     . SER A 1 105 ? 5.083   47.965  2.691   1.00 25.46  ? 105  SER A C     1 
ATOM   803   O O     . SER A 1 105 ? 5.748   48.847  2.133   1.00 25.89  ? 105  SER A O     1 
ATOM   804   C CB    . SER A 1 105 ? 2.704   47.512  2.098   1.00 25.47  ? 105  SER A CB    1 
ATOM   805   O OG    . SER A 1 105 ? 2.883   48.038  0.802   1.00 25.60  ? 105  SER A OG    1 
ATOM   806   N N     . LYS A 1 106 ? 5.569   46.765  3.010   1.00 25.06  ? 106  LYS A N     1 
ATOM   807   C CA    . LYS A 1 106 ? 6.902   46.313  2.614   1.00 24.82  ? 106  LYS A CA    1 
ATOM   808   C C     . LYS A 1 106 ? 6.838   44.853  2.179   1.00 24.31  ? 106  LYS A C     1 
ATOM   809   O O     . LYS A 1 106 ? 6.075   44.057  2.740   1.00 24.06  ? 106  LYS A O     1 
ATOM   810   C CB    . LYS A 1 106 ? 7.895   46.405  3.784   1.00 24.52  ? 106  LYS A CB    1 
ATOM   811   C CG    . LYS A 1 106 ? 8.260   47.795  4.217   1.00 25.74  ? 106  LYS A CG    1 
ATOM   812   C CD    . LYS A 1 106 ? 9.187   47.774  5.430   1.00 26.18  ? 106  LYS A CD    1 
ATOM   813   C CE    . LYS A 1 106 ? 9.587   49.205  5.785   1.00 29.88  ? 106  LYS A CE    1 
ATOM   814   N NZ    . LYS A 1 106 ? 10.830  49.267  6.592   1.00 32.07  ? 106  LYS A NZ    1 
ATOM   815   N N     . HIS A 1 107 ? 7.640   44.503  1.180   1.00 23.75  ? 107  HIS A N     1 
ATOM   816   C CA    . HIS A 1 107 ? 7.942   43.107  0.912   1.00 23.22  ? 107  HIS A CA    1 
ATOM   817   C C     . HIS A 1 107 ? 9.388   42.897  1.318   1.00 22.69  ? 107  HIS A C     1 
ATOM   818   O O     . HIS A 1 107 ? 10.292  43.525  0.755   1.00 22.48  ? 107  HIS A O     1 
ATOM   819   C CB    . HIS A 1 107 ? 7.747   42.781  -0.560  1.00 23.76  ? 107  HIS A CB    1 
ATOM   820   C CG    . HIS A 1 107 ? 6.314   42.699  -0.968  1.00 25.57  ? 107  HIS A CG    1 
ATOM   821   N ND1   . HIS A 1 107 ? 5.466   43.785  -0.923  1.00 28.21  ? 107  HIS A ND1   1 
ATOM   822   C CD2   . HIS A 1 107 ? 5.577   41.663  -1.427  1.00 27.30  ? 107  HIS A CD2   1 
ATOM   823   C CE1   . HIS A 1 107 ? 4.267   43.417  -1.334  1.00 28.43  ? 107  HIS A CE1   1 
ATOM   824   N NE2   . HIS A 1 107 ? 4.306   42.133  -1.640  1.00 27.01  ? 107  HIS A NE2   1 
ATOM   825   N N     . ILE A 1 108 ? 9.593   42.046  2.317   1.00 21.58  ? 108  ILE A N     1 
ATOM   826   C CA    . ILE A 1 108 ? 10.928  41.761  2.828   1.00 20.98  ? 108  ILE A CA    1 
ATOM   827   C C     . ILE A 1 108 ? 11.364  40.381  2.353   1.00 20.58  ? 108  ILE A C     1 
ATOM   828   O O     . ILE A 1 108 ? 10.794  39.370  2.764   1.00 20.55  ? 108  ILE A O     1 
ATOM   829   C CB    . ILE A 1 108 ? 10.966  41.859  4.368   1.00 21.08  ? 108  ILE A CB    1 
ATOM   830   C CG1   . ILE A 1 108 ? 10.495  43.252  4.795   1.00 21.41  ? 108  ILE A CG1   1 
ATOM   831   C CG2   . ILE A 1 108 ? 12.366  41.568  4.901   1.00 20.42  ? 108  ILE A CG2   1 
ATOM   832   C CD1   . ILE A 1 108 ? 9.838   43.272  6.138   1.00 24.24  ? 108  ILE A CD1   1 
ATOM   833   N N     . SER A 1 109 ? 12.361  40.360  1.467   1.00 19.69  ? 109  SER A N     1 
ATOM   834   C CA    . SER A 1 109 ? 12.914  39.124  0.932   1.00 19.04  ? 109  SER A CA    1 
ATOM   835   C C     . SER A 1 109 ? 13.602  38.318  2.028   1.00 18.97  ? 109  SER A C     1 
ATOM   836   O O     . SER A 1 109 ? 13.997  38.873  3.062   1.00 18.55  ? 109  SER A O     1 
ATOM   837   C CB    . SER A 1 109 ? 13.915  39.434  -0.191  1.00 19.08  ? 109  SER A CB    1 
ATOM   838   O OG    . SER A 1 109 ? 15.088  40.055  0.312   1.00 18.43  ? 109  SER A OG    1 
ATOM   839   N N     . TYR A 1 110 ? 13.753  37.014  1.803   1.00 18.94  ? 110  TYR A N     1 
ATOM   840   C CA    . TYR A 1 110 ? 14.551  36.181  2.709   1.00 19.33  ? 110  TYR A CA    1 
ATOM   841   C C     . TYR A 1 110 ? 15.945  36.783  2.922   1.00 19.53  ? 110  TYR A C     1 
ATOM   842   O O     . TYR A 1 110 ? 16.421  36.864  4.056   1.00 19.21  ? 110  TYR A O     1 
ATOM   843   C CB    . TYR A 1 110 ? 14.622  34.718  2.222   1.00 18.85  ? 110  TYR A CB    1 
ATOM   844   C CG    . TYR A 1 110 ? 13.469  33.900  2.753   1.00 18.96  ? 110  TYR A CG    1 
ATOM   845   C CD1   . TYR A 1 110 ? 12.291  33.766  2.024   1.00 18.42  ? 110  TYR A CD1   1 
ATOM   846   C CD2   . TYR A 1 110 ? 13.532  33.317  4.028   1.00 19.84  ? 110  TYR A CD2   1 
ATOM   847   C CE1   . TYR A 1 110 ? 11.208  33.036  2.531   1.00 19.21  ? 110  TYR A CE1   1 
ATOM   848   C CE2   . TYR A 1 110 ? 12.456  32.593  4.550   1.00 19.07  ? 110  TYR A CE2   1 
ATOM   849   C CZ    . TYR A 1 110 ? 11.299  32.455  3.791   1.00 18.73  ? 110  TYR A CZ    1 
ATOM   850   O OH    . TYR A 1 110 ? 10.242  31.741  4.297   1.00 17.46  ? 110  TYR A OH    1 
ATOM   851   N N     . ARG A 1 111 ? 16.562  37.252  1.835   1.00 20.16  ? 111  ARG A N     1 
ATOM   852   C CA    . ARG A 1 111 ? 17.896  37.854  1.903   1.00 21.33  ? 111  ARG A CA    1 
ATOM   853   C C     . ARG A 1 111 ? 17.924  39.116  2.763   1.00 20.90  ? 111  ARG A C     1 
ATOM   854   O O     . ARG A 1 111 ? 18.801  39.251  3.624   1.00 20.98  ? 111  ARG A O     1 
ATOM   855   C CB    . ARG A 1 111 ? 18.459  38.131  0.504   1.00 21.38  ? 111  ARG A CB    1 
ATOM   856   C CG    . ARG A 1 111 ? 19.946  38.453  0.505   1.00 23.00  ? 111  ARG A CG    1 
ATOM   857   C CD    . ARG A 1 111 ? 20.500  38.704  -0.888  1.00 24.30  ? 111  ARG A CD    1 
ATOM   858   N NE    . ARG A 1 111 ? 20.416  37.515  -1.747  1.00 30.53  ? 111  ARG A NE    1 
ATOM   859   C CZ    . ARG A 1 111 ? 19.542  37.368  -2.746  1.00 33.34  ? 111  ARG A CZ    1 
ATOM   860   N NH1   . ARG A 1 111 ? 18.663  38.334  -3.016  1.00 33.88  ? 111  ARG A NH1   1 
ATOM   861   N NH2   . ARG A 1 111 ? 19.540  36.251  -3.471  1.00 34.40  ? 111  ARG A NH2   1 
ATOM   862   N N     . GLU A 1 112 ? 16.976  40.030  2.547   1.00 20.83  ? 112  GLU A N     1 
ATOM   863   C CA    . GLU A 1 112 ? 16.896  41.233  3.391   1.00 21.80  ? 112  GLU A CA    1 
ATOM   864   C C     . GLU A 1 112 ? 16.638  40.881  4.861   1.00 20.61  ? 112  GLU A C     1 
ATOM   865   O O     . GLU A 1 112 ? 17.256  41.462  5.752   1.00 19.72  ? 112  GLU A O     1 
ATOM   866   C CB    . GLU A 1 112 ? 15.844  42.235  2.896   1.00 21.92  ? 112  GLU A CB    1 
ATOM   867   C CG    . GLU A 1 112 ? 15.789  43.533  3.750   1.00 24.35  ? 112  GLU A CG    1 
ATOM   868   C CD    . GLU A 1 112 ? 14.550  44.410  3.498   1.00 24.55  ? 112  GLU A CD    1 
ATOM   869   O OE1   . GLU A 1 112 ? 13.933  44.312  2.412   1.00 26.59  ? 112  GLU A OE1   1 
ATOM   870   O OE2   . GLU A 1 112 ? 14.202  45.215  4.399   1.00 29.31  ? 112  GLU A OE2   1 
ATOM   871   N N     . LEU A 1 113 ? 15.737  39.922  5.108   1.00 20.20  ? 113  LEU A N     1 
ATOM   872   C CA    . LEU A 1 113 ? 15.412  39.526  6.489   1.00 19.80  ? 113  LEU A CA    1 
ATOM   873   C C     . LEU A 1 113 ? 16.642  38.933  7.189   1.00 19.81  ? 113  LEU A C     1 
ATOM   874   O O     . LEU A 1 113 ? 16.949  39.289  8.321   1.00 19.75  ? 113  LEU A O     1 
ATOM   875   C CB    . LEU A 1 113 ? 14.219  38.549  6.543   1.00 19.29  ? 113  LEU A CB    1 
ATOM   876   C CG    . LEU A 1 113 ? 13.730  38.124  7.938   1.00 19.43  ? 113  LEU A CG    1 
ATOM   877   C CD1   . LEU A 1 113 ? 13.353  39.320  8.818   1.00 16.06  ? 113  LEU A CD1   1 
ATOM   878   C CD2   . LEU A 1 113 ? 12.561  37.140  7.860   1.00 19.40  ? 113  LEU A CD2   1 
ATOM   879   N N     . HIS A 1 114 ? 17.335  38.033  6.498   1.00 19.65  ? 114  HIS A N     1 
ATOM   880   C CA    . HIS A 1 114 ? 18.582  37.441  6.987   1.00 20.03  ? 114  HIS A CA    1 
ATOM   881   C C     . HIS A 1 114 ? 19.634  38.509  7.357   1.00 20.33  ? 114  HIS A C     1 
ATOM   882   O O     . HIS A 1 114 ? 20.252  38.445  8.425   1.00 19.35  ? 114  HIS A O     1 
ATOM   883   C CB    . HIS A 1 114 ? 19.126  36.474  5.927   1.00 19.73  ? 114  HIS A CB    1 
ATOM   884   C CG    . HIS A 1 114 ? 20.500  35.954  6.212   1.00 20.42  ? 114  HIS A CG    1 
ATOM   885   N ND1   . HIS A 1 114 ? 21.633  36.513  5.660   1.00 20.71  ? 114  HIS A ND1   1 
ATOM   886   C CD2   . HIS A 1 114 ? 20.924  34.915  6.972   1.00 21.01  ? 114  HIS A CD2   1 
ATOM   887   C CE1   . HIS A 1 114 ? 22.697  35.841  6.067   1.00 21.47  ? 114  HIS A CE1   1 
ATOM   888   N NE2   . HIS A 1 114 ? 22.296  34.868  6.866   1.00 21.86  ? 114  HIS A NE2   1 
ATOM   889   N N     . ARG A 1 115 ? 19.823  39.483  6.467   1.00 20.76  ? 115  ARG A N     1 
ATOM   890   C CA    . ARG A 1 115 ? 20.795  40.555  6.690   1.00 21.73  ? 115  ARG A CA    1 
ATOM   891   C C     . ARG A 1 115 ? 20.516  41.295  7.996   1.00 21.02  ? 115  ARG A C     1 
ATOM   892   O O     . ARG A 1 115 ? 21.426  41.514  8.794   1.00 21.23  ? 115  ARG A O     1 
ATOM   893   C CB    . ARG A 1 115 ? 20.831  41.529  5.499   1.00 21.55  ? 115  ARG A CB    1 
ATOM   894   C CG    . ARG A 1 115 ? 21.981  42.547  5.551   1.00 23.53  ? 115  ARG A CG    1 
ATOM   895   C CD    . ARG A 1 115 ? 22.185  43.229  4.184   1.00 23.72  ? 115  ARG A CD    1 
ATOM   896   N NE    . ARG A 1 115 ? 23.494  43.889  4.036   1.00 28.44  ? 115  ARG A NE    1 
ATOM   897   C CZ    . ARG A 1 115 ? 24.639  43.273  3.718   1.00 30.45  ? 115  ARG A CZ    1 
ATOM   898   N NH1   . ARG A 1 115 ? 24.692  41.949  3.546   1.00 30.05  ? 115  ARG A NH1   1 
ATOM   899   N NH2   . ARG A 1 115 ? 25.756  43.984  3.588   1.00 32.15  ? 115  ARG A NH2   1 
ATOM   900   N N     . ASP A 1 116 ? 19.254  41.655  8.214   1.00 20.93  ? 116  ASP A N     1 
ATOM   901   C CA    . ASP A 1 116 ? 18.860  42.412  9.403   1.00 20.97  ? 116  ASP A CA    1 
ATOM   902   C C     . ASP A 1 116 ? 18.939  41.584  10.672  1.00 20.28  ? 116  ASP A C     1 
ATOM   903   O O     . ASP A 1 116 ? 19.336  42.094  11.719  1.00 19.76  ? 116  ASP A O     1 
ATOM   904   C CB    . ASP A 1 116 ? 17.472  43.046  9.235   1.00 20.79  ? 116  ASP A CB    1 
ATOM   905   C CG    . ASP A 1 116 ? 17.525  44.385  8.500   1.00 23.14  ? 116  ASP A CG    1 
ATOM   906   O OD1   . ASP A 1 116 ? 18.644  44.941  8.307   1.00 23.18  ? 116  ASP A OD1   1 
ATOM   907   O OD2   . ASP A 1 116 ? 16.441  44.882  8.113   1.00 24.27  ? 116  ASP A OD2   1 
ATOM   908   N N     . VAL A 1 117 ? 18.594  40.299  10.564  1.00 19.88  ? 117  VAL A N     1 
ATOM   909   C CA    . VAL A 1 117 ? 18.712  39.373  11.693  1.00 19.38  ? 117  VAL A CA    1 
ATOM   910   C C     . VAL A 1 117 ? 20.183  39.212  12.112  1.00 19.59  ? 117  VAL A C     1 
ATOM   911   O O     . VAL A 1 117 ? 20.484  39.125  13.307  1.00 19.23  ? 117  VAL A O     1 
ATOM   912   C CB    . VAL A 1 117 ? 18.027  38.009  11.399  1.00 19.48  ? 117  VAL A CB    1 
ATOM   913   C CG1   . VAL A 1 117 ? 18.391  36.949  12.443  1.00 18.65  ? 117  VAL A CG1   1 
ATOM   914   C CG2   . VAL A 1 117 ? 16.507  38.181  11.340  1.00 18.40  ? 117  VAL A CG2   1 
ATOM   915   N N     . CYS A 1 118 ? 21.087  39.182  11.127  1.00 19.26  ? 118  CYS A N     1 
ATOM   916   C CA    . CYS A 1 118 ? 22.524  39.108  11.390  1.00 18.95  ? 118  CYS A CA    1 
ATOM   917   C C     . CYS A 1 118 ? 23.027  40.385  12.052  1.00 19.01  ? 118  CYS A C     1 
ATOM   918   O O     . CYS A 1 118 ? 23.749  40.327  13.045  1.00 18.62  ? 118  CYS A O     1 
ATOM   919   C CB    . CYS A 1 118 ? 23.299  38.846  10.095  1.00 19.12  ? 118  CYS A CB    1 
ATOM   920   S SG    . CYS A 1 118 ? 23.153  37.135  9.491   1.00 19.40  ? 118  CYS A SG    1 
ATOM   921   N N     . ARG A 1 119 ? 22.634  41.537  11.500  1.00 19.10  ? 119  ARG A N     1 
ATOM   922   C CA    . ARG A 1 119 ? 22.936  42.836  12.117  1.00 19.24  ? 119  ARG A CA    1 
ATOM   923   C C     . ARG A 1 119 ? 22.450  42.889  13.556  1.00 18.93  ? 119  ARG A C     1 
ATOM   924   O O     . ARG A 1 119 ? 23.209  43.274  14.445  1.00 19.40  ? 119  ARG A O     1 
ATOM   925   C CB    . ARG A 1 119 ? 22.375  44.018  11.307  1.00 18.88  ? 119  ARG A CB    1 
ATOM   926   C CG    . ARG A 1 119 ? 23.092  44.257  9.980   1.00 20.66  ? 119  ARG A CG    1 
ATOM   927   C CD    . ARG A 1 119 ? 22.967  45.706  9.485   1.00 24.03  ? 119  ARG A CD    1 
ATOM   928   N NE    . ARG A 1 119 ? 21.600  46.073  9.112   1.00 26.89  ? 119  ARG A NE    1 
ATOM   929   C CZ    . ARG A 1 119 ? 21.222  47.288  8.702   1.00 28.80  ? 119  ARG A CZ    1 
ATOM   930   N NH1   . ARG A 1 119 ? 22.107  48.275  8.604   1.00 28.79  ? 119  ARG A NH1   1 
ATOM   931   N NH2   . ARG A 1 119 ? 19.951  47.519  8.385   1.00 28.03  ? 119  ARG A NH2   1 
ATOM   932   N N     . PHE A 1 120 ? 21.201  42.486  13.790  1.00 18.88  ? 120  PHE A N     1 
ATOM   933   C CA    . PHE A 1 120 ? 20.639  42.544  15.138  1.00 18.67  ? 120  PHE A CA    1 
ATOM   934   C C     . PHE A 1 120 ? 21.194  41.498  16.089  1.00 18.56  ? 120  PHE A C     1 
ATOM   935   O O     . PHE A 1 120 ? 21.282  41.745  17.292  1.00 18.15  ? 120  PHE A O     1 
ATOM   936   C CB    . PHE A 1 120 ? 19.111  42.490  15.135  1.00 18.60  ? 120  PHE A CB    1 
ATOM   937   C CG    . PHE A 1 120 ? 18.503  43.097  16.365  1.00 19.03  ? 120  PHE A CG    1 
ATOM   938   C CD1   . PHE A 1 120 ? 18.609  44.475  16.599  1.00 19.27  ? 120  PHE A CD1   1 
ATOM   939   C CD2   . PHE A 1 120 ? 17.858  42.298  17.312  1.00 18.38  ? 120  PHE A CD2   1 
ATOM   940   C CE1   . PHE A 1 120 ? 18.066  45.048  17.759  1.00 19.11  ? 120  PHE A CE1   1 
ATOM   941   C CE2   . PHE A 1 120 ? 17.307  42.856  18.459  1.00 18.45  ? 120  PHE A CE2   1 
ATOM   942   C CZ    . PHE A 1 120 ? 17.412  44.238  18.685  1.00 18.70  ? 120  PHE A CZ    1 
ATOM   943   N N     . ALA A 1 121 ? 21.547  40.327  15.554  1.00 18.28  ? 121  ALA A N     1 
ATOM   944   C CA    . ALA A 1 121 ? 22.244  39.307  16.342  1.00 18.34  ? 121  ALA A CA    1 
ATOM   945   C C     . ALA A 1 121 ? 23.566  39.871  16.872  1.00 18.13  ? 121  ALA A C     1 
ATOM   946   O O     . ALA A 1 121 ? 23.881  39.718  18.057  1.00 18.12  ? 121  ALA A O     1 
ATOM   947   C CB    . ALA A 1 121 ? 22.478  38.039  15.519  1.00 18.01  ? 121  ALA A CB    1 
ATOM   948   N N     . ASN A 1 122 ? 24.329  40.530  16.000  1.00 18.29  ? 122  ASN A N     1 
ATOM   949   C CA    . ASN A 1 122 ? 25.567  41.206  16.432  1.00 18.32  ? 122  ASN A CA    1 
ATOM   950   C C     . ASN A 1 122 ? 25.328  42.352  17.424  1.00 18.28  ? 122  ASN A C     1 
ATOM   951   O O     . ASN A 1 122 ? 26.096  42.511  18.374  1.00 18.51  ? 122  ASN A O     1 
ATOM   952   C CB    . ASN A 1 122 ? 26.407  41.682  15.236  1.00 18.31  ? 122  ASN A CB    1 
ATOM   953   C CG    . ASN A 1 122 ? 27.091  40.532  14.505  1.00 18.35  ? 122  ASN A CG    1 
ATOM   954   O OD1   . ASN A 1 122 ? 27.511  39.550  15.119  1.00 18.21  ? 122  ASN A OD1   1 
ATOM   955   N ND2   . ASN A 1 122 ? 27.192  40.647  13.185  1.00 18.39  ? 122  ASN A ND2   1 
ATOM   956   N N     . THR A 1 123 ? 24.273  43.137  17.193  1.00 18.13  ? 123  THR A N     1 
ATOM   957   C CA    . THR A 1 123 ? 23.844  44.189  18.125  1.00 18.41  ? 123  THR A CA    1 
ATOM   958   C C     . THR A 1 123 ? 23.613  43.652  19.535  1.00 18.35  ? 123  THR A C     1 
ATOM   959   O O     . THR A 1 123 ? 24.112  44.227  20.510  1.00 18.55  ? 123  THR A O     1 
ATOM   960   C CB    . THR A 1 123 ? 22.552  44.906  17.636  1.00 18.52  ? 123  THR A CB    1 
ATOM   961   O OG1   . THR A 1 123 ? 22.821  45.580  16.404  1.00 19.00  ? 123  THR A OG1   1 
ATOM   962   C CG2   . THR A 1 123 ? 22.062  45.927  18.666  1.00 18.13  ? 123  THR A CG2   1 
ATOM   963   N N     . LEU A 1 124 ? 22.866  42.551  19.642  1.00 17.93  ? 124  LEU A N     1 
ATOM   964   C CA    . LEU A 1 124 ? 22.611  41.906  20.937  1.00 17.84  ? 124  LEU A CA    1 
ATOM   965   C C     . LEU A 1 124 ? 23.917  41.446  21.602  1.00 18.36  ? 124  LEU A C     1 
ATOM   966   O O     . LEU A 1 124 ? 24.185  41.782  22.766  1.00 18.30  ? 124  LEU A O     1 
ATOM   967   C CB    . LEU A 1 124 ? 21.645  40.725  20.783  1.00 17.64  ? 124  LEU A CB    1 
ATOM   968   C CG    . LEU A 1 124 ? 20.200  41.056  20.362  1.00 16.93  ? 124  LEU A CG    1 
ATOM   969   C CD1   . LEU A 1 124 ? 19.414  39.807  19.969  1.00 15.98  ? 124  LEU A CD1   1 
ATOM   970   C CD2   . LEU A 1 124 ? 19.473  41.816  21.463  1.00 15.76  ? 124  LEU A CD2   1 
ATOM   971   N N     . LEU A 1 125 ? 24.717  40.685  20.857  1.00 18.10  ? 125  LEU A N     1 
ATOM   972   C CA    . LEU A 1 125 ? 26.017  40.230  21.339  1.00 18.55  ? 125  LEU A CA    1 
ATOM   973   C C     . LEU A 1 125 ? 26.914  41.383  21.806  1.00 18.90  ? 125  LEU A C     1 
ATOM   974   O O     . LEU A 1 125 ? 27.536  41.294  22.860  1.00 18.71  ? 125  LEU A O     1 
ATOM   975   C CB    . LEU A 1 125 ? 26.728  39.377  20.281  1.00 17.83  ? 125  LEU A CB    1 
ATOM   976   C CG    . LEU A 1 125 ? 26.108  38.015  19.933  1.00 17.84  ? 125  LEU A CG    1 
ATOM   977   C CD1   . LEU A 1 125 ? 26.706  37.485  18.627  1.00 16.53  ? 125  LEU A CD1   1 
ATOM   978   C CD2   . LEU A 1 125 ? 26.234  36.973  21.067  1.00 15.94  ? 125  LEU A CD2   1 
ATOM   979   N N     . ASP A 1 126 ? 26.947  42.471  21.041  1.00 19.86  ? 126  ASP A N     1 
ATOM   980   C CA    . ASP A 1 126 ? 27.771  43.638  21.388  1.00 20.95  ? 126  ASP A CA    1 
ATOM   981   C C     . ASP A 1 126 ? 27.310  44.345  22.663  1.00 21.51  ? 126  ASP A C     1 
ATOM   982   O O     . ASP A 1 126 ? 28.094  45.029  23.322  1.00 21.62  ? 126  ASP A O     1 
ATOM   983   C CB    . ASP A 1 126 ? 27.798  44.627  20.230  1.00 20.93  ? 126  ASP A CB    1 
ATOM   984   C CG    . ASP A 1 126 ? 28.745  44.204  19.134  1.00 22.92  ? 126  ASP A CG    1 
ATOM   985   O OD1   . ASP A 1 126 ? 29.444  43.170  19.300  1.00 23.27  ? 126  ASP A OD1   1 
ATOM   986   O OD2   . ASP A 1 126 ? 28.805  44.914  18.105  1.00 24.35  ? 126  ASP A OD2   1 
ATOM   987   N N     . LEU A 1 127 ? 26.033  44.170  22.991  1.00 21.85  ? 127  LEU A N     1 
ATOM   988   C CA    . LEU A 1 127 ? 25.417  44.770  24.163  1.00 22.68  ? 127  LEU A CA    1 
ATOM   989   C C     . LEU A 1 127 ? 25.641  43.863  25.373  1.00 22.45  ? 127  LEU A C     1 
ATOM   990   O O     . LEU A 1 127 ? 25.306  44.218  26.508  1.00 22.50  ? 127  LEU A O     1 
ATOM   991   C CB    . LEU A 1 127 ? 23.918  44.950  23.893  1.00 22.68  ? 127  LEU A CB    1 
ATOM   992   C CG    . LEU A 1 127 ? 23.172  46.251  24.212  1.00 24.23  ? 127  LEU A CG    1 
ATOM   993   C CD1   . LEU A 1 127 ? 23.998  47.509  23.947  1.00 25.55  ? 127  LEU A CD1   1 
ATOM   994   C CD2   . LEU A 1 127 ? 21.867  46.292  23.416  1.00 23.79  ? 127  LEU A CD2   1 
ATOM   995   N N     . GLY A 1 128 ? 26.203  42.684  25.125  1.00 22.28  ? 128  GLY A N     1 
ATOM   996   C CA    . GLY A 1 128 ? 26.535  41.763  26.197  1.00 22.09  ? 128  GLY A CA    1 
ATOM   997   C C     . GLY A 1 128 ? 25.488  40.693  26.432  1.00 22.33  ? 128  GLY A C     1 
ATOM   998   O O     . GLY A 1 128 ? 25.584  39.944  27.408  1.00 22.68  ? 128  GLY A O     1 
ATOM   999   N N     . ILE A 1 129 ? 24.478  40.620  25.559  1.00 22.03  ? 129  ILE A N     1 
ATOM   1000  C CA    . ILE A 1 129 ? 23.501  39.529  25.624  1.00 21.39  ? 129  ILE A CA    1 
ATOM   1001  C C     . ILE A 1 129 ? 24.215  38.231  25.243  1.00 21.47  ? 129  ILE A C     1 
ATOM   1002  O O     . ILE A 1 129 ? 24.962  38.193  24.259  1.00 21.52  ? 129  ILE A O     1 
ATOM   1003  C CB    . ILE A 1 129 ? 22.253  39.778  24.707  1.00 21.35  ? 129  ILE A CB    1 
ATOM   1004  C CG1   . ILE A 1 129 ? 21.502  41.063  25.101  1.00 21.23  ? 129  ILE A CG1   1 
ATOM   1005  C CG2   . ILE A 1 129 ? 21.308  38.565  24.699  1.00 20.65  ? 129  ILE A CG2   1 
ATOM   1006  C CD1   . ILE A 1 129 ? 21.109  41.168  26.589  1.00 20.66  ? 129  ILE A CD1   1 
ATOM   1007  N N     . LYS A 1 130 ? 23.996  37.189  26.042  1.00 21.25  ? 130  LYS A N     1 
ATOM   1008  C CA    . LYS A 1 130 ? 24.593  35.878  25.833  1.00 21.54  ? 130  LYS A CA    1 
ATOM   1009  C C     . LYS A 1 130 ? 23.537  34.776  25.693  1.00 21.49  ? 130  LYS A C     1 
ATOM   1010  O O     . LYS A 1 130 ? 22.355  34.974  26.020  1.00 21.15  ? 130  LYS A O     1 
ATOM   1011  C CB    . LYS A 1 130 ? 25.529  35.554  27.006  1.00 22.18  ? 130  LYS A CB    1 
ATOM   1012  C CG    . LYS A 1 130 ? 26.828  36.359  27.001  1.00 23.76  ? 130  LYS A CG    1 
ATOM   1013  C CD    . LYS A 1 130 ? 27.348  36.581  28.413  1.00 27.99  ? 130  LYS A CD    1 
ATOM   1014  N N     . LYS A 1 131 ? 23.972  33.615  25.205  1.00 21.28  ? 131  LYS A N     1 
ATOM   1015  C CA    . LYS A 1 131 ? 23.128  32.427  25.165  1.00 21.00  ? 131  LYS A CA    1 
ATOM   1016  C C     . LYS A 1 131 ? 22.508  32.150  26.535  1.00 20.90  ? 131  LYS A C     1 
ATOM   1017  O O     . LYS A 1 131 ? 23.215  32.088  27.540  1.00 20.24  ? 131  LYS A O     1 
ATOM   1018  C CB    . LYS A 1 131 ? 23.952  31.214  24.742  1.00 21.38  ? 131  LYS A CB    1 
ATOM   1019  C CG    . LYS A 1 131 ? 23.121  29.940  24.556  1.00 21.38  ? 131  LYS A CG    1 
ATOM   1020  C CD    . LYS A 1 131 ? 24.000  28.774  24.143  1.00 22.61  ? 131  LYS A CD    1 
ATOM   1021  C CE    . LYS A 1 131 ? 23.193  27.495  24.116  1.00 22.37  ? 131  LYS A CE    1 
ATOM   1022  N NZ    . LYS A 1 131 ? 23.997  26.342  23.628  1.00 21.56  ? 131  LYS A NZ    1 
ATOM   1023  N N     . GLY A 1 132 ? 21.193  31.968  26.565  1.00 20.56  ? 132  GLY A N     1 
ATOM   1024  C CA    . GLY A 1 132 ? 20.491  31.668  27.809  1.00 20.64  ? 132  GLY A CA    1 
ATOM   1025  C C     . GLY A 1 132 ? 19.880  32.879  28.507  1.00 21.06  ? 132  GLY A C     1 
ATOM   1026  O O     . GLY A 1 132 ? 18.986  32.711  29.335  1.00 20.94  ? 132  GLY A O     1 
ATOM   1027  N N     . ASP A 1 133 ? 20.372  34.089  28.205  1.00 20.90  ? 133  ASP A N     1 
ATOM   1028  C CA    . ASP A 1 133 ? 19.757  35.320  28.719  1.00 20.89  ? 133  ASP A CA    1 
ATOM   1029  C C     . ASP A 1 133 ? 18.349  35.505  28.152  1.00 20.50  ? 133  ASP A C     1 
ATOM   1030  O O     . ASP A 1 133 ? 18.091  35.205  26.982  1.00 20.43  ? 133  ASP A O     1 
ATOM   1031  C CB    . ASP A 1 133 ? 20.567  36.565  28.364  1.00 20.74  ? 133  ASP A CB    1 
ATOM   1032  C CG    . ASP A 1 133 ? 21.930  36.594  29.012  1.00 22.94  ? 133  ASP A CG    1 
ATOM   1033  O OD1   . ASP A 1 133 ? 22.197  35.789  29.939  1.00 22.52  ? 133  ASP A OD1   1 
ATOM   1034  O OD2   . ASP A 1 133 ? 22.739  37.443  28.570  1.00 23.14  ? 133  ASP A OD2   1 
ATOM   1035  N N     . VAL A 1 134 ? 17.455  36.012  28.992  1.00 20.08  ? 134  VAL A N     1 
ATOM   1036  C CA    . VAL A 1 134 ? 16.097  36.321  28.582  1.00 20.38  ? 134  VAL A CA    1 
ATOM   1037  C C     . VAL A 1 134 ? 15.994  37.766  28.095  1.00 20.42  ? 134  VAL A C     1 
ATOM   1038  O O     . VAL A 1 134 ? 16.461  38.714  28.762  1.00 20.77  ? 134  VAL A O     1 
ATOM   1039  C CB    . VAL A 1 134 ? 15.081  36.067  29.720  1.00 20.32  ? 134  VAL A CB    1 
ATOM   1040  C CG1   . VAL A 1 134 ? 13.642  36.293  29.231  1.00 20.74  ? 134  VAL A CG1   1 
ATOM   1041  C CG2   . VAL A 1 134 ? 15.225  34.648  30.263  1.00 20.10  ? 134  VAL A CG2   1 
ATOM   1042  N N     . VAL A 1 135 ? 15.375  37.919  26.931  1.00 20.03  ? 135  VAL A N     1 
ATOM   1043  C CA    . VAL A 1 135 ? 15.142  39.224  26.315  1.00 19.92  ? 135  VAL A CA    1 
ATOM   1044  C C     . VAL A 1 135 ? 13.634  39.472  26.195  1.00 19.98  ? 135  VAL A C     1 
ATOM   1045  O O     . VAL A 1 135 ? 12.928  38.709  25.540  1.00 20.08  ? 135  VAL A O     1 
ATOM   1046  C CB    . VAL A 1 135 ? 15.816  39.294  24.917  1.00 20.03  ? 135  VAL A CB    1 
ATOM   1047  C CG1   . VAL A 1 135 ? 15.508  40.625  24.227  1.00 18.51  ? 135  VAL A CG1   1 
ATOM   1048  C CG2   . VAL A 1 135 ? 17.340  39.062  25.039  1.00 19.53  ? 135  VAL A CG2   1 
ATOM   1049  N N     . ALA A 1 136 ? 13.153  40.525  26.852  1.00 19.89  ? 136  ALA A N     1 
ATOM   1050  C CA    . ALA A 1 136 ? 11.751  40.911  26.794  1.00 19.92  ? 136  ALA A CA    1 
ATOM   1051  C C     . ALA A 1 136 ? 11.490  41.693  25.508  1.00 20.01  ? 136  ALA A C     1 
ATOM   1052  O O     . ALA A 1 136 ? 12.209  42.653  25.202  1.00 20.86  ? 136  ALA A O     1 
ATOM   1053  C CB    . ALA A 1 136 ? 11.378  41.751  28.014  1.00 19.85  ? 136  ALA A CB    1 
ATOM   1054  N N     . ILE A 1 137 ? 10.481  41.268  24.748  1.00 19.40  ? 137  ILE A N     1 
ATOM   1055  C CA    . ILE A 1 137 ? 10.087  41.971  23.529  1.00 18.94  ? 137  ILE A CA    1 
ATOM   1056  C C     . ILE A 1 137 ? 8.653   42.493  23.662  1.00 19.13  ? 137  ILE A C     1 
ATOM   1057  O O     . ILE A 1 137 ? 7.716   41.722  23.813  1.00 18.41  ? 137  ILE A O     1 
ATOM   1058  C CB    . ILE A 1 137 ? 10.270  41.099  22.259  1.00 19.32  ? 137  ILE A CB    1 
ATOM   1059  C CG1   . ILE A 1 137 ? 11.729  40.616  22.142  1.00 17.17  ? 137  ILE A CG1   1 
ATOM   1060  C CG2   . ILE A 1 137 ? 9.834   41.890  21.016  1.00 18.69  ? 137  ILE A CG2   1 
ATOM   1061  C CD1   . ILE A 1 137 ? 11.978  39.573  21.075  1.00 18.32  ? 137  ILE A CD1   1 
ATOM   1062  N N     . TYR A 1 138 ? 8.514   43.815  23.655  1.00 19.27  ? 138  TYR A N     1 
ATOM   1063  C CA    . TYR A 1 138 ? 7.224   44.490  23.855  1.00 19.83  ? 138  TYR A CA    1 
ATOM   1064  C C     . TYR A 1 138 ? 6.981   45.411  22.662  1.00 19.79  ? 138  TYR A C     1 
ATOM   1065  O O     . TYR A 1 138 ? 7.287   46.617  22.691  1.00 19.39  ? 138  TYR A O     1 
ATOM   1066  C CB    . TYR A 1 138 ? 7.251   45.247  25.195  1.00 19.67  ? 138  TYR A CB    1 
ATOM   1067  C CG    . TYR A 1 138 ? 5.966   45.925  25.633  1.00 19.48  ? 138  TYR A CG    1 
ATOM   1068  C CD1   . TYR A 1 138 ? 4.791   45.197  25.866  1.00 18.72  ? 138  TYR A CD1   1 
ATOM   1069  C CD2   . TYR A 1 138 ? 5.946   47.301  25.872  1.00 18.39  ? 138  TYR A CD2   1 
ATOM   1070  C CE1   . TYR A 1 138 ? 3.617   45.841  26.297  1.00 18.17  ? 138  TYR A CE1   1 
ATOM   1071  C CE2   . TYR A 1 138 ? 4.801   47.946  26.311  1.00 19.28  ? 138  TYR A CE2   1 
ATOM   1072  C CZ    . TYR A 1 138 ? 3.635   47.216  26.526  1.00 19.69  ? 138  TYR A CZ    1 
ATOM   1073  O OH    . TYR A 1 138 ? 2.502   47.890  26.968  1.00 19.97  ? 138  TYR A OH    1 
ATOM   1074  N N     . MET A 1 139 ? 6.438   44.816  21.605  1.00 20.17  ? 139  MET A N     1 
ATOM   1075  C CA    . MET A 1 139 ? 6.478   45.387  20.267  1.00 21.20  ? 139  MET A CA    1 
ATOM   1076  C C     . MET A 1 139 ? 5.127   45.335  19.572  1.00 21.88  ? 139  MET A C     1 
ATOM   1077  O O     . MET A 1 139 ? 4.311   44.446  19.868  1.00 22.99  ? 139  MET A O     1 
ATOM   1078  C CB    . MET A 1 139 ? 7.504   44.617  19.418  1.00 21.66  ? 139  MET A CB    1 
ATOM   1079  C CG    . MET A 1 139 ? 8.960   44.918  19.765  1.00 23.00  ? 139  MET A CG    1 
ATOM   1080  S SD    . MET A 1 139 ? 9.444   46.485  19.054  1.00 27.96  ? 139  MET A SD    1 
ATOM   1081  C CE    . MET A 1 139 ? 9.968   45.964  17.427  1.00 23.83  ? 139  MET A CE    1 
ATOM   1082  N N     . PRO A 1 140 ? 4.879   46.283  18.641  1.00 21.76  ? 140  PRO A N     1 
ATOM   1083  C CA    . PRO A 1 140 ? 3.674   46.210  17.822  1.00 21.71  ? 140  PRO A CA    1 
ATOM   1084  C C     . PRO A 1 140 ? 3.916   45.274  16.645  1.00 21.39  ? 140  PRO A C     1 
ATOM   1085  O O     . PRO A 1 140 ? 5.009   44.704  16.533  1.00 21.40  ? 140  PRO A O     1 
ATOM   1086  C CB    . PRO A 1 140 ? 3.467   47.660  17.366  1.00 21.89  ? 140  PRO A CB    1 
ATOM   1087  C CG    . PRO A 1 140 ? 4.843   48.286  17.394  1.00 21.67  ? 140  PRO A CG    1 
ATOM   1088  C CD    . PRO A 1 140 ? 5.716   47.453  18.304  1.00 21.85  ? 140  PRO A CD    1 
ATOM   1089  N N     . MET A 1 141 ? 2.906   45.094  15.794  1.00 20.93  ? 141  MET A N     1 
ATOM   1090  C CA    . MET A 1 141 ? 3.012   44.178  14.657  1.00 20.29  ? 141  MET A CA    1 
ATOM   1091  C C     . MET A 1 141 ? 3.763   44.836  13.492  1.00 20.16  ? 141  MET A C     1 
ATOM   1092  O O     . MET A 1 141 ? 3.173   45.260  12.493  1.00 20.35  ? 141  MET A O     1 
ATOM   1093  C CB    . MET A 1 141 ? 1.632   43.639  14.248  1.00 20.40  ? 141  MET A CB    1 
ATOM   1094  C CG    . MET A 1 141 ? 1.080   42.574  15.221  1.00 20.64  ? 141  MET A CG    1 
ATOM   1095  S SD    . MET A 1 141 ? 1.897   40.984  14.938  1.00 24.11  ? 141  MET A SD    1 
ATOM   1096  C CE    . MET A 1 141 ? 0.827   40.332  13.663  1.00 21.43  ? 141  MET A CE    1 
ATOM   1097  N N     . VAL A 1 142 ? 5.079   44.925  13.658  1.00 19.74  ? 142  VAL A N     1 
ATOM   1098  C CA    . VAL A 1 142 ? 5.988   45.444  12.648  1.00 19.13  ? 142  VAL A CA    1 
ATOM   1099  C C     . VAL A 1 142 ? 7.092   44.407  12.416  1.00 19.42  ? 142  VAL A C     1 
ATOM   1100  O O     . VAL A 1 142 ? 7.352   43.584  13.303  1.00 18.72  ? 142  VAL A O     1 
ATOM   1101  C CB    . VAL A 1 142 ? 6.591   46.820  13.061  1.00 19.40  ? 142  VAL A CB    1 
ATOM   1102  C CG1   . VAL A 1 142 ? 5.490   47.917  13.096  1.00 17.72  ? 142  VAL A CG1   1 
ATOM   1103  C CG2   . VAL A 1 142 ? 7.336   46.723  14.418  1.00 19.02  ? 142  VAL A CG2   1 
ATOM   1104  N N     . PRO A 1 143 ? 7.737   44.434  11.225  1.00 19.26  ? 143  PRO A N     1 
ATOM   1105  C CA    . PRO A 1 143 ? 8.732   43.411  10.872  1.00 19.79  ? 143  PRO A CA    1 
ATOM   1106  C C     . PRO A 1 143 ? 9.903   43.336  11.856  1.00 19.75  ? 143  PRO A C     1 
ATOM   1107  O O     . PRO A 1 143 ? 10.485  42.265  12.030  1.00 19.86  ? 143  PRO A O     1 
ATOM   1108  C CB    . PRO A 1 143 ? 9.239   43.870  9.504   1.00 19.39  ? 143  PRO A CB    1 
ATOM   1109  C CG    . PRO A 1 143 ? 8.129   44.700  8.958   1.00 19.66  ? 143  PRO A CG    1 
ATOM   1110  C CD    . PRO A 1 143 ? 7.574   45.419  10.141  1.00 19.08  ? 143  PRO A CD    1 
ATOM   1111  N N     . GLU A 1 144 ? 10.221  44.460  12.496  1.00 19.33  ? 144  GLU A N     1 
ATOM   1112  C CA    . GLU A 1 144 ? 11.294  44.506  13.498  1.00 19.45  ? 144  GLU A CA    1 
ATOM   1113  C C     . GLU A 1 144 ? 11.044  43.591  14.701  1.00 19.39  ? 144  GLU A C     1 
ATOM   1114  O O     . GLU A 1 144 ? 11.996  43.136  15.327  1.00 19.99  ? 144  GLU A O     1 
ATOM   1115  C CB    . GLU A 1 144 ? 11.555  45.937  13.961  1.00 19.08  ? 144  GLU A CB    1 
ATOM   1116  C CG    . GLU A 1 144 ? 12.166  46.833  12.878  1.00 20.60  ? 144  GLU A CG    1 
ATOM   1117  C CD    . GLU A 1 144 ? 11.115  47.489  11.977  1.00 22.67  ? 144  GLU A CD    1 
ATOM   1118  O OE1   . GLU A 1 144 ? 9.907   47.192  12.110  1.00 20.91  ? 144  GLU A OE1   1 
ATOM   1119  O OE2   . GLU A 1 144 ? 11.503  48.318  11.133  1.00 25.80  ? 144  GLU A OE2   1 
ATOM   1120  N N     . ALA A 1 145 ? 9.776   43.320  15.021  1.00 18.99  ? 145  ALA A N     1 
ATOM   1121  C CA    . ALA A 1 145 ? 9.459   42.355  16.083  1.00 18.86  ? 145  ALA A CA    1 
ATOM   1122  C C     . ALA A 1 145 ? 9.933   40.952  15.680  1.00 18.51  ? 145  ALA A C     1 
ATOM   1123  O O     . ALA A 1 145 ? 10.482  40.218  16.504  1.00 18.36  ? 145  ALA A O     1 
ATOM   1124  C CB    . ALA A 1 145 ? 7.969   42.357  16.427  1.00 17.90  ? 145  ALA A CB    1 
ATOM   1125  N N     . ALA A 1 146 ? 9.737   40.600  14.409  1.00 18.19  ? 146  ALA A N     1 
ATOM   1126  C CA    . ALA A 1 146 ? 10.235  39.322  13.876  1.00 18.32  ? 146  ALA A CA    1 
ATOM   1127  C C     . ALA A 1 146 ? 11.762  39.266  13.888  1.00 18.21  ? 146  ALA A C     1 
ATOM   1128  O O     . ALA A 1 146 ? 12.354  38.243  14.244  1.00 18.61  ? 146  ALA A O     1 
ATOM   1129  C CB    . ALA A 1 146 ? 9.702   39.083  12.454  1.00 18.07  ? 146  ALA A CB    1 
ATOM   1130  N N     . VAL A 1 147 ? 12.396  40.373  13.496  1.00 17.84  ? 147  VAL A N     1 
ATOM   1131  C CA    . VAL A 1 147 ? 13.854  40.447  13.439  1.00 17.57  ? 147  VAL A CA    1 
ATOM   1132  C C     . VAL A 1 147 ? 14.444  40.179  14.817  1.00 17.33  ? 147  VAL A C     1 
ATOM   1133  O O     . VAL A 1 147 ? 15.377  39.390  14.948  1.00 17.77  ? 147  VAL A O     1 
ATOM   1134  C CB    . VAL A 1 147 ? 14.349  41.825  12.900  1.00 17.83  ? 147  VAL A CB    1 
ATOM   1135  C CG1   . VAL A 1 147 ? 15.860  41.940  13.040  1.00 17.05  ? 147  VAL A CG1   1 
ATOM   1136  C CG2   . VAL A 1 147 ? 13.895  42.054  11.451  1.00 16.05  ? 147  VAL A CG2   1 
ATOM   1137  N N     . ALA A 1 148 ? 13.888  40.845  15.827  1.00 17.07  ? 148  ALA A N     1 
ATOM   1138  C CA    . ALA A 1 148 ? 14.298  40.689  17.226  1.00 17.08  ? 148  ALA A CA    1 
ATOM   1139  C C     . ALA A 1 148 ? 14.172  39.235  17.707  1.00 16.89  ? 148  ALA A C     1 
ATOM   1140  O O     . ALA A 1 148 ? 15.094  38.697  18.313  1.00 16.29  ? 148  ALA A O     1 
ATOM   1141  C CB    . ALA A 1 148 ? 13.479  41.630  18.136  1.00 16.42  ? 148  ALA A CB    1 
ATOM   1142  N N     . MET A 1 149 ? 13.020  38.622  17.446  1.00 17.06  ? 149  MET A N     1 
ATOM   1143  C CA    . MET A 1 149 ? 12.760  37.220  17.827  1.00 17.54  ? 149  MET A CA    1 
ATOM   1144  C C     . MET A 1 149 ? 13.744  36.245  17.155  1.00 17.88  ? 149  MET A C     1 
ATOM   1145  O O     . MET A 1 149 ? 14.359  35.420  17.831  1.00 17.69  ? 149  MET A O     1 
ATOM   1146  C CB    . MET A 1 149 ? 11.315  36.839  17.484  1.00 17.74  ? 149  MET A CB    1 
ATOM   1147  C CG    . MET A 1 149 ? 10.274  37.537  18.362  1.00 17.24  ? 149  MET A CG    1 
ATOM   1148  S SD    . MET A 1 149 ? 8.597   37.275  17.779  1.00 18.27  ? 149  MET A SD    1 
ATOM   1149  C CE    . MET A 1 149 ? 8.319   35.564  18.230  1.00 15.97  ? 149  MET A CE    1 
ATOM   1150  N N     . LEU A 1 150 ? 13.889  36.355  15.831  1.00 18.02  ? 150  LEU A N     1 
ATOM   1151  C CA    . LEU A 1 150 ? 14.864  35.544  15.071  1.00 18.04  ? 150  LEU A CA    1 
ATOM   1152  C C     . LEU A 1 150 ? 16.324  35.763  15.485  1.00 18.05  ? 150  LEU A C     1 
ATOM   1153  O O     . LEU A 1 150 ? 17.105  34.805  15.535  1.00 18.43  ? 150  LEU A O     1 
ATOM   1154  C CB    . LEU A 1 150 ? 14.719  35.782  13.567  1.00 17.80  ? 150  LEU A CB    1 
ATOM   1155  C CG    . LEU A 1 150 ? 13.418  35.268  12.932  1.00 18.51  ? 150  LEU A CG    1 
ATOM   1156  C CD1   . LEU A 1 150 ? 13.141  36.017  11.620  1.00 17.30  ? 150  LEU A CD1   1 
ATOM   1157  C CD2   . LEU A 1 150 ? 13.470  33.743  12.711  1.00 17.06  ? 150  LEU A CD2   1 
ATOM   1158  N N     . ALA A 1 151 ? 16.706  37.010  15.769  1.00 17.79  ? 151  ALA A N     1 
ATOM   1159  C CA    . ALA A 1 151 ? 18.073  37.272  16.254  1.00 17.67  ? 151  ALA A CA    1 
ATOM   1160  C C     . ALA A 1 151 ? 18.322  36.637  17.622  1.00 17.26  ? 151  ALA A C     1 
ATOM   1161  O O     . ALA A 1 151 ? 19.405  36.095  17.865  1.00 16.70  ? 151  ALA A O     1 
ATOM   1162  C CB    . ALA A 1 151 ? 18.373  38.765  16.296  1.00 17.67  ? 151  ALA A CB    1 
ATOM   1163  N N     . CYS A 1 152 ? 17.335  36.706  18.517  1.00 17.07  ? 152  CYS A N     1 
ATOM   1164  C CA    . CYS A 1 152 ? 17.479  36.071  19.838  1.00 17.88  ? 152  CYS A CA    1 
ATOM   1165  C C     . CYS A 1 152 ? 17.688  34.568  19.679  1.00 17.89  ? 152  CYS A C     1 
ATOM   1166  O O     . CYS A 1 152 ? 18.600  33.994  20.281  1.00 17.63  ? 152  CYS A O     1 
ATOM   1167  C CB    . CYS A 1 152 ? 16.267  36.343  20.743  1.00 17.60  ? 152  CYS A CB    1 
ATOM   1168  S SG    . CYS A 1 152 ? 16.175  38.023  21.354  1.00 19.61  ? 152  CYS A SG    1 
ATOM   1169  N N     . ALA A 1 153 ? 16.842  33.937  18.856  1.00 17.98  ? 153  ALA A N     1 
ATOM   1170  C CA    . ALA A 1 153 ? 16.965  32.510  18.575  1.00 17.89  ? 153  ALA A CA    1 
ATOM   1171  C C     . ALA A 1 153 ? 18.322  32.168  17.947  1.00 18.24  ? 153  ALA A C     1 
ATOM   1172  O O     . ALA A 1 153 ? 18.935  31.158  18.299  1.00 18.69  ? 153  ALA A O     1 
ATOM   1173  C CB    . ALA A 1 153 ? 15.809  32.035  17.678  1.00 17.50  ? 153  ALA A CB    1 
ATOM   1174  N N     . ARG A 1 154 ? 18.787  33.006  17.017  1.00 18.40  ? 154  ARG A N     1 
ATOM   1175  C CA    . ARG A 1 154 ? 20.060  32.778  16.334  1.00 18.67  ? 154  ARG A CA    1 
ATOM   1176  C C     . ARG A 1 154 ? 21.249  32.630  17.285  1.00 18.84  ? 154  ARG A C     1 
ATOM   1177  O O     . ARG A 1 154 ? 22.106  31.758  17.095  1.00 19.31  ? 154  ARG A O     1 
ATOM   1178  C CB    . ARG A 1 154 ? 20.343  33.908  15.342  1.00 19.01  ? 154  ARG A CB    1 
ATOM   1179  C CG    . ARG A 1 154 ? 21.419  33.569  14.309  1.00 18.55  ? 154  ARG A CG    1 
ATOM   1180  C CD    . ARG A 1 154 ? 21.629  34.727  13.351  1.00 18.83  ? 154  ARG A CD    1 
ATOM   1181  N NE    . ARG A 1 154 ? 22.636  34.463  12.317  1.00 20.04  ? 154  ARG A NE    1 
ATOM   1182  C CZ    . ARG A 1 154 ? 22.408  33.802  11.178  1.00 19.82  ? 154  ARG A CZ    1 
ATOM   1183  N NH1   . ARG A 1 154 ? 21.216  33.278  10.915  1.00 19.02  ? 154  ARG A NH1   1 
ATOM   1184  N NH2   . ARG A 1 154 ? 23.387  33.648  10.299  1.00 18.41  ? 154  ARG A NH2   1 
ATOM   1185  N N     . ILE A 1 155 ? 21.309  33.499  18.289  1.00 18.92  ? 155  ILE A N     1 
ATOM   1186  C CA    . ILE A 1 155 ? 22.395  33.491  19.266  1.00 18.89  ? 155  ILE A CA    1 
ATOM   1187  C C     . ILE A 1 155 ? 22.075  32.624  20.500  1.00 19.07  ? 155  ILE A C     1 
ATOM   1188  O O     . ILE A 1 155 ? 22.888  32.511  21.414  1.00 19.29  ? 155  ILE A O     1 
ATOM   1189  C CB    . ILE A 1 155 ? 22.813  34.948  19.674  1.00 19.04  ? 155  ILE A CB    1 
ATOM   1190  C CG1   . ILE A 1 155 ? 21.754  35.619  20.567  1.00 18.94  ? 155  ILE A CG1   1 
ATOM   1191  C CG2   . ILE A 1 155 ? 23.077  35.790  18.429  1.00 18.38  ? 155  ILE A CG2   1 
ATOM   1192  C CD1   . ILE A 1 155 ? 22.148  37.037  21.015  1.00 18.54  ? 155  ILE A CD1   1 
ATOM   1193  N N     . GLY A 1 156 ? 20.894  32.012  20.523  1.00 19.25  ? 156  GLY A N     1 
ATOM   1194  C CA    . GLY A 1 156 ? 20.496  31.172  21.659  1.00 19.24  ? 156  GLY A CA    1 
ATOM   1195  C C     . GLY A 1 156 ? 20.043  31.936  22.895  1.00 19.42  ? 156  GLY A C     1 
ATOM   1196  O O     . GLY A 1 156 ? 20.000  31.381  23.994  1.00 19.20  ? 156  GLY A O     1 
ATOM   1197  N N     . ALA A 1 157 ? 19.730  33.220  22.729  1.00 19.44  ? 157  ALA A N     1 
ATOM   1198  C CA    . ALA A 1 157 ? 19.081  33.988  23.790  1.00 19.55  ? 157  ALA A CA    1 
ATOM   1199  C C     . ALA A 1 157 ? 17.641  33.481  23.867  1.00 19.68  ? 157  ALA A C     1 
ATOM   1200  O O     . ALA A 1 157 ? 17.166  32.803  22.950  1.00 20.68  ? 157  ALA A O     1 
ATOM   1201  C CB    . ALA A 1 157 ? 19.121  35.481  23.481  1.00 19.31  ? 157  ALA A CB    1 
ATOM   1202  N N     . VAL A 1 158 ? 16.952  33.783  24.956  1.00 19.56  ? 158  VAL A N     1 
ATOM   1203  C CA    . VAL A 1 158 ? 15.610  33.244  25.171  1.00 18.63  ? 158  VAL A CA    1 
ATOM   1204  C C     . VAL A 1 158 ? 14.672  34.428  25.168  1.00 19.12  ? 158  VAL A C     1 
ATOM   1205  O O     . VAL A 1 158 ? 14.669  35.225  26.114  1.00 19.19  ? 158  VAL A O     1 
ATOM   1206  C CB    . VAL A 1 158 ? 15.520  32.470  26.511  1.00 18.79  ? 158  VAL A CB    1 
ATOM   1207  C CG1   . VAL A 1 158 ? 14.098  31.935  26.757  1.00 18.05  ? 158  VAL A CG1   1 
ATOM   1208  C CG2   . VAL A 1 158 ? 16.544  31.341  26.561  1.00 16.13  ? 158  VAL A CG2   1 
ATOM   1209  N N     . HIS A 1 159 ? 13.913  34.588  24.088  1.00 19.10  ? 159  HIS A N     1 
ATOM   1210  C CA    . HIS A 1 159 ? 13.017  35.726  24.020  1.00 18.67  ? 159  HIS A CA    1 
ATOM   1211  C C     . HIS A 1 159 ? 11.751  35.462  24.822  1.00 18.98  ? 159  HIS A C     1 
ATOM   1212  O O     . HIS A 1 159 ? 11.307  34.312  24.971  1.00 18.67  ? 159  HIS A O     1 
ATOM   1213  C CB    . HIS A 1 159 ? 12.750  36.207  22.579  1.00 18.78  ? 159  HIS A CB    1 
ATOM   1214  C CG    . HIS A 1 159 ? 11.961  35.257  21.725  1.00 18.51  ? 159  HIS A CG    1 
ATOM   1215  N ND1   . HIS A 1 159 ? 10.638  34.947  21.970  1.00 18.48  ? 159  HIS A ND1   1 
ATOM   1216  C CD2   . HIS A 1 159 ? 12.300  34.588  20.594  1.00 17.62  ? 159  HIS A CD2   1 
ATOM   1217  C CE1   . HIS A 1 159 ? 10.204  34.111  21.039  1.00 19.53  ? 159  HIS A CE1   1 
ATOM   1218  N NE2   . HIS A 1 159 ? 11.193  33.875  20.194  1.00 18.37  ? 159  HIS A NE2   1 
ATOM   1219  N N     . SER A 1 160 ? 11.208  36.533  25.383  1.00 18.78  ? 160  SER A N     1 
ATOM   1220  C CA    . SER A 1 160 ? 9.951   36.464  26.098  1.00 19.16  ? 160  SER A CA    1 
ATOM   1221  C C     . SER A 1 160 ? 9.104   37.612  25.576  1.00 19.03  ? 160  SER A C     1 
ATOM   1222  O O     . SER A 1 160 ? 9.260   38.747  26.017  1.00 19.02  ? 160  SER A O     1 
ATOM   1223  C CB    . SER A 1 160 ? 10.186  36.578  27.602  1.00 18.84  ? 160  SER A CB    1 
ATOM   1224  O OG    . SER A 1 160 ? 8.957   36.650  28.304  1.00 19.74  ? 160  SER A OG    1 
ATOM   1225  N N     . VAL A 1 161 ? 8.240   37.316  24.604  1.00 18.92  ? 161  VAL A N     1 
ATOM   1226  C CA    . VAL A 1 161 ? 7.451   38.353  23.934  1.00 18.41  ? 161  VAL A CA    1 
ATOM   1227  C C     . VAL A 1 161 ? 6.236   38.684  24.796  1.00 18.93  ? 161  VAL A C     1 
ATOM   1228  O O     . VAL A 1 161 ? 5.530   37.788  25.256  1.00 18.86  ? 161  VAL A O     1 
ATOM   1229  C CB    . VAL A 1 161 ? 7.032   37.956  22.485  1.00 18.78  ? 161  VAL A CB    1 
ATOM   1230  C CG1   . VAL A 1 161 ? 6.294   39.098  21.811  1.00 17.88  ? 161  VAL A CG1   1 
ATOM   1231  C CG2   . VAL A 1 161 ? 8.268   37.580  21.632  1.00 17.11  ? 161  VAL A CG2   1 
ATOM   1232  N N     . ILE A 1 162 ? 6.038   39.978  25.041  1.00 18.86  ? 162  ILE A N     1 
ATOM   1233  C CA    . ILE A 1 162 ? 4.949   40.470  25.871  1.00 18.96  ? 162  ILE A CA    1 
ATOM   1234  C C     . ILE A 1 162 ? 3.991   41.228  24.965  1.00 19.13  ? 162  ILE A C     1 
ATOM   1235  O O     . ILE A 1 162 ? 4.376   42.213  24.317  1.00 18.98  ? 162  ILE A O     1 
ATOM   1236  C CB    . ILE A 1 162 ? 5.451   41.405  27.007  1.00 18.90  ? 162  ILE A CB    1 
ATOM   1237  C CG1   . ILE A 1 162 ? 6.481   40.697  27.898  1.00 18.20  ? 162  ILE A CG1   1 
ATOM   1238  C CG2   . ILE A 1 162 ? 4.277   41.898  27.838  1.00 18.16  ? 162  ILE A CG2   1 
ATOM   1239  C CD1   . ILE A 1 162 ? 7.364   41.658  28.751  1.00 18.98  ? 162  ILE A CD1   1 
ATOM   1240  N N     . PHE A 1 163 ? 2.754   40.737  24.901  1.00 19.50  ? 163  PHE A N     1 
ATOM   1241  C CA    . PHE A 1 163 ? 1.696   41.347  24.088  1.00 20.01  ? 163  PHE A CA    1 
ATOM   1242  C C     . PHE A 1 163 ? 1.583   42.831  24.398  1.00 20.25  ? 163  PHE A C     1 
ATOM   1243  O O     . PHE A 1 163 ? 1.533   43.234  25.575  1.00 19.80  ? 163  PHE A O     1 
ATOM   1244  C CB    . PHE A 1 163 ? 0.367   40.629  24.345  1.00 20.22  ? 163  PHE A CB    1 
ATOM   1245  C CG    . PHE A 1 163 ? -0.852  41.327  23.762  1.00 21.30  ? 163  PHE A CG    1 
ATOM   1246  C CD1   . PHE A 1 163 ? -1.042  41.408  22.383  1.00 21.15  ? 163  PHE A CD1   1 
ATOM   1247  C CD2   . PHE A 1 163 ? -1.835  41.836  24.601  1.00 20.15  ? 163  PHE A CD2   1 
ATOM   1248  C CE1   . PHE A 1 163 ? -2.191  42.006  21.849  1.00 21.51  ? 163  PHE A CE1   1 
ATOM   1249  C CE2   . PHE A 1 163 ? -2.974  42.432  24.086  1.00 21.10  ? 163  PHE A CE2   1 
ATOM   1250  C CZ    . PHE A 1 163 ? -3.148  42.527  22.697  1.00 22.27  ? 163  PHE A CZ    1 
ATOM   1251  N N     . GLY A 1 164 ? 1.564   43.628  23.328  1.00 20.95  ? 164  GLY A N     1 
ATOM   1252  C CA    . GLY A 1 164 ? 1.616   45.095  23.393  1.00 21.23  ? 164  GLY A CA    1 
ATOM   1253  C C     . GLY A 1 164 ? 0.461   45.757  24.128  1.00 21.68  ? 164  GLY A C     1 
ATOM   1254  O O     . GLY A 1 164 ? 0.551   46.928  24.504  1.00 21.68  ? 164  GLY A O     1 
ATOM   1255  N N     . GLY A 1 165 ? -0.617  45.009  24.336  1.00 21.50  ? 165  GLY A N     1 
ATOM   1256  C CA    . GLY A 1 165 ? -1.777  45.527  25.046  1.00 21.76  ? 165  GLY A CA    1 
ATOM   1257  C C     . GLY A 1 165 ? -1.725  45.345  26.552  1.00 21.66  ? 165  GLY A C     1 
ATOM   1258  O O     . GLY A 1 165 ? -2.657  45.733  27.244  1.00 22.02  ? 165  GLY A O     1 
ATOM   1259  N N     . PHE A 1 166 ? -0.655  44.745  27.071  1.00 21.28  ? 166  PHE A N     1 
ATOM   1260  C CA    . PHE A 1 166 ? -0.496  44.634  28.521  1.00 20.90  ? 166  PHE A CA    1 
ATOM   1261  C C     . PHE A 1 166 ? -0.073  45.970  29.138  1.00 21.03  ? 166  PHE A C     1 
ATOM   1262  O O     . PHE A 1 166 ? 0.697   46.730  28.544  1.00 20.37  ? 166  PHE A O     1 
ATOM   1263  C CB    . PHE A 1 166 ? 0.493   43.526  28.908  1.00 21.04  ? 166  PHE A CB    1 
ATOM   1264  C CG    . PHE A 1 166 ? -0.110  42.143  28.943  1.00 20.85  ? 166  PHE A CG    1 
ATOM   1265  C CD1   . PHE A 1 166 ? 0.394   41.133  28.134  1.00 21.52  ? 166  PHE A CD1   1 
ATOM   1266  C CD2   . PHE A 1 166 ? -1.175  41.849  29.796  1.00 22.39  ? 166  PHE A CD2   1 
ATOM   1267  C CE1   . PHE A 1 166 ? -0.160  39.854  28.147  1.00 21.40  ? 166  PHE A CE1   1 
ATOM   1268  C CE2   . PHE A 1 166 ? -1.732  40.563  29.827  1.00 22.92  ? 166  PHE A CE2   1 
ATOM   1269  C CZ    . PHE A 1 166 ? -1.215  39.567  28.996  1.00 22.60  ? 166  PHE A CZ    1 
ATOM   1270  N N     . SER A 1 167 ? -0.591  46.234  30.337  1.00 21.32  ? 167  SER A N     1 
ATOM   1271  C CA    . SER A 1 167 ? -0.287  47.439  31.104  1.00 21.81  ? 167  SER A CA    1 
ATOM   1272  C C     . SER A 1 167 ? 1.149   47.439  31.625  1.00 21.59  ? 167  SER A C     1 
ATOM   1273  O O     . SER A 1 167 ? 1.808   46.401  31.597  1.00 21.95  ? 167  SER A O     1 
ATOM   1274  C CB    . SER A 1 167 ? -1.281  47.567  32.265  1.00 22.05  ? 167  SER A CB    1 
ATOM   1275  O OG    . SER A 1 167 ? -1.022  46.603  33.286  1.00 22.97  ? 167  SER A OG    1 
ATOM   1276  N N     . PRO A 1 168 ? 1.665   48.613  32.057  1.00 21.82  ? 168  PRO A N     1 
ATOM   1277  C CA    . PRO A 1 168 ? 2.959   48.658  32.749  1.00 21.86  ? 168  PRO A CA    1 
ATOM   1278  C C     . PRO A 1 168 ? 3.117   47.639  33.874  1.00 22.09  ? 168  PRO A C     1 
ATOM   1279  O O     . PRO A 1 168 ? 4.153   46.972  33.948  1.00 22.09  ? 168  PRO A O     1 
ATOM   1280  C CB    . PRO A 1 168 ? 3.019   50.089  33.285  1.00 21.69  ? 168  PRO A CB    1 
ATOM   1281  C CG    . PRO A 1 168 ? 2.281   50.876  32.251  1.00 21.67  ? 168  PRO A CG    1 
ATOM   1282  C CD    . PRO A 1 168 ? 1.127   49.973  31.843  1.00 22.03  ? 168  PRO A CD    1 
ATOM   1283  N N     . GLU A 1 169 ? 2.108   47.504  34.731  1.00 22.57  ? 169  GLU A N     1 
ATOM   1284  C CA    . GLU A 1 169 ? 2.153   46.518  35.808  1.00 23.11  ? 169  GLU A CA    1 
ATOM   1285  C C     . GLU A 1 169 ? 2.315   45.077  35.292  1.00 22.38  ? 169  GLU A C     1 
ATOM   1286  O O     . GLU A 1 169 ? 3.066   44.288  35.868  1.00 22.26  ? 169  GLU A O     1 
ATOM   1287  C CB    . GLU A 1 169 ? 0.907   46.626  36.691  1.00 24.02  ? 169  GLU A CB    1 
ATOM   1288  C CG    . GLU A 1 169 ? 0.971   45.806  37.980  1.00 27.39  ? 169  GLU A CG    1 
ATOM   1289  C CD    . GLU A 1 169 ? 1.886   46.421  39.027  1.00 32.57  ? 169  GLU A CD    1 
ATOM   1290  O OE1   . GLU A 1 169 ? 1.966   47.674  39.110  1.00 34.56  ? 169  GLU A OE1   1 
ATOM   1291  O OE2   . GLU A 1 169 ? 2.530   45.648  39.772  1.00 35.06  ? 169  GLU A OE2   1 
ATOM   1292  N N     . ALA A 1 170 ? 1.607   44.734  34.221  1.00 21.62  ? 170  ALA A N     1 
ATOM   1293  C CA    . ALA A 1 170 ? 1.696   43.392  33.671  1.00 21.46  ? 170  ALA A CA    1 
ATOM   1294  C C     . ALA A 1 170 ? 3.074   43.161  33.035  1.00 21.27  ? 170  ALA A C     1 
ATOM   1295  O O     . ALA A 1 170 ? 3.623   42.076  33.135  1.00 21.70  ? 170  ALA A O     1 
ATOM   1296  C CB    . ALA A 1 170 ? 0.578   43.142  32.677  1.00 21.29  ? 170  ALA A CB    1 
ATOM   1297  N N     . VAL A 1 171 ? 3.621   44.192  32.398  1.00 20.84  ? 171  VAL A N     1 
ATOM   1298  C CA    . VAL A 1 171 ? 4.962   44.140  31.807  1.00 20.31  ? 171  VAL A CA    1 
ATOM   1299  C C     . VAL A 1 171 ? 6.043   43.969  32.899  1.00 20.43  ? 171  VAL A C     1 
ATOM   1300  O O     . VAL A 1 171 ? 6.931   43.113  32.772  1.00 19.71  ? 171  VAL A O     1 
ATOM   1301  C CB    . VAL A 1 171 ? 5.233   45.409  30.928  1.00 20.30  ? 171  VAL A CB    1 
ATOM   1302  C CG1   . VAL A 1 171 ? 6.710   45.539  30.554  1.00 20.56  ? 171  VAL A CG1   1 
ATOM   1303  C CG2   . VAL A 1 171 ? 4.365   45.392  29.677  1.00 19.69  ? 171  VAL A CG2   1 
ATOM   1304  N N     . ALA A 1 172 ? 5.956   44.764  33.971  1.00 19.76  ? 172  ALA A N     1 
ATOM   1305  C CA    . ALA A 1 172 ? 6.882   44.626  35.102  1.00 20.53  ? 172  ALA A CA    1 
ATOM   1306  C C     . ALA A 1 172 ? 6.915   43.204  35.687  1.00 20.66  ? 172  ALA A C     1 
ATOM   1307  O O     . ALA A 1 172 ? 7.987   42.656  35.922  1.00 20.54  ? 172  ALA A O     1 
ATOM   1308  C CB    . ALA A 1 172 ? 6.579   45.670  36.212  1.00 20.32  ? 172  ALA A CB    1 
ATOM   1309  N N     . GLY A 1 173 ? 5.743   42.618  35.927  1.00 21.21  ? 173  GLY A N     1 
ATOM   1310  C CA    . GLY A 1 173 ? 5.656   41.250  36.464  1.00 21.37  ? 173  GLY A CA    1 
ATOM   1311  C C     . GLY A 1 173 ? 6.412   40.217  35.636  1.00 21.76  ? 173  GLY A C     1 
ATOM   1312  O O     . GLY A 1 173 ? 7.145   39.380  36.187  1.00 22.02  ? 173  GLY A O     1 
ATOM   1313  N N     . ARG A 1 174 ? 6.237   40.279  34.315  1.00 21.85  ? 174  ARG A N     1 
ATOM   1314  C CA    . ARG A 1 174 ? 6.923   39.377  33.381  1.00 22.00  ? 174  ARG A CA    1 
ATOM   1315  C C     . ARG A 1 174 ? 8.438   39.594  33.355  1.00 22.13  ? 174  ARG A C     1 
ATOM   1316  O O     . ARG A 1 174 ? 9.204   38.618  33.302  1.00 22.09  ? 174  ARG A O     1 
ATOM   1317  C CB    . ARG A 1 174 ? 6.320   39.494  31.963  1.00 22.21  ? 174  ARG A CB    1 
ATOM   1318  C CG    . ARG A 1 174 ? 4.937   38.861  31.861  1.00 21.38  ? 174  ARG A CG    1 
ATOM   1319  C CD    . ARG A 1 174 ? 4.099   39.450  30.731  1.00 21.23  ? 174  ARG A CD    1 
ATOM   1320  N NE    . ARG A 1 174 ? 2.817   38.755  30.627  1.00 19.33  ? 174  ARG A NE    1 
ATOM   1321  C CZ    . ARG A 1 174 ? 1.776   38.982  31.424  1.00 20.19  ? 174  ARG A CZ    1 
ATOM   1322  N NH1   . ARG A 1 174 ? 1.851   39.898  32.383  1.00 16.96  ? 174  ARG A NH1   1 
ATOM   1323  N NH2   . ARG A 1 174 ? 0.653   38.290  31.266  1.00 20.52  ? 174  ARG A NH2   1 
ATOM   1324  N N     . ILE A 1 175 ? 8.863   40.862  33.402  1.00 22.23  ? 175  ILE A N     1 
ATOM   1325  C CA    . ILE A 1 175 ? 10.294  41.228  33.461  1.00 22.07  ? 175  ILE A CA    1 
ATOM   1326  C C     . ILE A 1 175 ? 10.934  40.710  34.741  1.00 22.46  ? 175  ILE A C     1 
ATOM   1327  O O     . ILE A 1 175 ? 12.043  40.161  34.706  1.00 22.38  ? 175  ILE A O     1 
ATOM   1328  C CB    . ILE A 1 175 ? 10.516  42.768  33.332  1.00 22.32  ? 175  ILE A CB    1 
ATOM   1329  C CG1   . ILE A 1 175 ? 10.275  43.234  31.890  1.00 21.45  ? 175  ILE A CG1   1 
ATOM   1330  C CG2   . ILE A 1 175 ? 11.926  43.175  33.792  1.00 21.43  ? 175  ILE A CG2   1 
ATOM   1331  C CD1   . ILE A 1 175 ? 10.198  44.765  31.739  1.00 22.17  ? 175  ILE A CD1   1 
ATOM   1332  N N     . ILE A 1 176 ? 10.222  40.869  35.862  1.00 22.77  ? 176  ILE A N     1 
ATOM   1333  C CA    . ILE A 1 176 ? 10.695  40.402  37.177  1.00 22.87  ? 176  ILE A CA    1 
ATOM   1334  C C     . ILE A 1 176 ? 10.852  38.878  37.226  1.00 23.24  ? 176  ILE A C     1 
ATOM   1335  O O     . ILE A 1 176 ? 11.908  38.368  37.588  1.00 23.12  ? 176  ILE A O     1 
ATOM   1336  C CB    . ILE A 1 176 ? 9.767   40.877  38.327  1.00 23.07  ? 176  ILE A CB    1 
ATOM   1337  C CG1   . ILE A 1 176 ? 9.852   42.405  38.494  1.00 23.26  ? 176  ILE A CG1   1 
ATOM   1338  C CG2   . ILE A 1 176 ? 10.134  40.195  39.650  1.00 22.81  ? 176  ILE A CG2   1 
ATOM   1339  C CD1   . ILE A 1 176 ? 8.711   43.019  39.275  1.00 22.79  ? 176  ILE A CD1   1 
ATOM   1340  N N     . ASP A 1 177 ? 9.802   38.156  36.847  1.00 23.97  ? 177  ASP A N     1 
ATOM   1341  C CA    . ASP A 1 177 ? 9.832   36.697  36.863  1.00 24.74  ? 177  ASP A CA    1 
ATOM   1342  C C     . ASP A 1 177 ? 10.951  36.094  36.005  1.00 24.51  ? 177  ASP A C     1 
ATOM   1343  O O     . ASP A 1 177 ? 11.596  35.124  36.415  1.00 24.49  ? 177  ASP A O     1 
ATOM   1344  C CB    . ASP A 1 177 ? 8.495   36.115  36.415  1.00 25.02  ? 177  ASP A CB    1 
ATOM   1345  C CG    . ASP A 1 177 ? 8.426   34.615  36.635  1.00 27.41  ? 177  ASP A CG    1 
ATOM   1346  O OD1   . ASP A 1 177 ? 8.708   33.846  35.687  1.00 29.15  ? 177  ASP A OD1   1 
ATOM   1347  O OD2   . ASP A 1 177 ? 8.123   34.202  37.778  1.00 30.82  ? 177  ASP A OD2   1 
ATOM   1348  N N     . SER A 1 178 ? 11.165  36.667  34.824  1.00 23.86  ? 178  SER A N     1 
ATOM   1349  C CA    . SER A 1 178 ? 12.117  36.133  33.851  1.00 23.65  ? 178  SER A CA    1 
ATOM   1350  C C     . SER A 1 178 ? 13.550  36.672  34.014  1.00 23.71  ? 178  SER A C     1 
ATOM   1351  O O     . SER A 1 178 ? 14.476  36.179  33.363  1.00 23.49  ? 178  SER A O     1 
ATOM   1352  C CB    . SER A 1 178 ? 11.615  36.416  32.435  1.00 23.49  ? 178  SER A CB    1 
ATOM   1353  O OG    . SER A 1 178 ? 11.609  37.814  32.182  1.00 23.24  ? 178  SER A OG    1 
ATOM   1354  N N     . SER A 1 179 ? 13.725  37.676  34.878  1.00 23.83  ? 179  SER A N     1 
ATOM   1355  C CA    . SER A 1 179 ? 14.990  38.415  34.995  1.00 23.92  ? 179  SER A CA    1 
ATOM   1356  C C     . SER A 1 179 ? 15.504  38.890  33.615  1.00 23.75  ? 179  SER A C     1 
ATOM   1357  O O     . SER A 1 179 ? 16.679  38.711  33.278  1.00 23.67  ? 179  SER A O     1 
ATOM   1358  C CB    . SER A 1 179 ? 16.054  37.582  35.735  1.00 24.18  ? 179  SER A CB    1 
ATOM   1359  O OG    . SER A 1 179 ? 15.785  37.499  37.130  1.00 24.89  ? 179  SER A OG    1 
ATOM   1360  N N     . SER A 1 180 ? 14.613  39.487  32.823  1.00 23.58  ? 180  SER A N     1 
ATOM   1361  C CA    . SER A 1 180 ? 14.977  40.004  31.492  1.00 23.25  ? 180  SER A CA    1 
ATOM   1362  C C     . SER A 1 180 ? 16.078  41.052  31.607  1.00 22.83  ? 180  SER A C     1 
ATOM   1363  O O     . SER A 1 180 ? 16.007  41.962  32.451  1.00 22.35  ? 180  SER A O     1 
ATOM   1364  C CB    . SER A 1 180 ? 13.767  40.608  30.773  1.00 23.21  ? 180  SER A CB    1 
ATOM   1365  O OG    . SER A 1 180 ? 12.730  39.654  30.599  1.00 23.64  ? 180  SER A OG    1 
ATOM   1366  N N     . ARG A 1 181 ? 17.089  40.907  30.753  1.00 22.66  ? 181  ARG A N     1 
ATOM   1367  C CA    . ARG A 1 181 ? 18.286  41.747  30.774  1.00 22.90  ? 181  ARG A CA    1 
ATOM   1368  C C     . ARG A 1 181 ? 18.143  42.968  29.868  1.00 22.21  ? 181  ARG A C     1 
ATOM   1369  O O     . ARG A 1 181 ? 18.931  43.920  29.943  1.00 21.49  ? 181  ARG A O     1 
ATOM   1370  C CB    . ARG A 1 181 ? 19.498  40.914  30.328  1.00 23.44  ? 181  ARG A CB    1 
ATOM   1371  C CG    . ARG A 1 181 ? 20.088  40.034  31.425  1.00 26.28  ? 181  ARG A CG    1 
ATOM   1372  C CD    . ARG A 1 181 ? 21.495  39.564  31.050  1.00 31.29  ? 181  ARG A CD    1 
ATOM   1373  N NE    . ARG A 1 181 ? 22.384  40.688  30.755  1.00 33.01  ? 181  ARG A NE    1 
ATOM   1374  C CZ    . ARG A 1 181 ? 23.589  40.581  30.208  1.00 33.74  ? 181  ARG A CZ    1 
ATOM   1375  N NH1   . ARG A 1 181 ? 24.088  39.390  29.896  1.00 33.97  ? 181  ARG A NH1   1 
ATOM   1376  N NH2   . ARG A 1 181 ? 24.299  41.680  29.977  1.00 35.32  ? 181  ARG A NH2   1 
ATOM   1377  N N     . LEU A 1 182 ? 17.133  42.913  29.003  1.00 21.58  ? 182  LEU A N     1 
ATOM   1378  C CA    . LEU A 1 182 ? 16.946  43.884  27.941  1.00 20.91  ? 182  LEU A CA    1 
ATOM   1379  C C     . LEU A 1 182 ? 15.469  43.910  27.562  1.00 20.33  ? 182  LEU A C     1 
ATOM   1380  O O     . LEU A 1 182 ? 14.798  42.867  27.540  1.00 19.68  ? 182  LEU A O     1 
ATOM   1381  C CB    . LEU A 1 182 ? 17.808  43.504  26.716  1.00 21.14  ? 182  LEU A CB    1 
ATOM   1382  C CG    . LEU A 1 182 ? 17.653  44.302  25.404  1.00 21.51  ? 182  LEU A CG    1 
ATOM   1383  C CD1   . LEU A 1 182 ? 18.425  45.600  25.457  1.00 22.60  ? 182  LEU A CD1   1 
ATOM   1384  C CD2   . LEU A 1 182 ? 18.109  43.500  24.220  1.00 21.31  ? 182  LEU A CD2   1 
ATOM   1385  N N     . VAL A 1 183 ? 14.965  45.111  27.276  1.00 19.30  ? 183  VAL A N     1 
ATOM   1386  C CA    . VAL A 1 183 ? 13.626  45.267  26.719  1.00 18.25  ? 183  VAL A CA    1 
ATOM   1387  C C     . VAL A 1 183 ? 13.757  45.862  25.329  1.00 18.41  ? 183  VAL A C     1 
ATOM   1388  O O     . VAL A 1 183 ? 14.513  46.826  25.131  1.00 18.06  ? 183  VAL A O     1 
ATOM   1389  C CB    . VAL A 1 183 ? 12.712  46.186  27.583  1.00 17.66  ? 183  VAL A CB    1 
ATOM   1390  C CG1   . VAL A 1 183 ? 11.316  46.317  26.948  1.00 16.97  ? 183  VAL A CG1   1 
ATOM   1391  C CG2   . VAL A 1 183 ? 12.599  45.650  29.004  1.00 17.11  ? 183  VAL A CG2   1 
ATOM   1392  N N     . ILE A 1 184 ? 13.022  45.281  24.377  1.00 17.92  ? 184  ILE A N     1 
ATOM   1393  C CA    . ILE A 1 184 ? 12.956  45.794  23.013  1.00 17.62  ? 184  ILE A CA    1 
ATOM   1394  C C     . ILE A 1 184 ? 11.527  46.248  22.740  1.00 17.94  ? 184  ILE A C     1 
ATOM   1395  O O     . ILE A 1 184 ? 10.571  45.489  22.912  1.00 18.10  ? 184  ILE A O     1 
ATOM   1396  C CB    . ILE A 1 184 ? 13.401  44.739  21.965  1.00 17.72  ? 184  ILE A CB    1 
ATOM   1397  C CG1   . ILE A 1 184 ? 14.801  44.205  22.295  1.00 17.66  ? 184  ILE A CG1   1 
ATOM   1398  C CG2   . ILE A 1 184 ? 13.328  45.321  20.540  1.00 16.99  ? 184  ILE A CG2   1 
ATOM   1399  C CD1   . ILE A 1 184 ? 15.256  43.057  21.431  1.00 17.36  ? 184  ILE A CD1   1 
ATOM   1400  N N     . THR A 1 185 ? 11.386  47.499  22.326  1.00 17.78  ? 185  THR A N     1 
ATOM   1401  C CA    . THR A 1 185 ? 10.082  48.094  22.217  1.00 18.04  ? 185  THR A CA    1 
ATOM   1402  C C     . THR A 1 185 ? 10.054  49.143  21.112  1.00 18.45  ? 185  THR A C     1 
ATOM   1403  O O     . THR A 1 185 ? 11.014  49.267  20.352  1.00 18.53  ? 185  THR A O     1 
ATOM   1404  C CB    . THR A 1 185 ? 9.599   48.665  23.592  1.00 17.99  ? 185  THR A CB    1 
ATOM   1405  O OG1   . THR A 1 185 ? 8.199   48.954  23.511  1.00 18.76  ? 185  THR A OG1   1 
ATOM   1406  C CG2   . THR A 1 185 ? 10.383  49.932  24.015  1.00 17.19  ? 185  THR A CG2   1 
ATOM   1407  N N     . ALA A 1 186 ? 8.947   49.878  21.011  1.00 18.99  ? 186  ALA A N     1 
ATOM   1408  C CA    . ALA A 1 186 ? 8.845   50.980  20.057  1.00 19.28  ? 186  ALA A CA    1 
ATOM   1409  C C     . ALA A 1 186 ? 8.352   52.216  20.774  1.00 19.89  ? 186  ALA A C     1 
ATOM   1410  O O     . ALA A 1 186 ? 7.768   52.112  21.861  1.00 19.69  ? 186  ALA A O     1 
ATOM   1411  C CB    . ALA A 1 186 ? 7.913   50.610  18.898  1.00 18.93  ? 186  ALA A CB    1 
ATOM   1412  N N     . ASP A 1 187 ? 8.593   53.388  20.177  1.00 20.46  ? 187  ASP A N     1 
ATOM   1413  C CA    . ASP A 1 187 ? 8.049   54.620  20.716  1.00 21.20  ? 187  ASP A CA    1 
ATOM   1414  C C     . ASP A 1 187 ? 6.522   54.516  20.873  1.00 22.01  ? 187  ASP A C     1 
ATOM   1415  O O     . ASP A 1 187 ? 5.987   54.776  21.959  1.00 21.63  ? 187  ASP A O     1 
ATOM   1416  C CB    . ASP A 1 187 ? 8.517   55.880  19.934  1.00 20.96  ? 187  ASP A CB    1 
ATOM   1417  C CG    . ASP A 1 187 ? 8.242   55.819  18.427  1.00 21.80  ? 187  ASP A CG    1 
ATOM   1418  O OD1   . ASP A 1 187 ? 7.556   54.907  17.915  1.00 22.66  ? 187  ASP A OD1   1 
ATOM   1419  O OD2   . ASP A 1 187 ? 8.715   56.738  17.734  1.00 22.43  ? 187  ASP A OD2   1 
ATOM   1420  N N     . GLU A 1 188 ? 5.842   54.084  19.810  1.00 22.59  ? 188  GLU A N     1 
ATOM   1421  C CA    . GLU A 1 188 ? 4.390   53.868  19.836  1.00 23.87  ? 188  GLU A CA    1 
ATOM   1422  C C     . GLU A 1 188 ? 3.994   52.771  18.853  1.00 24.16  ? 188  GLU A C     1 
ATOM   1423  O O     . GLU A 1 188 ? 4.689   52.539  17.867  1.00 24.06  ? 188  GLU A O     1 
ATOM   1424  C CB    . GLU A 1 188 ? 3.635   55.146  19.452  1.00 23.61  ? 188  GLU A CB    1 
ATOM   1425  C CG    . GLU A 1 188 ? 3.788   56.340  20.383  1.00 24.31  ? 188  GLU A CG    1 
ATOM   1426  C CD    . GLU A 1 188 ? 2.939   57.531  19.937  1.00 25.49  ? 188  GLU A CD    1 
ATOM   1427  O OE1   . GLU A 1 188 ? 3.046   57.935  18.753  1.00 27.74  ? 188  GLU A OE1   1 
ATOM   1428  O OE2   . GLU A 1 188 ? 2.162   58.062  20.768  1.00 28.04  ? 188  GLU A OE2   1 
ATOM   1429  N N     . GLY A 1 189 ? 2.884   52.097  19.129  1.00 25.01  ? 189  GLY A N     1 
ATOM   1430  C CA    . GLY A 1 189 ? 2.246   51.218  18.147  1.00 26.75  ? 189  GLY A CA    1 
ATOM   1431  C C     . GLY A 1 189 ? 1.146   51.970  17.408  1.00 27.97  ? 189  GLY A C     1 
ATOM   1432  O O     . GLY A 1 189 ? 0.636   52.966  17.902  1.00 27.88  ? 189  GLY A O     1 
ATOM   1433  N N     . VAL A 1 190 ? 0.792   51.508  16.213  1.00 29.46  ? 190  VAL A N     1 
ATOM   1434  C CA    . VAL A 1 190 ? -0.300  52.110  15.444  1.00 30.85  ? 190  VAL A CA    1 
ATOM   1435  C C     . VAL A 1 190 ? -1.298  51.008  15.127  1.00 32.10  ? 190  VAL A C     1 
ATOM   1436  O O     . VAL A 1 190 ? -0.956  50.010  14.489  1.00 31.78  ? 190  VAL A O     1 
ATOM   1437  C CB    . VAL A 1 190 ? 0.188   52.787  14.134  1.00 30.72  ? 190  VAL A CB    1 
ATOM   1438  C CG1   . VAL A 1 190 ? -0.992  53.243  13.276  1.00 31.54  ? 190  VAL A CG1   1 
ATOM   1439  C CG2   . VAL A 1 190 ? 1.084   53.974  14.435  1.00 31.13  ? 190  VAL A CG2   1 
ATOM   1440  N N     . ARG A 1 191 ? -2.532  51.190  15.586  1.00 33.51  ? 191  ARG A N     1 
ATOM   1441  C CA    . ARG A 1 191 ? -3.567  50.180  15.414  1.00 35.64  ? 191  ARG A CA    1 
ATOM   1442  C C     . ARG A 1 191 ? -4.908  50.896  15.301  1.00 35.59  ? 191  ARG A C     1 
ATOM   1443  O O     . ARG A 1 191 ? -5.213  51.778  16.108  1.00 35.52  ? 191  ARG A O     1 
ATOM   1444  C CB    . ARG A 1 191 ? -3.548  49.204  16.599  1.00 35.63  ? 191  ARG A CB    1 
ATOM   1445  C CG    . ARG A 1 191 ? -4.172  47.840  16.330  1.00 37.33  ? 191  ARG A CG    1 
ATOM   1446  C CD    . ARG A 1 191 ? -3.819  46.866  17.459  1.00 38.27  ? 191  ARG A CD    1 
ATOM   1447  N NE    . ARG A 1 191 ? -4.751  45.742  17.620  1.00 43.28  ? 191  ARG A NE    1 
ATOM   1448  C CZ    . ARG A 1 191 ? -5.951  45.818  18.205  1.00 45.26  ? 191  ARG A CZ    1 
ATOM   1449  N NH1   . ARG A 1 191 ? -6.421  46.980  18.657  1.00 45.67  ? 191  ARG A NH1   1 
ATOM   1450  N NH2   . ARG A 1 191 ? -6.706  44.724  18.312  1.00 46.95  ? 191  ARG A NH2   1 
ATOM   1451  N N     . ALA A 1 192 ? -5.667  50.549  14.258  1.00 35.87  ? 192  ALA A N     1 
ATOM   1452  C CA    . ALA A 1 192 ? -6.990  51.125  13.982  1.00 35.90  ? 192  ALA A CA    1 
ATOM   1453  C C     . ALA A 1 192 ? -7.061  52.656  14.039  1.00 36.06  ? 192  ALA A C     1 
ATOM   1454  O O     . ALA A 1 192 ? -8.008  53.210  14.593  1.00 36.13  ? 192  ALA A O     1 
ATOM   1455  C CB    . ALA A 1 192 ? -8.048  50.493  14.913  1.00 36.02  ? 192  ALA A CB    1 
ATOM   1456  N N     . GLY A 1 193 ? -6.065  53.331  13.462  1.00 36.05  ? 193  GLY A N     1 
ATOM   1457  C CA    . GLY A 1 193 ? -5.978  54.794  13.495  1.00 36.12  ? 193  GLY A CA    1 
ATOM   1458  C C     . GLY A 1 193 ? -5.396  55.378  14.784  1.00 36.10  ? 193  GLY A C     1 
ATOM   1459  O O     . GLY A 1 193 ? -5.087  56.569  14.848  1.00 35.85  ? 193  GLY A O     1 
ATOM   1460  N N     . ALA A 1 194 ? -5.229  54.527  15.798  1.00 36.14  ? 194  ALA A N     1 
ATOM   1461  C CA    . ALA A 1 194 ? -4.839  54.954  17.146  1.00 35.92  ? 194  ALA A CA    1 
ATOM   1462  C C     . ALA A 1 194 ? -3.414  54.545  17.523  1.00 35.59  ? 194  ALA A C     1 
ATOM   1463  O O     . ALA A 1 194 ? -2.910  53.524  17.060  1.00 35.40  ? 194  ALA A O     1 
ATOM   1464  C CB    . ALA A 1 194 ? -5.837  54.406  18.183  1.00 35.82  ? 194  ALA A CB    1 
ATOM   1465  N N     . SER A 1 195 ? -2.795  55.352  18.391  1.00 35.45  ? 195  SER A N     1 
ATOM   1466  C CA    . SER A 1 195 ? -1.461  55.102  18.946  1.00 34.83  ? 195  SER A CA    1 
ATOM   1467  C C     . SER A 1 195 ? -1.512  54.384  20.291  1.00 34.15  ? 195  SER A C     1 
ATOM   1468  O O     . SER A 1 195 ? -2.339  54.693  21.149  1.00 34.32  ? 195  SER A O     1 
ATOM   1469  C CB    . SER A 1 195 ? -0.719  56.419  19.124  1.00 34.94  ? 195  SER A CB    1 
ATOM   1470  O OG    . SER A 1 195 ? -0.423  56.986  17.864  1.00 37.53  ? 195  SER A OG    1 
ATOM   1471  N N     . ILE A 1 196 ? -0.616  53.425  20.464  1.00 33.02  ? 196  ILE A N     1 
ATOM   1472  C CA    . ILE A 1 196 ? -0.432  52.734  21.733  1.00 31.93  ? 196  ILE A CA    1 
ATOM   1473  C C     . ILE A 1 196 ? 0.907   53.209  22.291  1.00 30.56  ? 196  ILE A C     1 
ATOM   1474  O O     . ILE A 1 196 ? 1.909   53.120  21.588  1.00 29.79  ? 196  ILE A O     1 
ATOM   1475  C CB    . ILE A 1 196 ? -0.404  51.198  21.523  1.00 32.25  ? 196  ILE A CB    1 
ATOM   1476  C CG1   . ILE A 1 196 ? -1.657  50.732  20.771  1.00 33.59  ? 196  ILE A CG1   1 
ATOM   1477  C CG2   . ILE A 1 196 ? -0.219  50.466  22.851  1.00 32.77  ? 196  ILE A CG2   1 
ATOM   1478  C CD1   . ILE A 1 196 ? -2.994  51.251  21.354  1.00 34.96  ? 196  ILE A CD1   1 
ATOM   1479  N N     . PRO A 1 197 ? 0.924   53.723  23.545  1.00 29.61  ? 197  PRO A N     1 
ATOM   1480  C CA    . PRO A 1 197 ? 2.146   54.333  24.091  1.00 28.64  ? 197  PRO A CA    1 
ATOM   1481  C C     . PRO A 1 197 ? 3.135   53.308  24.667  1.00 27.89  ? 197  PRO A C     1 
ATOM   1482  O O     . PRO A 1 197 ? 3.295   53.200  25.896  1.00 28.24  ? 197  PRO A O     1 
ATOM   1483  C CB    . PRO A 1 197 ? 1.612   55.273  25.182  1.00 28.66  ? 197  PRO A CB    1 
ATOM   1484  C CG    . PRO A 1 197 ? 0.316   54.629  25.640  1.00 29.42  ? 197  PRO A CG    1 
ATOM   1485  C CD    . PRO A 1 197 ? -0.201  53.767  24.505  1.00 29.32  ? 197  PRO A CD    1 
ATOM   1486  N N     . LEU A 1 198 ? 3.816   52.583  23.785  1.00 25.93  ? 198  LEU A N     1 
ATOM   1487  C CA    . LEU A 1 198 ? 4.613   51.442  24.208  1.00 24.31  ? 198  LEU A CA    1 
ATOM   1488  C C     . LEU A 1 198 ? 5.824   51.788  25.070  1.00 23.58  ? 198  LEU A C     1 
ATOM   1489  O O     . LEU A 1 198 ? 5.961   51.241  26.166  1.00 23.03  ? 198  LEU A O     1 
ATOM   1490  C CB    . LEU A 1 198 ? 5.013   50.576  23.008  1.00 23.89  ? 198  LEU A CB    1 
ATOM   1491  C CG    . LEU A 1 198 ? 3.886   49.832  22.282  1.00 23.95  ? 198  LEU A CG    1 
ATOM   1492  C CD1   . LEU A 1 198 ? 4.459   49.214  21.028  1.00 21.71  ? 198  LEU A CD1   1 
ATOM   1493  C CD2   . LEU A 1 198 ? 3.215   48.751  23.171  1.00 22.14  ? 198  LEU A CD2   1 
ATOM   1494  N N     . LYS A 1 199 ? 6.680   52.698  24.594  1.00 22.71  ? 199  LYS A N     1 
ATOM   1495  C CA    . LYS A 1 199 ? 7.888   53.098  25.339  1.00 22.33  ? 199  LYS A CA    1 
ATOM   1496  C C     . LYS A 1 199 ? 7.533   53.693  26.706  1.00 22.03  ? 199  LYS A C     1 
ATOM   1497  O O     . LYS A 1 199 ? 8.163   53.354  27.717  1.00 21.69  ? 199  LYS A O     1 
ATOM   1498  C CB    . LYS A 1 199 ? 8.770   54.047  24.504  1.00 22.57  ? 199  LYS A CB    1 
ATOM   1499  C CG    . LYS A 1 199 ? 9.809   54.910  25.287  1.00 23.63  ? 199  LYS A CG    1 
ATOM   1500  C CD    . LYS A 1 199 ? 10.969  54.086  25.840  1.00 24.47  ? 199  LYS A CD    1 
ATOM   1501  C CE    . LYS A 1 199 ? 12.210  54.951  26.100  1.00 22.77  ? 199  LYS A CE    1 
ATOM   1502  N NZ    . LYS A 1 199 ? 12.087  55.829  27.299  1.00 23.41  ? 199  LYS A NZ    1 
ATOM   1503  N N     . LYS A 1 200 ? 6.515   54.555  26.734  1.00 21.57  ? 200  LYS A N     1 
ATOM   1504  C CA    . LYS A 1 200 ? 6.031   55.135  27.986  1.00 21.71  ? 200  LYS A CA    1 
ATOM   1505  C C     . LYS A 1 200 ? 5.625   54.034  28.965  1.00 20.98  ? 200  LYS A C     1 
ATOM   1506  O O     . LYS A 1 200 ? 5.922   54.126  30.148  1.00 21.07  ? 200  LYS A O     1 
ATOM   1507  C CB    . LYS A 1 200 ? 4.865   56.112  27.751  1.00 21.78  ? 200  LYS A CB    1 
ATOM   1508  C CG    . LYS A 1 200 ? 4.591   57.051  28.941  1.00 22.43  ? 200  LYS A CG    1 
ATOM   1509  C CD    . LYS A 1 200 ? 3.292   57.853  28.765  1.00 22.60  ? 200  LYS A CD    1 
ATOM   1510  C CE    . LYS A 1 200 ? 2.974   58.721  29.995  1.00 24.07  ? 200  LYS A CE    1 
ATOM   1511  N NZ    . LYS A 1 200 ? 4.051   59.743  30.313  1.00 25.40  ? 200  LYS A NZ    1 
ATOM   1512  N N     . ASN A 1 201 ? 4.958   52.998  28.459  1.00 20.41  ? 201  ASN A N     1 
ATOM   1513  C CA    . ASN A 1 201 ? 4.569   51.834  29.268  1.00 19.85  ? 201  ASN A CA    1 
ATOM   1514  C C     . ASN A 1 201 ? 5.769   51.090  29.843  1.00 19.71  ? 201  ASN A C     1 
ATOM   1515  O O     . ASN A 1 201 ? 5.758   50.666  31.007  1.00 18.99  ? 201  ASN A O     1 
ATOM   1516  C CB    . ASN A 1 201 ? 3.681   50.883  28.464  1.00 19.76  ? 201  ASN A CB    1 
ATOM   1517  C CG    . ASN A 1 201 ? 2.243   51.385  28.332  1.00 19.98  ? 201  ASN A CG    1 
ATOM   1518  O OD1   . ASN A 1 201 ? 1.901   52.457  28.824  1.00 20.56  ? 201  ASN A OD1   1 
ATOM   1519  N ND2   . ASN A 1 201 ? 1.399   50.603  27.669  1.00 18.92  ? 201  ASN A ND2   1 
ATOM   1520  N N     . VAL A 1 202 ? 6.814   50.963  29.023  1.00 19.76  ? 202  VAL A N     1 
ATOM   1521  C CA    . VAL A 1 202 ? 8.088   50.407  29.462  1.00 19.63  ? 202  VAL A CA    1 
ATOM   1522  C C     . VAL A 1 202 ? 8.710   51.289  30.554  1.00 19.84  ? 202  VAL A C     1 
ATOM   1523  O O     . VAL A 1 202 ? 9.102   50.783  31.612  1.00 20.14  ? 202  VAL A O     1 
ATOM   1524  C CB    . VAL A 1 202 ? 9.038   50.178  28.272  1.00 19.41  ? 202  VAL A CB    1 
ATOM   1525  C CG1   . VAL A 1 202 ? 10.418  49.758  28.747  1.00 19.05  ? 202  VAL A CG1   1 
ATOM   1526  C CG2   . VAL A 1 202 ? 8.459   49.102  27.351  1.00 19.16  ? 202  VAL A CG2   1 
ATOM   1527  N N     . ASP A 1 203 ? 8.759   52.599  30.308  1.00 19.93  ? 203  ASP A N     1 
ATOM   1528  C CA    . ASP A 1 203 ? 9.235   53.567  31.298  1.00 20.17  ? 203  ASP A CA    1 
ATOM   1529  C C     . ASP A 1 203 ? 8.580   53.353  32.659  1.00 19.82  ? 203  ASP A C     1 
ATOM   1530  O O     . ASP A 1 203 ? 9.277   53.261  33.675  1.00 19.26  ? 203  ASP A O     1 
ATOM   1531  C CB    . ASP A 1 203 ? 8.981   55.001  30.833  1.00 20.21  ? 203  ASP A CB    1 
ATOM   1532  C CG    . ASP A 1 203 ? 9.992   55.479  29.804  1.00 21.47  ? 203  ASP A CG    1 
ATOM   1533  O OD1   . ASP A 1 203 ? 10.974  54.748  29.509  1.00 21.13  ? 203  ASP A OD1   1 
ATOM   1534  O OD2   . ASP A 1 203 ? 9.804   56.610  29.295  1.00 23.30  ? 203  ASP A OD2   1 
ATOM   1535  N N     . ASP A 1 204 ? 7.248   53.270  32.665  1.00 19.48  ? 204  ASP A N     1 
ATOM   1536  C CA    . ASP A 1 204 ? 6.492   53.065  33.906  1.00 19.79  ? 204  ASP A CA    1 
ATOM   1537  C C     . ASP A 1 204 ? 6.759   51.725  34.572  1.00 19.08  ? 204  ASP A C     1 
ATOM   1538  O O     . ASP A 1 204 ? 6.866   51.664  35.797  1.00 18.55  ? 204  ASP A O     1 
ATOM   1539  C CB    . ASP A 1 204 ? 4.996   53.277  33.685  1.00 19.82  ? 204  ASP A CB    1 
ATOM   1540  C CG    . ASP A 1 204 ? 4.651   54.739  33.425  1.00 22.43  ? 204  ASP A CG    1 
ATOM   1541  O OD1   . ASP A 1 204 ? 3.511   55.011  32.984  1.00 26.62  ? 204  ASP A OD1   1 
ATOM   1542  O OD2   . ASP A 1 204 ? 5.522   55.614  33.650  1.00 22.34  ? 204  ASP A OD2   1 
ATOM   1543  N N     . ALA A 1 205 ? 6.886   50.666  33.765  1.00 18.53  ? 205  ALA A N     1 
ATOM   1544  C CA    . ALA A 1 205 ? 7.213   49.328  34.263  1.00 18.56  ? 205  ALA A CA    1 
ATOM   1545  C C     . ALA A 1 205 ? 8.559   49.295  34.975  1.00 18.86  ? 205  ALA A C     1 
ATOM   1546  O O     . ALA A 1 205 ? 8.686   48.701  36.054  1.00 18.73  ? 205  ALA A O     1 
ATOM   1547  C CB    . ALA A 1 205 ? 7.207   48.296  33.109  1.00 18.23  ? 205  ALA A CB    1 
ATOM   1548  N N     . LEU A 1 206 ? 9.559   49.936  34.369  1.00 19.47  ? 206  LEU A N     1 
ATOM   1549  C CA    . LEU A 1 206 ? 10.926  49.916  34.898  1.00 20.66  ? 206  LEU A CA    1 
ATOM   1550  C C     . LEU A 1 206 ? 11.085  50.724  36.187  1.00 21.36  ? 206  LEU A C     1 
ATOM   1551  O O     . LEU A 1 206 ? 12.086  50.597  36.881  1.00 21.69  ? 206  LEU A O     1 
ATOM   1552  C CB    . LEU A 1 206 ? 11.949  50.346  33.829  1.00 20.15  ? 206  LEU A CB    1 
ATOM   1553  C CG    . LEU A 1 206 ? 12.059  49.479  32.564  1.00 21.02  ? 206  LEU A CG    1 
ATOM   1554  C CD1   . LEU A 1 206 ? 13.309  49.844  31.802  1.00 20.85  ? 206  LEU A CD1   1 
ATOM   1555  C CD2   . LEU A 1 206 ? 12.058  47.977  32.860  1.00 20.50  ? 206  LEU A CD2   1 
ATOM   1556  N N     . LYS A 1 207 ? 10.081  51.529  36.511  1.00 22.62  ? 207  LYS A N     1 
ATOM   1557  C CA    . LYS A 1 207 ? 10.044  52.251  37.786  1.00 23.90  ? 207  LYS A CA    1 
ATOM   1558  C C     . LYS A 1 207 ? 9.614   51.375  38.968  1.00 24.30  ? 207  LYS A C     1 
ATOM   1559  O O     . LYS A 1 207 ? 9.833   51.740  40.125  1.00 24.23  ? 207  LYS A O     1 
ATOM   1560  C CB    . LYS A 1 207 ? 9.142   53.482  37.678  1.00 24.19  ? 207  LYS A CB    1 
ATOM   1561  C CG    . LYS A 1 207 ? 9.817   54.662  36.981  1.00 26.10  ? 207  LYS A CG    1 
ATOM   1562  C CD    . LYS A 1 207 ? 8.786   55.658  36.483  1.00 28.80  ? 207  LYS A CD    1 
ATOM   1563  C CE    . LYS A 1 207 ? 9.458   56.886  35.894  1.00 30.87  ? 207  LYS A CE    1 
ATOM   1564  N NZ    . LYS A 1 207 ? 8.459   57.795  35.238  1.00 33.23  ? 207  LYS A NZ    1 
ATOM   1565  N N     . ASN A 1 208 ? 9.007   50.224  38.680  1.00 24.84  ? 208  ASN A N     1 
ATOM   1566  C CA    . ASN A 1 208 ? 8.723   49.239  39.719  1.00 25.09  ? 208  ASN A CA    1 
ATOM   1567  C C     . ASN A 1 208 ? 10.038  48.904  40.411  1.00 25.52  ? 208  ASN A C     1 
ATOM   1568  O O     . ASN A 1 208 ? 11.005  48.527  39.742  1.00 25.66  ? 208  ASN A O     1 
ATOM   1569  C CB    . ASN A 1 208 ? 8.078   47.982  39.123  1.00 25.20  ? 208  ASN A CB    1 
ATOM   1570  C CG    . ASN A 1 208 ? 7.611   47.001  40.187  1.00 25.11  ? 208  ASN A CG    1 
ATOM   1571  O OD1   . ASN A 1 208 ? 8.380   46.602  41.066  1.00 25.93  ? 208  ASN A OD1   1 
ATOM   1572  N ND2   . ASN A 1 208 ? 6.349   46.605  40.109  1.00 23.57  ? 208  ASN A ND2   1 
ATOM   1573  N N     . PRO A 1 209 ? 10.096  49.075  41.748  1.00 25.85  ? 209  PRO A N     1 
ATOM   1574  C CA    . PRO A 1 209 ? 11.356  48.899  42.475  1.00 25.98  ? 209  PRO A CA    1 
ATOM   1575  C C     . PRO A 1 209 ? 11.869  47.466  42.452  1.00 25.97  ? 209  PRO A C     1 
ATOM   1576  O O     . PRO A 1 209 ? 13.054  47.231  42.714  1.00 25.99  ? 209  PRO A O     1 
ATOM   1577  C CB    . PRO A 1 209 ? 11.007  49.326  43.911  1.00 26.15  ? 209  PRO A CB    1 
ATOM   1578  C CG    . PRO A 1 209 ? 9.538   49.187  44.022  1.00 25.88  ? 209  PRO A CG    1 
ATOM   1579  C CD    . PRO A 1 209 ? 8.990   49.457  42.646  1.00 26.08  ? 209  PRO A CD    1 
ATOM   1580  N N     . ASN A 1 210 ? 10.987  46.521  42.134  1.00 25.77  ? 210  ASN A N     1 
ATOM   1581  C CA    . ASN A 1 210 ? 11.369  45.116  42.060  1.00 25.93  ? 210  ASN A CA    1 
ATOM   1582  C C     . ASN A 1 210 ? 12.027  44.732  40.725  1.00 25.59  ? 210  ASN A C     1 
ATOM   1583  O O     . ASN A 1 210 ? 12.568  43.632  40.601  1.00 25.40  ? 210  ASN A O     1 
ATOM   1584  C CB    . ASN A 1 210 ? 10.169  44.206  42.365  1.00 26.22  ? 210  ASN A CB    1 
ATOM   1585  C CG    . ASN A 1 210 ? 9.623   44.406  43.768  1.00 27.37  ? 210  ASN A CG    1 
ATOM   1586  O OD1   . ASN A 1 210 ? 10.288  44.100  44.754  1.00 29.76  ? 210  ASN A OD1   1 
ATOM   1587  N ND2   . ASN A 1 210 ? 8.408   44.922  43.860  1.00 28.75  ? 210  ASN A ND2   1 
ATOM   1588  N N     . VAL A 1 211 ? 11.977  45.625  39.732  1.00 25.38  ? 211  VAL A N     1 
ATOM   1589  C CA    . VAL A 1 211 ? 12.727  45.417  38.487  1.00 25.10  ? 211  VAL A CA    1 
ATOM   1590  C C     . VAL A 1 211 ? 14.199  45.731  38.744  1.00 25.64  ? 211  VAL A C     1 
ATOM   1591  O O     . VAL A 1 211 ? 14.560  46.872  39.055  1.00 25.62  ? 211  VAL A O     1 
ATOM   1592  C CB    . VAL A 1 211 ? 12.208  46.281  37.308  1.00 25.22  ? 211  VAL A CB    1 
ATOM   1593  C CG1   . VAL A 1 211 ? 13.104  46.093  36.075  1.00 23.87  ? 211  VAL A CG1   1 
ATOM   1594  C CG2   . VAL A 1 211 ? 10.739  45.949  36.975  1.00 24.42  ? 211  VAL A CG2   1 
ATOM   1595  N N     . THR A 1 212 ? 15.043  44.712  38.607  1.00 26.07  ? 212  THR A N     1 
ATOM   1596  C CA    . THR A 1 212 ? 16.463  44.832  38.943  1.00 26.33  ? 212  THR A CA    1 
ATOM   1597  C C     . THR A 1 212 ? 17.409  44.330  37.847  1.00 26.31  ? 212  THR A C     1 
ATOM   1598  O O     . THR A 1 212 ? 18.626  44.523  37.933  1.00 26.31  ? 212  THR A O     1 
ATOM   1599  C CB    . THR A 1 212 ? 16.784  44.096  40.265  1.00 26.35  ? 212  THR A CB    1 
ATOM   1600  O OG1   . THR A 1 212 ? 16.429  42.715  40.148  1.00 26.62  ? 212  THR A OG1   1 
ATOM   1601  C CG2   . THR A 1 212 ? 16.014  44.714  41.423  1.00 26.67  ? 212  THR A CG2   1 
ATOM   1602  N N     . SER A 1 213 ? 16.849  43.713  36.811  1.00 26.05  ? 213  SER A N     1 
ATOM   1603  C CA    . SER A 1 213 ? 17.646  42.987  35.820  1.00 25.94  ? 213  SER A CA    1 
ATOM   1604  C C     . SER A 1 213 ? 17.870  43.713  34.490  1.00 25.90  ? 213  SER A C     1 
ATOM   1605  O O     . SER A 1 213 ? 18.721  43.304  33.699  1.00 26.15  ? 213  SER A O     1 
ATOM   1606  C CB    . SER A 1 213 ? 16.989  41.633  35.540  1.00 26.11  ? 213  SER A CB    1 
ATOM   1607  O OG    . SER A 1 213 ? 15.647  41.800  35.098  1.00 25.64  ? 213  SER A OG    1 
ATOM   1608  N N     . VAL A 1 214 ? 17.100  44.764  34.224  1.00 25.58  ? 214  VAL A N     1 
ATOM   1609  C CA    . VAL A 1 214 ? 17.127  45.385  32.900  1.00 25.06  ? 214  VAL A CA    1 
ATOM   1610  C C     . VAL A 1 214 ? 18.286  46.355  32.804  1.00 24.86  ? 214  VAL A C     1 
ATOM   1611  O O     . VAL A 1 214 ? 18.393  47.287  33.599  1.00 24.89  ? 214  VAL A O     1 
ATOM   1612  C CB    . VAL A 1 214 ? 15.780  46.071  32.532  1.00 25.20  ? 214  VAL A CB    1 
ATOM   1613  C CG1   . VAL A 1 214 ? 15.895  46.851  31.220  1.00 24.56  ? 214  VAL A CG1   1 
ATOM   1614  C CG2   . VAL A 1 214 ? 14.666  45.036  32.427  1.00 24.62  ? 214  VAL A CG2   1 
ATOM   1615  N N     . GLU A 1 215 ? 19.155  46.130  31.826  1.00 24.61  ? 215  GLU A N     1 
ATOM   1616  C CA    . GLU A 1 215 ? 20.319  46.999  31.635  1.00 24.63  ? 215  GLU A CA    1 
ATOM   1617  C C     . GLU A 1 215 ? 20.076  48.043  30.547  1.00 23.54  ? 215  GLU A C     1 
ATOM   1618  O O     . GLU A 1 215 ? 20.540  49.172  30.657  1.00 23.51  ? 215  GLU A O     1 
ATOM   1619  C CB    . GLU A 1 215 ? 21.580  46.165  31.362  1.00 24.85  ? 215  GLU A CB    1 
ATOM   1620  C CG    . GLU A 1 215 ? 22.138  45.503  32.628  1.00 28.37  ? 215  GLU A CG    1 
ATOM   1621  C CD    . GLU A 1 215 ? 22.844  44.171  32.372  1.00 33.63  ? 215  GLU A CD    1 
ATOM   1622  O OE1   . GLU A 1 215 ? 22.608  43.224  33.161  1.00 35.93  ? 215  GLU A OE1   1 
ATOM   1623  O OE2   . GLU A 1 215 ? 23.621  44.058  31.393  1.00 34.93  ? 215  GLU A OE2   1 
ATOM   1624  N N     . HIS A 1 216 ? 19.334  47.663  29.509  1.00 22.49  ? 216  HIS A N     1 
ATOM   1625  C CA    . HIS A 1 216 ? 19.059  48.563  28.392  1.00 21.59  ? 216  HIS A CA    1 
ATOM   1626  C C     . HIS A 1 216 ? 17.652  48.388  27.854  1.00 20.92  ? 216  HIS A C     1 
ATOM   1627  O O     . HIS A 1 216 ? 17.038  47.342  28.054  1.00 20.74  ? 216  HIS A O     1 
ATOM   1628  C CB    . HIS A 1 216 ? 20.052  48.329  27.258  1.00 21.79  ? 216  HIS A CB    1 
ATOM   1629  C CG    . HIS A 1 216 ? 21.460  48.684  27.609  1.00 22.73  ? 216  HIS A CG    1 
ATOM   1630  N ND1   . HIS A 1 216 ? 21.880  49.988  27.762  1.00 24.13  ? 216  HIS A ND1   1 
ATOM   1631  C CD2   . HIS A 1 216 ? 22.545  47.908  27.836  1.00 23.77  ? 216  HIS A CD2   1 
ATOM   1632  C CE1   . HIS A 1 216 ? 23.165  50.000  28.069  1.00 24.47  ? 216  HIS A CE1   1 
ATOM   1633  N NE2   . HIS A 1 216 ? 23.594  48.751  28.116  1.00 23.55  ? 216  HIS A NE2   1 
ATOM   1634  N N     . VAL A 1 217 ? 17.154  49.435  27.195  1.00 19.69  ? 217  VAL A N     1 
ATOM   1635  C CA    . VAL A 1 217 ? 15.912  49.401  26.453  1.00 18.98  ? 217  VAL A CA    1 
ATOM   1636  C C     . VAL A 1 217 ? 16.262  49.842  25.034  1.00 18.79  ? 217  VAL A C     1 
ATOM   1637  O O     . VAL A 1 217 ? 16.787  50.935  24.827  1.00 18.70  ? 217  VAL A O     1 
ATOM   1638  C CB    . VAL A 1 217 ? 14.802  50.341  27.058  1.00 18.84  ? 217  VAL A CB    1 
ATOM   1639  C CG1   . VAL A 1 217 ? 13.502  50.230  26.263  1.00 18.67  ? 217  VAL A CG1   1 
ATOM   1640  C CG2   . VAL A 1 217 ? 14.527  50.029  28.505  1.00 17.58  ? 217  VAL A CG2   1 
ATOM   1641  N N     . ILE A 1 218 ? 16.010  48.972  24.063  1.00 18.75  ? 218  ILE A N     1 
ATOM   1642  C CA    . ILE A 1 218 ? 16.200  49.312  22.664  1.00 18.31  ? 218  ILE A CA    1 
ATOM   1643  C C     . ILE A 1 218 ? 14.858  49.766  22.135  1.00 18.35  ? 218  ILE A C     1 
ATOM   1644  O O     . ILE A 1 218 ? 13.857  49.075  22.330  1.00 18.84  ? 218  ILE A O     1 
ATOM   1645  C CB    . ILE A 1 218 ? 16.716  48.104  21.851  1.00 18.72  ? 218  ILE A CB    1 
ATOM   1646  C CG1   . ILE A 1 218 ? 18.156  47.771  22.239  1.00 18.13  ? 218  ILE A CG1   1 
ATOM   1647  C CG2   . ILE A 1 218 ? 16.604  48.360  20.330  1.00 18.49  ? 218  ILE A CG2   1 
ATOM   1648  C CD1   . ILE A 1 218 ? 18.633  46.409  21.728  1.00 17.76  ? 218  ILE A CD1   1 
ATOM   1649  N N     . VAL A 1 219 ? 14.830  50.927  21.482  1.00 18.23  ? 219  VAL A N     1 
ATOM   1650  C CA    . VAL A 1 219 ? 13.566  51.547  21.045  1.00 18.42  ? 219  VAL A CA    1 
ATOM   1651  C C     . VAL A 1 219 ? 13.513  51.761  19.530  1.00 18.82  ? 219  VAL A C     1 
ATOM   1652  O O     . VAL A 1 219 ? 14.395  52.407  18.957  1.00 18.09  ? 219  VAL A O     1 
ATOM   1653  C CB    . VAL A 1 219 ? 13.295  52.920  21.743  1.00 18.63  ? 219  VAL A CB    1 
ATOM   1654  C CG1   . VAL A 1 219 ? 11.876  53.422  21.419  1.00 18.25  ? 219  VAL A CG1   1 
ATOM   1655  C CG2   . VAL A 1 219 ? 13.491  52.834  23.250  1.00 18.01  ? 219  VAL A CG2   1 
ATOM   1656  N N     . LEU A 1 220 ? 12.474  51.218  18.890  1.00 19.30  ? 220  LEU A N     1 
ATOM   1657  C CA    . LEU A 1 220 ? 12.204  51.522  17.483  1.00 19.90  ? 220  LEU A CA    1 
ATOM   1658  C C     . LEU A 1 220 ? 11.440  52.842  17.336  1.00 20.69  ? 220  LEU A C     1 
ATOM   1659  O O     . LEU A 1 220 ? 10.375  53.025  17.934  1.00 21.00  ? 220  LEU A O     1 
ATOM   1660  C CB    . LEU A 1 220 ? 11.435  50.377  16.802  1.00 19.91  ? 220  LEU A CB    1 
ATOM   1661  C CG    . LEU A 1 220 ? 11.041  50.512  15.324  1.00 19.74  ? 220  LEU A CG    1 
ATOM   1662  C CD1   . LEU A 1 220 ? 12.269  50.537  14.393  1.00 20.68  ? 220  LEU A CD1   1 
ATOM   1663  C CD2   . LEU A 1 220 ? 10.079  49.391  14.927  1.00 19.44  ? 220  LEU A CD2   1 
ATOM   1664  N N     . LYS A 1 221 ? 11.991  53.751  16.532  1.00 21.48  ? 221  LYS A N     1 
ATOM   1665  C CA    . LYS A 1 221 ? 11.292  54.978  16.159  1.00 22.42  ? 221  LYS A CA    1 
ATOM   1666  C C     . LYS A 1 221 ? 10.274  54.667  15.054  1.00 23.04  ? 221  LYS A C     1 
ATOM   1667  O O     . LYS A 1 221 ? 10.592  54.728  13.855  1.00 23.22  ? 221  LYS A O     1 
ATOM   1668  C CB    . LYS A 1 221 ? 12.280  56.052  15.705  1.00 22.08  ? 221  LYS A CB    1 
ATOM   1669  C CG    . LYS A 1 221 ? 11.675  57.459  15.645  1.00 22.59  ? 221  LYS A CG    1 
ATOM   1670  C CD    . LYS A 1 221 ? 12.718  58.506  15.263  1.00 22.86  ? 221  LYS A CD    1 
ATOM   1671  C CE    . LYS A 1 221 ? 13.482  58.991  16.483  1.00 25.60  ? 221  LYS A CE    1 
ATOM   1672  N NZ    . LYS A 1 221 ? 14.893  59.406  16.140  1.00 28.19  ? 221  LYS A NZ    1 
ATOM   1673  N N     . ARG A 1 222 ? 9.063   54.315  15.476  1.00 23.57  ? 222  ARG A N     1 
ATOM   1674  C CA    . ARG A 1 222 ? 8.001   53.889  14.568  1.00 23.89  ? 222  ARG A CA    1 
ATOM   1675  C C     . ARG A 1 222 ? 7.143   55.061  14.114  1.00 24.43  ? 222  ARG A C     1 
ATOM   1676  O O     . ARG A 1 222 ? 6.784   55.149  12.936  1.00 24.55  ? 222  ARG A O     1 
ATOM   1677  C CB    . ARG A 1 222 ? 7.130   52.806  15.234  1.00 23.96  ? 222  ARG A CB    1 
ATOM   1678  C CG    . ARG A 1 222 ? 5.796   52.519  14.540  1.00 23.17  ? 222  ARG A CG    1 
ATOM   1679  C CD    . ARG A 1 222 ? 5.996   51.911  13.168  1.00 24.18  ? 222  ARG A CD    1 
ATOM   1680  N NE    . ARG A 1 222 ? 4.726   51.750  12.459  1.00 25.45  ? 222  ARG A NE    1 
ATOM   1681  C CZ    . ARG A 1 222 ? 4.161   52.671  11.687  1.00 26.97  ? 222  ARG A CZ    1 
ATOM   1682  N NH1   . ARG A 1 222 ? 4.748   53.861  11.499  1.00 27.03  ? 222  ARG A NH1   1 
ATOM   1683  N NH2   . ARG A 1 222 ? 3.001   52.397  11.094  1.00 26.53  ? 222  ARG A NH2   1 
ATOM   1684  N N     . THR A 1 223 ? 6.811   55.946  15.054  1.00 25.25  ? 223  THR A N     1 
ATOM   1685  C CA    . THR A 1 223 ? 5.949   57.088  14.778  1.00 26.12  ? 223  THR A CA    1 
ATOM   1686  C C     . THR A 1 223 ? 6.726   58.391  14.846  1.00 26.97  ? 223  THR A C     1 
ATOM   1687  O O     . THR A 1 223 ? 6.350   59.383  14.204  1.00 27.15  ? 223  THR A O     1 
ATOM   1688  C CB    . THR A 1 223 ? 4.762   57.177  15.767  1.00 26.37  ? 223  THR A CB    1 
ATOM   1689  O OG1   . THR A 1 223 ? 5.260   57.336  17.103  1.00 25.39  ? 223  THR A OG1   1 
ATOM   1690  C CG2   . THR A 1 223 ? 3.877   55.928  15.685  1.00 25.92  ? 223  THR A CG2   1 
ATOM   1691  N N     . GLY A 1 224 ? 7.801   58.385  15.634  1.00 27.52  ? 224  GLY A N     1 
ATOM   1692  C CA    . GLY A 1 224 ? 8.629   59.575  15.827  1.00 28.53  ? 224  GLY A CA    1 
ATOM   1693  C C     . GLY A 1 224 ? 8.019   60.568  16.794  1.00 29.11  ? 224  GLY A C     1 
ATOM   1694  O O     . GLY A 1 224 ? 8.352   61.746  16.769  1.00 29.33  ? 224  GLY A O     1 
ATOM   1695  N N     . SER A 1 225 ? 7.126   60.085  17.651  1.00 29.78  ? 225  SER A N     1 
ATOM   1696  C CA    . SER A 1 225 ? 6.468   60.913  18.653  1.00 30.29  ? 225  SER A CA    1 
ATOM   1697  C C     . SER A 1 225 ? 7.395   61.335  19.788  1.00 30.48  ? 225  SER A C     1 
ATOM   1698  O O     . SER A 1 225 ? 8.447   60.732  19.996  1.00 30.51  ? 225  SER A O     1 
ATOM   1699  C CB    . SER A 1 225 ? 5.264   60.179  19.231  1.00 30.34  ? 225  SER A CB    1 
ATOM   1700  O OG    . SER A 1 225 ? 4.185   60.223  18.319  1.00 32.21  ? 225  SER A OG    1 
ATOM   1701  N N     . ASP A 1 226 ? 6.991   62.388  20.503  1.00 30.64  ? 226  ASP A N     1 
ATOM   1702  C CA    . ASP A 1 226 ? 7.689   62.858  21.690  1.00 30.95  ? 226  ASP A CA    1 
ATOM   1703  C C     . ASP A 1 226 ? 7.641   61.778  22.756  1.00 30.37  ? 226  ASP A C     1 
ATOM   1704  O O     . ASP A 1 226 ? 6.557   61.319  23.127  1.00 30.79  ? 226  ASP A O     1 
ATOM   1705  C CB    . ASP A 1 226 ? 7.025   64.128  22.236  1.00 31.54  ? 226  ASP A CB    1 
ATOM   1706  C CG    . ASP A 1 226 ? 7.614   65.396  21.659  1.00 33.45  ? 226  ASP A CG    1 
ATOM   1707  O OD1   . ASP A 1 226 ? 8.240   65.330  20.575  1.00 35.39  ? 226  ASP A OD1   1 
ATOM   1708  O OD2   . ASP A 1 226 ? 7.442   66.466  22.296  1.00 34.95  ? 226  ASP A OD2   1 
ATOM   1709  N N     . ILE A 1 227 ? 8.816   61.364  23.225  1.00 29.41  ? 227  ILE A N     1 
ATOM   1710  C CA    . ILE A 1 227 ? 8.932   60.390  24.310  1.00 28.41  ? 227  ILE A CA    1 
ATOM   1711  C C     . ILE A 1 227 ? 10.026  60.821  25.270  1.00 28.00  ? 227  ILE A C     1 
ATOM   1712  O O     . ILE A 1 227 ? 10.981  61.502  24.874  1.00 28.03  ? 227  ILE A O     1 
ATOM   1713  C CB    . ILE A 1 227 ? 9.239   58.941  23.806  1.00 28.33  ? 227  ILE A CB    1 
ATOM   1714  C CG1   . ILE A 1 227 ? 10.567  58.888  23.032  1.00 28.40  ? 227  ILE A CG1   1 
ATOM   1715  C CG2   . ILE A 1 227 ? 8.067   58.385  22.977  1.00 27.94  ? 227  ILE A CG2   1 
ATOM   1716  C CD1   . ILE A 1 227 ? 11.145  57.487  22.838  1.00 28.23  ? 227  ILE A CD1   1 
ATOM   1717  N N     . ASP A 1 228 ? 9.885   60.415  26.528  1.00 27.06  ? 228  ASP A N     1 
ATOM   1718  C CA    . ASP A 1 228 ? 10.943  60.570  27.510  1.00 26.60  ? 228  ASP A CA    1 
ATOM   1719  C C     . ASP A 1 228 ? 12.102  59.628  27.186  1.00 25.91  ? 228  ASP A C     1 
ATOM   1720  O O     . ASP A 1 228 ? 11.905  58.564  26.605  1.00 26.05  ? 228  ASP A O     1 
ATOM   1721  C CB    . ASP A 1 228 ? 10.400  60.332  28.921  1.00 26.71  ? 228  ASP A CB    1 
ATOM   1722  C CG    . ASP A 1 228 ? 9.189   61.215  29.236  1.00 27.19  ? 228  ASP A CG    1 
ATOM   1723  O OD1   . ASP A 1 228 ? 8.142   60.677  29.666  1.00 27.08  ? 228  ASP A OD1   1 
ATOM   1724  O OD2   . ASP A 1 228 ? 9.275   62.441  29.019  1.00 27.16  ? 228  ASP A OD2   1 
ATOM   1725  N N     . TRP A 1 229 ? 13.311  60.038  27.544  1.00 25.42  ? 229  TRP A N     1 
ATOM   1726  C CA    . TRP A 1 229 ? 14.510  59.287  27.206  1.00 25.09  ? 229  TRP A CA    1 
ATOM   1727  C C     . TRP A 1 229 ? 15.416  59.219  28.426  1.00 25.45  ? 229  TRP A C     1 
ATOM   1728  O O     . TRP A 1 229 ? 15.677  60.242  29.052  1.00 25.17  ? 229  TRP A O     1 
ATOM   1729  C CB    . TRP A 1 229 ? 15.238  59.976  26.037  1.00 24.31  ? 229  TRP A CB    1 
ATOM   1730  C CG    . TRP A 1 229 ? 16.222  59.094  25.317  1.00 23.20  ? 229  TRP A CG    1 
ATOM   1731  C CD1   . TRP A 1 229 ? 17.592  59.166  25.370  1.00 22.53  ? 229  TRP A CD1   1 
ATOM   1732  C CD2   . TRP A 1 229 ? 15.911  58.011  24.431  1.00 22.01  ? 229  TRP A CD2   1 
ATOM   1733  N NE1   . TRP A 1 229 ? 18.147  58.188  24.573  1.00 22.16  ? 229  TRP A NE1   1 
ATOM   1734  C CE2   . TRP A 1 229 ? 17.140  57.467  23.986  1.00 22.42  ? 229  TRP A CE2   1 
ATOM   1735  C CE3   . TRP A 1 229 ? 14.713  57.438  23.979  1.00 21.46  ? 229  TRP A CE3   1 
ATOM   1736  C CZ2   . TRP A 1 229 ? 17.203  56.376  23.106  1.00 23.28  ? 229  TRP A CZ2   1 
ATOM   1737  C CZ3   . TRP A 1 229 ? 14.778  56.355  23.102  1.00 22.28  ? 229  TRP A CZ3   1 
ATOM   1738  C CH2   . TRP A 1 229 ? 16.016  55.838  22.675  1.00 22.39  ? 229  TRP A CH2   1 
ATOM   1739  N N     . GLN A 1 230 ? 15.875  58.016  28.772  1.00 25.93  ? 230  GLN A N     1 
ATOM   1740  C CA    . GLN A 1 230 ? 16.900  57.863  29.811  1.00 26.76  ? 230  GLN A CA    1 
ATOM   1741  C C     . GLN A 1 230 ? 18.277  57.609  29.181  1.00 26.71  ? 230  GLN A C     1 
ATOM   1742  O O     . GLN A 1 230 ? 18.528  56.542  28.613  1.00 26.60  ? 230  GLN A O     1 
ATOM   1743  C CB    . GLN A 1 230 ? 16.535  56.759  30.810  1.00 26.70  ? 230  GLN A CB    1 
ATOM   1744  C CG    . GLN A 1 230 ? 17.470  56.685  32.032  1.00 27.41  ? 230  GLN A CG    1 
ATOM   1745  C CD    . GLN A 1 230 ? 16.917  55.805  33.148  1.00 27.70  ? 230  GLN A CD    1 
ATOM   1746  O OE1   . GLN A 1 230 ? 15.772  55.969  33.584  1.00 30.03  ? 230  GLN A OE1   1 
ATOM   1747  N NE2   . GLN A 1 230 ? 17.731  54.870  33.619  1.00 27.78  ? 230  GLN A NE2   1 
ATOM   1748  N N     . GLU A 1 231 ? 19.157  58.604  29.276  1.00 26.65  ? 231  GLU A N     1 
ATOM   1749  C CA    . GLU A 1 231 ? 20.490  58.523  28.666  1.00 26.80  ? 231  GLU A CA    1 
ATOM   1750  C C     . GLU A 1 231 ? 21.297  57.386  29.301  1.00 25.89  ? 231  GLU A C     1 
ATOM   1751  O O     . GLU A 1 231 ? 21.250  57.192  30.524  1.00 25.80  ? 231  GLU A O     1 
ATOM   1752  C CB    . GLU A 1 231 ? 21.224  59.872  28.784  1.00 27.32  ? 231  GLU A CB    1 
ATOM   1753  C CG    . GLU A 1 231 ? 22.042  60.257  27.535  1.00 29.73  ? 231  GLU A CG    1 
ATOM   1754  C CD    . GLU A 1 231 ? 21.177  60.511  26.296  1.00 32.49  ? 231  GLU A CD    1 
ATOM   1755  O OE1   . GLU A 1 231 ? 20.343  61.450  26.313  1.00 32.83  ? 231  GLU A OE1   1 
ATOM   1756  O OE2   . GLU A 1 231 ? 21.340  59.772  25.294  1.00 34.68  ? 231  GLU A OE2   1 
ATOM   1757  N N     . GLY A 1 232 ? 22.004  56.623  28.464  1.00 25.00  ? 232  GLY A N     1 
ATOM   1758  C CA    . GLY A 1 232 ? 22.732  55.424  28.905  1.00 23.79  ? 232  GLY A CA    1 
ATOM   1759  C C     . GLY A 1 232 ? 21.926  54.130  28.790  1.00 23.25  ? 232  GLY A C     1 
ATOM   1760  O O     . GLY A 1 232 ? 22.394  53.143  28.204  1.00 23.77  ? 232  GLY A O     1 
ATOM   1761  N N     . ARG A 1 233 ? 20.715  54.130  29.347  1.00 21.80  ? 233  ARG A N     1 
ATOM   1762  C CA    . ARG A 1 233 ? 19.839  52.956  29.309  1.00 20.71  ? 233  ARG A CA    1 
ATOM   1763  C C     . ARG A 1 233 ? 19.161  52.775  27.946  1.00 19.98  ? 233  ARG A C     1 
ATOM   1764  O O     . ARG A 1 233 ? 19.192  51.683  27.368  1.00 19.37  ? 233  ARG A O     1 
ATOM   1765  C CB    . ARG A 1 233 ? 18.777  53.044  30.410  1.00 20.33  ? 233  ARG A CB    1 
ATOM   1766  C CG    . ARG A 1 233 ? 17.845  51.838  30.476  1.00 20.09  ? 233  ARG A CG    1 
ATOM   1767  C CD    . ARG A 1 233 ? 16.636  52.124  31.338  1.00 20.63  ? 233  ARG A CD    1 
ATOM   1768  N NE    . ARG A 1 233 ? 15.660  52.957  30.642  1.00 21.34  ? 233  ARG A NE    1 
ATOM   1769  C CZ    . ARG A 1 233 ? 14.518  53.397  31.164  1.00 23.67  ? 233  ARG A CZ    1 
ATOM   1770  N NH1   . ARG A 1 233 ? 14.191  53.114  32.424  1.00 23.30  ? 233  ARG A NH1   1 
ATOM   1771  N NH2   . ARG A 1 233 ? 13.698  54.143  30.420  1.00 24.55  ? 233  ARG A NH2   1 
ATOM   1772  N N     . ASP A 1 234 ? 18.560  53.852  27.437  1.00 19.72  ? 234  ASP A N     1 
ATOM   1773  C CA    . ASP A 1 234 ? 17.733  53.781  26.234  1.00 19.20  ? 234  ASP A CA    1 
ATOM   1774  C C     . ASP A 1 234 ? 18.581  53.927  24.997  1.00 18.72  ? 234  ASP A C     1 
ATOM   1775  O O     . ASP A 1 234 ? 19.479  54.779  24.943  1.00 17.66  ? 234  ASP A O     1 
ATOM   1776  C CB    . ASP A 1 234 ? 16.653  54.872  26.242  1.00 19.73  ? 234  ASP A CB    1 
ATOM   1777  C CG    . ASP A 1 234 ? 15.643  54.690  27.346  1.00 20.34  ? 234  ASP A CG    1 
ATOM   1778  O OD1   . ASP A 1 234 ? 15.531  53.572  27.897  1.00 22.17  ? 234  ASP A OD1   1 
ATOM   1779  O OD2   . ASP A 1 234 ? 14.950  55.679  27.663  1.00 21.79  ? 234  ASP A OD2   1 
ATOM   1780  N N     . LEU A 1 235 ? 18.264  53.115  23.992  1.00 18.10  ? 235  LEU A N     1 
ATOM   1781  C CA    . LEU A 1 235 ? 19.013  53.084  22.740  1.00 18.04  ? 235  LEU A CA    1 
ATOM   1782  C C     . LEU A 1 235 ? 18.070  52.986  21.546  1.00 17.89  ? 235  LEU A C     1 
ATOM   1783  O O     . LEU A 1 235 ? 17.122  52.213  21.570  1.00 17.69  ? 235  LEU A O     1 
ATOM   1784  C CB    . LEU A 1 235 ? 19.990  51.904  22.724  1.00 18.06  ? 235  LEU A CB    1 
ATOM   1785  C CG    . LEU A 1 235 ? 21.030  51.757  23.844  1.00 18.61  ? 235  LEU A CG    1 
ATOM   1786  C CD1   . LEU A 1 235 ? 21.569  50.335  23.864  1.00 18.86  ? 235  LEU A CD1   1 
ATOM   1787  C CD2   . LEU A 1 235 ? 22.186  52.795  23.753  1.00 17.59  ? 235  LEU A CD2   1 
ATOM   1788  N N     . TRP A 1 236 ? 18.340  53.767  20.503  1.00 17.88  ? 236  TRP A N     1 
ATOM   1789  C CA    . TRP A 1 236 ? 17.529  53.748  19.290  1.00 18.25  ? 236  TRP A CA    1 
ATOM   1790  C C     . TRP A 1 236 ? 17.896  52.546  18.434  1.00 18.38  ? 236  TRP A C     1 
ATOM   1791  O O     . TRP A 1 236 ? 19.081  52.268  18.212  1.00 18.07  ? 236  TRP A O     1 
ATOM   1792  C CB    . TRP A 1 236 ? 17.718  55.037  18.476  1.00 18.50  ? 236  TRP A CB    1 
ATOM   1793  C CG    . TRP A 1 236 ? 17.086  56.278  19.077  1.00 18.93  ? 236  TRP A CG    1 
ATOM   1794  C CD1   . TRP A 1 236 ? 17.740  57.374  19.569  1.00 19.02  ? 236  TRP A CD1   1 
ATOM   1795  C CD2   . TRP A 1 236 ? 15.684  56.547  19.233  1.00 19.20  ? 236  TRP A CD2   1 
ATOM   1796  N NE1   . TRP A 1 236 ? 16.836  58.304  20.026  1.00 19.17  ? 236  TRP A NE1   1 
ATOM   1797  C CE2   . TRP A 1 236 ? 15.567  57.821  19.834  1.00 20.46  ? 236  TRP A CE2   1 
ATOM   1798  C CE3   . TRP A 1 236 ? 14.514  55.829  18.939  1.00 20.48  ? 236  TRP A CE3   1 
ATOM   1799  C CZ2   . TRP A 1 236 ? 14.323  58.399  20.140  1.00 20.09  ? 236  TRP A CZ2   1 
ATOM   1800  C CZ3   . TRP A 1 236 ? 13.278  56.405  19.242  1.00 19.28  ? 236  TRP A CZ3   1 
ATOM   1801  C CH2   . TRP A 1 236 ? 13.196  57.676  19.831  1.00 19.39  ? 236  TRP A CH2   1 
ATOM   1802  N N     . TRP A 1 237 ? 16.875  51.840  17.958  1.00 18.54  ? 237  TRP A N     1 
ATOM   1803  C CA    . TRP A 1 237 ? 17.040  50.687  17.059  1.00 18.74  ? 237  TRP A CA    1 
ATOM   1804  C C     . TRP A 1 237 ? 17.942  50.993  15.857  1.00 18.83  ? 237  TRP A C     1 
ATOM   1805  O O     . TRP A 1 237 ? 18.896  50.257  15.589  1.00 18.38  ? 237  TRP A O     1 
ATOM   1806  C CB    . TRP A 1 237 ? 15.664  50.215  16.572  1.00 19.13  ? 237  TRP A CB    1 
ATOM   1807  C CG    . TRP A 1 237 ? 15.695  49.062  15.612  1.00 19.46  ? 237  TRP A CG    1 
ATOM   1808  C CD1   . TRP A 1 237 ? 16.052  49.098  14.293  1.00 20.36  ? 237  TRP A CD1   1 
ATOM   1809  C CD2   . TRP A 1 237 ? 15.323  47.710  15.888  1.00 20.43  ? 237  TRP A CD2   1 
ATOM   1810  N NE1   . TRP A 1 237 ? 15.942  47.849  13.735  1.00 20.79  ? 237  TRP A NE1   1 
ATOM   1811  C CE2   . TRP A 1 237 ? 15.489  46.977  14.688  1.00 20.14  ? 237  TRP A CE2   1 
ATOM   1812  C CE3   . TRP A 1 237 ? 14.867  47.044  17.034  1.00 21.00  ? 237  TRP A CE3   1 
ATOM   1813  C CZ2   . TRP A 1 237 ? 15.229  45.605  14.601  1.00 20.41  ? 237  TRP A CZ2   1 
ATOM   1814  C CZ3   . TRP A 1 237 ? 14.593  45.670  16.947  1.00 20.93  ? 237  TRP A CZ3   1 
ATOM   1815  C CH2   . TRP A 1 237 ? 14.779  44.969  15.740  1.00 20.53  ? 237  TRP A CH2   1 
ATOM   1816  N N     . ARG A 1 238 ? 17.639  52.075  15.137  1.00 19.21  ? 238  ARG A N     1 
ATOM   1817  C CA    . ARG A 1 238 ? 18.398  52.418  13.931  1.00 19.13  ? 238  ARG A CA    1 
ATOM   1818  C C     . ARG A 1 238 ? 19.878  52.697  14.230  1.00 19.71  ? 238  ARG A C     1 
ATOM   1819  O O     . ARG A 1 238 ? 20.753  52.192  13.534  1.00 19.44  ? 238  ARG A O     1 
ATOM   1820  C CB    . ARG A 1 238 ? 17.753  53.576  13.161  1.00 19.28  ? 238  ARG A CB    1 
ATOM   1821  C CG    . ARG A 1 238 ? 18.438  53.827  11.793  1.00 18.65  ? 238  ARG A CG    1 
ATOM   1822  C CD    . ARG A 1 238 ? 17.839  54.966  10.976  1.00 18.90  ? 238  ARG A CD    1 
ATOM   1823  N NE    . ARG A 1 238 ? 18.815  55.455  10.000  1.00 16.87  ? 238  ARG A NE    1 
ATOM   1824  C CZ    . ARG A 1 238 ? 19.036  54.900  8.806   1.00 17.60  ? 238  ARG A CZ    1 
ATOM   1825  N NH1   . ARG A 1 238 ? 18.336  53.842  8.405   1.00 17.89  ? 238  ARG A NH1   1 
ATOM   1826  N NH2   . ARG A 1 238 ? 19.960  55.402  8.005   1.00 15.83  ? 238  ARG A NH2   1 
ATOM   1827  N N     . ASP A 1 239 ? 20.146  53.482  15.273  1.00 20.26  ? 239  ASP A N     1 
ATOM   1828  C CA    . ASP A 1 239 ? 21.518  53.811  15.679  1.00 21.05  ? 239  ASP A CA    1 
ATOM   1829  C C     . ASP A 1 239 ? 22.367  52.572  15.933  1.00 21.02  ? 239  ASP A C     1 
ATOM   1830  O O     . ASP A 1 239 ? 23.538  52.544  15.585  1.00 20.41  ? 239  ASP A O     1 
ATOM   1831  C CB    . ASP A 1 239 ? 21.513  54.697  16.932  1.00 21.50  ? 239  ASP A CB    1 
ATOM   1832  C CG    . ASP A 1 239 ? 20.986  56.098  16.657  1.00 23.82  ? 239  ASP A CG    1 
ATOM   1833  O OD1   . ASP A 1 239 ? 20.813  56.455  15.467  1.00 26.14  ? 239  ASP A OD1   1 
ATOM   1834  O OD2   . ASP A 1 239 ? 20.749  56.845  17.633  1.00 25.49  ? 239  ASP A OD2   1 
ATOM   1835  N N     . LEU A 1 240 ? 21.770  51.553  16.550  1.00 21.36  ? 240  LEU A N     1 
ATOM   1836  C CA    . LEU A 1 240 ? 22.477  50.297  16.813  1.00 21.99  ? 240  LEU A CA    1 
ATOM   1837  C C     . LEU A 1 240 ? 22.667  49.434  15.562  1.00 21.85  ? 240  LEU A C     1 
ATOM   1838  O O     . LEU A 1 240 ? 23.768  48.951  15.296  1.00 21.81  ? 240  LEU A O     1 
ATOM   1839  C CB    . LEU A 1 240 ? 21.759  49.475  17.896  1.00 22.14  ? 240  LEU A CB    1 
ATOM   1840  C CG    . LEU A 1 240 ? 21.679  50.034  19.318  1.00 22.88  ? 240  LEU A CG    1 
ATOM   1841  C CD1   . LEU A 1 240 ? 20.736  49.166  20.148  1.00 22.25  ? 240  LEU A CD1   1 
ATOM   1842  C CD2   . LEU A 1 240 ? 23.049  50.138  19.975  1.00 22.38  ? 240  LEU A CD2   1 
ATOM   1843  N N     . ILE A 1 241 ? 21.594  49.232  14.804  1.00 22.07  ? 241  ILE A N     1 
ATOM   1844  C CA    . ILE A 1 241 ? 21.632  48.281  13.686  1.00 22.48  ? 241  ILE A CA    1 
ATOM   1845  C C     . ILE A 1 241 ? 22.500  48.785  12.518  1.00 23.06  ? 241  ILE A C     1 
ATOM   1846  O O     . ILE A 1 241 ? 23.198  48.005  11.852  1.00 22.98  ? 241  ILE A O     1 
ATOM   1847  C CB    . ILE A 1 241 ? 20.197  47.855  13.240  1.00 22.44  ? 241  ILE A CB    1 
ATOM   1848  C CG1   . ILE A 1 241 ? 20.238  46.502  12.531  1.00 22.47  ? 241  ILE A CG1   1 
ATOM   1849  C CG2   . ILE A 1 241 ? 19.523  48.936  12.375  1.00 21.27  ? 241  ILE A CG2   1 
ATOM   1850  C CD1   . ILE A 1 241 ? 18.908  45.783  12.478  1.00 21.33  ? 241  ILE A CD1   1 
ATOM   1851  N N     . GLU A 1 242 ? 22.473  50.097  12.302  1.00 23.35  ? 242  GLU A N     1 
ATOM   1852  C CA    . GLU A 1 242 ? 23.311  50.733  11.300  1.00 24.03  ? 242  GLU A CA    1 
ATOM   1853  C C     . GLU A 1 242 ? 24.784  50.522  11.595  1.00 23.84  ? 242  GLU A C     1 
ATOM   1854  O O     . GLU A 1 242 ? 25.596  50.469  10.673  1.00 23.50  ? 242  GLU A O     1 
ATOM   1855  C CB    . GLU A 1 242 ? 23.011  52.238  11.214  1.00 24.33  ? 242  GLU A CB    1 
ATOM   1856  C CG    . GLU A 1 242 ? 21.707  52.555  10.484  1.00 26.72  ? 242  GLU A CG    1 
ATOM   1857  C CD    . GLU A 1 242 ? 21.572  51.789  9.172   1.00 29.21  ? 242  GLU A CD    1 
ATOM   1858  O OE1   . GLU A 1 242 ? 22.428  51.996  8.282   1.00 31.08  ? 242  GLU A OE1   1 
ATOM   1859  O OE2   . GLU A 1 242 ? 20.615  50.987  9.037   1.00 29.93  ? 242  GLU A OE2   1 
ATOM   1860  N N     . LYS A 1 243 ? 25.121  50.406  12.879  1.00 23.71  ? 243  LYS A N     1 
ATOM   1861  C CA    . LYS A 1 243 ? 26.517  50.247  13.293  1.00 23.68  ? 243  LYS A CA    1 
ATOM   1862  C C     . LYS A 1 243 ? 26.981  48.790  13.224  1.00 23.44  ? 243  LYS A C     1 
ATOM   1863  O O     . LYS A 1 243 ? 28.178  48.513  13.308  1.00 22.88  ? 243  LYS A O     1 
ATOM   1864  C CB    . LYS A 1 243 ? 26.725  50.799  14.706  1.00 23.98  ? 243  LYS A CB    1 
ATOM   1865  N N     . ALA A 1 244 ? 26.030  47.870  13.055  1.00 22.85  ? 244  ALA A N     1 
ATOM   1866  C CA    . ALA A 1 244 ? 26.297  46.440  13.209  1.00 22.70  ? 244  ALA A CA    1 
ATOM   1867  C C     . ALA A 1 244 ? 26.760  45.783  11.916  1.00 22.74  ? 244  ALA A C     1 
ATOM   1868  O O     . ALA A 1 244 ? 26.337  46.162  10.823  1.00 22.97  ? 244  ALA A O     1 
ATOM   1869  C CB    . ALA A 1 244 ? 25.068  45.728  13.756  1.00 22.18  ? 244  ALA A CB    1 
ATOM   1870  N N     . SER A 1 245 ? 27.628  44.789  12.053  1.00 22.76  ? 245  SER A N     1 
ATOM   1871  C CA    . SER A 1 245 ? 28.039  43.971  10.923  1.00 22.97  ? 245  SER A CA    1 
ATOM   1872  C C     . SER A 1 245 ? 26.880  43.113  10.398  1.00 23.03  ? 245  SER A C     1 
ATOM   1873  O O     . SER A 1 245 ? 26.154  42.502  11.181  1.00 22.62  ? 245  SER A O     1 
ATOM   1874  C CB    . SER A 1 245 ? 29.213  43.071  11.314  1.00 22.92  ? 245  SER A CB    1 
ATOM   1875  O OG    . SER A 1 245 ? 29.522  42.176  10.261  1.00 23.44  ? 245  SER A OG    1 
ATOM   1876  N N     . PRO A 1 246 ? 26.711  43.068  9.064   1.00 23.39  ? 246  PRO A N     1 
ATOM   1877  C CA    . PRO A 1 246 ? 25.710  42.194  8.467   1.00 23.84  ? 246  PRO A CA    1 
ATOM   1878  C C     . PRO A 1 246 ? 26.177  40.729  8.377   1.00 24.23  ? 246  PRO A C     1 
ATOM   1879  O O     . PRO A 1 246 ? 25.437  39.876  7.879   1.00 23.90  ? 246  PRO A O     1 
ATOM   1880  C CB    . PRO A 1 246 ? 25.519  42.798  7.076   1.00 23.98  ? 246  PRO A CB    1 
ATOM   1881  C CG    . PRO A 1 246 ? 26.845  43.373  6.736   1.00 23.50  ? 246  PRO A CG    1 
ATOM   1882  C CD    . PRO A 1 246 ? 27.440  43.851  8.044   1.00 23.48  ? 246  PRO A CD    1 
ATOM   1883  N N     . GLU A 1 247 ? 27.386  40.451  8.862   1.00 24.55  ? 247  GLU A N     1 
ATOM   1884  C CA    . GLU A 1 247 ? 27.936  39.093  8.854   1.00 25.32  ? 247  GLU A CA    1 
ATOM   1885  C C     . GLU A 1 247 ? 27.825  38.468  10.234  1.00 24.34  ? 247  GLU A C     1 
ATOM   1886  O O     . GLU A 1 247 ? 28.285  39.041  11.222  1.00 24.31  ? 247  GLU A O     1 
ATOM   1887  C CB    . GLU A 1 247 ? 29.403  39.087  8.399   1.00 25.94  ? 247  GLU A CB    1 
ATOM   1888  C CG    . GLU A 1 247 ? 29.686  39.896  7.127   1.00 30.63  ? 247  GLU A CG    1 
ATOM   1889  C CD    . GLU A 1 247 ? 29.147  39.226  5.871   1.00 36.09  ? 247  GLU A CD    1 
ATOM   1890  O OE1   . GLU A 1 247 ? 29.702  38.170  5.474   1.00 38.42  ? 247  GLU A OE1   1 
ATOM   1891  O OE2   . GLU A 1 247 ? 28.177  39.757  5.279   1.00 38.15  ? 247  GLU A OE2   1 
ATOM   1892  N N     . HIS A 1 248 ? 27.193  37.302  10.292  1.00 23.81  ? 248  HIS A N     1 
ATOM   1893  C CA    . HIS A 1 248 ? 27.069  36.541  11.532  1.00 23.64  ? 248  HIS A CA    1 
ATOM   1894  C C     . HIS A 1 248 ? 26.930  35.056  11.216  1.00 23.63  ? 248  HIS A C     1 
ATOM   1895  O O     . HIS A 1 248 ? 26.066  34.655  10.436  1.00 23.27  ? 248  HIS A O     1 
ATOM   1896  C CB    . HIS A 1 248 ? 25.899  37.029  12.407  1.00 23.23  ? 248  HIS A CB    1 
ATOM   1897  C CG    . HIS A 1 248 ? 25.758  36.262  13.686  1.00 22.98  ? 248  HIS A CG    1 
ATOM   1898  N ND1   . HIS A 1 248 ? 25.071  35.071  13.765  1.00 22.18  ? 248  HIS A ND1   1 
ATOM   1899  C CD2   . HIS A 1 248 ? 26.267  36.482  14.922  1.00 22.79  ? 248  HIS A CD2   1 
ATOM   1900  C CE1   . HIS A 1 248 ? 25.143  34.603  14.997  1.00 22.61  ? 248  HIS A CE1   1 
ATOM   1901  N NE2   . HIS A 1 248 ? 25.865  35.440  15.719  1.00 22.19  ? 248  HIS A NE2   1 
ATOM   1902  N N     . GLN A 1 249 ? 27.811  34.256  11.809  1.00 24.04  ? 249  GLN A N     1 
ATOM   1903  C CA    . GLN A 1 249 ? 27.810  32.805  11.629  1.00 24.97  ? 249  GLN A CA    1 
ATOM   1904  C C     . GLN A 1 249 ? 26.959  32.158  12.713  1.00 24.37  ? 249  GLN A C     1 
ATOM   1905  O O     . GLN A 1 249 ? 27.231  32.335  13.905  1.00 24.25  ? 249  GLN A O     1 
ATOM   1906  C CB    . GLN A 1 249 ? 29.234  32.230  11.692  1.00 25.31  ? 249  GLN A CB    1 
ATOM   1907  C CG    . GLN A 1 249 ? 30.230  32.873  10.738  1.00 28.76  ? 249  GLN A CG    1 
ATOM   1908  C CD    . GLN A 1 249 ? 29.797  32.777  9.287   1.00 34.11  ? 249  GLN A CD    1 
ATOM   1909  O OE1   . GLN A 1 249 ? 29.498  33.796  8.646   1.00 36.78  ? 249  GLN A OE1   1 
ATOM   1910  N NE2   . GLN A 1 249 ? 29.749  31.549  8.759   1.00 35.33  ? 249  GLN A NE2   1 
ATOM   1911  N N     . PRO A 1 250 ? 25.933  31.393  12.310  1.00 24.21  ? 250  PRO A N     1 
ATOM   1912  C CA    . PRO A 1 250 ? 25.087  30.776  13.329  1.00 24.24  ? 250  PRO A CA    1 
ATOM   1913  C C     . PRO A 1 250 ? 25.829  29.637  14.029  1.00 24.10  ? 250  PRO A C     1 
ATOM   1914  O O     . PRO A 1 250 ? 26.572  28.888  13.387  1.00 24.08  ? 250  PRO A O     1 
ATOM   1915  C CB    . PRO A 1 250 ? 23.892  30.250  12.531  1.00 24.14  ? 250  PRO A CB    1 
ATOM   1916  C CG    . PRO A 1 250 ? 24.389  30.068  11.149  1.00 24.24  ? 250  PRO A CG    1 
ATOM   1917  C CD    . PRO A 1 250 ? 25.525  31.033  10.940  1.00 24.23  ? 250  PRO A CD    1 
ATOM   1918  N N     . GLU A 1 251 ? 25.653  29.532  15.338  1.00 23.97  ? 251  GLU A N     1 
ATOM   1919  C CA    . GLU A 1 251 ? 26.270  28.450  16.092  1.00 24.05  ? 251  GLU A CA    1 
ATOM   1920  C C     . GLU A 1 251 ? 25.247  27.371  16.428  1.00 23.24  ? 251  GLU A C     1 
ATOM   1921  O O     . GLU A 1 251 ? 24.036  27.628  16.474  1.00 22.83  ? 251  GLU A O     1 
ATOM   1922  C CB    . GLU A 1 251 ? 26.957  28.990  17.352  1.00 24.53  ? 251  GLU A CB    1 
ATOM   1923  C CG    . GLU A 1 251 ? 28.443  29.263  17.157  1.00 28.43  ? 251  GLU A CG    1 
ATOM   1924  C CD    . GLU A 1 251 ? 28.979  30.339  18.074  1.00 33.00  ? 251  GLU A CD    1 
ATOM   1925  O OE1   . GLU A 1 251 ? 29.977  30.991  17.686  1.00 35.88  ? 251  GLU A OE1   1 
ATOM   1926  O OE2   . GLU A 1 251 ? 28.414  30.540  19.174  1.00 34.40  ? 251  GLU A OE2   1 
ATOM   1927  N N     . ALA A 1 252 ? 25.748  26.160  16.639  1.00 22.44  ? 252  ALA A N     1 
ATOM   1928  C CA    . ALA A 1 252 ? 24.916  25.016  16.967  1.00 21.87  ? 252  ALA A CA    1 
ATOM   1929  C C     . ALA A 1 252 ? 24.320  25.141  18.369  1.00 21.54  ? 252  ALA A C     1 
ATOM   1930  O O     . ALA A 1 252 ? 25.048  25.365  19.351  1.00 21.21  ? 252  ALA A O     1 
ATOM   1931  C CB    . ALA A 1 252 ? 25.723  23.729  16.839  1.00 22.03  ? 252  ALA A CB    1 
ATOM   1932  N N     . MET A 1 253 ? 22.997  25.007  18.435  1.00 20.59  ? 253  MET A N     1 
ATOM   1933  C CA    . MET A 1 253 ? 22.257  24.878  19.685  1.00 20.43  ? 253  MET A CA    1 
ATOM   1934  C C     . MET A 1 253 ? 21.853  23.414  19.846  1.00 19.97  ? 253  MET A C     1 
ATOM   1935  O O     . MET A 1 253 ? 21.526  22.763  18.855  1.00 19.56  ? 253  MET A O     1 
ATOM   1936  C CB    . MET A 1 253 ? 20.993  25.760  19.653  1.00 20.38  ? 253  MET A CB    1 
ATOM   1937  C CG    . MET A 1 253 ? 21.272  27.228  19.253  1.00 21.58  ? 253  MET A CG    1 
ATOM   1938  S SD    . MET A 1 253 ? 22.388  28.013  20.432  1.00 23.86  ? 253  MET A SD    1 
ATOM   1939  C CE    . MET A 1 253 ? 23.149  29.302  19.443  1.00 22.69  ? 253  MET A CE    1 
ATOM   1940  N N     . ASN A 1 254 ? 21.862  22.902  21.078  1.00 19.76  ? 254  ASN A N     1 
ATOM   1941  C CA    . ASN A 1 254 ? 21.284  21.577  21.343  1.00 20.14  ? 254  ASN A CA    1 
ATOM   1942  C C     . ASN A 1 254 ? 19.787  21.613  21.107  1.00 19.87  ? 254  ASN A C     1 
ATOM   1943  O O     . ASN A 1 254 ? 19.146  22.645  21.326  1.00 19.97  ? 254  ASN A O     1 
ATOM   1944  C CB    . ASN A 1 254 ? 21.560  21.098  22.776  1.00 20.32  ? 254  ASN A CB    1 
ATOM   1945  C CG    . ASN A 1 254 ? 21.136  19.639  22.997  1.00 22.57  ? 254  ASN A CG    1 
ATOM   1946  O OD1   . ASN A 1 254 ? 20.028  19.357  23.508  1.00 23.20  ? 254  ASN A OD1   1 
ATOM   1947  N ND2   . ASN A 1 254 ? 22.000  18.695  22.569  1.00 22.88  ? 254  ASN A ND2   1 
ATOM   1948  N N     . ALA A 1 255 ? 19.236  20.486  20.667  1.00 19.75  ? 255  ALA A N     1 
ATOM   1949  C CA    . ALA A 1 255 ? 17.802  20.363  20.434  1.00 19.59  ? 255  ALA A CA    1 
ATOM   1950  C C     . ALA A 1 255 ? 17.001  20.850  21.632  1.00 19.37  ? 255  ALA A C     1 
ATOM   1951  O O     . ALA A 1 255 ? 15.925  21.429  21.465  1.00 19.43  ? 255  ALA A O     1 
ATOM   1952  C CB    . ALA A 1 255 ? 17.439  18.928  20.132  1.00 19.29  ? 255  ALA A CB    1 
ATOM   1953  N N     . GLU A 1 256 ? 17.531  20.598  22.830  1.00 19.01  ? 256  GLU A N     1 
ATOM   1954  C CA    . GLU A 1 256 ? 16.826  20.907  24.075  1.00 18.84  ? 256  GLU A CA    1 
ATOM   1955  C C     . GLU A 1 256 ? 17.259  22.216  24.740  1.00 18.61  ? 256  GLU A C     1 
ATOM   1956  O O     . GLU A 1 256 ? 16.858  22.480  25.867  1.00 19.15  ? 256  GLU A O     1 
ATOM   1957  C CB    . GLU A 1 256 ? 16.887  19.728  25.074  1.00 18.75  ? 256  GLU A CB    1 
ATOM   1958  C CG    . GLU A 1 256 ? 16.091  18.477  24.635  1.00 17.95  ? 256  GLU A CG    1 
ATOM   1959  C CD    . GLU A 1 256 ? 14.583  18.717  24.516  1.00 18.41  ? 256  GLU A CD    1 
ATOM   1960  O OE1   . GLU A 1 256 ? 14.059  19.700  25.091  1.00 16.52  ? 256  GLU A OE1   1 
ATOM   1961  O OE2   . GLU A 1 256 ? 13.910  17.911  23.841  1.00 19.82  ? 256  GLU A OE2   1 
ATOM   1962  N N     . ASP A 1 257 ? 18.045  23.041  24.044  1.00 18.25  ? 257  ASP A N     1 
ATOM   1963  C CA    . ASP A 1 257 ? 18.287  24.420  24.495  1.00 18.48  ? 257  ASP A CA    1 
ATOM   1964  C C     . ASP A 1 257 ? 16.976  25.220  24.517  1.00 18.63  ? 257  ASP A C     1 
ATOM   1965  O O     . ASP A 1 257 ? 16.177  25.115  23.588  1.00 18.61  ? 257  ASP A O     1 
ATOM   1966  C CB    . ASP A 1 257 ? 19.313  25.132  23.602  1.00 18.44  ? 257  ASP A CB    1 
ATOM   1967  C CG    . ASP A 1 257 ? 20.753  24.728  23.912  1.00 18.92  ? 257  ASP A CG    1 
ATOM   1968  O OD1   . ASP A 1 257 ? 21.018  24.172  24.997  1.00 18.40  ? 257  ASP A OD1   1 
ATOM   1969  O OD2   . ASP A 1 257 ? 21.635  24.978  23.064  1.00 19.94  ? 257  ASP A OD2   1 
ATOM   1970  N N     . PRO A 1 258 ? 16.745  26.007  25.587  1.00 18.83  ? 258  PRO A N     1 
ATOM   1971  C CA    . PRO A 1 258 ? 15.540  26.844  25.664  1.00 18.82  ? 258  PRO A CA    1 
ATOM   1972  C C     . PRO A 1 258 ? 15.481  27.815  24.488  1.00 18.73  ? 258  PRO A C     1 
ATOM   1973  O O     . PRO A 1 258 ? 16.524  28.358  24.074  1.00 18.65  ? 258  PRO A O     1 
ATOM   1974  C CB    . PRO A 1 258 ? 15.718  27.627  26.969  1.00 18.97  ? 258  PRO A CB    1 
ATOM   1975  C CG    . PRO A 1 258 ? 16.715  26.846  27.778  1.00 20.23  ? 258  PRO A CG    1 
ATOM   1976  C CD    . PRO A 1 258 ? 17.611  26.144  26.776  1.00 19.02  ? 258  PRO A CD    1 
ATOM   1977  N N     . LEU A 1 259 ? 14.281  28.010  23.943  1.00 18.20  ? 259  LEU A N     1 
ATOM   1978  C CA    . LEU A 1 259 ? 14.089  28.884  22.778  1.00 17.98  ? 259  LEU A CA    1 
ATOM   1979  C C     . LEU A 1 259 ? 13.323  30.150  23.150  1.00 18.22  ? 259  LEU A C     1 
ATOM   1980  O O     . LEU A 1 259 ? 13.742  31.272  22.827  1.00 18.52  ? 259  LEU A O     1 
ATOM   1981  C CB    . LEU A 1 259 ? 13.353  28.144  21.647  1.00 17.70  ? 259  LEU A CB    1 
ATOM   1982  C CG    . LEU A 1 259 ? 12.986  28.965  20.398  1.00 18.20  ? 259  LEU A CG    1 
ATOM   1983  C CD1   . LEU A 1 259 ? 14.241  29.268  19.571  1.00 17.83  ? 259  LEU A CD1   1 
ATOM   1984  C CD2   . LEU A 1 259 ? 11.937  28.249  19.545  1.00 16.94  ? 259  LEU A CD2   1 
ATOM   1985  N N     . PHE A 1 260 ? 12.181  29.966  23.796  1.00 17.98  ? 260  PHE A N     1 
ATOM   1986  C CA    . PHE A 1 260 ? 11.407  31.097  24.254  1.00 17.58  ? 260  PHE A CA    1 
ATOM   1987  C C     . PHE A 1 260 ? 10.570  30.756  25.465  1.00 18.00  ? 260  PHE A C     1 
ATOM   1988  O O     . PHE A 1 260 ? 10.381  29.582  25.798  1.00 17.67  ? 260  PHE A O     1 
ATOM   1989  C CB    . PHE A 1 260 ? 10.556  31.710  23.126  1.00 17.28  ? 260  PHE A CB    1 
ATOM   1990  C CG    . PHE A 1 260 ? 9.415   30.851  22.651  1.00 16.95  ? 260  PHE A CG    1 
ATOM   1991  C CD1   . PHE A 1 260 ? 8.186   30.844  23.331  1.00 17.53  ? 260  PHE A CD1   1 
ATOM   1992  C CD2   . PHE A 1 260 ? 9.552   30.075  21.503  1.00 17.65  ? 260  PHE A CD2   1 
ATOM   1993  C CE1   . PHE A 1 260 ? 7.112   30.055  22.877  1.00 17.38  ? 260  PHE A CE1   1 
ATOM   1994  C CE2   . PHE A 1 260 ? 8.496   29.285  21.040  1.00 18.08  ? 260  PHE A CE2   1 
ATOM   1995  C CZ    . PHE A 1 260 ? 7.265   29.285  21.720  1.00 18.77  ? 260  PHE A CZ    1 
ATOM   1996  N N     . ILE A 1 261 ? 10.122  31.813  26.136  1.00 18.67  ? 261  ILE A N     1 
ATOM   1997  C CA    . ILE A 1 261 ? 9.147   31.742  27.208  1.00 19.74  ? 261  ILE A CA    1 
ATOM   1998  C C     . ILE A 1 261 ? 7.961   32.571  26.763  1.00 19.14  ? 261  ILE A C     1 
ATOM   1999  O O     . ILE A 1 261 ? 8.148   33.620  26.136  1.00 18.59  ? 261  ILE A O     1 
ATOM   2000  C CB    . ILE A 1 261 ? 9.679   32.407  28.501  1.00 20.05  ? 261  ILE A CB    1 
ATOM   2001  C CG1   . ILE A 1 261 ? 11.094  31.934  28.838  1.00 22.86  ? 261  ILE A CG1   1 
ATOM   2002  C CG2   . ILE A 1 261 ? 8.771   32.105  29.662  1.00 22.35  ? 261  ILE A CG2   1 
ATOM   2003  C CD1   . ILE A 1 261 ? 11.195  30.491  29.198  1.00 23.66  ? 261  ILE A CD1   1 
ATOM   2004  N N     . LEU A 1 262 ? 6.752   32.113  27.092  1.00 18.57  ? 262  LEU A N     1 
ATOM   2005  C CA    . LEU A 1 262 ? 5.535   32.912  26.912  1.00 18.58  ? 262  LEU A CA    1 
ATOM   2006  C C     . LEU A 1 262 ? 4.691   32.831  28.165  1.00 18.24  ? 262  LEU A C     1 
ATOM   2007  O O     . LEU A 1 262 ? 4.233   31.740  28.543  1.00 17.10  ? 262  LEU A O     1 
ATOM   2008  C CB    . LEU A 1 262 ? 4.681   32.405  25.738  1.00 18.64  ? 262  LEU A CB    1 
ATOM   2009  C CG    . LEU A 1 262 ? 4.668   33.151  24.406  1.00 21.08  ? 262  LEU A CG    1 
ATOM   2010  C CD1   . LEU A 1 262 ? 3.633   32.497  23.516  1.00 21.54  ? 262  LEU A CD1   1 
ATOM   2011  C CD2   . LEU A 1 262 ? 4.404   34.671  24.545  1.00 19.15  ? 262  LEU A CD2   1 
ATOM   2012  N N     . TYR A 1 263 ? 4.469   33.977  28.794  1.00 18.18  ? 263  TYR A N     1 
ATOM   2013  C CA    . TYR A 1 263 ? 3.605   34.024  29.961  1.00 19.48  ? 263  TYR A CA    1 
ATOM   2014  C C     . TYR A 1 263 ? 2.164   33.738  29.572  1.00 20.26  ? 263  TYR A C     1 
ATOM   2015  O O     . TYR A 1 263 ? 1.624   34.303  28.604  1.00 20.94  ? 263  TYR A O     1 
ATOM   2016  C CB    . TYR A 1 263 ? 3.797   35.324  30.768  1.00 19.14  ? 263  TYR A CB    1 
ATOM   2017  C CG    . TYR A 1 263 ? 5.131   35.262  31.481  1.00 18.84  ? 263  TYR A CG    1 
ATOM   2018  C CD1   . TYR A 1 263 ? 6.309   35.626  30.828  1.00 18.52  ? 263  TYR A CD1   1 
ATOM   2019  C CD2   . TYR A 1 263 ? 5.221   34.768  32.773  1.00 17.32  ? 263  TYR A CD2   1 
ATOM   2020  C CE1   . TYR A 1 263 ? 7.540   35.528  31.465  1.00 18.37  ? 263  TYR A CE1   1 
ATOM   2021  C CE2   . TYR A 1 263 ? 6.442   34.664  33.421  1.00 18.10  ? 263  TYR A CE2   1 
ATOM   2022  C CZ    . TYR A 1 263 ? 7.595   35.043  32.764  1.00 19.25  ? 263  TYR A CZ    1 
ATOM   2023  O OH    . TYR A 1 263 ? 8.805   34.933  33.408  1.00 20.47  ? 263  TYR A OH    1 
ATOM   2024  N N     . THR A 1 264 ? 1.580   32.810  30.319  1.00 20.34  ? 264  THR A N     1 
ATOM   2025  C CA    . THR A 1 264 ? 0.303   32.233  30.001  1.00 20.27  ? 264  THR A CA    1 
ATOM   2026  C C     . THR A 1 264 ? -0.517  32.168  31.264  1.00 20.52  ? 264  THR A C     1 
ATOM   2027  O O     . THR A 1 264 ? -0.019  31.738  32.299  1.00 20.10  ? 264  THR A O     1 
ATOM   2028  C CB    . THR A 1 264 ? 0.500   30.808  29.463  1.00 20.36  ? 264  THR A CB    1 
ATOM   2029  O OG1   . THR A 1 264 ? 1.365   30.864  28.333  1.00 19.47  ? 264  THR A OG1   1 
ATOM   2030  C CG2   . THR A 1 264 ? -0.825  30.186  29.043  1.00 20.25  ? 264  THR A CG2   1 
ATOM   2031  N N     . SER A 1 265 ? -1.776  32.598  31.167  1.00 21.31  ? 265  SER A N     1 
ATOM   2032  C CA    . SER A 1 265 ? -2.713  32.535  32.286  1.00 22.17  ? 265  SER A CA    1 
ATOM   2033  C C     . SER A 1 265 ? -3.126  31.110  32.614  1.00 22.41  ? 265  SER A C     1 
ATOM   2034  O O     . SER A 1 265 ? -3.384  30.298  31.725  1.00 22.46  ? 265  SER A O     1 
ATOM   2035  C CB    . SER A 1 265 ? -3.963  33.369  31.993  1.00 22.25  ? 265  SER A CB    1 
ATOM   2036  O OG    . SER A 1 265 ? -3.632  34.746  31.937  1.00 22.49  ? 265  SER A OG    1 
ATOM   2037  N N     . GLY A 1 266 ? -3.204  30.827  33.907  1.00 22.77  ? 266  GLY A N     1 
ATOM   2038  C CA    . GLY A 1 266 ? -3.610  29.516  34.384  1.00 23.46  ? 266  GLY A CA    1 
ATOM   2039  C C     . GLY A 1 266 ? -4.747  29.614  35.370  1.00 24.12  ? 266  GLY A C     1 
ATOM   2040  O O     . GLY A 1 266 ? -5.219  30.710  35.686  1.00 23.55  ? 266  GLY A O     1 
ATOM   2041  N N     . SER A 1 267 ? -5.168  28.454  35.859  1.00 25.28  ? 267  SER A N     1 
ATOM   2042  C CA    . SER A 1 267 ? -6.304  28.332  36.768  1.00 26.74  ? 267  SER A CA    1 
ATOM   2043  C C     . SER A 1 267 ? -6.004  28.904  38.156  1.00 27.41  ? 267  SER A C     1 
ATOM   2044  O O     . SER A 1 267 ? -6.908  29.344  38.874  1.00 27.25  ? 267  SER A O     1 
ATOM   2045  C CB    . SER A 1 267 ? -6.727  26.866  36.881  1.00 26.89  ? 267  SER A CB    1 
ATOM   2046  O OG    . SER A 1 267 ? -8.052  26.769  37.377  1.00 28.74  ? 267  SER A OG    1 
ATOM   2047  N N     . THR A 1 268 ? -4.730  28.900  38.541  1.00 28.13  ? 268  THR A N     1 
ATOM   2048  C CA    . THR A 1 268 ? -4.358  29.463  39.834  1.00 28.61  ? 268  THR A CA    1 
ATOM   2049  C C     . THR A 1 268 ? -3.230  30.459  39.644  1.00 28.37  ? 268  THR A C     1 
ATOM   2050  O O     . THR A 1 268 ? -2.363  30.258  38.793  1.00 28.44  ? 268  THR A O     1 
ATOM   2051  C CB    . THR A 1 268 ? -3.904  28.376  40.841  1.00 28.79  ? 268  THR A CB    1 
ATOM   2052  O OG1   . THR A 1 268 ? -2.552  28.012  40.563  1.00 30.90  ? 268  THR A OG1   1 
ATOM   2053  C CG2   . THR A 1 268 ? -4.785  27.130  40.763  1.00 28.80  ? 268  THR A CG2   1 
ATOM   2054  N N     . GLY A 1 269 ? -3.241  31.516  40.453  1.00 28.14  ? 269  GLY A N     1 
ATOM   2055  C CA    . GLY A 1 269 ? -2.140  32.482  40.497  1.00 27.76  ? 269  GLY A CA    1 
ATOM   2056  C C     . GLY A 1 269 ? -2.003  33.334  39.246  1.00 27.40  ? 269  GLY A C     1 
ATOM   2057  O O     . GLY A 1 269 ? -2.927  33.427  38.436  1.00 27.23  ? 269  GLY A O     1 
ATOM   2058  N N     . LYS A 1 270 ? -0.838  33.952  39.102  1.00 26.94  ? 270  LYS A N     1 
ATOM   2059  C CA    . LYS A 1 270 ? -0.545  34.831  37.978  1.00 27.24  ? 270  LYS A CA    1 
ATOM   2060  C C     . LYS A 1 270 ? 0.082   34.055  36.808  1.00 26.06  ? 270  LYS A C     1 
ATOM   2061  O O     . LYS A 1 270 ? 0.497   32.906  36.982  1.00 24.81  ? 270  LYS A O     1 
ATOM   2062  C CB    . LYS A 1 270 ? 0.314   36.009  38.446  1.00 27.71  ? 270  LYS A CB    1 
ATOM   2063  C CG    . LYS A 1 270 ? -0.440  36.890  39.467  1.00 28.70  ? 270  LYS A CG    1 
ATOM   2064  C CD    . LYS A 1 270 ? 0.404   38.027  40.030  1.00 29.96  ? 270  LYS A CD    1 
ATOM   2065  C CE    . LYS A 1 270 ? 0.056   39.360  39.358  1.00 34.50  ? 270  LYS A CE    1 
ATOM   2066  N NZ    . LYS A 1 270 ? 0.389   40.532  40.237  1.00 37.35  ? 270  LYS A NZ    1 
ATOM   2067  N N     . PRO A 1 271 ? 0.110   34.665  35.603  1.00 25.53  ? 271  PRO A N     1 
ATOM   2068  C CA    . PRO A 1 271 ? 0.645   33.950  34.452  1.00 25.04  ? 271  PRO A CA    1 
ATOM   2069  C C     . PRO A 1 271 ? 2.037   33.386  34.729  1.00 24.28  ? 271  PRO A C     1 
ATOM   2070  O O     . PRO A 1 271 ? 2.833   34.015  35.432  1.00 23.48  ? 271  PRO A O     1 
ATOM   2071  C CB    . PRO A 1 271 ? 0.701   35.037  33.364  1.00 25.04  ? 271  PRO A CB    1 
ATOM   2072  C CG    . PRO A 1 271 ? -0.426  35.948  33.722  1.00 25.32  ? 271  PRO A CG    1 
ATOM   2073  C CD    . PRO A 1 271 ? -0.339  36.025  35.226  1.00 25.83  ? 271  PRO A CD    1 
ATOM   2074  N N     . LYS A 1 272 ? 2.299   32.193  34.204  1.00 23.45  ? 272  LYS A N     1 
ATOM   2075  C CA    . LYS A 1 272 ? 3.624   31.576  34.320  1.00 23.13  ? 272  LYS A CA    1 
ATOM   2076  C C     . LYS A 1 272 ? 4.249   31.428  32.942  1.00 21.84  ? 272  LYS A C     1 
ATOM   2077  O O     . LYS A 1 272 ? 3.543   31.342  31.931  1.00 21.23  ? 272  LYS A O     1 
ATOM   2078  C CB    . LYS A 1 272 ? 3.556   30.215  35.027  1.00 23.55  ? 272  LYS A CB    1 
ATOM   2079  C CG    . LYS A 1 272 ? 2.968   30.239  36.459  1.00 25.27  ? 272  LYS A CG    1 
ATOM   2080  C CD    . LYS A 1 272 ? 3.697   31.231  37.375  1.00 28.15  ? 272  LYS A CD    1 
ATOM   2081  C CE    . LYS A 1 272 ? 3.511   30.899  38.871  1.00 29.03  ? 272  LYS A CE    1 
ATOM   2082  N NZ    . LYS A 1 272 ? 2.080   30.663  39.251  1.00 32.45  ? 272  LYS A NZ    1 
ATOM   2083  N N     . GLY A 1 273 ? 5.576   31.399  32.911  1.00 21.00  ? 273  GLY A N     1 
ATOM   2084  C CA    . GLY A 1 273 ? 6.313   31.358  31.655  1.00 19.53  ? 273  GLY A CA    1 
ATOM   2085  C C     . GLY A 1 273 ? 6.399   29.958  31.082  1.00 18.94  ? 273  GLY A C     1 
ATOM   2086  O O     . GLY A 1 273 ? 7.223   29.152  31.506  1.00 18.87  ? 273  GLY A O     1 
ATOM   2087  N N     . VAL A 1 274 ? 5.554   29.679  30.100  1.00 18.18  ? 274  VAL A N     1 
ATOM   2088  C CA    . VAL A 1 274 ? 5.588   28.400  29.402  1.00 17.40  ? 274  VAL A CA    1 
ATOM   2089  C C     . VAL A 1 274 ? 6.842   28.346  28.536  1.00 17.64  ? 274  VAL A C     1 
ATOM   2090  O O     . VAL A 1 274 ? 7.045   29.203  27.668  1.00 17.73  ? 274  VAL A O     1 
ATOM   2091  C CB    . VAL A 1 274 ? 4.302   28.185  28.551  1.00 17.35  ? 274  VAL A CB    1 
ATOM   2092  C CG1   . VAL A 1 274 ? 4.395   26.899  27.711  1.00 16.00  ? 274  VAL A CG1   1 
ATOM   2093  C CG2   . VAL A 1 274 ? 3.082   28.142  29.445  1.00 15.95  ? 274  VAL A CG2   1 
ATOM   2094  N N     . LEU A 1 275 ? 7.679   27.342  28.780  1.00 17.23  ? 275  LEU A N     1 
ATOM   2095  C CA    . LEU A 1 275 ? 8.973   27.238  28.100  1.00 17.47  ? 275  LEU A CA    1 
ATOM   2096  C C     . LEU A 1 275 ? 8.992   26.218  26.958  1.00 17.32  ? 275  LEU A C     1 
ATOM   2097  O O     . LEU A 1 275 ? 8.657   25.043  27.153  1.00 17.00  ? 275  LEU A O     1 
ATOM   2098  C CB    . LEU A 1 275 ? 10.098  26.919  29.099  1.00 17.35  ? 275  LEU A CB    1 
ATOM   2099  C CG    . LEU A 1 275 ? 11.564  26.936  28.604  1.00 17.28  ? 275  LEU A CG    1 
ATOM   2100  C CD1   . LEU A 1 275 ? 12.515  27.309  29.745  1.00 18.06  ? 275  LEU A CD1   1 
ATOM   2101  C CD2   . LEU A 1 275 ? 11.985  25.627  27.990  1.00 17.68  ? 275  LEU A CD2   1 
ATOM   2102  N N     . HIS A 1 276 ? 9.431   26.677  25.786  1.00 17.17  ? 276  HIS A N     1 
ATOM   2103  C CA    . HIS A 1 276 ? 9.726   25.791  24.666  1.00 17.32  ? 276  HIS A CA    1 
ATOM   2104  C C     . HIS A 1 276 ? 11.217  25.716  24.361  1.00 17.76  ? 276  HIS A C     1 
ATOM   2105  O O     . HIS A 1 276 ? 11.938  26.723  24.426  1.00 17.53  ? 276  HIS A O     1 
ATOM   2106  C CB    . HIS A 1 276 ? 8.946   26.203  23.416  1.00 17.34  ? 276  HIS A CB    1 
ATOM   2107  C CG    . HIS A 1 276 ? 7.484   25.904  23.512  1.00 17.99  ? 276  HIS A CG    1 
ATOM   2108  N ND1   . HIS A 1 276 ? 6.959   24.662  23.222  1.00 18.78  ? 276  HIS A ND1   1 
ATOM   2109  C CD2   . HIS A 1 276 ? 6.442   26.671  23.913  1.00 17.97  ? 276  HIS A CD2   1 
ATOM   2110  C CE1   . HIS A 1 276 ? 5.651   24.686  23.411  1.00 18.89  ? 276  HIS A CE1   1 
ATOM   2111  N NE2   . HIS A 1 276 ? 5.311   25.893  23.831  1.00 19.38  ? 276  HIS A NE2   1 
ATOM   2112  N N     . THR A 1 277 ? 11.674  24.507  24.040  1.00 17.90  ? 277  THR A N     1 
ATOM   2113  C CA    . THR A 1 277 ? 13.032  24.311  23.559  1.00 17.99  ? 277  THR A CA    1 
ATOM   2114  C C     . THR A 1 277 ? 13.044  24.409  22.021  1.00 18.63  ? 277  THR A C     1 
ATOM   2115  O O     . THR A 1 277 ? 12.096  24.952  21.421  1.00 19.04  ? 277  THR A O     1 
ATOM   2116  C CB    . THR A 1 277 ? 13.680  23.027  24.140  1.00 18.02  ? 277  THR A CB    1 
ATOM   2117  O OG1   . THR A 1 277 ? 12.893  21.881  23.815  1.00 18.50  ? 277  THR A OG1   1 
ATOM   2118  C CG2   . THR A 1 277 ? 13.791  23.135  25.665  1.00 17.43  ? 277  THR A CG2   1 
ATOM   2119  N N     . THR A 1 278 ? 14.087  23.898  21.378  1.00 18.85  ? 278  THR A N     1 
ATOM   2120  C CA    . THR A 1 278 ? 14.370  24.282  20.000  1.00 18.89  ? 278  THR A CA    1 
ATOM   2121  C C     . THR A 1 278 ? 13.984  23.264  18.926  1.00 18.91  ? 278  THR A C     1 
ATOM   2122  O O     . THR A 1 278 ? 13.243  23.600  17.992  1.00 18.45  ? 278  THR A O     1 
ATOM   2123  C CB    . THR A 1 278 ? 15.851  24.665  19.839  1.00 19.39  ? 278  THR A CB    1 
ATOM   2124  O OG1   . THR A 1 278 ? 16.189  25.649  20.827  1.00 19.96  ? 278  THR A OG1   1 
ATOM   2125  C CG2   . THR A 1 278 ? 16.113  25.232  18.430  1.00 18.63  ? 278  THR A CG2   1 
ATOM   2126  N N     . GLY A 1 279 ? 14.499  22.039  19.059  1.00 18.80  ? 279  GLY A N     1 
ATOM   2127  C CA    . GLY A 1 279 ? 14.385  21.005  18.027  1.00 18.59  ? 279  GLY A CA    1 
ATOM   2128  C C     . GLY A 1 279 ? 12.977  20.512  17.752  1.00 18.82  ? 279  GLY A C     1 
ATOM   2129  O O     . GLY A 1 279 ? 12.434  20.743  16.664  1.00 18.81  ? 279  GLY A O     1 
ATOM   2130  N N     . GLY A 1 280 ? 12.390  19.826  18.735  1.00 18.40  ? 280  GLY A N     1 
ATOM   2131  C CA    . GLY A 1 280 ? 11.058  19.255  18.597  1.00 17.10  ? 280  GLY A CA    1 
ATOM   2132  C C     . GLY A 1 280 ? 10.007  20.311  18.313  1.00 17.27  ? 280  GLY A C     1 
ATOM   2133  O O     . GLY A 1 280 ? 9.112   20.092  17.484  1.00 17.14  ? 280  GLY A O     1 
ATOM   2134  N N     . TYR A 1 281 ? 10.115  21.454  18.998  1.00 16.60  ? 281  TYR A N     1 
ATOM   2135  C CA    . TYR A 1 281 ? 9.220   22.592  18.750  1.00 16.71  ? 281  TYR A CA    1 
ATOM   2136  C C     . TYR A 1 281 ? 9.217   23.002  17.276  1.00 16.16  ? 281  TYR A C     1 
ATOM   2137  O O     . TYR A 1 281 ? 8.157   23.090  16.653  1.00 16.72  ? 281  TYR A O     1 
ATOM   2138  C CB    . TYR A 1 281 ? 9.546   23.816  19.643  1.00 16.37  ? 281  TYR A CB    1 
ATOM   2139  C CG    . TYR A 1 281 ? 8.816   25.057  19.169  1.00 16.85  ? 281  TYR A CG    1 
ATOM   2140  C CD1   . TYR A 1 281 ? 7.505   25.316  19.588  1.00 17.34  ? 281  TYR A CD1   1 
ATOM   2141  C CD2   . TYR A 1 281 ? 9.413   25.948  18.260  1.00 16.88  ? 281  TYR A CD2   1 
ATOM   2142  C CE1   . TYR A 1 281 ? 6.804   26.433  19.121  1.00 17.52  ? 281  TYR A CE1   1 
ATOM   2143  C CE2   . TYR A 1 281 ? 8.723   27.075  17.785  1.00 16.79  ? 281  TYR A CE2   1 
ATOM   2144  C CZ    . TYR A 1 281 ? 7.419   27.304  18.226  1.00 17.64  ? 281  TYR A CZ    1 
ATOM   2145  O OH    . TYR A 1 281 ? 6.715   28.394  17.787  1.00 17.02  ? 281  TYR A OH    1 
ATOM   2146  N N     . LEU A 1 282 ? 10.391  23.269  16.718  1.00 16.10  ? 282  LEU A N     1 
ATOM   2147  C CA    . LEU A 1 282 ? 10.468  23.711  15.327  1.00 16.15  ? 282  LEU A CA    1 
ATOM   2148  C C     . LEU A 1 282 ? 10.046  22.617  14.331  1.00 16.55  ? 282  LEU A C     1 
ATOM   2149  O O     . LEU A 1 282 ? 9.363   22.906  13.336  1.00 16.45  ? 282  LEU A O     1 
ATOM   2150  C CB    . LEU A 1 282 ? 11.870  24.236  14.991  1.00 16.51  ? 282  LEU A CB    1 
ATOM   2151  C CG    . LEU A 1 282 ? 11.994  24.981  13.650  1.00 16.66  ? 282  LEU A CG    1 
ATOM   2152  C CD1   . LEU A 1 282 ? 10.947  26.138  13.534  1.00 15.24  ? 282  LEU A CD1   1 
ATOM   2153  C CD2   . LEU A 1 282 ? 13.419  25.488  13.437  1.00 15.06  ? 282  LEU A CD2   1 
ATOM   2154  N N     . VAL A 1 283 ? 10.461  21.370  14.577  1.00 16.52  ? 283  VAL A N     1 
ATOM   2155  C CA    . VAL A 1 283 ? 9.994   20.256  13.734  1.00 16.68  ? 283  VAL A CA    1 
ATOM   2156  C C     . VAL A 1 283 ? 8.465   20.237  13.710  1.00 17.26  ? 283  VAL A C     1 
ATOM   2157  O O     . VAL A 1 283 ? 7.839   20.135  12.630  1.00 17.55  ? 283  VAL A O     1 
ATOM   2158  C CB    . VAL A 1 283 ? 10.502  18.859  14.218  1.00 16.93  ? 283  VAL A CB    1 
ATOM   2159  C CG1   . VAL A 1 283 ? 9.766   17.727  13.475  1.00 15.50  ? 283  VAL A CG1   1 
ATOM   2160  C CG2   . VAL A 1 283 ? 12.018  18.727  14.039  1.00 15.79  ? 283  VAL A CG2   1 
ATOM   2161  N N     . TYR A 1 284 ? 7.870   20.343  14.903  1.00 17.08  ? 284  TYR A N     1 
ATOM   2162  C CA    . TYR A 1 284 ? 6.428   20.223  15.049  1.00 16.82  ? 284  TYR A CA    1 
ATOM   2163  C C     . TYR A 1 284 ? 5.715   21.411  14.416  1.00 17.18  ? 284  TYR A C     1 
ATOM   2164  O O     . TYR A 1 284 ? 4.712   21.228  13.712  1.00 17.58  ? 284  TYR A O     1 
ATOM   2165  C CB    . TYR A 1 284 ? 6.028   20.039  16.521  1.00 16.38  ? 284  TYR A CB    1 
ATOM   2166  C CG    . TYR A 1 284 ? 4.653   19.410  16.686  1.00 15.21  ? 284  TYR A CG    1 
ATOM   2167  C CD1   . TYR A 1 284 ? 3.556   20.186  17.052  1.00 14.78  ? 284  TYR A CD1   1 
ATOM   2168  C CD2   . TYR A 1 284 ? 4.453   18.046  16.463  1.00 13.15  ? 284  TYR A CD2   1 
ATOM   2169  C CE1   . TYR A 1 284 ? 2.303   19.632  17.197  1.00 12.86  ? 284  TYR A CE1   1 
ATOM   2170  C CE2   . TYR A 1 284 ? 3.197   17.478  16.607  1.00 12.27  ? 284  TYR A CE2   1 
ATOM   2171  C CZ    . TYR A 1 284 ? 2.123   18.274  16.960  1.00 14.13  ? 284  TYR A CZ    1 
ATOM   2172  O OH    . TYR A 1 284 ? 0.866   17.723  17.104  1.00 12.54  ? 284  TYR A OH    1 
ATOM   2173  N N     . ALA A 1 285 ? 6.239   22.616  14.651  1.00 17.48  ? 285  ALA A N     1 
ATOM   2174  C CA    . ALA A 1 285 ? 5.697   23.829  14.018  1.00 17.88  ? 285  ALA A CA    1 
ATOM   2175  C C     . ALA A 1 285 ? 5.736   23.742  12.484  1.00 17.94  ? 285  ALA A C     1 
ATOM   2176  O O     . ALA A 1 285 ? 4.729   24.016  11.824  1.00 18.01  ? 285  ALA A O     1 
ATOM   2177  C CB    . ALA A 1 285 ? 6.419   25.102  14.522  1.00 16.99  ? 285  ALA A CB    1 
ATOM   2178  N N     . ALA A 1 286 ? 6.881   23.333  11.924  1.00 18.01  ? 286  ALA A N     1 
ATOM   2179  C CA    . ALA A 1 286 ? 7.019   23.215  10.469  1.00 17.98  ? 286  ALA A CA    1 
ATOM   2180  C C     . ALA A 1 286 ? 6.120   22.133  9.852   1.00 18.46  ? 286  ALA A C     1 
ATOM   2181  O O     . ALA A 1 286 ? 5.554   22.325  8.763   1.00 18.73  ? 286  ALA A O     1 
ATOM   2182  C CB    . ALA A 1 286 ? 8.467   22.974  10.087  1.00 17.95  ? 286  ALA A CB    1 
ATOM   2183  N N     . THR A 1 287 ? 6.009   20.997  10.542  1.00 18.10  ? 287  THR A N     1 
ATOM   2184  C CA    . THR A 1 287 ? 5.267   19.837  10.046  1.00 17.90  ? 287  THR A CA    1 
ATOM   2185  C C     . THR A 1 287 ? 3.759   20.114  10.058  1.00 17.93  ? 287  THR A C     1 
ATOM   2186  O O     . THR A 1 287 ? 3.079   19.865  9.072   1.00 18.44  ? 287  THR A O     1 
ATOM   2187  C CB    . THR A 1 287 ? 5.600   18.575  10.886  1.00 17.86  ? 287  THR A CB    1 
ATOM   2188  O OG1   . THR A 1 287 ? 7.005   18.309  10.796  1.00 17.92  ? 287  THR A OG1   1 
ATOM   2189  C CG2   . THR A 1 287 ? 4.807   17.347  10.403  1.00 17.59  ? 287  THR A CG2   1 
ATOM   2190  N N     . THR A 1 288 ? 3.253   20.630  11.179  1.00 17.87  ? 288  THR A N     1 
ATOM   2191  C CA    . THR A 1 288 ? 1.850   21.017  11.288  1.00 17.80  ? 288  THR A CA    1 
ATOM   2192  C C     . THR A 1 288 ? 1.486   22.113  10.288  1.00 18.18  ? 288  THR A C     1 
ATOM   2193  O O     . THR A 1 288 ? 0.491   21.982  9.572   1.00 19.04  ? 288  THR A O     1 
ATOM   2194  C CB    . THR A 1 288 ? 1.450   21.420  12.722  1.00 17.59  ? 288  THR A CB    1 
ATOM   2195  O OG1   . THR A 1 288 ? 2.345   22.413  13.219  1.00 17.07  ? 288  THR A OG1   1 
ATOM   2196  C CG2   . THR A 1 288 ? 1.487   20.220  13.652  1.00 17.08  ? 288  THR A CG2   1 
ATOM   2197  N N     . PHE A 1 289 ? 2.293   23.165  10.204  1.00 17.93  ? 289  PHE A N     1 
ATOM   2198  C CA    . PHE A 1 289 ? 2.048   24.208  9.203   1.00 18.50  ? 289  PHE A CA    1 
ATOM   2199  C C     . PHE A 1 289 ? 1.909   23.629  7.795   1.00 19.10  ? 289  PHE A C     1 
ATOM   2200  O O     . PHE A 1 289 ? 0.918   23.883  7.117   1.00 19.33  ? 289  PHE A O     1 
ATOM   2201  C CB    . PHE A 1 289 ? 3.138   25.286  9.219   1.00 17.88  ? 289  PHE A CB    1 
ATOM   2202  C CG    . PHE A 1 289 ? 3.066   26.233  8.053   1.00 17.03  ? 289  PHE A CG    1 
ATOM   2203  C CD1   . PHE A 1 289 ? 2.257   27.359  8.109   1.00 15.07  ? 289  PHE A CD1   1 
ATOM   2204  C CD2   . PHE A 1 289 ? 3.819   25.997  6.890   1.00 17.20  ? 289  PHE A CD2   1 
ATOM   2205  C CE1   . PHE A 1 289 ? 2.183   28.236  7.021   1.00 15.95  ? 289  PHE A CE1   1 
ATOM   2206  C CE2   . PHE A 1 289 ? 3.756   26.883  5.799   1.00 16.26  ? 289  PHE A CE2   1 
ATOM   2207  C CZ    . PHE A 1 289 ? 2.936   27.988  5.868   1.00 14.89  ? 289  PHE A CZ    1 
ATOM   2208  N N     . LYS A 1 290 ? 2.913   22.866  7.366   1.00 19.94  ? 290  LYS A N     1 
ATOM   2209  C CA    . LYS A 1 290 ? 2.959   22.327  6.011   1.00 20.79  ? 290  LYS A CA    1 
ATOM   2210  C C     . LYS A 1 290 ? 1.735   21.469  5.690   1.00 21.03  ? 290  LYS A C     1 
ATOM   2211  O O     . LYS A 1 290 ? 1.065   21.702  4.687   1.00 21.50  ? 290  LYS A O     1 
ATOM   2212  C CB    . LYS A 1 290 ? 4.245   21.533  5.794   1.00 20.82  ? 290  LYS A CB    1 
ATOM   2213  C CG    . LYS A 1 290 ? 4.453   21.016  4.368   1.00 23.69  ? 290  LYS A CG    1 
ATOM   2214  C CD    . LYS A 1 290 ? 5.942   20.765  4.145   1.00 26.53  ? 290  LYS A CD    1 
ATOM   2215  C CE    . LYS A 1 290 ? 6.192   19.404  3.570   1.00 30.31  ? 290  LYS A CE    1 
ATOM   2216  N NZ    . LYS A 1 290 ? 7.666   19.111  3.528   1.00 32.47  ? 290  LYS A NZ    1 
ATOM   2217  N N     . TYR A 1 291 ? 1.435   20.502  6.552   1.00 20.81  ? 291  TYR A N     1 
ATOM   2218  C CA    . TYR A 1 291 ? 0.389   19.539  6.253   1.00 21.01  ? 291  TYR A CA    1 
ATOM   2219  C C     . TYR A 1 291 ? -1.014  20.068  6.447   1.00 20.73  ? 291  TYR A C     1 
ATOM   2220  O O     . TYR A 1 291 ? -1.899  19.734  5.661   1.00 20.69  ? 291  TYR A O     1 
ATOM   2221  C CB    . TYR A 1 291 ? 0.569   18.246  7.049   1.00 21.20  ? 291  TYR A CB    1 
ATOM   2222  C CG    . TYR A 1 291 ? 1.782   17.432  6.640   1.00 22.92  ? 291  TYR A CG    1 
ATOM   2223  C CD1   . TYR A 1 291 ? 2.475   16.665  7.582   1.00 23.44  ? 291  TYR A CD1   1 
ATOM   2224  C CD2   . TYR A 1 291 ? 2.244   17.429  5.318   1.00 22.65  ? 291  TYR A CD2   1 
ATOM   2225  C CE1   . TYR A 1 291 ? 3.586   15.907  7.217   1.00 23.88  ? 291  TYR A CE1   1 
ATOM   2226  C CE2   . TYR A 1 291 ? 3.370   16.673  4.947   1.00 22.47  ? 291  TYR A CE2   1 
ATOM   2227  C CZ    . TYR A 1 291 ? 4.029   15.926  5.901   1.00 23.27  ? 291  TYR A CZ    1 
ATOM   2228  O OH    . TYR A 1 291 ? 5.121   15.161  5.552   1.00 25.44  ? 291  TYR A OH    1 
ATOM   2229  N N     . VAL A 1 292 ? -1.222  20.874  7.490   1.00 20.02  ? 292  VAL A N     1 
ATOM   2230  C CA    . VAL A 1 292 ? -2.576  21.333  7.832   1.00 19.70  ? 292  VAL A CA    1 
ATOM   2231  C C     . VAL A 1 292 ? -3.064  22.435  6.892   1.00 19.74  ? 292  VAL A C     1 
ATOM   2232  O O     . VAL A 1 292 ? -4.237  22.473  6.534   1.00 19.56  ? 292  VAL A O     1 
ATOM   2233  C CB    . VAL A 1 292 ? -2.666  21.756  9.323   1.00 19.82  ? 292  VAL A CB    1 
ATOM   2234  C CG1   . VAL A 1 292 ? -3.930  22.556  9.628   1.00 18.19  ? 292  VAL A CG1   1 
ATOM   2235  C CG2   . VAL A 1 292 ? -2.594  20.520  10.205  1.00 19.06  ? 292  VAL A CG2   1 
ATOM   2236  N N     . PHE A 1 293 ? -2.156  23.326  6.496   1.00 19.56  ? 293  PHE A N     1 
ATOM   2237  C CA    . PHE A 1 293 ? -2.478  24.384  5.544   1.00 19.48  ? 293  PHE A CA    1 
ATOM   2238  C C     . PHE A 1 293 ? -2.195  23.943  4.103   1.00 20.09  ? 293  PHE A C     1 
ATOM   2239  O O     . PHE A 1 293 ? -2.395  24.714  3.153   1.00 19.98  ? 293  PHE A O     1 
ATOM   2240  C CB    . PHE A 1 293 ? -1.712  25.667  5.910   1.00 19.37  ? 293  PHE A CB    1 
ATOM   2241  C CG    . PHE A 1 293 ? -2.152  26.285  7.227   1.00 19.88  ? 293  PHE A CG    1 
ATOM   2242  C CD1   . PHE A 1 293 ? -1.243  26.446  8.279   1.00 20.97  ? 293  PHE A CD1   1 
ATOM   2243  C CD2   . PHE A 1 293 ? -3.471  26.692  7.413   1.00 18.07  ? 293  PHE A CD2   1 
ATOM   2244  C CE1   . PHE A 1 293 ? -1.632  27.018  9.489   1.00 19.70  ? 293  PHE A CE1   1 
ATOM   2245  C CE2   . PHE A 1 293 ? -3.883  27.263  8.622   1.00 20.14  ? 293  PHE A CE2   1 
ATOM   2246  C CZ    . PHE A 1 293 ? -2.960  27.424  9.673   1.00 20.33  ? 293  PHE A CZ    1 
ATOM   2247  N N     . ASP A 1 294 ? -1.735  22.696  3.955   1.00 20.34  ? 294  ASP A N     1 
ATOM   2248  C CA    . ASP A 1 294 ? -1.416  22.118  2.656   1.00 21.25  ? 294  ASP A CA    1 
ATOM   2249  C C     . ASP A 1 294 ? -0.488  23.037  1.839   1.00 21.50  ? 294  ASP A C     1 
ATOM   2250  O O     . ASP A 1 294 ? -0.730  23.301  0.660   1.00 20.95  ? 294  ASP A O     1 
ATOM   2251  C CB    . ASP A 1 294 ? -2.711  21.822  1.895   1.00 21.46  ? 294  ASP A CB    1 
ATOM   2252  C CG    . ASP A 1 294 ? -2.508  20.850  0.763   1.00 22.78  ? 294  ASP A CG    1 
ATOM   2253  O OD1   . ASP A 1 294 ? -3.004  21.135  -0.351  1.00 24.72  ? 294  ASP A OD1   1 
ATOM   2254  O OD2   . ASP A 1 294 ? -1.851  19.812  0.987   1.00 24.56  ? 294  ASP A OD2   1 
ATOM   2255  N N     . TYR A 1 295 ? 0.569   23.527  2.482   1.00 22.09  ? 295  TYR A N     1 
ATOM   2256  C CA    . TYR A 1 295 ? 1.366   24.590  1.909   1.00 22.76  ? 295  TYR A CA    1 
ATOM   2257  C C     . TYR A 1 295 ? 2.176   24.104  0.700   1.00 22.71  ? 295  TYR A C     1 
ATOM   2258  O O     . TYR A 1 295 ? 2.885   23.105  0.785   1.00 22.11  ? 295  TYR A O     1 
ATOM   2259  C CB    . TYR A 1 295 ? 2.288   25.227  2.960   1.00 24.06  ? 295  TYR A CB    1 
ATOM   2260  C CG    . TYR A 1 295 ? 3.377   26.026  2.299   1.00 25.95  ? 295  TYR A CG    1 
ATOM   2261  C CD1   . TYR A 1 295 ? 3.148   27.330  1.860   1.00 27.65  ? 295  TYR A CD1   1 
ATOM   2262  C CD2   . TYR A 1 295 ? 4.618   25.451  2.045   1.00 27.56  ? 295  TYR A CD2   1 
ATOM   2263  C CE1   . TYR A 1 295 ? 4.150   28.046  1.212   1.00 27.80  ? 295  TYR A CE1   1 
ATOM   2264  C CE2   . TYR A 1 295 ? 5.610   26.150  1.406   1.00 28.20  ? 295  TYR A CE2   1 
ATOM   2265  C CZ    . TYR A 1 295 ? 5.373   27.442  0.988   1.00 27.23  ? 295  TYR A CZ    1 
ATOM   2266  O OH    . TYR A 1 295 ? 6.397   28.115  0.349   1.00 28.15  ? 295  TYR A OH    1 
ATOM   2267  N N     . HIS A 1 296 ? 2.032   24.810  -0.423  1.00 22.42  ? 296  HIS A N     1 
ATOM   2268  C CA    . HIS A 1 296 ? 2.833   24.566  -1.624  1.00 22.57  ? 296  HIS A CA    1 
ATOM   2269  C C     . HIS A 1 296 ? 3.681   25.809  -1.882  1.00 22.32  ? 296  HIS A C     1 
ATOM   2270  O O     . HIS A 1 296 ? 3.213   26.924  -1.639  1.00 22.07  ? 296  HIS A O     1 
ATOM   2271  C CB    . HIS A 1 296 ? 1.936   24.319  -2.845  1.00 22.68  ? 296  HIS A CB    1 
ATOM   2272  C CG    . HIS A 1 296 ? 1.206   23.014  -2.815  1.00 23.27  ? 296  HIS A CG    1 
ATOM   2273  N ND1   . HIS A 1 296 ? 0.254   22.715  -1.863  1.00 22.42  ? 296  HIS A ND1   1 
ATOM   2274  C CD2   . HIS A 1 296 ? 1.270   21.938  -3.635  1.00 22.97  ? 296  HIS A CD2   1 
ATOM   2275  C CE1   . HIS A 1 296 ? -0.228  21.507  -2.091  1.00 22.43  ? 296  HIS A CE1   1 
ATOM   2276  N NE2   . HIS A 1 296 ? 0.374   21.012  -3.159  1.00 23.71  ? 296  HIS A NE2   1 
ATOM   2277  N N     . PRO A 1 297 ? 4.922   25.628  -2.384  1.00 22.49  ? 297  PRO A N     1 
ATOM   2278  C CA    . PRO A 1 297 ? 5.752   26.786  -2.710  1.00 22.21  ? 297  PRO A CA    1 
ATOM   2279  C C     . PRO A 1 297 ? 4.977   27.803  -3.542  1.00 22.20  ? 297  PRO A C     1 
ATOM   2280  O O     . PRO A 1 297 ? 4.284   27.434  -4.496  1.00 21.47  ? 297  PRO A O     1 
ATOM   2281  C CB    . PRO A 1 297 ? 6.906   26.177  -3.517  1.00 22.43  ? 297  PRO A CB    1 
ATOM   2282  C CG    . PRO A 1 297 ? 7.043   24.804  -2.967  1.00 23.20  ? 297  PRO A CG    1 
ATOM   2283  C CD    . PRO A 1 297 ? 5.623   24.354  -2.663  1.00 22.40  ? 297  PRO A CD    1 
ATOM   2284  N N     . GLY A 1 298 ? 5.059   29.070  -3.138  1.00 22.37  ? 298  GLY A N     1 
ATOM   2285  C CA    . GLY A 1 298 ? 4.324   30.141  -3.814  1.00 22.74  ? 298  GLY A CA    1 
ATOM   2286  C C     . GLY A 1 298 ? 3.022   30.562  -3.144  1.00 22.79  ? 298  GLY A C     1 
ATOM   2287  O O     . GLY A 1 298 ? 2.501   31.643  -3.433  1.00 23.39  ? 298  GLY A O     1 
ATOM   2288  N N     . ASP A 1 299 ? 2.483   29.710  -2.272  1.00 22.21  ? 299  ASP A N     1 
ATOM   2289  C CA    . ASP A 1 299 ? 1.260   30.038  -1.543  1.00 21.87  ? 299  ASP A CA    1 
ATOM   2290  C C     . ASP A 1 299 ? 1.510   31.244  -0.650  1.00 21.24  ? 299  ASP A C     1 
ATOM   2291  O O     . ASP A 1 299 ? 2.509   31.287  0.069   1.00 21.61  ? 299  ASP A O     1 
ATOM   2292  C CB    . ASP A 1 299 ? 0.776   28.846  -0.704  1.00 21.93  ? 299  ASP A CB    1 
ATOM   2293  C CG    . ASP A 1 299 ? 0.191   27.705  -1.560  1.00 22.59  ? 299  ASP A CG    1 
ATOM   2294  O OD1   . ASP A 1 299 ? -0.090  27.924  -2.766  1.00 21.64  ? 299  ASP A OD1   1 
ATOM   2295  O OD2   . ASP A 1 299 ? 0.009   26.586  -1.013  1.00 21.78  ? 299  ASP A OD2   1 
ATOM   2296  N N     . ILE A 1 300 ? 0.631   32.240  -0.733  1.00 20.19  ? 300  ILE A N     1 
ATOM   2297  C CA    . ILE A 1 300 ? 0.710   33.407  0.142   1.00 19.12  ? 300  ILE A CA    1 
ATOM   2298  C C     . ILE A 1 300 ? -0.112  33.088  1.377   1.00 18.21  ? 300  ILE A C     1 
ATOM   2299  O O     . ILE A 1 300 ? -1.297  32.783  1.274   1.00 17.64  ? 300  ILE A O     1 
ATOM   2300  C CB    . ILE A 1 300 ? 0.183   34.699  -0.544  1.00 19.35  ? 300  ILE A CB    1 
ATOM   2301  C CG1   . ILE A 1 300 ? 0.888   34.938  -1.898  1.00 20.98  ? 300  ILE A CG1   1 
ATOM   2302  C CG2   . ILE A 1 300 ? 0.273   35.920  0.401   1.00 18.49  ? 300  ILE A CG2   1 
ATOM   2303  C CD1   . ILE A 1 300 ? 2.414   35.124  -1.830  1.00 22.58  ? 300  ILE A CD1   1 
ATOM   2304  N N     . TYR A 1 301 ? 0.524   33.183  2.542   1.00 17.76  ? 301  TYR A N     1 
ATOM   2305  C CA    . TYR A 1 301 ? -0.085  32.765  3.791   1.00 17.63  ? 301  TYR A CA    1 
ATOM   2306  C C     . TYR A 1 301 ? -0.281  33.944  4.746   1.00 17.90  ? 301  TYR A C     1 
ATOM   2307  O O     . TYR A 1 301 ? 0.625   34.772  4.915   1.00 17.92  ? 301  TYR A O     1 
ATOM   2308  C CB    . TYR A 1 301 ? 0.776   31.664  4.426   1.00 17.54  ? 301  TYR A CB    1 
ATOM   2309  C CG    . TYR A 1 301 ? 0.431   31.317  5.861   1.00 18.09  ? 301  TYR A CG    1 
ATOM   2310  C CD1   . TYR A 1 301 ? 1.153   31.871  6.925   1.00 19.00  ? 301  TYR A CD1   1 
ATOM   2311  C CD2   . TYR A 1 301 ? -0.617  30.439  6.157   1.00 19.15  ? 301  TYR A CD2   1 
ATOM   2312  C CE1   . TYR A 1 301 ? 0.848   31.555  8.246   1.00 19.37  ? 301  TYR A CE1   1 
ATOM   2313  C CE2   . TYR A 1 301 ? -0.939  30.117  7.475   1.00 18.68  ? 301  TYR A CE2   1 
ATOM   2314  C CZ    . TYR A 1 301 ? -0.210  30.681  8.511   1.00 19.12  ? 301  TYR A CZ    1 
ATOM   2315  O OH    . TYR A 1 301 ? -0.511  30.350  9.802   1.00 19.59  ? 301  TYR A OH    1 
ATOM   2316  N N     . TRP A 1 302 ? -1.458  34.012  5.372   1.00 17.79  ? 302  TRP A N     1 
ATOM   2317  C CA    . TRP A 1 302 ? -1.763  35.085  6.320   1.00 17.95  ? 302  TRP A CA    1 
ATOM   2318  C C     . TRP A 1 302 ? -2.425  34.572  7.593   1.00 18.50  ? 302  TRP A C     1 
ATOM   2319  O O     . TRP A 1 302 ? -3.588  34.154  7.589   1.00 18.54  ? 302  TRP A O     1 
ATOM   2320  C CB    . TRP A 1 302 ? -2.617  36.192  5.683   1.00 17.51  ? 302  TRP A CB    1 
ATOM   2321  C CG    . TRP A 1 302 ? -2.907  37.374  6.610   1.00 16.96  ? 302  TRP A CG    1 
ATOM   2322  C CD1   . TRP A 1 302 ? -2.164  37.780  7.704   1.00 17.52  ? 302  TRP A CD1   1 
ATOM   2323  C CD2   . TRP A 1 302 ? -3.994  38.314  6.501   1.00 17.19  ? 302  TRP A CD2   1 
ATOM   2324  N NE1   . TRP A 1 302 ? -2.735  38.901  8.280   1.00 15.64  ? 302  TRP A NE1   1 
ATOM   2325  C CE2   . TRP A 1 302 ? -3.857  39.245  7.566   1.00 16.39  ? 302  TRP A CE2   1 
ATOM   2326  C CE3   . TRP A 1 302 ? -5.069  38.462  5.607   1.00 17.31  ? 302  TRP A CE3   1 
ATOM   2327  C CZ2   . TRP A 1 302 ? -4.760  40.298  7.761   1.00 16.43  ? 302  TRP A CZ2   1 
ATOM   2328  C CZ3   . TRP A 1 302 ? -5.978  39.499  5.815   1.00 16.37  ? 302  TRP A CZ3   1 
ATOM   2329  C CH2   . TRP A 1 302 ? -5.809  40.411  6.880   1.00 17.63  ? 302  TRP A CH2   1 
ATOM   2330  N N     . CYS A 1 303 ? -1.651  34.586  8.668   1.00 19.04  ? 303  CYS A N     1 
ATOM   2331  C CA    . CYS A 1 303 ? -2.164  34.366  10.003  1.00 19.47  ? 303  CYS A CA    1 
ATOM   2332  C C     . CYS A 1 303 ? -2.360  35.744  10.645  1.00 19.77  ? 303  CYS A C     1 
ATOM   2333  O O     . CYS A 1 303 ? -1.461  36.574  10.610  1.00 19.84  ? 303  CYS A O     1 
ATOM   2334  C CB    . CYS A 1 303 ? -1.170  33.533  10.807  1.00 19.38  ? 303  CYS A CB    1 
ATOM   2335  S SG    . CYS A 1 303 ? -1.503  33.510  12.574  1.00 20.41  ? 303  CYS A SG    1 
ATOM   2336  N N     . THR A 1 304 ? -3.529  35.975  11.234  1.00 20.30  ? 304  THR A N     1 
ATOM   2337  C CA    . THR A 1 304 ? -3.872  37.287  11.768  1.00 20.37  ? 304  THR A CA    1 
ATOM   2338  C C     . THR A 1 304 ? -3.477  37.473  13.242  1.00 20.92  ? 304  THR A C     1 
ATOM   2339  O O     . THR A 1 304 ? -3.661  38.563  13.804  1.00 20.52  ? 304  THR A O     1 
ATOM   2340  C CB    . THR A 1 304 ? -5.385  37.585  11.588  1.00 20.98  ? 304  THR A CB    1 
ATOM   2341  O OG1   . THR A 1 304 ? -6.156  36.703  12.421  1.00 20.45  ? 304  THR A OG1   1 
ATOM   2342  C CG2   . THR A 1 304 ? -5.794  37.398  10.115  1.00 20.15  ? 304  THR A CG2   1 
ATOM   2343  N N     . ALA A 1 305 ? -2.935  36.428  13.866  1.00 20.36  ? 305  ALA A N     1 
ATOM   2344  C CA    . ALA A 1 305 ? -2.634  36.497  15.300  1.00 21.39  ? 305  ALA A CA    1 
ATOM   2345  C C     . ALA A 1 305 ? -1.453  37.425  15.584  1.00 21.47  ? 305  ALA A C     1 
ATOM   2346  O O     . ALA A 1 305 ? -0.504  37.509  14.797  1.00 21.45  ? 305  ALA A O     1 
ATOM   2347  C CB    . ALA A 1 305 ? -2.363  35.102  15.875  1.00 21.06  ? 305  ALA A CB    1 
ATOM   2348  N N     . ASP A 1 306 ? -1.526  38.110  16.718  1.00 21.56  ? 306  ASP A N     1 
ATOM   2349  C CA    . ASP A 1 306 ? -0.444  38.964  17.188  1.00 21.75  ? 306  ASP A CA    1 
ATOM   2350  C C     . ASP A 1 306 ? 0.764   38.113  17.567  1.00 22.17  ? 306  ASP A C     1 
ATOM   2351  O O     . ASP A 1 306 ? 0.623   37.020  18.156  1.00 21.16  ? 306  ASP A O     1 
ATOM   2352  C CB    . ASP A 1 306 ? -0.908  39.753  18.409  1.00 21.90  ? 306  ASP A CB    1 
ATOM   2353  C CG    . ASP A 1 306 ? -0.060  40.984  18.676  1.00 22.85  ? 306  ASP A CG    1 
ATOM   2354  O OD1   . ASP A 1 306 ? 1.001   40.861  19.334  1.00 21.58  ? 306  ASP A OD1   1 
ATOM   2355  O OD2   . ASP A 1 306 ? -0.500  42.088  18.272  1.00 24.23  ? 306  ASP A OD2   1 
ATOM   2356  N N     . VAL A 1 307 ? 1.947   38.649  17.248  1.00 22.22  ? 307  VAL A N     1 
ATOM   2357  C CA    . VAL A 1 307 ? 3.225   38.062  17.632  1.00 22.65  ? 307  VAL A CA    1 
ATOM   2358  C C     . VAL A 1 307 ? 3.335   37.800  19.151  1.00 22.51  ? 307  VAL A C     1 
ATOM   2359  O O     . VAL A 1 307 ? 4.077   36.906  19.574  1.00 22.83  ? 307  VAL A O     1 
ATOM   2360  C CB    . VAL A 1 307 ? 4.418   38.947  17.116  1.00 23.29  ? 307  VAL A CB    1 
ATOM   2361  C CG1   . VAL A 1 307 ? 4.600   40.223  17.966  1.00 22.37  ? 307  VAL A CG1   1 
ATOM   2362  C CG2   . VAL A 1 307 ? 5.686   38.154  17.088  1.00 24.43  ? 307  VAL A CG2   1 
ATOM   2363  N N     . GLY A 1 308 ? 2.590   38.567  19.954  1.00 21.86  ? 308  GLY A N     1 
ATOM   2364  C CA    . GLY A 1 308 ? 2.574   38.404  21.418  1.00 21.20  ? 308  GLY A CA    1 
ATOM   2365  C C     . GLY A 1 308 ? 1.922   37.126  21.939  1.00 21.36  ? 308  GLY A C     1 
ATOM   2366  O O     . GLY A 1 308 ? 1.995   36.834  23.139  1.00 21.32  ? 308  GLY A O     1 
ATOM   2367  N N     . TRP A 1 309 ? 1.267   36.374  21.051  1.00 20.54  ? 309  TRP A N     1 
ATOM   2368  C CA    . TRP A 1 309 ? 0.629   35.114  21.428  1.00 20.04  ? 309  TRP A CA    1 
ATOM   2369  C C     . TRP A 1 309 ? 1.308   33.947  20.722  1.00 19.08  ? 309  TRP A C     1 
ATOM   2370  O O     . TRP A 1 309 ? 2.039   34.135  19.741  1.00 18.67  ? 309  TRP A O     1 
ATOM   2371  C CB    . TRP A 1 309 ? -0.899  35.143  21.161  1.00 20.71  ? 309  TRP A CB    1 
ATOM   2372  C CG    . TRP A 1 309 ? -1.626  36.367  21.757  1.00 21.53  ? 309  TRP A CG    1 
ATOM   2373  C CD1   . TRP A 1 309 ? -2.368  37.291  21.072  1.00 22.23  ? 309  TRP A CD1   1 
ATOM   2374  C CD2   . TRP A 1 309 ? -1.633  36.798  23.137  1.00 22.58  ? 309  TRP A CD2   1 
ATOM   2375  N NE1   . TRP A 1 309 ? -2.844  38.251  21.937  1.00 23.39  ? 309  TRP A NE1   1 
ATOM   2376  C CE2   . TRP A 1 309 ? -2.408  37.975  23.204  1.00 22.70  ? 309  TRP A CE2   1 
ATOM   2377  C CE3   . TRP A 1 309 ? -1.067  36.295  24.319  1.00 23.36  ? 309  TRP A CE3   1 
ATOM   2378  C CZ2   . TRP A 1 309 ? -2.648  38.647  24.404  1.00 23.33  ? 309  TRP A CZ2   1 
ATOM   2379  C CZ3   . TRP A 1 309 ? -1.292  36.972  25.510  1.00 22.29  ? 309  TRP A CZ3   1 
ATOM   2380  C CH2   . TRP A 1 309 ? -2.076  38.135  25.544  1.00 22.37  ? 309  TRP A CH2   1 
ATOM   2381  N N     . VAL A 1 310 ? 1.074   32.738  21.229  1.00 19.04  ? 310  VAL A N     1 
ATOM   2382  C CA    . VAL A 1 310 ? 1.734   31.522  20.715  1.00 18.00  ? 310  VAL A CA    1 
ATOM   2383  C C     . VAL A 1 310 ? 1.415   31.263  19.231  1.00 18.33  ? 310  VAL A C     1 
ATOM   2384  O O     . VAL A 1 310 ? 2.250   30.740  18.485  1.00 18.20  ? 310  VAL A O     1 
ATOM   2385  C CB    . VAL A 1 310 ? 1.382   30.275  21.590  1.00 17.73  ? 310  VAL A CB    1 
ATOM   2386  C CG1   . VAL A 1 310 ? -0.106  29.876  21.430  1.00 16.06  ? 310  VAL A CG1   1 
ATOM   2387  C CG2   . VAL A 1 310 ? 2.332   29.118  21.300  1.00 16.76  ? 310  VAL A CG2   1 
ATOM   2388  N N     . THR A 1 311 ? 0.204   31.615  18.812  1.00 18.34  ? 311  THR A N     1 
ATOM   2389  C CA    . THR A 1 311 ? -0.187  31.450  17.411  1.00 19.10  ? 311  THR A CA    1 
ATOM   2390  C C     . THR A 1 311 ? 0.704   32.288  16.492  1.00 18.89  ? 311  THR A C     1 
ATOM   2391  O O     . THR A 1 311 ? 1.052   31.852  15.394  1.00 18.94  ? 311  THR A O     1 
ATOM   2392  C CB    . THR A 1 311 ? -1.665  31.800  17.201  1.00 18.98  ? 311  THR A CB    1 
ATOM   2393  O OG1   . THR A 1 311 ? -2.450  31.020  18.106  1.00 20.72  ? 311  THR A OG1   1 
ATOM   2394  C CG2   . THR A 1 311 ? -2.109  31.475  15.776  1.00 19.36  ? 311  THR A CG2   1 
ATOM   2395  N N     . GLY A 1 312 ? 1.078   33.472  16.972  1.00 19.05  ? 312  GLY A N     1 
ATOM   2396  C CA    . GLY A 1 312 ? 2.007   34.352  16.289  1.00 19.46  ? 312  GLY A CA    1 
ATOM   2397  C C     . GLY A 1 312 ? 3.423   33.804  16.276  1.00 20.29  ? 312  GLY A C     1 
ATOM   2398  O O     . GLY A 1 312 ? 4.132   33.981  15.282  1.00 21.46  ? 312  GLY A O     1 
ATOM   2399  N N     . HIS A 1 313 ? 3.839   33.131  17.358  1.00 19.18  ? 313  HIS A N     1 
ATOM   2400  C CA    . HIS A 1 313 ? 5.140   32.459  17.392  1.00 18.69  ? 313  HIS A CA    1 
ATOM   2401  C C     . HIS A 1 313 ? 5.181   31.307  16.376  1.00 19.03  ? 313  HIS A C     1 
ATOM   2402  O O     . HIS A 1 313 ? 5.992   31.294  15.449  1.00 19.26  ? 313  HIS A O     1 
ATOM   2403  C CB    . HIS A 1 313 ? 5.449   31.906  18.791  1.00 18.17  ? 313  HIS A CB    1 
ATOM   2404  C CG    . HIS A 1 313 ? 5.814   32.950  19.807  1.00 17.52  ? 313  HIS A CG    1 
ATOM   2405  N ND1   . HIS A 1 313 ? 5.162   34.164  19.909  1.00 17.08  ? 313  HIS A ND1   1 
ATOM   2406  C CD2   . HIS A 1 313 ? 6.735   32.934  20.802  1.00 17.17  ? 313  HIS A CD2   1 
ATOM   2407  C CE1   . HIS A 1 313 ? 5.683   34.857  20.908  1.00 19.06  ? 313  HIS A CE1   1 
ATOM   2408  N NE2   . HIS A 1 313 ? 6.640   34.133  21.467  1.00 17.43  ? 313  HIS A NE2   1 
ATOM   2409  N N     . SER A 1 314 ? 4.285   30.349  16.548  1.00 18.48  ? 314  SER A N     1 
ATOM   2410  C CA    . SER A 1 314 ? 4.332   29.139  15.748  1.00 19.07  ? 314  SER A CA    1 
ATOM   2411  C C     . SER A 1 314 ? 3.845   29.307  14.304  1.00 18.68  ? 314  SER A C     1 
ATOM   2412  O O     . SER A 1 314 ? 4.408   28.697  13.392  1.00 17.77  ? 314  SER A O     1 
ATOM   2413  C CB    . SER A 1 314 ? 3.551   28.038  16.453  1.00 18.66  ? 314  SER A CB    1 
ATOM   2414  O OG    . SER A 1 314 ? 4.158   27.760  17.692  1.00 19.86  ? 314  SER A OG    1 
ATOM   2415  N N     . TYR A 1 315 ? 2.805   30.117  14.108  1.00 18.25  ? 315  TYR A N     1 
ATOM   2416  C CA    . TYR A 1 315 ? 2.133   30.150  12.806  1.00 19.75  ? 315  TYR A CA    1 
ATOM   2417  C C     . TYR A 1 315 ? 2.132   31.492  12.066  1.00 20.66  ? 315  TYR A C     1 
ATOM   2418  O O     . TYR A 1 315 ? 1.638   31.579  10.950  1.00 21.92  ? 315  TYR A O     1 
ATOM   2419  C CB    . TYR A 1 315 ? 0.739   29.504  12.901  1.00 18.42  ? 315  TYR A CB    1 
ATOM   2420  C CG    . TYR A 1 315 ? 0.862   28.071  13.374  1.00 18.07  ? 315  TYR A CG    1 
ATOM   2421  C CD1   . TYR A 1 315 ? 0.520   27.718  14.683  1.00 18.86  ? 315  TYR A CD1   1 
ATOM   2422  C CD2   . TYR A 1 315 ? 1.401   27.075  12.539  1.00 18.54  ? 315  TYR A CD2   1 
ATOM   2423  C CE1   . TYR A 1 315 ? 0.677   26.411  15.144  1.00 17.22  ? 315  TYR A CE1   1 
ATOM   2424  C CE2   . TYR A 1 315 ? 1.574   25.755  13.003  1.00 17.73  ? 315  TYR A CE2   1 
ATOM   2425  C CZ    . TYR A 1 315 ? 1.200   25.444  14.311  1.00 18.38  ? 315  TYR A CZ    1 
ATOM   2426  O OH    . TYR A 1 315 ? 1.325   24.157  14.789  1.00 17.81  ? 315  TYR A OH    1 
ATOM   2427  N N     . LEU A 1 316 ? 2.689   32.529  12.675  1.00 21.62  ? 316  LEU A N     1 
ATOM   2428  C CA    . LEU A 1 316 ? 3.011   33.730  11.917  1.00 22.26  ? 316  LEU A CA    1 
ATOM   2429  C C     . LEU A 1 316 ? 4.458   33.606  11.455  1.00 22.23  ? 316  LEU A C     1 
ATOM   2430  O O     . LEU A 1 316 ? 4.776   33.854  10.296  1.00 22.39  ? 316  LEU A O     1 
ATOM   2431  C CB    . LEU A 1 316 ? 2.819   34.999  12.756  1.00 22.54  ? 316  LEU A CB    1 
ATOM   2432  C CG    . LEU A 1 316 ? 2.877   36.446  12.201  1.00 23.92  ? 316  LEU A CG    1 
ATOM   2433  C CD1   . LEU A 1 316 ? 4.182   36.802  11.502  1.00 27.11  ? 316  LEU A CD1   1 
ATOM   2434  C CD2   . LEU A 1 316 ? 1.726   36.742  11.259  1.00 26.02  ? 316  LEU A CD2   1 
ATOM   2435  N N     . LEU A 1 317 ? 5.325   33.180  12.364  1.00 22.46  ? 317  LEU A N     1 
ATOM   2436  C CA    . LEU A 1 317 ? 6.763   33.255  12.124  1.00 22.33  ? 317  LEU A CA    1 
ATOM   2437  C C     . LEU A 1 317 ? 7.478   31.934  11.910  1.00 21.55  ? 317  LEU A C     1 
ATOM   2438  O O     . LEU A 1 317 ? 7.945   31.664  10.804  1.00 21.34  ? 317  LEU A O     1 
ATOM   2439  C CB    . LEU A 1 317 ? 7.431   34.051  13.240  1.00 23.33  ? 317  LEU A CB    1 
ATOM   2440  C CG    . LEU A 1 317 ? 7.066   35.536  13.083  1.00 26.86  ? 317  LEU A CG    1 
ATOM   2441  C CD1   . LEU A 1 317 ? 7.429   36.341  14.323  1.00 28.79  ? 317  LEU A CD1   1 
ATOM   2442  C CD2   . LEU A 1 317 ? 7.740   36.117  11.809  1.00 27.69  ? 317  LEU A CD2   1 
ATOM   2443  N N     . TYR A 1 318 ? 7.572   31.115  12.954  1.00 20.42  ? 318  TYR A N     1 
ATOM   2444  C CA    . TYR A 1 318 ? 8.489   29.978  12.921  1.00 20.08  ? 318  TYR A CA    1 
ATOM   2445  C C     . TYR A 1 318 ? 8.123   28.866  11.933  1.00 19.48  ? 318  TYR A C     1 
ATOM   2446  O O     . TYR A 1 318 ? 8.943   28.486  11.111  1.00 18.59  ? 318  TYR A O     1 
ATOM   2447  C CB    . TYR A 1 318 ? 8.763   29.455  14.345  1.00 20.36  ? 318  TYR A CB    1 
ATOM   2448  C CG    . TYR A 1 318 ? 9.502   30.479  15.210  1.00 20.25  ? 318  TYR A CG    1 
ATOM   2449  C CD1   . TYR A 1 318 ? 10.527  31.254  14.669  1.00 20.90  ? 318  TYR A CD1   1 
ATOM   2450  C CD2   . TYR A 1 318 ? 9.180   30.664  16.558  1.00 19.91  ? 318  TYR A CD2   1 
ATOM   2451  C CE1   . TYR A 1 318 ? 11.220  32.204  15.442  1.00 21.51  ? 318  TYR A CE1   1 
ATOM   2452  C CE2   . TYR A 1 318 ? 9.866   31.612  17.351  1.00 20.88  ? 318  TYR A CE2   1 
ATOM   2453  C CZ    . TYR A 1 318 ? 10.894  32.364  16.784  1.00 21.69  ? 318  TYR A CZ    1 
ATOM   2454  O OH    . TYR A 1 318 ? 11.597  33.287  17.528  1.00 21.48  ? 318  TYR A OH    1 
ATOM   2455  N N     . GLY A 1 319 ? 6.902   28.348  12.013  1.00 19.65  ? 319  GLY A N     1 
ATOM   2456  C CA    . GLY A 1 319 ? 6.446   27.309  11.072  1.00 19.85  ? 319  GLY A CA    1 
ATOM   2457  C C     . GLY A 1 319 ? 6.559   27.724  9.608   1.00 19.78  ? 319  GLY A C     1 
ATOM   2458  O O     . GLY A 1 319 ? 7.154   27.011  8.812   1.00 19.57  ? 319  GLY A O     1 
ATOM   2459  N N     . PRO A 1 320 ? 5.965   28.875  9.242   1.00 19.72  ? 320  PRO A N     1 
ATOM   2460  C CA    . PRO A 1 320 ? 6.041   29.371  7.862   1.00 19.54  ? 320  PRO A CA    1 
ATOM   2461  C C     . PRO A 1 320 ? 7.453   29.649  7.343   1.00 19.19  ? 320  PRO A C     1 
ATOM   2462  O O     . PRO A 1 320 ? 7.760   29.286  6.204   1.00 19.60  ? 320  PRO A O     1 
ATOM   2463  C CB    . PRO A 1 320 ? 5.199   30.661  7.897   1.00 19.15  ? 320  PRO A CB    1 
ATOM   2464  C CG    . PRO A 1 320 ? 4.297   30.485  9.059   1.00 19.77  ? 320  PRO A CG    1 
ATOM   2465  C CD    . PRO A 1 320 ? 5.116   29.738  10.079  1.00 19.60  ? 320  PRO A CD    1 
ATOM   2466  N N     . LEU A 1 321 ? 8.297   30.305  8.140   1.00 18.88  ? 321  LEU A N     1 
ATOM   2467  C CA    . LEU A 1 321 ? 9.654   30.628  7.664   1.00 18.50  ? 321  LEU A CA    1 
ATOM   2468  C C     . LEU A 1 321 ? 10.510  29.378  7.523   1.00 18.19  ? 321  LEU A C     1 
ATOM   2469  O O     . LEU A 1 321 ? 11.337  29.295  6.621   1.00 18.33  ? 321  LEU A O     1 
ATOM   2470  C CB    . LEU A 1 321 ? 10.352  31.670  8.561   1.00 18.24  ? 321  LEU A CB    1 
ATOM   2471  C CG    . LEU A 1 321 ? 9.791   33.098  8.590   1.00 19.05  ? 321  LEU A CG    1 
ATOM   2472  C CD1   . LEU A 1 321 ? 10.563  33.989  9.580   1.00 18.83  ? 321  LEU A CD1   1 
ATOM   2473  C CD2   . LEU A 1 321 ? 9.792   33.728  7.182   1.00 18.95  ? 321  LEU A CD2   1 
ATOM   2474  N N     . ALA A 1 322 ? 10.310  28.401  8.407   1.00 17.82  ? 322  ALA A N     1 
ATOM   2475  C CA    . ALA A 1 322 ? 11.076  27.163  8.325   1.00 17.86  ? 322  ALA A CA    1 
ATOM   2476  C C     . ALA A 1 322 ? 10.783  26.463  7.005   1.00 17.99  ? 322  ALA A C     1 
ATOM   2477  O O     . ALA A 1 322 ? 11.687  25.895  6.393   1.00 18.17  ? 322  ALA A O     1 
ATOM   2478  C CB    . ALA A 1 322 ? 10.782  26.238  9.515   1.00 17.59  ? 322  ALA A CB    1 
ATOM   2479  N N     . CYS A 1 323 ? 9.524   26.533  6.561   1.00 18.39  ? 323  CYS A N     1 
ATOM   2480  C CA    . CYS A 1 323 ? 9.095   25.935  5.284   1.00 18.53  ? 323  CYS A CA    1 
ATOM   2481  C C     . CYS A 1 323 ? 9.396   26.792  4.050   1.00 18.16  ? 323  CYS A C     1 
ATOM   2482  O O     . CYS A 1 323 ? 9.138   26.377  2.926   1.00 17.93  ? 323  CYS A O     1 
ATOM   2483  C CB    . CYS A 1 323 ? 7.602   25.603  5.329   1.00 18.74  ? 323  CYS A CB    1 
ATOM   2484  S SG    . CYS A 1 323 ? 7.176   24.303  6.511   1.00 19.81  ? 323  CYS A SG    1 
ATOM   2485  N N     . GLY A 1 324 ? 9.938   27.989  4.256   1.00 18.13  ? 324  GLY A N     1 
ATOM   2486  C CA    . GLY A 1 324 ? 10.308  28.855  3.139   1.00 17.80  ? 324  GLY A CA    1 
ATOM   2487  C C     . GLY A 1 324 ? 9.123   29.592  2.539   1.00 18.48  ? 324  GLY A C     1 
ATOM   2488  O O     . GLY A 1 324 ? 9.172   30.030  1.385   1.00 18.62  ? 324  GLY A O     1 
ATOM   2489  N N     . ALA A 1 325 ? 8.055   29.740  3.322   1.00 18.18  ? 325  ALA A N     1 
ATOM   2490  C CA    . ALA A 1 325 ? 6.824   30.372  2.841   1.00 18.15  ? 325  ALA A CA    1 
ATOM   2491  C C     . ALA A 1 325 ? 6.937   31.906  2.820   1.00 18.25  ? 325  ALA A C     1 
ATOM   2492  O O     . ALA A 1 325 ? 7.841   32.477  3.417   1.00 17.69  ? 325  ALA A O     1 
ATOM   2493  C CB    . ALA A 1 325 ? 5.637   29.940  3.735   1.00 18.14  ? 325  ALA A CB    1 
ATOM   2494  N N     . THR A 1 326 ? 6.013   32.558  2.116   1.00 18.49  ? 326  THR A N     1 
ATOM   2495  C CA    . THR A 1 326 ? 5.737   33.975  2.307   1.00 18.37  ? 326  THR A CA    1 
ATOM   2496  C C     . THR A 1 326 ? 4.618   34.104  3.345   1.00 18.84  ? 326  THR A C     1 
ATOM   2497  O O     . THR A 1 326 ? 3.506   33.582  3.143   1.00 18.49  ? 326  THR A O     1 
ATOM   2498  C CB    . THR A 1 326 ? 5.267   34.637  1.000   1.00 18.66  ? 326  THR A CB    1 
ATOM   2499  O OG1   . THR A 1 326 ? 6.259   34.471  -0.010  1.00 16.88  ? 326  THR A OG1   1 
ATOM   2500  C CG2   . THR A 1 326 ? 5.014   36.137  1.210   1.00 17.68  ? 326  THR A CG2   1 
ATOM   2501  N N     . THR A 1 327 ? 4.922   34.793  4.448   1.00 19.10  ? 327  THR A N     1 
ATOM   2502  C CA    . THR A 1 327 ? 3.979   35.006  5.544   1.00 19.00  ? 327  THR A CA    1 
ATOM   2503  C C     . THR A 1 327 ? 3.632   36.498  5.648   1.00 19.38  ? 327  THR A C     1 
ATOM   2504  O O     . THR A 1 327 ? 4.500   37.354  5.514   1.00 20.07  ? 327  THR A O     1 
ATOM   2505  C CB    . THR A 1 327 ? 4.514   34.403  6.895   1.00 19.52  ? 327  THR A CB    1 
ATOM   2506  O OG1   . THR A 1 327 ? 3.499   34.459  7.912   1.00 19.57  ? 327  THR A OG1   1 
ATOM   2507  C CG2   . THR A 1 327 ? 5.770   35.118  7.391   1.00 18.21  ? 327  THR A CG2   1 
ATOM   2508  N N     . LEU A 1 328 ? 2.355   36.807  5.849   1.00 19.04  ? 328  LEU A N     1 
ATOM   2509  C CA    . LEU A 1 328 ? 1.913   38.187  5.892   1.00 18.68  ? 328  LEU A CA    1 
ATOM   2510  C C     . LEU A 1 328 ? 1.775   38.647  7.335   1.00 19.09  ? 328  LEU A C     1 
ATOM   2511  O O     . LEU A 1 328 ? 1.100   37.995  8.154   1.00 18.53  ? 328  LEU A O     1 
ATOM   2512  C CB    . LEU A 1 328 ? 0.588   38.363  5.137   1.00 18.02  ? 328  LEU A CB    1 
ATOM   2513  C CG    . LEU A 1 328 ? 0.148   39.773  4.715   1.00 18.30  ? 328  LEU A CG    1 
ATOM   2514  C CD1   . LEU A 1 328 ? -0.805  39.673  3.524   1.00 18.76  ? 328  LEU A CD1   1 
ATOM   2515  C CD2   . LEU A 1 328 ? -0.487  40.579  5.841   1.00 17.97  ? 328  LEU A CD2   1 
ATOM   2516  N N     . MET A 1 329 ? 2.406   39.783  7.634   1.00 19.66  ? 329  MET A N     1 
ATOM   2517  C CA    . MET A 1 329 ? 2.258   40.432  8.931   1.00 21.05  ? 329  MET A CA    1 
ATOM   2518  C C     . MET A 1 329 ? 1.450   41.726  8.786   1.00 20.34  ? 329  MET A C     1 
ATOM   2519  O O     . MET A 1 329 ? 1.863   42.653  8.086   1.00 20.11  ? 329  MET A O     1 
ATOM   2520  C CB    . MET A 1 329 ? 3.636   40.715  9.556   1.00 20.87  ? 329  MET A CB    1 
ATOM   2521  C CG    . MET A 1 329 ? 3.553   41.227  10.979  1.00 22.97  ? 329  MET A CG    1 
ATOM   2522  S SD    . MET A 1 329 ? 5.102   41.847  11.697  1.00 24.95  ? 329  MET A SD    1 
ATOM   2523  C CE    . MET A 1 329 ? 6.211   40.476  11.382  1.00 25.18  ? 329  MET A CE    1 
ATOM   2524  N N     . PHE A 1 330 ? 0.311   41.782  9.472   1.00 19.92  ? 330  PHE A N     1 
ATOM   2525  C CA    . PHE A 1 330 ? -0.610  42.901  9.376   1.00 19.73  ? 330  PHE A CA    1 
ATOM   2526  C C     . PHE A 1 330 ? -0.565  43.711  10.665  1.00 19.70  ? 330  PHE A C     1 
ATOM   2527  O O     . PHE A 1 330 ? -0.739  43.181  11.768  1.00 19.40  ? 330  PHE A O     1 
ATOM   2528  C CB    . PHE A 1 330 ? -2.029  42.384  9.069   1.00 19.37  ? 330  PHE A CB    1 
ATOM   2529  C CG    . PHE A 1 330 ? -3.104  43.457  9.029   1.00 21.05  ? 330  PHE A CG    1 
ATOM   2530  C CD1   . PHE A 1 330 ? -2.913  44.658  8.333   1.00 20.77  ? 330  PHE A CD1   1 
ATOM   2531  C CD2   . PHE A 1 330 ? -4.337  43.235  9.649   1.00 20.49  ? 330  PHE A CD2   1 
ATOM   2532  C CE1   . PHE A 1 330 ? -3.925  45.641  8.298   1.00 20.30  ? 330  PHE A CE1   1 
ATOM   2533  C CE2   . PHE A 1 330 ? -5.355  44.192  9.602   1.00 20.93  ? 330  PHE A CE2   1 
ATOM   2534  C CZ    . PHE A 1 330 ? -5.150  45.404  8.931   1.00 19.82  ? 330  PHE A CZ    1 
ATOM   2535  N N     . GLU A 1 331 ? -0.325  45.004  10.510  1.00 19.93  ? 331  GLU A N     1 
ATOM   2536  C CA    . GLU A 1 331 ? -0.158  45.905  11.639  1.00 20.56  ? 331  GLU A CA    1 
ATOM   2537  C C     . GLU A 1 331 ? -1.486  46.206  12.343  1.00 20.98  ? 331  GLU A C     1 
ATOM   2538  O O     . GLU A 1 331 ? -1.498  46.469  13.542  1.00 21.04  ? 331  GLU A O     1 
ATOM   2539  C CB    . GLU A 1 331 ? 0.487   47.211  11.163  1.00 20.21  ? 331  GLU A CB    1 
ATOM   2540  C CG    . GLU A 1 331 ? 0.954   48.132  12.279  1.00 20.48  ? 331  GLU A CG    1 
ATOM   2541  C CD    . GLU A 1 331 ? 1.467   49.491  11.782  1.00 20.89  ? 331  GLU A CD    1 
ATOM   2542  O OE1   . GLU A 1 331 ? 0.900   50.062  10.817  1.00 20.06  ? 331  GLU A OE1   1 
ATOM   2543  O OE2   . GLU A 1 331 ? 2.445   49.999  12.380  1.00 22.21  ? 331  GLU A OE2   1 
ATOM   2544  N N     . GLY A 1 332 ? -2.595  46.172  11.603  1.00 21.06  ? 332  GLY A N     1 
ATOM   2545  C CA    . GLY A 1 332 ? -3.855  46.715  12.111  1.00 21.77  ? 332  GLY A CA    1 
ATOM   2546  C C     . GLY A 1 332 ? -4.877  45.703  12.592  1.00 22.49  ? 332  GLY A C     1 
ATOM   2547  O O     . GLY A 1 332 ? -4.517  44.649  13.141  1.00 21.90  ? 332  GLY A O     1 
ATOM   2548  N N     . VAL A 1 333 ? -6.154  46.043  12.397  1.00 23.10  ? 333  VAL A N     1 
ATOM   2549  C CA    . VAL A 1 333 ? -7.275  45.158  12.744  1.00 24.07  ? 333  VAL A CA    1 
ATOM   2550  C C     . VAL A 1 333 ? -8.150  44.822  11.512  1.00 24.13  ? 333  VAL A C     1 
ATOM   2551  O O     . VAL A 1 333 ? -8.245  45.627  10.584  1.00 23.83  ? 333  VAL A O     1 
ATOM   2552  C CB    . VAL A 1 333 ? -8.139  45.722  13.927  1.00 24.51  ? 333  VAL A CB    1 
ATOM   2553  C CG1   . VAL A 1 333 ? -7.310  45.830  15.188  1.00 25.39  ? 333  VAL A CG1   1 
ATOM   2554  C CG2   . VAL A 1 333 ? -8.748  47.063  13.591  1.00 24.52  ? 333  VAL A CG2   1 
ATOM   2555  N N     . PRO A 1 334 ? -8.788  43.631  11.506  1.00 24.21  ? 334  PRO A N     1 
ATOM   2556  C CA    . PRO A 1 334 ? -9.547  43.141  10.337  1.00 24.54  ? 334  PRO A CA    1 
ATOM   2557  C C     . PRO A 1 334 ? -10.720 44.024  9.923   1.00 24.65  ? 334  PRO A C     1 
ATOM   2558  O O     . PRO A 1 334 ? -11.263 43.842  8.820   1.00 24.48  ? 334  PRO A O     1 
ATOM   2559  C CB    . PRO A 1 334 ? -10.073 41.763  10.800  1.00 25.05  ? 334  PRO A CB    1 
ATOM   2560  C CG    . PRO A 1 334 ? -10.048 41.831  12.321  1.00 25.01  ? 334  PRO A CG    1 
ATOM   2561  C CD    . PRO A 1 334 ? -8.826  42.665  12.622  1.00 24.24  ? 334  PRO A CD    1 
ATOM   2562  N N     . ASN A 1 335 ? -11.109 44.964  10.790  1.00 24.30  ? 335  ASN A N     1 
ATOM   2563  C CA    . ASN A 1 335 ? -12.262 45.821  10.513  1.00 23.89  ? 335  ASN A CA    1 
ATOM   2564  C C     . ASN A 1 335 ? -12.029 47.330  10.591  1.00 23.11  ? 335  ASN A C     1 
ATOM   2565  O O     . ASN A 1 335 ? -12.969 48.084  10.822  1.00 23.12  ? 335  ASN A O     1 
ATOM   2566  C CB    . ASN A 1 335 ? -13.486 45.413  11.361  1.00 24.18  ? 335  ASN A CB    1 
ATOM   2567  C CG    . ASN A 1 335 ? -13.232 45.461  12.877  1.00 25.81  ? 335  ASN A CG    1 
ATOM   2568  O OD1   . ASN A 1 335 ? -14.092 45.036  13.654  1.00 29.63  ? 335  ASN A OD1   1 
ATOM   2569  N ND2   . ASN A 1 335 ? -12.073 45.956  13.300  1.00 23.90  ? 335  ASN A ND2   1 
ATOM   2570  N N     . TRP A 1 336 ? -10.788 47.769  10.398  1.00 22.27  ? 336  TRP A N     1 
ATOM   2571  C CA    . TRP A 1 336 ? -10.507 49.197  10.277  1.00 21.85  ? 336  TRP A CA    1 
ATOM   2572  C C     . TRP A 1 336 ? -9.678  49.477  9.021   1.00 21.74  ? 336  TRP A C     1 
ATOM   2573  O O     . TRP A 1 336 ? -8.687  48.780  8.768   1.00 21.54  ? 336  TRP A O     1 
ATOM   2574  C CB    . TRP A 1 336 ? -9.794  49.741  11.529  1.00 22.06  ? 336  TRP A CB    1 
ATOM   2575  C CG    . TRP A 1 336 ? -9.734  51.239  11.541  1.00 22.45  ? 336  TRP A CG    1 
ATOM   2576  C CD1   . TRP A 1 336 ? -10.648 52.082  12.094  1.00 22.46  ? 336  TRP A CD1   1 
ATOM   2577  C CD2   . TRP A 1 336 ? -8.737  52.074  10.924  1.00 22.16  ? 336  TRP A CD2   1 
ATOM   2578  N NE1   . TRP A 1 336 ? -10.274 53.384  11.886  1.00 22.67  ? 336  TRP A NE1   1 
ATOM   2579  C CE2   . TRP A 1 336 ? -9.107  53.410  11.170  1.00 22.15  ? 336  TRP A CE2   1 
ATOM   2580  C CE3   . TRP A 1 336 ? -7.563  51.822  10.202  1.00 23.08  ? 336  TRP A CE3   1 
ATOM   2581  C CZ2   . TRP A 1 336 ? -8.350  54.494  10.719  1.00 21.49  ? 336  TRP A CZ2   1 
ATOM   2582  C CZ3   . TRP A 1 336 ? -6.805  52.904  9.752   1.00 22.24  ? 336  TRP A CZ3   1 
ATOM   2583  C CH2   . TRP A 1 336 ? -7.202  54.223  10.019  1.00 22.45  ? 336  TRP A CH2   1 
ATOM   2584  N N     . PRO A 1 337 ? -10.044 50.525  8.250   1.00 21.70  ? 337  PRO A N     1 
ATOM   2585  C CA    . PRO A 1 337 ? -11.129 51.496  8.482   1.00 21.78  ? 337  PRO A CA    1 
ATOM   2586  C C     . PRO A 1 337 ? -12.564 50.972  8.345   1.00 21.43  ? 337  PRO A C     1 
ATOM   2587  O O     . PRO A 1 337 ? -13.470 51.561  8.930   1.00 21.52  ? 337  PRO A O     1 
ATOM   2588  C CB    . PRO A 1 337 ? -10.855 52.598  7.434   1.00 21.95  ? 337  PRO A CB    1 
ATOM   2589  C CG    . PRO A 1 337 ? -9.453  52.345  6.949   1.00 22.22  ? 337  PRO A CG    1 
ATOM   2590  C CD    . PRO A 1 337 ? -9.281  50.859  7.038   1.00 21.36  ? 337  PRO A CD    1 
ATOM   2591  N N     . THR A 1 338 ? -12.765 49.892  7.586   1.00 20.92  ? 338  THR A N     1 
ATOM   2592  C CA    . THR A 1 338 ? -14.110 49.344  7.341   1.00 20.17  ? 338  THR A CA    1 
ATOM   2593  C C     . THR A 1 338 ? -14.118 47.836  7.614   1.00 19.48  ? 338  THR A C     1 
ATOM   2594  O O     . THR A 1 338 ? -13.045 47.216  7.636   1.00 19.03  ? 338  THR A O     1 
ATOM   2595  C CB    . THR A 1 338 ? -14.600 49.605  5.881   1.00 20.66  ? 338  THR A CB    1 
ATOM   2596  O OG1   . THR A 1 338 ? -13.928 48.724  4.970   1.00 21.58  ? 338  THR A OG1   1 
ATOM   2597  C CG2   . THR A 1 338 ? -14.388 51.086  5.451   1.00 20.68  ? 338  THR A CG2   1 
ATOM   2598  N N     . PRO A 1 339 ? -15.319 47.238  7.821   1.00 18.46  ? 339  PRO A N     1 
ATOM   2599  C CA    . PRO A 1 339 ? -15.378 45.777  8.052   1.00 17.99  ? 339  PRO A CA    1 
ATOM   2600  C C     . PRO A 1 339 ? -14.791 44.944  6.905   1.00 17.27  ? 339  PRO A C     1 
ATOM   2601  O O     . PRO A 1 339 ? -14.426 43.792  7.122   1.00 17.26  ? 339  PRO A O     1 
ATOM   2602  C CB    . PRO A 1 339 ? -16.878 45.500  8.230   1.00 18.05  ? 339  PRO A CB    1 
ATOM   2603  C CG    . PRO A 1 339 ? -17.469 46.861  8.624   1.00 17.96  ? 339  PRO A CG    1 
ATOM   2604  C CD    . PRO A 1 339 ? -16.659 47.861  7.867   1.00 18.15  ? 339  PRO A CD    1 
ATOM   2605  N N     . ALA A 1 340 ? -14.670 45.539  5.719   1.00 16.67  ? 340  ALA A N     1 
ATOM   2606  C CA    . ALA A 1 340 ? -14.102 44.873  4.544   1.00 17.23  ? 340  ALA A CA    1 
ATOM   2607  C C     . ALA A 1 340 ? -12.565 44.816  4.494   1.00 17.41  ? 340  ALA A C     1 
ATOM   2608  O O     . ALA A 1 340 ? -11.997 44.230  3.562   1.00 17.85  ? 340  ALA A O     1 
ATOM   2609  C CB    . ALA A 1 340 ? -14.647 45.503  3.255   1.00 17.63  ? 340  ALA A CB    1 
ATOM   2610  N N     . ARG A 1 341 ? -11.894 45.395  5.490   1.00 17.63  ? 341  ARG A N     1 
ATOM   2611  C CA    . ARG A 1 341 ? -10.424 45.449  5.495   1.00 17.82  ? 341  ARG A CA    1 
ATOM   2612  C C     . ARG A 1 341 ? -9.735  44.093  5.322   1.00 18.10  ? 341  ARG A C     1 
ATOM   2613  O O     . ARG A 1 341 ? -8.818  43.950  4.496   1.00 18.75  ? 341  ARG A O     1 
ATOM   2614  C CB    . ARG A 1 341 ? -9.869  46.148  6.745   1.00 17.78  ? 341  ARG A CB    1 
ATOM   2615  C CG    . ARG A 1 341 ? -8.334  46.350  6.690   1.00 16.88  ? 341  ARG A CG    1 
ATOM   2616  C CD    . ARG A 1 341 ? -7.956  47.366  5.612   1.00 19.37  ? 341  ARG A CD    1 
ATOM   2617  N NE    . ARG A 1 341 ? -6.511  47.504  5.373   1.00 19.37  ? 341  ARG A NE    1 
ATOM   2618  C CZ    . ARG A 1 341 ? -5.670  48.173  6.159   1.00 19.12  ? 341  ARG A CZ    1 
ATOM   2619  N NH1   . ARG A 1 341 ? -6.107  48.751  7.268   1.00 17.10  ? 341  ARG A NH1   1 
ATOM   2620  N NH2   . ARG A 1 341 ? -4.384  48.267  5.832   1.00 19.28  ? 341  ARG A NH2   1 
ATOM   2621  N N     . MET A 1 342 ? -10.156 43.102  6.095   1.00 17.80  ? 342  MET A N     1 
ATOM   2622  C CA    . MET A 1 342 ? -9.513  41.796  6.009   1.00 17.90  ? 342  MET A CA    1 
ATOM   2623  C C     . MET A 1 342 ? -9.519  41.276  4.570   1.00 17.74  ? 342  MET A C     1 
ATOM   2624  O O     . MET A 1 342 ? -8.480  40.853  4.060   1.00 17.67  ? 342  MET A O     1 
ATOM   2625  C CB    . MET A 1 342 ? -10.155 40.791  6.951   1.00 17.34  ? 342  MET A CB    1 
ATOM   2626  C CG    . MET A 1 342 ? -9.425  39.453  6.971   1.00 17.81  ? 342  MET A CG    1 
ATOM   2627  S SD    . MET A 1 342 ? -10.223 38.250  8.048   1.00 19.22  ? 342  MET A SD    1 
ATOM   2628  C CE    . MET A 1 342 ? -11.560 37.692  7.002   1.00 17.10  ? 342  MET A CE    1 
ATOM   2629  N N     . CYS A 1 343 ? -10.678 41.338  3.910   1.00 17.27  ? 343  CYS A N     1 
ATOM   2630  C CA    . CYS A 1 343 ? -10.769 40.869  2.537   1.00 17.13  ? 343  CYS A CA    1 
ATOM   2631  C C     . CYS A 1 343 ? -10.049 41.778  1.536   1.00 16.78  ? 343  CYS A C     1 
ATOM   2632  O O     . CYS A 1 343 ? -9.581  41.296  0.512   1.00 16.87  ? 343  CYS A O     1 
ATOM   2633  C CB    . CYS A 1 343 ? -12.217 40.563  2.138   1.00 16.91  ? 343  CYS A CB    1 
ATOM   2634  S SG    . CYS A 1 343 ? -12.923 39.165  3.092   1.00 18.69  ? 343  CYS A SG    1 
ATOM   2635  N N     . GLN A 1 344 ? -9.934  43.075  1.838   1.00 16.94  ? 344  GLN A N     1 
ATOM   2636  C CA    . GLN A 1 344 ? -9.132  43.997  0.998   1.00 16.36  ? 344  GLN A CA    1 
ATOM   2637  C C     . GLN A 1 344 ? -7.658  43.612  1.040   1.00 16.89  ? 344  GLN A C     1 
ATOM   2638  O O     . GLN A 1 344 ? -6.974  43.645  0.005   1.00 16.73  ? 344  GLN A O     1 
ATOM   2639  C CB    . GLN A 1 344 ? -9.323  45.465  1.402   1.00 16.38  ? 344  GLN A CB    1 
ATOM   2640  C CG    . GLN A 1 344 ? -10.730 46.026  1.081   1.00 16.08  ? 344  GLN A CG    1 
ATOM   2641  C CD    . GLN A 1 344 ? -11.084 47.314  1.831   1.00 16.20  ? 344  GLN A CD    1 
ATOM   2642  O OE1   . GLN A 1 344 ? -12.062 47.977  1.501   1.00 18.55  ? 344  GLN A OE1   1 
ATOM   2643  N NE2   . GLN A 1 344 ? -10.303 47.661  2.834   1.00 16.24  ? 344  GLN A NE2   1 
ATOM   2644  N N     . VAL A 1 345 ? -7.184  43.228  2.232   1.00 16.91  ? 345  VAL A N     1 
ATOM   2645  C CA    . VAL A 1 345 ? -5.809  42.734  2.431   1.00 17.10  ? 345  VAL A CA    1 
ATOM   2646  C C     . VAL A 1 345 ? -5.613  41.438  1.640   1.00 17.38  ? 345  VAL A C     1 
ATOM   2647  O O     . VAL A 1 345 ? -4.659  41.314  0.857   1.00 17.49  ? 345  VAL A O     1 
ATOM   2648  C CB    . VAL A 1 345 ? -5.464  42.543  3.942   1.00 17.06  ? 345  VAL A CB    1 
ATOM   2649  C CG1   . VAL A 1 345 ? -4.038  41.999  4.149   1.00 16.46  ? 345  VAL A CG1   1 
ATOM   2650  C CG2   . VAL A 1 345 ? -5.635  43.862  4.707   1.00 17.19  ? 345  VAL A CG2   1 
ATOM   2651  N N     . VAL A 1 346 ? -6.537  40.494  1.815   1.00 17.39  ? 346  VAL A N     1 
ATOM   2652  C CA    . VAL A 1 346 ? -6.569  39.269  0.994   1.00 16.79  ? 346  VAL A CA    1 
ATOM   2653  C C     . VAL A 1 346 ? -6.386  39.564  -0.505  1.00 17.56  ? 346  VAL A C     1 
ATOM   2654  O O     . VAL A 1 346 ? -5.502  38.986  -1.133  1.00 17.40  ? 346  VAL A O     1 
ATOM   2655  C CB    . VAL A 1 346 ? -7.841  38.424  1.273   1.00 16.98  ? 346  VAL A CB    1 
ATOM   2656  C CG1   . VAL A 1 346 ? -8.055  37.329  0.215   1.00 14.76  ? 346  VAL A CG1   1 
ATOM   2657  C CG2   . VAL A 1 346 ? -7.781  37.815  2.700   1.00 16.20  ? 346  VAL A CG2   1 
ATOM   2658  N N     . ASP A 1 347 ? -7.204  40.467  -1.062  1.00 18.12  ? 347  ASP A N     1 
ATOM   2659  C CA    . ASP A 1 347 ? -7.138  40.819  -2.485  1.00 18.80  ? 347  ASP A CA    1 
ATOM   2660  C C     . ASP A 1 347 ? -5.838  41.523  -2.871  1.00 19.15  ? 347  ASP A C     1 
ATOM   2661  O O     . ASP A 1 347 ? -5.274  41.249  -3.929  1.00 18.82  ? 347  ASP A O     1 
ATOM   2662  C CB    . ASP A 1 347 ? -8.288  41.749  -2.867  1.00 18.91  ? 347  ASP A CB    1 
ATOM   2663  C CG    . ASP A 1 347 ? -9.625  41.038  -2.986  1.00 19.59  ? 347  ASP A CG    1 
ATOM   2664  O OD1   . ASP A 1 347 ? -9.678  39.782  -2.955  1.00 20.11  ? 347  ASP A OD1   1 
ATOM   2665  O OD2   . ASP A 1 347 ? -10.631 41.771  -3.128  1.00 20.26  ? 347  ASP A OD2   1 
ATOM   2666  N N     . LYS A 1 348 ? -5.393  42.451  -2.022  1.00 19.24  ? 348  LYS A N     1 
ATOM   2667  C CA    . LYS A 1 348 ? -4.226  43.278  -2.312  1.00 20.16  ? 348  LYS A CA    1 
ATOM   2668  C C     . LYS A 1 348 ? -2.977  42.403  -2.455  1.00 20.31  ? 348  LYS A C     1 
ATOM   2669  O O     . LYS A 1 348 ? -2.174  42.590  -3.380  1.00 20.25  ? 348  LYS A O     1 
ATOM   2670  C CB    . LYS A 1 348 ? -4.040  44.351  -1.228  1.00 19.89  ? 348  LYS A CB    1 
ATOM   2671  C CG    . LYS A 1 348 ? -2.835  45.257  -1.425  1.00 20.87  ? 348  LYS A CG    1 
ATOM   2672  C CD    . LYS A 1 348 ? -2.728  46.320  -0.341  1.00 21.26  ? 348  LYS A CD    1 
ATOM   2673  C CE    . LYS A 1 348 ? -1.429  47.127  -0.499  1.00 22.45  ? 348  LYS A CE    1 
ATOM   2674  N NZ    . LYS A 1 348 ? -1.124  47.921  0.729   1.00 22.97  ? 348  LYS A NZ    1 
ATOM   2675  N N     . HIS A 1 349 ? -2.842  41.431  -1.557  1.00 19.83  ? 349  HIS A N     1 
ATOM   2676  C CA    . HIS A 1 349 ? -1.651  40.593  -1.519  1.00 19.97  ? 349  HIS A CA    1 
ATOM   2677  C C     . HIS A 1 349 ? -1.901  39.188  -2.063  1.00 19.54  ? 349  HIS A C     1 
ATOM   2678  O O     . HIS A 1 349 ? -1.024  38.317  -1.987  1.00 19.44  ? 349  HIS A O     1 
ATOM   2679  C CB    . HIS A 1 349 ? -1.071  40.583  -0.095  1.00 19.57  ? 349  HIS A CB    1 
ATOM   2680  C CG    . HIS A 1 349 ? -0.695  41.949  0.396   1.00 20.50  ? 349  HIS A CG    1 
ATOM   2681  N ND1   . HIS A 1 349 ? 0.349   42.672  -0.145  1.00 20.35  ? 349  HIS A ND1   1 
ATOM   2682  C CD2   . HIS A 1 349 ? -1.242  42.736  1.353   1.00 20.79  ? 349  HIS A CD2   1 
ATOM   2683  C CE1   . HIS A 1 349 ? 0.440   43.837  0.471   1.00 20.73  ? 349  HIS A CE1   1 
ATOM   2684  N NE2   . HIS A 1 349 ? -0.510  43.898  1.388   1.00 21.53  ? 349  HIS A NE2   1 
ATOM   2685  N N     . GLN A 1 350 ? -3.094  38.988  -2.628  1.00 19.17  ? 350  GLN A N     1 
ATOM   2686  C CA    . GLN A 1 350 ? -3.483  37.707  -3.246  1.00 19.08  ? 350  GLN A CA    1 
ATOM   2687  C C     . GLN A 1 350 ? -3.230  36.539  -2.283  1.00 18.76  ? 350  GLN A C     1 
ATOM   2688  O O     . GLN A 1 350 ? -2.600  35.532  -2.633  1.00 18.48  ? 350  GLN A O     1 
ATOM   2689  C CB    . GLN A 1 350 ? -2.761  37.488  -4.588  1.00 19.17  ? 350  GLN A CB    1 
ATOM   2690  C CG    . GLN A 1 350 ? -3.144  38.495  -5.688  1.00 20.27  ? 350  GLN A CG    1 
ATOM   2691  C CD    . GLN A 1 350 ? -4.540  38.244  -6.218  1.00 20.73  ? 350  GLN A CD    1 
ATOM   2692  O OE1   . GLN A 1 350 ? -5.476  38.979  -5.905  1.00 22.99  ? 350  GLN A OE1   1 
ATOM   2693  N NE2   . GLN A 1 350 ? -4.695  37.186  -6.990  1.00 19.70  ? 350  GLN A NE2   1 
ATOM   2694  N N     . VAL A 1 351 ? -3.718  36.698  -1.059  1.00 18.39  ? 351  VAL A N     1 
ATOM   2695  C CA    . VAL A 1 351 ? -3.576  35.668  -0.033  1.00 18.00  ? 351  VAL A CA    1 
ATOM   2696  C C     . VAL A 1 351 ? -4.277  34.368  -0.457  1.00 17.64  ? 351  VAL A C     1 
ATOM   2697  O O     . VAL A 1 351 ? -5.419  34.396  -0.927  1.00 17.86  ? 351  VAL A O     1 
ATOM   2698  C CB    . VAL A 1 351 ? -4.114  36.170  1.320   1.00 17.98  ? 351  VAL A CB    1 
ATOM   2699  C CG1   . VAL A 1 351 ? -4.105  35.050  2.360   1.00 18.80  ? 351  VAL A CG1   1 
ATOM   2700  C CG2   . VAL A 1 351 ? -3.294  37.357  1.802   1.00 17.48  ? 351  VAL A CG2   1 
ATOM   2701  N N     . ASN A 1 352 ? -3.581  33.243  -0.311  1.00 16.96  ? 352  ASN A N     1 
ATOM   2702  C CA    . ASN A 1 352 ? -4.147  31.933  -0.649  1.00 16.58  ? 352  ASN A CA    1 
ATOM   2703  C C     . ASN A 1 352 ? -4.576  31.142  0.588   1.00 16.14  ? 352  ASN A C     1 
ATOM   2704  O O     . ASN A 1 352 ? -5.391  30.231  0.483   1.00 16.10  ? 352  ASN A O     1 
ATOM   2705  C CB    . ASN A 1 352 ? -3.146  31.085  -1.440  1.00 16.20  ? 352  ASN A CB    1 
ATOM   2706  C CG    . ASN A 1 352 ? -2.620  31.789  -2.684  1.00 17.06  ? 352  ASN A CG    1 
ATOM   2707  O OD1   . ASN A 1 352 ? -1.422  32.038  -2.794  1.00 14.71  ? 352  ASN A OD1   1 
ATOM   2708  N ND2   . ASN A 1 352 ? -3.511  32.096  -3.631  1.00 16.19  ? 352  ASN A ND2   1 
ATOM   2709  N N     . ILE A 1 353 ? -3.981  31.459  1.738   1.00 15.95  ? 353  ILE A N     1 
ATOM   2710  C CA    . ILE A 1 353 ? -4.296  30.770  2.995   1.00 16.14  ? 353  ILE A CA    1 
ATOM   2711  C C     . ILE A 1 353 ? -4.556  31.811  4.069   1.00 16.94  ? 353  ILE A C     1 
ATOM   2712  O O     . ILE A 1 353 ? -3.697  32.662  4.334   1.00 17.21  ? 353  ILE A O     1 
ATOM   2713  C CB    . ILE A 1 353 ? -3.164  29.823  3.478   1.00 16.05  ? 353  ILE A CB    1 
ATOM   2714  C CG1   . ILE A 1 353 ? -2.729  28.867  2.360   1.00 14.85  ? 353  ILE A CG1   1 
ATOM   2715  C CG2   . ILE A 1 353 ? -3.621  29.037  4.721   1.00 13.86  ? 353  ILE A CG2   1 
ATOM   2716  C CD1   . ILE A 1 353 ? -1.314  28.296  2.540   1.00 15.67  ? 353  ILE A CD1   1 
ATOM   2717  N N     . LEU A 1 354 ? -5.743  31.750  4.668   1.00 17.07  ? 354  LEU A N     1 
ATOM   2718  C CA    . LEU A 1 354 ? -6.100  32.680  5.734   1.00 17.63  ? 354  LEU A CA    1 
ATOM   2719  C C     . LEU A 1 354 ? -6.414  31.920  7.022   1.00 17.94  ? 354  LEU A C     1 
ATOM   2720  O O     . LEU A 1 354 ? -7.231  31.000  7.028   1.00 18.05  ? 354  LEU A O     1 
ATOM   2721  C CB    . LEU A 1 354 ? -7.292  33.543  5.316   1.00 17.52  ? 354  LEU A CB    1 
ATOM   2722  C CG    . LEU A 1 354 ? -7.879  34.514  6.349   1.00 17.21  ? 354  LEU A CG    1 
ATOM   2723  C CD1   . LEU A 1 354 ? -6.894  35.634  6.664   1.00 16.17  ? 354  LEU A CD1   1 
ATOM   2724  C CD2   . LEU A 1 354 ? -9.196  35.084  5.843   1.00 17.78  ? 354  LEU A CD2   1 
ATOM   2725  N N     . TYR A 1 355 ? -5.772  32.335  8.107   1.00 18.34  ? 355  TYR A N     1 
ATOM   2726  C CA    . TYR A 1 355 ? -5.895  31.682  9.403   1.00 18.75  ? 355  TYR A CA    1 
ATOM   2727  C C     . TYR A 1 355 ? -6.232  32.770  10.424  1.00 18.89  ? 355  TYR A C     1 
ATOM   2728  O O     . TYR A 1 355 ? -5.394  33.619  10.730  1.00 19.09  ? 355  TYR A O     1 
ATOM   2729  C CB    . TYR A 1 355 ? -4.556  31.011  9.739   1.00 18.97  ? 355  TYR A CB    1 
ATOM   2730  C CG    . TYR A 1 355 ? -4.475  30.171  10.995  1.00 19.30  ? 355  TYR A CG    1 
ATOM   2731  C CD1   . TYR A 1 355 ? -5.512  29.314  11.380  1.00 20.16  ? 355  TYR A CD1   1 
ATOM   2732  C CD2   . TYR A 1 355 ? -3.312  30.188  11.777  1.00 19.82  ? 355  TYR A CD2   1 
ATOM   2733  C CE1   . TYR A 1 355 ? -5.396  28.523  12.538  1.00 19.53  ? 355  TYR A CE1   1 
ATOM   2734  C CE2   . TYR A 1 355 ? -3.188  29.402  12.918  1.00 18.43  ? 355  TYR A CE2   1 
ATOM   2735  C CZ    . TYR A 1 355 ? -4.222  28.579  13.294  1.00 19.97  ? 355  TYR A CZ    1 
ATOM   2736  O OH    . TYR A 1 355 ? -4.071  27.820  14.443  1.00 21.16  ? 355  TYR A OH    1 
ATOM   2737  N N     . THR A 1 356 ? -7.461  32.751  10.933  1.00 18.52  ? 356  THR A N     1 
ATOM   2738  C CA    . THR A 1 356 ? -7.915  33.792  11.836  1.00 18.56  ? 356  THR A CA    1 
ATOM   2739  C C     . THR A 1 356 ? -8.695  33.238  13.046  1.00 18.78  ? 356  THR A C     1 
ATOM   2740  O O     . THR A 1 356 ? -8.686  32.029  13.282  1.00 19.01  ? 356  THR A O     1 
ATOM   2741  C CB    . THR A 1 356 ? -8.663  34.940  11.070  1.00 18.31  ? 356  THR A CB    1 
ATOM   2742  O OG1   . THR A 1 356 ? -8.798  36.081  11.931  1.00 18.71  ? 356  THR A OG1   1 
ATOM   2743  C CG2   . THR A 1 356 ? -10.047 34.492  10.564  1.00 19.03  ? 356  THR A CG2   1 
ATOM   2744  N N     . ALA A 1 357 ? -9.321  34.119  13.822  1.00 18.14  ? 357  ALA A N     1 
ATOM   2745  C CA    . ALA A 1 357 ? -9.934  33.745  15.106  1.00 18.74  ? 357  ALA A CA    1 
ATOM   2746  C C     . ALA A 1 357 ? -11.447 33.939  15.088  1.00 18.15  ? 357  ALA A C     1 
ATOM   2747  O O     . ALA A 1 357 ? -11.938 34.870  14.450  1.00 18.64  ? 357  ALA A O     1 
ATOM   2748  C CB    . ALA A 1 357 ? -9.311  34.576  16.260  1.00 18.41  ? 357  ALA A CB    1 
ATOM   2749  N N     . PRO A 1 358 ? -12.194 33.049  15.764  1.00 18.13  ? 358  PRO A N     1 
ATOM   2750  C CA    . PRO A 1 358 ? -13.652 33.228  15.832  1.00 18.22  ? 358  PRO A CA    1 
ATOM   2751  C C     . PRO A 1 358 ? -14.133 34.601  16.318  1.00 18.29  ? 358  PRO A C     1 
ATOM   2752  O O     . PRO A 1 358 ? -15.176 35.059  15.868  1.00 18.35  ? 358  PRO A O     1 
ATOM   2753  C CB    . PRO A 1 358 ? -14.105 32.097  16.776  1.00 18.44  ? 358  PRO A CB    1 
ATOM   2754  C CG    . PRO A 1 358 ? -13.046 31.002  16.557  1.00 17.78  ? 358  PRO A CG    1 
ATOM   2755  C CD    . PRO A 1 358 ? -11.758 31.797  16.422  1.00 17.82  ? 358  PRO A CD    1 
ATOM   2756  N N     . THR A 1 359 ? -13.404 35.259  17.216  1.00 18.11  ? 359  THR A N     1 
ATOM   2757  C CA    . THR A 1 359 ? -13.808 36.607  17.623  1.00 18.67  ? 359  THR A CA    1 
ATOM   2758  C C     . THR A 1 359 ? -13.817 37.576  16.435  1.00 18.19  ? 359  THR A C     1 
ATOM   2759  O O     . THR A 1 359 ? -14.737 38.376  16.299  1.00 18.16  ? 359  THR A O     1 
ATOM   2760  C CB    . THR A 1 359 ? -12.959 37.178  18.796  1.00 19.19  ? 359  THR A CB    1 
ATOM   2761  O OG1   . THR A 1 359 ? -13.152 36.361  19.960  1.00 20.39  ? 359  THR A OG1   1 
ATOM   2762  C CG2   . THR A 1 359 ? -13.406 38.613  19.136  1.00 20.05  ? 359  THR A CG2   1 
ATOM   2763  N N     . ALA A 1 360 ? -12.795 37.506  15.585  1.00 17.65  ? 360  ALA A N     1 
ATOM   2764  C CA    . ALA A 1 360 ? -12.765 38.310  14.364  1.00 17.70  ? 360  ALA A CA    1 
ATOM   2765  C C     . ALA A 1 360 ? -13.895 37.908  13.404  1.00 17.51  ? 360  ALA A C     1 
ATOM   2766  O O     . ALA A 1 360 ? -14.602 38.766  12.881  1.00 17.05  ? 360  ALA A O     1 
ATOM   2767  C CB    . ALA A 1 360 ? -11.405 38.206  13.675  1.00 17.78  ? 360  ALA A CB    1 
ATOM   2768  N N     . ILE A 1 361 ? -14.077 36.603  13.201  1.00 17.73  ? 361  ILE A N     1 
ATOM   2769  C CA    . ILE A 1 361 ? -15.149 36.094  12.327  1.00 17.71  ? 361  ILE A CA    1 
ATOM   2770  C C     . ILE A 1 361 ? -16.532 36.576  12.793  1.00 18.28  ? 361  ILE A C     1 
ATOM   2771  O O     . ILE A 1 361 ? -17.352 37.008  11.977  1.00 18.24  ? 361  ILE A O     1 
ATOM   2772  C CB    . ILE A 1 361 ? -15.119 34.555  12.220  1.00 17.28  ? 361  ILE A CB    1 
ATOM   2773  C CG1   . ILE A 1 361 ? -13.794 34.085  11.597  1.00 16.65  ? 361  ILE A CG1   1 
ATOM   2774  C CG2   . ILE A 1 361 ? -16.304 34.042  11.396  1.00 18.17  ? 361  ILE A CG2   1 
ATOM   2775  C CD1   . ILE A 1 361 ? -13.492 32.596  11.815  1.00 17.81  ? 361  ILE A CD1   1 
ATOM   2776  N N     . ARG A 1 362 ? -16.783 36.520  14.100  1.00 18.56  ? 362  ARG A N     1 
ATOM   2777  C CA    . ARG A 1 362 ? -18.069 36.980  14.648  1.00 19.58  ? 362  ARG A CA    1 
ATOM   2778  C C     . ARG A 1 362 ? -18.287 38.484  14.437  1.00 19.41  ? 362  ARG A C     1 
ATOM   2779  O O     . ARG A 1 362 ? -19.390 38.920  14.085  1.00 18.44  ? 362  ARG A O     1 
ATOM   2780  C CB    . ARG A 1 362 ? -18.169 36.653  16.144  1.00 19.59  ? 362  ARG A CB    1 
ATOM   2781  C CG    . ARG A 1 362 ? -18.389 35.168  16.457  1.00 19.91  ? 362  ARG A CG    1 
ATOM   2782  C CD    . ARG A 1 362 ? -18.762 34.962  17.919  1.00 20.48  ? 362  ARG A CD    1 
ATOM   2783  N NE    . ARG A 1 362 ? -17.790 35.589  18.837  1.00 24.97  ? 362  ARG A NE    1 
ATOM   2784  C CZ    . ARG A 1 362 ? -16.736 34.954  19.346  1.00 24.94  ? 362  ARG A CZ    1 
ATOM   2785  N NH1   . ARG A 1 362 ? -16.534 33.686  19.033  1.00 23.08  ? 362  ARG A NH1   1 
ATOM   2786  N NH2   . ARG A 1 362 ? -15.896 35.577  20.174  1.00 25.05  ? 362  ARG A NH2   1 
ATOM   2787  N N     . ALA A 1 363 ? -17.224 39.261  14.664  1.00 19.63  ? 363  ALA A N     1 
ATOM   2788  C CA    . ALA A 1 363 ? -17.224 40.699  14.425  1.00 19.98  ? 363  ALA A CA    1 
ATOM   2789  C C     . ALA A 1 363 ? -17.533 41.064  12.952  1.00 20.20  ? 363  ALA A C     1 
ATOM   2790  O O     . ALA A 1 363 ? -18.285 41.997  12.683  1.00 19.52  ? 363  ALA A O     1 
ATOM   2791  C CB    . ALA A 1 363 ? -15.878 41.305  14.868  1.00 20.13  ? 363  ALA A CB    1 
ATOM   2792  N N     . LEU A 1 364 ? -16.961 40.323  12.009  1.00 20.28  ? 364  LEU A N     1 
ATOM   2793  C CA    . LEU A 1 364 ? -17.234 40.570  10.592  1.00 20.48  ? 364  LEU A CA    1 
ATOM   2794  C C     . LEU A 1 364 ? -18.624 40.088  10.180  1.00 20.45  ? 364  LEU A C     1 
ATOM   2795  O O     . LEU A 1 364 ? -19.266 40.703  9.332   1.00 20.13  ? 364  LEU A O     1 
ATOM   2796  C CB    . LEU A 1 364 ? -16.192 39.898  9.716   1.00 20.50  ? 364  LEU A CB    1 
ATOM   2797  C CG    . LEU A 1 364 ? -14.725 40.310  9.873   1.00 21.88  ? 364  LEU A CG    1 
ATOM   2798  C CD1   . LEU A 1 364 ? -13.927 39.523  8.877   1.00 23.49  ? 364  LEU A CD1   1 
ATOM   2799  C CD2   . LEU A 1 364 ? -14.519 41.799  9.647   1.00 23.77  ? 364  LEU A CD2   1 
ATOM   2800  N N     . MET A 1 365 ? -19.068 38.982  10.783  1.00 20.27  ? 365  MET A N     1 
ATOM   2801  C CA    . MET A 1 365 ? -20.376 38.393  10.502  1.00 20.99  ? 365  MET A CA    1 
ATOM   2802  C C     . MET A 1 365 ? -21.507 39.328  10.938  1.00 19.80  ? 365  MET A C     1 
ATOM   2803  O O     . MET A 1 365 ? -22.550 39.402  10.282  1.00 19.12  ? 365  MET A O     1 
ATOM   2804  C CB    . MET A 1 365 ? -20.526 37.017  11.190  1.00 20.59  ? 365  MET A CB    1 
ATOM   2805  C CG    . MET A 1 365 ? -21.844 36.283  10.846  1.00 22.87  ? 365  MET A CG    1 
ATOM   2806  S SD    . MET A 1 365 ? -22.017 34.629  11.578  1.00 24.37  ? 365  MET A SD    1 
ATOM   2807  C CE    . MET A 1 365 ? -21.241 34.907  13.163  1.00 25.25  ? 365  MET A CE    1 
ATOM   2808  N N     . ALA A 1 366 ? -21.285 40.034  12.048  1.00 19.21  ? 366  ALA A N     1 
ATOM   2809  C CA    . ALA A 1 366 ? -22.245 41.011  12.566  1.00 18.87  ? 366  ALA A CA    1 
ATOM   2810  C C     . ALA A 1 366 ? -22.505 42.127  11.546  1.00 18.61  ? 366  ALA A C     1 
ATOM   2811  O O     . ALA A 1 366 ? -23.589 42.712  11.524  1.00 17.67  ? 366  ALA A O     1 
ATOM   2812  C CB    . ALA A 1 366 ? -21.766 41.588  13.915  1.00 18.33  ? 366  ALA A CB    1 
ATOM   2813  N N     . GLU A 1 367 ? -21.514 42.391  10.692  1.00 18.34  ? 367  GLU A N     1 
ATOM   2814  C CA    . GLU A 1 367 ? -21.650 43.399  9.632   1.00 18.76  ? 367  GLU A CA    1 
ATOM   2815  C C     . GLU A 1 367 ? -22.164 42.820  8.302   1.00 18.41  ? 367  GLU A C     1 
ATOM   2816  O O     . GLU A 1 367 ? -22.387 43.569  7.337   1.00 18.58  ? 367  GLU A O     1 
ATOM   2817  C CB    . GLU A 1 367 ? -20.325 44.161  9.424   1.00 19.11  ? 367  GLU A CB    1 
ATOM   2818  C CG    . GLU A 1 367 ? -19.713 44.710  10.720  1.00 22.33  ? 367  GLU A CG    1 
ATOM   2819  C CD    . GLU A 1 367 ? -20.705 45.550  11.526  1.00 27.95  ? 367  GLU A CD    1 
ATOM   2820  O OE1   . GLU A 1 367 ? -21.399 46.389  10.910  1.00 28.53  ? 367  GLU A OE1   1 
ATOM   2821  O OE2   . GLU A 1 367 ? -20.807 45.361  12.770  1.00 30.44  ? 367  GLU A OE2   1 
ATOM   2822  N N     . GLY A 1 368 ? -22.360 41.503  8.249   1.00 18.13  ? 368  GLY A N     1 
ATOM   2823  C CA    . GLY A 1 368 ? -22.922 40.852  7.056   1.00 17.83  ? 368  GLY A CA    1 
ATOM   2824  C C     . GLY A 1 368 ? -22.120 41.150  5.791   1.00 17.65  ? 368  GLY A C     1 
ATOM   2825  O O     . GLY A 1 368 ? -20.899 41.070  5.804   1.00 16.74  ? 368  GLY A O     1 
ATOM   2826  N N     . ASP A 1 369 ? -22.799 41.503  4.701   1.00 17.48  ? 369  ASP A N     1 
ATOM   2827  C CA    . ASP A 1 369 ? -22.102 41.683  3.416   1.00 17.98  ? 369  ASP A CA    1 
ATOM   2828  C C     . ASP A 1 369 ? -21.142 42.891  3.347   1.00 18.03  ? 369  ASP A C     1 
ATOM   2829  O O     . ASP A 1 369 ? -20.369 43.008  2.390   1.00 17.68  ? 369  ASP A O     1 
ATOM   2830  C CB    . ASP A 1 369 ? -23.077 41.657  2.239   1.00 17.96  ? 369  ASP A CB    1 
ATOM   2831  C CG    . ASP A 1 369 ? -23.544 40.246  1.896   1.00 19.04  ? 369  ASP A CG    1 
ATOM   2832  O OD1   . ASP A 1 369 ? -23.062 39.270  2.512   1.00 21.40  ? 369  ASP A OD1   1 
ATOM   2833  O OD2   . ASP A 1 369 ? -24.407 40.105  1.005   1.00 20.83  ? 369  ASP A OD2   1 
ATOM   2834  N N     . LYS A 1 370 ? -21.185 43.767  4.362   1.00 17.76  ? 370  LYS A N     1 
ATOM   2835  C CA    . LYS A 1 370 ? -20.210 44.859  4.498   1.00 18.30  ? 370  LYS A CA    1 
ATOM   2836  C C     . LYS A 1 370 ? -18.788 44.352  4.714   1.00 18.49  ? 370  LYS A C     1 
ATOM   2837  O O     . LYS A 1 370 ? -17.817 45.078  4.443   1.00 18.73  ? 370  LYS A O     1 
ATOM   2838  C CB    . LYS A 1 370 ? -20.605 45.843  5.621   1.00 18.45  ? 370  LYS A CB    1 
ATOM   2839  N N     . ALA A 1 371 ? -18.669 43.108  5.185   1.00 18.01  ? 371  ALA A N     1 
ATOM   2840  C CA    . ALA A 1 371 ? -17.365 42.462  5.353   1.00 18.57  ? 371  ALA A CA    1 
ATOM   2841  C C     . ALA A 1 371 ? -16.729 42.002  4.028   1.00 18.53  ? 371  ALA A C     1 
ATOM   2842  O O     . ALA A 1 371 ? -15.514 41.817  3.952   1.00 18.18  ? 371  ALA A O     1 
ATOM   2843  C CB    . ALA A 1 371 ? -17.464 41.279  6.353   1.00 18.31  ? 371  ALA A CB    1 
ATOM   2844  N N     . ILE A 1 372 ? -17.543 41.834  2.989   1.00 18.88  ? 372  ILE A N     1 
ATOM   2845  C CA    . ILE A 1 372 ? -17.028 41.375  1.697   1.00 19.42  ? 372  ILE A CA    1 
ATOM   2846  C C     . ILE A 1 372 ? -17.240 42.364  0.541   1.00 19.97  ? 372  ILE A C     1 
ATOM   2847  O O     . ILE A 1 372 ? -16.722 42.150  -0.561  1.00 19.97  ? 372  ILE A O     1 
ATOM   2848  C CB    . ILE A 1 372 ? -17.552 39.951  1.327   1.00 19.29  ? 372  ILE A CB    1 
ATOM   2849  C CG1   . ILE A 1 372 ? -19.083 39.931  1.191   1.00 19.15  ? 372  ILE A CG1   1 
ATOM   2850  C CG2   . ILE A 1 372 ? -17.085 38.937  2.366   1.00 19.25  ? 372  ILE A CG2   1 
ATOM   2851  C CD1   . ILE A 1 372 ? -19.623 38.716  0.403   1.00 18.52  ? 372  ILE A CD1   1 
ATOM   2852  N N     . GLU A 1 373 ? -17.976 43.446  0.801   1.00 20.40  ? 373  GLU A N     1 
ATOM   2853  C CA    . GLU A 1 373 ? -18.364 44.394  -0.243  1.00 21.36  ? 373  GLU A CA    1 
ATOM   2854  C C     . GLU A 1 373 ? -17.168 44.937  -1.031  1.00 20.45  ? 373  GLU A C     1 
ATOM   2855  O O     . GLU A 1 373 ? -16.205 45.428  -0.446  1.00 20.09  ? 373  GLU A O     1 
ATOM   2856  C CB    . GLU A 1 373 ? -19.200 45.526  0.360   1.00 21.59  ? 373  GLU A CB    1 
ATOM   2857  C CG    . GLU A 1 373 ? -19.598 46.618  -0.598  1.00 23.57  ? 373  GLU A CG    1 
ATOM   2858  C CD    . GLU A 1 373 ? -20.395 47.732  0.078   1.00 24.41  ? 373  GLU A CD    1 
ATOM   2859  O OE1   . GLU A 1 373 ? -21.578 47.501  0.409   1.00 27.83  ? 373  GLU A OE1   1 
ATOM   2860  O OE2   . GLU A 1 373 ? -19.843 48.847  0.259   1.00 28.70  ? 373  GLU A OE2   1 
ATOM   2861  N N     . GLY A 1 374 ? -17.234 44.809  -2.359  1.00 20.45  ? 374  GLY A N     1 
ATOM   2862  C CA    . GLY A 1 374 ? -16.195 45.328  -3.265  1.00 19.86  ? 374  GLY A CA    1 
ATOM   2863  C C     . GLY A 1 374 ? -14.924 44.491  -3.252  1.00 19.67  ? 374  GLY A C     1 
ATOM   2864  O O     . GLY A 1 374 ? -13.895 44.913  -3.784  1.00 19.44  ? 374  GLY A O     1 
ATOM   2865  N N     . THR A 1 375 ? -14.986 43.314  -2.624  1.00 18.90  ? 375  THR A N     1 
ATOM   2866  C CA    . THR A 1 375 ? -13.835 42.416  -2.586  1.00 18.35  ? 375  THR A CA    1 
ATOM   2867  C C     . THR A 1 375 ? -14.093 41.184  -3.425  1.00 18.68  ? 375  THR A C     1 
ATOM   2868  O O     . THR A 1 375 ? -15.239 40.787  -3.645  1.00 17.56  ? 375  THR A O     1 
ATOM   2869  C CB    . THR A 1 375 ? -13.401 41.993  -1.144  1.00 18.34  ? 375  THR A CB    1 
ATOM   2870  O OG1   . THR A 1 375 ? -14.321 41.028  -0.611  1.00 15.53  ? 375  THR A OG1   1 
ATOM   2871  C CG2   . THR A 1 375 ? -13.287 43.209  -0.227  1.00 16.92  ? 375  THR A CG2   1 
ATOM   2872  N N     . ASP A 1 376 ? -13.004 40.580  -3.874  1.00 19.36  ? 376  ASP A N     1 
ATOM   2873  C CA    . ASP A 1 376 ? -13.067 39.453  -4.792  1.00 20.54  ? 376  ASP A CA    1 
ATOM   2874  C C     . ASP A 1 376 ? -12.931 38.133  -4.033  1.00 20.21  ? 376  ASP A C     1 
ATOM   2875  O O     . ASP A 1 376 ? -13.818 37.287  -4.105  1.00 20.55  ? 376  ASP A O     1 
ATOM   2876  C CB    . ASP A 1 376 ? -11.987 39.612  -5.874  1.00 20.97  ? 376  ASP A CB    1 
ATOM   2877  C CG    . ASP A 1 376 ? -12.018 38.503  -6.894  1.00 23.33  ? 376  ASP A CG    1 
ATOM   2878  O OD1   . ASP A 1 376 ? -11.585 37.383  -6.571  1.00 25.17  ? 376  ASP A OD1   1 
ATOM   2879  O OD2   . ASP A 1 376 ? -12.470 38.752  -8.029  1.00 28.24  ? 376  ASP A OD2   1 
ATOM   2880  N N     . ARG A 1 377 ? -11.822 37.981  -3.307  1.00 20.22  ? 377  ARG A N     1 
ATOM   2881  C CA    . ARG A 1 377 ? -11.527 36.806  -2.467  1.00 19.71  ? 377  ARG A CA    1 
ATOM   2882  C C     . ARG A 1 377 ? -11.161 35.511  -3.229  1.00 19.89  ? 377  ARG A C     1 
ATOM   2883  O O     . ARG A 1 377 ? -10.914 34.471  -2.594  1.00 20.03  ? 377  ARG A O     1 
ATOM   2884  C CB    . ARG A 1 377 ? -12.666 36.538  -1.454  1.00 19.91  ? 377  ARG A CB    1 
ATOM   2885  C CG    . ARG A 1 377 ? -12.885 37.630  -0.387  1.00 19.49  ? 377  ARG A CG    1 
ATOM   2886  C CD    . ARG A 1 377 ? -14.372 37.768  0.022   1.00 19.57  ? 377  ARG A CD    1 
ATOM   2887  N NE    . ARG A 1 377 ? -15.173 38.398  -1.046  1.00 21.04  ? 377  ARG A NE    1 
ATOM   2888  C CZ    . ARG A 1 377 ? -16.305 37.901  -1.539  1.00 21.20  ? 377  ARG A CZ    1 
ATOM   2889  N NH1   . ARG A 1 377 ? -16.811 36.766  -1.064  1.00 20.08  ? 377  ARG A NH1   1 
ATOM   2890  N NH2   . ARG A 1 377 ? -16.940 38.545  -2.508  1.00 21.66  ? 377  ARG A NH2   1 
ATOM   2891  N N     . SER A 1 378 ? -11.100 35.563  -4.563  1.00 19.21  ? 378  SER A N     1 
ATOM   2892  C CA    . SER A 1 378 ? -10.864 34.347  -5.378  1.00 19.27  ? 378  SER A CA    1 
ATOM   2893  C C     . SER A 1 378 ? -9.496  33.687  -5.184  1.00 18.56  ? 378  SER A C     1 
ATOM   2894  O O     . SER A 1 378 ? -9.329  32.512  -5.517  1.00 18.30  ? 378  SER A O     1 
ATOM   2895  C CB    . SER A 1 378 ? -11.075 34.604  -6.887  1.00 19.29  ? 378  SER A CB    1 
ATOM   2896  O OG    . SER A 1 378 ? -12.347 35.182  -7.149  1.00 21.20  ? 378  SER A OG    1 
ATOM   2897  N N     . SER A 1 379 ? -8.519  34.424  -4.663  1.00 17.80  ? 379  SER A N     1 
ATOM   2898  C CA    . SER A 1 379 ? -7.183  33.842  -4.460  1.00 17.31  ? 379  SER A CA    1 
ATOM   2899  C C     . SER A 1 379 ? -7.148  32.813  -3.316  1.00 17.35  ? 379  SER A C     1 
ATOM   2900  O O     . SER A 1 379 ? -6.227  31.990  -3.254  1.00 17.18  ? 379  SER A O     1 
ATOM   2901  C CB    . SER A 1 379 ? -6.115  34.926  -4.248  1.00 17.24  ? 379  SER A CB    1 
ATOM   2902  O OG    . SER A 1 379 ? -6.384  35.696  -3.078  1.00 17.19  ? 379  SER A OG    1 
ATOM   2903  N N     . LEU A 1 380 ? -8.149  32.847  -2.427  1.00 16.92  ? 380  LEU A N     1 
ATOM   2904  C CA    . LEU A 1 380 ? -8.165  31.953  -1.253  1.00 17.01  ? 380  LEU A CA    1 
ATOM   2905  C C     . LEU A 1 380 ? -8.400  30.503  -1.647  1.00 17.22  ? 380  LEU A C     1 
ATOM   2906  O O     . LEU A 1 380 ? -9.257  30.216  -2.482  1.00 17.11  ? 380  LEU A O     1 
ATOM   2907  C CB    . LEU A 1 380 ? -9.224  32.383  -0.218  1.00 16.42  ? 380  LEU A CB    1 
ATOM   2908  C CG    . LEU A 1 380 ? -8.968  33.669  0.588   1.00 16.84  ? 380  LEU A CG    1 
ATOM   2909  C CD1   . LEU A 1 380 ? -10.211 34.096  1.343   1.00 15.95  ? 380  LEU A CD1   1 
ATOM   2910  C CD2   . LEU A 1 380 ? -7.784  33.559  1.548   1.00 15.34  ? 380  LEU A CD2   1 
ATOM   2911  N N     . ARG A 1 381 ? -7.630  29.597  -1.042  1.00 17.71  ? 381  ARG A N     1 
ATOM   2912  C CA    . ARG A 1 381 ? -7.822  28.154  -1.223  1.00 17.98  ? 381  ARG A CA    1 
ATOM   2913  C C     . ARG A 1 381 ? -8.116  27.430  0.100   1.00 17.64  ? 381  ARG A C     1 
ATOM   2914  O O     . ARG A 1 381 ? -8.773  26.393  0.113   1.00 17.06  ? 381  ARG A O     1 
ATOM   2915  C CB    . ARG A 1 381 ? -6.605  27.526  -1.904  1.00 17.91  ? 381  ARG A CB    1 
ATOM   2916  C CG    . ARG A 1 381 ? -6.580  27.745  -3.421  1.00 19.41  ? 381  ARG A CG    1 
ATOM   2917  C CD    . ARG A 1 381 ? -5.405  27.034  -4.089  1.00 19.31  ? 381  ARG A CD    1 
ATOM   2918  N NE    . ARG A 1 381 ? -4.106  27.626  -3.752  1.00 21.13  ? 381  ARG A NE    1 
ATOM   2919  C CZ    . ARG A 1 381 ? -3.450  28.502  -4.512  1.00 22.63  ? 381  ARG A CZ    1 
ATOM   2920  N NH1   . ARG A 1 381 ? -3.957  28.921  -5.670  1.00 20.90  ? 381  ARG A NH1   1 
ATOM   2921  N NH2   . ARG A 1 381 ? -2.276  28.957  -4.110  1.00 24.31  ? 381  ARG A NH2   1 
ATOM   2922  N N     . ILE A 1 382 ? -7.625  27.992  1.207   1.00 17.53  ? 382  ILE A N     1 
ATOM   2923  C CA    . ILE A 1 382 ? -7.713  27.351  2.526   1.00 17.47  ? 382  ILE A CA    1 
ATOM   2924  C C     . ILE A 1 382 ? -8.055  28.413  3.565   1.00 17.37  ? 382  ILE A C     1 
ATOM   2925  O O     . ILE A 1 382 ? -7.508  29.519  3.540   1.00 17.38  ? 382  ILE A O     1 
ATOM   2926  C CB    . ILE A 1 382 ? -6.364  26.670  2.932   1.00 17.42  ? 382  ILE A CB    1 
ATOM   2927  C CG1   . ILE A 1 382 ? -5.913  25.624  1.894   1.00 17.36  ? 382  ILE A CG1   1 
ATOM   2928  C CG2   . ILE A 1 382 ? -6.436  26.074  4.346   1.00 17.68  ? 382  ILE A CG2   1 
ATOM   2929  C CD1   . ILE A 1 382 ? -6.693  24.292  1.940   1.00 15.79  ? 382  ILE A CD1   1 
ATOM   2930  N N     . LEU A 1 383 ? -8.987  28.075  4.448   1.00 17.57  ? 383  LEU A N     1 
ATOM   2931  C CA    . LEU A 1 383 ? -9.318  28.908  5.596   1.00 17.62  ? 383  LEU A CA    1 
ATOM   2932  C C     . LEU A 1 383 ? -8.978  28.158  6.873   1.00 17.63  ? 383  LEU A C     1 
ATOM   2933  O O     . LEU A 1 383 ? -8.955  26.920  6.894   1.00 18.00  ? 383  LEU A O     1 
ATOM   2934  C CB    . LEU A 1 383 ? -10.801 29.292  5.586   1.00 17.70  ? 383  LEU A CB    1 
ATOM   2935  C CG    . LEU A 1 383 ? -11.316 30.167  4.438   1.00 17.83  ? 383  LEU A CG    1 
ATOM   2936  C CD1   . LEU A 1 383 ? -12.829 30.378  4.585   1.00 15.45  ? 383  LEU A CD1   1 
ATOM   2937  C CD2   . LEU A 1 383 ? -10.591 31.518  4.404   1.00 17.38  ? 383  LEU A CD2   1 
ATOM   2938  N N     . GLY A 1 384 ? -8.696  28.909  7.932   1.00 17.75  ? 384  GLY A N     1 
ATOM   2939  C CA    . GLY A 1 384 ? -8.393  28.335  9.236   1.00 17.30  ? 384  GLY A CA    1 
ATOM   2940  C C     . GLY A 1 384 ? -8.987  29.153  10.363  1.00 17.53  ? 384  GLY A C     1 
ATOM   2941  O O     . GLY A 1 384 ? -9.220  30.355  10.214  1.00 16.80  ? 384  GLY A O     1 
ATOM   2942  N N     . SER A 1 385 ? -9.228  28.495  11.494  1.00 17.71  ? 385  SER A N     1 
ATOM   2943  C CA    . SER A 1 385 ? -9.790  29.136  12.685  1.00 18.46  ? 385  SER A CA    1 
ATOM   2944  C C     . SER A 1 385 ? -9.083  28.612  13.942  1.00 18.79  ? 385  SER A C     1 
ATOM   2945  O O     . SER A 1 385 ? -8.781  27.422  14.044  1.00 18.64  ? 385  SER A O     1 
ATOM   2946  C CB    . SER A 1 385 ? -11.299 28.855  12.766  1.00 18.90  ? 385  SER A CB    1 
ATOM   2947  O OG    . SER A 1 385 ? -11.848 29.376  13.972  1.00 19.82  ? 385  SER A OG    1 
ATOM   2948  N N     . VAL A 1 386 ? -8.814  29.500  14.893  1.00 19.24  ? 386  VAL A N     1 
ATOM   2949  C CA    . VAL A 1 386 ? -8.066  29.132  16.090  1.00 19.23  ? 386  VAL A CA    1 
ATOM   2950  C C     . VAL A 1 386 ? -8.481  29.933  17.328  1.00 19.77  ? 386  VAL A C     1 
ATOM   2951  O O     . VAL A 1 386 ? -8.864  31.092  17.221  1.00 19.19  ? 386  VAL A O     1 
ATOM   2952  C CB    . VAL A 1 386 ? -6.518  29.308  15.847  1.00 19.40  ? 386  VAL A CB    1 
ATOM   2953  C CG1   . VAL A 1 386 ? -6.150  30.787  15.512  1.00 18.46  ? 386  VAL A CG1   1 
ATOM   2954  C CG2   . VAL A 1 386 ? -5.710  28.804  17.037  1.00 18.33  ? 386  VAL A CG2   1 
ATOM   2955  N N     . GLY A 1 387 ? -8.377  29.308  18.502  1.00 20.74  ? 387  GLY A N     1 
ATOM   2956  C CA    . GLY A 1 387 ? -8.272  30.049  19.771  1.00 21.05  ? 387  GLY A CA    1 
ATOM   2957  C C     . GLY A 1 387 ? -9.463  29.946  20.706  1.00 21.95  ? 387  GLY A C     1 
ATOM   2958  O O     . GLY A 1 387 ? -9.366  30.267  21.904  1.00 21.53  ? 387  GLY A O     1 
ATOM   2959  N N     . GLU A 1 388 ? -10.597 29.531  20.150  1.00 22.37  ? 388  GLU A N     1 
ATOM   2960  C CA    . GLU A 1 388 ? -11.854 29.496  20.879  1.00 23.62  ? 388  GLU A CA    1 
ATOM   2961  C C     . GLU A 1 388 ? -12.801 28.607  20.107  1.00 23.59  ? 388  GLU A C     1 
ATOM   2962  O O     . GLU A 1 388 ? -12.597 28.378  18.906  1.00 23.56  ? 388  GLU A O     1 
ATOM   2963  C CB    . GLU A 1 388 ? -12.457 30.915  21.041  1.00 23.82  ? 388  GLU A CB    1 
ATOM   2964  C CG    . GLU A 1 388 ? -12.054 31.843  19.934  1.00 25.11  ? 388  GLU A CG    1 
ATOM   2965  C CD    . GLU A 1 388 ? -12.594 33.256  20.040  1.00 24.63  ? 388  GLU A CD    1 
ATOM   2966  O OE1   . GLU A 1 388 ? -13.705 33.444  20.597  1.00 26.76  ? 388  GLU A OE1   1 
ATOM   2967  O OE2   . GLU A 1 388 ? -11.910 34.165  19.497  1.00 22.84  ? 388  GLU A OE2   1 
ATOM   2968  N N     . PRO A 1 389 ? -13.835 28.084  20.788  1.00 23.68  ? 389  PRO A N     1 
ATOM   2969  C CA    . PRO A 1 389 ? -14.821 27.283  20.056  1.00 23.80  ? 389  PRO A CA    1 
ATOM   2970  C C     . PRO A 1 389 ? -15.454 28.136  18.971  1.00 23.75  ? 389  PRO A C     1 
ATOM   2971  O O     . PRO A 1 389 ? -15.629 29.335  19.162  1.00 24.07  ? 389  PRO A O     1 
ATOM   2972  C CB    . PRO A 1 389 ? -15.851 26.913  21.138  1.00 23.77  ? 389  PRO A CB    1 
ATOM   2973  C CG    . PRO A 1 389 ? -15.094 27.017  22.438  1.00 23.83  ? 389  PRO A CG    1 
ATOM   2974  C CD    . PRO A 1 389 ? -14.137 28.161  22.230  1.00 23.31  ? 389  PRO A CD    1 
ATOM   2975  N N     . ILE A 1 390 ? -15.747 27.537  17.826  1.00 23.50  ? 390  ILE A N     1 
ATOM   2976  C CA    . ILE A 1 390 ? -16.475 28.249  16.778  1.00 23.89  ? 390  ILE A CA    1 
ATOM   2977  C C     . ILE A 1 390 ? -17.862 27.620  16.650  1.00 23.68  ? 390  ILE A C     1 
ATOM   2978  O O     . ILE A 1 390 ? -17.984 26.419  16.414  1.00 23.84  ? 390  ILE A O     1 
ATOM   2979  C CB    . ILE A 1 390 ? -15.680 28.298  15.435  1.00 23.64  ? 390  ILE A CB    1 
ATOM   2980  C CG1   . ILE A 1 390 ? -16.412 29.190  14.413  1.00 24.86  ? 390  ILE A CG1   1 
ATOM   2981  C CG2   . ILE A 1 390 ? -15.387 26.882  14.922  1.00 23.96  ? 390  ILE A CG2   1 
ATOM   2982  C CD1   . ILE A 1 390 ? -15.610 29.592  13.180  1.00 23.53  ? 390  ILE A CD1   1 
ATOM   2983  N N     . ASN A 1 391 ? -18.910 28.402  16.867  1.00 23.96  ? 391  ASN A N     1 
ATOM   2984  C CA    . ASN A 1 391 ? -20.247 27.851  16.669  1.00 24.58  ? 391  ASN A CA    1 
ATOM   2985  C C     . ASN A 1 391 ? -20.487 27.562  15.181  1.00 23.88  ? 391  ASN A C     1 
ATOM   2986  O O     . ASN A 1 391 ? -19.961 28.277  14.320  1.00 24.03  ? 391  ASN A O     1 
ATOM   2987  C CB    . ASN A 1 391 ? -21.339 28.734  17.287  1.00 25.53  ? 391  ASN A CB    1 
ATOM   2988  C CG    . ASN A 1 391 ? -22.240 29.366  16.248  1.00 28.13  ? 391  ASN A CG    1 
ATOM   2989  O OD1   . ASN A 1 391 ? -21.898 30.403  15.674  1.00 31.97  ? 391  ASN A OD1   1 
ATOM   2990  N ND2   . ASN A 1 391 ? -23.388 28.738  15.986  1.00 28.12  ? 391  ASN A ND2   1 
ATOM   2991  N N     . PRO A 1 392 ? -21.240 26.484  14.873  1.00 23.46  ? 392  PRO A N     1 
ATOM   2992  C CA    . PRO A 1 392 ? -21.541 26.081  13.495  1.00 22.55  ? 392  PRO A CA    1 
ATOM   2993  C C     . PRO A 1 392 ? -21.956 27.207  12.533  1.00 22.11  ? 392  PRO A C     1 
ATOM   2994  O O     . PRO A 1 392 ? -21.523 27.201  11.378  1.00 21.75  ? 392  PRO A O     1 
ATOM   2995  C CB    . PRO A 1 392 ? -22.696 25.086  13.666  1.00 22.34  ? 392  PRO A CB    1 
ATOM   2996  C CG    . PRO A 1 392 ? -22.431 24.454  14.975  1.00 23.40  ? 392  PRO A CG    1 
ATOM   2997  C CD    . PRO A 1 392 ? -21.840 25.553  15.852  1.00 23.33  ? 392  PRO A CD    1 
ATOM   2998  N N     . GLU A 1 393 ? -22.810 28.122  12.989  1.00 21.70  ? 393  GLU A N     1 
ATOM   2999  C CA    . GLU A 1 393 ? -23.341 29.224  12.159  1.00 22.15  ? 393  GLU A CA    1 
ATOM   3000  C C     . GLU A 1 393 ? -22.248 30.201  11.729  1.00 20.99  ? 393  GLU A C     1 
ATOM   3001  O O     . GLU A 1 393 ? -22.231 30.667  10.594  1.00 21.29  ? 393  GLU A O     1 
ATOM   3002  C CB    . GLU A 1 393 ? -24.464 29.982  12.896  1.00 22.19  ? 393  GLU A CB    1 
ATOM   3003  C CG    . GLU A 1 393 ? -25.739 29.144  13.132  1.00 24.46  ? 393  GLU A CG    1 
ATOM   3004  C CD    . GLU A 1 393 ? -26.835 29.883  13.928  1.00 25.21  ? 393  GLU A CD    1 
ATOM   3005  O OE1   . GLU A 1 393 ? -26.532 30.837  14.692  1.00 29.92  ? 393  GLU A OE1   1 
ATOM   3006  O OE2   . GLU A 1 393 ? -28.011 29.484  13.796  1.00 29.84  ? 393  GLU A OE2   1 
ATOM   3007  N N     . ALA A 1 394 ? -21.325 30.497  12.633  1.00 20.22  ? 394  ALA A N     1 
ATOM   3008  C CA    . ALA A 1 394 ? -20.192 31.368  12.310  1.00 19.46  ? 394  ALA A CA    1 
ATOM   3009  C C     . ALA A 1 394 ? -19.269 30.638  11.333  1.00 18.61  ? 394  ALA A C     1 
ATOM   3010  O O     . ALA A 1 394 ? -18.792 31.210  10.355  1.00 18.64  ? 394  ALA A O     1 
ATOM   3011  C CB    . ALA A 1 394 ? -19.444 31.748  13.582  1.00 19.44  ? 394  ALA A CB    1 
ATOM   3012  N N     . TRP A 1 395 ? -19.047 29.360  11.609  1.00 17.89  ? 395  TRP A N     1 
ATOM   3013  C CA    . TRP A 1 395 ? -18.282 28.478  10.738  1.00 17.27  ? 395  TRP A CA    1 
ATOM   3014  C C     . TRP A 1 395 ? -18.861 28.482  9.319   1.00 17.04  ? 395  TRP A C     1 
ATOM   3015  O O     . TRP A 1 395 ? -18.127 28.664  8.340   1.00 16.22  ? 395  TRP A O     1 
ATOM   3016  C CB    . TRP A 1 395 ? -18.284 27.065  11.329  1.00 16.81  ? 395  TRP A CB    1 
ATOM   3017  C CG    . TRP A 1 395 ? -17.306 26.112  10.703  1.00 17.12  ? 395  TRP A CG    1 
ATOM   3018  C CD1   . TRP A 1 395 ? -16.133 25.673  11.247  1.00 17.55  ? 395  TRP A CD1   1 
ATOM   3019  C CD2   . TRP A 1 395 ? -17.430 25.450  9.424   1.00 17.17  ? 395  TRP A CD2   1 
ATOM   3020  N NE1   . TRP A 1 395 ? -15.516 24.784  10.385  1.00 18.82  ? 395  TRP A NE1   1 
ATOM   3021  C CE2   . TRP A 1 395 ? -16.292 24.636  9.262   1.00 17.22  ? 395  TRP A CE2   1 
ATOM   3022  C CE3   . TRP A 1 395 ? -18.389 25.482  8.400   1.00 17.00  ? 395  TRP A CE3   1 
ATOM   3023  C CZ2   . TRP A 1 395 ? -16.089 23.845  8.123   1.00 16.62  ? 395  TRP A CZ2   1 
ATOM   3024  C CZ3   . TRP A 1 395 ? -18.185 24.701  7.265   1.00 17.64  ? 395  TRP A CZ3   1 
ATOM   3025  C CH2   . TRP A 1 395 ? -17.038 23.889  7.141   1.00 17.19  ? 395  TRP A CH2   1 
ATOM   3026  N N     . GLU A 1 396 ? -20.179 28.310  9.210   1.00 16.69  ? 396  GLU A N     1 
ATOM   3027  C CA    . GLU A 1 396 ? -20.824 28.302  7.897   1.00 17.08  ? 396  GLU A CA    1 
ATOM   3028  C C     . GLU A 1 396 ? -20.688 29.663  7.184   1.00 17.01  ? 396  GLU A C     1 
ATOM   3029  O O     . GLU A 1 396 ? -20.455 29.709  5.976   1.00 16.93  ? 396  GLU A O     1 
ATOM   3030  C CB    . GLU A 1 396 ? -22.290 27.864  7.995   1.00 16.84  ? 396  GLU A CB    1 
ATOM   3031  C CG    . GLU A 1 396 ? -22.497 26.361  8.315   1.00 19.97  ? 396  GLU A CG    1 
ATOM   3032  C CD    . GLU A 1 396 ? -22.091 25.425  7.180   1.00 22.43  ? 396  GLU A CD    1 
ATOM   3033  O OE1   . GLU A 1 396 ? -21.919 25.885  6.035   1.00 23.19  ? 396  GLU A OE1   1 
ATOM   3034  O OE2   . GLU A 1 396 ? -21.940 24.210  7.433   1.00 26.77  ? 396  GLU A OE2   1 
ATOM   3035  N N     . TRP A 1 397 ? -20.817 30.757  7.938   1.00 16.49  ? 397  TRP A N     1 
ATOM   3036  C CA    . TRP A 1 397 ? -20.722 32.107  7.367   1.00 16.57  ? 397  TRP A CA    1 
ATOM   3037  C C     . TRP A 1 397 ? -19.315 32.378  6.811   1.00 16.46  ? 397  TRP A C     1 
ATOM   3038  O O     . TRP A 1 397 ? -19.154 32.912  5.714   1.00 16.30  ? 397  TRP A O     1 
ATOM   3039  C CB    . TRP A 1 397 ? -21.104 33.160  8.419   1.00 16.49  ? 397  TRP A CB    1 
ATOM   3040  C CG    . TRP A 1 397 ? -21.126 34.547  7.878   1.00 16.58  ? 397  TRP A CG    1 
ATOM   3041  C CD1   . TRP A 1 397 ? -22.208 35.221  7.377   1.00 16.16  ? 397  TRP A CD1   1 
ATOM   3042  C CD2   . TRP A 1 397 ? -20.013 35.436  7.774   1.00 16.66  ? 397  TRP A CD2   1 
ATOM   3043  N NE1   . TRP A 1 397 ? -21.831 36.480  6.965   1.00 17.77  ? 397  TRP A NE1   1 
ATOM   3044  C CE2   . TRP A 1 397 ? -20.490 36.637  7.193   1.00 17.70  ? 397  TRP A CE2   1 
ATOM   3045  C CE3   . TRP A 1 397 ? -18.657 35.339  8.114   1.00 17.35  ? 397  TRP A CE3   1 
ATOM   3046  C CZ2   . TRP A 1 397 ? -19.655 37.732  6.943   1.00 17.36  ? 397  TRP A CZ2   1 
ATOM   3047  C CZ3   . TRP A 1 397 ? -17.822 36.429  7.863   1.00 17.22  ? 397  TRP A CZ3   1 
ATOM   3048  C CH2   . TRP A 1 397 ? -18.331 37.608  7.276   1.00 16.90  ? 397  TRP A CH2   1 
ATOM   3049  N N     . TYR A 1 398 ? -18.310 32.004  7.596   1.00 16.80  ? 398  TYR A N     1 
ATOM   3050  C CA    . TYR A 1 398 ? -16.898 32.079  7.225   1.00 16.70  ? 398  TYR A CA    1 
ATOM   3051  C C     . TYR A 1 398 ? -16.633 31.261  5.952   1.00 17.06  ? 398  TYR A C     1 
ATOM   3052  O O     . TYR A 1 398 ? -16.065 31.780  4.978   1.00 16.95  ? 398  TYR A O     1 
ATOM   3053  C CB    . TYR A 1 398 ? -16.077 31.562  8.416   1.00 16.50  ? 398  TYR A CB    1 
ATOM   3054  C CG    . TYR A 1 398 ? -14.562 31.653  8.348   1.00 16.79  ? 398  TYR A CG    1 
ATOM   3055  C CD1   . TYR A 1 398 ? -13.916 32.807  7.908   1.00 15.93  ? 398  TYR A CD1   1 
ATOM   3056  C CD2   . TYR A 1 398 ? -13.773 30.585  8.794   1.00 16.76  ? 398  TYR A CD2   1 
ATOM   3057  C CE1   . TYR A 1 398 ? -12.521 32.887  7.890   1.00 16.45  ? 398  TYR A CE1   1 
ATOM   3058  C CE2   . TYR A 1 398 ? -12.388 30.654  8.781   1.00 16.54  ? 398  TYR A CE2   1 
ATOM   3059  C CZ    . TYR A 1 398 ? -11.762 31.806  8.332   1.00 17.22  ? 398  TYR A CZ    1 
ATOM   3060  O OH    . TYR A 1 398 ? -10.378 31.878  8.323   1.00 15.67  ? 398  TYR A OH    1 
ATOM   3061  N N     . TRP A 1 399 ? -17.086 30.005  5.960   1.00 17.03  ? 399  TRP A N     1 
ATOM   3062  C CA    . TRP A 1 399 ? -16.966 29.093  4.833   1.00 17.70  ? 399  TRP A CA    1 
ATOM   3063  C C     . TRP A 1 399 ? -17.638 29.638  3.563   1.00 17.84  ? 399  TRP A C     1 
ATOM   3064  O O     . TRP A 1 399 ? -17.054 29.579  2.473   1.00 17.83  ? 399  TRP A O     1 
ATOM   3065  C CB    . TRP A 1 399 ? -17.555 27.721  5.224   1.00 18.39  ? 399  TRP A CB    1 
ATOM   3066  C CG    . TRP A 1 399 ? -17.498 26.672  4.161   1.00 18.59  ? 399  TRP A CG    1 
ATOM   3067  C CD1   . TRP A 1 399 ? -16.429 25.891  3.840   1.00 20.27  ? 399  TRP A CD1   1 
ATOM   3068  C CD2   . TRP A 1 399 ? -18.561 26.272  3.289   1.00 20.05  ? 399  TRP A CD2   1 
ATOM   3069  N NE1   . TRP A 1 399 ? -16.752 25.040  2.806   1.00 19.65  ? 399  TRP A NE1   1 
ATOM   3070  C CE2   . TRP A 1 399 ? -18.054 25.256  2.449   1.00 20.02  ? 399  TRP A CE2   1 
ATOM   3071  C CE3   . TRP A 1 399 ? -19.893 26.682  3.127   1.00 20.20  ? 399  TRP A CE3   1 
ATOM   3072  C CZ2   . TRP A 1 399 ? -18.836 24.630  1.465   1.00 20.46  ? 399  TRP A CZ2   1 
ATOM   3073  C CZ3   . TRP A 1 399 ? -20.667 26.066  2.149   1.00 20.56  ? 399  TRP A CZ3   1 
ATOM   3074  C CH2   . TRP A 1 399 ? -20.131 25.050  1.328   1.00 19.94  ? 399  TRP A CH2   1 
ATOM   3075  N N     . LYS A 1 400 ? -18.847 30.182  3.720   1.00 17.40  ? 400  LYS A N     1 
ATOM   3076  C CA    . LYS A 1 400 ? -19.643 30.683  2.598   1.00 17.34  ? 400  LYS A CA    1 
ATOM   3077  C C     . LYS A 1 400 ? -19.176 32.047  2.071   1.00 17.60  ? 400  LYS A C     1 
ATOM   3078  O O     . LYS A 1 400 ? -19.011 32.225  0.856   1.00 17.21  ? 400  LYS A O     1 
ATOM   3079  C CB    . LYS A 1 400 ? -21.139 30.730  2.970   1.00 17.46  ? 400  LYS A CB    1 
ATOM   3080  C CG    . LYS A 1 400 ? -22.025 31.477  1.950   1.00 17.46  ? 400  LYS A CG    1 
ATOM   3081  C CD    . LYS A 1 400 ? -23.502 31.465  2.352   1.00 17.08  ? 400  LYS A CD    1 
ATOM   3082  C CE    . LYS A 1 400 ? -24.372 32.061  1.240   1.00 18.19  ? 400  LYS A CE    1 
ATOM   3083  N NZ    . LYS A 1 400 ? -25.774 32.293  1.724   1.00 20.21  ? 400  LYS A NZ    1 
ATOM   3084  N N     . LYS A 1 401 ? -18.986 33.003  2.981   1.00 17.22  ? 401  LYS A N     1 
ATOM   3085  C CA    . LYS A 1 401 ? -18.760 34.398  2.604   1.00 16.83  ? 401  LYS A CA    1 
ATOM   3086  C C     . LYS A 1 401 ? -17.300 34.718  2.309   1.00 17.67  ? 401  LYS A C     1 
ATOM   3087  O O     . LYS A 1 401 ? -17.004 35.392  1.323   1.00 17.85  ? 401  LYS A O     1 
ATOM   3088  C CB    . LYS A 1 401 ? -19.308 35.355  3.673   1.00 16.57  ? 401  LYS A CB    1 
ATOM   3089  C CG    . LYS A 1 401 ? -20.817 35.278  3.870   1.00 16.06  ? 401  LYS A CG    1 
ATOM   3090  C CD    . LYS A 1 401 ? -21.555 35.781  2.619   1.00 15.77  ? 401  LYS A CD    1 
ATOM   3091  C CE    . LYS A 1 401 ? -23.054 35.726  2.776   1.00 13.33  ? 401  LYS A CE    1 
ATOM   3092  N NZ    . LYS A 1 401 ? -23.638 36.562  1.705   1.00 14.56  ? 401  LYS A NZ    1 
ATOM   3093  N N     . ILE A 1 402 ? -16.395 34.247  3.166   1.00 17.56  ? 402  ILE A N     1 
ATOM   3094  C CA    . ILE A 1 402 ? -14.972 34.481  2.967   1.00 17.93  ? 402  ILE A CA    1 
ATOM   3095  C C     . ILE A 1 402 ? -14.359 33.456  2.002   1.00 18.20  ? 402  ILE A C     1 
ATOM   3096  O O     . ILE A 1 402 ? -13.586 33.832  1.109   1.00 17.88  ? 402  ILE A O     1 
ATOM   3097  C CB    . ILE A 1 402 ? -14.184 34.500  4.301   1.00 17.77  ? 402  ILE A CB    1 
ATOM   3098  C CG1   . ILE A 1 402 ? -14.875 35.389  5.355   1.00 17.93  ? 402  ILE A CG1   1 
ATOM   3099  C CG2   . ILE A 1 402 ? -12.721 34.903  4.060   1.00 18.15  ? 402  ILE A CG2   1 
ATOM   3100  C CD1   . ILE A 1 402 ? -15.097 36.835  4.975   1.00 16.20  ? 402  ILE A CD1   1 
ATOM   3101  N N     . GLY A 1 403 ? -14.719 32.182  2.176   1.00 17.60  ? 403  GLY A N     1 
ATOM   3102  C CA    . GLY A 1 403 ? -14.192 31.106  1.346   1.00 18.30  ? 403  GLY A CA    1 
ATOM   3103  C C     . GLY A 1 403 ? -14.967 30.869  0.064   1.00 18.90  ? 403  GLY A C     1 
ATOM   3104  O O     . GLY A 1 403 ? -14.551 30.066  -0.762  1.00 19.00  ? 403  GLY A O     1 
ATOM   3105  N N     . LYS A 1 404 ? -16.095 31.566  -0.094  1.00 19.63  ? 404  LYS A N     1 
ATOM   3106  C CA    . LYS A 1 404 ? -16.980 31.441  -1.262  1.00 20.55  ? 404  LYS A CA    1 
ATOM   3107  C C     . LYS A 1 404 ? -17.422 29.996  -1.518  1.00 20.71  ? 404  LYS A C     1 
ATOM   3108  O O     . LYS A 1 404 ? -17.604 29.581  -2.667  1.00 20.29  ? 404  LYS A O     1 
ATOM   3109  C CB    . LYS A 1 404 ? -16.336 32.083  -2.506  1.00 20.66  ? 404  LYS A CB    1 
ATOM   3110  C CG    . LYS A 1 404 ? -16.100 33.605  -2.342  1.00 20.91  ? 404  LYS A CG    1 
ATOM   3111  C CD    . LYS A 1 404 ? -15.184 34.172  -3.422  1.00 21.92  ? 404  LYS A CD    1 
ATOM   3112  C CE    . LYS A 1 404 ? -15.890 34.306  -4.771  1.00 25.16  ? 404  LYS A CE    1 
ATOM   3113  N NZ    . LYS A 1 404 ? -14.927 34.727  -5.822  1.00 25.59  ? 404  LYS A NZ    1 
ATOM   3114  N N     . GLU A 1 405 ? -17.584 29.241  -0.428  1.00 20.99  ? 405  GLU A N     1 
ATOM   3115  C CA    . GLU A 1 405 ? -17.983 27.827  -0.464  1.00 21.83  ? 405  GLU A CA    1 
ATOM   3116  C C     . GLU A 1 405 ? -16.954 26.944  -1.165  1.00 21.83  ? 405  GLU A C     1 
ATOM   3117  O O     . GLU A 1 405 ? -17.251 25.803  -1.520  1.00 21.93  ? 405  GLU A O     1 
ATOM   3118  C CB    . GLU A 1 405 ? -19.377 27.660  -1.114  1.00 21.87  ? 405  GLU A CB    1 
ATOM   3119  C CG    . GLU A 1 405 ? -20.402 28.704  -0.638  1.00 22.41  ? 405  GLU A CG    1 
ATOM   3120  C CD    . GLU A 1 405 ? -21.816 28.449  -1.132  1.00 23.10  ? 405  GLU A CD    1 
ATOM   3121  O OE1   . GLU A 1 405 ? -22.617 29.399  -1.131  1.00 25.74  ? 405  GLU A OE1   1 
ATOM   3122  O OE2   . GLU A 1 405 ? -22.140 27.310  -1.521  1.00 25.21  ? 405  GLU A OE2   1 
ATOM   3123  N N     . LYS A 1 406 ? -15.742 27.464  -1.340  1.00 21.78  ? 406  LYS A N     1 
ATOM   3124  C CA    . LYS A 1 406 ? -14.699 26.762  -2.097  1.00 22.45  ? 406  LYS A CA    1 
ATOM   3125  C C     . LYS A 1 406 ? -13.536 26.285  -1.218  1.00 21.40  ? 406  LYS A C     1 
ATOM   3126  O O     . LYS A 1 406 ? -12.714 25.479  -1.652  1.00 21.76  ? 406  LYS A O     1 
ATOM   3127  C CB    . LYS A 1 406 ? -14.180 27.645  -3.254  1.00 22.66  ? 406  LYS A CB    1 
ATOM   3128  C CG    . LYS A 1 406 ? -15.203 27.911  -4.386  1.00 24.41  ? 406  LYS A CG    1 
ATOM   3129  C CD    . LYS A 1 406 ? -14.633 28.885  -5.446  1.00 24.64  ? 406  LYS A CD    1 
ATOM   3130  C CE    . LYS A 1 406 ? -15.417 28.808  -6.770  1.00 27.25  ? 406  LYS A CE    1 
ATOM   3131  N NZ    . LYS A 1 406 ? -15.085 29.898  -7.764  1.00 28.14  ? 406  LYS A NZ    1 
ATOM   3132  N N     . CYS A 1 407 ? -13.463 26.779  0.012   1.00 20.55  ? 407  CYS A N     1 
ATOM   3133  C CA    . CYS A 1 407 ? -12.289 26.527  0.857   1.00 19.80  ? 407  CYS A CA    1 
ATOM   3134  C C     . CYS A 1 407 ? -12.584 25.665  2.074   1.00 19.42  ? 407  CYS A C     1 
ATOM   3135  O O     . CYS A 1 407 ? -13.468 25.993  2.867   1.00 19.58  ? 407  CYS A O     1 
ATOM   3136  C CB    . CYS A 1 407 ? -11.657 27.849  1.320   1.00 19.25  ? 407  CYS A CB    1 
ATOM   3137  S SG    . CYS A 1 407 ? -11.255 28.986  0.001   1.00 19.57  ? 407  CYS A SG    1 
ATOM   3138  N N     . PRO A 1 408 ? -11.820 24.570  2.245   1.00 19.51  ? 408  PRO A N     1 
ATOM   3139  C CA    . PRO A 1 408 ? -11.834 23.849  3.521   1.00 19.35  ? 408  PRO A CA    1 
ATOM   3140  C C     . PRO A 1 408 ? -11.501 24.813  4.658   1.00 19.56  ? 408  PRO A C     1 
ATOM   3141  O O     . PRO A 1 408 ? -10.647 25.700  4.492   1.00 19.68  ? 408  PRO A O     1 
ATOM   3142  C CB    . PRO A 1 408 ? -10.690 22.839  3.365   1.00 19.01  ? 408  PRO A CB    1 
ATOM   3143  C CG    . PRO A 1 408 ? -10.583 22.620  1.901   1.00 18.63  ? 408  PRO A CG    1 
ATOM   3144  C CD    . PRO A 1 408 ? -10.892 23.949  1.274   1.00 18.98  ? 408  PRO A CD    1 
ATOM   3145  N N     . VAL A 1 409 ? -12.191 24.655  5.784   1.00 19.54  ? 409  VAL A N     1 
ATOM   3146  C CA    . VAL A 1 409 ? -11.886 25.398  7.004   1.00 19.08  ? 409  VAL A CA    1 
ATOM   3147  C C     . VAL A 1 409 ? -11.196 24.435  7.962   1.00 19.39  ? 409  VAL A C     1 
ATOM   3148  O O     . VAL A 1 409 ? -11.749 23.390  8.283   1.00 19.29  ? 409  VAL A O     1 
ATOM   3149  C CB    . VAL A 1 409 ? -13.172 25.962  7.678   1.00 19.44  ? 409  VAL A CB    1 
ATOM   3150  C CG1   . VAL A 1 409 ? -12.851 26.642  9.037   1.00 18.38  ? 409  VAL A CG1   1 
ATOM   3151  C CG2   . VAL A 1 409 ? -13.863 26.941  6.766   1.00 17.63  ? 409  VAL A CG2   1 
ATOM   3152  N N     . VAL A 1 410 ? -9.980  24.769  8.387   1.00 19.36  ? 410  VAL A N     1 
ATOM   3153  C CA    . VAL A 1 410 ? -9.291  23.964  9.393   1.00 19.22  ? 410  VAL A CA    1 
ATOM   3154  C C     . VAL A 1 410 ? -9.405  24.631  10.773  1.00 19.28  ? 410  VAL A C     1 
ATOM   3155  O O     . VAL A 1 410 ? -8.792  25.661  11.022  1.00 19.14  ? 410  VAL A O     1 
ATOM   3156  C CB    . VAL A 1 410 ? -7.802  23.626  9.006   1.00 19.42  ? 410  VAL A CB    1 
ATOM   3157  C CG1   . VAL A 1 410 ? -7.761  22.702  7.802   1.00 19.10  ? 410  VAL A CG1   1 
ATOM   3158  C CG2   . VAL A 1 410 ? -6.966  24.887  8.729   1.00 19.33  ? 410  VAL A CG2   1 
ATOM   3159  N N     . ASP A 1 411 ? -10.237 24.048  11.634  1.00 18.79  ? 411  ASP A N     1 
ATOM   3160  C CA    . ASP A 1 411 ? -10.422 24.491  13.004  1.00 19.03  ? 411  ASP A CA    1 
ATOM   3161  C C     . ASP A 1 411 ? -9.348  23.792  13.829  1.00 18.83  ? 411  ASP A C     1 
ATOM   3162  O O     . ASP A 1 411 ? -9.436  22.596  14.056  1.00 19.17  ? 411  ASP A O     1 
ATOM   3163  C CB    . ASP A 1 411 ? -11.834 24.074  13.454  1.00 18.69  ? 411  ASP A CB    1 
ATOM   3164  C CG    . ASP A 1 411 ? -12.175 24.483  14.898  1.00 19.71  ? 411  ASP A CG    1 
ATOM   3165  O OD1   . ASP A 1 411 ? -11.426 25.248  15.565  1.00 18.89  ? 411  ASP A OD1   1 
ATOM   3166  O OD2   . ASP A 1 411 ? -13.245 24.029  15.364  1.00 20.05  ? 411  ASP A OD2   1 
ATOM   3167  N N     . THR A 1 412 ? -8.325  24.531  14.249  1.00 18.53  ? 412  THR A N     1 
ATOM   3168  C CA    . THR A 1 412 ? -7.166  23.925  14.916  1.00 18.00  ? 412  THR A CA    1 
ATOM   3169  C C     . THR A 1 412 ? -7.237  24.091  16.438  1.00 17.94  ? 412  THR A C     1 
ATOM   3170  O O     . THR A 1 412 ? -7.081  25.204  16.943  1.00 17.35  ? 412  THR A O     1 
ATOM   3171  C CB    . THR A 1 412 ? -5.840  24.563  14.444  1.00 17.99  ? 412  THR A CB    1 
ATOM   3172  O OG1   . THR A 1 412 ? -5.859  25.958  14.770  1.00 17.60  ? 412  THR A OG1   1 
ATOM   3173  C CG2   . THR A 1 412 ? -5.619  24.382  12.930  1.00 16.48  ? 412  THR A CG2   1 
ATOM   3174  N N     . TRP A 1 413 ? -7.465  22.991  17.162  1.00 17.67  ? 413  TRP A N     1 
ATOM   3175  C CA    . TRP A 1 413 ? -7.352  23.033  18.623  1.00 17.20  ? 413  TRP A CA    1 
ATOM   3176  C C     . TRP A 1 413 ? -5.929  22.746  19.072  1.00 17.03  ? 413  TRP A C     1 
ATOM   3177  O O     . TRP A 1 413 ? -5.310  21.768  18.643  1.00 16.68  ? 413  TRP A O     1 
ATOM   3178  C CB    . TRP A 1 413 ? -8.331  22.090  19.349  1.00 17.15  ? 413  TRP A CB    1 
ATOM   3179  C CG    . TRP A 1 413 ? -8.079  22.112  20.852  1.00 17.53  ? 413  TRP A CG    1 
ATOM   3180  C CD1   . TRP A 1 413 ? -8.575  23.008  21.754  1.00 18.02  ? 413  TRP A CD1   1 
ATOM   3181  C CD2   . TRP A 1 413 ? -7.229  21.225  21.597  1.00 17.41  ? 413  TRP A CD2   1 
ATOM   3182  N NE1   . TRP A 1 413 ? -8.106  22.721  23.022  1.00 17.57  ? 413  TRP A NE1   1 
ATOM   3183  C CE2   . TRP A 1 413 ? -7.272  21.637  22.948  1.00 17.12  ? 413  TRP A CE2   1 
ATOM   3184  C CE3   . TRP A 1 413 ? -6.442  20.114  21.251  1.00 17.95  ? 413  TRP A CE3   1 
ATOM   3185  C CZ2   . TRP A 1 413 ? -6.555  20.981  23.959  1.00 17.35  ? 413  TRP A CZ2   1 
ATOM   3186  C CZ3   . TRP A 1 413 ? -5.727  19.466  22.255  1.00 17.84  ? 413  TRP A CZ3   1 
ATOM   3187  C CH2   . TRP A 1 413 ? -5.792  19.906  23.597  1.00 17.85  ? 413  TRP A CH2   1 
ATOM   3188  N N     . TRP A 1 414 ? -5.428  23.620  19.948  1.00 16.78  ? 414  TRP A N     1 
ATOM   3189  C CA    . TRP A 1 414 ? -4.136  23.458  20.617  1.00 16.46  ? 414  TRP A CA    1 
ATOM   3190  C C     . TRP A 1 414 ? -3.994  24.548  21.682  1.00 16.78  ? 414  TRP A C     1 
ATOM   3191  O O     . TRP A 1 414 ? -4.959  25.259  21.967  1.00 16.79  ? 414  TRP A O     1 
ATOM   3192  C CB    . TRP A 1 414 ? -2.970  23.473  19.621  1.00 15.91  ? 414  TRP A CB    1 
ATOM   3193  C CG    . TRP A 1 414 ? -2.830  24.735  18.814  1.00 16.06  ? 414  TRP A CG    1 
ATOM   3194  C CD1   . TRP A 1 414 ? -3.716  25.227  17.904  1.00 15.78  ? 414  TRP A CD1   1 
ATOM   3195  C CD2   . TRP A 1 414 ? -1.730  25.656  18.843  1.00 16.70  ? 414  TRP A CD2   1 
ATOM   3196  N NE1   . TRP A 1 414 ? -3.239  26.398  17.366  1.00 16.99  ? 414  TRP A NE1   1 
ATOM   3197  C CE2   . TRP A 1 414 ? -2.019  26.682  17.920  1.00 15.43  ? 414  TRP A CE2   1 
ATOM   3198  C CE3   . TRP A 1 414 ? -0.525  25.713  19.567  1.00 16.84  ? 414  TRP A CE3   1 
ATOM   3199  C CZ2   . TRP A 1 414 ? -1.161  27.767  17.706  1.00 15.58  ? 414  TRP A CZ2   1 
ATOM   3200  C CZ3   . TRP A 1 414 ? 0.346   26.777  19.340  1.00 15.59  ? 414  TRP A CZ3   1 
ATOM   3201  C CH2   . TRP A 1 414 ? 0.023   27.792  18.412  1.00 15.72  ? 414  TRP A CH2   1 
ATOM   3202  N N     . GLN A 1 415 ? -2.805  24.656  22.281  1.00 16.98  ? 415  GLN A N     1 
ATOM   3203  C CA    . GLN A 1 415 ? -2.572  25.555  23.418  1.00 17.26  ? 415  GLN A CA    1 
ATOM   3204  C C     . GLN A 1 415 ? -1.127  26.024  23.415  1.00 17.34  ? 415  GLN A C     1 
ATOM   3205  O O     . GLN A 1 415 ? -0.295  25.457  22.702  1.00 17.12  ? 415  GLN A O     1 
ATOM   3206  C CB    . GLN A 1 415 ? -2.788  24.828  24.744  1.00 17.93  ? 415  GLN A CB    1 
ATOM   3207  C CG    . GLN A 1 415 ? -3.958  23.890  24.812  1.00 18.47  ? 415  GLN A CG    1 
ATOM   3208  C CD    . GLN A 1 415 ? -4.018  23.198  26.137  1.00 19.48  ? 415  GLN A CD    1 
ATOM   3209  O OE1   . GLN A 1 415 ? -3.231  22.287  26.413  1.00 18.01  ? 415  GLN A OE1   1 
ATOM   3210  N NE2   . GLN A 1 415 ? -4.940  23.641  26.990  1.00 19.35  ? 415  GLN A NE2   1 
ATOM   3211  N N     . THR A 1 416 ? -0.818  27.035  24.229  1.00 16.92  ? 416  THR A N     1 
ATOM   3212  C CA    . THR A 1 416 ? 0.574   27.489  24.402  1.00 16.67  ? 416  THR A CA    1 
ATOM   3213  C C     . THR A 1 416 ? 1.460   26.300  24.787  1.00 16.93  ? 416  THR A C     1 
ATOM   3214  O O     . THR A 1 416 ? 2.545   26.099  24.225  1.00 17.17  ? 416  THR A O     1 
ATOM   3215  C CB    . THR A 1 416 ? 0.687   28.611  25.480  1.00 16.77  ? 416  THR A CB    1 
ATOM   3216  O OG1   . THR A 1 416 ? -0.261  29.650  25.199  1.00 14.86  ? 416  THR A OG1   1 
ATOM   3217  C CG2   . THR A 1 416 ? 2.102   29.227  25.493  1.00 15.80  ? 416  THR A CG2   1 
ATOM   3218  N N     . GLU A 1 417 ? 0.972   25.502  25.734  1.00 17.23  ? 417  GLU A N     1 
ATOM   3219  C CA    . GLU A 1 417 ? 1.716   24.372  26.268  1.00 17.28  ? 417  GLU A CA    1 
ATOM   3220  C C     . GLU A 1 417 ? 1.971   23.262  25.247  1.00 17.09  ? 417  GLU A C     1 
ATOM   3221  O O     . GLU A 1 417 ? 2.813   22.393  25.485  1.00 17.13  ? 417  GLU A O     1 
ATOM   3222  C CB    . GLU A 1 417 ? 0.986   23.786  27.489  1.00 17.60  ? 417  GLU A CB    1 
ATOM   3223  C CG    . GLU A 1 417 ? 0.851   24.732  28.671  1.00 18.19  ? 417  GLU A CG    1 
ATOM   3224  C CD    . GLU A 1 417 ? -0.442  25.561  28.653  1.00 19.65  ? 417  GLU A CD    1 
ATOM   3225  O OE1   . GLU A 1 417 ? -1.053  25.760  27.574  1.00 19.43  ? 417  GLU A OE1   1 
ATOM   3226  O OE2   . GLU A 1 417 ? -0.836  26.039  29.734  1.00 19.95  ? 417  GLU A OE2   1 
ATOM   3227  N N     . THR A 1 418 ? 1.251   23.278  24.125  1.00 16.86  ? 418  THR A N     1 
ATOM   3228  C CA    . THR A 1 418 ? 1.393   22.209  23.137  1.00 16.97  ? 418  THR A CA    1 
ATOM   3229  C C     . THR A 1 418 ? 2.299   22.551  21.936  1.00 17.52  ? 418  THR A C     1 
ATOM   3230  O O     . THR A 1 418 ? 2.651   21.658  21.156  1.00 17.83  ? 418  THR A O     1 
ATOM   3231  C CB    . THR A 1 418 ? 0.028   21.646  22.651  1.00 16.93  ? 418  THR A CB    1 
ATOM   3232  O OG1   . THR A 1 418 ? -0.552  22.521  21.678  1.00 17.52  ? 418  THR A OG1   1 
ATOM   3233  C CG2   . THR A 1 418 ? -0.951  21.418  23.822  1.00 15.99  ? 418  THR A CG2   1 
ATOM   3234  N N     . GLY A 1 419 ? 2.686   23.822  21.798  1.00 17.29  ? 419  GLY A N     1 
ATOM   3235  C CA    . GLY A 1 419 ? 3.608   24.242  20.734  1.00 17.04  ? 419  GLY A CA    1 
ATOM   3236  C C     . GLY A 1 419 ? 3.020   24.368  19.336  1.00 17.40  ? 419  GLY A C     1 
ATOM   3237  O O     . GLY A 1 419 ? 3.333   25.328  18.606  1.00 17.87  ? 419  GLY A O     1 
ATOM   3238  N N     . GLY A 1 420 ? 2.184   23.403  18.951  1.00 17.09  ? 420  GLY A N     1 
ATOM   3239  C CA    . GLY A 1 420 ? 1.530   23.409  17.645  1.00 16.49  ? 420  GLY A CA    1 
ATOM   3240  C C     . GLY A 1 420 ? 0.204   22.665  17.642  1.00 16.68  ? 420  GLY A C     1 
ATOM   3241  O O     . GLY A 1 420 ? -0.250  22.167  18.688  1.00 15.94  ? 420  GLY A O     1 
ATOM   3242  N N     . PHE A 1 421 ? -0.414  22.585  16.463  1.00 16.21  ? 421  PHE A N     1 
ATOM   3243  C CA    . PHE A 1 421 ? -1.748  21.968  16.303  1.00 16.07  ? 421  PHE A CA    1 
ATOM   3244  C C     . PHE A 1 421 ? -1.818  20.576  16.928  1.00 16.10  ? 421  PHE A C     1 
ATOM   3245  O O     . PHE A 1 421 ? -0.873  19.789  16.799  1.00 15.48  ? 421  PHE A O     1 
ATOM   3246  C CB    . PHE A 1 421 ? -2.136  21.877  14.818  1.00 16.01  ? 421  PHE A CB    1 
ATOM   3247  C CG    . PHE A 1 421 ? -2.058  23.191  14.071  1.00 15.44  ? 421  PHE A CG    1 
ATOM   3248  C CD1   . PHE A 1 421 ? -1.848  23.200  12.703  1.00 16.40  ? 421  PHE A CD1   1 
ATOM   3249  C CD2   . PHE A 1 421 ? -2.206  24.411  14.739  1.00 16.38  ? 421  PHE A CD2   1 
ATOM   3250  C CE1   . PHE A 1 421 ? -1.770  24.409  11.986  1.00 17.56  ? 421  PHE A CE1   1 
ATOM   3251  C CE2   . PHE A 1 421 ? -2.137  25.611  14.055  1.00 16.40  ? 421  PHE A CE2   1 
ATOM   3252  C CZ    . PHE A 1 421 ? -1.915  25.616  12.664  1.00 16.92  ? 421  PHE A CZ    1 
ATOM   3253  N N     . MET A 1 422 ? -2.940  20.275  17.586  1.00 16.02  ? 422  MET A N     1 
ATOM   3254  C CA    . MET A 1 422 ? -3.097  18.999  18.301  1.00 16.24  ? 422  MET A CA    1 
ATOM   3255  C C     . MET A 1 422 ? -4.255  18.155  17.765  1.00 16.40  ? 422  MET A C     1 
ATOM   3256  O O     . MET A 1 422 ? -4.107  16.959  17.542  1.00 16.20  ? 422  MET A O     1 
ATOM   3257  C CB    . MET A 1 422 ? -3.291  19.247  19.799  1.00 15.74  ? 422  MET A CB    1 
ATOM   3258  C CG    . MET A 1 422 ? -2.079  19.863  20.485  1.00 16.46  ? 422  MET A CG    1 
ATOM   3259  S SD    . MET A 1 422 ? -0.659  18.728  20.520  1.00 17.87  ? 422  MET A SD    1 
ATOM   3260  C CE    . MET A 1 422 ? -1.234  17.598  21.794  1.00 17.27  ? 422  MET A CE    1 
ATOM   3261  N N     . ILE A 1 423 ? -5.410  18.788  17.590  1.00 16.21  ? 423  ILE A N     1 
ATOM   3262  C CA    . ILE A 1 423 ? -6.565  18.148  16.977  1.00 16.56  ? 423  ILE A CA    1 
ATOM   3263  C C     . ILE A 1 423 ? -7.008  19.107  15.897  1.00 17.08  ? 423  ILE A C     1 
ATOM   3264  O O     . ILE A 1 423 ? -7.264  20.279  16.187  1.00 17.48  ? 423  ILE A O     1 
ATOM   3265  C CB    . ILE A 1 423 ? -7.707  17.907  17.996  1.00 16.60  ? 423  ILE A CB    1 
ATOM   3266  C CG1   . ILE A 1 423 ? -7.238  16.954  19.111  1.00 14.93  ? 423  ILE A CG1   1 
ATOM   3267  C CG2   . ILE A 1 423 ? -8.947  17.356  17.289  1.00 16.96  ? 423  ILE A CG2   1 
ATOM   3268  C CD1   . ILE A 1 423 ? -8.284  16.721  20.211  1.00 15.97  ? 423  ILE A CD1   1 
ATOM   3269  N N     . THR A 1 424 ? -7.076  18.619  14.657  1.00 16.88  ? 424  THR A N     1 
ATOM   3270  C CA    . THR A 1 424 ? -7.278  19.499  13.500  1.00 17.32  ? 424  THR A CA    1 
ATOM   3271  C C     . THR A 1 424 ? -7.612  18.700  12.252  1.00 17.41  ? 424  THR A C     1 
ATOM   3272  O O     . THR A 1 424 ? -7.117  17.573  12.078  1.00 17.65  ? 424  THR A O     1 
ATOM   3273  C CB    . THR A 1 424 ? -6.012  20.377  13.209  1.00 17.09  ? 424  THR A CB    1 
ATOM   3274  O OG1   . THR A 1 424 ? -6.266  21.249  12.100  1.00 17.87  ? 424  THR A OG1   1 
ATOM   3275  C CG2   . THR A 1 424 ? -4.793  19.508  12.881  1.00 16.14  ? 424  THR A CG2   1 
ATOM   3276  N N     . PRO A 1 425 ? -8.441  19.276  11.365  1.00 17.68  ? 425  PRO A N     1 
ATOM   3277  C CA    . PRO A 1 425 ? -8.588  18.609  10.081  1.00 17.69  ? 425  PRO A CA    1 
ATOM   3278  C C     . PRO A 1 425 ? -7.327  18.780  9.238   1.00 18.30  ? 425  PRO A C     1 
ATOM   3279  O O     . PRO A 1 425 ? -6.528  19.697  9.469   1.00 17.80  ? 425  PRO A O     1 
ATOM   3280  C CB    . PRO A 1 425 ? -9.748  19.357  9.412   1.00 17.62  ? 425  PRO A CB    1 
ATOM   3281  C CG    . PRO A 1 425 ? -10.240 20.373  10.386  1.00 17.20  ? 425  PRO A CG    1 
ATOM   3282  C CD    . PRO A 1 425 ? -9.236  20.521  11.459  1.00 17.62  ? 425  PRO A CD    1 
ATOM   3283  N N     . LEU A 1 426 ? -7.130  17.863  8.306   1.00 19.13  ? 426  LEU A N     1 
ATOM   3284  C CA    . LEU A 1 426 ? -6.195  18.069  7.206   1.00 20.05  ? 426  LEU A CA    1 
ATOM   3285  C C     . LEU A 1 426 ? -7.114  18.174  5.996   1.00 19.73  ? 426  LEU A C     1 
ATOM   3286  O O     . LEU A 1 426 ? -7.978  17.325  5.823   1.00 20.27  ? 426  LEU A O     1 
ATOM   3287  C CB    . LEU A 1 426 ? -5.195  16.906  7.088   1.00 20.25  ? 426  LEU A CB    1 
ATOM   3288  C CG    . LEU A 1 426 ? -3.951  16.923  8.006   1.00 21.39  ? 426  LEU A CG    1 
ATOM   3289  C CD1   . LEU A 1 426 ? -4.295  16.845  9.490   1.00 21.93  ? 426  LEU A CD1   1 
ATOM   3290  C CD2   . LEU A 1 426 ? -3.000  15.789  7.661   1.00 21.23  ? 426  LEU A CD2   1 
ATOM   3291  N N     . PRO A 1 427 ? -6.984  19.267  5.213   1.00 19.60  ? 427  PRO A N     1 
ATOM   3292  C CA    . PRO A 1 427 ? -7.956  19.666  4.189   1.00 19.34  ? 427  PRO A CA    1 
ATOM   3293  C C     . PRO A 1 427 ? -8.218  18.670  3.057   1.00 19.14  ? 427  PRO A C     1 
ATOM   3294  O O     . PRO A 1 427 ? -9.329  18.640  2.536   1.00 19.17  ? 427  PRO A O     1 
ATOM   3295  C CB    . PRO A 1 427 ? -7.390  20.996  3.641   1.00 19.18  ? 427  PRO A CB    1 
ATOM   3296  C CG    . PRO A 1 427 ? -5.995  21.049  4.078   1.00 19.45  ? 427  PRO A CG    1 
ATOM   3297  C CD    . PRO A 1 427 ? -5.884  20.243  5.332   1.00 19.14  ? 427  PRO A CD    1 
ATOM   3298  N N     . GLY A 1 428 ? -7.213  17.893  2.665   1.00 18.96  ? 428  GLY A N     1 
ATOM   3299  C CA    . GLY A 1 428 ? -7.411  16.849  1.659   1.00 18.83  ? 428  GLY A CA    1 
ATOM   3300  C C     . GLY A 1 428 ? -7.627  15.458  2.231   1.00 18.52  ? 428  GLY A C     1 
ATOM   3301  O O     . GLY A 1 428 ? -7.755  14.494  1.477   1.00 18.93  ? 428  GLY A O     1 
ATOM   3302  N N     . ALA A 1 429 ? -7.672  15.347  3.556   1.00 18.26  ? 429  ALA A N     1 
ATOM   3303  C CA    . ALA A 1 429 ? -7.791  14.039  4.214   1.00 18.46  ? 429  ALA A CA    1 
ATOM   3304  C C     . ALA A 1 429 ? -9.105  13.836  4.967   1.00 18.62  ? 429  ALA A C     1 
ATOM   3305  O O     . ALA A 1 429 ? -9.638  12.720  4.996   1.00 18.70  ? 429  ALA A O     1 
ATOM   3306  C CB    . ALA A 1 429 ? -6.606  13.810  5.164   1.00 18.07  ? 429  ALA A CB    1 
ATOM   3307  N N     . ILE A 1 430 ? -9.617  14.910  5.577   1.00 18.78  ? 430  ILE A N     1 
ATOM   3308  C CA    . ILE A 1 430 ? -10.691 14.815  6.577   1.00 18.86  ? 430  ILE A CA    1 
ATOM   3309  C C     . ILE A 1 430 ? -11.900 15.652  6.180   1.00 19.07  ? 430  ILE A C     1 
ATOM   3310  O O     . ILE A 1 430 ? -11.784 16.871  5.959   1.00 18.86  ? 430  ILE A O     1 
ATOM   3311  C CB    . ILE A 1 430 ? -10.177 15.227  8.018   1.00 19.59  ? 430  ILE A CB    1 
ATOM   3312  C CG1   . ILE A 1 430 ? -9.168  14.199  8.549   1.00 19.03  ? 430  ILE A CG1   1 
ATOM   3313  C CG2   . ILE A 1 430 ? -11.343 15.358  9.029   1.00 19.00  ? 430  ILE A CG2   1 
ATOM   3314  C CD1   . ILE A 1 430 ? -8.267  14.727  9.653   1.00 18.80  ? 430  ILE A CD1   1 
ATOM   3315  N N     . GLU A 1 431 ? -13.060 14.995  6.099   1.00 19.06  ? 431  GLU A N     1 
ATOM   3316  C CA    . GLU A 1 431 ? -14.322 15.673  5.803   1.00 19.34  ? 431  GLU A CA    1 
ATOM   3317  C C     . GLU A 1 431 ? -14.748 16.505  7.002   1.00 18.96  ? 431  GLU A C     1 
ATOM   3318  O O     . GLU A 1 431 ? -14.632 16.061  8.133   1.00 18.81  ? 431  GLU A O     1 
ATOM   3319  C CB    . GLU A 1 431 ? -15.413 14.665  5.451   1.00 19.85  ? 431  GLU A CB    1 
ATOM   3320  C CG    . GLU A 1 431 ? -15.083 13.795  4.252   1.00 21.88  ? 431  GLU A CG    1 
ATOM   3321  C CD    . GLU A 1 431 ? -16.260 12.963  3.819   1.00 25.58  ? 431  GLU A CD    1 
ATOM   3322  O OE1   . GLU A 1 431 ? -16.801 12.226  4.665   1.00 27.55  ? 431  GLU A OE1   1 
ATOM   3323  O OE2   . GLU A 1 431 ? -16.650 13.051  2.632   1.00 27.29  ? 431  GLU A OE2   1 
ATOM   3324  N N     . LEU A 1 432 ? -15.234 17.714  6.752   1.00 18.49  ? 432  LEU A N     1 
ATOM   3325  C CA    . LEU A 1 432 ? -15.410 18.688  7.832   1.00 18.10  ? 432  LEU A CA    1 
ATOM   3326  C C     . LEU A 1 432 ? -16.792 18.663  8.467   1.00 18.30  ? 432  LEU A C     1 
ATOM   3327  O O     . LEU A 1 432 ? -17.797 18.463  7.781   1.00 18.50  ? 432  LEU A O     1 
ATOM   3328  C CB    . LEU A 1 432 ? -15.136 20.095  7.311   1.00 17.83  ? 432  LEU A CB    1 
ATOM   3329  C CG    . LEU A 1 432 ? -13.860 20.308  6.507   1.00 17.60  ? 432  LEU A CG    1 
ATOM   3330  C CD1   . LEU A 1 432 ? -13.853 21.709  5.934   1.00 16.86  ? 432  LEU A CD1   1 
ATOM   3331  C CD2   . LEU A 1 432 ? -12.639 20.051  7.378   1.00 17.39  ? 432  LEU A CD2   1 
ATOM   3332  N N     . LYS A 1 433 ? -16.830 18.876  9.777   1.00 17.73  ? 433  LYS A N     1 
ATOM   3333  C CA    . LYS A 1 433 ? -18.077 19.155  10.480  1.00 17.79  ? 433  LYS A CA    1 
ATOM   3334  C C     . LYS A 1 433 ? -17.961 20.537  11.112  1.00 17.86  ? 433  LYS A C     1 
ATOM   3335  O O     . LYS A 1 433 ? -17.012 20.810  11.874  1.00 17.99  ? 433  LYS A O     1 
ATOM   3336  C CB    . LYS A 1 433 ? -18.363 18.095  11.554  1.00 17.60  ? 433  LYS A CB    1 
ATOM   3337  C CG    . LYS A 1 433 ? -18.536 16.667  11.023  1.00 18.16  ? 433  LYS A CG    1 
ATOM   3338  C CD    . LYS A 1 433 ? -18.933 15.700  12.147  1.00 17.41  ? 433  LYS A CD    1 
ATOM   3339  C CE    . LYS A 1 433 ? -18.819 14.255  11.708  1.00 19.04  ? 433  LYS A CE    1 
ATOM   3340  N NZ    . LYS A 1 433 ? -19.391 13.357  12.759  1.00 20.77  ? 433  LYS A NZ    1 
ATOM   3341  N N     . ALA A 1 434 ? -18.915 21.402  10.775  1.00 17.34  ? 434  ALA A N     1 
ATOM   3342  C CA    . ALA A 1 434 ? -18.971 22.776  11.273  1.00 17.82  ? 434  ALA A CA    1 
ATOM   3343  C C     . ALA A 1 434 ? -18.960 22.839  12.808  1.00 17.77  ? 434  ALA A C     1 
ATOM   3344  O O     . ALA A 1 434 ? -19.912 22.392  13.456  1.00 17.81  ? 434  ALA A O     1 
ATOM   3345  C CB    . ALA A 1 434 ? -20.213 23.494  10.700  1.00 17.00  ? 434  ALA A CB    1 
ATOM   3346  N N     . GLY A 1 435 ? -17.876 23.380  13.373  1.00 17.91  ? 435  GLY A N     1 
ATOM   3347  C CA    . GLY A 1 435 ? -17.701 23.484  14.837  1.00 17.89  ? 435  GLY A CA    1 
ATOM   3348  C C     . GLY A 1 435 ? -16.809 22.408  15.460  1.00 17.78  ? 435  GLY A C     1 
ATOM   3349  O O     . GLY A 1 435 ? -16.472 22.480  16.643  1.00 17.94  ? 435  GLY A O     1 
ATOM   3350  N N     . SER A 1 436 ? -16.427 21.406  14.667  1.00 17.57  ? 436  SER A N     1 
ATOM   3351  C CA    . SER A 1 436 ? -15.578 20.314  15.139  1.00 17.52  ? 436  SER A CA    1 
ATOM   3352  C C     . SER A 1 436 ? -14.113 20.493  14.739  1.00 17.86  ? 436  SER A C     1 
ATOM   3353  O O     . SER A 1 436 ? -13.815 20.815  13.593  1.00 18.52  ? 436  SER A O     1 
ATOM   3354  C CB    . SER A 1 436 ? -16.079 18.983  14.587  1.00 17.11  ? 436  SER A CB    1 
ATOM   3355  O OG    . SER A 1 436 ? -15.281 17.891  15.037  1.00 17.50  ? 436  SER A OG    1 
ATOM   3356  N N     . ALA A 1 437 ? -13.196 20.254  15.676  1.00 17.69  ? 437  ALA A N     1 
ATOM   3357  C CA    . ALA A 1 437 ? -11.771 20.211  15.340  1.00 17.47  ? 437  ALA A CA    1 
ATOM   3358  C C     . ALA A 1 437 ? -11.389 18.884  14.671  1.00 17.79  ? 437  ALA A C     1 
ATOM   3359  O O     . ALA A 1 437 ? -10.300 18.760  14.094  1.00 17.94  ? 437  ALA A O     1 
ATOM   3360  C CB    . ALA A 1 437 ? -10.919 20.460  16.578  1.00 17.49  ? 437  ALA A CB    1 
ATOM   3361  N N     . THR A 1 438 ? -12.294 17.902  14.731  1.00 17.81  ? 438  THR A N     1 
ATOM   3362  C CA    . THR A 1 438 ? -12.138 16.607  14.046  1.00 17.64  ? 438  THR A CA    1 
ATOM   3363  C C     . THR A 1 438 ? -11.114 15.664  14.731  1.00 18.05  ? 438  THR A C     1 
ATOM   3364  O O     . THR A 1 438 ? -11.333 15.247  15.877  1.00 18.12  ? 438  THR A O     1 
ATOM   3365  C CB    . THR A 1 438 ? -11.874 16.744  12.489  1.00 17.51  ? 438  THR A CB    1 
ATOM   3366  O OG1   . THR A 1 438 ? -10.509 17.100  12.246  1.00 17.31  ? 438  THR A OG1   1 
ATOM   3367  C CG2   . THR A 1 438 ? -12.782 17.800  11.852  1.00 17.19  ? 438  THR A CG2   1 
ATOM   3368  N N     . ARG A 1 439 ? -10.011 15.343  14.049  1.00 17.72  ? 439  ARG A N     1 
ATOM   3369  C CA    . ARG A 1 439 ? -9.140  14.229  14.469  1.00 18.08  ? 439  ARG A CA    1 
ATOM   3370  C C     . ARG A 1 439 ? -7.800  14.670  15.047  1.00 17.95  ? 439  ARG A C     1 
ATOM   3371  O O     . ARG A 1 439 ? -7.315  15.724  14.691  1.00 18.23  ? 439  ARG A O     1 
ATOM   3372  C CB    . ARG A 1 439 ? -8.874  13.300  13.277  1.00 18.26  ? 439  ARG A CB    1 
ATOM   3373  C CG    . ARG A 1 439 ? -10.121 12.646  12.700  1.00 18.95  ? 439  ARG A CG    1 
ATOM   3374  C CD    . ARG A 1 439 ? -9.766  11.335  12.012  1.00 20.97  ? 439  ARG A CD    1 
ATOM   3375  N NE    . ARG A 1 439 ? -10.931 10.708  11.399  1.00 19.32  ? 439  ARG A NE    1 
ATOM   3376  C CZ    . ARG A 1 439 ? -11.826 9.963   12.043  1.00 21.24  ? 439  ARG A CZ    1 
ATOM   3377  N NH1   . ARG A 1 439 ? -11.715 9.730   13.348  1.00 18.87  ? 439  ARG A NH1   1 
ATOM   3378  N NH2   . ARG A 1 439 ? -12.850 9.450   11.367  1.00 22.79  ? 439  ARG A NH2   1 
ATOM   3379  N N     . PRO A 1 440 ? -7.176  13.836  15.910  1.00 18.29  ? 440  PRO A N     1 
ATOM   3380  C CA    . PRO A 1 440 ? -5.823  14.169  16.399  1.00 17.82  ? 440  PRO A CA    1 
ATOM   3381  C C     . PRO A 1 440 ? -4.778  14.220  15.279  1.00 17.72  ? 440  PRO A C     1 
ATOM   3382  O O     . PRO A 1 440 ? -4.879  13.474  14.289  1.00 17.43  ? 440  PRO A O     1 
ATOM   3383  C CB    . PRO A 1 440 ? -5.508  13.039  17.392  1.00 17.74  ? 440  PRO A CB    1 
ATOM   3384  C CG    . PRO A 1 440 ? -6.426  11.903  17.006  1.00 18.11  ? 440  PRO A CG    1 
ATOM   3385  C CD    . PRO A 1 440 ? -7.680  12.568  16.486  1.00 18.00  ? 440  PRO A CD    1 
ATOM   3386  N N     . PHE A 1 441 ? -3.807  15.125  15.420  1.00 17.50  ? 441  PHE A N     1 
ATOM   3387  C CA    . PHE A 1 441 ? -2.664  15.197  14.506  1.00 17.34  ? 441  PHE A CA    1 
ATOM   3388  C C     . PHE A 1 441 ? -1.701  14.020  14.749  1.00 17.74  ? 441  PHE A C     1 
ATOM   3389  O O     . PHE A 1 441 ? -1.809  13.328  15.769  1.00 17.09  ? 441  PHE A O     1 
ATOM   3390  C CB    . PHE A 1 441 ? -1.931  16.537  14.656  1.00 17.72  ? 441  PHE A CB    1 
ATOM   3391  C CG    . PHE A 1 441 ? -0.951  16.821  13.541  1.00 16.89  ? 441  PHE A CG    1 
ATOM   3392  C CD1   . PHE A 1 441 ? -1.400  17.167  12.279  1.00 17.37  ? 441  PHE A CD1   1 
ATOM   3393  C CD2   . PHE A 1 441 ? 0.416   16.693  13.750  1.00 18.31  ? 441  PHE A CD2   1 
ATOM   3394  C CE1   . PHE A 1 441 ? -0.506  17.414  11.250  1.00 18.07  ? 441  PHE A CE1   1 
ATOM   3395  C CE2   . PHE A 1 441 ? 1.328   16.922  12.710  1.00 18.60  ? 441  PHE A CE2   1 
ATOM   3396  C CZ    . PHE A 1 441 ? 0.866   17.286  11.467  1.00 17.35  ? 441  PHE A CZ    1 
ATOM   3397  N N     . PHE A 1 442 ? -0.786  13.780  13.802  1.00 17.90  ? 442  PHE A N     1 
ATOM   3398  C CA    . PHE A 1 442 ? 0.257   12.746  13.941  1.00 17.94  ? 442  PHE A CA    1 
ATOM   3399  C C     . PHE A 1 442 ? 1.006   12.902  15.258  1.00 18.34  ? 442  PHE A C     1 
ATOM   3400  O O     . PHE A 1 442 ? 1.446   14.002  15.592  1.00 18.72  ? 442  PHE A O     1 
ATOM   3401  C CB    . PHE A 1 442 ? 1.258   12.827  12.772  1.00 17.88  ? 442  PHE A CB    1 
ATOM   3402  C CG    . PHE A 1 442 ? 0.613   12.847  11.412  1.00 16.98  ? 442  PHE A CG    1 
ATOM   3403  C CD1   . PHE A 1 442 ? 1.032   13.749  10.448  1.00 17.02  ? 442  PHE A CD1   1 
ATOM   3404  C CD2   . PHE A 1 442 ? -0.437  11.976  11.104  1.00 16.65  ? 442  PHE A CD2   1 
ATOM   3405  C CE1   . PHE A 1 442 ? 0.432   13.768  9.171   1.00 17.73  ? 442  PHE A CE1   1 
ATOM   3406  C CE2   . PHE A 1 442 ? -1.053  12.001  9.841   1.00 17.31  ? 442  PHE A CE2   1 
ATOM   3407  C CZ    . PHE A 1 442 ? -0.614  12.899  8.873   1.00 17.14  ? 442  PHE A CZ    1 
ATOM   3408  N N     . GLY A 1 443 ? 1.129   11.812  16.018  1.00 18.81  ? 443  GLY A N     1 
ATOM   3409  C CA    . GLY A 1 443 ? 1.827   11.840  17.315  1.00 18.52  ? 443  GLY A CA    1 
ATOM   3410  C C     . GLY A 1 443 ? 0.973   12.193  18.530  1.00 19.12  ? 443  GLY A C     1 
ATOM   3411  O O     . GLY A 1 443 ? 1.445   12.103  19.673  1.00 19.61  ? 443  GLY A O     1 
ATOM   3412  N N     . VAL A 1 444 ? -0.284  12.576  18.295  1.00 18.70  ? 444  VAL A N     1 
ATOM   3413  C CA    . VAL A 1 444 ? -1.183  13.066  19.359  1.00 18.80  ? 444  VAL A CA    1 
ATOM   3414  C C     . VAL A 1 444 ? -2.183  11.980  19.753  1.00 18.94  ? 444  VAL A C     1 
ATOM   3415  O O     . VAL A 1 444 ? -2.931  11.507  18.913  1.00 19.01  ? 444  VAL A O     1 
ATOM   3416  C CB    . VAL A 1 444 ? -1.917  14.378  18.924  1.00 18.58  ? 444  VAL A CB    1 
ATOM   3417  C CG1   . VAL A 1 444 ? -2.891  14.869  20.003  1.00 18.67  ? 444  VAL A CG1   1 
ATOM   3418  C CG2   . VAL A 1 444 ? -0.896  15.469  18.569  1.00 17.95  ? 444  VAL A CG2   1 
ATOM   3419  N N     . GLN A 1 445 ? -2.158  11.569  21.022  1.00 19.21  ? 445  GLN A N     1 
ATOM   3420  C CA    . GLN A 1 445 ? -3.080  10.560  21.547  1.00 19.91  ? 445  GLN A CA    1 
ATOM   3421  C C     . GLN A 1 445 ? -4.024  11.196  22.572  1.00 19.43  ? 445  GLN A C     1 
ATOM   3422  O O     . GLN A 1 445 ? -3.723  11.237  23.765  1.00 19.26  ? 445  GLN A O     1 
ATOM   3423  C CB    . GLN A 1 445 ? -2.334  9.361   22.176  1.00 19.86  ? 445  GLN A CB    1 
ATOM   3424  C CG    . GLN A 1 445 ? -1.255  8.759   21.289  1.00 20.76  ? 445  GLN A CG    1 
ATOM   3425  C CD    . GLN A 1 445 ? -0.616  7.486   21.852  1.00 21.67  ? 445  GLN A CD    1 
ATOM   3426  O OE1   . GLN A 1 445 ? -1.293  6.497   22.122  1.00 23.98  ? 445  GLN A OE1   1 
ATOM   3427  N NE2   . GLN A 1 445 ? 0.699   7.507   21.997  1.00 23.29  ? 445  GLN A NE2   1 
ATOM   3428  N N     . PRO A 1 446 ? -5.180  11.688  22.106  1.00 19.55  ? 446  PRO A N     1 
ATOM   3429  C CA    . PRO A 1 446 ? -6.117  12.291  23.039  1.00 19.55  ? 446  PRO A CA    1 
ATOM   3430  C C     . PRO A 1 446 ? -6.978  11.225  23.704  1.00 19.36  ? 446  PRO A C     1 
ATOM   3431  O O     . PRO A 1 446 ? -7.078  10.106  23.208  1.00 19.61  ? 446  PRO A O     1 
ATOM   3432  C CB    . PRO A 1 446 ? -6.965  13.180  22.139  1.00 19.37  ? 446  PRO A CB    1 
ATOM   3433  C CG    . PRO A 1 446 ? -7.007  12.433  20.834  1.00 19.86  ? 446  PRO A CG    1 
ATOM   3434  C CD    . PRO A 1 446 ? -5.688  11.707  20.720  1.00 19.54  ? 446  PRO A CD    1 
ATOM   3435  N N     . ALA A 1 447 ? -7.576  11.581  24.832  1.00 19.52  ? 447  ALA A N     1 
ATOM   3436  C CA    . ALA A 1 447 ? -8.513  10.719  25.536  1.00 19.34  ? 447  ALA A CA    1 
ATOM   3437  C C     . ALA A 1 447 ? -9.433  11.617  26.351  1.00 19.37  ? 447  ALA A C     1 
ATOM   3438  O O     . ALA A 1 447 ? -9.086  12.780  26.645  1.00 19.22  ? 447  ALA A O     1 
ATOM   3439  C CB    . ALA A 1 447 ? -7.777  9.734   26.444  1.00 19.16  ? 447  ALA A CB    1 
ATOM   3440  N N     . LEU A 1 448 ? -10.603 11.078  26.688  1.00 18.93  ? 448  LEU A N     1 
ATOM   3441  C CA    . LEU A 1 448 ? -11.582 11.745  27.532  1.00 19.09  ? 448  LEU A CA    1 
ATOM   3442  C C     . LEU A 1 448 ? -11.766 10.951  28.818  1.00 19.44  ? 448  LEU A C     1 
ATOM   3443  O O     . LEU A 1 448 ? -12.005 9.741   28.783  1.00 19.67  ? 448  LEU A O     1 
ATOM   3444  C CB    . LEU A 1 448 ? -12.925 11.892  26.803  1.00 18.60  ? 448  LEU A CB    1 
ATOM   3445  C CG    . LEU A 1 448 ? -12.936 12.657  25.469  1.00 18.34  ? 448  LEU A CG    1 
ATOM   3446  C CD1   . LEU A 1 448 ? -14.309 12.628  24.840  1.00 18.15  ? 448  LEU A CD1   1 
ATOM   3447  C CD2   . LEU A 1 448 ? -12.452 14.094  25.612  1.00 16.47  ? 448  LEU A CD2   1 
ATOM   3448  N N     . VAL A 1 449 ? -11.637 11.636  29.951  1.00 19.66  ? 449  VAL A N     1 
ATOM   3449  C CA    . VAL A 1 449 ? -11.813 11.010  31.258  1.00 19.77  ? 449  VAL A CA    1 
ATOM   3450  C C     . VAL A 1 449 ? -12.851 11.751  32.094  1.00 20.02  ? 449  VAL A C     1 
ATOM   3451  O O     . VAL A 1 449 ? -13.051 12.954  31.923  1.00 19.76  ? 449  VAL A O     1 
ATOM   3452  C CB    . VAL A 1 449 ? -10.471 10.926  32.041  1.00 19.83  ? 449  VAL A CB    1 
ATOM   3453  C CG1   . VAL A 1 449 ? -9.482  10.027  31.314  1.00 19.76  ? 449  VAL A CG1   1 
ATOM   3454  C CG2   . VAL A 1 449 ? -9.872  12.326  32.279  1.00 18.76  ? 449  VAL A CG2   1 
ATOM   3455  N N     . ASP A 1 450 ? -13.510 11.037  33.006  1.00 20.79  ? 450  ASP A N     1 
ATOM   3456  C CA    . ASP A 1 450 ? -14.422 11.697  33.936  1.00 21.07  ? 450  ASP A CA    1 
ATOM   3457  C C     . ASP A 1 450 ? -13.609 12.409  35.018  1.00 21.43  ? 450  ASP A C     1 
ATOM   3458  O O     . ASP A 1 450 ? -12.369 12.374  34.994  1.00 20.94  ? 450  ASP A O     1 
ATOM   3459  C CB    . ASP A 1 450 ? -15.466 10.723  34.510  1.00 21.55  ? 450  ASP A CB    1 
ATOM   3460  C CG    . ASP A 1 450 ? -14.850 9.567   35.295  1.00 20.93  ? 450  ASP A CG    1 
ATOM   3461  O OD1   . ASP A 1 450 ? -13.662 9.635   35.686  1.00 20.83  ? 450  ASP A OD1   1 
ATOM   3462  O OD2   . ASP A 1 450 ? -15.583 8.584   35.530  1.00 20.89  ? 450  ASP A OD2   1 
ATOM   3463  N N     . ASN A 1 451 ? -14.293 13.078  35.940  1.00 21.74  ? 451  ASN A N     1 
ATOM   3464  C CA    . ASN A 1 451 ? -13.602 13.847  36.976  1.00 22.73  ? 451  ASN A CA    1 
ATOM   3465  C C     . ASN A 1 451 ? -12.767 12.967  37.905  1.00 22.90  ? 451  ASN A C     1 
ATOM   3466  O O     . ASN A 1 451 ? -11.911 13.469  38.628  1.00 22.97  ? 451  ASN A O     1 
ATOM   3467  C CB    . ASN A 1 451 ? -14.591 14.686  37.789  1.00 22.93  ? 451  ASN A CB    1 
ATOM   3468  C CG    . ASN A 1 451 ? -15.150 15.857  37.006  1.00 24.07  ? 451  ASN A CG    1 
ATOM   3469  O OD1   . ASN A 1 451 ? -14.528 16.354  36.056  1.00 25.66  ? 451  ASN A OD1   1 
ATOM   3470  N ND2   . ASN A 1 451 ? -16.327 16.319  37.411  1.00 24.54  ? 451  ASN A ND2   1 
ATOM   3471  N N     . GLU A 1 452 ? -13.019 11.660  37.859  1.00 23.23  ? 452  GLU A N     1 
ATOM   3472  C CA    . GLU A 1 452 ? -12.308 10.683  38.682  1.00 24.17  ? 452  GLU A CA    1 
ATOM   3473  C C     . GLU A 1 452 ? -11.118 10.046  37.950  1.00 24.04  ? 452  GLU A C     1 
ATOM   3474  O O     . GLU A 1 452 ? -10.369 9.271   38.524  1.00 23.90  ? 452  GLU A O     1 
ATOM   3475  C CB    . GLU A 1 452 ? -13.283 9.612   39.204  1.00 24.47  ? 452  GLU A CB    1 
ATOM   3476  C CG    . GLU A 1 452 ? -14.321 10.137  40.220  1.00 26.60  ? 452  GLU A CG    1 
ATOM   3477  C CD    . GLU A 1 452 ? -15.395 11.063  39.609  1.00 29.64  ? 452  GLU A CD    1 
ATOM   3478  O OE1   . GLU A 1 452 ? -15.896 10.772  38.492  1.00 30.12  ? 452  GLU A OE1   1 
ATOM   3479  O OE2   . GLU A 1 452 ? -15.752 12.082  40.261  1.00 30.42  ? 452  GLU A OE2   1 
ATOM   3480  N N     . GLY A 1 453 ? -10.932 10.392  36.684  1.00 24.30  ? 453  GLY A N     1 
ATOM   3481  C CA    . GLY A 1 453 ? -9.791  9.886   35.931  1.00 24.82  ? 453  GLY A CA    1 
ATOM   3482  C C     . GLY A 1 453 ? -10.051 8.634   35.113  1.00 24.86  ? 453  GLY A C     1 
ATOM   3483  O O     . GLY A 1 453 ? -9.126  8.097   34.507  1.00 25.08  ? 453  GLY A O     1 
ATOM   3484  N N     . HIS A 1 454 ? -11.304 8.182   35.084  1.00 25.14  ? 454  HIS A N     1 
ATOM   3485  C CA    . HIS A 1 454 ? -11.698 6.987   34.324  1.00 25.68  ? 454  HIS A CA    1 
ATOM   3486  C C     . HIS A 1 454 ? -11.825 7.318   32.846  1.00 25.54  ? 454  HIS A C     1 
ATOM   3487  O O     . HIS A 1 454 ? -12.585 8.215   32.494  1.00 25.87  ? 454  HIS A O     1 
ATOM   3488  C CB    . HIS A 1 454 ? -13.047 6.455   34.804  1.00 25.67  ? 454  HIS A CB    1 
ATOM   3489  C CG    . HIS A 1 454 ? -13.123 6.208   36.279  1.00 27.58  ? 454  HIS A CG    1 
ATOM   3490  N ND1   . HIS A 1 454 ? -14.247 6.501   37.023  1.00 28.87  ? 454  HIS A ND1   1 
ATOM   3491  C CD2   . HIS A 1 454 ? -12.223 5.688   37.147  1.00 27.89  ? 454  HIS A CD2   1 
ATOM   3492  C CE1   . HIS A 1 454 ? -14.037 6.170   38.285  1.00 28.36  ? 454  HIS A CE1   1 
ATOM   3493  N NE2   . HIS A 1 454 ? -12.816 5.677   38.386  1.00 28.84  ? 454  HIS A NE2   1 
ATOM   3494  N N     . PRO A 1 455 ? -11.096 6.590   31.974  1.00 25.56  ? 455  PRO A N     1 
ATOM   3495  C CA    . PRO A 1 455 ? -11.217 6.808   30.524  1.00 25.39  ? 455  PRO A CA    1 
ATOM   3496  C C     . PRO A 1 455 ? -12.629 6.502   30.035  1.00 24.98  ? 455  PRO A C     1 
ATOM   3497  O O     . PRO A 1 455 ? -13.200 5.486   30.404  1.00 24.82  ? 455  PRO A O     1 
ATOM   3498  C CB    . PRO A 1 455 ? -10.206 5.817   29.921  1.00 25.57  ? 455  PRO A CB    1 
ATOM   3499  C CG    . PRO A 1 455 ? -9.262  5.490   31.047  1.00 25.49  ? 455  PRO A CG    1 
ATOM   3500  C CD    . PRO A 1 455 ? -10.110 5.539   32.288  1.00 25.58  ? 455  PRO A CD    1 
ATOM   3501  N N     . GLN A 1 456 ? -13.186 7.400   29.230  1.00 24.65  ? 456  GLN A N     1 
ATOM   3502  C CA    . GLN A 1 456 ? -14.542 7.256   28.729  1.00 24.54  ? 456  GLN A CA    1 
ATOM   3503  C C     . GLN A 1 456 ? -14.474 6.795   27.276  1.00 24.76  ? 456  GLN A C     1 
ATOM   3504  O O     . GLN A 1 456 ? -13.814 7.429   26.448  1.00 24.49  ? 456  GLN A O     1 
ATOM   3505  C CB    . GLN A 1 456 ? -15.304 8.582   28.855  1.00 24.67  ? 456  GLN A CB    1 
ATOM   3506  C CG    . GLN A 1 456 ? -15.383 9.151   30.281  1.00 24.69  ? 456  GLN A CG    1 
ATOM   3507  C CD    . GLN A 1 456 ? -16.025 8.190   31.273  1.00 25.27  ? 456  GLN A CD    1 
ATOM   3508  O OE1   . GLN A 1 456 ? -15.364 7.682   32.192  1.00 23.78  ? 456  GLN A OE1   1 
ATOM   3509  N NE2   . GLN A 1 456 ? -17.316 7.929   31.088  1.00 25.16  ? 456  GLN A NE2   1 
ATOM   3510  N N     . GLU A 1 457 ? -15.125 5.671   26.984  1.00 24.95  ? 457  GLU A N     1 
ATOM   3511  C CA    . GLU A 1 457 ? -15.033 5.032   25.666  1.00 25.40  ? 457  GLU A CA    1 
ATOM   3512  C C     . GLU A 1 457 ? -16.218 5.389   24.772  1.00 24.62  ? 457  GLU A C     1 
ATOM   3513  O O     . GLU A 1 457 ? -17.294 5.722   25.264  1.00 24.41  ? 457  GLU A O     1 
ATOM   3514  C CB    . GLU A 1 457 ? -14.916 3.500   25.795  1.00 25.76  ? 457  GLU A CB    1 
ATOM   3515  C CG    . GLU A 1 457 ? -13.830 2.996   26.757  1.00 29.15  ? 457  GLU A CG    1 
ATOM   3516  C CD    . GLU A 1 457 ? -12.393 3.296   26.312  1.00 33.96  ? 457  GLU A CD    1 
ATOM   3517  O OE1   . GLU A 1 457 ? -12.170 4.206   25.472  1.00 35.27  ? 457  GLU A OE1   1 
ATOM   3518  O OE2   . GLU A 1 457 ? -11.473 2.614   26.831  1.00 36.04  ? 457  GLU A OE2   1 
ATOM   3519  N N     . GLY A 1 458 ? -16.008 5.313   23.460  1.00 24.11  ? 458  GLY A N     1 
ATOM   3520  C CA    . GLY A 1 458 ? -17.075 5.572   22.484  1.00 23.46  ? 458  GLY A CA    1 
ATOM   3521  C C     . GLY A 1 458 ? -17.447 7.035   22.335  1.00 22.94  ? 458  GLY A C     1 
ATOM   3522  O O     . GLY A 1 458 ? -16.649 7.924   22.635  1.00 22.77  ? 458  GLY A O     1 
ATOM   3523  N N     . ALA A 1 459 ? -18.658 7.280   21.841  1.00 22.68  ? 459  ALA A N     1 
ATOM   3524  C CA    . ALA A 1 459 ? -19.199 8.630   21.754  1.00 22.42  ? 459  ALA A CA    1 
ATOM   3525  C C     . ALA A 1 459 ? -19.566 9.069   23.168  1.00 22.34  ? 459  ALA A C     1 
ATOM   3526  O O     . ALA A 1 459 ? -20.398 8.446   23.839  1.00 21.84  ? 459  ALA A O     1 
ATOM   3527  C CB    . ALA A 1 459 ? -20.415 8.684   20.808  1.00 22.42  ? 459  ALA A CB    1 
ATOM   3528  N N     . THR A 1 460 ? -18.905 10.120  23.630  1.00 22.18  ? 460  THR A N     1 
ATOM   3529  C CA    . THR A 1 460 ? -18.971 10.498  25.033  1.00 22.58  ? 460  THR A CA    1 
ATOM   3530  C C     . THR A 1 460 ? -18.394 11.900  25.238  1.00 22.58  ? 460  THR A C     1 
ATOM   3531  O O     . THR A 1 460 ? -17.902 12.509  24.294  1.00 22.48  ? 460  THR A O     1 
ATOM   3532  C CB    . THR A 1 460 ? -18.244 9.432   25.922  1.00 22.55  ? 460  THR A CB    1 
ATOM   3533  O OG1   . THR A 1 460 ? -18.470 9.717   27.302  1.00 24.14  ? 460  THR A OG1   1 
ATOM   3534  C CG2   . THR A 1 460 ? -16.736 9.370   25.639  1.00 22.67  ? 460  THR A CG2   1 
ATOM   3535  N N     . GLU A 1 461 ? -18.471 12.417  26.461  1.00 22.68  ? 461  GLU A N     1 
ATOM   3536  C CA    . GLU A 1 461 ? -17.811 13.674  26.789  1.00 23.38  ? 461  GLU A CA    1 
ATOM   3537  C C     . GLU A 1 461 ? -16.980 13.533  28.067  1.00 21.96  ? 461  GLU A C     1 
ATOM   3538  O O     . GLU A 1 461 ? -17.234 12.643  28.892  1.00 21.19  ? 461  GLU A O     1 
ATOM   3539  C CB    . GLU A 1 461 ? -18.828 14.833  26.879  1.00 23.53  ? 461  GLU A CB    1 
ATOM   3540  C CG    . GLU A 1 461 ? -19.754 14.806  28.101  1.00 26.58  ? 461  GLU A CG    1 
ATOM   3541  C CD    . GLU A 1 461 ? -21.039 15.640  27.935  1.00 27.25  ? 461  GLU A CD    1 
ATOM   3542  O OE1   . GLU A 1 461 ? -21.012 16.714  27.270  1.00 32.71  ? 461  GLU A OE1   1 
ATOM   3543  O OE2   . GLU A 1 461 ? -22.084 15.217  28.488  1.00 32.21  ? 461  GLU A OE2   1 
ATOM   3544  N N     . GLY A 1 462 ? -15.978 14.396  28.218  1.00 20.61  ? 462  GLY A N     1 
ATOM   3545  C CA    . GLY A 1 462 ? -15.200 14.442  29.450  1.00 19.70  ? 462  GLY A CA    1 
ATOM   3546  C C     . GLY A 1 462 ? -14.070 15.448  29.436  1.00 19.41  ? 462  GLY A C     1 
ATOM   3547  O O     . GLY A 1 462 ? -14.026 16.350  28.593  1.00 18.94  ? 462  GLY A O     1 
ATOM   3548  N N     . ASN A 1 463 ? -13.172 15.288  30.401  1.00 19.01  ? 463  ASN A N     1 
ATOM   3549  C CA    . ASN A 1 463 ? -11.935 16.053  30.501  1.00 18.72  ? 463  ASN A CA    1 
ATOM   3550  C C     . ASN A 1 463 ? -10.944 15.599  29.456  1.00 18.28  ? 463  ASN A C     1 
ATOM   3551  O O     . ASN A 1 463 ? -10.618 14.416  29.390  1.00 18.53  ? 463  ASN A O     1 
ATOM   3552  C CB    . ASN A 1 463 ? -11.357 15.867  31.911  1.00 18.98  ? 463  ASN A CB    1 
ATOM   3553  C CG    . ASN A 1 463 ? -12.331 16.308  32.979  1.00 18.70  ? 463  ASN A CG    1 
ATOM   3554  O OD1   . ASN A 1 463 ? -12.693 17.478  33.028  1.00 20.66  ? 463  ASN A OD1   1 
ATOM   3555  N ND2   . ASN A 1 463 ? -12.798 15.372  33.808  1.00 17.91  ? 463  ASN A ND2   1 
ATOM   3556  N N     . LEU A 1 464 ? -10.475 16.536  28.634  1.00 17.91  ? 464  LEU A N     1 
ATOM   3557  C CA    . LEU A 1 464 ? -9.577  16.223  27.519  1.00 17.24  ? 464  LEU A CA    1 
ATOM   3558  C C     . LEU A 1 464 ? -8.129  16.136  27.976  1.00 17.20  ? 464  LEU A C     1 
ATOM   3559  O O     . LEU A 1 464 ? -7.552  17.131  28.432  1.00 17.28  ? 464  LEU A O     1 
ATOM   3560  C CB    . LEU A 1 464 ? -9.734  17.264  26.394  1.00 17.20  ? 464  LEU A CB    1 
ATOM   3561  C CG    . LEU A 1 464 ? -8.832  17.236  25.155  1.00 17.66  ? 464  LEU A CG    1 
ATOM   3562  C CD1   . LEU A 1 464 ? -8.807  15.855  24.437  1.00 16.84  ? 464  LEU A CD1   1 
ATOM   3563  C CD2   . LEU A 1 464 ? -9.268  18.344  24.197  1.00 17.26  ? 464  LEU A CD2   1 
ATOM   3564  N N     . VAL A 1 465 ? -7.558  14.936  27.872  1.00 16.93  ? 465  VAL A N     1 
ATOM   3565  C CA    . VAL A 1 465 ? -6.160  14.690  28.219  1.00 16.47  ? 465  VAL A CA    1 
ATOM   3566  C C     . VAL A 1 465 ? -5.402  14.163  27.002  1.00 16.97  ? 465  VAL A C     1 
ATOM   3567  O O     . VAL A 1 465 ? -6.015  13.690  26.032  1.00 16.57  ? 465  VAL A O     1 
ATOM   3568  C CB    . VAL A 1 465 ? -6.003  13.675  29.400  1.00 17.09  ? 465  VAL A CB    1 
ATOM   3569  C CG1   . VAL A 1 465 ? -6.622  14.217  30.699  1.00 16.92  ? 465  VAL A CG1   1 
ATOM   3570  C CG2   . VAL A 1 465 ? -6.561  12.292  29.032  1.00 15.52  ? 465  VAL A CG2   1 
ATOM   3571  N N     . ILE A 1 466 ? -4.073  14.269  27.048  1.00 16.97  ? 466  ILE A N     1 
ATOM   3572  C CA    . ILE A 1 466 ? -3.192  13.692  26.035  1.00 16.76  ? 466  ILE A CA    1 
ATOM   3573  C C     . ILE A 1 466 ? -2.298  12.694  26.767  1.00 17.19  ? 466  ILE A C     1 
ATOM   3574  O O     . ILE A 1 466 ? -1.651  13.033  27.765  1.00 17.07  ? 466  ILE A O     1 
ATOM   3575  C CB    . ILE A 1 466 ? -2.336  14.760  25.298  1.00 16.75  ? 466  ILE A CB    1 
ATOM   3576  C CG1   . ILE A 1 466 ? -3.184  15.979  24.855  1.00 16.60  ? 466  ILE A CG1   1 
ATOM   3577  C CG2   . ILE A 1 466 ? -1.594  14.128  24.112  1.00 16.46  ? 466  ILE A CG2   1 
ATOM   3578  C CD1   . ILE A 1 466 ? -4.193  15.716  23.718  1.00 17.04  ? 466  ILE A CD1   1 
ATOM   3579  N N     . THR A 1 467 ? -2.272  11.460  26.276  1.00 17.34  ? 467  THR A N     1 
ATOM   3580  C CA    . THR A 1 467 ? -1.738  10.334  27.050  1.00 17.31  ? 467  THR A CA    1 
ATOM   3581  C C     . THR A 1 467 ? -0.279  10.003  26.740  1.00 17.23  ? 467  THR A C     1 
ATOM   3582  O O     . THR A 1 467 ? 0.298   9.108   27.348  1.00 16.53  ? 467  THR A O     1 
ATOM   3583  C CB    . THR A 1 467 ? -2.602  9.072   26.862  1.00 17.28  ? 467  THR A CB    1 
ATOM   3584  O OG1   . THR A 1 467 ? -2.558  8.675   25.492  1.00 17.55  ? 467  THR A OG1   1 
ATOM   3585  C CG2   . THR A 1 467 ? -4.049  9.370   27.234  1.00 18.30  ? 467  THR A CG2   1 
ATOM   3586  N N     . ASP A 1 468 ? 0.316   10.730  25.798  1.00 17.25  ? 468  ASP A N     1 
ATOM   3587  C CA    . ASP A 1 468 ? 1.748   10.595  25.512  1.00 17.74  ? 468  ASP A CA    1 
ATOM   3588  C C     . ASP A 1 468 ? 2.286   11.923  24.968  1.00 17.42  ? 468  ASP A C     1 
ATOM   3589  O O     . ASP A 1 468 ? 1.511   12.815  24.608  1.00 17.03  ? 468  ASP A O     1 
ATOM   3590  C CB    . ASP A 1 468 ? 1.988   9.449   24.516  1.00 18.03  ? 468  ASP A CB    1 
ATOM   3591  C CG    . ASP A 1 468 ? 3.354   8.793   24.678  1.00 20.48  ? 468  ASP A CG    1 
ATOM   3592  O OD1   . ASP A 1 468 ? 4.276   9.398   25.274  1.00 22.06  ? 468  ASP A OD1   1 
ATOM   3593  O OD2   . ASP A 1 468 ? 3.512   7.650   24.196  1.00 24.70  ? 468  ASP A OD2   1 
ATOM   3594  N N     . SER A 1 469 ? 3.608   12.051  24.930  1.00 17.52  ? 469  SER A N     1 
ATOM   3595  C CA    . SER A 1 469 ? 4.265   13.257  24.421  1.00 17.42  ? 469  SER A CA    1 
ATOM   3596  C C     . SER A 1 469 ? 4.260   13.360  22.893  1.00 17.30  ? 469  SER A C     1 
ATOM   3597  O O     . SER A 1 469 ? 3.963   12.395  22.184  1.00 17.06  ? 469  SER A O     1 
ATOM   3598  C CB    . SER A 1 469 ? 5.700   13.349  24.957  1.00 17.42  ? 469  SER A CB    1 
ATOM   3599  O OG    . SER A 1 469 ? 6.239   14.652  24.746  1.00 17.40  ? 469  SER A OG    1 
ATOM   3600  N N     . TRP A 1 470 ? 4.583   14.558  22.408  1.00 17.49  ? 470  TRP A N     1 
ATOM   3601  C CA    . TRP A 1 470 ? 4.656   14.883  20.985  1.00 17.52  ? 470  TRP A CA    1 
ATOM   3602  C C     . TRP A 1 470 ? 5.766   15.940  20.905  1.00 18.19  ? 470  TRP A C     1 
ATOM   3603  O O     . TRP A 1 470 ? 6.042   16.617  21.909  1.00 18.32  ? 470  TRP A O     1 
ATOM   3604  C CB    . TRP A 1 470 ? 3.307   15.415  20.462  1.00 16.82  ? 470  TRP A CB    1 
ATOM   3605  C CG    . TRP A 1 470 ? 2.864   16.679  21.179  1.00 17.06  ? 470  TRP A CG    1 
ATOM   3606  C CD1   . TRP A 1 470 ? 3.031   17.966  20.749  1.00 15.38  ? 470  TRP A CD1   1 
ATOM   3607  C CD2   . TRP A 1 470 ? 2.228   16.763  22.467  1.00 15.80  ? 470  TRP A CD2   1 
ATOM   3608  N NE1   . TRP A 1 470 ? 2.531   18.849  21.688  1.00 15.79  ? 470  TRP A NE1   1 
ATOM   3609  C CE2   . TRP A 1 470 ? 2.027   18.138  22.746  1.00 16.02  ? 470  TRP A CE2   1 
ATOM   3610  C CE3   . TRP A 1 470 ? 1.785   15.813  23.394  1.00 14.46  ? 470  TRP A CE3   1 
ATOM   3611  C CZ2   . TRP A 1 470 ? 1.417   18.585  23.930  1.00 15.82  ? 470  TRP A CZ2   1 
ATOM   3612  C CZ3   . TRP A 1 470 ? 1.179   16.254  24.573  1.00 15.40  ? 470  TRP A CZ3   1 
ATOM   3613  C CH2   . TRP A 1 470 ? 0.997   17.633  24.827  1.00 16.14  ? 470  TRP A CH2   1 
ATOM   3614  N N     . PRO A 1 471 ? 6.444   16.053  19.746  1.00 18.33  ? 471  PRO A N     1 
ATOM   3615  C CA    . PRO A 1 471 ? 7.663   16.879  19.698  1.00 18.29  ? 471  PRO A CA    1 
ATOM   3616  C C     . PRO A 1 471 ? 7.517   18.350  20.121  1.00 18.45  ? 471  PRO A C     1 
ATOM   3617  O O     . PRO A 1 471 ? 8.466   18.917  20.658  1.00 18.34  ? 471  PRO A O     1 
ATOM   3618  C CB    . PRO A 1 471 ? 8.100   16.774  18.228  1.00 17.93  ? 471  PRO A CB    1 
ATOM   3619  C CG    . PRO A 1 471 ? 7.529   15.445  17.777  1.00 18.71  ? 471  PRO A CG    1 
ATOM   3620  C CD    . PRO A 1 471 ? 6.185   15.393  18.453  1.00 18.10  ? 471  PRO A CD    1 
ATOM   3621  N N     . GLY A 1 472 ? 6.360   18.960  19.865  1.00 18.56  ? 472  GLY A N     1 
ATOM   3622  C CA    . GLY A 1 472 ? 6.159   20.388  20.155  1.00 18.65  ? 472  GLY A CA    1 
ATOM   3623  C C     . GLY A 1 472 ? 5.810   20.730  21.591  1.00 18.50  ? 472  GLY A C     1 
ATOM   3624  O O     . GLY A 1 472 ? 5.642   21.906  21.924  1.00 18.46  ? 472  GLY A O     1 
ATOM   3625  N N     . GLN A 1 473 ? 5.706   19.716  22.451  1.00 18.24  ? 473  GLN A N     1 
ATOM   3626  C CA    . GLN A 1 473 ? 5.244   19.922  23.827  1.00 17.65  ? 473  GLN A CA    1 
ATOM   3627  C C     . GLN A 1 473 ? 6.154   20.876  24.600  1.00 18.07  ? 473  GLN A C     1 
ATOM   3628  O O     . GLN A 1 473 ? 7.380   20.767  24.525  1.00 18.07  ? 473  GLN A O     1 
ATOM   3629  C CB    . GLN A 1 473 ? 5.148   18.583  24.568  1.00 18.08  ? 473  GLN A CB    1 
ATOM   3630  C CG    . GLN A 1 473 ? 4.451   18.673  25.928  1.00 16.21  ? 473  GLN A CG    1 
ATOM   3631  C CD    . GLN A 1 473 ? 4.152   17.330  26.556  1.00 17.18  ? 473  GLN A CD    1 
ATOM   3632  O OE1   . GLN A 1 473 ? 4.571   16.275  26.060  1.00 17.52  ? 473  GLN A OE1   1 
ATOM   3633  N NE2   . GLN A 1 473 ? 3.420   17.357  27.663  1.00 15.06  ? 473  GLN A NE2   1 
ATOM   3634  N N     . ALA A 1 474 ? 5.552   21.801  25.352  1.00 17.77  ? 474  ALA A N     1 
ATOM   3635  C CA    . ALA A 1 474 ? 6.316   22.647  26.266  1.00 17.98  ? 474  ALA A CA    1 
ATOM   3636  C C     . ALA A 1 474 ? 7.072   21.757  27.252  1.00 17.86  ? 474  ALA A C     1 
ATOM   3637  O O     . ALA A 1 474 ? 6.542   20.725  27.701  1.00 17.82  ? 474  ALA A O     1 
ATOM   3638  C CB    . ALA A 1 474 ? 5.406   23.620  26.996  1.00 17.51  ? 474  ALA A CB    1 
ATOM   3639  N N     . ARG A 1 475 ? 8.301   22.155  27.581  1.00 17.33  ? 475  ARG A N     1 
ATOM   3640  C CA    . ARG A 1 475 ? 9.193   21.311  28.378  1.00 16.96  ? 475  ARG A CA    1 
ATOM   3641  C C     . ARG A 1 475 ? 9.154   21.582  29.878  1.00 17.48  ? 475  ARG A C     1 
ATOM   3642  O O     . ARG A 1 475 ? 9.467   20.697  30.669  1.00 17.52  ? 475  ARG A O     1 
ATOM   3643  C CB    . ARG A 1 475 ? 10.635  21.411  27.867  1.00 16.59  ? 475  ARG A CB    1 
ATOM   3644  C CG    . ARG A 1 475 ? 10.783  21.152  26.379  1.00 16.50  ? 475  ARG A CG    1 
ATOM   3645  C CD    . ARG A 1 475 ? 10.281  19.764  25.994  1.00 14.96  ? 475  ARG A CD    1 
ATOM   3646  N NE    . ARG A 1 475 ? 11.056  19.256  24.863  1.00 16.82  ? 475  ARG A NE    1 
ATOM   3647  C CZ    . ARG A 1 475 ? 10.591  19.065  23.628  1.00 15.95  ? 475  ARG A CZ    1 
ATOM   3648  N NH1   . ARG A 1 475 ? 9.310   19.302  23.327  1.00 11.69  ? 475  ARG A NH1   1 
ATOM   3649  N NH2   . ARG A 1 475 ? 11.426  18.615  22.690  1.00 15.30  ? 475  ARG A NH2   1 
ATOM   3650  N N     . THR A 1 476 ? 8.794   22.805  30.263  1.00 17.63  ? 476  THR A N     1 
ATOM   3651  C CA    . THR A 1 476 ? 8.687   23.171  31.674  1.00 17.99  ? 476  THR A CA    1 
ATOM   3652  C C     . THR A 1 476 ? 7.981   24.525  31.845  1.00 18.20  ? 476  THR A C     1 
ATOM   3653  O O     . THR A 1 476 ? 7.572   25.139  30.864  1.00 18.07  ? 476  THR A O     1 
ATOM   3654  C CB    . THR A 1 476 ? 10.083  23.184  32.368  1.00 18.42  ? 476  THR A CB    1 
ATOM   3655  O OG1   . THR A 1 476 ? 9.917   23.315  33.785  1.00 17.08  ? 476  THR A OG1   1 
ATOM   3656  C CG2   . THR A 1 476 ? 10.959  24.318  31.827  1.00 17.66  ? 476  THR A CG2   1 
ATOM   3657  N N     . LEU A 1 477 ? 7.821   24.965  33.091  1.00 18.76  ? 477  LEU A N     1 
ATOM   3658  C CA    . LEU A 1 477 ? 7.510   26.366  33.373  1.00 19.58  ? 477  LEU A CA    1 
ATOM   3659  C C     . LEU A 1 477 ? 8.780   27.042  33.870  1.00 20.23  ? 477  LEU A C     1 
ATOM   3660  O O     . LEU A 1 477 ? 9.484   26.485  34.711  1.00 20.62  ? 477  LEU A O     1 
ATOM   3661  C CB    . LEU A 1 477 ? 6.403   26.484  34.418  1.00 19.46  ? 477  LEU A CB    1 
ATOM   3662  C CG    . LEU A 1 477 ? 5.013   25.959  34.034  1.00 19.69  ? 477  LEU A CG    1 
ATOM   3663  C CD1   . LEU A 1 477 ? 4.075   25.953  35.252  1.00 19.24  ? 477  LEU A CD1   1 
ATOM   3664  C CD2   . LEU A 1 477 ? 4.408   26.775  32.887  1.00 17.41  ? 477  LEU A CD2   1 
ATOM   3665  N N     . PHE A 1 478 ? 9.074   28.236  33.351  1.00 21.00  ? 478  PHE A N     1 
ATOM   3666  C CA    . PHE A 1 478 ? 10.360  28.895  33.603  1.00 21.35  ? 478  PHE A CA    1 
ATOM   3667  C C     . PHE A 1 478 ? 10.701  28.933  35.091  1.00 21.35  ? 478  PHE A C     1 
ATOM   3668  O O     . PHE A 1 478 ? 9.952   29.490  35.886  1.00 21.66  ? 478  PHE A O     1 
ATOM   3669  C CB    . PHE A 1 478 ? 10.386  30.311  33.027  1.00 22.10  ? 478  PHE A CB    1 
ATOM   3670  C CG    . PHE A 1 478 ? 11.688  31.036  33.278  1.00 23.65  ? 478  PHE A CG    1 
ATOM   3671  C CD1   . PHE A 1 478 ? 12.813  30.760  32.506  1.00 24.19  ? 478  PHE A CD1   1 
ATOM   3672  C CD2   . PHE A 1 478 ? 11.794  31.970  34.303  1.00 25.28  ? 478  PHE A CD2   1 
ATOM   3673  C CE1   . PHE A 1 478 ? 14.024  31.414  32.744  1.00 25.59  ? 478  PHE A CE1   1 
ATOM   3674  C CE2   . PHE A 1 478 ? 12.999  32.622  34.554  1.00 26.36  ? 478  PHE A CE2   1 
ATOM   3675  C CZ    . PHE A 1 478 ? 14.114  32.353  33.768  1.00 25.08  ? 478  PHE A CZ    1 
ATOM   3676  N N     . GLY A 1 479 ? 11.817  28.302  35.450  1.00 21.11  ? 479  GLY A N     1 
ATOM   3677  C CA    . GLY A 1 479 ? 12.311  28.261  36.820  1.00 20.85  ? 479  GLY A CA    1 
ATOM   3678  C C     . GLY A 1 479 ? 11.411  27.515  37.798  1.00 20.79  ? 479  GLY A C     1 
ATOM   3679  O O     . GLY A 1 479 ? 11.559  27.670  39.005  1.00 20.69  ? 479  GLY A O     1 
ATOM   3680  N N     . ASP A 1 480 ? 10.475  26.711  37.291  1.00 20.36  ? 480  ASP A N     1 
ATOM   3681  C CA    . ASP A 1 480 ? 9.537   25.995  38.163  1.00 19.87  ? 480  ASP A CA    1 
ATOM   3682  C C     . ASP A 1 480 ? 9.002   24.697  37.544  1.00 19.26  ? 480  ASP A C     1 
ATOM   3683  O O     . ASP A 1 480 ? 7.819   24.575  37.262  1.00 18.99  ? 480  ASP A O     1 
ATOM   3684  C CB    . ASP A 1 480 ? 8.387   26.922  38.596  1.00 19.64  ? 480  ASP A CB    1 
ATOM   3685  C CG    . ASP A 1 480 ? 7.840   26.575  39.975  1.00 20.92  ? 480  ASP A CG    1 
ATOM   3686  O OD1   . ASP A 1 480 ? 8.068   25.424  40.439  1.00 21.68  ? 480  ASP A OD1   1 
ATOM   3687  O OD2   . ASP A 1 480 ? 7.179   27.452  40.596  1.00 20.40  ? 480  ASP A OD2   1 
ATOM   3688  N N     . HIS A 1 481 ? 9.887   23.722  37.363  1.00 18.98  ? 481  HIS A N     1 
ATOM   3689  C CA    . HIS A 1 481 ? 9.504   22.411  36.848  1.00 18.53  ? 481  HIS A CA    1 
ATOM   3690  C C     . HIS A 1 481 ? 8.590   21.627  37.791  1.00 18.37  ? 481  HIS A C     1 
ATOM   3691  O O     . HIS A 1 481 ? 7.782   20.812  37.342  1.00 18.07  ? 481  HIS A O     1 
ATOM   3692  C CB    . HIS A 1 481 ? 10.729  21.575  36.504  1.00 18.60  ? 481  HIS A CB    1 
ATOM   3693  C CG    . HIS A 1 481 ? 10.400  20.328  35.754  1.00 18.76  ? 481  HIS A CG    1 
ATOM   3694  N ND1   . HIS A 1 481 ? 10.143  20.321  34.400  1.00 21.10  ? 481  HIS A ND1   1 
ATOM   3695  C CD2   . HIS A 1 481 ? 10.262  19.047  36.171  1.00 19.38  ? 481  HIS A CD2   1 
ATOM   3696  C CE1   . HIS A 1 481 ? 9.874   19.087  34.012  1.00 20.61  ? 481  HIS A CE1   1 
ATOM   3697  N NE2   . HIS A 1 481 ? 9.936   18.296  35.068  1.00 20.35  ? 481  HIS A NE2   1 
ATOM   3698  N N     . GLU A 1 482 ? 8.718   21.865  39.089  1.00 18.47  ? 482  GLU A N     1 
ATOM   3699  C CA    . GLU A 1 482 ? 7.813   21.237  40.053  1.00 18.52  ? 482  GLU A CA    1 
ATOM   3700  C C     . GLU A 1 482 ? 6.375   21.727  39.890  1.00 18.13  ? 482  GLU A C     1 
ATOM   3701  O O     . GLU A 1 482 ? 5.449   20.948  40.014  1.00 17.92  ? 482  GLU A O     1 
ATOM   3702  C CB    . GLU A 1 482 ? 8.292   21.485  41.475  1.00 19.03  ? 482  GLU A CB    1 
ATOM   3703  C CG    . GLU A 1 482 ? 9.518   20.671  41.863  1.00 20.47  ? 482  GLU A CG    1 
ATOM   3704  C CD    . GLU A 1 482 ? 9.829   20.810  43.329  1.00 21.97  ? 482  GLU A CD    1 
ATOM   3705  O OE1   . GLU A 1 482 ? 8.875   20.966  44.111  1.00 23.59  ? 482  GLU A OE1   1 
ATOM   3706  O OE2   . GLU A 1 482 ? 11.016  20.774  43.707  1.00 23.84  ? 482  GLU A OE2   1 
ATOM   3707  N N     . ARG A 1 483 ? 6.194   23.018  39.615  1.00 17.97  ? 483  ARG A N     1 
ATOM   3708  C CA    . ARG A 1 483 ? 4.855   23.547  39.322  1.00 18.46  ? 483  ARG A CA    1 
ATOM   3709  C C     . ARG A 1 483 ? 4.323   23.043  37.981  1.00 18.02  ? 483  ARG A C     1 
ATOM   3710  O O     . ARG A 1 483 ? 3.127   22.807  37.844  1.00 18.11  ? 483  ARG A O     1 
ATOM   3711  C CB    . ARG A 1 483 ? 4.822   25.080  39.343  1.00 18.48  ? 483  ARG A CB    1 
ATOM   3712  C CG    . ARG A 1 483 ? 3.398   25.643  39.292  1.00 19.46  ? 483  ARG A CG    1 
ATOM   3713  C CD    . ARG A 1 483 ? 3.386   27.127  38.974  1.00 21.87  ? 483  ARG A CD    1 
ATOM   3714  N N     . PHE A 1 484 ? 5.211   22.902  36.998  1.00 17.92  ? 484  PHE A N     1 
ATOM   3715  C CA    . PHE A 1 484 ? 4.876   22.300  35.700  1.00 17.56  ? 484  PHE A CA    1 
ATOM   3716  C C     . PHE A 1 484 ? 4.253   20.911  35.897  1.00 18.23  ? 484  PHE A C     1 
ATOM   3717  O O     . PHE A 1 484 ? 3.184   20.608  35.329  1.00 17.80  ? 484  PHE A O     1 
ATOM   3718  C CB    . PHE A 1 484 ? 6.135   22.235  34.834  1.00 17.65  ? 484  PHE A CB    1 
ATOM   3719  C CG    . PHE A 1 484 ? 5.939   21.618  33.458  1.00 17.26  ? 484  PHE A CG    1 
ATOM   3720  C CD1   . PHE A 1 484 ? 5.285   22.319  32.446  1.00 17.79  ? 484  PHE A CD1   1 
ATOM   3721  C CD2   . PHE A 1 484 ? 6.477   20.363  33.167  1.00 16.95  ? 484  PHE A CD2   1 
ATOM   3722  C CE1   . PHE A 1 484 ? 5.140   21.773  31.172  1.00 18.11  ? 484  PHE A CE1   1 
ATOM   3723  C CE2   . PHE A 1 484 ? 6.353   19.804  31.897  1.00 17.50  ? 484  PHE A CE2   1 
ATOM   3724  C CZ    . PHE A 1 484 ? 5.682   20.509  30.890  1.00 17.68  ? 484  PHE A CZ    1 
ATOM   3725  N N     . GLU A 1 485 ? 4.900   20.086  36.720  1.00 18.49  ? 485  GLU A N     1 
ATOM   3726  C CA    . GLU A 1 485 ? 4.348   18.783  37.071  1.00 19.88  ? 485  GLU A CA    1 
ATOM   3727  C C     . GLU A 1 485 ? 2.973   18.924  37.733  1.00 19.77  ? 485  GLU A C     1 
ATOM   3728  O O     . GLU A 1 485 ? 2.018   18.274  37.308  1.00 19.57  ? 485  GLU A O     1 
ATOM   3729  C CB    . GLU A 1 485 ? 5.303   17.980  37.982  1.00 19.93  ? 485  GLU A CB    1 
ATOM   3730  C CG    . GLU A 1 485 ? 6.709   17.686  37.399  1.00 21.39  ? 485  GLU A CG    1 
ATOM   3731  C CD    . GLU A 1 485 ? 7.481   16.584  38.171  1.00 22.31  ? 485  GLU A CD    1 
ATOM   3732  O OE1   . GLU A 1 485 ? 7.145   16.338  39.361  1.00 25.57  ? 485  GLU A OE1   1 
ATOM   3733  O OE2   . GLU A 1 485 ? 8.426   15.968  37.592  1.00 22.87  ? 485  GLU A OE2   1 
ATOM   3734  N N     . GLN A 1 486 ? 2.879   19.773  38.761  1.00 20.10  ? 486  GLN A N     1 
ATOM   3735  C CA    . GLN A 1 486 ? 1.653   19.928  39.558  1.00 21.61  ? 486  GLN A CA    1 
ATOM   3736  C C     . GLN A 1 486 ? 0.466   20.404  38.712  1.00 20.66  ? 486  GLN A C     1 
ATOM   3737  O O     . GLN A 1 486 ? -0.650  19.876  38.814  1.00 20.74  ? 486  GLN A O     1 
ATOM   3738  C CB    . GLN A 1 486 ? 1.878   20.882  40.755  1.00 21.18  ? 486  GLN A CB    1 
ATOM   3739  C CG    . GLN A 1 486 ? 2.818   20.323  41.823  1.00 24.25  ? 486  GLN A CG    1 
ATOM   3740  C CD    . GLN A 1 486 ? 3.019   21.257  43.027  1.00 26.18  ? 486  GLN A CD    1 
ATOM   3741  O OE1   . GLN A 1 486 ? 2.156   21.346  43.928  1.00 32.22  ? 486  GLN A OE1   1 
ATOM   3742  N NE2   . GLN A 1 486 ? 4.180   21.927  43.071  1.00 29.51  ? 486  GLN A NE2   1 
ATOM   3743  N N     . THR A 1 487 ? 0.727   21.387  37.861  1.00 19.68  ? 487  THR A N     1 
ATOM   3744  C CA    . THR A 1 487 ? -0.301  22.007  37.055  1.00 19.06  ? 487  THR A CA    1 
ATOM   3745  C C     . THR A 1 487 ? -0.890  21.050  36.016  1.00 18.81  ? 487  THR A C     1 
ATOM   3746  O O     . THR A 1 487 ? -2.115  20.957  35.889  1.00 18.84  ? 487  THR A O     1 
ATOM   3747  C CB    . THR A 1 487 ? 0.256   23.253  36.371  1.00 19.29  ? 487  THR A CB    1 
ATOM   3748  O OG1   . THR A 1 487 ? 0.810   24.108  37.376  1.00 19.87  ? 487  THR A OG1   1 
ATOM   3749  C CG2   . THR A 1 487 ? -0.843  24.009  35.606  1.00 19.88  ? 487  THR A CG2   1 
ATOM   3750  N N     . TYR A 1 488 ? -0.029  20.337  35.294  1.00 17.67  ? 488  TYR A N     1 
ATOM   3751  C CA    . TYR A 1 488 ? -0.466  19.598  34.119  1.00 17.39  ? 488  TYR A CA    1 
ATOM   3752  C C     . TYR A 1 488 ? -0.517  18.094  34.277  1.00 17.67  ? 488  TYR A C     1 
ATOM   3753  O O     . TYR A 1 488 ? -1.234  17.426  33.524  1.00 17.54  ? 488  TYR A O     1 
ATOM   3754  C CB    . TYR A 1 488 ? 0.402   19.954  32.908  1.00 17.15  ? 488  TYR A CB    1 
ATOM   3755  C CG    . TYR A 1 488 ? 0.425   21.432  32.624  1.00 16.69  ? 488  TYR A CG    1 
ATOM   3756  C CD1   . TYR A 1 488 ? 1.532   22.205  32.972  1.00 15.59  ? 488  TYR A CD1   1 
ATOM   3757  C CD2   . TYR A 1 488 ? -0.669  22.063  32.030  1.00 15.53  ? 488  TYR A CD2   1 
ATOM   3758  C CE1   . TYR A 1 488 ? 1.563   23.550  32.726  1.00 15.88  ? 488  TYR A CE1   1 
ATOM   3759  C CE2   . TYR A 1 488 ? -0.659  23.429  31.787  1.00 16.47  ? 488  TYR A CE2   1 
ATOM   3760  C CZ    . TYR A 1 488 ? 0.459   24.169  32.142  1.00 16.92  ? 488  TYR A CZ    1 
ATOM   3761  O OH    . TYR A 1 488 ? 0.504   25.525  31.893  1.00 16.07  ? 488  TYR A OH    1 
ATOM   3762  N N     . PHE A 1 489 ? 0.225   17.555  35.243  1.00 17.71  ? 489  PHE A N     1 
ATOM   3763  C CA    . PHE A 1 489 ? 0.415   16.104  35.316  1.00 18.49  ? 489  PHE A CA    1 
ATOM   3764  C C     . PHE A 1 489 ? -0.006  15.458  36.662  1.00 19.32  ? 489  PHE A C     1 
ATOM   3765  O O     . PHE A 1 489 ? 0.273   14.270  36.899  1.00 20.36  ? 489  PHE A O     1 
ATOM   3766  C CB    . PHE A 1 489 ? 1.876   15.762  34.996  1.00 17.95  ? 489  PHE A CB    1 
ATOM   3767  C CG    . PHE A 1 489 ? 2.323   16.193  33.624  1.00 17.69  ? 489  PHE A CG    1 
ATOM   3768  C CD1   . PHE A 1 489 ? 2.957   17.424  33.437  1.00 17.40  ? 489  PHE A CD1   1 
ATOM   3769  C CD2   . PHE A 1 489 ? 2.128   15.362  32.516  1.00 17.72  ? 489  PHE A CD2   1 
ATOM   3770  C CE1   . PHE A 1 489 ? 3.379   17.827  32.175  1.00 17.63  ? 489  PHE A CE1   1 
ATOM   3771  C CE2   . PHE A 1 489 ? 2.542   15.758  31.246  1.00 17.26  ? 489  PHE A CE2   1 
ATOM   3772  C CZ    . PHE A 1 489 ? 3.170   17.000  31.076  1.00 17.98  ? 489  PHE A CZ    1 
ATOM   3773  N N     . SER A 1 490 ? -0.678  16.218  37.527  1.00 19.44  ? 490  SER A N     1 
ATOM   3774  C CA    . SER A 1 490 ? -1.101  15.706  38.840  1.00 20.16  ? 490  SER A CA    1 
ATOM   3775  C C     . SER A 1 490 ? -2.593  15.380  38.954  1.00 20.09  ? 490  SER A C     1 
ATOM   3776  O O     . SER A 1 490 ? -2.981  14.565  39.783  1.00 20.19  ? 490  SER A O     1 
ATOM   3777  C CB    . SER A 1 490 ? -0.724  16.688  39.953  1.00 20.30  ? 490  SER A CB    1 
ATOM   3778  O OG    . SER A 1 490 ? -1.572  17.826  39.899  1.00 21.90  ? 490  SER A OG    1 
ATOM   3779  N N     . THR A 1 491 ? -3.434  16.031  38.155  1.00 20.27  ? 491  THR A N     1 
ATOM   3780  C CA    . THR A 1 491 ? -4.887  15.767  38.208  1.00 20.38  ? 491  THR A CA    1 
ATOM   3781  C C     . THR A 1 491 ? -5.208  14.351  37.718  1.00 19.98  ? 491  THR A C     1 
ATOM   3782  O O     . THR A 1 491 ? -5.975  13.619  38.344  1.00 19.72  ? 491  THR A O     1 
ATOM   3783  C CB    . THR A 1 491 ? -5.679  16.785  37.366  1.00 20.43  ? 491  THR A CB    1 
ATOM   3784  O OG1   . THR A 1 491 ? -5.246  18.110  37.690  1.00 21.40  ? 491  THR A OG1   1 
ATOM   3785  C CG2   . THR A 1 491 ? -7.181  16.667  37.632  1.00 20.94  ? 491  THR A CG2   1 
ATOM   3786  N N     . PHE A 1 492 ? -4.616  13.992  36.582  1.00 19.78  ? 492  PHE A N     1 
ATOM   3787  C CA    . PHE A 1 492 ? -4.780  12.674  35.994  1.00 20.02  ? 492  PHE A CA    1 
ATOM   3788  C C     . PHE A 1 492 ? -3.381  12.130  35.759  1.00 20.66  ? 492  PHE A C     1 
ATOM   3789  O O     . PHE A 1 492 ? -2.662  12.593  34.873  1.00 21.11  ? 492  PHE A O     1 
ATOM   3790  C CB    . PHE A 1 492 ? -5.614  12.768  34.707  1.00 19.17  ? 492  PHE A CB    1 
ATOM   3791  C CG    . PHE A 1 492 ? -6.973  13.432  34.905  1.00 18.04  ? 492  PHE A CG    1 
ATOM   3792  C CD1   . PHE A 1 492 ? -7.260  14.654  34.314  1.00 15.89  ? 492  PHE A CD1   1 
ATOM   3793  C CD2   . PHE A 1 492 ? -7.949  12.835  35.709  1.00 17.10  ? 492  PHE A CD2   1 
ATOM   3794  C CE1   . PHE A 1 492 ? -8.499  15.272  34.494  1.00 16.06  ? 492  PHE A CE1   1 
ATOM   3795  C CE2   . PHE A 1 492 ? -9.194  13.438  35.903  1.00 16.73  ? 492  PHE A CE2   1 
ATOM   3796  C CZ    . PHE A 1 492 ? -9.472  14.671  35.289  1.00 17.71  ? 492  PHE A CZ    1 
ATOM   3797  N N     . LYS A 1 493 ? -2.987  11.188  36.608  1.00 21.37  ? 493  LYS A N     1 
ATOM   3798  C CA    . LYS A 1 493 ? -1.606  10.711  36.700  1.00 22.31  ? 493  LYS A CA    1 
ATOM   3799  C C     . LYS A 1 493 ? -1.148  10.066  35.405  1.00 22.39  ? 493  LYS A C     1 
ATOM   3800  O O     . LYS A 1 493 ? -1.894  9.313   34.788  1.00 21.93  ? 493  LYS A O     1 
ATOM   3801  C CB    . LYS A 1 493 ? -1.453  9.710   37.859  1.00 22.92  ? 493  LYS A CB    1 
ATOM   3802  C CG    . LYS A 1 493 ? -1.919  10.228  39.234  1.00 24.36  ? 493  LYS A CG    1 
ATOM   3803  C CD    . LYS A 1 493 ? -1.012  11.336  39.785  1.00 26.25  ? 493  LYS A CD    1 
ATOM   3804  C CE    . LYS A 1 493 ? -1.558  11.906  41.098  1.00 26.18  ? 493  LYS A CE    1 
ATOM   3805  N NZ    . LYS A 1 493 ? -0.817  13.132  41.522  1.00 28.35  ? 493  LYS A NZ    1 
ATOM   3806  N N     . ASN A 1 494 ? 0.080   10.382  34.997  1.00 22.96  ? 494  ASN A N     1 
ATOM   3807  C CA    . ASN A 1 494 ? 0.652   9.881   33.740  1.00 23.45  ? 494  ASN A CA    1 
ATOM   3808  C C     . ASN A 1 494 ? -0.005  10.434  32.485  1.00 22.93  ? 494  ASN A C     1 
ATOM   3809  O O     . ASN A 1 494 ? 0.154   9.881   31.396  1.00 21.82  ? 494  ASN A O     1 
ATOM   3810  C CB    . ASN A 1 494 ? 0.667   8.352   33.704  1.00 24.02  ? 494  ASN A CB    1 
ATOM   3811  C CG    . ASN A 1 494 ? 2.051   7.802   33.864  1.00 27.20  ? 494  ASN A CG    1 
ATOM   3812  O OD1   . ASN A 1 494 ? 2.915   8.010   32.993  1.00 29.79  ? 494  ASN A OD1   1 
ATOM   3813  N ND2   . ASN A 1 494 ? 2.295   7.118   34.990  1.00 28.27  ? 494  ASN A ND2   1 
ATOM   3814  N N     . MET A 1 495 ? -0.729  11.537  32.653  1.00 22.56  ? 495  MET A N     1 
ATOM   3815  C CA    . MET A 1 495 ? -1.418  12.180  31.550  1.00 22.97  ? 495  MET A CA    1 
ATOM   3816  C C     . MET A 1 495 ? -1.228  13.681  31.590  1.00 21.33  ? 495  MET A C     1 
ATOM   3817  O O     . MET A 1 495 ? -1.104  14.270  32.671  1.00 20.84  ? 495  MET A O     1 
ATOM   3818  C CB    . MET A 1 495 ? -2.900  11.844  31.601  1.00 22.64  ? 495  MET A CB    1 
ATOM   3819  C CG    . MET A 1 495 ? -3.209  10.437  31.145  1.00 24.68  ? 495  MET A CG    1 
ATOM   3820  S SD    . MET A 1 495 ? -4.919  10.077  31.513  1.00 27.30  ? 495  MET A SD    1 
ATOM   3821  C CE    . MET A 1 495 ? -4.770  9.452   33.188  1.00 29.89  ? 495  MET A CE    1 
ATOM   3822  N N     . TYR A 1 496 ? -1.188  14.286  30.405  1.00 20.19  ? 496  TYR A N     1 
ATOM   3823  C CA    . TYR A 1 496 ? -1.200  15.733  30.280  1.00 19.40  ? 496  TYR A CA    1 
ATOM   3824  C C     . TYR A 1 496 ? -2.656  16.195  30.272  1.00 19.11  ? 496  TYR A C     1 
ATOM   3825  O O     . TYR A 1 496 ? -3.422  15.789  29.392  1.00 19.57  ? 496  TYR A O     1 
ATOM   3826  C CB    . TYR A 1 496 ? -0.469  16.198  28.996  1.00 19.40  ? 496  TYR A CB    1 
ATOM   3827  C CG    . TYR A 1 496 ? -0.681  17.671  28.716  1.00 19.02  ? 496  TYR A CG    1 
ATOM   3828  C CD1   . TYR A 1 496 ? 0.068   18.648  29.387  1.00 18.63  ? 496  TYR A CD1   1 
ATOM   3829  C CD2   . TYR A 1 496 ? -1.660  18.093  27.812  1.00 18.45  ? 496  TYR A CD2   1 
ATOM   3830  C CE1   . TYR A 1 496 ? -0.144  20.008  29.147  1.00 19.30  ? 496  TYR A CE1   1 
ATOM   3831  C CE2   . TYR A 1 496 ? -1.869  19.440  27.564  1.00 19.43  ? 496  TYR A CE2   1 
ATOM   3832  C CZ    . TYR A 1 496 ? -1.113  20.391  28.236  1.00 19.56  ? 496  TYR A CZ    1 
ATOM   3833  O OH    . TYR A 1 496 ? -1.346  21.722  28.003  1.00 19.25  ? 496  TYR A OH    1 
ATOM   3834  N N     . PHE A 1 497 ? -3.037  17.024  31.243  1.00 18.02  ? 497  PHE A N     1 
ATOM   3835  C CA    . PHE A 1 497 ? -4.399  17.587  31.308  1.00 17.69  ? 497  PHE A CA    1 
ATOM   3836  C C     . PHE A 1 497 ? -4.437  18.987  30.702  1.00 17.79  ? 497  PHE A C     1 
ATOM   3837  O O     . PHE A 1 497 ? -3.814  19.915  31.220  1.00 18.13  ? 497  PHE A O     1 
ATOM   3838  C CB    . PHE A 1 497 ? -4.926  17.606  32.751  1.00 17.39  ? 497  PHE A CB    1 
ATOM   3839  C CG    . PHE A 1 497 ? -6.346  18.155  32.899  1.00 17.55  ? 497  PHE A CG    1 
ATOM   3840  C CD1   . PHE A 1 497 ? -7.308  17.969  31.895  1.00 17.19  ? 497  PHE A CD1   1 
ATOM   3841  C CD2   . PHE A 1 497 ? -6.714  18.843  34.060  1.00 17.30  ? 497  PHE A CD2   1 
ATOM   3842  C CE1   . PHE A 1 497 ? -8.609  18.475  32.029  1.00 17.18  ? 497  PHE A CE1   1 
ATOM   3843  C CE2   . PHE A 1 497 ? -8.022  19.343  34.227  1.00 18.12  ? 497  PHE A CE2   1 
ATOM   3844  C CZ    . PHE A 1 497 ? -8.976  19.150  33.206  1.00 18.38  ? 497  PHE A CZ    1 
ATOM   3845  N N     . SER A 1 498 ? -5.168  19.118  29.599  1.00 18.03  ? 498  SER A N     1 
ATOM   3846  C CA    . SER A 1 498 ? -5.297  20.368  28.852  1.00 18.12  ? 498  SER A CA    1 
ATOM   3847  C C     . SER A 1 498 ? -6.076  21.444  29.627  1.00 18.37  ? 498  SER A C     1 
ATOM   3848  O O     . SER A 1 498 ? -5.933  22.638  29.351  1.00 19.09  ? 498  SER A O     1 
ATOM   3849  C CB    . SER A 1 498 ? -6.036  20.090  27.535  1.00 18.17  ? 498  SER A CB    1 
ATOM   3850  O OG    . SER A 1 498 ? -7.408  19.783  27.782  1.00 16.46  ? 498  SER A OG    1 
ATOM   3851  N N     . GLY A 1 499 ? -6.923  21.021  30.562  1.00 18.17  ? 499  GLY A N     1 
ATOM   3852  C CA    . GLY A 1 499 ? -7.852  21.945  31.226  1.00 18.64  ? 499  GLY A CA    1 
ATOM   3853  C C     . GLY A 1 499 ? -9.114  22.248  30.423  1.00 18.84  ? 499  GLY A C     1 
ATOM   3854  O O     . GLY A 1 499 ? -9.954  23.032  30.862  1.00 18.98  ? 499  GLY A O     1 
ATOM   3855  N N     . ASP A 1 500 ? -9.252  21.614  29.257  1.00 18.98  ? 500  ASP A N     1 
ATOM   3856  C CA    . ASP A 1 500 ? -10.461 21.697  28.424  1.00 19.34  ? 500  ASP A CA    1 
ATOM   3857  C C     . ASP A 1 500 ? -11.399 20.499  28.582  1.00 19.30  ? 500  ASP A C     1 
ATOM   3858  O O     . ASP A 1 500 ? -10.975 19.396  28.922  1.00 19.76  ? 500  ASP A O     1 
ATOM   3859  C CB    . ASP A 1 500 ? -10.082 21.795  26.940  1.00 18.96  ? 500  ASP A CB    1 
ATOM   3860  C CG    . ASP A 1 500 ? -9.621  23.172  26.544  1.00 20.33  ? 500  ASP A CG    1 
ATOM   3861  O OD1   . ASP A 1 500 ? -10.282 24.172  26.930  1.00 20.22  ? 500  ASP A OD1   1 
ATOM   3862  O OD2   . ASP A 1 500 ? -8.598  23.254  25.832  1.00 19.55  ? 500  ASP A OD2   1 
ATOM   3863  N N     . GLY A 1 501 ? -12.677 20.721  28.313  1.00 19.32  ? 501  GLY A N     1 
ATOM   3864  C CA    . GLY A 1 501 ? -13.613 19.623  28.141  1.00 19.85  ? 501  GLY A CA    1 
ATOM   3865  C C     . GLY A 1 501 ? -13.813 19.398  26.654  1.00 20.25  ? 501  GLY A C     1 
ATOM   3866  O O     . GLY A 1 501 ? -13.515 20.286  25.838  1.00 20.34  ? 501  GLY A O     1 
ATOM   3867  N N     . ALA A 1 502 ? -14.300 18.213  26.292  1.00 20.32  ? 502  ALA A N     1 
ATOM   3868  C CA    . ALA A 1 502 ? -14.619 17.901  24.892  1.00 20.52  ? 502  ALA A CA    1 
ATOM   3869  C C     . ALA A 1 502 ? -15.627 16.778  24.791  1.00 20.95  ? 502  ALA A C     1 
ATOM   3870  O O     . ALA A 1 502 ? -15.729 15.959  25.693  1.00 21.43  ? 502  ALA A O     1 
ATOM   3871  C CB    . ALA A 1 502 ? -13.356 17.546  24.108  1.00 20.14  ? 502  ALA A CB    1 
ATOM   3872  N N     . ARG A 1 503 ? -16.385 16.752  23.701  1.00 21.50  ? 503  ARG A N     1 
ATOM   3873  C CA    . ARG A 1 503 ? -17.136 15.559  23.347  1.00 22.36  ? 503  ARG A CA    1 
ATOM   3874  C C     . ARG A 1 503 ? -16.516 14.874  22.137  1.00 21.38  ? 503  ARG A C     1 
ATOM   3875  O O     . ARG A 1 503 ? -15.898 15.529  21.294  1.00 20.69  ? 503  ARG A O     1 
ATOM   3876  C CB    . ARG A 1 503 ? -18.639 15.840  23.174  1.00 22.48  ? 503  ARG A CB    1 
ATOM   3877  C CG    . ARG A 1 503 ? -19.143 16.119  21.781  1.00 25.24  ? 503  ARG A CG    1 
ATOM   3878  C CD    . ARG A 1 503 ? -20.684 16.295  21.804  1.00 25.41  ? 503  ARG A CD    1 
ATOM   3879  N NE    . ARG A 1 503 ? -21.158 17.158  20.719  1.00 31.37  ? 503  ARG A NE    1 
ATOM   3880  C CZ    . ARG A 1 503 ? -21.048 18.496  20.695  1.00 34.00  ? 503  ARG A CZ    1 
ATOM   3881  N NH1   . ARG A 1 503 ? -20.459 19.160  21.695  1.00 33.32  ? 503  ARG A NH1   1 
ATOM   3882  N NH2   . ARG A 1 503 ? -21.524 19.180  19.653  1.00 35.00  ? 503  ARG A NH2   1 
ATOM   3883  N N     . ARG A 1 504 ? -16.643 13.550  22.092  1.00 20.48  ? 504  ARG A N     1 
ATOM   3884  C CA    . ARG A 1 504 ? -16.227 12.763  20.935  1.00 20.32  ? 504  ARG A CA    1 
ATOM   3885  C C     . ARG A 1 504 ? -17.474 12.124  20.358  1.00 20.31  ? 504  ARG A C     1 
ATOM   3886  O O     . ARG A 1 504 ? -18.292 11.574  21.102  1.00 20.62  ? 504  ARG A O     1 
ATOM   3887  C CB    . ARG A 1 504 ? -15.208 11.684  21.329  1.00 20.49  ? 504  ARG A CB    1 
ATOM   3888  C CG    . ARG A 1 504 ? -14.583 10.928  20.135  1.00 19.95  ? 504  ARG A CG    1 
ATOM   3889  C CD    . ARG A 1 504 ? -13.526 9.891   20.576  1.00 20.48  ? 504  ARG A CD    1 
ATOM   3890  N NE    . ARG A 1 504 ? -14.031 9.006   21.630  1.00 20.42  ? 504  ARG A NE    1 
ATOM   3891  C CZ    . ARG A 1 504 ? -13.451 8.811   22.813  1.00 20.49  ? 504  ARG A CZ    1 
ATOM   3892  N NH1   . ARG A 1 504 ? -12.295 9.400   23.129  1.00 19.10  ? 504  ARG A NH1   1 
ATOM   3893  N NH2   . ARG A 1 504 ? -14.028 7.996   23.678  1.00 20.80  ? 504  ARG A NH2   1 
ATOM   3894  N N     . ASP A 1 505 ? -17.650 12.231  19.046  1.00 19.96  ? 505  ASP A N     1 
ATOM   3895  C CA    . ASP A 1 505 ? -18.837 11.666  18.431  1.00 19.96  ? 505  ASP A CA    1 
ATOM   3896  C C     . ASP A 1 505 ? -18.553 10.256  17.907  1.00 20.27  ? 505  ASP A C     1 
ATOM   3897  O O     . ASP A 1 505 ? -17.451 9.715   18.101  1.00 19.83  ? 505  ASP A O     1 
ATOM   3898  C CB    . ASP A 1 505 ? -19.452 12.614  17.369  1.00 19.65  ? 505  ASP A CB    1 
ATOM   3899  C CG    . ASP A 1 505 ? -18.570 12.813  16.133  1.00 19.19  ? 505  ASP A CG    1 
ATOM   3900  O OD1   . ASP A 1 505 ? -17.703 11.960  15.821  1.00 18.27  ? 505  ASP A OD1   1 
ATOM   3901  O OD2   . ASP A 1 505 ? -18.769 13.843  15.446  1.00 18.44  ? 505  ASP A OD2   1 
ATOM   3902  N N     . GLU A 1 506 ? -19.557 9.674   17.262  1.00 21.01  ? 506  GLU A N     1 
ATOM   3903  C CA    . GLU A 1 506 ? -19.511 8.298   16.752  1.00 21.97  ? 506  GLU A CA    1 
ATOM   3904  C C     . GLU A 1 506 ? -18.454 8.082   15.664  1.00 21.98  ? 506  GLU A C     1 
ATOM   3905  O O     . GLU A 1 506 ? -18.001 6.950   15.456  1.00 22.33  ? 506  GLU A O     1 
ATOM   3906  C CB    . GLU A 1 506 ? -20.891 7.882   16.224  1.00 22.11  ? 506  GLU A CB    1 
ATOM   3907  C CG    . GLU A 1 506 ? -22.015 7.858   17.263  1.00 25.00  ? 506  GLU A CG    1 
ATOM   3908  C CD    . GLU A 1 506 ? -22.558 9.248   17.646  1.00 30.52  ? 506  GLU A CD    1 
ATOM   3909  O OE1   . GLU A 1 506 ? -23.350 9.304   18.620  1.00 32.49  ? 506  GLU A OE1   1 
ATOM   3910  O OE2   . GLU A 1 506 ? -22.207 10.274  16.992  1.00 30.95  ? 506  GLU A OE2   1 
ATOM   3911  N N     . ASP A 1 507 ? -18.069 9.154   14.967  1.00 21.90  ? 507  ASP A N     1 
ATOM   3912  C CA    . ASP A 1 507 ? -16.981 9.084   13.980  1.00 21.72  ? 507  ASP A CA    1 
ATOM   3913  C C     . ASP A 1 507 ? -15.594 9.229   14.619  1.00 21.75  ? 507  ASP A C     1 
ATOM   3914  O O     . ASP A 1 507 ? -14.569 9.071   13.931  1.00 21.95  ? 507  ASP A O     1 
ATOM   3915  C CB    . ASP A 1 507 ? -17.136 10.174  12.913  1.00 21.95  ? 507  ASP A CB    1 
ATOM   3916  C CG    . ASP A 1 507 ? -18.251 9.889   11.928  1.00 23.03  ? 507  ASP A CG    1 
ATOM   3917  O OD1   . ASP A 1 507 ? -18.393 8.732   11.461  1.00 24.53  ? 507  ASP A OD1   1 
ATOM   3918  O OD2   . ASP A 1 507 ? -18.991 10.839  11.611  1.00 24.49  ? 507  ASP A OD2   1 
ATOM   3919  N N     . GLY A 1 508 ? -15.548 9.534   15.919  1.00 21.11  ? 508  GLY A N     1 
ATOM   3920  C CA    . GLY A 1 508 ? -14.268 9.823   16.582  1.00 20.49  ? 508  GLY A CA    1 
ATOM   3921  C C     . GLY A 1 508 ? -13.839 11.281  16.449  1.00 20.29  ? 508  GLY A C     1 
ATOM   3922  O O     . GLY A 1 508 ? -12.697 11.626  16.759  1.00 19.92  ? 508  GLY A O     1 
ATOM   3923  N N     . TYR A 1 509 ? -14.751 12.141  15.987  1.00 19.82  ? 509  TYR A N     1 
ATOM   3924  C CA    . TYR A 1 509 ? -14.467 13.574  15.880  1.00 19.78  ? 509  TYR A CA    1 
ATOM   3925  C C     . TYR A 1 509 ? -14.615 14.244  17.240  1.00 19.88  ? 509  TYR A C     1 
ATOM   3926  O O     . TYR A 1 509 ? -15.608 14.014  17.954  1.00 20.08  ? 509  TYR A O     1 
ATOM   3927  C CB    . TYR A 1 509 ? -15.421 14.264  14.902  1.00 19.37  ? 509  TYR A CB    1 
ATOM   3928  C CG    . TYR A 1 509 ? -15.108 14.118  13.421  1.00 19.94  ? 509  TYR A CG    1 
ATOM   3929  C CD1   . TYR A 1 509 ? -14.709 12.893  12.873  1.00 19.21  ? 509  TYR A CD1   1 
ATOM   3930  C CD2   . TYR A 1 509 ? -15.270 15.206  12.555  1.00 19.46  ? 509  TYR A CD2   1 
ATOM   3931  C CE1   . TYR A 1 509 ? -14.465 12.768  11.503  1.00 19.64  ? 509  TYR A CE1   1 
ATOM   3932  C CE2   . TYR A 1 509 ? -15.029 15.093  11.192  1.00 18.84  ? 509  TYR A CE2   1 
ATOM   3933  C CZ    . TYR A 1 509 ? -14.623 13.879  10.672  1.00 19.76  ? 509  TYR A CZ    1 
ATOM   3934  O OH    . TYR A 1 509 ? -14.386 13.781  9.330   1.00 18.66  ? 509  TYR A OH    1 
ATOM   3935  N N     . TYR A 1 510 ? -13.650 15.098  17.572  1.00 19.16  ? 510  TYR A N     1 
ATOM   3936  C CA    . TYR A 1 510 ? -13.675 15.856  18.823  1.00 19.35  ? 510  TYR A CA    1 
ATOM   3937  C C     . TYR A 1 510 ? -14.347 17.223  18.667  1.00 19.60  ? 510  TYR A C     1 
ATOM   3938  O O     . TYR A 1 510 ? -14.143 17.917  17.667  1.00 19.36  ? 510  TYR A O     1 
ATOM   3939  C CB    . TYR A 1 510 ? -12.250 16.003  19.381  1.00 19.04  ? 510  TYR A CB    1 
ATOM   3940  C CG    . TYR A 1 510 ? -11.700 14.704  19.950  1.00 18.81  ? 510  TYR A CG    1 
ATOM   3941  C CD1   . TYR A 1 510 ? -11.070 13.763  19.126  1.00 16.69  ? 510  TYR A CD1   1 
ATOM   3942  C CD2   . TYR A 1 510 ? -11.838 14.407  21.314  1.00 17.45  ? 510  TYR A CD2   1 
ATOM   3943  C CE1   . TYR A 1 510 ? -10.563 12.563  19.653  1.00 17.54  ? 510  TYR A CE1   1 
ATOM   3944  C CE2   . TYR A 1 510 ? -11.348 13.206  21.851  1.00 17.91  ? 510  TYR A CE2   1 
ATOM   3945  C CZ    . TYR A 1 510 ? -10.714 12.293  21.019  1.00 18.19  ? 510  TYR A CZ    1 
ATOM   3946  O OH    . TYR A 1 510 ? -10.232 11.114  21.557  1.00 18.35  ? 510  TYR A OH    1 
ATOM   3947  N N     . TRP A 1 511 ? -15.158 17.580  19.660  1.00 20.00  ? 511  TRP A N     1 
ATOM   3948  C CA    . TRP A 1 511 ? -15.802 18.877  19.738  1.00 20.84  ? 511  TRP A CA    1 
ATOM   3949  C C     . TRP A 1 511 ? -15.397 19.488  21.082  1.00 22.03  ? 511  TRP A C     1 
ATOM   3950  O O     . TRP A 1 511 ? -15.843 19.036  22.143  1.00 21.40  ? 511  TRP A O     1 
ATOM   3951  C CB    . TRP A 1 511 ? -17.333 18.749  19.638  1.00 20.24  ? 511  TRP A CB    1 
ATOM   3952  C CG    . TRP A 1 511 ? -17.847 18.016  18.406  1.00 19.34  ? 511  TRP A CG    1 
ATOM   3953  C CD1   . TRP A 1 511 ? -17.769 16.668  18.160  1.00 19.47  ? 511  TRP A CD1   1 
ATOM   3954  C CD2   . TRP A 1 511 ? -18.551 18.584  17.291  1.00 20.05  ? 511  TRP A CD2   1 
ATOM   3955  N NE1   . TRP A 1 511 ? -18.364 16.364  16.955  1.00 19.43  ? 511  TRP A NE1   1 
ATOM   3956  C CE2   . TRP A 1 511 ? -18.852 17.521  16.398  1.00 19.77  ? 511  TRP A CE2   1 
ATOM   3957  C CE3   . TRP A 1 511 ? -18.946 19.892  16.948  1.00 18.99  ? 511  TRP A CE3   1 
ATOM   3958  C CZ2   . TRP A 1 511 ? -19.527 17.725  15.185  1.00 18.82  ? 511  TRP A CZ2   1 
ATOM   3959  C CZ3   . TRP A 1 511 ? -19.623 20.094  15.739  1.00 19.80  ? 511  TRP A CZ3   1 
ATOM   3960  C CH2   . TRP A 1 511 ? -19.912 19.017  14.876  1.00 18.97  ? 511  TRP A CH2   1 
ATOM   3961  N N     . ILE A 1 512 ? -14.524 20.494  21.022  1.00 22.92  ? 512  ILE A N     1 
ATOM   3962  C CA    . ILE A 1 512 ? -13.966 21.107  22.219  1.00 24.41  ? 512  ILE A CA    1 
ATOM   3963  C C     . ILE A 1 512 ? -14.933 22.155  22.728  1.00 24.68  ? 512  ILE A C     1 
ATOM   3964  O O     . ILE A 1 512 ? -15.262 23.106  22.026  1.00 25.63  ? 512  ILE A O     1 
ATOM   3965  C CB    . ILE A 1 512 ? -12.565 21.733  21.985  1.00 24.66  ? 512  ILE A CB    1 
ATOM   3966  C CG1   . ILE A 1 512 ? -11.482 20.648  21.849  1.00 25.50  ? 512  ILE A CG1   1 
ATOM   3967  C CG2   . ILE A 1 512 ? -12.183 22.622  23.179  1.00 25.92  ? 512  ILE A CG2   1 
ATOM   3968  C CD1   . ILE A 1 512 ? -11.473 19.900  20.548  1.00 27.72  ? 512  ILE A CD1   1 
ATOM   3969  N N     . THR A 1 513 ? -15.387 21.969  23.960  1.00 24.96  ? 513  THR A N     1 
ATOM   3970  C CA    . THR A 1 513 ? -16.433 22.805  24.515  1.00 24.71  ? 513  THR A CA    1 
ATOM   3971  C C     . THR A 1 513 ? -15.918 23.967  25.367  1.00 24.83  ? 513  THR A C     1 
ATOM   3972  O O     . THR A 1 513 ? -16.681 24.879  25.689  1.00 25.89  ? 513  THR A O     1 
ATOM   3973  C CB    . THR A 1 513 ? -17.439 21.959  25.297  1.00 24.69  ? 513  THR A CB    1 
ATOM   3974  O OG1   . THR A 1 513 ? -16.731 21.010  26.103  1.00 25.13  ? 513  THR A OG1   1 
ATOM   3975  C CG2   . THR A 1 513 ? -18.329 21.194  24.321  1.00 24.35  ? 513  THR A CG2   1 
ATOM   3976  N N     . GLY A 1 514 ? -14.637 23.940  25.723  1.00 23.79  ? 514  GLY A N     1 
ATOM   3977  C CA    . GLY A 1 514 ? -14.035 25.031  26.483  1.00 22.76  ? 514  GLY A CA    1 
ATOM   3978  C C     . GLY A 1 514 ? -13.370 24.592  27.775  1.00 21.95  ? 514  GLY A C     1 
ATOM   3979  O O     . GLY A 1 514 ? -13.387 23.413  28.138  1.00 21.14  ? 514  GLY A O     1 
ATOM   3980  N N     . ARG A 1 515 ? -12.777 25.554  28.472  1.00 21.36  ? 515  ARG A N     1 
ATOM   3981  C CA    . ARG A 1 515 ? -12.089 25.277  29.720  1.00 20.97  ? 515  ARG A CA    1 
ATOM   3982  C C     . ARG A 1 515 ? -13.038 24.683  30.767  1.00 21.61  ? 515  ARG A C     1 
ATOM   3983  O O     . ARG A 1 515 ? -14.183 25.133  30.912  1.00 21.41  ? 515  ARG A O     1 
ATOM   3984  C CB    . ARG A 1 515 ? -11.451 26.553  30.265  1.00 20.77  ? 515  ARG A CB    1 
ATOM   3985  C CG    . ARG A 1 515 ? -10.470 27.263  29.309  1.00 20.00  ? 515  ARG A CG    1 
ATOM   3986  C CD    . ARG A 1 515 ? -9.260  26.396  28.958  1.00 21.11  ? 515  ARG A CD    1 
ATOM   3987  N NE    . ARG A 1 515 ? -8.402  26.072  30.101  1.00 20.74  ? 515  ARG A NE    1 
ATOM   3988  C CZ    . ARG A 1 515 ? -7.076  25.986  30.014  1.00 22.62  ? 515  ARG A CZ    1 
ATOM   3989  N NH1   . ARG A 1 515 ? -6.471  26.216  28.847  1.00 22.19  ? 515  ARG A NH1   1 
ATOM   3990  N NH2   . ARG A 1 515 ? -6.346  25.695  31.083  1.00 21.70  ? 515  ARG A NH2   1 
ATOM   3991  N N     . VAL A 1 516 ? -12.561 23.676  31.492  1.00 21.61  ? 516  VAL A N     1 
ATOM   3992  C CA    . VAL A 1 516 ? -13.300 23.164  32.646  1.00 21.82  ? 516  VAL A CA    1 
ATOM   3993  C C     . VAL A 1 516 ? -12.666 23.676  33.937  1.00 21.81  ? 516  VAL A C     1 
ATOM   3994  O O     . VAL A 1 516 ? -13.162 23.419  35.027  1.00 21.37  ? 516  VAL A O     1 
ATOM   3995  C CB    . VAL A 1 516 ? -13.414 21.600  32.663  1.00 22.08  ? 516  VAL A CB    1 
ATOM   3996  C CG1   . VAL A 1 516 ? -14.340 21.109  31.535  1.00 22.63  ? 516  VAL A CG1   1 
ATOM   3997  C CG2   . VAL A 1 516 ? -12.048 20.940  32.593  1.00 21.31  ? 516  VAL A CG2   1 
ATOM   3998  N N     . ASP A 1 517 ? -11.552 24.383  33.809  1.00 22.03  ? 517  ASP A N     1 
ATOM   3999  C CA    . ASP A 1 517 ? -10.916 24.970  34.982  1.00 22.72  ? 517  ASP A CA    1 
ATOM   4000  C C     . ASP A 1 517 ? -11.322 26.448  35.071  1.00 23.28  ? 517  ASP A C     1 
ATOM   4001  O O     . ASP A 1 517 ? -12.228 26.896  34.346  1.00 23.79  ? 517  ASP A O     1 
ATOM   4002  C CB    . ASP A 1 517 ? -9.393  24.753  34.956  1.00 22.64  ? 517  ASP A CB    1 
ATOM   4003  C CG    . ASP A 1 517 ? -8.745  25.250  33.672  1.00 22.64  ? 517  ASP A CG    1 
ATOM   4004  O OD1   . ASP A 1 517 ? -7.531  25.040  33.498  1.00 22.58  ? 517  ASP A OD1   1 
ATOM   4005  O OD2   . ASP A 1 517 ? -9.446  25.857  32.835  1.00 23.83  ? 517  ASP A OD2   1 
ATOM   4006  N N     . ASP A 1 518 ? -10.681 27.211  35.949  1.00 23.39  ? 518  ASP A N     1 
ATOM   4007  C CA    . ASP A 1 518 ? -11.138 28.571  36.198  1.00 23.65  ? 518  ASP A CA    1 
ATOM   4008  C C     . ASP A 1 518 ? -10.384 29.553  35.305  1.00 23.31  ? 518  ASP A C     1 
ATOM   4009  O O     . ASP A 1 518 ? -9.745  30.505  35.776  1.00 23.40  ? 518  ASP A O     1 
ATOM   4010  C CB    . ASP A 1 518 ? -11.006 28.908  37.681  1.00 24.07  ? 518  ASP A CB    1 
ATOM   4011  C CG    . ASP A 1 518 ? -11.969 28.105  38.545  1.00 26.47  ? 518  ASP A CG    1 
ATOM   4012  O OD1   . ASP A 1 518 ? -13.199 28.180  38.319  1.00 29.07  ? 518  ASP A OD1   1 
ATOM   4013  O OD2   . ASP A 1 518 ? -11.490 27.393  39.447  1.00 29.53  ? 518  ASP A OD2   1 
ATOM   4014  N N     . VAL A 1 519 ? -10.457 29.285  34.005  1.00 22.77  ? 519  VAL A N     1 
ATOM   4015  C CA    . VAL A 1 519 ? -9.769  30.081  32.990  1.00 22.31  ? 519  VAL A CA    1 
ATOM   4016  C C     . VAL A 1 519 ? -10.827 30.555  32.011  1.00 22.25  ? 519  VAL A C     1 
ATOM   4017  O O     . VAL A 1 519 ? -11.662 29.770  31.562  1.00 21.67  ? 519  VAL A O     1 
ATOM   4018  C CB    . VAL A 1 519 ? -8.664  29.250  32.280  1.00 22.07  ? 519  VAL A CB    1 
ATOM   4019  C CG1   . VAL A 1 519 ? -8.088  29.982  31.046  1.00 22.08  ? 519  VAL A CG1   1 
ATOM   4020  C CG2   . VAL A 1 519 ? -7.556  28.909  33.252  1.00 20.84  ? 519  VAL A CG2   1 
ATOM   4021  N N     . LEU A 1 520 ? -10.802 31.849  31.715  1.00 22.71  ? 520  LEU A N     1 
ATOM   4022  C CA    . LEU A 1 520 ? -11.749 32.453  30.781  1.00 23.54  ? 520  LEU A CA    1 
ATOM   4023  C C     . LEU A 1 520 ? -11.189 32.545  29.372  1.00 23.41  ? 520  LEU A C     1 
ATOM   4024  O O     . LEU A 1 520 ? -9.976  32.477  29.168  1.00 23.85  ? 520  LEU A O     1 
ATOM   4025  C CB    . LEU A 1 520 ? -12.174 33.852  31.257  1.00 23.67  ? 520  LEU A CB    1 
ATOM   4026  C CG    . LEU A 1 520 ? -12.904 33.952  32.607  1.00 25.36  ? 520  LEU A CG    1 
ATOM   4027  C CD1   . LEU A 1 520 ? -13.563 35.291  32.765  1.00 26.97  ? 520  LEU A CD1   1 
ATOM   4028  C CD2   . LEU A 1 520 ? -13.943 32.856  32.775  1.00 25.74  ? 520  LEU A CD2   1 
ATOM   4029  N N     . ASN A 1 521 ? -12.090 32.708  28.409  1.00 23.17  ? 521  ASN A N     1 
ATOM   4030  C CA    . ASN A 1 521 ? -11.720 33.001  27.038  1.00 23.12  ? 521  ASN A CA    1 
ATOM   4031  C C     . ASN A 1 521 ? -12.490 34.249  26.563  1.00 22.91  ? 521  ASN A C     1 
ATOM   4032  O O     . ASN A 1 521 ? -13.666 34.173  26.209  1.00 22.15  ? 521  ASN A O     1 
ATOM   4033  C CB    . ASN A 1 521 ? -12.011 31.781  26.164  1.00 23.35  ? 521  ASN A CB    1 
ATOM   4034  C CG    . ASN A 1 521 ? -11.326 31.839  24.804  1.00 24.57  ? 521  ASN A CG    1 
ATOM   4035  O OD1   . ASN A 1 521 ? -11.228 32.897  24.183  1.00 25.42  ? 521  ASN A OD1   1 
ATOM   4036  N ND2   . ASN A 1 521 ? -10.875 30.678  24.322  1.00 24.90  ? 521  ASN A ND2   1 
ATOM   4037  N N     . VAL A 1 522 ? -11.807 35.391  26.561  1.00 23.02  ? 522  VAL A N     1 
ATOM   4038  C CA    . VAL A 1 522 ? -12.431 36.699  26.332  1.00 23.44  ? 522  VAL A CA    1 
ATOM   4039  C C     . VAL A 1 522 ? -11.847 37.304  25.062  1.00 23.71  ? 522  VAL A C     1 
ATOM   4040  O O     . VAL A 1 522 ? -10.683 37.728  25.047  1.00 23.83  ? 522  VAL A O     1 
ATOM   4041  C CB    . VAL A 1 522 ? -12.196 37.663  27.533  1.00 23.82  ? 522  VAL A CB    1 
ATOM   4042  C CG1   . VAL A 1 522 ? -13.082 38.923  27.406  1.00 24.55  ? 522  VAL A CG1   1 
ATOM   4043  C CG2   . VAL A 1 522 ? -12.465 36.950  28.881  1.00 24.40  ? 522  VAL A CG2   1 
ATOM   4044  N N     . SER A 1 523 ? -12.650 37.316  23.997  1.00 23.71  ? 523  SER A N     1 
ATOM   4045  C CA    . SER A 1 523 ? -12.219 37.743  22.667  1.00 24.04  ? 523  SER A CA    1 
ATOM   4046  C C     . SER A 1 523 ? -10.936 37.033  22.240  1.00 24.25  ? 523  SER A C     1 
ATOM   4047  O O     . SER A 1 523 ? -10.018 37.659  21.711  1.00 24.46  ? 523  SER A O     1 
ATOM   4048  C CB    . SER A 1 523 ? -12.021 39.270  22.603  1.00 24.15  ? 523  SER A CB    1 
ATOM   4049  O OG    . SER A 1 523 ? -13.164 39.962  23.065  1.00 25.10  ? 523  SER A OG    1 
ATOM   4050  N N     . GLY A 1 524 ? -10.876 35.729  22.489  1.00 24.76  ? 524  GLY A N     1 
ATOM   4051  C CA    . GLY A 1 524 ? -9.724  34.922  22.126  1.00 24.86  ? 524  GLY A CA    1 
ATOM   4052  C C     . GLY A 1 524 ? -8.576  35.019  23.117  1.00 25.36  ? 524  GLY A C     1 
ATOM   4053  O O     . GLY A 1 524 ? -7.525  34.409  22.900  1.00 26.05  ? 524  GLY A O     1 
ATOM   4054  N N     . HIS A 1 525 ? -8.752  35.777  24.200  1.00 24.59  ? 525  HIS A N     1 
ATOM   4055  C CA    . HIS A 1 525 ? -7.686  35.896  25.191  1.00 24.68  ? 525  HIS A CA    1 
ATOM   4056  C C     . HIS A 1 525 ? -7.950  34.977  26.376  1.00 23.95  ? 525  HIS A C     1 
ATOM   4057  O O     . HIS A 1 525 ? -9.011  35.032  27.001  1.00 23.52  ? 525  HIS A O     1 
ATOM   4058  C CB    . HIS A 1 525 ? -7.466  37.345  25.665  1.00 24.70  ? 525  HIS A CB    1 
ATOM   4059  C CG    . HIS A 1 525 ? -7.096  38.296  24.569  1.00 26.88  ? 525  HIS A CG    1 
ATOM   4060  N ND1   . HIS A 1 525 ? -7.825  39.436  24.295  1.00 28.30  ? 525  HIS A ND1   1 
ATOM   4061  C CD2   . HIS A 1 525 ? -6.085  38.270  23.667  1.00 27.76  ? 525  HIS A CD2   1 
ATOM   4062  C CE1   . HIS A 1 525 ? -7.274  40.076  23.278  1.00 29.09  ? 525  HIS A CE1   1 
ATOM   4063  N NE2   . HIS A 1 525 ? -6.219  39.389  22.875  1.00 29.68  ? 525  HIS A NE2   1 
ATOM   4064  N N     . ARG A 1 526 ? -6.956  34.141  26.660  1.00 22.98  ? 526  ARG A N     1 
ATOM   4065  C CA    . ARG A 1 526 ? -6.956  33.234  27.784  1.00 22.06  ? 526  ARG A CA    1 
ATOM   4066  C C     . ARG A 1 526 ? -6.601  34.052  29.027  1.00 22.36  ? 526  ARG A C     1 
ATOM   4067  O O     . ARG A 1 526 ? -5.525  34.659  29.081  1.00 22.53  ? 526  ARG A O     1 
ATOM   4068  C CB    . ARG A 1 526 ? -5.906  32.162  27.510  1.00 21.71  ? 526  ARG A CB    1 
ATOM   4069  C CG    . ARG A 1 526 ? -5.702  31.137  28.597  1.00 20.40  ? 526  ARG A CG    1 
ATOM   4070  C CD    . ARG A 1 526 ? -4.778  30.032  28.096  1.00 18.35  ? 526  ARG A CD    1 
ATOM   4071  N NE    . ARG A 1 526 ? -4.189  29.300  29.210  1.00 15.40  ? 526  ARG A NE    1 
ATOM   4072  C CZ    . ARG A 1 526 ? -3.391  28.242  29.093  1.00 15.42  ? 526  ARG A CZ    1 
ATOM   4073  N NH1   . ARG A 1 526 ? -3.060  27.752  27.894  1.00 13.36  ? 526  ARG A NH1   1 
ATOM   4074  N NH2   . ARG A 1 526 ? -2.919  27.669  30.193  1.00 12.23  ? 526  ARG A NH2   1 
ATOM   4075  N N     . LEU A 1 527 ? -7.510  34.085  30.002  1.00 22.12  ? 527  LEU A N     1 
ATOM   4076  C CA    . LEU A 1 527 ? -7.319  34.823  31.268  1.00 22.86  ? 527  LEU A CA    1 
ATOM   4077  C C     . LEU A 1 527 ? -7.765  34.011  32.483  1.00 22.58  ? 527  LEU A C     1 
ATOM   4078  O O     . LEU A 1 527 ? -8.829  33.401  32.459  1.00 22.55  ? 527  LEU A O     1 
ATOM   4079  C CB    . LEU A 1 527 ? -8.121  36.135  31.266  1.00 22.95  ? 527  LEU A CB    1 
ATOM   4080  C CG    . LEU A 1 527 ? -7.649  37.252  30.340  1.00 25.15  ? 527  LEU A CG    1 
ATOM   4081  C CD1   . LEU A 1 527 ? -8.738  38.306  30.218  1.00 25.63  ? 527  LEU A CD1   1 
ATOM   4082  C CD2   . LEU A 1 527 ? -6.336  37.862  30.854  1.00 25.99  ? 527  LEU A CD2   1 
ATOM   4083  N N     . GLY A 1 528 ? -6.978  34.045  33.555  1.00 22.42  ? 528  GLY A N     1 
ATOM   4084  C CA    . GLY A 1 528 ? -7.360  33.397  34.813  1.00 22.27  ? 528  GLY A CA    1 
ATOM   4085  C C     . GLY A 1 528 ? -8.370  34.224  35.589  1.00 23.00  ? 528  GLY A C     1 
ATOM   4086  O O     . GLY A 1 528 ? -8.234  35.444  35.684  1.00 23.21  ? 528  GLY A O     1 
ATOM   4087  N N     . THR A 1 529 ? -9.393  33.575  36.143  1.00 23.38  ? 529  THR A N     1 
ATOM   4088  C CA    . THR A 1 529 ? -10.359 34.279  37.013  1.00 24.08  ? 529  THR A CA    1 
ATOM   4089  C C     . THR A 1 529 ? -9.678  34.814  38.280  1.00 24.49  ? 529  THR A C     1 
ATOM   4090  O O     . THR A 1 529 ? -9.984  35.919  38.738  1.00 23.85  ? 529  THR A O     1 
ATOM   4091  C CB    . THR A 1 529 ? -11.584 33.403  37.391  1.00 23.89  ? 529  THR A CB    1 
ATOM   4092  O OG1   . THR A 1 529 ? -11.152 32.143  37.925  1.00 25.19  ? 529  THR A OG1   1 
ATOM   4093  C CG2   . THR A 1 529 ? -12.454 33.156  36.175  1.00 23.46  ? 529  THR A CG2   1 
ATOM   4094  N N     . ALA A 1 530 ? -8.732  34.037  38.811  1.00 24.98  ? 530  ALA A N     1 
ATOM   4095  C CA    . ALA A 1 530 ? -7.997  34.415  40.011  1.00 26.07  ? 530  ALA A CA    1 
ATOM   4096  C C     . ALA A 1 530 ? -7.124  35.657  39.835  1.00 26.86  ? 530  ALA A C     1 
ATOM   4097  O O     . ALA A 1 530 ? -7.047  36.473  40.755  1.00 27.40  ? 530  ALA A O     1 
ATOM   4098  C CB    . ALA A 1 530 ? -7.173  33.240  40.535  1.00 26.22  ? 530  ALA A CB    1 
ATOM   4099  N N     . GLU A 1 531 ? -6.475  35.820  38.677  1.00 26.86  ? 531  GLU A N     1 
ATOM   4100  C CA    . GLU A 1 531 ? -5.655  37.023  38.465  1.00 27.05  ? 531  GLU A CA    1 
ATOM   4101  C C     . GLU A 1 531 ? -6.505  38.308  38.409  1.00 26.38  ? 531  GLU A C     1 
ATOM   4102  O O     . GLU A 1 531 ? -6.088  39.354  38.896  1.00 25.83  ? 531  GLU A O     1 
ATOM   4103  C CB    . GLU A 1 531 ? -4.712  36.893  37.252  1.00 27.11  ? 531  GLU A CB    1 
ATOM   4104  C CG    . GLU A 1 531 ? -5.371  36.924  35.870  1.00 28.63  ? 531  GLU A CG    1 
ATOM   4105  C CD    . GLU A 1 531 ? -4.387  36.551  34.747  1.00 28.28  ? 531  GLU A CD    1 
ATOM   4106  O OE1   . GLU A 1 531 ? -3.420  37.315  34.527  1.00 27.91  ? 531  GLU A OE1   1 
ATOM   4107  O OE2   . GLU A 1 531 ? -4.582  35.492  34.096  1.00 28.03  ? 531  GLU A OE2   1 
ATOM   4108  N N     . ILE A 1 532 ? -7.702  38.209  37.836  1.00 26.13  ? 532  ILE A N     1 
ATOM   4109  C CA    . ILE A 1 532 ? -8.648  39.323  37.819  1.00 26.05  ? 532  ILE A CA    1 
ATOM   4110  C C     . ILE A 1 532 ? -9.153  39.626  39.244  1.00 26.28  ? 532  ILE A C     1 
ATOM   4111  O O     . ILE A 1 532 ? -9.279  40.790  39.630  1.00 26.05  ? 532  ILE A O     1 
ATOM   4112  C CB    . ILE A 1 532 ? -9.815  39.078  36.833  1.00 26.16  ? 532  ILE A CB    1 
ATOM   4113  C CG1   . ILE A 1 532 ? -9.266  38.800  35.428  1.00 26.00  ? 532  ILE A CG1   1 
ATOM   4114  C CG2   . ILE A 1 532 ? -10.777 40.288  36.808  1.00 25.50  ? 532  ILE A CG2   1 
ATOM   4115  C CD1   . ILE A 1 532 ? -10.304 38.375  34.406  1.00 26.27  ? 532  ILE A CD1   1 
ATOM   4116  N N     . GLU A 1 533 ? -9.408  38.572  40.022  1.00 26.09  ? 533  GLU A N     1 
ATOM   4117  C CA    . GLU A 1 533 ? -9.800  38.714  41.422  1.00 26.53  ? 533  GLU A CA    1 
ATOM   4118  C C     . GLU A 1 533 ? -8.724  39.429  42.246  1.00 26.90  ? 533  GLU A C     1 
ATOM   4119  O O     . GLU A 1 533 ? -9.042  40.322  43.041  1.00 26.98  ? 533  GLU A O     1 
ATOM   4120  C CB    . GLU A 1 533 ? -10.145 37.347  42.031  1.00 26.36  ? 533  GLU A CB    1 
ATOM   4121  C CG    . GLU A 1 533 ? -11.458 36.770  41.507  1.00 26.20  ? 533  GLU A CG    1 
ATOM   4122  C CD    . GLU A 1 533 ? -11.695 35.306  41.894  1.00 26.95  ? 533  GLU A CD    1 
ATOM   4123  O OE1   . GLU A 1 533 ? -10.904 34.730  42.667  1.00 27.87  ? 533  GLU A OE1   1 
ATOM   4124  O OE2   . GLU A 1 533 ? -12.702 34.734  41.433  1.00 25.75  ? 533  GLU A OE2   1 
ATOM   4125  N N     . SER A 1 534 ? -7.458  39.056  42.032  1.00 27.01  ? 534  SER A N     1 
ATOM   4126  C CA    . SER A 1 534 ? -6.317  39.710  42.692  1.00 27.72  ? 534  SER A CA    1 
ATOM   4127  C C     . SER A 1 534 ? -6.197  41.188  42.309  1.00 26.96  ? 534  SER A C     1 
ATOM   4128  O O     . SER A 1 534 ? -6.013  42.050  43.167  1.00 26.88  ? 534  SER A O     1 
ATOM   4129  C CB    . SER A 1 534 ? -5.014  38.979  42.359  1.00 27.85  ? 534  SER A CB    1 
ATOM   4130  O OG    . SER A 1 534 ? -5.081  37.643  42.823  1.00 31.32  ? 534  SER A OG    1 
ATOM   4131  N N     . ALA A 1 535 ? -6.299  41.466  41.017  1.00 26.61  ? 535  ALA A N     1 
ATOM   4132  C CA    . ALA A 1 535 ? -6.313  42.839  40.521  1.00 26.81  ? 535  ALA A CA    1 
ATOM   4133  C C     . ALA A 1 535 ? -7.426  43.667  41.183  1.00 26.76  ? 535  ALA A C     1 
ATOM   4134  O O     . ALA A 1 535 ? -7.176  44.780  41.650  1.00 26.98  ? 535  ALA A O     1 
ATOM   4135  C CB    . ALA A 1 535 ? -6.438  42.860  38.997  1.00 26.48  ? 535  ALA A CB    1 
ATOM   4136  N N     . LEU A 1 536 ? -8.638  43.112  41.248  1.00 26.71  ? 536  LEU A N     1 
ATOM   4137  C CA    . LEU A 1 536 ? -9.773  43.790  41.903  1.00 26.57  ? 536  LEU A CA    1 
ATOM   4138  C C     . LEU A 1 536 ? -9.519  44.038  43.391  1.00 26.75  ? 536  LEU A C     1 
ATOM   4139  O O     . LEU A 1 536 ? -9.687  45.153  43.872  1.00 27.14  ? 536  LEU A O     1 
ATOM   4140  C CB    . LEU A 1 536 ? -11.069 42.990  41.725  1.00 26.45  ? 536  LEU A CB    1 
ATOM   4141  C CG    . LEU A 1 536 ? -11.686 42.966  40.325  1.00 26.05  ? 536  LEU A CG    1 
ATOM   4142  C CD1   . LEU A 1 536 ? -12.661 41.817  40.183  1.00 24.24  ? 536  LEU A CD1   1 
ATOM   4143  C CD2   . LEU A 1 536 ? -12.373 44.303  40.044  1.00 25.80  ? 536  LEU A CD2   1 
ATOM   4144  N N     . VAL A 1 537 ? -9.098  42.994  44.105  1.00 26.37  ? 537  VAL A N     1 
ATOM   4145  C CA    . VAL A 1 537 ? -8.843  43.068  45.544  1.00 26.37  ? 537  VAL A CA    1 
ATOM   4146  C C     . VAL A 1 537 ? -7.721  44.057  45.896  1.00 26.56  ? 537  VAL A C     1 
ATOM   4147  O O     . VAL A 1 537 ? -7.743  44.667  46.966  1.00 26.47  ? 537  VAL A O     1 
ATOM   4148  C CB    . VAL A 1 537 ? -8.582  41.648  46.147  1.00 26.27  ? 537  VAL A CB    1 
ATOM   4149  C CG1   . VAL A 1 537 ? -8.031  41.720  47.574  1.00 26.23  ? 537  VAL A CG1   1 
ATOM   4150  C CG2   . VAL A 1 537 ? -9.861  40.822  46.114  1.00 25.71  ? 537  VAL A CG2   1 
ATOM   4151  N N     . ALA A 1 538 ? -6.753  44.235  45.000  1.00 26.68  ? 538  ALA A N     1 
ATOM   4152  C CA    . ALA A 1 538 ? -5.698  45.241  45.220  1.00 26.60  ? 538  ALA A CA    1 
ATOM   4153  C C     . ALA A 1 538 ? -6.244  46.682  45.303  1.00 26.67  ? 538  ALA A C     1 
ATOM   4154  O O     . ALA A 1 538 ? -5.593  47.560  45.879  1.00 26.47  ? 538  ALA A O     1 
ATOM   4155  C CB    . ALA A 1 538 ? -4.613  45.133  44.162  1.00 26.45  ? 538  ALA A CB    1 
ATOM   4156  N N     . HIS A 1 539 ? -7.435  46.921  44.744  1.00 26.64  ? 539  HIS A N     1 
ATOM   4157  C CA    . HIS A 1 539 ? -8.078  48.235  44.853  1.00 26.88  ? 539  HIS A CA    1 
ATOM   4158  C C     . HIS A 1 539 ? -8.431  48.526  46.322  1.00 26.74  ? 539  HIS A C     1 
ATOM   4159  O O     . HIS A 1 539 ? -9.008  47.674  46.995  1.00 26.71  ? 539  HIS A O     1 
ATOM   4160  C CB    . HIS A 1 539 ? -9.331  48.326  43.957  1.00 26.83  ? 539  HIS A CB    1 
ATOM   4161  C CG    . HIS A 1 539 ? -9.911  49.704  43.873  1.00 27.29  ? 539  HIS A CG    1 
ATOM   4162  N ND1   . HIS A 1 539 ? -10.717 50.235  44.860  1.00 27.79  ? 539  HIS A ND1   1 
ATOM   4163  C CD2   . HIS A 1 539 ? -9.782  50.671  42.933  1.00 27.67  ? 539  HIS A CD2   1 
ATOM   4164  C CE1   . HIS A 1 539 ? -11.066 51.465  44.526  1.00 27.46  ? 539  HIS A CE1   1 
ATOM   4165  N NE2   . HIS A 1 539 ? -10.508 51.756  43.364  1.00 28.05  ? 539  HIS A NE2   1 
ATOM   4166  N N     . PRO A 1 540 ? -8.072  49.726  46.826  1.00 27.01  ? 540  PRO A N     1 
ATOM   4167  C CA    . PRO A 1 540 ? -8.289  50.090  48.246  1.00 26.84  ? 540  PRO A CA    1 
ATOM   4168  C C     . PRO A 1 540 ? -9.743  50.094  48.763  1.00 26.98  ? 540  PRO A C     1 
ATOM   4169  O O     . PRO A 1 540 ? -9.951  50.065  49.982  1.00 26.76  ? 540  PRO A O     1 
ATOM   4170  C CB    . PRO A 1 540 ? -7.682  51.501  48.356  1.00 27.16  ? 540  PRO A CB    1 
ATOM   4171  C CG    . PRO A 1 540 ? -7.597  52.016  46.943  1.00 27.32  ? 540  PRO A CG    1 
ATOM   4172  C CD    . PRO A 1 540 ? -7.397  50.803  46.072  1.00 26.89  ? 540  PRO A CD    1 
ATOM   4173  N N     . LYS A 1 541 ? -10.734 50.127  47.871  1.00 26.74  ? 541  LYS A N     1 
ATOM   4174  C CA    . LYS A 1 541 ? -12.140 50.086  48.306  1.00 26.88  ? 541  LYS A CA    1 
ATOM   4175  C C     . LYS A 1 541 ? -12.731 48.676  48.343  1.00 26.19  ? 541  LYS A C     1 
ATOM   4176  O O     . LYS A 1 541 ? -13.765 48.453  48.976  1.00 26.59  ? 541  LYS A O     1 
ATOM   4177  C CB    . LYS A 1 541 ? -13.027 51.001  47.448  1.00 26.79  ? 541  LYS A CB    1 
ATOM   4178  C CG    . LYS A 1 541 ? -12.881 52.492  47.749  1.00 27.65  ? 541  LYS A CG    1 
ATOM   4179  C CD    . LYS A 1 541 ? -13.854 53.305  46.920  1.00 27.90  ? 541  LYS A CD    1 
ATOM   4180  C CE    . LYS A 1 541 ? -13.791 54.794  47.265  1.00 30.77  ? 541  LYS A CE    1 
ATOM   4181  N NZ    . LYS A 1 541 ? -12.620 55.443  46.604  1.00 32.40  ? 541  LYS A NZ    1 
ATOM   4182  N N     . ILE A 1 542 ? -12.065 47.736  47.682  1.00 25.43  ? 542  ILE A N     1 
ATOM   4183  C CA    . ILE A 1 542 ? -12.581 46.379  47.482  1.00 24.62  ? 542  ILE A CA    1 
ATOM   4184  C C     . ILE A 1 542 ? -12.005 45.386  48.496  1.00 24.74  ? 542  ILE A C     1 
ATOM   4185  O O     . ILE A 1 542 ? -10.785 45.305  48.671  1.00 24.17  ? 542  ILE A O     1 
ATOM   4186  C CB    . ILE A 1 542 ? -12.259 45.879  46.044  1.00 24.74  ? 542  ILE A CB    1 
ATOM   4187  C CG1   . ILE A 1 542 ? -12.999 46.727  44.997  1.00 24.68  ? 542  ILE A CG1   1 
ATOM   4188  C CG2   . ILE A 1 542 ? -12.556 44.388  45.904  1.00 24.23  ? 542  ILE A CG2   1 
ATOM   4189  C CD1   . ILE A 1 542 ? -12.721 46.333  43.542  1.00 23.70  ? 542  ILE A CD1   1 
ATOM   4190  N N     . ALA A 1 543 ? -12.893 44.624  49.140  1.00 24.67  ? 543  ALA A N     1 
ATOM   4191  C CA    . ALA A 1 543 ? -12.519 43.626  50.143  1.00 25.10  ? 543  ALA A CA    1 
ATOM   4192  C C     . ALA A 1 543 ? -12.386 42.223  49.551  1.00 25.59  ? 543  ALA A C     1 
ATOM   4193  O O     . ALA A 1 543 ? -11.453 41.477  49.880  1.00 25.81  ? 543  ALA A O     1 
ATOM   4194  C CB    . ALA A 1 543 ? -13.544 43.609  51.272  1.00 25.16  ? 543  ALA A CB    1 
ATOM   4195  N N     . GLU A 1 544 ? -13.334 41.874  48.686  1.00 25.79  ? 544  GLU A N     1 
ATOM   4196  C CA    . GLU A 1 544 ? -13.479 40.519  48.174  1.00 26.11  ? 544  GLU A CA    1 
ATOM   4197  C C     . GLU A 1 544 ? -13.991 40.595  46.740  1.00 25.85  ? 544  GLU A C     1 
ATOM   4198  O O     . GLU A 1 544 ? -14.675 41.552  46.377  1.00 25.48  ? 544  GLU A O     1 
ATOM   4199  C CB    . GLU A 1 544 ? -14.486 39.764  49.049  1.00 26.49  ? 544  GLU A CB    1 
ATOM   4200  C CG    . GLU A 1 544 ? -14.069 38.374  49.441  1.00 29.24  ? 544  GLU A CG    1 
ATOM   4201  C CD    . GLU A 1 544 ? -14.682 37.907  50.765  1.00 31.91  ? 544  GLU A CD    1 
ATOM   4202  O OE1   . GLU A 1 544 ? -15.527 38.613  51.367  1.00 33.22  ? 544  GLU A OE1   1 
ATOM   4203  O OE2   . GLU A 1 544 ? -14.307 36.806  51.208  1.00 33.62  ? 544  GLU A OE2   1 
ATOM   4204  N N     . ALA A 1 545 ? -13.654 39.587  45.931  1.00 25.82  ? 545  ALA A N     1 
ATOM   4205  C CA    . ALA A 1 545 ? -14.107 39.515  44.548  1.00 25.74  ? 545  ALA A CA    1 
ATOM   4206  C C     . ALA A 1 545 ? -14.195 38.079  44.057  1.00 25.74  ? 545  ALA A C     1 
ATOM   4207  O O     . ALA A 1 545 ? -13.315 37.260  44.330  1.00 25.57  ? 545  ALA A O     1 
ATOM   4208  C CB    . ALA A 1 545 ? -13.192 40.332  43.619  1.00 25.66  ? 545  ALA A CB    1 
ATOM   4209  N N     . ALA A 1 546 ? -15.267 37.790  43.325  1.00 25.24  ? 546  ALA A N     1 
ATOM   4210  C CA    . ALA A 1 546 ? -15.407 36.523  42.631  1.00 24.98  ? 546  ALA A CA    1 
ATOM   4211  C C     . ALA A 1 546 ? -15.748 36.818  41.181  1.00 24.86  ? 546  ALA A C     1 
ATOM   4212  O O     . ALA A 1 546 ? -16.706 37.544  40.878  1.00 24.91  ? 546  ALA A O     1 
ATOM   4213  C CB    . ALA A 1 546 ? -16.462 35.666  43.276  1.00 24.77  ? 546  ALA A CB    1 
ATOM   4214  N N     . VAL A 1 547 ? -14.942 36.262  40.288  1.00 24.69  ? 547  VAL A N     1 
ATOM   4215  C CA    . VAL A 1 547 ? -15.059 36.555  38.867  1.00 24.80  ? 547  VAL A CA    1 
ATOM   4216  C C     . VAL A 1 547 ? -15.446 35.284  38.140  1.00 24.60  ? 547  VAL A C     1 
ATOM   4217  O O     . VAL A 1 547 ? -14.864 34.225  38.376  1.00 24.90  ? 547  VAL A O     1 
ATOM   4218  C CB    . VAL A 1 547 ? -13.721 37.057  38.296  1.00 24.44  ? 547  VAL A CB    1 
ATOM   4219  C CG1   . VAL A 1 547 ? -13.795 37.206  36.770  1.00 24.85  ? 547  VAL A CG1   1 
ATOM   4220  C CG2   . VAL A 1 547 ? -13.314 38.360  38.968  1.00 25.26  ? 547  VAL A CG2   1 
ATOM   4221  N N     . VAL A 1 548 ? -16.430 35.407  37.258  1.00 24.29  ? 548  VAL A N     1 
ATOM   4222  C CA    . VAL A 1 548 ? -16.863 34.304  36.405  1.00 24.32  ? 548  VAL A CA    1 
ATOM   4223  C C     . VAL A 1 548 ? -17.025 34.825  34.984  1.00 24.12  ? 548  VAL A C     1 
ATOM   4224  O O     . VAL A 1 548 ? -17.135 36.037  34.768  1.00 23.73  ? 548  VAL A O     1 
ATOM   4225  C CB    . VAL A 1 548 ? -18.227 33.712  36.865  1.00 23.85  ? 548  VAL A CB    1 
ATOM   4226  C CG1   . VAL A 1 548 ? -18.132 33.136  38.258  1.00 25.16  ? 548  VAL A CG1   1 
ATOM   4227  C CG2   . VAL A 1 548 ? -19.329 34.766  36.803  1.00 23.84  ? 548  VAL A CG2   1 
ATOM   4228  N N     . GLY A 1 549 ? -17.075 33.904  34.023  1.00 24.49  ? 549  GLY A N     1 
ATOM   4229  C CA    . GLY A 1 549 ? -17.424 34.253  32.655  1.00 24.59  ? 549  GLY A CA    1 
ATOM   4230  C C     . GLY A 1 549 ? -18.898 34.038  32.360  1.00 25.49  ? 549  GLY A C     1 
ATOM   4231  O O     . GLY A 1 549 ? -19.550 33.146  32.929  1.00 25.34  ? 549  GLY A O     1 
ATOM   4232  N N     . ILE A 1 550 ? -19.431 34.864  31.468  1.00 25.63  ? 550  ILE A N     1 
ATOM   4233  C CA    . ILE A 1 550 ? -20.786 34.682  30.969  1.00 26.04  ? 550  ILE A CA    1 
ATOM   4234  C C     . ILE A 1 550 ? -20.710 34.636  29.451  1.00 26.52  ? 550  ILE A C     1 
ATOM   4235  O O     . ILE A 1 550 ? -19.785 35.214  28.878  1.00 26.45  ? 550  ILE A O     1 
ATOM   4236  C CB    . ILE A 1 550 ? -21.741 35.815  31.441  1.00 26.31  ? 550  ILE A CB    1 
ATOM   4237  C CG1   . ILE A 1 550 ? -21.251 37.202  30.978  1.00 25.73  ? 550  ILE A CG1   1 
ATOM   4238  C CG2   . ILE A 1 550 ? -21.911 35.761  32.965  1.00 25.78  ? 550  ILE A CG2   1 
ATOM   4239  C CD1   . ILE A 1 550 ? -22.313 38.321  31.063  1.00 26.05  ? 550  ILE A CD1   1 
ATOM   4240  N N     . PRO A 1 551 ? -21.660 33.933  28.791  1.00 26.78  ? 551  PRO A N     1 
ATOM   4241  C CA    . PRO A 1 551 ? -21.663 33.926  27.326  1.00 26.93  ? 551  PRO A CA    1 
ATOM   4242  C C     . PRO A 1 551 ? -21.800 35.338  26.785  1.00 27.34  ? 551  PRO A C     1 
ATOM   4243  O O     . PRO A 1 551 ? -22.447 36.183  27.413  1.00 27.58  ? 551  PRO A O     1 
ATOM   4244  C CB    . PRO A 1 551 ? -22.908 33.101  26.970  1.00 27.05  ? 551  PRO A CB    1 
ATOM   4245  C CG    . PRO A 1 551 ? -23.164 32.252  28.182  1.00 27.25  ? 551  PRO A CG    1 
ATOM   4246  C CD    . PRO A 1 551 ? -22.744 33.105  29.352  1.00 26.73  ? 551  PRO A CD    1 
ATOM   4247  N N     . HIS A 1 552 ? -21.172 35.593  25.644  1.00 27.53  ? 552  HIS A N     1 
ATOM   4248  C CA    . HIS A 1 552 ? -21.236 36.896  24.999  1.00 27.88  ? 552  HIS A CA    1 
ATOM   4249  C C     . HIS A 1 552 ? -21.161 36.679  23.494  1.00 27.72  ? 552  HIS A C     1 
ATOM   4250  O O     . HIS A 1 552 ? -20.255 35.997  23.006  1.00 27.97  ? 552  HIS A O     1 
ATOM   4251  C CB    . HIS A 1 552 ? -20.092 37.790  25.480  1.00 28.29  ? 552  HIS A CB    1 
ATOM   4252  C CG    . HIS A 1 552 ? -20.213 39.220  25.041  1.00 30.01  ? 552  HIS A CG    1 
ATOM   4253  N ND1   . HIS A 1 552 ? -20.653 40.224  25.879  1.00 32.16  ? 552  HIS A ND1   1 
ATOM   4254  C CD2   . HIS A 1 552 ? -19.959 39.811  23.850  1.00 30.97  ? 552  HIS A CD2   1 
ATOM   4255  C CE1   . HIS A 1 552 ? -20.660 41.372  25.223  1.00 32.96  ? 552  HIS A CE1   1 
ATOM   4256  N NE2   . HIS A 1 552 ? -20.245 41.148  23.989  1.00 33.13  ? 552  HIS A NE2   1 
ATOM   4257  N N     . ALA A 1 553 ? -22.120 37.241  22.764  1.00 27.23  ? 553  ALA A N     1 
ATOM   4258  C CA    . ALA A 1 553 ? -22.211 37.034  21.320  1.00 27.40  ? 553  ALA A CA    1 
ATOM   4259  C C     . ALA A 1 553 ? -20.932 37.450  20.594  1.00 27.36  ? 553  ALA A C     1 
ATOM   4260  O O     . ALA A 1 553 ? -20.505 36.783  19.664  1.00 27.75  ? 553  ALA A O     1 
ATOM   4261  C CB    . ALA A 1 553 ? -23.425 37.774  20.732  1.00 27.11  ? 553  ALA A CB    1 
ATOM   4262  N N     . ILE A 1 554 ? -20.343 38.556  21.032  1.00 27.61  ? 554  ILE A N     1 
ATOM   4263  C CA    . ILE A 1 554 ? -19.158 39.139  20.405  1.00 27.95  ? 554  ILE A CA    1 
ATOM   4264  C C     . ILE A 1 554 ? -17.844 38.566  20.979  1.00 27.61  ? 554  ILE A C     1 
ATOM   4265  O O     . ILE A 1 554 ? -17.048 37.984  20.244  1.00 27.89  ? 554  ILE A O     1 
ATOM   4266  C CB    . ILE A 1 554 ? -19.227 40.698  20.479  1.00 28.38  ? 554  ILE A CB    1 
ATOM   4267  C CG1   . ILE A 1 554 ? -20.184 41.233  19.402  1.00 28.98  ? 554  ILE A CG1   1 
ATOM   4268  C CG2   . ILE A 1 554 ? -17.832 41.370  20.392  1.00 28.70  ? 554  ILE A CG2   1 
ATOM   4269  C CD1   . ILE A 1 554 ? -19.935 40.662  17.972  1.00 31.66  ? 554  ILE A CD1   1 
ATOM   4270  N N     . LYS A 1 555 ? -17.658 38.689  22.287  1.00 26.87  ? 555  LYS A N     1 
ATOM   4271  C CA    . LYS A 1 555 ? -16.412 38.302  22.942  1.00 26.81  ? 555  LYS A CA    1 
ATOM   4272  C C     . LYS A 1 555 ? -16.288 36.792  23.208  1.00 26.38  ? 555  LYS A C     1 
ATOM   4273  O O     . LYS A 1 555 ? -15.217 36.326  23.598  1.00 26.27  ? 555  LYS A O     1 
ATOM   4274  C CB    . LYS A 1 555 ? -16.258 39.056  24.263  1.00 26.91  ? 555  LYS A CB    1 
ATOM   4275  C CG    . LYS A 1 555 ? -16.544 40.551  24.184  1.00 27.68  ? 555  LYS A CG    1 
ATOM   4276  C CD    . LYS A 1 555 ? -16.047 41.258  25.419  1.00 28.81  ? 555  LYS A CD    1 
ATOM   4277  C CE    . LYS A 1 555 ? -16.555 42.689  25.455  1.00 30.38  ? 555  LYS A CE    1 
ATOM   4278  N NZ    . LYS A 1 555 ? -15.709 43.525  26.341  1.00 31.88  ? 555  LYS A NZ    1 
ATOM   4279  N N     . GLY A 1 556 ? -17.374 36.040  23.009  1.00 25.73  ? 556  GLY A N     1 
ATOM   4280  C CA    . GLY A 1 556 ? -17.413 34.618  23.385  1.00 25.27  ? 556  GLY A CA    1 
ATOM   4281  C C     . GLY A 1 556 ? -17.735 34.463  24.863  1.00 25.08  ? 556  GLY A C     1 
ATOM   4282  O O     . GLY A 1 556 ? -18.754 33.888  25.231  1.00 25.09  ? 556  GLY A O     1 
ATOM   4283  N N     . GLN A 1 557 ? -16.858 34.983  25.711  1.00 24.91  ? 557  GLN A N     1 
ATOM   4284  C CA    . GLN A 1 557 ? -17.161 35.160  27.137  1.00 25.12  ? 557  GLN A CA    1 
ATOM   4285  C C     . GLN A 1 557 ? -16.903 36.599  27.537  1.00 24.86  ? 557  GLN A C     1 
ATOM   4286  O O     . GLN A 1 557 ? -15.968 37.221  27.050  1.00 24.86  ? 557  GLN A O     1 
ATOM   4287  C CB    . GLN A 1 557 ? -16.284 34.266  28.018  1.00 24.83  ? 557  GLN A CB    1 
ATOM   4288  C CG    . GLN A 1 557 ? -16.829 32.878  28.242  1.00 25.75  ? 557  GLN A CG    1 
ATOM   4289  C CD    . GLN A 1 557 ? -16.055 32.129  29.312  1.00 27.51  ? 557  GLN A CD    1 
ATOM   4290  O OE1   . GLN A 1 557 ? -14.819 32.093  29.294  1.00 26.16  ? 557  GLN A OE1   1 
ATOM   4291  N NE2   . GLN A 1 557 ? -16.784 31.520  30.254  1.00 26.13  ? 557  GLN A NE2   1 
ATOM   4292  N N     . ALA A 1 558 ? -17.730 37.113  28.432  1.00 25.09  ? 558  ALA A N     1 
ATOM   4293  C CA    . ALA A 1 558 ? -17.475 38.395  29.074  1.00 25.07  ? 558  ALA A CA    1 
ATOM   4294  C C     . ALA A 1 558 ? -17.071 38.143  30.527  1.00 25.04  ? 558  ALA A C     1 
ATOM   4295  O O     . ALA A 1 558 ? -17.295 37.062  31.063  1.00 24.76  ? 558  ALA A O     1 
ATOM   4296  C CB    . ALA A 1 558 ? -18.714 39.286  29.002  1.00 25.25  ? 558  ALA A CB    1 
ATOM   4297  N N     . ILE A 1 559 ? -16.465 39.150  31.145  1.00 25.02  ? 559  ILE A N     1 
ATOM   4298  C CA    . ILE A 1 559 ? -15.997 39.075  32.517  1.00 25.02  ? 559  ILE A CA    1 
ATOM   4299  C C     . ILE A 1 559 ? -17.040 39.712  33.425  1.00 25.47  ? 559  ILE A C     1 
ATOM   4300  O O     . ILE A 1 559 ? -17.341 40.907  33.298  1.00 25.70  ? 559  ILE A O     1 
ATOM   4301  C CB    . ILE A 1 559 ? -14.627 39.789  32.677  1.00 25.19  ? 559  ILE A CB    1 
ATOM   4302  C CG1   . ILE A 1 559 ? -13.571 39.100  31.803  1.00 24.06  ? 559  ILE A CG1   1 
ATOM   4303  C CG2   . ILE A 1 559 ? -14.197 39.834  34.151  1.00 24.31  ? 559  ILE A CG2   1 
ATOM   4304  C CD1   . ILE A 1 559 ? -12.325 39.933  31.571  1.00 23.10  ? 559  ILE A CD1   1 
ATOM   4305  N N     . TYR A 1 560 ? -17.579 38.896  34.332  1.00 25.27  ? 560  TYR A N     1 
ATOM   4306  C CA    . TYR A 1 560 ? -18.611 39.307  35.274  1.00 25.00  ? 560  TYR A CA    1 
ATOM   4307  C C     . TYR A 1 560 ? -17.992 39.200  36.649  1.00 24.78  ? 560  TYR A C     1 
ATOM   4308  O O     . TYR A 1 560 ? -17.627 38.110  37.083  1.00 24.85  ? 560  TYR A O     1 
ATOM   4309  C CB    . TYR A 1 560 ? -19.822 38.374  35.160  1.00 24.95  ? 560  TYR A CB    1 
ATOM   4310  C CG    . TYR A 1 560 ? -21.079 38.790  35.922  1.00 24.59  ? 560  TYR A CG    1 
ATOM   4311  C CD1   . TYR A 1 560 ? -21.122 38.765  37.311  1.00 24.79  ? 560  TYR A CD1   1 
ATOM   4312  C CD2   . TYR A 1 560 ? -22.243 39.162  35.234  1.00 24.95  ? 560  TYR A CD2   1 
ATOM   4313  C CE1   . TYR A 1 560 ? -22.292 39.127  38.010  1.00 24.88  ? 560  TYR A CE1   1 
ATOM   4314  C CE2   . TYR A 1 560 ? -23.417 39.526  35.916  1.00 25.52  ? 560  TYR A CE2   1 
ATOM   4315  C CZ    . TYR A 1 560 ? -23.429 39.506  37.304  1.00 25.37  ? 560  TYR A CZ    1 
ATOM   4316  O OH    . TYR A 1 560 ? -24.567 39.869  37.980  1.00 24.42  ? 560  TYR A OH    1 
ATOM   4317  N N     . ALA A 1 561 ? -17.884 40.332  37.337  1.00 24.85  ? 561  ALA A N     1 
ATOM   4318  C CA    . ALA A 1 561 ? -17.177 40.382  38.616  1.00 24.79  ? 561  ALA A CA    1 
ATOM   4319  C C     . ALA A 1 561 ? -18.117 40.698  39.774  1.00 25.02  ? 561  ALA A C     1 
ATOM   4320  O O     . ALA A 1 561 ? -18.708 41.786  39.820  1.00 25.28  ? 561  ALA A O     1 
ATOM   4321  C CB    . ALA A 1 561 ? -16.041 41.411  38.551  1.00 24.55  ? 561  ALA A CB    1 
ATOM   4322  N N     . TYR A 1 562 ? -18.262 39.746  40.701  1.00 24.96  ? 562  TYR A N     1 
ATOM   4323  C CA    . TYR A 1 562 ? -18.984 40.007  41.955  1.00 24.84  ? 562  TYR A CA    1 
ATOM   4324  C C     . TYR A 1 562 ? -17.988 40.677  42.891  1.00 25.38  ? 562  TYR A C     1 
ATOM   4325  O O     . TYR A 1 562 ? -16.883 40.165  43.088  1.00 25.59  ? 562  TYR A O     1 
ATOM   4326  C CB    . TYR A 1 562 ? -19.487 38.711  42.587  1.00 24.57  ? 562  TYR A CB    1 
ATOM   4327  C CG    . TYR A 1 562 ? -20.568 37.959  41.827  1.00 23.56  ? 562  TYR A CG    1 
ATOM   4328  C CD1   . TYR A 1 562 ? -20.238 37.042  40.823  1.00 23.36  ? 562  TYR A CD1   1 
ATOM   4329  C CD2   . TYR A 1 562 ? -21.916 38.121  42.156  1.00 22.99  ? 562  TYR A CD2   1 
ATOM   4330  C CE1   . TYR A 1 562 ? -21.236 36.322  40.143  1.00 23.51  ? 562  TYR A CE1   1 
ATOM   4331  C CE2   . TYR A 1 562 ? -22.915 37.412  41.486  1.00 22.51  ? 562  TYR A CE2   1 
ATOM   4332  C CZ    . TYR A 1 562 ? -22.568 36.516  40.487  1.00 23.00  ? 562  TYR A CZ    1 
ATOM   4333  O OH    . TYR A 1 562 ? -23.557 35.826  39.828  1.00 23.64  ? 562  TYR A OH    1 
ATOM   4334  N N     . VAL A 1 563 ? -18.362 41.823  43.457  1.00 25.82  ? 563  VAL A N     1 
ATOM   4335  C CA    . VAL A 1 563 ? -17.419 42.625  44.238  1.00 26.08  ? 563  VAL A CA    1 
ATOM   4336  C C     . VAL A 1 563 ? -18.008 43.035  45.585  1.00 26.39  ? 563  VAL A C     1 
ATOM   4337  O O     . VAL A 1 563 ? -19.119 43.577  45.668  1.00 26.09  ? 563  VAL A O     1 
ATOM   4338  C CB    . VAL A 1 563 ? -16.941 43.888  43.460  1.00 26.22  ? 563  VAL A CB    1 
ATOM   4339  C CG1   . VAL A 1 563 ? -16.077 44.775  44.356  1.00 26.76  ? 563  VAL A CG1   1 
ATOM   4340  C CG2   . VAL A 1 563 ? -16.160 43.498  42.199  1.00 26.09  ? 563  VAL A CG2   1 
ATOM   4341  N N     . THR A 1 564 ? -17.249 42.762  46.638  1.00 26.66  ? 564  THR A N     1 
ATOM   4342  C CA    . THR A 1 564 ? -17.618 43.185  47.969  1.00 27.18  ? 564  THR A CA    1 
ATOM   4343  C C     . THR A 1 564 ? -16.660 44.313  48.347  1.00 27.68  ? 564  THR A C     1 
ATOM   4344  O O     . THR A 1 564 ? -15.443 44.176  48.217  1.00 27.87  ? 564  THR A O     1 
ATOM   4345  C CB    . THR A 1 564 ? -17.579 41.999  48.966  1.00 27.27  ? 564  THR A CB    1 
ATOM   4346  O OG1   . THR A 1 564 ? -18.428 40.956  48.477  1.00 27.65  ? 564  THR A OG1   1 
ATOM   4347  C CG2   . THR A 1 564 ? -18.070 42.408  50.355  1.00 26.38  ? 564  THR A CG2   1 
ATOM   4348  N N     . LEU A 1 565 ? -17.225 45.442  48.758  1.00 28.16  ? 565  LEU A N     1 
ATOM   4349  C CA    . LEU A 1 565 ? -16.437 46.598  49.170  1.00 28.47  ? 565  LEU A CA    1 
ATOM   4350  C C     . LEU A 1 565 ? -16.104 46.478  50.652  1.00 28.77  ? 565  LEU A C     1 
ATOM   4351  O O     . LEU A 1 565 ? -16.816 45.810  51.407  1.00 28.43  ? 565  LEU A O     1 
ATOM   4352  C CB    . LEU A 1 565 ? -17.197 47.910  48.894  1.00 28.28  ? 565  LEU A CB    1 
ATOM   4353  C CG    . LEU A 1 565 ? -17.620 48.217  47.448  1.00 28.20  ? 565  LEU A CG    1 
ATOM   4354  C CD1   . LEU A 1 565 ? -18.502 49.442  47.380  1.00 27.69  ? 565  LEU A CD1   1 
ATOM   4355  C CD2   . LEU A 1 565 ? -16.414 48.369  46.508  1.00 28.08  ? 565  LEU A CD2   1 
ATOM   4356  N N     . ASN A 1 566 ? -15.014 47.122  51.056  1.00 29.36  ? 566  ASN A N     1 
ATOM   4357  C CA    . ASN A 1 566 ? -14.669 47.250  52.468  1.00 30.06  ? 566  ASN A CA    1 
ATOM   4358  C C     . ASN A 1 566 ? -15.846 47.831  53.245  1.00 30.78  ? 566  ASN A C     1 
ATOM   4359  O O     . ASN A 1 566 ? -16.591 48.671  52.722  1.00 30.67  ? 566  ASN A O     1 
ATOM   4360  C CB    . ASN A 1 566 ? -13.426 48.126  52.639  1.00 29.74  ? 566  ASN A CB    1 
ATOM   4361  C CG    . ASN A 1 566 ? -12.170 47.479  52.065  1.00 29.90  ? 566  ASN A CG    1 
ATOM   4362  O OD1   . ASN A 1 566 ? -12.003 46.263  52.127  1.00 29.09  ? 566  ASN A OD1   1 
ATOM   4363  N ND2   . ASN A 1 566 ? -11.279 48.297  51.514  1.00 28.58  ? 566  ASN A ND2   1 
ATOM   4364  N N     . HIS A 1 567 ? -16.030 47.359  54.476  1.00 31.57  ? 567  HIS A N     1 
ATOM   4365  C CA    . HIS A 1 567 ? -17.104 47.862  55.323  1.00 32.76  ? 567  HIS A CA    1 
ATOM   4366  C C     . HIS A 1 567 ? -16.990 49.374  55.473  1.00 32.77  ? 567  HIS A C     1 
ATOM   4367  O O     . HIS A 1 567 ? -15.908 49.905  55.744  1.00 32.78  ? 567  HIS A O     1 
ATOM   4368  C CB    . HIS A 1 567 ? -17.117 47.150  56.675  1.00 33.16  ? 567  HIS A CB    1 
ATOM   4369  C CG    . HIS A 1 567 ? -17.796 45.811  56.641  1.00 35.14  ? 567  HIS A CG    1 
ATOM   4370  N ND1   . HIS A 1 567 ? -18.921 45.526  57.386  1.00 36.98  ? 567  HIS A ND1   1 
ATOM   4371  C CD2   . HIS A 1 567 ? -17.513 44.684  55.942  1.00 36.57  ? 567  HIS A CD2   1 
ATOM   4372  C CE1   . HIS A 1 567 ? -19.299 44.281  57.152  1.00 37.44  ? 567  HIS A CE1   1 
ATOM   4373  N NE2   . HIS A 1 567 ? -18.461 43.748  56.280  1.00 37.11  ? 567  HIS A NE2   1 
ATOM   4374  N N     . GLY A 1 568 ? -18.110 50.054  55.244  1.00 33.03  ? 568  GLY A N     1 
ATOM   4375  C CA    . GLY A 1 568 ? -18.155 51.514  55.255  1.00 33.27  ? 568  GLY A CA    1 
ATOM   4376  C C     . GLY A 1 568 ? -18.278 52.118  53.865  1.00 33.51  ? 568  GLY A C     1 
ATOM   4377  O O     . GLY A 1 568 ? -18.785 53.235  53.717  1.00 33.28  ? 568  GLY A O     1 
ATOM   4378  N N     . GLU A 1 569 ? -17.814 51.383  52.849  1.00 33.52  ? 569  GLU A N     1 
ATOM   4379  C CA    . GLU A 1 569 ? -17.851 51.852  51.460  1.00 33.74  ? 569  GLU A CA    1 
ATOM   4380  C C     . GLU A 1 569 ? -19.209 51.647  50.799  1.00 33.70  ? 569  GLU A C     1 
ATOM   4381  O O     . GLU A 1 569 ? -19.884 50.644  51.036  1.00 33.72  ? 569  GLU A O     1 
ATOM   4382  C CB    . GLU A 1 569 ? -16.767 51.172  50.612  1.00 33.75  ? 569  GLU A CB    1 
ATOM   4383  C CG    . GLU A 1 569 ? -15.333 51.509  51.004  1.00 34.74  ? 569  GLU A CG    1 
ATOM   4384  C CD    . GLU A 1 569 ? -14.964 52.972  50.774  1.00 36.21  ? 569  GLU A CD    1 
ATOM   4385  O OE1   . GLU A 1 569 ? -15.536 53.621  49.863  1.00 37.01  ? 569  GLU A OE1   1 
ATOM   4386  O OE2   . GLU A 1 569 ? -14.087 53.468  51.509  1.00 36.73  ? 569  GLU A OE2   1 
ATOM   4387  N N     . GLU A 1 570 ? -19.585 52.599  49.949  1.00 33.75  ? 570  GLU A N     1 
ATOM   4388  C CA    . GLU A 1 570 ? -20.837 52.536  49.201  1.00 33.85  ? 570  GLU A CA    1 
ATOM   4389  C C     . GLU A 1 570 ? -20.581 52.703  47.698  1.00 33.88  ? 570  GLU A C     1 
ATOM   4390  O O     . GLU A 1 570 ? -19.757 53.526  47.298  1.00 33.89  ? 570  GLU A O     1 
ATOM   4391  C CB    . GLU A 1 570 ? -21.818 53.607  49.703  1.00 34.04  ? 570  GLU A CB    1 
ATOM   4392  N N     . PRO A 1 571 ? -21.292 51.921  46.860  1.00 33.84  ? 571  PRO A N     1 
ATOM   4393  C CA    . PRO A 1 571 ? -21.112 52.001  45.409  1.00 33.89  ? 571  PRO A CA    1 
ATOM   4394  C C     . PRO A 1 571 ? -21.573 53.342  44.826  1.00 33.97  ? 571  PRO A C     1 
ATOM   4395  O O     . PRO A 1 571 ? -22.331 54.075  45.471  1.00 33.71  ? 571  PRO A O     1 
ATOM   4396  C CB    . PRO A 1 571 ? -22.010 50.872  44.874  1.00 33.75  ? 571  PRO A CB    1 
ATOM   4397  C CG    . PRO A 1 571 ? -22.355 50.033  46.041  1.00 33.55  ? 571  PRO A CG    1 
ATOM   4398  C CD    . PRO A 1 571 ? -22.314 50.925  47.229  1.00 33.85  ? 571  PRO A CD    1 
ATOM   4399  N N     . SER A 1 572 ? -21.106 53.639  43.612  1.00 33.83  ? 572  SER A N     1 
ATOM   4400  C CA    . SER A 1 572 ? -21.547 54.801  42.834  1.00 33.64  ? 572  SER A CA    1 
ATOM   4401  C C     . SER A 1 572 ? -21.277 54.549  41.342  1.00 33.60  ? 572  SER A C     1 
ATOM   4402  O O     . SER A 1 572 ? -20.636 53.550  40.996  1.00 33.41  ? 572  SER A O     1 
ATOM   4403  C CB    . SER A 1 572 ? -20.852 56.078  43.323  1.00 33.67  ? 572  SER A CB    1 
ATOM   4404  O OG    . SER A 1 572 ? -19.450 55.916  43.394  1.00 33.16  ? 572  SER A OG    1 
ATOM   4405  N N     . PRO A 1 573 ? -21.788 55.425  40.445  1.00 33.51  ? 573  PRO A N     1 
ATOM   4406  C CA    . PRO A 1 573 ? -21.420 55.242  39.030  1.00 33.38  ? 573  PRO A CA    1 
ATOM   4407  C C     . PRO A 1 573 ? -19.973 55.645  38.732  1.00 33.06  ? 573  PRO A C     1 
ATOM   4408  O O     . PRO A 1 573 ? -19.369 55.125  37.776  1.00 33.24  ? 573  PRO A O     1 
ATOM   4409  C CB    . PRO A 1 573 ? -22.404 56.148  38.271  1.00 33.49  ? 573  PRO A CB    1 
ATOM   4410  C CG    . PRO A 1 573 ? -23.382 56.642  39.290  1.00 33.56  ? 573  PRO A CG    1 
ATOM   4411  C CD    . PRO A 1 573 ? -22.707 56.563  40.622  1.00 33.63  ? 573  PRO A CD    1 
ATOM   4412  N N     . GLU A 1 574 ? -19.426 56.556  39.540  1.00 32.45  ? 574  GLU A N     1 
ATOM   4413  C CA    . GLU A 1 574 ? -18.004 56.906  39.455  1.00 32.30  ? 574  GLU A CA    1 
ATOM   4414  C C     . GLU A 1 574 ? -17.132 55.701  39.836  1.00 31.71  ? 574  GLU A C     1 
ATOM   4415  O O     . GLU A 1 574 ? -16.080 55.485  39.241  1.00 31.45  ? 574  GLU A O     1 
ATOM   4416  C CB    . GLU A 1 574 ? -17.659 58.134  40.317  1.00 32.04  ? 574  GLU A CB    1 
ATOM   4417  C CG    . GLU A 1 574 ? -18.276 59.450  39.829  1.00 32.70  ? 574  GLU A CG    1 
ATOM   4418  C CD    . GLU A 1 574 ? -17.760 60.694  40.576  1.00 33.44  ? 574  GLU A CD    1 
ATOM   4419  O OE1   . GLU A 1 574 ? -16.840 60.570  41.417  1.00 35.03  ? 574  GLU A OE1   1 
ATOM   4420  O OE2   . GLU A 1 574 ? -18.273 61.810  40.311  1.00 34.87  ? 574  GLU A OE2   1 
ATOM   4421  N N     . LEU A 1 575 ? -17.592 54.908  40.803  1.00 31.18  ? 575  LEU A N     1 
ATOM   4422  C CA    . LEU A 1 575 ? -16.855 53.720  41.248  1.00 31.01  ? 575  LEU A CA    1 
ATOM   4423  C C     . LEU A 1 575 ? -16.778 52.629  40.174  1.00 30.84  ? 575  LEU A C     1 
ATOM   4424  O O     . LEU A 1 575 ? -15.748 51.964  40.024  1.00 30.66  ? 575  LEU A O     1 
ATOM   4425  C CB    . LEU A 1 575 ? -17.451 53.157  42.543  1.00 31.17  ? 575  LEU A CB    1 
ATOM   4426  C CG    . LEU A 1 575 ? -16.612 52.130  43.316  1.00 31.05  ? 575  LEU A CG    1 
ATOM   4427  C CD1   . LEU A 1 575 ? -15.225 52.674  43.631  1.00 30.66  ? 575  LEU A CD1   1 
ATOM   4428  C CD2   . LEU A 1 575 ? -17.337 51.729  44.595  1.00 31.01  ? 575  LEU A CD2   1 
ATOM   4429  N N     . TYR A 1 576 ? -17.866 52.464  39.427  1.00 30.73  ? 576  TYR A N     1 
ATOM   4430  C CA    . TYR A 1 576 ? -17.925 51.533  38.300  1.00 30.62  ? 576  TYR A CA    1 
ATOM   4431  C C     . TYR A 1 576 ? -16.775 51.760  37.313  1.00 29.95  ? 576  TYR A C     1 
ATOM   4432  O O     . TYR A 1 576 ? -16.018 50.837  37.021  1.00 29.81  ? 576  TYR A O     1 
ATOM   4433  C CB    . TYR A 1 576 ? -19.257 51.683  37.573  1.00 31.50  ? 576  TYR A CB    1 
ATOM   4434  C CG    . TYR A 1 576 ? -19.823 50.406  36.997  1.00 32.94  ? 576  TYR A CG    1 
ATOM   4435  C CD1   . TYR A 1 576 ? -20.794 49.680  37.697  1.00 34.12  ? 576  TYR A CD1   1 
ATOM   4436  C CD2   . TYR A 1 576 ? -19.419 49.936  35.742  1.00 33.54  ? 576  TYR A CD2   1 
ATOM   4437  C CE1   . TYR A 1 576 ? -21.341 48.508  37.169  1.00 34.94  ? 576  TYR A CE1   1 
ATOM   4438  C CE2   . TYR A 1 576 ? -19.955 48.755  35.203  1.00 33.87  ? 576  TYR A CE2   1 
ATOM   4439  C CZ    . TYR A 1 576 ? -20.917 48.051  35.925  1.00 34.05  ? 576  TYR A CZ    1 
ATOM   4440  O OH    . TYR A 1 576 ? -21.473 46.897  35.415  1.00 34.03  ? 576  TYR A OH    1 
ATOM   4441  N N     . ALA A 1 577 ? -16.652 52.988  36.809  1.00 29.06  ? 577  ALA A N     1 
ATOM   4442  C CA    . ALA A 1 577 ? -15.592 53.347  35.875  1.00 28.51  ? 577  ALA A CA    1 
ATOM   4443  C C     . ALA A 1 577 ? -14.207 53.328  36.541  1.00 28.47  ? 577  ALA A C     1 
ATOM   4444  O O     . ALA A 1 577 ? -13.221 52.924  35.911  1.00 28.09  ? 577  ALA A O     1 
ATOM   4445  C CB    . ALA A 1 577 ? -15.868 54.706  35.248  1.00 28.69  ? 577  ALA A CB    1 
ATOM   4446  N N     . GLU A 1 578 ? -14.138 53.759  37.804  1.00 27.98  ? 578  GLU A N     1 
ATOM   4447  C CA    . GLU A 1 578 ? -12.881 53.714  38.563  1.00 28.22  ? 578  GLU A CA    1 
ATOM   4448  C C     . GLU A 1 578 ? -12.326 52.295  38.636  1.00 27.24  ? 578  GLU A C     1 
ATOM   4449  O O     . GLU A 1 578 ? -11.158 52.069  38.325  1.00 26.81  ? 578  GLU A O     1 
ATOM   4450  C CB    . GLU A 1 578 ? -13.051 54.292  39.976  1.00 28.26  ? 578  GLU A CB    1 
ATOM   4451  C CG    . GLU A 1 578 ? -11.775 54.234  40.842  1.00 29.48  ? 578  GLU A CG    1 
ATOM   4452  C CD    . GLU A 1 578 ? -11.988 54.776  42.256  1.00 30.46  ? 578  GLU A CD    1 
ATOM   4453  O OE1   . GLU A 1 578 ? -12.873 55.647  42.451  1.00 33.09  ? 578  GLU A OE1   1 
ATOM   4454  O OE2   . GLU A 1 578 ? -11.260 54.340  43.176  1.00 32.66  ? 578  GLU A OE2   1 
ATOM   4455  N N     . VAL A 1 579 ? -13.177 51.349  39.030  1.00 26.43  ? 579  VAL A N     1 
ATOM   4456  C CA    . VAL A 1 579 ? -12.775 49.949  39.195  1.00 26.01  ? 579  VAL A CA    1 
ATOM   4457  C C     . VAL A 1 579 ? -12.424 49.306  37.839  1.00 26.13  ? 579  VAL A C     1 
ATOM   4458  O O     . VAL A 1 579 ? -11.432 48.585  37.736  1.00 25.79  ? 579  VAL A O     1 
ATOM   4459  C CB    . VAL A 1 579 ? -13.872 49.135  39.952  1.00 26.03  ? 579  VAL A CB    1 
ATOM   4460  C CG1   . VAL A 1 579 ? -13.591 47.631  39.917  1.00 24.64  ? 579  VAL A CG1   1 
ATOM   4461  C CG2   . VAL A 1 579 ? -14.020 49.638  41.395  1.00 25.60  ? 579  VAL A CG2   1 
ATOM   4462  N N     . ARG A 1 580 ? -13.224 49.585  36.804  1.00 26.17  ? 580  ARG A N     1 
ATOM   4463  C CA    . ARG A 1 580 ? -12.891 49.147  35.443  1.00 26.52  ? 580  ARG A CA    1 
ATOM   4464  C C     . ARG A 1 580 ? -11.496 49.651  35.027  1.00 26.27  ? 580  ARG A C     1 
ATOM   4465  O O     . ARG A 1 580 ? -10.650 48.859  34.611  1.00 26.07  ? 580  ARG A O     1 
ATOM   4466  C CB    . ARG A 1 580 ? -13.963 49.565  34.421  1.00 26.84  ? 580  ARG A CB    1 
ATOM   4467  C CG    . ARG A 1 580 ? -15.355 48.951  34.672  1.00 28.86  ? 580  ARG A CG    1 
ATOM   4468  C CD    . ARG A 1 580 ? -16.075 48.512  33.373  1.00 31.86  ? 580  ARG A CD    1 
ATOM   4469  N NE    . ARG A 1 580 ? -15.864 49.410  32.236  1.00 34.97  ? 580  ARG A NE    1 
ATOM   4470  C CZ    . ARG A 1 580 ? -16.013 49.058  30.957  1.00 37.07  ? 580  ARG A CZ    1 
ATOM   4471  N NH1   . ARG A 1 580 ? -16.372 47.821  30.627  1.00 36.62  ? 580  ARG A NH1   1 
ATOM   4472  N NH2   . ARG A 1 580 ? -15.795 49.948  29.994  1.00 38.91  ? 580  ARG A NH2   1 
ATOM   4473  N N     . ASN A 1 581 ? -11.270 50.961  35.159  1.00 25.94  ? 581  ASN A N     1 
ATOM   4474  C CA    . ASN A 1 581 ? -9.964  51.591  34.892  1.00 25.65  ? 581  ASN A CA    1 
ATOM   4475  C C     . ASN A 1 581 ? -8.803  51.040  35.751  1.00 25.32  ? 581  ASN A C     1 
ATOM   4476  O O     . ASN A 1 581 ? -7.672  50.955  35.279  1.00 25.51  ? 581  ASN A O     1 
ATOM   4477  C CB    . ASN A 1 581 ? -10.057 53.120  35.057  1.00 25.29  ? 581  ASN A CB    1 
ATOM   4478  C CG    . ASN A 1 581 ? -10.693 53.819  33.841  1.00 26.20  ? 581  ASN A CG    1 
ATOM   4479  O OD1   . ASN A 1 581 ? -10.645 53.310  32.719  1.00 28.01  ? 581  ASN A OD1   1 
ATOM   4480  N ND2   . ASN A 1 581 ? -11.272 54.993  34.064  1.00 23.73  ? 581  ASN A ND2   1 
ATOM   4481  N N     . TRP A 1 582 ? -9.084  50.694  37.007  1.00 24.95  ? 582  TRP A N     1 
ATOM   4482  C CA    . TRP A 1 582 ? -8.113  50.009  37.876  1.00 24.62  ? 582  TRP A CA    1 
ATOM   4483  C C     . TRP A 1 582 ? -7.630  48.675  37.272  1.00 24.81  ? 582  TRP A C     1 
ATOM   4484  O O     . TRP A 1 582 ? -6.434  48.406  37.223  1.00 24.68  ? 582  TRP A O     1 
ATOM   4485  C CB    . TRP A 1 582 ? -8.712  49.774  39.272  1.00 23.93  ? 582  TRP A CB    1 
ATOM   4486  C CG    . TRP A 1 582 ? -7.777  49.072  40.249  1.00 23.84  ? 582  TRP A CG    1 
ATOM   4487  C CD1   . TRP A 1 582 ? -7.742  47.733  40.543  1.00 23.33  ? 582  TRP A CD1   1 
ATOM   4488  C CD2   . TRP A 1 582 ? -6.750  49.682  41.044  1.00 23.94  ? 582  TRP A CD2   1 
ATOM   4489  N NE1   . TRP A 1 582 ? -6.759  47.475  41.473  1.00 22.57  ? 582  TRP A NE1   1 
ATOM   4490  C CE2   . TRP A 1 582 ? -6.135  48.652  41.798  1.00 23.48  ? 582  TRP A CE2   1 
ATOM   4491  C CE3   . TRP A 1 582 ? -6.293  51.004  41.200  1.00 24.15  ? 582  TRP A CE3   1 
ATOM   4492  C CZ2   . TRP A 1 582 ? -5.079  48.896  42.683  1.00 22.39  ? 582  TRP A CZ2   1 
ATOM   4493  C CZ3   . TRP A 1 582 ? -5.237  51.246  42.092  1.00 23.96  ? 582  TRP A CZ3   1 
ATOM   4494  C CH2   . TRP A 1 582 ? -4.649  50.193  42.821  1.00 23.71  ? 582  TRP A CH2   1 
ATOM   4495  N N     . VAL A 1 583 ? -8.560  47.837  36.824  1.00 25.47  ? 583  VAL A N     1 
ATOM   4496  C CA    . VAL A 1 583 ? -8.196  46.538  36.233  1.00 25.98  ? 583  VAL A CA    1 
ATOM   4497  C C     . VAL A 1 583 ? -7.443  46.735  34.907  1.00 26.76  ? 583  VAL A C     1 
ATOM   4498  O O     . VAL A 1 583 ? -6.525  45.976  34.570  1.00 26.85  ? 583  VAL A O     1 
ATOM   4499  C CB    . VAL A 1 583 ? -9.435  45.636  36.047  1.00 26.20  ? 583  VAL A CB    1 
ATOM   4500  C CG1   . VAL A 1 583 ? -9.063  44.319  35.345  1.00 25.90  ? 583  VAL A CG1   1 
ATOM   4501  C CG2   . VAL A 1 583 ? -10.095 45.355  37.398  1.00 25.35  ? 583  VAL A CG2   1 
ATOM   4502  N N     . ARG A 1 584 ? -7.832  47.781  34.179  1.00 27.56  ? 584  ARG A N     1 
ATOM   4503  C CA    . ARG A 1 584 ? -7.186  48.185  32.944  1.00 28.77  ? 584  ARG A CA    1 
ATOM   4504  C C     . ARG A 1 584 ? -5.727  48.554  33.221  1.00 28.62  ? 584  ARG A C     1 
ATOM   4505  O O     . ARG A 1 584 ? -4.842  48.306  32.401  1.00 28.70  ? 584  ARG A O     1 
ATOM   4506  C CB    . ARG A 1 584 ? -7.942  49.387  32.382  1.00 29.50  ? 584  ARG A CB    1 
ATOM   4507  C CG    . ARG A 1 584 ? -8.051  49.446  30.882  1.00 32.69  ? 584  ARG A CG    1 
ATOM   4508  C CD    . ARG A 1 584 ? -9.300  50.222  30.477  1.00 36.46  ? 584  ARG A CD    1 
ATOM   4509  N NE    . ARG A 1 584 ? -9.185  50.751  29.118  1.00 39.89  ? 584  ARG A NE    1 
ATOM   4510  C CZ    . ARG A 1 584 ? -9.815  50.253  28.057  1.00 40.58  ? 584  ARG A CZ    1 
ATOM   4511  N NH1   . ARG A 1 584 ? -10.629 49.205  28.188  1.00 40.40  ? 584  ARG A NH1   1 
ATOM   4512  N NH2   . ARG A 1 584 ? -9.635  50.811  26.862  1.00 40.48  ? 584  ARG A NH2   1 
ATOM   4513  N N     . LYS A 1 585 ? -5.493  49.133  34.396  1.00 28.44  ? 585  LYS A N     1 
ATOM   4514  C CA    . LYS A 1 585 ? -4.161  49.529  34.847  1.00 28.39  ? 585  LYS A CA    1 
ATOM   4515  C C     . LYS A 1 585 ? -3.348  48.348  35.388  1.00 27.63  ? 585  LYS A C     1 
ATOM   4516  O O     . LYS A 1 585 ? -2.146  48.255  35.149  1.00 27.07  ? 585  LYS A O     1 
ATOM   4517  C CB    . LYS A 1 585 ? -4.280  50.628  35.910  1.00 28.69  ? 585  LYS A CB    1 
ATOM   4518  C CG    . LYS A 1 585 ? -2.957  51.076  36.526  1.00 31.50  ? 585  LYS A CG    1 
ATOM   4519  C CD    . LYS A 1 585 ? -3.186  51.677  37.918  1.00 36.09  ? 585  LYS A CD    1 
ATOM   4520  C CE    . LYS A 1 585 ? -1.878  51.886  38.675  1.00 38.68  ? 585  LYS A CE    1 
ATOM   4521  N NZ    . LYS A 1 585 ? -2.112  52.463  40.043  1.00 41.09  ? 585  LYS A NZ    1 
ATOM   4522  N N     . GLU A 1 586 ? -4.009  47.460  36.126  1.00 27.43  ? 586  GLU A N     1 
ATOM   4523  C CA    . GLU A 1 586 ? -3.359  46.294  36.735  1.00 27.06  ? 586  GLU A CA    1 
ATOM   4524  C C     . GLU A 1 586 ? -2.917  45.253  35.701  1.00 26.41  ? 586  GLU A C     1 
ATOM   4525  O O     . GLU A 1 586 ? -1.845  44.666  35.830  1.00 26.32  ? 586  GLU A O     1 
ATOM   4526  C CB    . GLU A 1 586 ? -4.294  45.635  37.762  1.00 27.57  ? 586  GLU A CB    1 
ATOM   4527  C CG    . GLU A 1 586 ? -4.394  46.380  39.097  1.00 29.20  ? 586  GLU A CG    1 
ATOM   4528  C CD    . GLU A 1 586 ? -3.078  46.366  39.849  1.00 31.50  ? 586  GLU A CD    1 
ATOM   4529  O OE1   . GLU A 1 586 ? -2.742  45.302  40.411  1.00 32.54  ? 586  GLU A OE1   1 
ATOM   4530  O OE2   . GLU A 1 586 ? -2.377  47.410  39.854  1.00 32.14  ? 586  GLU A OE2   1 
ATOM   4531  N N     . ILE A 1 587 ? -3.755  45.031  34.689  1.00 25.65  ? 587  ILE A N     1 
ATOM   4532  C CA    . ILE A 1 587 ? -3.505  44.007  33.678  1.00 25.01  ? 587  ILE A CA    1 
ATOM   4533  C C     . ILE A 1 587 ? -3.467  44.616  32.275  1.00 25.12  ? 587  ILE A C     1 
ATOM   4534  O O     . ILE A 1 587 ? -2.431  44.578  31.606  1.00 24.54  ? 587  ILE A O     1 
ATOM   4535  C CB    . ILE A 1 587 ? -4.540  42.839  33.746  1.00 25.06  ? 587  ILE A CB    1 
ATOM   4536  C CG1   . ILE A 1 587 ? -4.550  42.206  35.152  1.00 25.45  ? 587  ILE A CG1   1 
ATOM   4537  C CG2   . ILE A 1 587 ? -4.207  41.776  32.680  1.00 23.43  ? 587  ILE A CG2   1 
ATOM   4538  C CD1   . ILE A 1 587 ? -5.670  41.205  35.404  1.00 24.66  ? 587  ILE A CD1   1 
ATOM   4539  N N     . GLY A 1 588 ? -4.601  45.181  31.857  1.00 25.27  ? 588  GLY A N     1 
ATOM   4540  C CA    . GLY A 1 588 ? -4.754  45.824  30.548  1.00 25.79  ? 588  GLY A CA    1 
ATOM   4541  C C     . GLY A 1 588 ? -6.216  45.810  30.113  1.00 26.13  ? 588  GLY A C     1 
ATOM   4542  O O     . GLY A 1 588 ? -7.032  45.136  30.735  1.00 25.99  ? 588  GLY A O     1 
ATOM   4543  N N     . PRO A 1 589 ? -6.555  46.561  29.044  1.00 26.82  ? 589  PRO A N     1 
ATOM   4544  C CA    . PRO A 1 589 ? -7.899  46.552  28.443  1.00 27.22  ? 589  PRO A CA    1 
ATOM   4545  C C     . PRO A 1 589 ? -8.500  45.154  28.273  1.00 27.92  ? 589  PRO A C     1 
ATOM   4546  O O     . PRO A 1 589 ? -9.696  44.972  28.522  1.00 27.99  ? 589  PRO A O     1 
ATOM   4547  C CB    . PRO A 1 589 ? -7.676  47.213  27.083  1.00 26.97  ? 589  PRO A CB    1 
ATOM   4548  C CG    . PRO A 1 589 ? -6.580  48.208  27.359  1.00 27.35  ? 589  PRO A CG    1 
ATOM   4549  C CD    . PRO A 1 589 ? -5.658  47.512  28.351  1.00 26.88  ? 589  PRO A CD    1 
ATOM   4550  N N     . LEU A 1 590 ? -7.668  44.182  27.894  1.00 28.48  ? 590  LEU A N     1 
ATOM   4551  C CA    . LEU A 1 590 ? -8.105  42.801  27.629  1.00 28.96  ? 590  LEU A CA    1 
ATOM   4552  C C     . LEU A 1 590 ? -8.794  42.122  28.824  1.00 29.24  ? 590  LEU A C     1 
ATOM   4553  O O     . LEU A 1 590 ? -9.571  41.176  28.642  1.00 29.53  ? 590  LEU A O     1 
ATOM   4554  C CB    . LEU A 1 590 ? -6.927  41.945  27.121  1.00 28.91  ? 590  LEU A CB    1 
ATOM   4555  C CG    . LEU A 1 590 ? -5.860  41.404  28.106  1.00 29.41  ? 590  LEU A CG    1 
ATOM   4556  C CD1   . LEU A 1 590 ? -4.959  40.367  27.443  1.00 29.06  ? 590  LEU A CD1   1 
ATOM   4557  C CD2   . LEU A 1 590 ? -5.005  42.511  28.702  1.00 29.84  ? 590  LEU A CD2   1 
ATOM   4558  N N     . ALA A 1 591 ? -8.515  42.620  30.031  1.00 29.53  ? 591  ALA A N     1 
ATOM   4559  C CA    . ALA A 1 591 ? -9.056  42.049  31.264  1.00 29.56  ? 591  ALA A CA    1 
ATOM   4560  C C     . ALA A 1 591 ? -10.122 42.918  31.943  1.00 29.93  ? 591  ALA A C     1 
ATOM   4561  O O     . ALA A 1 591 ? -10.570 42.601  33.048  1.00 30.42  ? 591  ALA A O     1 
ATOM   4562  C CB    . ALA A 1 591 ? -7.923  41.733  32.243  1.00 29.31  ? 591  ALA A CB    1 
ATOM   4563  N N     . THR A 1 592 ? -10.535 44.007  31.301  1.00 30.40  ? 592  THR A N     1 
ATOM   4564  C CA    . THR A 1 592 ? -11.552 44.879  31.905  1.00 30.82  ? 592  THR A CA    1 
ATOM   4565  C C     . THR A 1 592 ? -12.877 44.126  32.124  1.00 30.52  ? 592  THR A C     1 
ATOM   4566  O O     . THR A 1 592 ? -13.416 43.543  31.186  1.00 30.29  ? 592  THR A O     1 
ATOM   4567  C CB    . THR A 1 592 ? -11.826 46.146  31.051  1.00 31.00  ? 592  THR A CB    1 
ATOM   4568  O OG1   . THR A 1 592 ? -10.605 46.623  30.478  1.00 32.15  ? 592  THR A OG1   1 
ATOM   4569  C CG2   . THR A 1 592 ? -12.453 47.249  31.904  1.00 30.87  ? 592  THR A CG2   1 
ATOM   4570  N N     . PRO A 1 593 ? -13.403 44.136  33.364  1.00 30.76  ? 593  PRO A N     1 
ATOM   4571  C CA    . PRO A 1 593 ? -14.702 43.506  33.610  1.00 30.58  ? 593  PRO A CA    1 
ATOM   4572  C C     . PRO A 1 593 ? -15.828 44.187  32.845  1.00 30.67  ? 593  PRO A C     1 
ATOM   4573  O O     . PRO A 1 593 ? -15.925 45.419  32.830  1.00 30.58  ? 593  PRO A O     1 
ATOM   4574  C CB    . PRO A 1 593 ? -14.908 43.691  35.112  1.00 30.84  ? 593  PRO A CB    1 
ATOM   4575  C CG    . PRO A 1 593 ? -13.521 43.929  35.658  1.00 31.27  ? 593  PRO A CG    1 
ATOM   4576  C CD    . PRO A 1 593 ? -12.830 44.699  34.598  1.00 30.52  ? 593  PRO A CD    1 
ATOM   4577  N N     . ASP A 1 594 ? -16.659 43.380  32.199  1.00 30.43  ? 594  ASP A N     1 
ATOM   4578  C CA    . ASP A 1 594 ? -17.821 43.892  31.499  1.00 30.22  ? 594  ASP A CA    1 
ATOM   4579  C C     . ASP A 1 594 ? -18.951 44.247  32.475  1.00 29.96  ? 594  ASP A C     1 
ATOM   4580  O O     . ASP A 1 594 ? -19.697 45.195  32.228  1.00 30.16  ? 594  ASP A O     1 
ATOM   4581  C CB    . ASP A 1 594 ? -18.261 42.894  30.424  1.00 30.34  ? 594  ASP A CB    1 
ATOM   4582  C CG    . ASP A 1 594 ? -17.126 42.566  29.447  1.00 31.82  ? 594  ASP A CG    1 
ATOM   4583  O OD1   . ASP A 1 594 ? -16.838 43.413  28.576  1.00 31.84  ? 594  ASP A OD1   1 
ATOM   4584  O OD2   . ASP A 1 594 ? -16.495 41.488  29.570  1.00 32.31  ? 594  ASP A OD2   1 
ATOM   4585  N N     . VAL A 1 595 ? -19.059 43.500  33.579  1.00 29.02  ? 595  VAL A N     1 
ATOM   4586  C CA    . VAL A 1 595 ? -20.090 43.734  34.605  1.00 28.02  ? 595  VAL A CA    1 
ATOM   4587  C C     . VAL A 1 595 ? -19.439 43.767  35.989  1.00 27.53  ? 595  VAL A C     1 
ATOM   4588  O O     . VAL A 1 595 ? -18.592 42.921  36.304  1.00 27.48  ? 595  VAL A O     1 
ATOM   4589  C CB    . VAL A 1 595 ? -21.197 42.625  34.600  1.00 27.92  ? 595  VAL A CB    1 
ATOM   4590  C CG1   . VAL A 1 595 ? -22.184 42.807  35.750  1.00 27.20  ? 595  VAL A CG1   1 
ATOM   4591  C CG2   . VAL A 1 595 ? -21.946 42.579  33.270  1.00 28.14  ? 595  VAL A CG2   1 
ATOM   4592  N N     . LEU A 1 596 ? -19.830 44.751  36.798  1.00 26.74  ? 596  LEU A N     1 
ATOM   4593  C CA    . LEU A 1 596 ? -19.474 44.796  38.214  1.00 26.25  ? 596  LEU A CA    1 
ATOM   4594  C C     . LEU A 1 596 ? -20.739 44.653  39.044  1.00 26.50  ? 596  LEU A C     1 
ATOM   4595  O O     . LEU A 1 596 ? -21.626 45.512  39.002  1.00 26.28  ? 596  LEU A O     1 
ATOM   4596  C CB    . LEU A 1 596 ? -18.752 46.096  38.571  1.00 25.73  ? 596  LEU A CB    1 
ATOM   4597  C CG    . LEU A 1 596 ? -17.370 46.357  37.944  1.00 25.76  ? 596  LEU A CG    1 
ATOM   4598  C CD1   . LEU A 1 596 ? -16.991 47.809  38.154  1.00 25.17  ? 596  LEU A CD1   1 
ATOM   4599  C CD2   . LEU A 1 596 ? -16.295 45.429  38.507  1.00 24.54  ? 596  LEU A CD2   1 
ATOM   4600  N N     . HIS A 1 597 ? -20.808 43.559  39.791  1.00 26.57  ? 597  HIS A N     1 
ATOM   4601  C CA    . HIS A 1 597 ? -21.961 43.227  40.616  1.00 26.73  ? 597  HIS A CA    1 
ATOM   4602  C C     . HIS A 1 597 ? -21.609 43.493  42.081  1.00 27.16  ? 597  HIS A C     1 
ATOM   4603  O O     . HIS A 1 597 ? -21.032 42.625  42.753  1.00 26.85  ? 597  HIS A O     1 
ATOM   4604  C CB    . HIS A 1 597 ? -22.307 41.743  40.380  1.00 26.95  ? 597  HIS A CB    1 
ATOM   4605  C CG    . HIS A 1 597 ? -23.524 41.254  41.108  1.00 26.16  ? 597  HIS A CG    1 
ATOM   4606  N ND1   . HIS A 1 597 ? -24.515 40.531  40.482  1.00 25.46  ? 597  HIS A ND1   1 
ATOM   4607  C CD2   . HIS A 1 597 ? -23.900 41.359  42.406  1.00 25.27  ? 597  HIS A CD2   1 
ATOM   4608  C CE1   . HIS A 1 597 ? -25.450 40.213  41.360  1.00 25.67  ? 597  HIS A CE1   1 
ATOM   4609  N NE2   . HIS A 1 597 ? -25.097 40.699  42.536  1.00 25.37  ? 597  HIS A NE2   1 
ATOM   4610  N N     . TRP A 1 598 ? -21.933 44.694  42.573  1.00 27.34  ? 598  TRP A N     1 
ATOM   4611  C CA    . TRP A 1 598 ? -21.695 45.022  43.981  1.00 28.15  ? 598  TRP A CA    1 
ATOM   4612  C C     . TRP A 1 598 ? -22.588 44.138  44.849  1.00 28.30  ? 598  TRP A C     1 
ATOM   4613  O O     . TRP A 1 598 ? -23.804 44.118  44.666  1.00 28.17  ? 598  TRP A O     1 
ATOM   4614  C CB    . TRP A 1 598 ? -21.981 46.503  44.297  1.00 28.69  ? 598  TRP A CB    1 
ATOM   4615  C CG    . TRP A 1 598 ? -21.421 47.498  43.312  1.00 29.21  ? 598  TRP A CG    1 
ATOM   4616  C CD1   . TRP A 1 598 ? -22.138 48.335  42.500  1.00 30.29  ? 598  TRP A CD1   1 
ATOM   4617  C CD2   . TRP A 1 598 ? -20.039 47.759  43.037  1.00 29.39  ? 598  TRP A CD2   1 
ATOM   4618  N NE1   . TRP A 1 598 ? -21.288 49.106  41.743  1.00 30.35  ? 598  TRP A NE1   1 
ATOM   4619  C CE2   . TRP A 1 598 ? -19.995 48.774  42.050  1.00 30.27  ? 598  TRP A CE2   1 
ATOM   4620  C CE3   . TRP A 1 598 ? -18.833 47.237  43.529  1.00 29.35  ? 598  TRP A CE3   1 
ATOM   4621  C CZ2   . TRP A 1 598 ? -18.792 49.274  41.540  1.00 29.83  ? 598  TRP A CZ2   1 
ATOM   4622  C CZ3   . TRP A 1 598 ? -17.632 47.739  43.020  1.00 30.09  ? 598  TRP A CZ3   1 
ATOM   4623  C CH2   . TRP A 1 598 ? -17.624 48.745  42.035  1.00 30.09  ? 598  TRP A CH2   1 
ATOM   4624  N N     . THR A 1 599 ? -21.975 43.413  45.782  1.00 28.53  ? 599  THR A N     1 
ATOM   4625  C CA    . THR A 1 599 ? -22.710 42.530  46.685  1.00 29.19  ? 599  THR A CA    1 
ATOM   4626  C C     . THR A 1 599 ? -22.032 42.419  48.048  1.00 29.85  ? 599  THR A C     1 
ATOM   4627  O O     . THR A 1 599 ? -20.823 42.627  48.161  1.00 29.89  ? 599  THR A O     1 
ATOM   4628  C CB    . THR A 1 599 ? -22.885 41.102  46.086  1.00 28.86  ? 599  THR A CB    1 
ATOM   4629  O OG1   . THR A 1 599 ? -23.886 40.398  46.824  1.00 28.65  ? 599  THR A OG1   1 
ATOM   4630  C CG2   . THR A 1 599 ? -21.578 40.305  46.140  1.00 28.41  ? 599  THR A CG2   1 
ATOM   4631  N N     . ASP A 1 600 ? -22.826 42.111  49.074  1.00 30.63  ? 600  ASP A N     1 
ATOM   4632  C CA    . ASP A 1 600 ? -22.306 41.611  50.353  1.00 31.51  ? 600  ASP A CA    1 
ATOM   4633  C C     . ASP A 1 600 ? -22.685 40.134  50.525  1.00 31.89  ? 600  ASP A C     1 
ATOM   4634  O O     . ASP A 1 600 ? -22.514 39.554  51.606  1.00 31.73  ? 600  ASP A O     1 
ATOM   4635  C CB    . ASP A 1 600 ? -22.842 42.442  51.532  1.00 31.80  ? 600  ASP A CB    1 
ATOM   4636  C CG    . ASP A 1 600 ? -22.370 43.891  51.495  1.00 33.20  ? 600  ASP A CG    1 
ATOM   4637  O OD1   . ASP A 1 600 ? -21.157 44.136  51.280  1.00 34.41  ? 600  ASP A OD1   1 
ATOM   4638  O OD2   . ASP A 1 600 ? -23.215 44.793  51.688  1.00 34.92  ? 600  ASP A OD2   1 
ATOM   4639  N N     . SER A 1 601 ? -23.196 39.531  49.451  1.00 32.49  ? 601  SER A N     1 
ATOM   4640  C CA    . SER A 1 601 ? -23.799 38.193  49.523  1.00 33.25  ? 601  SER A CA    1 
ATOM   4641  C C     . SER A 1 601 ? -23.017 37.088  48.802  1.00 33.77  ? 601  SER A C     1 
ATOM   4642  O O     . SER A 1 601 ? -23.626 36.170  48.243  1.00 33.81  ? 601  SER A O     1 
ATOM   4643  C CB    . SER A 1 601 ? -25.243 38.227  49.006  1.00 33.06  ? 601  SER A CB    1 
ATOM   4644  O OG    . SER A 1 601 ? -26.036 39.144  49.735  1.00 33.45  ? 601  SER A OG    1 
ATOM   4645  N N     . LEU A 1 602 ? -21.684 37.163  48.818  1.00 34.46  ? 602  LEU A N     1 
ATOM   4646  C CA    . LEU A 1 602 ? -20.857 36.085  48.267  1.00 35.14  ? 602  LEU A CA    1 
ATOM   4647  C C     . LEU A 1 602 ? -21.173 34.763  48.973  1.00 35.86  ? 602  LEU A C     1 
ATOM   4648  O O     . LEU A 1 602 ? -21.146 34.701  50.205  1.00 36.00  ? 602  LEU A O     1 
ATOM   4649  C CB    . LEU A 1 602 ? -19.362 36.415  48.368  1.00 34.98  ? 602  LEU A CB    1 
ATOM   4650  C CG    . LEU A 1 602 ? -18.764 37.362  47.316  1.00 35.05  ? 602  LEU A CG    1 
ATOM   4651  C CD1   . LEU A 1 602 ? -17.290 37.619  47.591  1.00 34.10  ? 602  LEU A CD1   1 
ATOM   4652  C CD2   . LEU A 1 602 ? -18.950 36.813  45.909  1.00 34.37  ? 602  LEU A CD2   1 
ATOM   4653  N N     . PRO A 1 603 ? -21.481 33.705  48.196  1.00 36.56  ? 603  PRO A N     1 
ATOM   4654  C CA    . PRO A 1 603 ? -21.994 32.455  48.754  1.00 37.32  ? 603  PRO A CA    1 
ATOM   4655  C C     . PRO A 1 603 ? -20.886 31.520  49.242  1.00 38.14  ? 603  PRO A C     1 
ATOM   4656  O O     . PRO A 1 603 ? -20.198 30.875  48.442  1.00 38.46  ? 603  PRO A O     1 
ATOM   4657  C CB    . PRO A 1 603 ? -22.755 31.840  47.577  1.00 37.22  ? 603  PRO A CB    1 
ATOM   4658  C CG    . PRO A 1 603 ? -22.039 32.339  46.366  1.00 36.76  ? 603  PRO A CG    1 
ATOM   4659  C CD    . PRO A 1 603 ? -21.338 33.628  46.730  1.00 36.61  ? 603  PRO A CD    1 
ATOM   4660  N N     . LYS A 1 604 ? -20.729 31.448  50.557  1.00 39.09  ? 604  LYS A N     1 
ATOM   4661  C CA    . LYS A 1 604 ? -19.643 30.685  51.151  1.00 40.10  ? 604  LYS A CA    1 
ATOM   4662  C C     . LYS A 1 604 ? -20.139 29.503  51.960  1.00 40.71  ? 604  LYS A C     1 
ATOM   4663  O O     . LYS A 1 604 ? -21.151 29.598  52.655  1.00 40.66  ? 604  LYS A O     1 
ATOM   4664  C CB    . LYS A 1 604 ? -18.792 31.585  52.047  1.00 40.14  ? 604  LYS A CB    1 
ATOM   4665  C CG    . LYS A 1 604 ? -17.928 32.560  51.291  1.00 40.58  ? 604  LYS A CG    1 
ATOM   4666  C CD    . LYS A 1 604 ? -17.228 33.488  52.251  1.00 41.58  ? 604  LYS A CD    1 
ATOM   4667  C CE    . LYS A 1 604 ? -16.501 34.579  51.505  1.00 41.91  ? 604  LYS A CE    1 
ATOM   4668  N NZ    . LYS A 1 604 ? -16.186 35.677  52.451  1.00 43.22  ? 604  LYS A NZ    1 
ATOM   4669  N N     . THR A 1 605 ? -19.410 28.393  51.864  1.00 41.60  ? 605  THR A N     1 
ATOM   4670  C CA    . THR A 1 605 ? -19.593 27.254  52.762  1.00 42.57  ? 605  THR A CA    1 
ATOM   4671  C C     . THR A 1 605 ? -19.219 27.682  54.181  1.00 42.93  ? 605  THR A C     1 
ATOM   4672  O O     . THR A 1 605 ? -18.697 28.783  54.393  1.00 43.07  ? 605  THR A O     1 
ATOM   4673  C CB    . THR A 1 605 ? -18.712 26.049  52.354  1.00 42.65  ? 605  THR A CB    1 
ATOM   4674  O OG1   . THR A 1 605 ? -17.329 26.381  52.533  1.00 43.19  ? 605  THR A OG1   1 
ATOM   4675  C CG2   . THR A 1 605 ? -18.950 25.660  50.898  1.00 43.24  ? 605  THR A CG2   1 
ATOM   4676  N N     . ARG A 1 606 ? -19.483 26.807  55.147  1.00 43.64  ? 606  ARG A N     1 
ATOM   4677  C CA    . ARG A 1 606 ? -19.151 27.077  56.545  1.00 44.18  ? 606  ARG A CA    1 
ATOM   4678  C C     . ARG A 1 606 ? -17.636 27.180  56.776  1.00 44.37  ? 606  ARG A C     1 
ATOM   4679  O O     . ARG A 1 606 ? -17.187 27.918  57.661  1.00 44.38  ? 606  ARG A O     1 
ATOM   4680  C CB    . ARG A 1 606 ? -19.779 26.021  57.456  1.00 44.35  ? 606  ARG A CB    1 
ATOM   4681  C CG    . ARG A 1 606 ? -21.297 26.131  57.561  1.00 44.93  ? 606  ARG A CG    1 
ATOM   4682  C CD    . ARG A 1 606 ? -21.902 24.926  58.270  1.00 45.82  ? 606  ARG A CD    1 
ATOM   4683  N NE    . ARG A 1 606 ? -23.363 24.913  58.180  1.00 46.43  ? 606  ARG A NE    1 
ATOM   4684  C CZ    . ARG A 1 606 ? -24.056 24.437  57.146  1.00 46.72  ? 606  ARG A CZ    1 
ATOM   4685  N NH1   . ARG A 1 606 ? -23.436 23.926  56.088  1.00 46.76  ? 606  ARG A NH1   1 
ATOM   4686  N NH2   . ARG A 1 606 ? -25.381 24.473  57.168  1.00 47.03  ? 606  ARG A NH2   1 
ATOM   4687  N N     . SER A 1 607 ? -16.863 26.454  55.967  1.00 44.50  ? 607  SER A N     1 
ATOM   4688  C CA    . SER A 1 607 ? -15.400 26.512  56.020  1.00 44.66  ? 607  SER A CA    1 
ATOM   4689  C C     . SER A 1 607 ? -14.845 27.795  55.386  1.00 44.65  ? 607  SER A C     1 
ATOM   4690  O O     . SER A 1 607 ? -13.791 28.293  55.796  1.00 44.81  ? 607  SER A O     1 
ATOM   4691  C CB    . SER A 1 607 ? -14.777 25.278  55.352  1.00 44.75  ? 607  SER A CB    1 
ATOM   4692  O OG    . SER A 1 607 ? -14.811 25.371  53.935  1.00 44.52  ? 607  SER A OG    1 
ATOM   4693  N N     . GLY A 1 608 ? -15.552 28.316  54.384  1.00 44.48  ? 608  GLY A N     1 
ATOM   4694  C CA    . GLY A 1 608 ? -15.134 29.538  53.697  1.00 44.15  ? 608  GLY A CA    1 
ATOM   4695  C C     . GLY A 1 608 ? -14.929 29.379  52.200  1.00 43.91  ? 608  GLY A C     1 
ATOM   4696  O O     . GLY A 1 608 ? -14.503 30.322  51.524  1.00 43.80  ? 608  GLY A O     1 
ATOM   4697  N N     . LYS A 1 609 ? -15.224 28.189  51.679  1.00 43.58  ? 609  LYS A N     1 
ATOM   4698  C CA    . LYS A 1 609 ? -15.147 27.952  50.239  1.00 43.30  ? 609  LYS A CA    1 
ATOM   4699  C C     . LYS A 1 609 ? -16.229 28.755  49.526  1.00 43.09  ? 609  LYS A C     1 
ATOM   4700  O O     . LYS A 1 609 ? -17.393 28.749  49.927  1.00 43.00  ? 609  LYS A O     1 
ATOM   4701  C CB    . LYS A 1 609 ? -15.283 26.461  49.912  1.00 43.33  ? 609  LYS A CB    1 
ATOM   4702  N N     . ILE A 1 610 ? -15.830 29.470  48.483  1.00 42.91  ? 610  ILE A N     1 
ATOM   4703  C CA    . ILE A 1 610 ? -16.777 30.228  47.678  1.00 42.55  ? 610  ILE A CA    1 
ATOM   4704  C C     . ILE A 1 610 ? -17.432 29.307  46.631  1.00 42.00  ? 610  ILE A C     1 
ATOM   4705  O O     . ILE A 1 610 ? -16.744 28.675  45.823  1.00 41.95  ? 610  ILE A O     1 
ATOM   4706  C CB    . ILE A 1 610 ? -16.115 31.511  47.077  1.00 42.76  ? 610  ILE A CB    1 
ATOM   4707  C CG1   . ILE A 1 610 ? -17.132 32.356  46.302  1.00 42.98  ? 610  ILE A CG1   1 
ATOM   4708  C CG2   . ILE A 1 610 ? -14.854 31.171  46.246  1.00 43.30  ? 610  ILE A CG2   1 
ATOM   4709  C CD1   . ILE A 1 610 ? -17.178 32.064  44.825  1.00 44.15  ? 610  ILE A CD1   1 
ATOM   4710  N N     . MET A 1 611 ? -18.761 29.217  46.678  1.00 41.20  ? 611  MET A N     1 
ATOM   4711  C CA    . MET A 1 611 ? -19.516 28.364  45.759  1.00 40.69  ? 611  MET A CA    1 
ATOM   4712  C C     . MET A 1 611 ? -19.625 29.001  44.374  1.00 39.60  ? 611  MET A C     1 
ATOM   4713  O O     . MET A 1 611 ? -20.465 29.868  44.136  1.00 39.62  ? 611  MET A O     1 
ATOM   4714  C CB    . MET A 1 611 ? -20.897 28.009  46.339  1.00 40.70  ? 611  MET A CB    1 
ATOM   4715  C CG    . MET A 1 611 ? -20.856 26.892  47.377  1.00 41.01  ? 611  MET A CG    1 
ATOM   4716  S SD    . MET A 1 611 ? -22.471 26.242  47.886  1.00 42.68  ? 611  MET A SD    1 
ATOM   4717  C CE    . MET A 1 611 ? -23.045 25.440  46.380  1.00 43.84  ? 611  MET A CE    1 
ATOM   4718  N N     . ARG A 1 612 ? -18.766 28.551  43.465  1.00 38.40  ? 612  ARG A N     1 
ATOM   4719  C CA    . ARG A 1 612 ? -18.583 29.194  42.167  1.00 37.28  ? 612  ARG A CA    1 
ATOM   4720  C C     . ARG A 1 612 ? -19.620 28.838  41.107  1.00 36.14  ? 612  ARG A C     1 
ATOM   4721  O O     . ARG A 1 612 ? -19.903 29.645  40.221  1.00 35.39  ? 612  ARG A O     1 
ATOM   4722  C CB    . ARG A 1 612 ? -17.186 28.893  41.630  1.00 37.70  ? 612  ARG A CB    1 
ATOM   4723  C CG    . ARG A 1 612 ? -16.083 29.572  42.407  1.00 39.29  ? 612  ARG A CG    1 
ATOM   4724  C CD    . ARG A 1 612 ? -14.789 29.555  41.633  1.00 41.37  ? 612  ARG A CD    1 
ATOM   4725  N NE    . ARG A 1 612 ? -14.253 30.907  41.573  1.00 43.62  ? 612  ARG A NE    1 
ATOM   4726  C CZ    . ARG A 1 612 ? -14.379 31.724  40.532  1.00 43.84  ? 612  ARG A CZ    1 
ATOM   4727  N NH1   . ARG A 1 612 ? -14.996 31.335  39.423  1.00 43.42  ? 612  ARG A NH1   1 
ATOM   4728  N NH2   . ARG A 1 612 ? -13.861 32.933  40.595  1.00 45.33  ? 612  ARG A NH2   1 
ATOM   4729  N N     . ARG A 1 613 ? -20.162 27.625  41.186  1.00 34.88  ? 613  ARG A N     1 
ATOM   4730  C CA    . ARG A 1 613 ? -21.181 27.169  40.238  1.00 34.09  ? 613  ARG A CA    1 
ATOM   4731  C C     . ARG A 1 613 ? -22.461 28.023  40.296  1.00 33.40  ? 613  ARG A C     1 
ATOM   4732  O O     . ARG A 1 613 ? -23.032 28.370  39.259  1.00 33.02  ? 613  ARG A O     1 
ATOM   4733  C CB    . ARG A 1 613 ? -21.502 25.687  40.452  1.00 34.02  ? 613  ARG A CB    1 
ATOM   4734  N N     . ILE A 1 614 ? -22.901 28.364  41.504  1.00 32.74  ? 614  ILE A N     1 
ATOM   4735  C CA    . ILE A 1 614 ? -24.065 29.231  41.659  1.00 32.32  ? 614  ILE A CA    1 
ATOM   4736  C C     . ILE A 1 614 ? -23.806 30.626  41.066  1.00 31.75  ? 614  ILE A C     1 
ATOM   4737  O O     . ILE A 1 614 ? -24.631 31.139  40.312  1.00 31.55  ? 614  ILE A O     1 
ATOM   4738  C CB    . ILE A 1 614 ? -24.588 29.289  43.131  1.00 32.54  ? 614  ILE A CB    1 
ATOM   4739  C CG1   . ILE A 1 614 ? -25.751 30.277  43.267  1.00 32.93  ? 614  ILE A CG1   1 
ATOM   4740  C CG2   . ILE A 1 614 ? -23.483 29.640  44.109  1.00 33.06  ? 614  ILE A CG2   1 
ATOM   4741  C CD1   . ILE A 1 614 ? -27.057 29.771  42.672  1.00 34.57  ? 614  ILE A CD1   1 
ATOM   4742  N N     . LEU A 1 615 ? -22.651 31.210  41.380  1.00 30.95  ? 615  LEU A N     1 
ATOM   4743  C CA    . LEU A 1 615 ? -22.267 32.510  40.824  1.00 30.64  ? 615  LEU A CA    1 
ATOM   4744  C C     . LEU A 1 615 ? -22.220 32.498  39.295  1.00 30.35  ? 615  LEU A C     1 
ATOM   4745  O O     . LEU A 1 615 ? -22.674 33.443  38.644  1.00 29.96  ? 615  LEU A O     1 
ATOM   4746  C CB    . LEU A 1 615 ? -20.929 32.976  41.406  1.00 30.47  ? 615  LEU A CB    1 
ATOM   4747  C CG    . LEU A 1 615 ? -20.925 33.272  42.910  1.00 30.23  ? 615  LEU A CG    1 
ATOM   4748  C CD1   . LEU A 1 615 ? -19.534 33.672  43.345  1.00 30.46  ? 615  LEU A CD1   1 
ATOM   4749  C CD2   . LEU A 1 615 ? -21.929 34.358  43.273  1.00 28.89  ? 615  LEU A CD2   1 
ATOM   4750  N N     . ARG A 1 616 ? -21.686 31.412  38.740  1.00 30.12  ? 616  ARG A N     1 
ATOM   4751  C CA    . ARG A 1 616 ? -21.674 31.182  37.302  1.00 30.46  ? 616  ARG A CA    1 
ATOM   4752  C C     . ARG A 1 616 ? -23.102 31.154  36.753  1.00 29.49  ? 616  ARG A C     1 
ATOM   4753  O O     . ARG A 1 616 ? -23.406 31.820  35.759  1.00 29.07  ? 616  ARG A O     1 
ATOM   4754  C CB    . ARG A 1 616 ? -20.963 29.856  36.995  1.00 30.49  ? 616  ARG A CB    1 
ATOM   4755  C CG    . ARG A 1 616 ? -20.206 29.830  35.670  1.00 32.54  ? 616  ARG A CG    1 
ATOM   4756  C CD    . ARG A 1 616 ? -19.270 28.591  35.527  1.00 32.75  ? 616  ARG A CD    1 
ATOM   4757  N NE    . ARG A 1 616 ? -18.232 28.510  36.566  1.00 35.61  ? 616  ARG A NE    1 
ATOM   4758  C CZ    . ARG A 1 616 ? -18.127 27.521  37.457  1.00 37.11  ? 616  ARG A CZ    1 
ATOM   4759  N NH1   . ARG A 1 616 ? -18.982 26.505  37.450  1.00 36.64  ? 616  ARG A NH1   1 
ATOM   4760  N NH2   . ARG A 1 616 ? -17.153 27.538  38.360  1.00 38.72  ? 616  ARG A NH2   1 
ATOM   4761  N N     . LYS A 1 617 ? -23.975 30.393  37.417  1.00 28.73  ? 617  LYS A N     1 
ATOM   4762  C CA    . LYS A 1 617 ? -25.363 30.219  36.970  1.00 27.98  ? 617  LYS A CA    1 
ATOM   4763  C C     . LYS A 1 617 ? -26.140 31.527  37.008  1.00 27.49  ? 617  LYS A C     1 
ATOM   4764  O O     . LYS A 1 617 ? -26.767 31.904  36.017  1.00 27.56  ? 617  LYS A O     1 
ATOM   4765  C CB    . LYS A 1 617 ? -26.075 29.144  37.801  1.00 27.96  ? 617  LYS A CB    1 
ATOM   4766  N N     . ILE A 1 618 ? -26.089 32.221  38.146  1.00 27.20  ? 618  ILE A N     1 
ATOM   4767  C CA    . ILE A 1 618 ? -26.804 33.489  38.316  1.00 27.07  ? 618  ILE A CA    1 
ATOM   4768  C C     . ILE A 1 618 ? -26.351 34.521  37.274  1.00 27.22  ? 618  ILE A C     1 
ATOM   4769  O O     . ILE A 1 618 ? -27.187 35.138  36.595  1.00 26.75  ? 618  ILE A O     1 
ATOM   4770  C CB    . ILE A 1 618 ? -26.680 34.041  39.766  1.00 27.09  ? 618  ILE A CB    1 
ATOM   4771  C CG1   . ILE A 1 618 ? -27.487 33.162  40.743  1.00 27.26  ? 618  ILE A CG1   1 
ATOM   4772  C CG2   . ILE A 1 618 ? -27.135 35.506  39.835  1.00 26.82  ? 618  ILE A CG2   1 
ATOM   4773  C CD1   . ILE A 1 618 ? -27.337 33.527  42.208  1.00 26.74  ? 618  ILE A CD1   1 
ATOM   4774  N N     . ALA A 1 619 ? -25.033 34.670  37.130  1.00 27.13  ? 619  ALA A N     1 
ATOM   4775  C CA    . ALA A 1 619 ? -24.454 35.618  36.167  1.00 27.67  ? 619  ALA A CA    1 
ATOM   4776  C C     . ALA A 1 619 ? -24.894 35.351  34.721  1.00 27.84  ? 619  ALA A C     1 
ATOM   4777  O O     . ALA A 1 619 ? -24.999 36.270  33.926  1.00 27.97  ? 619  ALA A O     1 
ATOM   4778  C CB    . ALA A 1 619 ? -22.928 35.640  36.281  1.00 27.17  ? 619  ALA A CB    1 
ATOM   4779  N N     . ALA A 1 620 ? -25.165 34.089  34.405  1.00 28.69  ? 620  ALA A N     1 
ATOM   4780  C CA    . ALA A 1 620 ? -25.648 33.691  33.087  1.00 29.52  ? 620  ALA A CA    1 
ATOM   4781  C C     . ALA A 1 620 ? -27.144 33.970  32.871  1.00 29.87  ? 620  ALA A C     1 
ATOM   4782  O O     . ALA A 1 620 ? -27.659 33.769  31.770  1.00 30.05  ? 620  ALA A O     1 
ATOM   4783  C CB    . ALA A 1 620 ? -25.350 32.220  32.850  1.00 29.47  ? 620  ALA A CB    1 
ATOM   4784  N N     . GLY A 1 621 ? -27.832 34.427  33.915  1.00 30.40  ? 621  GLY A N     1 
ATOM   4785  C CA    . GLY A 1 621 ? -29.271 34.693  33.838  1.00 30.78  ? 621  GLY A CA    1 
ATOM   4786  C C     . GLY A 1 621 ? -30.198 33.561  34.272  1.00 31.45  ? 621  GLY A C     1 
ATOM   4787  O O     . GLY A 1 621 ? -31.415 33.626  34.034  1.00 31.33  ? 621  GLY A O     1 
ATOM   4788  N N     . ASP A 1 622 ? -29.647 32.524  34.904  1.00 31.77  ? 622  ASP A N     1 
ATOM   4789  C CA    . ASP A 1 622 ? -30.474 31.435  35.443  1.00 32.32  ? 622  ASP A CA    1 
ATOM   4790  C C     . ASP A 1 622 ? -31.228 31.868  36.708  1.00 32.38  ? 622  ASP A C     1 
ATOM   4791  O O     . ASP A 1 622 ? -30.664 32.540  37.574  1.00 32.15  ? 622  ASP A O     1 
ATOM   4792  C CB    . ASP A 1 622 ? -29.634 30.192  35.752  1.00 32.52  ? 622  ASP A CB    1 
ATOM   4793  C CG    . ASP A 1 622 ? -28.901 29.643  34.533  1.00 33.91  ? 622  ASP A CG    1 
ATOM   4794  O OD1   . ASP A 1 622 ? -28.140 28.662  34.711  1.00 34.37  ? 622  ASP A OD1   1 
ATOM   4795  O OD2   . ASP A 1 622 ? -29.069 30.178  33.411  1.00 35.56  ? 622  ASP A OD2   1 
ATOM   4796  N N     . THR A 1 623 ? -32.497 31.469  36.800  1.00 32.63  ? 623  THR A N     1 
ATOM   4797  C CA    . THR A 1 623 ? -33.355 31.754  37.962  1.00 33.10  ? 623  THR A CA    1 
ATOM   4798  C C     . THR A 1 623 ? -33.765 30.456  38.691  1.00 33.12  ? 623  THR A C     1 
ATOM   4799  O O     . THR A 1 623 ? -34.442 30.498  39.729  1.00 33.06  ? 623  THR A O     1 
ATOM   4800  C CB    . THR A 1 623 ? -34.641 32.545  37.546  1.00 33.09  ? 623  THR A CB    1 
ATOM   4801  O OG1   . THR A 1 623 ? -34.293 33.646  36.696  1.00 33.95  ? 623  THR A OG1   1 
ATOM   4802  C CG2   . THR A 1 623 ? -35.372 33.096  38.768  1.00 34.03  ? 623  THR A CG2   1 
ATOM   4803  N N     . SER A 1 624 ? -33.351 29.312  38.146  1.00 33.16  ? 624  SER A N     1 
ATOM   4804  C CA    . SER A 1 624 ? -33.746 28.004  38.673  1.00 33.37  ? 624  SER A CA    1 
ATOM   4805  C C     . SER A 1 624 ? -32.606 26.993  38.629  1.00 33.54  ? 624  SER A C     1 
ATOM   4806  O O     . SER A 1 624 ? -31.644 27.168  37.880  1.00 33.45  ? 624  SER A O     1 
ATOM   4807  C CB    . SER A 1 624 ? -34.927 27.456  37.876  1.00 33.26  ? 624  SER A CB    1 
ATOM   4808  O OG    . SER A 1 624 ? -36.027 28.341  37.941  1.00 33.82  ? 624  SER A OG    1 
ATOM   4809  N N     . ASN A 1 625 ? -32.733 25.937  39.434  1.00 33.72  ? 625  ASN A N     1 
ATOM   4810  C CA    . ASN A 1 625 ? -31.777 24.816  39.470  1.00 33.98  ? 625  ASN A CA    1 
ATOM   4811  C C     . ASN A 1 625 ? -30.298 25.221  39.482  1.00 33.94  ? 625  ASN A C     1 
ATOM   4812  O O     . ASN A 1 625 ? -29.836 25.893  40.407  1.00 34.17  ? 625  ASN A O     1 
ATOM   4813  C CB    . ASN A 1 625 ? -32.056 23.826  38.329  1.00 34.07  ? 625  ASN A CB    1 
ATOM   4814  N N     . THR A 1 631 ? -25.037 23.150  52.911  1.00 38.84  ? 631  THR A N     1 
ATOM   4815  C CA    . THR A 1 631 ? -23.644 23.532  52.651  1.00 38.94  ? 631  THR A CA    1 
ATOM   4816  C C     . THR A 1 631 ? -23.374 25.036  52.829  1.00 38.97  ? 631  THR A C     1 
ATOM   4817  O O     . THR A 1 631 ? -22.385 25.413  53.467  1.00 39.16  ? 631  THR A O     1 
ATOM   4818  C CB    . THR A 1 631 ? -23.143 23.010  51.266  1.00 39.07  ? 631  THR A CB    1 
ATOM   4819  O OG1   . THR A 1 631 ? -22.596 21.696  51.427  1.00 39.20  ? 631  THR A OG1   1 
ATOM   4820  C CG2   . THR A 1 631 ? -22.064 23.903  50.679  1.00 38.68  ? 631  THR A CG2   1 
ATOM   4821  N N     . LEU A 1 632 ? -24.242 25.884  52.274  1.00 38.78  ? 632  LEU A N     1 
ATOM   4822  C CA    . LEU A 1 632 ? -24.097 27.338  52.426  1.00 38.52  ? 632  LEU A CA    1 
ATOM   4823  C C     . LEU A 1 632 ? -24.282 27.788  53.873  1.00 38.27  ? 632  LEU A C     1 
ATOM   4824  O O     . LEU A 1 632 ? -25.228 27.374  54.545  1.00 38.26  ? 632  LEU A O     1 
ATOM   4825  C CB    . LEU A 1 632 ? -25.067 28.099  51.514  1.00 38.41  ? 632  LEU A CB    1 
ATOM   4826  C CG    . LEU A 1 632 ? -24.702 28.244  50.036  1.00 38.66  ? 632  LEU A CG    1 
ATOM   4827  C CD1   . LEU A 1 632 ? -25.816 28.946  49.274  1.00 38.50  ? 632  LEU A CD1   1 
ATOM   4828  C CD2   . LEU A 1 632 ? -23.386 28.996  49.858  1.00 38.90  ? 632  LEU A CD2   1 
ATOM   4829  N N     . ALA A 1 633 ? -23.367 28.636  54.336  1.00 38.06  ? 633  ALA A N     1 
ATOM   4830  C CA    . ALA A 1 633 ? -23.400 29.175  55.695  1.00 37.96  ? 633  ALA A CA    1 
ATOM   4831  C C     . ALA A 1 633 ? -24.643 30.038  55.935  1.00 37.82  ? 633  ALA A C     1 
ATOM   4832  O O     . ALA A 1 633 ? -25.251 29.983  57.009  1.00 37.94  ? 633  ALA A O     1 
ATOM   4833  C CB    . ALA A 1 633 ? -22.130 29.968  55.974  1.00 38.05  ? 633  ALA A CB    1 
ATOM   4834  N N     . ASP A 1 634 ? -25.006 30.824  54.922  1.00 37.48  ? 634  ASP A N     1 
ATOM   4835  C CA    . ASP A 1 634 ? -26.233 31.614  54.919  1.00 37.06  ? 634  ASP A CA    1 
ATOM   4836  C C     . ASP A 1 634 ? -26.952 31.396  53.579  1.00 36.60  ? 634  ASP A C     1 
ATOM   4837  O O     . ASP A 1 634 ? -26.596 32.017  52.575  1.00 36.71  ? 634  ASP A O     1 
ATOM   4838  C CB    . ASP A 1 634 ? -25.901 33.096  55.139  1.00 37.29  ? 634  ASP A CB    1 
ATOM   4839  C CG    . ASP A 1 634 ? -27.139 33.963  55.354  1.00 37.65  ? 634  ASP A CG    1 
ATOM   4840  O OD1   . ASP A 1 634 ? -28.210 33.432  55.726  1.00 37.46  ? 634  ASP A OD1   1 
ATOM   4841  O OD2   . ASP A 1 634 ? -27.026 35.193  55.158  1.00 38.06  ? 634  ASP A OD2   1 
ATOM   4842  N N     . PRO A 1 635 ? -27.953 30.495  53.552  1.00 36.09  ? 635  PRO A N     1 
ATOM   4843  C CA    . PRO A 1 635 ? -28.610 30.098  52.295  1.00 35.73  ? 635  PRO A CA    1 
ATOM   4844  C C     . PRO A 1 635 ? -29.413 31.211  51.602  1.00 35.22  ? 635  PRO A C     1 
ATOM   4845  O O     . PRO A 1 635 ? -29.701 31.107  50.405  1.00 35.09  ? 635  PRO A O     1 
ATOM   4846  C CB    . PRO A 1 635 ? -29.537 28.951  52.730  1.00 35.65  ? 635  PRO A CB    1 
ATOM   4847  C CG    . PRO A 1 635 ? -29.785 29.191  54.167  1.00 35.95  ? 635  PRO A CG    1 
ATOM   4848  C CD    . PRO A 1 635 ? -28.522 29.785  54.713  1.00 36.10  ? 635  PRO A CD    1 
ATOM   4849  N N     . GLY A 1 636 ? -29.761 32.256  52.351  1.00 34.73  ? 636  GLY A N     1 
ATOM   4850  C CA    . GLY A 1 636 ? -30.515 33.392  51.823  1.00 33.92  ? 636  GLY A CA    1 
ATOM   4851  C C     . GLY A 1 636 ? -29.705 34.363  50.974  1.00 33.47  ? 636  GLY A C     1 
ATOM   4852  O O     . GLY A 1 636 ? -30.247 35.357  50.486  1.00 33.56  ? 636  GLY A O     1 
ATOM   4853  N N     . VAL A 1 637 ? -28.411 34.091  50.797  1.00 32.77  ? 637  VAL A N     1 
ATOM   4854  C CA    . VAL A 1 637 ? -27.582 34.895  49.888  1.00 32.03  ? 637  VAL A CA    1 
ATOM   4855  C C     . VAL A 1 637 ? -27.979 34.702  48.421  1.00 31.61  ? 637  VAL A C     1 
ATOM   4856  O O     . VAL A 1 637 ? -27.894 35.638  47.622  1.00 31.29  ? 637  VAL A O     1 
ATOM   4857  C CB    . VAL A 1 637 ? -26.048 34.646  50.053  1.00 32.05  ? 637  VAL A CB    1 
ATOM   4858  C CG1   . VAL A 1 637 ? -25.576 35.070  51.439  1.00 32.35  ? 637  VAL A CG1   1 
ATOM   4859  C CG2   . VAL A 1 637 ? -25.664 33.196  49.744  1.00 31.50  ? 637  VAL A CG2   1 
ATOM   4860  N N     . VAL A 1 638 ? -28.410 33.488  48.085  1.00 31.12  ? 638  VAL A N     1 
ATOM   4861  C CA    . VAL A 1 638 ? -28.796 33.135  46.718  1.00 30.96  ? 638  VAL A CA    1 
ATOM   4862  C C     . VAL A 1 638 ? -29.919 34.051  46.226  1.00 30.83  ? 638  VAL A C     1 
ATOM   4863  O O     . VAL A 1 638 ? -29.839 34.601  45.125  1.00 30.68  ? 638  VAL A O     1 
ATOM   4864  C CB    . VAL A 1 638 ? -29.217 31.640  46.610  1.00 31.01  ? 638  VAL A CB    1 
ATOM   4865  C CG1   . VAL A 1 638 ? -29.676 31.292  45.192  1.00 30.88  ? 638  VAL A CG1   1 
ATOM   4866  C CG2   . VAL A 1 638 ? -28.075 30.727  47.036  1.00 30.66  ? 638  VAL A CG2   1 
ATOM   4867  N N     . GLU A 1 639 ? -30.943 34.219  47.063  1.00 30.68  ? 639  GLU A N     1 
ATOM   4868  C CA    . GLU A 1 639 ? -32.070 35.106  46.781  1.00 30.89  ? 639  GLU A CA    1 
ATOM   4869  C C     . GLU A 1 639 ? -31.610 36.546  46.556  1.00 30.50  ? 639  GLU A C     1 
ATOM   4870  O O     . GLU A 1 639 ? -32.003 37.180  45.573  1.00 30.26  ? 639  GLU A O     1 
ATOM   4871  C CB    . GLU A 1 639 ? -33.094 35.041  47.926  1.00 31.25  ? 639  GLU A CB    1 
ATOM   4872  C CG    . GLU A 1 639 ? -34.342 35.910  47.740  1.00 32.95  ? 639  GLU A CG    1 
ATOM   4873  C CD    . GLU A 1 639 ? -35.332 35.342  46.727  1.00 35.03  ? 639  GLU A CD    1 
ATOM   4874  O OE1   . GLU A 1 639 ? -36.470 35.007  47.136  1.00 35.00  ? 639  GLU A OE1   1 
ATOM   4875  O OE2   . GLU A 1 639 ? -34.975 35.237  45.526  1.00 36.26  ? 639  GLU A OE2   1 
ATOM   4876  N N     . LYS A 1 640 ? -30.776 37.048  47.468  1.00 30.15  ? 640  LYS A N     1 
ATOM   4877  C CA    . LYS A 1 640 ? -30.232 38.399  47.370  1.00 30.04  ? 640  LYS A CA    1 
ATOM   4878  C C     . LYS A 1 640 ? -29.443 38.585  46.066  1.00 29.99  ? 640  LYS A C     1 
ATOM   4879  O O     . LYS A 1 640 ? -29.615 39.593  45.376  1.00 30.09  ? 640  LYS A O     1 
ATOM   4880  C CB    . LYS A 1 640 ? -29.349 38.714  48.581  1.00 30.14  ? 640  LYS A CB    1 
ATOM   4881  N N     . LEU A 1 641 ? -28.604 37.604  45.729  1.00 29.78  ? 641  LEU A N     1 
ATOM   4882  C CA    . LEU A 1 641 ? -27.789 37.645  44.505  1.00 29.82  ? 641  LEU A CA    1 
ATOM   4883  C C     . LEU A 1 641 ? -28.641 37.705  43.225  1.00 30.28  ? 641  LEU A C     1 
ATOM   4884  O O     . LEU A 1 641 ? -28.326 38.460  42.303  1.00 30.00  ? 641  LEU A O     1 
ATOM   4885  C CB    . LEU A 1 641 ? -26.807 36.467  44.457  1.00 29.39  ? 641  LEU A CB    1 
ATOM   4886  C CG    . LEU A 1 641 ? -25.598 36.456  45.405  1.00 28.77  ? 641  LEU A CG    1 
ATOM   4887  C CD1   . LEU A 1 641 ? -24.967 35.073  45.427  1.00 28.14  ? 641  LEU A CD1   1 
ATOM   4888  C CD2   . LEU A 1 641 ? -24.547 37.530  45.037  1.00 28.91  ? 641  LEU A CD2   1 
ATOM   4889  N N     . LEU A 1 642 ? -29.714 36.915  43.189  1.00 30.79  ? 642  LEU A N     1 
ATOM   4890  C CA    . LEU A 1 642 ? -30.687 36.928  42.088  1.00 31.70  ? 642  LEU A CA    1 
ATOM   4891  C C     . LEU A 1 642 ? -31.361 38.288  41.909  1.00 32.27  ? 642  LEU A C     1 
ATOM   4892  O O     . LEU A 1 642 ? -31.458 38.789  40.789  1.00 32.27  ? 642  LEU A O     1 
ATOM   4893  C CB    . LEU A 1 642 ? -31.769 35.854  42.295  1.00 31.73  ? 642  LEU A CB    1 
ATOM   4894  C CG    . LEU A 1 642 ? -31.419 34.383  42.045  1.00 31.85  ? 642  LEU A CG    1 
ATOM   4895  C CD1   . LEU A 1 642 ? -32.502 33.486  42.622  1.00 32.15  ? 642  LEU A CD1   1 
ATOM   4896  C CD2   . LEU A 1 642 ? -31.229 34.102  40.561  1.00 31.42  ? 642  LEU A CD2   1 
ATOM   4897  N N     . GLU A 1 643 ? -31.834 38.864  43.014  1.00 33.06  ? 643  GLU A N     1 
ATOM   4898  C CA    . GLU A 1 643 ? -32.442 40.195  43.016  1.00 33.95  ? 643  GLU A CA    1 
ATOM   4899  C C     . GLU A 1 643 ? -31.487 41.238  42.445  1.00 34.39  ? 643  GLU A C     1 
ATOM   4900  O O     . GLU A 1 643 ? -31.860 42.009  41.560  1.00 34.66  ? 643  GLU A O     1 
ATOM   4901  C CB    . GLU A 1 643 ? -32.823 40.612  44.435  1.00 33.87  ? 643  GLU A CB    1 
ATOM   4902  C CG    . GLU A 1 643 ? -34.107 40.014  44.966  1.00 34.18  ? 643  GLU A CG    1 
ATOM   4903  C CD    . GLU A 1 643 ? -34.329 40.332  46.440  1.00 34.39  ? 643  GLU A CD    1 
ATOM   4904  O OE1   . GLU A 1 643 ? -35.301 39.797  47.023  1.00 34.56  ? 643  GLU A OE1   1 
ATOM   4905  O OE2   . GLU A 1 643 ? -33.533 41.112  47.016  1.00 34.42  ? 643  GLU A OE2   1 
ATOM   4906  N N     . GLU A 1 644 ? -30.260 41.252  42.963  1.00 34.98  ? 644  GLU A N     1 
ATOM   4907  C CA    . GLU A 1 644 ? -29.229 42.199  42.531  1.00 35.51  ? 644  GLU A CA    1 
ATOM   4908  C C     . GLU A 1 644 ? -28.895 42.051  41.042  1.00 36.48  ? 644  GLU A C     1 
ATOM   4909  O O     . GLU A 1 644 ? -28.696 43.048  40.343  1.00 36.50  ? 644  GLU A O     1 
ATOM   4910  C CB    . GLU A 1 644 ? -27.962 42.033  43.378  1.00 35.55  ? 644  GLU A CB    1 
ATOM   4911  C CG    . GLU A 1 644 ? -28.131 42.365  44.864  1.00 34.75  ? 644  GLU A CG    1 
ATOM   4912  C CD    . GLU A 1 644 ? -26.980 41.847  45.731  1.00 34.27  ? 644  GLU A CD    1 
ATOM   4913  O OE1   . GLU A 1 644 ? -26.098 41.136  45.208  1.00 31.88  ? 644  GLU A OE1   1 
ATOM   4914  O OE2   . GLU A 1 644 ? -26.960 42.156  46.941  1.00 31.56  ? 644  GLU A OE2   1 
ATOM   4915  N N     . LYS A 1 645 ? -28.837 40.805  40.567  1.00 37.52  ? 645  LYS A N     1 
ATOM   4916  C CA    . LYS A 1 645 ? -28.615 40.514  39.150  1.00 38.60  ? 645  LYS A CA    1 
ATOM   4917  C C     . LYS A 1 645 ? -29.735 41.096  38.281  1.00 39.49  ? 645  LYS A C     1 
ATOM   4918  O O     . LYS A 1 645 ? -29.480 41.566  37.168  1.00 39.67  ? 645  LYS A O     1 
ATOM   4919  C CB    . LYS A 1 645 ? -28.495 39.005  38.917  1.00 38.46  ? 645  LYS A CB    1 
ATOM   4920  C CG    . LYS A 1 645 ? -27.621 38.622  37.729  1.00 39.02  ? 645  LYS A CG    1 
ATOM   4921  C CD    . LYS A 1 645 ? -28.393 38.616  36.430  1.00 39.95  ? 645  LYS A CD    1 
ATOM   4922  C CE    . LYS A 1 645 ? -27.458 38.562  35.236  1.00 40.34  ? 645  LYS A CE    1 
ATOM   4923  N NZ    . LYS A 1 645 ? -28.236 38.641  33.967  1.00 40.64  ? 645  LYS A NZ    1 
ATOM   4924  N N     . GLN A 1 646 ? -30.963 41.069  38.794  1.00 40.35  ? 646  GLN A N     1 
ATOM   4925  C CA    . GLN A 1 646 ? -32.113 41.640  38.090  1.00 41.57  ? 646  GLN A CA    1 
ATOM   4926  C C     . GLN A 1 646 ? -32.049 43.166  37.986  1.00 41.94  ? 646  GLN A C     1 
ATOM   4927  O O     . GLN A 1 646 ? -32.481 43.745  36.986  1.00 42.17  ? 646  GLN A O     1 
ATOM   4928  C CB    . GLN A 1 646 ? -33.418 41.212  38.762  1.00 41.63  ? 646  GLN A CB    1 
ATOM   4929  C CG    . GLN A 1 646 ? -33.903 39.835  38.338  1.00 42.97  ? 646  GLN A CG    1 
ATOM   4930  C CD    . GLN A 1 646 ? -34.450 39.821  36.919  1.00 44.27  ? 646  GLN A CD    1 
ATOM   4931  O OE1   . GLN A 1 646 ? -35.424 40.514  36.603  1.00 44.60  ? 646  GLN A OE1   1 
ATOM   4932  N NE2   . GLN A 1 646 ? -33.828 39.026  36.058  1.00 44.14  ? 646  GLN A NE2   1 
ATOM   4933  N N     . ALA A 1 647 ? -31.510 43.805  39.025  1.00 42.36  ? 647  ALA A N     1 
ATOM   4934  C CA    . ALA A 1 647 ? -31.355 45.258  39.064  1.00 42.58  ? 647  ALA A CA    1 
ATOM   4935  C C     . ALA A 1 647 ? -30.398 45.767  37.981  1.00 42.85  ? 647  ALA A C     1 
ATOM   4936  O O     . ALA A 1 647 ? -29.470 45.062  37.565  1.00 43.25  ? 647  ALA A O     1 
ATOM   4937  C CB    . ALA A 1 647 ? -30.888 45.698  40.444  1.00 42.47  ? 647  ALA A CB    1 
ATOM   4938  N N     . HIS B 1 5   ? -32.094 68.192  47.229  1.00 48.62  ? 5    HIS B N     1 
ATOM   4939  C CA    . HIS B 1 5   ? -30.893 69.080  47.289  1.00 48.53  ? 5    HIS B CA    1 
ATOM   4940  C C     . HIS B 1 5   ? -30.907 70.121  46.165  1.00 47.55  ? 5    HIS B C     1 
ATOM   4941  O O     . HIS B 1 5   ? -30.923 69.760  44.985  1.00 47.87  ? 5    HIS B O     1 
ATOM   4942  C CB    . HIS B 1 5   ? -29.605 68.239  47.222  1.00 49.21  ? 5    HIS B CB    1 
ATOM   4943  C CG    . HIS B 1 5   ? -28.352 69.055  47.088  1.00 50.99  ? 5    HIS B CG    1 
ATOM   4944  N ND1   . HIS B 1 5   ? -27.913 69.555  45.879  1.00 52.39  ? 5    HIS B ND1   1 
ATOM   4945  C CD2   . HIS B 1 5   ? -27.445 69.455  48.012  1.00 52.43  ? 5    HIS B CD2   1 
ATOM   4946  C CE1   . HIS B 1 5   ? -26.794 70.232  46.065  1.00 52.91  ? 5    HIS B CE1   1 
ATOM   4947  N NE2   . HIS B 1 5   ? -26.485 70.182  47.349  1.00 53.42  ? 5    HIS B NE2   1 
ATOM   4948  N N     . LYS B 1 6   ? -30.889 71.402  46.542  1.00 46.04  ? 6    LYS B N     1 
ATOM   4949  C CA    . LYS B 1 6   ? -30.797 72.516  45.585  1.00 44.52  ? 6    LYS B CA    1 
ATOM   4950  C C     . LYS B 1 6   ? -29.372 73.080  45.494  1.00 43.06  ? 6    LYS B C     1 
ATOM   4951  O O     . LYS B 1 6   ? -28.740 73.369  46.519  1.00 43.44  ? 6    LYS B O     1 
ATOM   4952  C CB    . LYS B 1 6   ? -31.774 73.644  45.952  1.00 44.54  ? 6    LYS B CB    1 
ATOM   4953  C CG    . LYS B 1 6   ? -33.139 73.588  45.258  1.00 44.66  ? 6    LYS B CG    1 
ATOM   4954  C CD    . LYS B 1 6   ? -34.066 74.696  45.778  1.00 44.95  ? 6    LYS B CD    1 
ATOM   4955  C CE    . LYS B 1 6   ? -35.192 75.024  44.799  1.00 46.06  ? 6    LYS B CE    1 
ATOM   4956  N NZ    . LYS B 1 6   ? -36.064 76.160  45.256  1.00 46.05  ? 6    LYS B NZ    1 
ATOM   4957  N N     . HIS B 1 7   ? -28.874 73.229  44.267  1.00 40.71  ? 7    HIS B N     1 
ATOM   4958  C CA    . HIS B 1 7   ? -27.594 73.887  44.026  1.00 38.42  ? 7    HIS B CA    1 
ATOM   4959  C C     . HIS B 1 7   ? -27.797 75.395  43.950  1.00 37.16  ? 7    HIS B C     1 
ATOM   4960  O O     . HIS B 1 7   ? -28.422 75.902  43.012  1.00 36.60  ? 7    HIS B O     1 
ATOM   4961  C CB    . HIS B 1 7   ? -26.940 73.371  42.741  1.00 38.26  ? 7    HIS B CB    1 
ATOM   4962  C CG    . HIS B 1 7   ? -26.386 71.986  42.861  1.00 37.45  ? 7    HIS B CG    1 
ATOM   4963  N ND1   . HIS B 1 7   ? -25.082 71.737  43.230  1.00 36.32  ? 7    HIS B ND1   1 
ATOM   4964  C CD2   . HIS B 1 7   ? -26.960 70.776  42.663  1.00 36.66  ? 7    HIS B CD2   1 
ATOM   4965  C CE1   . HIS B 1 7   ? -24.877 70.432  43.256  1.00 36.83  ? 7    HIS B CE1   1 
ATOM   4966  N NE2   . HIS B 1 7   ? -25.998 69.826  42.909  1.00 36.87  ? 7    HIS B NE2   1 
ATOM   4967  N N     . ALA B 1 8   ? -27.272 76.101  44.947  1.00 35.75  ? 8    ALA B N     1 
ATOM   4968  C CA    . ALA B 1 8   ? -27.389 77.556  45.022  1.00 34.52  ? 8    ALA B CA    1 
ATOM   4969  C C     . ALA B 1 8   ? -26.597 78.251  43.914  1.00 33.61  ? 8    ALA B C     1 
ATOM   4970  O O     . ALA B 1 8   ? -25.655 77.678  43.340  1.00 33.54  ? 8    ALA B O     1 
ATOM   4971  C CB    . ALA B 1 8   ? -26.950 78.055  46.393  1.00 34.83  ? 8    ALA B CB    1 
ATOM   4972  N N     . ILE B 1 9   ? -27.004 79.479  43.606  1.00 32.33  ? 9    ILE B N     1 
ATOM   4973  C CA    . ILE B 1 9   ? -26.346 80.295  42.594  1.00 31.18  ? 9    ILE B CA    1 
ATOM   4974  C C     . ILE B 1 9   ? -25.002 80.779  43.139  1.00 30.85  ? 9    ILE B C     1 
ATOM   4975  O O     . ILE B 1 9   ? -24.952 81.389  44.216  1.00 31.14  ? 9    ILE B O     1 
ATOM   4976  C CB    . ILE B 1 9   ? -27.238 81.496  42.178  1.00 31.21  ? 9    ILE B CB    1 
ATOM   4977  C CG1   . ILE B 1 9   ? -28.547 81.003  41.550  1.00 30.16  ? 9    ILE B CG1   1 
ATOM   4978  C CG2   . ILE B 1 9   ? -26.495 82.455  41.231  1.00 30.55  ? 9    ILE B CG2   1 
ATOM   4979  C CD1   . ILE B 1 9   ? -29.680 81.986  41.673  1.00 28.50  ? 9    ILE B CD1   1 
ATOM   4980  N N     . PRO B 1 10  ? -23.906 80.516  42.397  1.00 30.29  ? 10   PRO B N     1 
ATOM   4981  C CA    . PRO B 1 10  ? -22.578 80.892  42.889  1.00 29.79  ? 10   PRO B CA    1 
ATOM   4982  C C     . PRO B 1 10  ? -22.367 82.400  42.858  1.00 29.10  ? 10   PRO B C     1 
ATOM   4983  O O     . PRO B 1 10  ? -22.947 83.087  42.012  1.00 28.57  ? 10   PRO B O     1 
ATOM   4984  C CB    . PRO B 1 10  ? -21.621 80.197  41.911  1.00 29.81  ? 10   PRO B CB    1 
ATOM   4985  C CG    . PRO B 1 10  ? -22.464 79.293  41.073  1.00 30.07  ? 10   PRO B CG    1 
ATOM   4986  C CD    . PRO B 1 10  ? -23.830 79.881  41.072  1.00 30.05  ? 10   PRO B CD    1 
ATOM   4987  N N     . ALA B 1 11  ? -21.538 82.897  43.779  1.00 28.69  ? 11   ALA B N     1 
ATOM   4988  C CA    . ALA B 1 11  ? -21.275 84.332  43.920  1.00 28.03  ? 11   ALA B CA    1 
ATOM   4989  C C     . ALA B 1 11  ? -20.799 84.972  42.617  1.00 27.78  ? 11   ALA B C     1 
ATOM   4990  O O     . ALA B 1 11  ? -21.276 86.049  42.255  1.00 27.64  ? 11   ALA B O     1 
ATOM   4991  C CB    . ALA B 1 11  ? -20.267 84.593  45.044  1.00 28.13  ? 11   ALA B CB    1 
ATOM   4992  N N     . ASN B 1 12  ? -19.868 84.308  41.923  1.00 27.48  ? 12   ASN B N     1 
ATOM   4993  C CA    . ASN B 1 12  ? -19.351 84.790  40.641  1.00 27.06  ? 12   ASN B CA    1 
ATOM   4994  C C     . ASN B 1 12  ? -20.457 85.005  39.599  1.00 27.05  ? 12   ASN B C     1 
ATOM   4995  O O     . ASN B 1 12  ? -20.439 85.990  38.871  1.00 26.82  ? 12   ASN B O     1 
ATOM   4996  C CB    . ASN B 1 12  ? -18.248 83.866  40.091  1.00 27.11  ? 12   ASN B CB    1 
ATOM   4997  C CG    . ASN B 1 12  ? -18.782 82.509  39.609  1.00 27.19  ? 12   ASN B CG    1 
ATOM   4998  O OD1   . ASN B 1 12  ? -19.431 81.786  40.362  1.00 27.36  ? 12   ASN B OD1   1 
ATOM   4999  N ND2   . ASN B 1 12  ? -18.493 82.159  38.350  1.00 24.98  ? 12   ASN B ND2   1 
ATOM   5000  N N     . ILE B 1 13  ? -21.413 84.080  39.536  1.00 26.78  ? 13   ILE B N     1 
ATOM   5001  C CA    . ILE B 1 13  ? -22.536 84.198  38.614  1.00 26.92  ? 13   ILE B CA    1 
ATOM   5002  C C     . ILE B 1 13  ? -23.491 85.295  39.100  1.00 27.39  ? 13   ILE B C     1 
ATOM   5003  O O     . ILE B 1 13  ? -23.858 86.184  38.333  1.00 27.48  ? 13   ILE B O     1 
ATOM   5004  C CB    . ILE B 1 13  ? -23.255 82.826  38.399  1.00 26.88  ? 13   ILE B CB    1 
ATOM   5005  C CG1   . ILE B 1 13  ? -22.304 81.817  37.740  1.00 26.25  ? 13   ILE B CG1   1 
ATOM   5006  C CG2   . ILE B 1 13  ? -24.540 82.984  37.567  1.00 26.62  ? 13   ILE B CG2   1 
ATOM   5007  C CD1   . ILE B 1 13  ? -21.859 82.184  36.315  1.00 25.29  ? 13   ILE B CD1   1 
ATOM   5008  N N     . ALA B 1 14  ? -23.860 85.247  40.379  1.00 27.79  ? 14   ALA B N     1 
ATOM   5009  C CA    . ALA B 1 14  ? -24.715 86.277  40.973  1.00 28.38  ? 14   ALA B CA    1 
ATOM   5010  C C     . ALA B 1 14  ? -24.191 87.691  40.682  1.00 28.84  ? 14   ALA B C     1 
ATOM   5011  O O     . ALA B 1 14  ? -24.969 88.594  40.364  1.00 29.04  ? 14   ALA B O     1 
ATOM   5012  C CB    . ALA B 1 14  ? -24.858 86.054  42.469  1.00 28.14  ? 14   ALA B CB    1 
ATOM   5013  N N     . ASP B 1 15  ? -22.873 87.862  40.763  1.00 29.14  ? 15   ASP B N     1 
ATOM   5014  C CA    . ASP B 1 15  ? -22.248 89.162  40.588  1.00 29.89  ? 15   ASP B CA    1 
ATOM   5015  C C     . ASP B 1 15  ? -22.310 89.687  39.147  1.00 30.15  ? 15   ASP B C     1 
ATOM   5016  O O     . ASP B 1 15  ? -22.324 90.901  38.936  1.00 30.56  ? 15   ASP B O     1 
ATOM   5017  C CB    . ASP B 1 15  ? -20.798 89.136  41.100  1.00 30.26  ? 15   ASP B CB    1 
ATOM   5018  C CG    . ASP B 1 15  ? -20.700 89.065  42.647  1.00 31.63  ? 15   ASP B CG    1 
ATOM   5019  O OD1   . ASP B 1 15  ? -21.740 89.172  43.347  1.00 32.53  ? 15   ASP B OD1   1 
ATOM   5020  O OD2   . ASP B 1 15  ? -19.567 88.905  43.166  1.00 32.83  ? 15   ASP B OD2   1 
ATOM   5021  N N     . ARG B 1 16  ? -22.368 88.783  38.168  1.00 30.09  ? 16   ARG B N     1 
ATOM   5022  C CA    . ARG B 1 16  ? -22.320 89.172  36.754  1.00 30.34  ? 16   ARG B CA    1 
ATOM   5023  C C     . ARG B 1 16  ? -23.599 88.907  35.933  1.00 29.44  ? 16   ARG B C     1 
ATOM   5024  O O     . ARG B 1 16  ? -23.694 89.337  34.777  1.00 29.09  ? 16   ARG B O     1 
ATOM   5025  C CB    . ARG B 1 16  ? -21.090 88.543  36.063  1.00 30.47  ? 16   ARG B CB    1 
ATOM   5026  C CG    . ARG B 1 16  ? -21.149 87.022  35.904  1.00 31.81  ? 16   ARG B CG    1 
ATOM   5027  C CD    . ARG B 1 16  ? -19.818 86.424  35.416  1.00 32.14  ? 16   ARG B CD    1 
ATOM   5028  N NE    . ARG B 1 16  ? -19.710 86.389  33.953  1.00 34.72  ? 16   ARG B NE    1 
ATOM   5029  C CZ    . ARG B 1 16  ? -18.852 87.112  33.229  1.00 36.81  ? 16   ARG B CZ    1 
ATOM   5030  N NH1   . ARG B 1 16  ? -17.997 87.951  33.817  1.00 36.53  ? 16   ARG B NH1   1 
ATOM   5031  N NH2   . ARG B 1 16  ? -18.842 86.986  31.904  1.00 37.48  ? 16   ARG B NH2   1 
ATOM   5032  N N     . CYS B 1 17  ? -24.575 88.215  36.522  1.00 28.72  ? 17   CYS B N     1 
ATOM   5033  C CA    . CYS B 1 17  ? -25.718 87.700  35.753  1.00 28.10  ? 17   CYS B CA    1 
ATOM   5034  C C     . CYS B 1 17  ? -26.563 88.775  35.065  1.00 27.80  ? 17   CYS B C     1 
ATOM   5035  O O     . CYS B 1 17  ? -26.788 89.856  35.611  1.00 27.54  ? 17   CYS B O     1 
ATOM   5036  C CB    . CYS B 1 17  ? -26.598 86.774  36.602  1.00 28.25  ? 17   CYS B CB    1 
ATOM   5037  S SG    . CYS B 1 17  ? -27.563 87.571  37.913  1.00 28.31  ? 17   CYS B SG    1 
ATOM   5038  N N     . LEU B 1 18  ? -27.016 88.457  33.852  1.00 27.36  ? 18   LEU B N     1 
ATOM   5039  C CA    . LEU B 1 18  ? -27.904 89.327  33.083  1.00 27.06  ? 18   LEU B CA    1 
ATOM   5040  C C     . LEU B 1 18  ? -29.295 89.389  33.722  1.00 27.08  ? 18   LEU B C     1 
ATOM   5041  O O     . LEU B 1 18  ? -29.901 90.463  33.808  1.00 26.84  ? 18   LEU B O     1 
ATOM   5042  C CB    . LEU B 1 18  ? -27.986 88.860  31.621  1.00 26.82  ? 18   LEU B CB    1 
ATOM   5043  C CG    . LEU B 1 18  ? -26.674 88.854  30.820  1.00 26.97  ? 18   LEU B CG    1 
ATOM   5044  C CD1   . LEU B 1 18  ? -26.903 88.445  29.378  1.00 26.21  ? 18   LEU B CD1   1 
ATOM   5045  C CD2   . LEU B 1 18  ? -25.944 90.216  30.877  1.00 27.27  ? 18   LEU B CD2   1 
ATOM   5046  N N     . ILE B 1 19  ? -29.777 88.234  34.186  1.00 26.88  ? 19   ILE B N     1 
ATOM   5047  C CA    . ILE B 1 19  ? -31.079 88.124  34.855  1.00 26.72  ? 19   ILE B CA    1 
ATOM   5048  C C     . ILE B 1 19  ? -30.938 87.510  36.253  1.00 26.41  ? 19   ILE B C     1 
ATOM   5049  O O     . ILE B 1 19  ? -30.584 86.332  36.381  1.00 26.00  ? 19   ILE B O     1 
ATOM   5050  C CB    . ILE B 1 19  ? -32.077 87.243  34.041  1.00 26.65  ? 19   ILE B CB    1 
ATOM   5051  C CG1   . ILE B 1 19  ? -32.111 87.629  32.549  1.00 27.34  ? 19   ILE B CG1   1 
ATOM   5052  C CG2   . ILE B 1 19  ? -33.469 87.243  34.693  1.00 26.30  ? 19   ILE B CG2   1 
ATOM   5053  C CD1   . ILE B 1 19  ? -32.897 88.892  32.198  1.00 28.00  ? 19   ILE B CD1   1 
ATOM   5054  N N     . ASN B 1 20  ? -31.228 88.301  37.288  1.00 26.07  ? 20   ASN B N     1 
ATOM   5055  C CA    . ASN B 1 20  ? -31.274 87.788  38.664  1.00 26.17  ? 20   ASN B CA    1 
ATOM   5056  C C     . ASN B 1 20  ? -32.659 87.211  39.004  1.00 26.55  ? 20   ASN B C     1 
ATOM   5057  O O     . ASN B 1 20  ? -33.570 87.285  38.177  1.00 26.56  ? 20   ASN B O     1 
ATOM   5058  C CB    . ASN B 1 20  ? -30.812 88.859  39.679  1.00 25.90  ? 20   ASN B CB    1 
ATOM   5059  C CG    . ASN B 1 20  ? -31.792 90.028  39.818  1.00 25.72  ? 20   ASN B CG    1 
ATOM   5060  O OD1   . ASN B 1 20  ? -33.014 89.847  39.821  1.00 25.04  ? 20   ASN B OD1   1 
ATOM   5061  N ND2   . ASN B 1 20  ? -31.248 91.236  39.971  1.00 24.81  ? 20   ASN B ND2   1 
ATOM   5062  N N     . PRO B 1 21  ? -32.829 86.636  40.215  1.00 27.20  ? 21   PRO B N     1 
ATOM   5063  C CA    . PRO B 1 21  ? -34.110 85.992  40.546  1.00 27.52  ? 21   PRO B CA    1 
ATOM   5064  C C     . PRO B 1 21  ? -35.326 86.926  40.512  1.00 27.93  ? 21   PRO B C     1 
ATOM   5065  O O     . PRO B 1 21  ? -36.404 86.508  40.076  1.00 27.78  ? 21   PRO B O     1 
ATOM   5066  C CB    . PRO B 1 21  ? -33.883 85.459  41.967  1.00 27.41  ? 21   PRO B CB    1 
ATOM   5067  C CG    . PRO B 1 21  ? -32.390 85.370  42.107  1.00 27.62  ? 21   PRO B CG    1 
ATOM   5068  C CD    . PRO B 1 21  ? -31.871 86.531  41.332  1.00 27.40  ? 21   PRO B CD    1 
ATOM   5069  N N     . GLU B 1 22  ? -35.162 88.167  40.970  1.00 28.26  ? 22   GLU B N     1 
ATOM   5070  C CA    . GLU B 1 22  ? -36.268 89.129  40.971  1.00 29.28  ? 22   GLU B CA    1 
ATOM   5071  C C     . GLU B 1 22  ? -36.621 89.544  39.548  1.00 28.67  ? 22   GLU B C     1 
ATOM   5072  O O     . GLU B 1 22  ? -37.799 89.670  39.205  1.00 28.43  ? 22   GLU B O     1 
ATOM   5073  C CB    . GLU B 1 22  ? -35.943 90.365  41.827  1.00 29.17  ? 22   GLU B CB    1 
ATOM   5074  C CG    . GLU B 1 22  ? -37.149 91.282  42.081  1.00 30.73  ? 22   GLU B CG    1 
ATOM   5075  C CD    . GLU B 1 22  ? -36.779 92.599  42.765  1.00 31.79  ? 22   GLU B CD    1 
ATOM   5076  O OE1   . GLU B 1 22  ? -37.613 93.121  43.551  1.00 34.95  ? 22   GLU B OE1   1 
ATOM   5077  O OE2   . GLU B 1 22  ? -35.660 93.116  42.520  1.00 34.62  ? 22   GLU B OE2   1 
ATOM   5078  N N     . GLN B 1 23  ? -35.586 89.751  38.734  1.00 28.65  ? 23   GLN B N     1 
ATOM   5079  C CA    . GLN B 1 23  ? -35.737 90.089  37.320  1.00 28.64  ? 23   GLN B CA    1 
ATOM   5080  C C     . GLN B 1 23  ? -36.451 88.985  36.533  1.00 28.34  ? 23   GLN B C     1 
ATOM   5081  O O     . GLN B 1 23  ? -37.311 89.286  35.702  1.00 28.47  ? 23   GLN B O     1 
ATOM   5082  C CB    . GLN B 1 23  ? -34.375 90.429  36.702  1.00 28.67  ? 23   GLN B CB    1 
ATOM   5083  C CG    . GLN B 1 23  ? -33.807 91.762  37.217  1.00 29.24  ? 23   GLN B CG    1 
ATOM   5084  C CD    . GLN B 1 23  ? -32.387 92.041  36.763  1.00 29.13  ? 23   GLN B CD    1 
ATOM   5085  O OE1   . GLN B 1 23  ? -31.581 91.127  36.565  1.00 29.65  ? 23   GLN B OE1   1 
ATOM   5086  N NE2   . GLN B 1 23  ? -32.069 93.320  36.606  1.00 30.21  ? 23   GLN B NE2   1 
ATOM   5087  N N     . TYR B 1 24  ? -36.118 87.721  36.813  1.00 27.88  ? 24   TYR B N     1 
ATOM   5088  C CA    . TYR B 1 24  ? -36.844 86.584  36.222  1.00 27.42  ? 24   TYR B CA    1 
ATOM   5089  C C     . TYR B 1 24  ? -38.337 86.628  36.554  1.00 27.29  ? 24   TYR B C     1 
ATOM   5090  O O     . TYR B 1 24  ? -39.183 86.484  35.661  1.00 27.27  ? 24   TYR B O     1 
ATOM   5091  C CB    . TYR B 1 24  ? -36.281 85.216  36.651  1.00 27.18  ? 24   TYR B CB    1 
ATOM   5092  C CG    . TYR B 1 24  ? -37.202 84.077  36.227  1.00 27.24  ? 24   TYR B CG    1 
ATOM   5093  C CD1   . TYR B 1 24  ? -37.213 83.619  34.909  1.00 26.78  ? 24   TYR B CD1   1 
ATOM   5094  C CD2   . TYR B 1 24  ? -38.095 83.496  37.130  1.00 26.79  ? 24   TYR B CD2   1 
ATOM   5095  C CE1   . TYR B 1 24  ? -38.072 82.603  34.506  1.00 26.95  ? 24   TYR B CE1   1 
ATOM   5096  C CE2   . TYR B 1 24  ? -38.962 82.484  36.737  1.00 25.97  ? 24   TYR B CE2   1 
ATOM   5097  C CZ    . TYR B 1 24  ? -38.942 82.042  35.422  1.00 27.53  ? 24   TYR B CZ    1 
ATOM   5098  O OH    . TYR B 1 24  ? -39.792 81.035  35.019  1.00 28.36  ? 24   TYR B OH    1 
ATOM   5099  N N     . GLU B 1 25  ? -38.654 86.800  37.838  1.00 27.00  ? 25   GLU B N     1 
ATOM   5100  C CA    . GLU B 1 25  ? -40.050 86.783  38.288  1.00 27.13  ? 25   GLU B CA    1 
ATOM   5101  C C     . GLU B 1 25  ? -40.847 87.903  37.647  1.00 26.56  ? 25   GLU B C     1 
ATOM   5102  O O     . GLU B 1 25  ? -41.985 87.693  37.215  1.00 26.85  ? 25   GLU B O     1 
ATOM   5103  C CB    . GLU B 1 25  ? -40.158 86.852  39.816  1.00 27.09  ? 25   GLU B CB    1 
ATOM   5104  C CG    . GLU B 1 25  ? -39.632 85.615  40.554  1.00 29.85  ? 25   GLU B CG    1 
ATOM   5105  C CD    . GLU B 1 25  ? -40.416 84.328  40.262  1.00 32.94  ? 25   GLU B CD    1 
ATOM   5106  O OE1   . GLU B 1 25  ? -41.566 84.408  39.771  1.00 34.24  ? 25   GLU B OE1   1 
ATOM   5107  O OE2   . GLU B 1 25  ? -39.876 83.228  40.533  1.00 34.37  ? 25   GLU B OE2   1 
ATOM   5108  N N     . THR B 1 26  ? -40.229 89.081  37.578  1.00 26.01  ? 26   THR B N     1 
ATOM   5109  C CA    . THR B 1 26  ? -40.850 90.270  37.004  1.00 25.60  ? 26   THR B CA    1 
ATOM   5110  C C     . THR B 1 26  ? -41.055 90.119  35.497  1.00 25.11  ? 26   THR B C     1 
ATOM   5111  O O     . THR B 1 26  ? -42.144 90.388  34.985  1.00 24.60  ? 26   THR B O     1 
ATOM   5112  C CB    . THR B 1 26  ? -40.040 91.547  37.343  1.00 25.30  ? 26   THR B CB    1 
ATOM   5113  O OG1   . THR B 1 26  ? -40.011 91.721  38.767  1.00 25.46  ? 26   THR B OG1   1 
ATOM   5114  C CG2   . THR B 1 26  ? -40.668 92.794  36.712  1.00 26.07  ? 26   THR B CG2   1 
ATOM   5115  N N     . LYS B 1 27  ? -40.014 89.678  34.796  1.00 25.00  ? 27   LYS B N     1 
ATOM   5116  C CA    . LYS B 1 27  ? -40.092 89.508  33.352  1.00 25.28  ? 27   LYS B CA    1 
ATOM   5117  C C     . LYS B 1 27  ? -41.067 88.408  32.952  1.00 24.67  ? 27   LYS B C     1 
ATOM   5118  O O     . LYS B 1 27  ? -41.812 88.569  31.987  1.00 24.66  ? 27   LYS B O     1 
ATOM   5119  C CB    . LYS B 1 27  ? -38.712 89.246  32.741  1.00 25.42  ? 27   LYS B CB    1 
ATOM   5120  C CG    . LYS B 1 27  ? -37.828 90.489  32.645  1.00 26.47  ? 27   LYS B CG    1 
ATOM   5121  C CD    . LYS B 1 27  ? -36.533 90.175  31.889  1.00 26.69  ? 27   LYS B CD    1 
ATOM   5122  C CE    . LYS B 1 27  ? -35.588 91.370  31.882  1.00 28.69  ? 27   LYS B CE    1 
ATOM   5123  N NZ    . LYS B 1 27  ? -36.110 92.464  31.007  1.00 30.81  ? 27   LYS B NZ    1 
ATOM   5124  N N     . TYR B 1 28  ? -41.076 87.301  33.693  1.00 24.08  ? 28   TYR B N     1 
ATOM   5125  C CA    . TYR B 1 28  ? -41.972 86.195  33.359  1.00 23.62  ? 28   TYR B CA    1 
ATOM   5126  C C     . TYR B 1 28  ? -43.429 86.622  33.502  1.00 23.41  ? 28   TYR B C     1 
ATOM   5127  O O     . TYR B 1 28  ? -44.256 86.337  32.631  1.00 22.92  ? 28   TYR B O     1 
ATOM   5128  C CB    . TYR B 1 28  ? -41.701 84.935  34.197  1.00 23.35  ? 28   TYR B CB    1 
ATOM   5129  C CG    . TYR B 1 28  ? -42.625 83.798  33.815  1.00 23.13  ? 28   TYR B CG    1 
ATOM   5130  C CD1   . TYR B 1 28  ? -42.353 82.999  32.701  1.00 23.55  ? 28   TYR B CD1   1 
ATOM   5131  C CD2   . TYR B 1 28  ? -43.786 83.540  34.548  1.00 23.36  ? 28   TYR B CD2   1 
ATOM   5132  C CE1   . TYR B 1 28  ? -43.203 81.964  32.334  1.00 23.35  ? 28   TYR B CE1   1 
ATOM   5133  C CE2   . TYR B 1 28  ? -44.651 82.511  34.188  1.00 23.84  ? 28   TYR B CE2   1 
ATOM   5134  C CZ    . TYR B 1 28  ? -44.353 81.727  33.076  1.00 23.49  ? 28   TYR B CZ    1 
ATOM   5135  O OH    . TYR B 1 28  ? -45.205 80.711  32.713  1.00 22.59  ? 28   TYR B OH    1 
ATOM   5136  N N     . LYS B 1 29  ? -43.732 87.300  34.606  1.00 23.34  ? 29   LYS B N     1 
ATOM   5137  C CA    . LYS B 1 29  ? -45.078 87.804  34.846  1.00 23.22  ? 29   LYS B CA    1 
ATOM   5138  C C     . LYS B 1 29  ? -45.526 88.714  33.699  1.00 23.12  ? 29   LYS B C     1 
ATOM   5139  O O     . LYS B 1 29  ? -46.609 88.518  33.145  1.00 23.22  ? 29   LYS B O     1 
ATOM   5140  C CB    . LYS B 1 29  ? -45.163 88.531  36.198  1.00 23.59  ? 29   LYS B CB    1 
ATOM   5141  N N     . GLN B 1 30  ? -44.691 89.683  33.319  1.00 23.21  ? 30   GLN B N     1 
ATOM   5142  C CA    . GLN B 1 30  ? -45.051 90.587  32.217  1.00 23.16  ? 30   GLN B CA    1 
ATOM   5143  C C     . GLN B 1 30  ? -45.220 89.832  30.894  1.00 23.26  ? 30   GLN B C     1 
ATOM   5144  O O     . GLN B 1 30  ? -46.140 90.128  30.125  1.00 22.97  ? 30   GLN B O     1 
ATOM   5145  C CB    . GLN B 1 30  ? -44.057 91.740  32.056  1.00 23.07  ? 30   GLN B CB    1 
ATOM   5146  C CG    . GLN B 1 30  ? -44.606 92.873  31.175  1.00 23.18  ? 30   GLN B CG    1 
ATOM   5147  C CD    . GLN B 1 30  ? -43.562 93.883  30.732  1.00 23.46  ? 30   GLN B CD    1 
ATOM   5148  O OE1   . GLN B 1 30  ? -42.393 93.555  30.536  1.00 25.13  ? 30   GLN B OE1   1 
ATOM   5149  N NE2   . GLN B 1 30  ? -43.991 95.122  30.554  1.00 24.69  ? 30   GLN B NE2   1 
ATOM   5150  N N     . SER B 1 31  ? -44.344 88.860  30.641  1.00 23.42  ? 31   SER B N     1 
ATOM   5151  C CA    . SER B 1 31  ? -44.399 88.083  29.396  1.00 24.03  ? 31   SER B CA    1 
ATOM   5152  C C     . SER B 1 31  ? -45.719 87.328  29.266  1.00 25.02  ? 31   SER B C     1 
ATOM   5153  O O     . SER B 1 31  ? -46.223 87.141  28.156  1.00 25.23  ? 31   SER B O     1 
ATOM   5154  C CB    . SER B 1 31  ? -43.198 87.138  29.261  1.00 23.80  ? 31   SER B CB    1 
ATOM   5155  O OG    . SER B 1 31  ? -43.296 86.019  30.122  1.00 22.47  ? 31   SER B OG    1 
ATOM   5156  N N     . ILE B 1 32  ? -46.280 86.928  30.410  1.00 25.95  ? 32   ILE B N     1 
ATOM   5157  C CA    . ILE B 1 32  ? -47.544 86.179  30.462  1.00 26.81  ? 32   ILE B CA    1 
ATOM   5158  C C     . ILE B 1 32  ? -48.773 87.098  30.490  1.00 27.28  ? 32   ILE B C     1 
ATOM   5159  O O     . ILE B 1 32  ? -49.728 86.870  29.747  1.00 27.46  ? 32   ILE B O     1 
ATOM   5160  C CB    . ILE B 1 32  ? -47.565 85.166  31.664  1.00 27.12  ? 32   ILE B CB    1 
ATOM   5161  C CG1   . ILE B 1 32  ? -46.457 84.112  31.520  1.00 26.67  ? 32   ILE B CG1   1 
ATOM   5162  C CG2   . ILE B 1 32  ? -48.929 84.497  31.823  1.00 27.60  ? 32   ILE B CG2   1 
ATOM   5163  C CD1   . ILE B 1 32  ? -46.106 83.738  30.092  1.00 27.57  ? 32   ILE B CD1   1 
ATOM   5164  N N     . ASN B 1 33  ? -48.736 88.139  31.323  1.00 27.55  ? 33   ASN B N     1 
ATOM   5165  C CA    . ASN B 1 33  ? -49.858 89.071  31.444  1.00 28.26  ? 33   ASN B CA    1 
ATOM   5166  C C     . ASN B 1 33  ? -49.993 90.039  30.260  1.00 28.21  ? 33   ASN B C     1 
ATOM   5167  O O     . ASN B 1 33  ? -51.108 90.378  29.855  1.00 28.39  ? 33   ASN B O     1 
ATOM   5168  C CB    . ASN B 1 33  ? -49.770 89.872  32.752  1.00 28.69  ? 33   ASN B CB    1 
ATOM   5169  C CG    . ASN B 1 33  ? -49.802 88.988  34.009  1.00 30.44  ? 33   ASN B CG    1 
ATOM   5170  O OD1   . ASN B 1 33  ? -50.194 87.814  33.977  1.00 31.63  ? 33   ASN B OD1   1 
ATOM   5171  N ND2   . ASN B 1 33  ? -49.393 89.572  35.133  1.00 32.16  ? 33   ASN B ND2   1 
ATOM   5172  N N     . ASP B 1 34  ? -48.861 90.488  29.716  1.00 27.87  ? 34   ASP B N     1 
ATOM   5173  C CA    . ASP B 1 34  ? -48.857 91.476  28.635  1.00 27.33  ? 34   ASP B CA    1 
ATOM   5174  C C     . ASP B 1 34  ? -47.779 91.167  27.590  1.00 26.91  ? 34   ASP B C     1 
ATOM   5175  O O     . ASP B 1 34  ? -46.785 91.899  27.480  1.00 26.33  ? 34   ASP B O     1 
ATOM   5176  C CB    . ASP B 1 34  ? -48.672 92.885  29.211  1.00 27.71  ? 34   ASP B CB    1 
ATOM   5177  C CG    . ASP B 1 34  ? -49.009 93.985  28.212  1.00 28.93  ? 34   ASP B CG    1 
ATOM   5178  O OD1   . ASP B 1 34  ? -49.491 93.675  27.100  1.00 29.51  ? 34   ASP B OD1   1 
ATOM   5179  O OD2   . ASP B 1 34  ? -48.795 95.174  28.550  1.00 30.42  ? 34   ASP B OD2   1 
ATOM   5180  N N     . PRO B 1 35  ? -47.979 90.081  26.808  1.00 26.66  ? 35   PRO B N     1 
ATOM   5181  C CA    . PRO B 1 35  ? -46.992 89.654  25.812  1.00 26.25  ? 35   PRO B CA    1 
ATOM   5182  C C     . PRO B 1 35  ? -46.746 90.664  24.684  1.00 25.84  ? 35   PRO B C     1 
ATOM   5183  O O     . PRO B 1 35  ? -45.660 90.670  24.120  1.00 25.93  ? 35   PRO B O     1 
ATOM   5184  C CB    . PRO B 1 35  ? -47.575 88.340  25.266  1.00 26.02  ? 35   PRO B CB    1 
ATOM   5185  C CG    . PRO B 1 35  ? -49.012 88.412  25.542  1.00 26.79  ? 35   PRO B CG    1 
ATOM   5186  C CD    . PRO B 1 35  ? -49.151 89.187  26.824  1.00 26.74  ? 35   PRO B CD    1 
ATOM   5187  N N     . ASP B 1 36  ? -47.731 91.501  24.360  1.00 25.66  ? 36   ASP B N     1 
ATOM   5188  C CA    . ASP B 1 36  ? -47.534 92.572  23.372  1.00 25.56  ? 36   ASP B CA    1 
ATOM   5189  C C     . ASP B 1 36  ? -46.502 93.611  23.817  1.00 25.37  ? 36   ASP B C     1 
ATOM   5190  O O     . ASP B 1 36  ? -45.670 94.040  23.021  1.00 25.64  ? 36   ASP B O     1 
ATOM   5191  C CB    . ASP B 1 36  ? -48.860 93.253  23.011  1.00 25.65  ? 36   ASP B CB    1 
ATOM   5192  C CG    . ASP B 1 36  ? -49.674 92.454  22.000  1.00 26.39  ? 36   ASP B CG    1 
ATOM   5193  O OD1   . ASP B 1 36  ? -50.864 92.762  21.823  1.00 27.32  ? 36   ASP B OD1   1 
ATOM   5194  O OD2   . ASP B 1 36  ? -49.135 91.514  21.380  1.00 26.96  ? 36   ASP B OD2   1 
ATOM   5195  N N     . THR B 1 37  ? -46.559 94.016  25.084  1.00 24.89  ? 37   THR B N     1 
ATOM   5196  C CA    . THR B 1 37  ? -45.552 94.921  25.646  1.00 24.17  ? 37   THR B CA    1 
ATOM   5197  C C     . THR B 1 37  ? -44.199 94.215  25.865  1.00 23.72  ? 37   THR B C     1 
ATOM   5198  O O     . THR B 1 37  ? -43.163 94.718  25.418  1.00 23.56  ? 37   THR B O     1 
ATOM   5199  C CB    . THR B 1 37  ? -46.066 95.626  26.930  1.00 24.36  ? 37   THR B CB    1 
ATOM   5200  O OG1   . THR B 1 37  ? -47.282 96.330  26.624  1.00 23.90  ? 37   THR B OG1   1 
ATOM   5201  C CG2   . THR B 1 37  ? -45.040 96.618  27.476  1.00 24.00  ? 37   THR B CG2   1 
ATOM   5202  N N     . PHE B 1 38  ? -44.203 93.049  26.512  1.00 23.17  ? 38   PHE B N     1 
ATOM   5203  C CA    . PHE B 1 38  ? -42.950 92.322  26.748  1.00 22.79  ? 38   PHE B CA    1 
ATOM   5204  C C     . PHE B 1 38  ? -42.213 92.009  25.436  1.00 22.76  ? 38   PHE B C     1 
ATOM   5205  O O     . PHE B 1 38  ? -41.064 92.417  25.240  1.00 22.24  ? 38   PHE B O     1 
ATOM   5206  C CB    . PHE B 1 38  ? -43.171 91.043  27.570  1.00 23.19  ? 38   PHE B CB    1 
ATOM   5207  C CG    . PHE B 1 38  ? -41.901 90.276  27.831  1.00 23.12  ? 38   PHE B CG    1 
ATOM   5208  C CD1   . PHE B 1 38  ? -41.100 90.586  28.928  1.00 23.90  ? 38   PHE B CD1   1 
ATOM   5209  C CD2   . PHE B 1 38  ? -41.483 89.281  26.959  1.00 23.38  ? 38   PHE B CD2   1 
ATOM   5210  C CE1   . PHE B 1 38  ? -39.915 89.899  29.154  1.00 23.64  ? 38   PHE B CE1   1 
ATOM   5211  C CE2   . PHE B 1 38  ? -40.298 88.592  27.176  1.00 23.70  ? 38   PHE B CE2   1 
ATOM   5212  C CZ    . PHE B 1 38  ? -39.518 88.901  28.275  1.00 24.08  ? 38   PHE B CZ    1 
ATOM   5213  N N     . TRP B 1 39  ? -42.880 91.303  24.530  1.00 22.83  ? 39   TRP B N     1 
ATOM   5214  C CA    . TRP B 1 39  ? -42.259 90.943  23.255  1.00 22.97  ? 39   TRP B CA    1 
ATOM   5215  C C     . TRP B 1 39  ? -42.107 92.121  22.277  1.00 23.35  ? 39   TRP B C     1 
ATOM   5216  O O     . TRP B 1 39  ? -41.252 92.088  21.396  1.00 24.12  ? 39   TRP B O     1 
ATOM   5217  C CB    . TRP B 1 39  ? -42.970 89.739  22.621  1.00 22.47  ? 39   TRP B CB    1 
ATOM   5218  C CG    . TRP B 1 39  ? -42.740 88.454  23.404  1.00 21.90  ? 39   TRP B CG    1 
ATOM   5219  C CD1   . TRP B 1 39  ? -43.675 87.743  24.101  1.00 21.85  ? 39   TRP B CD1   1 
ATOM   5220  C CD2   . TRP B 1 39  ? -41.491 87.754  23.581  1.00 21.17  ? 39   TRP B CD2   1 
ATOM   5221  N NE1   . TRP B 1 39  ? -43.093 86.639  24.691  1.00 21.19  ? 39   TRP B NE1   1 
ATOM   5222  C CE2   . TRP B 1 39  ? -41.755 86.626  24.394  1.00 20.88  ? 39   TRP B CE2   1 
ATOM   5223  C CE3   . TRP B 1 39  ? -40.179 87.973  23.134  1.00 21.11  ? 39   TRP B CE3   1 
ATOM   5224  C CZ2   . TRP B 1 39  ? -40.759 85.712  24.760  1.00 21.49  ? 39   TRP B CZ2   1 
ATOM   5225  C CZ3   . TRP B 1 39  ? -39.186 87.070  23.500  1.00 21.64  ? 39   TRP B CZ3   1 
ATOM   5226  C CH2   . TRP B 1 39  ? -39.485 85.944  24.300  1.00 21.97  ? 39   TRP B CH2   1 
ATOM   5227  N N     . GLY B 1 40  ? -42.923 93.161  22.437  1.00 23.67  ? 40   GLY B N     1 
ATOM   5228  C CA    . GLY B 1 40  ? -42.763 94.388  21.662  1.00 23.49  ? 40   GLY B CA    1 
ATOM   5229  C C     . GLY B 1 40  ? -41.429 95.036  21.976  1.00 23.84  ? 40   GLY B C     1 
ATOM   5230  O O     . GLY B 1 40  ? -40.707 95.461  21.074  1.00 23.11  ? 40   GLY B O     1 
ATOM   5231  N N     . GLU B 1 41  ? -41.101 95.099  23.266  1.00 24.24  ? 41   GLU B N     1 
ATOM   5232  C CA    . GLU B 1 41  ? -39.811 95.624  23.712  1.00 24.91  ? 41   GLU B CA    1 
ATOM   5233  C C     . GLU B 1 41  ? -38.670 94.648  23.399  1.00 24.48  ? 41   GLU B C     1 
ATOM   5234  O O     . GLU B 1 41  ? -37.623 95.045  22.889  1.00 24.60  ? 41   GLU B O     1 
ATOM   5235  C CB    . GLU B 1 41  ? -39.849 95.945  25.210  1.00 24.97  ? 41   GLU B CB    1 
ATOM   5236  C CG    . GLU B 1 41  ? -40.853 97.050  25.573  1.00 26.31  ? 41   GLU B CG    1 
ATOM   5237  C CD    . GLU B 1 41  ? -41.004 97.266  27.068  1.00 26.63  ? 41   GLU B CD    1 
ATOM   5238  O OE1   . GLU B 1 41  ? -41.470 98.364  27.461  1.00 29.08  ? 41   GLU B OE1   1 
ATOM   5239  O OE2   . GLU B 1 41  ? -40.661 96.349  27.849  1.00 28.91  ? 41   GLU B OE2   1 
ATOM   5240  N N     . GLN B 1 42  ? -38.881 93.369  23.686  1.00 24.17  ? 42   GLN B N     1 
ATOM   5241  C CA    . GLN B 1 42  ? -37.810 92.384  23.560  1.00 23.91  ? 42   GLN B CA    1 
ATOM   5242  C C     . GLN B 1 42  ? -37.389 92.137  22.096  1.00 23.72  ? 42   GLN B C     1 
ATOM   5243  O O     . GLN B 1 42  ? -36.223 91.864  21.821  1.00 23.61  ? 42   GLN B O     1 
ATOM   5244  C CB    . GLN B 1 42  ? -38.164 91.087  24.330  1.00 23.70  ? 42   GLN B CB    1 
ATOM   5245  C CG    . GLN B 1 42  ? -37.083 89.999  24.334  1.00 23.44  ? 42   GLN B CG    1 
ATOM   5246  C CD    . GLN B 1 42  ? -35.709 90.474  24.802  1.00 23.81  ? 42   GLN B CD    1 
ATOM   5247  O OE1   . GLN B 1 42  ? -34.680 89.974  24.338  1.00 25.18  ? 42   GLN B OE1   1 
ATOM   5248  N NE2   . GLN B 1 42  ? -35.684 91.427  25.719  1.00 21.61  ? 42   GLN B NE2   1 
ATOM   5249  N N     . GLY B 1 43  ? -38.331 92.278  21.167  1.00 23.86  ? 43   GLY B N     1 
ATOM   5250  C CA    . GLY B 1 43  ? -38.042 92.173  19.733  1.00 23.63  ? 43   GLY B CA    1 
ATOM   5251  C C     . GLY B 1 43  ? -36.989 93.142  19.205  1.00 23.90  ? 43   GLY B C     1 
ATOM   5252  O O     . GLY B 1 43  ? -36.434 92.914  18.121  1.00 23.87  ? 43   GLY B O     1 
ATOM   5253  N N     . LYS B 1 44  ? -36.710 94.217  19.956  1.00 23.53  ? 44   LYS B N     1 
ATOM   5254  C CA    . LYS B 1 44  ? -35.659 95.193  19.588  1.00 23.63  ? 44   LYS B CA    1 
ATOM   5255  C C     . LYS B 1 44  ? -34.227 94.627  19.711  1.00 23.38  ? 44   LYS B C     1 
ATOM   5256  O O     . LYS B 1 44  ? -33.250 95.303  19.362  1.00 23.21  ? 44   LYS B O     1 
ATOM   5257  C CB    . LYS B 1 44  ? -35.771 96.504  20.395  1.00 23.94  ? 44   LYS B CB    1 
ATOM   5258  C CG    . LYS B 1 44  ? -37.149 97.192  20.405  1.00 24.69  ? 44   LYS B CG    1 
ATOM   5259  C CD    . LYS B 1 44  ? -37.693 97.453  19.006  1.00 26.59  ? 44   LYS B CD    1 
ATOM   5260  C CE    . LYS B 1 44  ? -39.064 98.151  19.046  1.00 27.10  ? 44   LYS B CE    1 
ATOM   5261  N NZ    . LYS B 1 44  ? -39.047 99.503  19.693  1.00 27.92  ? 44   LYS B NZ    1 
ATOM   5262  N N     . ILE B 1 45  ? -34.109 93.396  20.209  1.00 22.82  ? 45   ILE B N     1 
ATOM   5263  C CA    . ILE B 1 45  ? -32.840 92.659  20.170  1.00 22.53  ? 45   ILE B CA    1 
ATOM   5264  C C     . ILE B 1 45  ? -32.371 92.475  18.718  1.00 22.61  ? 45   ILE B C     1 
ATOM   5265  O O     . ILE B 1 45  ? -31.186 92.248  18.459  1.00 23.12  ? 45   ILE B O     1 
ATOM   5266  C CB    . ILE B 1 45  ? -32.950 91.283  20.893  1.00 22.85  ? 45   ILE B CB    1 
ATOM   5267  C CG1   . ILE B 1 45  ? -31.554 90.688  21.162  1.00 22.86  ? 45   ILE B CG1   1 
ATOM   5268  C CG2   . ILE B 1 45  ? -33.884 90.316  20.121  1.00 20.06  ? 45   ILE B CG2   1 
ATOM   5269  C CD1   . ILE B 1 45  ? -31.535 89.546  22.192  1.00 23.05  ? 45   ILE B CD1   1 
ATOM   5270  N N     . LEU B 1 46  ? -33.307 92.589  17.777  1.00 22.15  ? 46   LEU B N     1 
ATOM   5271  C CA    . LEU B 1 46  ? -32.995 92.517  16.360  1.00 22.11  ? 46   LEU B CA    1 
ATOM   5272  C C     . LEU B 1 46  ? -33.118 93.887  15.702  1.00 22.63  ? 46   LEU B C     1 
ATOM   5273  O O     . LEU B 1 46  ? -33.887 94.739  16.157  1.00 21.93  ? 46   LEU B O     1 
ATOM   5274  C CB    . LEU B 1 46  ? -33.933 91.531  15.658  1.00 21.86  ? 46   LEU B CB    1 
ATOM   5275  C CG    . LEU B 1 46  ? -34.031 90.085  16.165  1.00 21.21  ? 46   LEU B CG    1 
ATOM   5276  C CD1   . LEU B 1 46  ? -34.789 89.240  15.147  1.00 19.04  ? 46   LEU B CD1   1 
ATOM   5277  C CD2   . LEU B 1 46  ? -32.642 89.478  16.459  1.00 20.61  ? 46   LEU B CD2   1 
ATOM   5278  N N     . ASP B 1 47  ? -32.355 94.094  14.631  1.00 23.13  ? 47   ASP B N     1 
ATOM   5279  C CA    . ASP B 1 47  ? -32.571 95.239  13.762  1.00 23.65  ? 47   ASP B CA    1 
ATOM   5280  C C     . ASP B 1 47  ? -33.715 94.919  12.825  1.00 23.82  ? 47   ASP B C     1 
ATOM   5281  O O     . ASP B 1 47  ? -33.758 93.837  12.232  1.00 24.07  ? 47   ASP B O     1 
ATOM   5282  C CB    . ASP B 1 47  ? -31.331 95.544  12.925  1.00 24.12  ? 47   ASP B CB    1 
ATOM   5283  C CG    . ASP B 1 47  ? -30.235 96.228  13.711  1.00 25.08  ? 47   ASP B CG    1 
ATOM   5284  O OD1   . ASP B 1 47  ? -29.276 96.689  13.053  1.00 27.06  ? 47   ASP B OD1   1 
ATOM   5285  O OD2   . ASP B 1 47  ? -30.318 96.307  14.962  1.00 26.14  ? 47   ASP B OD2   1 
ATOM   5286  N N     . TRP B 1 48  ? -34.632 95.870  12.689  1.00 24.05  ? 48   TRP B N     1 
ATOM   5287  C CA    . TRP B 1 48  ? -35.780 95.732  11.803  1.00 24.11  ? 48   TRP B CA    1 
ATOM   5288  C C     . TRP B 1 48  ? -35.680 96.767  10.689  1.00 24.65  ? 48   TRP B C     1 
ATOM   5289  O O     . TRP B 1 48  ? -35.265 97.906  10.926  1.00 24.82  ? 48   TRP B O     1 
ATOM   5290  C CB    . TRP B 1 48  ? -37.080 95.888  12.594  1.00 23.46  ? 48   TRP B CB    1 
ATOM   5291  C CG    . TRP B 1 48  ? -37.284 94.756  13.570  1.00 23.60  ? 48   TRP B CG    1 
ATOM   5292  C CD1   . TRP B 1 48  ? -36.723 94.631  14.811  1.00 22.81  ? 48   TRP B CD1   1 
ATOM   5293  C CD2   . TRP B 1 48  ? -38.094 93.591  13.376  1.00 22.60  ? 48   TRP B CD2   1 
ATOM   5294  N NE1   . TRP B 1 48  ? -37.132 93.460  15.402  1.00 22.52  ? 48   TRP B NE1   1 
ATOM   5295  C CE2   . TRP B 1 48  ? -37.974 92.801  14.545  1.00 22.43  ? 48   TRP B CE2   1 
ATOM   5296  C CE3   . TRP B 1 48  ? -38.916 93.138  12.329  1.00 23.22  ? 48   TRP B CE3   1 
ATOM   5297  C CZ2   . TRP B 1 48  ? -38.641 91.580  14.702  1.00 21.78  ? 48   TRP B CZ2   1 
ATOM   5298  C CZ3   . TRP B 1 48  ? -39.585 91.916  12.487  1.00 22.53  ? 48   TRP B CZ3   1 
ATOM   5299  C CH2   . TRP B 1 48  ? -39.435 91.153  13.668  1.00 22.75  ? 48   TRP B CH2   1 
ATOM   5300  N N     . ILE B 1 49  ? -36.034 96.359  9.473   1.00 24.85  ? 49   ILE B N     1 
ATOM   5301  C CA    . ILE B 1 49  ? -35.998 97.253  8.320   1.00 25.00  ? 49   ILE B CA    1 
ATOM   5302  C C     . ILE B 1 49  ? -37.243 98.154  8.319   1.00 25.25  ? 49   ILE B C     1 
ATOM   5303  O O     . ILE B 1 49  ? -37.128 99.380  8.353   1.00 24.84  ? 49   ILE B O     1 
ATOM   5304  C CB    . ILE B 1 49  ? -35.776 96.475  7.001   1.00 24.81  ? 49   ILE B CB    1 
ATOM   5305  C CG1   . ILE B 1 49  ? -34.358 95.883  7.000   1.00 25.23  ? 49   ILE B CG1   1 
ATOM   5306  C CG2   . ILE B 1 49  ? -35.953 97.400  5.797   1.00 25.41  ? 49   ILE B CG2   1 
ATOM   5307  C CD1   . ILE B 1 49  ? -34.074 94.817  5.937   1.00 24.84  ? 49   ILE B CD1   1 
ATOM   5308  N N     . THR B 1 50  ? -38.430 97.552  8.308   1.00 25.82  ? 50   THR B N     1 
ATOM   5309  C CA    . THR B 1 50  ? -39.635 98.312  8.647   1.00 26.55  ? 50   THR B CA    1 
ATOM   5310  C C     . THR B 1 50  ? -40.116 97.828  10.005  1.00 26.41  ? 50   THR B C     1 
ATOM   5311  O O     . THR B 1 50  ? -40.254 96.622  10.220  1.00 26.41  ? 50   THR B O     1 
ATOM   5312  C CB    . THR B 1 50  ? -40.767 98.224  7.584   1.00 26.64  ? 50   THR B CB    1 
ATOM   5313  O OG1   . THR B 1 50  ? -41.296 96.896  7.547   1.00 28.73  ? 50   THR B OG1   1 
ATOM   5314  C CG2   . THR B 1 50  ? -40.261 98.606  6.204   1.00 26.27  ? 50   THR B CG2   1 
ATOM   5315  N N     . PRO B 1 51  ? -40.358 98.769  10.937  1.00 26.71  ? 51   PRO B N     1 
ATOM   5316  C CA    . PRO B 1 51  ? -40.703 98.372  12.299  1.00 26.44  ? 51   PRO B CA    1 
ATOM   5317  C C     . PRO B 1 51  ? -42.027 97.623  12.330  1.00 26.41  ? 51   PRO B C     1 
ATOM   5318  O O     . PRO B 1 51  ? -42.917 97.916  11.531  1.00 26.37  ? 51   PRO B O     1 
ATOM   5319  C CB    . PRO B 1 51  ? -40.818 99.708  13.041  1.00 26.56  ? 51   PRO B CB    1 
ATOM   5320  C CG    . PRO B 1 51  ? -41.097 100.721 11.969  1.00 26.98  ? 51   PRO B CG    1 
ATOM   5321  C CD    . PRO B 1 51  ? -40.339 100.236 10.772  1.00 26.54  ? 51   PRO B CD    1 
ATOM   5322  N N     . TYR B 1 52  ? -42.143 96.637  13.214  1.00 26.19  ? 52   TYR B N     1 
ATOM   5323  C CA    . TYR B 1 52  ? -43.438 96.008  13.452  1.00 26.35  ? 52   TYR B CA    1 
ATOM   5324  C C     . TYR B 1 52  ? -44.323 96.932  14.295  1.00 26.87  ? 52   TYR B C     1 
ATOM   5325  O O     . TYR B 1 52  ? -43.832 97.825  14.990  1.00 26.61  ? 52   TYR B O     1 
ATOM   5326  C CB    . TYR B 1 52  ? -43.283 94.649  14.138  1.00 25.99  ? 52   TYR B CB    1 
ATOM   5327  C CG    . TYR B 1 52  ? -42.429 94.667  15.387  1.00 25.20  ? 52   TYR B CG    1 
ATOM   5328  C CD1   . TYR B 1 52  ? -42.945 95.104  16.608  1.00 25.02  ? 52   TYR B CD1   1 
ATOM   5329  C CD2   . TYR B 1 52  ? -41.106 94.230  15.350  1.00 25.17  ? 52   TYR B CD2   1 
ATOM   5330  C CE1   . TYR B 1 52  ? -42.156 95.118  17.759  1.00 25.31  ? 52   TYR B CE1   1 
ATOM   5331  C CE2   . TYR B 1 52  ? -40.311 94.234  16.493  1.00 24.46  ? 52   TYR B CE2   1 
ATOM   5332  C CZ    . TYR B 1 52  ? -40.841 94.673  17.687  1.00 25.14  ? 52   TYR B CZ    1 
ATOM   5333  O OH    . TYR B 1 52  ? -40.047 94.675  18.807  1.00 25.07  ? 52   TYR B OH    1 
ATOM   5334  N N     . GLN B 1 53  ? -45.627 96.705  14.218  1.00 27.52  ? 53   GLN B N     1 
ATOM   5335  C CA    . GLN B 1 53  ? -46.581 97.371  15.081  1.00 28.22  ? 53   GLN B CA    1 
ATOM   5336  C C     . GLN B 1 53  ? -47.391 96.282  15.790  1.00 28.06  ? 53   GLN B C     1 
ATOM   5337  O O     . GLN B 1 53  ? -47.566 96.331  17.005  1.00 28.39  ? 53   GLN B O     1 
ATOM   5338  C CB    . GLN B 1 53  ? -47.469 98.313  14.268  1.00 28.38  ? 53   GLN B CB    1 
ATOM   5339  C CG    . GLN B 1 53  ? -47.647 99.679  14.909  1.00 31.18  ? 53   GLN B CG    1 
ATOM   5340  C CD    . GLN B 1 53  ? -48.199 100.727 13.949  1.00 33.45  ? 53   GLN B CD    1 
ATOM   5341  O OE1   . GLN B 1 53  ? -49.002 101.576 14.341  1.00 34.00  ? 53   GLN B OE1   1 
ATOM   5342  N NE2   . GLN B 1 53  ? -47.769 100.673 12.686  1.00 34.94  ? 53   GLN B NE2   1 
ATOM   5343  N N     . LYS B 1 54  ? -47.853 95.290  15.029  1.00 27.86  ? 54   LYS B N     1 
ATOM   5344  C CA    . LYS B 1 54  ? -48.503 94.100  15.595  1.00 27.87  ? 54   LYS B CA    1 
ATOM   5345  C C     . LYS B 1 54  ? -47.458 93.173  16.208  1.00 26.39  ? 54   LYS B C     1 
ATOM   5346  O O     . LYS B 1 54  ? -46.439 92.884  15.591  1.00 26.78  ? 54   LYS B O     1 
ATOM   5347  C CB    . LYS B 1 54  ? -49.318 93.354  14.525  1.00 27.83  ? 54   LYS B CB    1 
ATOM   5348  C CG    . LYS B 1 54  ? -50.654 94.032  14.171  1.00 29.68  ? 54   LYS B CG    1 
ATOM   5349  C CD    . LYS B 1 54  ? -51.368 93.349  12.998  1.00 29.99  ? 54   LYS B CD    1 
ATOM   5350  C CE    . LYS B 1 54  ? -51.064 94.040  11.661  1.00 34.67  ? 54   LYS B CE    1 
ATOM   5351  N NZ    . LYS B 1 54  ? -51.777 93.411  10.489  1.00 35.64  ? 54   LYS B NZ    1 
ATOM   5352  N N     . VAL B 1 55  ? -47.705 92.724  17.430  1.00 25.12  ? 55   VAL B N     1 
ATOM   5353  C CA    . VAL B 1 55  ? -46.779 91.835  18.123  1.00 23.88  ? 55   VAL B CA    1 
ATOM   5354  C C     . VAL B 1 55  ? -47.357 90.414  18.119  1.00 23.35  ? 55   VAL B C     1 
ATOM   5355  O O     . VAL B 1 55  ? -46.983 89.606  17.266  1.00 23.22  ? 55   VAL B O     1 
ATOM   5356  C CB    . VAL B 1 55  ? -46.415 92.358  19.543  1.00 23.62  ? 55   VAL B CB    1 
ATOM   5357  C CG1   . VAL B 1 55  ? -45.525 91.361  20.310  1.00 23.61  ? 55   VAL B CG1   1 
ATOM   5358  C CG2   . VAL B 1 55  ? -45.717 93.690  19.438  1.00 23.32  ? 55   VAL B CG2   1 
ATOM   5359  N N     . LYS B 1 56  ? -48.289 90.120  19.027  1.00 22.65  ? 56   LYS B N     1 
ATOM   5360  C CA    . LYS B 1 56  ? -48.861 88.774  19.119  1.00 22.48  ? 56   LYS B CA    1 
ATOM   5361  C C     . LYS B 1 56  ? -50.192 88.658  18.378  1.00 22.13  ? 56   LYS B C     1 
ATOM   5362  O O     . LYS B 1 56  ? -51.126 89.419  18.636  1.00 22.18  ? 56   LYS B O     1 
ATOM   5363  C CB    . LYS B 1 56  ? -49.017 88.356  20.584  1.00 22.31  ? 56   LYS B CB    1 
ATOM   5364  C CG    . LYS B 1 56  ? -49.443 86.906  20.807  1.00 22.59  ? 56   LYS B CG    1 
ATOM   5365  C CD    . LYS B 1 56  ? -49.579 86.621  22.306  1.00 22.67  ? 56   LYS B CD    1 
ATOM   5366  C CE    . LYS B 1 56  ? -49.875 85.154  22.611  1.00 22.95  ? 56   LYS B CE    1 
ATOM   5367  N NZ    . LYS B 1 56  ? -51.315 84.831  22.440  1.00 22.76  ? 56   LYS B NZ    1 
ATOM   5368  N N     . ASN B 1 57  ? -50.262 87.707  17.449  1.00 22.01  ? 57   ASN B N     1 
ATOM   5369  C CA    . ASN B 1 57  ? -51.501 87.418  16.712  1.00 22.01  ? 57   ASN B CA    1 
ATOM   5370  C C     . ASN B 1 57  ? -51.652 85.915  16.494  1.00 21.49  ? 57   ASN B C     1 
ATOM   5371  O O     . ASN B 1 57  ? -51.381 85.396  15.403  1.00 21.39  ? 57   ASN B O     1 
ATOM   5372  C CB    . ASN B 1 57  ? -51.543 88.164  15.374  1.00 21.92  ? 57   ASN B CB    1 
ATOM   5373  C CG    . ASN B 1 57  ? -52.927 88.117  14.708  1.00 23.65  ? 57   ASN B CG    1 
ATOM   5374  O OD1   . ASN B 1 57  ? -53.937 87.788  15.346  1.00 24.78  ? 57   ASN B OD1   1 
ATOM   5375  N ND2   . ASN B 1 57  ? -52.975 88.462  13.420  1.00 22.82  ? 57   ASN B ND2   1 
ATOM   5376  N N     . THR B 1 58  ? -52.085 85.219  17.544  1.00 20.88  ? 58   THR B N     1 
ATOM   5377  C CA    . THR B 1 58  ? -52.084 83.757  17.524  1.00 20.26  ? 58   THR B CA    1 
ATOM   5378  C C     . THR B 1 58  ? -53.417 83.141  17.958  1.00 20.08  ? 58   THR B C     1 
ATOM   5379  O O     . THR B 1 58  ? -54.208 83.768  18.684  1.00 19.55  ? 58   THR B O     1 
ATOM   5380  C CB    . THR B 1 58  ? -50.943 83.181  18.396  1.00 20.04  ? 58   THR B CB    1 
ATOM   5381  O OG1   . THR B 1 58  ? -51.217 83.442  19.773  1.00 20.30  ? 58   THR B OG1   1 
ATOM   5382  C CG2   . THR B 1 58  ? -49.596 83.801  18.025  1.00 19.72  ? 58   THR B CG2   1 
ATOM   5383  N N     . SER B 1 59  ? -53.645 81.908  17.507  1.00 19.59  ? 59   SER B N     1 
ATOM   5384  C CA    . SER B 1 59  ? -54.801 81.105  17.909  1.00 19.28  ? 59   SER B CA    1 
ATOM   5385  C C     . SER B 1 59  ? -54.493 79.615  17.767  1.00 19.03  ? 59   SER B C     1 
ATOM   5386  O O     . SER B 1 59  ? -53.910 79.189  16.761  1.00 18.89  ? 59   SER B O     1 
ATOM   5387  C CB    . SER B 1 59  ? -56.029 81.457  17.073  1.00 19.38  ? 59   SER B CB    1 
ATOM   5388  O OG    . SER B 1 59  ? -57.098 80.575  17.375  1.00 19.53  ? 59   SER B OG    1 
ATOM   5389  N N     . PHE B 1 60  ? -54.869 78.849  18.794  1.00 18.50  ? 60   PHE B N     1 
ATOM   5390  C CA    . PHE B 1 60  ? -54.754 77.393  18.809  1.00 18.51  ? 60   PHE B CA    1 
ATOM   5391  C C     . PHE B 1 60  ? -56.127 76.740  18.614  1.00 18.85  ? 60   PHE B C     1 
ATOM   5392  O O     . PHE B 1 60  ? -56.288 75.543  18.888  1.00 18.90  ? 60   PHE B O     1 
ATOM   5393  C CB    . PHE B 1 60  ? -54.180 76.905  20.152  1.00 18.07  ? 60   PHE B CB    1 
ATOM   5394  C CG    . PHE B 1 60  ? -52.716 77.206  20.364  1.00 18.04  ? 60   PHE B CG    1 
ATOM   5395  C CD1   . PHE B 1 60  ? -52.124 76.919  21.593  1.00 17.90  ? 60   PHE B CD1   1 
ATOM   5396  C CD2   . PHE B 1 60  ? -51.925 77.774  19.358  1.00 17.44  ? 60   PHE B CD2   1 
ATOM   5397  C CE1   . PHE B 1 60  ? -50.768 77.180  21.815  1.00 17.03  ? 60   PHE B CE1   1 
ATOM   5398  C CE2   . PHE B 1 60  ? -50.577 78.037  19.573  1.00 17.39  ? 60   PHE B CE2   1 
ATOM   5399  C CZ    . PHE B 1 60  ? -49.998 77.744  20.808  1.00 17.35  ? 60   PHE B CZ    1 
ATOM   5400  N N     . ALA B 1 61  ? -57.110 77.529  18.167  1.00 18.98  ? 61   ALA B N     1 
ATOM   5401  C CA    . ALA B 1 61  ? -58.500 77.076  18.056  1.00 19.39  ? 61   ALA B CA    1 
ATOM   5402  C C     . ALA B 1 61  ? -58.598 75.867  17.134  1.00 19.84  ? 61   ALA B C     1 
ATOM   5403  O O     . ALA B 1 61  ? -57.919 75.828  16.103  1.00 19.87  ? 61   ALA B O     1 
ATOM   5404  C CB    . ALA B 1 61  ? -59.399 78.206  17.548  1.00 19.55  ? 61   ALA B CB    1 
ATOM   5405  N N     . PRO B 1 62  ? -59.435 74.874  17.503  1.00 20.09  ? 62   PRO B N     1 
ATOM   5406  C CA    . PRO B 1 62  ? -59.551 73.646  16.704  1.00 20.50  ? 62   PRO B CA    1 
ATOM   5407  C C     . PRO B 1 62  ? -60.047 73.943  15.280  1.00 20.71  ? 62   PRO B C     1 
ATOM   5408  O O     . PRO B 1 62  ? -60.948 74.751  15.097  1.00 20.91  ? 62   PRO B O     1 
ATOM   5409  C CB    . PRO B 1 62  ? -60.591 72.823  17.479  1.00 20.58  ? 62   PRO B CB    1 
ATOM   5410  C CG    . PRO B 1 62  ? -60.578 73.383  18.865  1.00 20.41  ? 62   PRO B CG    1 
ATOM   5411  C CD    . PRO B 1 62  ? -60.333 74.847  18.673  1.00 20.07  ? 62   PRO B CD    1 
ATOM   5412  N N     . GLY B 1 63  ? -59.438 73.319  14.282  1.00 21.23  ? 63   GLY B N     1 
ATOM   5413  C CA    . GLY B 1 63  ? -59.813 73.556  12.881  1.00 21.41  ? 63   GLY B CA    1 
ATOM   5414  C C     . GLY B 1 63  ? -59.372 74.884  12.272  1.00 21.49  ? 63   GLY B C     1 
ATOM   5415  O O     . GLY B 1 63  ? -59.724 75.174  11.136  1.00 21.72  ? 63   GLY B O     1 
ATOM   5416  N N     . ASN B 1 64  ? -58.605 75.692  13.009  1.00 21.36  ? 64   ASN B N     1 
ATOM   5417  C CA    . ASN B 1 64  ? -58.271 77.049  12.567  1.00 21.33  ? 64   ASN B CA    1 
ATOM   5418  C C     . ASN B 1 64  ? -57.056 77.622  13.289  1.00 21.32  ? 64   ASN B C     1 
ATOM   5419  O O     . ASN B 1 64  ? -57.077 78.770  13.740  1.00 21.31  ? 64   ASN B O     1 
ATOM   5420  C CB    . ASN B 1 64  ? -59.482 77.983  12.749  1.00 21.66  ? 64   ASN B CB    1 
ATOM   5421  C CG    . ASN B 1 64  ? -59.497 79.160  11.750  1.00 23.22  ? 64   ASN B CG    1 
ATOM   5422  O OD1   . ASN B 1 64  ? -60.208 80.157  11.956  1.00 24.59  ? 64   ASN B OD1   1 
ATOM   5423  N ND2   . ASN B 1 64  ? -58.731 79.039  10.668  1.00 22.21  ? 64   ASN B ND2   1 
ATOM   5424  N N     . VAL B 1 65  ? -55.998 76.817  13.390  1.00 21.12  ? 65   VAL B N     1 
ATOM   5425  C CA    . VAL B 1 65  ? -54.766 77.226  14.053  1.00 21.17  ? 65   VAL B CA    1 
ATOM   5426  C C     . VAL B 1 65  ? -53.997 78.221  13.181  1.00 21.13  ? 65   VAL B C     1 
ATOM   5427  O O     . VAL B 1 65  ? -53.794 77.990  11.986  1.00 20.77  ? 65   VAL B O     1 
ATOM   5428  C CB    . VAL B 1 65  ? -53.871 76.004  14.401  1.00 21.22  ? 65   VAL B CB    1 
ATOM   5429  C CG1   . VAL B 1 65  ? -52.509 76.453  14.920  1.00 21.17  ? 65   VAL B CG1   1 
ATOM   5430  C CG2   . VAL B 1 65  ? -54.570 75.098  15.429  1.00 21.30  ? 65   VAL B CG2   1 
ATOM   5431  N N     . SER B 1 66  ? -53.589 79.334  13.787  1.00 20.95  ? 66   SER B N     1 
ATOM   5432  C CA    . SER B 1 66  ? -52.824 80.368  13.091  1.00 20.86  ? 66   SER B CA    1 
ATOM   5433  C C     . SER B 1 66  ? -51.916 81.083  14.077  1.00 20.64  ? 66   SER B C     1 
ATOM   5434  O O     . SER B 1 66  ? -52.380 81.586  15.096  1.00 20.21  ? 66   SER B O     1 
ATOM   5435  C CB    . SER B 1 66  ? -53.763 81.378  12.430  1.00 20.93  ? 66   SER B CB    1 
ATOM   5436  O OG    . SER B 1 66  ? -53.029 82.376  11.742  1.00 22.13  ? 66   SER B OG    1 
ATOM   5437  N N     . ILE B 1 67  ? -50.625 81.125  13.764  1.00 20.41  ? 67   ILE B N     1 
ATOM   5438  C CA    . ILE B 1 67  ? -49.617 81.680  14.668  1.00 20.41  ? 67   ILE B CA    1 
ATOM   5439  C C     . ILE B 1 67  ? -48.829 82.751  13.922  1.00 20.40  ? 67   ILE B C     1 
ATOM   5440  O O     . ILE B 1 67  ? -48.179 82.456  12.919  1.00 20.71  ? 67   ILE B O     1 
ATOM   5441  C CB    . ILE B 1 67  ? -48.651 80.555  15.170  1.00 20.38  ? 67   ILE B CB    1 
ATOM   5442  C CG1   . ILE B 1 67  ? -49.433 79.462  15.918  1.00 20.42  ? 67   ILE B CG1   1 
ATOM   5443  C CG2   . ILE B 1 67  ? -47.506 81.139  15.997  1.00 20.46  ? 67   ILE B CG2   1 
ATOM   5444  C CD1   . ILE B 1 67  ? -48.857 78.025  15.776  1.00 18.32  ? 67   ILE B CD1   1 
ATOM   5445  N N     . LYS B 1 68  ? -48.891 83.990  14.405  1.00 20.43  ? 68   LYS B N     1 
ATOM   5446  C CA    . LYS B 1 68  ? -48.154 85.090  13.789  1.00 20.80  ? 68   LYS B CA    1 
ATOM   5447  C C     . LYS B 1 68  ? -47.537 85.988  14.846  1.00 20.81  ? 68   LYS B C     1 
ATOM   5448  O O     . LYS B 1 68  ? -48.173 86.317  15.853  1.00 20.83  ? 68   LYS B O     1 
ATOM   5449  C CB    . LYS B 1 68  ? -49.056 85.934  12.878  1.00 20.56  ? 68   LYS B CB    1 
ATOM   5450  C CG    . LYS B 1 68  ? -49.530 85.240  11.602  1.00 21.34  ? 68   LYS B CG    1 
ATOM   5451  C CD    . LYS B 1 68  ? -50.542 86.107  10.840  1.00 21.80  ? 68   LYS B CD    1 
ATOM   5452  C CE    . LYS B 1 68  ? -51.053 85.405  9.575   1.00 23.65  ? 68   LYS B CE    1 
ATOM   5453  N NZ    . LYS B 1 68  ? -51.942 86.326  8.778   1.00 25.67  ? 68   LYS B NZ    1 
ATOM   5454  N N     . TRP B 1 69  ? -46.299 86.397  14.598  1.00 20.65  ? 69   TRP B N     1 
ATOM   5455  C CA    . TRP B 1 69  ? -45.610 87.329  15.469  1.00 20.45  ? 69   TRP B CA    1 
ATOM   5456  C C     . TRP B 1 69  ? -44.928 88.384  14.623  1.00 20.64  ? 69   TRP B C     1 
ATOM   5457  O O     . TRP B 1 69  ? -44.363 88.067  13.573  1.00 20.53  ? 69   TRP B O     1 
ATOM   5458  C CB    . TRP B 1 69  ? -44.573 86.595  16.312  1.00 20.18  ? 69   TRP B CB    1 
ATOM   5459  C CG    . TRP B 1 69  ? -45.147 85.733  17.392  1.00 19.79  ? 69   TRP B CG    1 
ATOM   5460  C CD1   . TRP B 1 69  ? -45.544 84.425  17.286  1.00 19.12  ? 69   TRP B CD1   1 
ATOM   5461  C CD2   . TRP B 1 69  ? -45.358 86.107  18.759  1.00 19.79  ? 69   TRP B CD2   1 
ATOM   5462  N NE1   . TRP B 1 69  ? -46.002 83.971  18.502  1.00 18.40  ? 69   TRP B NE1   1 
ATOM   5463  C CE2   . TRP B 1 69  ? -45.902 84.982  19.422  1.00 19.55  ? 69   TRP B CE2   1 
ATOM   5464  C CE3   . TRP B 1 69  ? -45.156 87.290  19.484  1.00 18.93  ? 69   TRP B CE3   1 
ATOM   5465  C CZ2   . TRP B 1 69  ? -46.240 85.002  20.782  1.00 19.25  ? 69   TRP B CZ2   1 
ATOM   5466  C CZ3   . TRP B 1 69  ? -45.485 87.308  20.832  1.00 19.77  ? 69   TRP B CZ3   1 
ATOM   5467  C CH2   . TRP B 1 69  ? -46.021 86.164  21.469  1.00 19.11  ? 69   TRP B CH2   1 
ATOM   5468  N N     . TYR B 1 70  ? -45.005 89.635  15.079  1.00 21.06  ? 70   TYR B N     1 
ATOM   5469  C CA    . TYR B 1 70  ? -44.343 90.773  14.433  1.00 21.38  ? 70   TYR B CA    1 
ATOM   5470  C C     . TYR B 1 70  ? -44.677 90.897  12.944  1.00 21.68  ? 70   TYR B C     1 
ATOM   5471  O O     . TYR B 1 70  ? -43.843 91.345  12.159  1.00 21.06  ? 70   TYR B O     1 
ATOM   5472  C CB    . TYR B 1 70  ? -42.822 90.673  14.605  1.00 21.36  ? 70   TYR B CB    1 
ATOM   5473  C CG    . TYR B 1 70  ? -42.335 90.485  16.022  1.00 21.18  ? 70   TYR B CG    1 
ATOM   5474  C CD1   . TYR B 1 70  ? -41.652 89.325  16.396  1.00 20.77  ? 70   TYR B CD1   1 
ATOM   5475  C CD2   . TYR B 1 70  ? -42.536 91.473  16.985  1.00 20.57  ? 70   TYR B CD2   1 
ATOM   5476  C CE1   . TYR B 1 70  ? -41.182 89.152  17.702  1.00 19.80  ? 70   TYR B CE1   1 
ATOM   5477  C CE2   . TYR B 1 70  ? -42.073 91.312  18.286  1.00 20.86  ? 70   TYR B CE2   1 
ATOM   5478  C CZ    . TYR B 1 70  ? -41.398 90.155  18.638  1.00 20.94  ? 70   TYR B CZ    1 
ATOM   5479  O OH    . TYR B 1 70  ? -40.950 90.008  19.935  1.00 21.40  ? 70   TYR B OH    1 
ATOM   5480  N N     . GLU B 1 71  ? -45.902 90.516  12.580  1.00 22.56  ? 71   GLU B N     1 
ATOM   5481  C CA    . GLU B 1 71  ? -46.263 90.192  11.188  1.00 23.56  ? 71   GLU B CA    1 
ATOM   5482  C C     . GLU B 1 71  ? -46.154 91.339  10.180  1.00 23.84  ? 71   GLU B C     1 
ATOM   5483  O O     . GLU B 1 71  ? -46.000 91.098  8.977   1.00 24.15  ? 71   GLU B O     1 
ATOM   5484  C CB    . GLU B 1 71  ? -47.669 89.591  11.129  1.00 23.69  ? 71   GLU B CB    1 
ATOM   5485  C CG    . GLU B 1 71  ? -48.775 90.576  11.470  1.00 24.88  ? 71   GLU B CG    1 
ATOM   5486  C CD    . GLU B 1 71  ? -50.123 89.909  11.587  1.00 27.50  ? 71   GLU B CD    1 
ATOM   5487  O OE1   . GLU B 1 71  ? -50.394 89.296  12.647  1.00 28.27  ? 71   GLU B OE1   1 
ATOM   5488  O OE2   . GLU B 1 71  ? -50.915 90.001  10.620  1.00 28.11  ? 71   GLU B OE2   1 
ATOM   5489  N N     . ASP B 1 72  ? -46.257 92.571  10.667  1.00 23.85  ? 72   ASP B N     1 
ATOM   5490  C CA    . ASP B 1 72  ? -46.138 93.744  9.805   1.00 24.54  ? 72   ASP B CA    1 
ATOM   5491  C C     . ASP B 1 72  ? -44.745 94.369  9.894   1.00 24.43  ? 72   ASP B C     1 
ATOM   5492  O O     . ASP B 1 72  ? -44.550 95.523  9.501   1.00 24.76  ? 72   ASP B O     1 
ATOM   5493  C CB    . ASP B 1 72  ? -47.238 94.774  10.103  1.00 24.67  ? 72   ASP B CB    1 
ATOM   5494  C CG    . ASP B 1 72  ? -47.272 95.212  11.560  1.00 26.18  ? 72   ASP B CG    1 
ATOM   5495  O OD1   . ASP B 1 72  ? -46.477 94.698  12.383  1.00 27.80  ? 72   ASP B OD1   1 
ATOM   5496  O OD2   . ASP B 1 72  ? -48.109 96.091  11.884  1.00 28.88  ? 72   ASP B OD2   1 
ATOM   5497  N N     . GLY B 1 73  ? -43.787 93.606  10.420  1.00 23.85  ? 73   GLY B N     1 
ATOM   5498  C CA    . GLY B 1 73  ? -42.394 94.029  10.446  1.00 23.49  ? 73   GLY B CA    1 
ATOM   5499  C C     . GLY B 1 73  ? -41.600 93.333  9.359   1.00 23.38  ? 73   GLY B C     1 
ATOM   5500  O O     . GLY B 1 73  ? -41.954 92.230  8.935   1.00 23.38  ? 73   GLY B O     1 
ATOM   5501  N N     . THR B 1 74  ? -40.538 93.980  8.886   1.00 23.31  ? 74   THR B N     1 
ATOM   5502  C CA    . THR B 1 74  ? -39.613 93.328  7.951   1.00 23.42  ? 74   THR B CA    1 
ATOM   5503  C C     . THR B 1 74  ? -38.195 93.380  8.513   1.00 23.25  ? 74   THR B C     1 
ATOM   5504  O O     . THR B 1 74  ? -37.862 94.263  9.304   1.00 23.34  ? 74   THR B O     1 
ATOM   5505  C CB    . THR B 1 74  ? -39.628 93.925  6.502   1.00 23.42  ? 74   THR B CB    1 
ATOM   5506  O OG1   . THR B 1 74  ? -39.046 95.233  6.504   1.00 24.25  ? 74   THR B OG1   1 
ATOM   5507  C CG2   . THR B 1 74  ? -41.042 93.980  5.911   1.00 23.43  ? 74   THR B CG2   1 
ATOM   5508  N N     . LEU B 1 75  ? -37.376 92.420  8.099   1.00 22.97  ? 75   LEU B N     1 
ATOM   5509  C CA    . LEU B 1 75  ? -36.024 92.264  8.611   1.00 22.81  ? 75   LEU B CA    1 
ATOM   5510  C C     . LEU B 1 75  ? -35.247 91.337  7.697   1.00 22.79  ? 75   LEU B C     1 
ATOM   5511  O O     . LEU B 1 75  ? -35.811 90.741  6.768   1.00 23.09  ? 75   LEU B O     1 
ATOM   5512  C CB    . LEU B 1 75  ? -36.038 91.693  10.044  1.00 22.57  ? 75   LEU B CB    1 
ATOM   5513  C CG    . LEU B 1 75  ? -36.257 90.191  10.276  1.00 22.77  ? 75   LEU B CG    1 
ATOM   5514  C CD1   . LEU B 1 75  ? -35.954 89.820  11.727  1.00 21.36  ? 75   LEU B CD1   1 
ATOM   5515  C CD2   . LEU B 1 75  ? -37.669 89.741  9.884   1.00 22.66  ? 75   LEU B CD2   1 
ATOM   5516  N N     . ASN B 1 76  ? -33.950 91.219  7.962   1.00 22.56  ? 76   ASN B N     1 
ATOM   5517  C CA    . ASN B 1 76  ? -33.130 90.213  7.308   1.00 22.61  ? 76   ASN B CA    1 
ATOM   5518  C C     . ASN B 1 76  ? -32.243 89.538  8.352   1.00 22.45  ? 76   ASN B C     1 
ATOM   5519  O O     . ASN B 1 76  ? -31.515 90.212  9.089   1.00 22.05  ? 76   ASN B O     1 
ATOM   5520  C CB    . ASN B 1 76  ? -32.308 90.825  6.161   1.00 22.47  ? 76   ASN B CB    1 
ATOM   5521  C CG    . ASN B 1 76  ? -31.689 89.768  5.257   1.00 22.41  ? 76   ASN B CG    1 
ATOM   5522  O OD1   . ASN B 1 76  ? -32.129 89.571  4.121   1.00 23.02  ? 76   ASN B OD1   1 
ATOM   5523  N ND2   . ASN B 1 76  ? -30.667 89.087  5.755   1.00 20.91  ? 76   ASN B ND2   1 
ATOM   5524  N N     . LEU B 1 77  ? -32.327 88.211  8.417   1.00 22.49  ? 77   LEU B N     1 
ATOM   5525  C CA    . LEU B 1 77  ? -31.625 87.429  9.445   1.00 22.88  ? 77   LEU B CA    1 
ATOM   5526  C C     . LEU B 1 77  ? -30.111 87.524  9.309   1.00 22.89  ? 77   LEU B C     1 
ATOM   5527  O O     . LEU B 1 77  ? -29.407 87.606  10.314  1.00 23.56  ? 77   LEU B O     1 
ATOM   5528  C CB    . LEU B 1 77  ? -32.057 85.956  9.391   1.00 22.92  ? 77   LEU B CB    1 
ATOM   5529  C CG    . LEU B 1 77  ? -31.291 84.957  10.274  1.00 23.54  ? 77   LEU B CG    1 
ATOM   5530  C CD1   . LEU B 1 77  ? -32.214 83.850  10.769  1.00 22.81  ? 77   LEU B CD1   1 
ATOM   5531  C CD2   . LEU B 1 77  ? -30.068 84.374  9.539   1.00 23.41  ? 77   LEU B CD2   1 
ATOM   5532  N N     . ALA B 1 78  ? -29.619 87.472  8.071   1.00 22.74  ? 78   ALA B N     1 
ATOM   5533  C CA    . ALA B 1 78  ? -28.185 87.579  7.799   1.00 22.75  ? 78   ALA B CA    1 
ATOM   5534  C C     . ALA B 1 78  ? -27.644 88.967  8.172   1.00 22.61  ? 78   ALA B C     1 
ATOM   5535  O O     . ALA B 1 78  ? -26.560 89.083  8.749   1.00 22.43  ? 78   ALA B O     1 
ATOM   5536  C CB    . ALA B 1 78  ? -27.898 87.261  6.336   1.00 22.71  ? 78   ALA B CB    1 
ATOM   5537  N N     . ALA B 1 79  ? -28.413 90.008  7.851   1.00 22.18  ? 79   ALA B N     1 
ATOM   5538  C CA    . ALA B 1 79  ? -28.094 91.369  8.271   1.00 22.26  ? 79   ALA B CA    1 
ATOM   5539  C C     . ALA B 1 79  ? -27.974 91.440  9.799   1.00 21.93  ? 79   ALA B C     1 
ATOM   5540  O O     . ALA B 1 79  ? -27.127 92.149  10.334  1.00 21.80  ? 79   ALA B O     1 
ATOM   5541  C CB    . ALA B 1 79  ? -29.151 92.360  7.753   1.00 22.11  ? 79   ALA B CB    1 
ATOM   5542  N N     . ASN B 1 80  ? -28.816 90.673  10.481  1.00 21.70  ? 80   ASN B N     1 
ATOM   5543  C CA    . ASN B 1 80  ? -28.799 90.597  11.939  1.00 21.51  ? 80   ASN B CA    1 
ATOM   5544  C C     . ASN B 1 80  ? -27.673 89.735  12.514  1.00 21.13  ? 80   ASN B C     1 
ATOM   5545  O O     . ASN B 1 80  ? -27.215 89.963  13.634  1.00 20.60  ? 80   ASN B O     1 
ATOM   5546  C CB    . ASN B 1 80  ? -30.154 90.109  12.452  1.00 21.12  ? 80   ASN B CB    1 
ATOM   5547  C CG    . ASN B 1 80  ? -31.139 91.235  12.629  1.00 21.64  ? 80   ASN B CG    1 
ATOM   5548  O OD1   . ASN B 1 80  ? -31.081 91.975  13.613  1.00 21.81  ? 80   ASN B OD1   1 
ATOM   5549  N ND2   . ASN B 1 80  ? -32.051 91.386  11.670  1.00 21.80  ? 80   ASN B ND2   1 
ATOM   5550  N N     . CYS B 1 81  ? -27.242 88.738  11.746  1.00 20.95  ? 81   CYS B N     1 
ATOM   5551  C CA    . CYS B 1 81  ? -26.229 87.796  12.216  1.00 20.86  ? 81   CYS B CA    1 
ATOM   5552  C C     . CYS B 1 81  ? -24.815 88.194  11.785  1.00 20.80  ? 81   CYS B C     1 
ATOM   5553  O O     . CYS B 1 81  ? -23.824 87.633  12.283  1.00 20.73  ? 81   CYS B O     1 
ATOM   5554  C CB    . CYS B 1 81  ? -26.559 86.389  11.721  1.00 20.90  ? 81   CYS B CB    1 
ATOM   5555  S SG    . CYS B 1 81  ? -27.994 85.649  12.549  1.00 21.77  ? 81   CYS B SG    1 
ATOM   5556  N N     . LEU B 1 82  ? -24.734 89.154  10.860  1.00 19.93  ? 82   LEU B N     1 
ATOM   5557  C CA    . LEU B 1 82  ? -23.476 89.517  10.200  1.00 19.64  ? 82   LEU B CA    1 
ATOM   5558  C C     . LEU B 1 82  ? -23.292 91.019  10.054  1.00 19.29  ? 82   LEU B C     1 
ATOM   5559  O O     . LEU B 1 82  ? -22.507 91.620  10.787  1.00 19.08  ? 82   LEU B O     1 
ATOM   5560  C CB    . LEU B 1 82  ? -23.382 88.846  8.821   1.00 19.47  ? 82   LEU B CB    1 
ATOM   5561  C CG    . LEU B 1 82  ? -23.541 87.327  8.823   1.00 19.40  ? 82   LEU B CG    1 
ATOM   5562  C CD1   . LEU B 1 82  ? -23.900 86.771  7.442   1.00 20.84  ? 82   LEU B CD1   1 
ATOM   5563  C CD2   . LEU B 1 82  ? -22.287 86.684  9.357   1.00 20.01  ? 82   LEU B CD2   1 
ATOM   5564  N N     . ASP B 1 83  ? -24.045 91.614  9.124   1.00 19.82  ? 83   ASP B N     1 
ATOM   5565  C CA    . ASP B 1 83  ? -23.849 92.999  8.680   1.00 19.71  ? 83   ASP B CA    1 
ATOM   5566  C C     . ASP B 1 83  ? -23.801 93.994  9.824   1.00 20.07  ? 83   ASP B C     1 
ATOM   5567  O O     . ASP B 1 83  ? -22.908 94.859  9.862   1.00 20.05  ? 83   ASP B O     1 
ATOM   5568  C CB    . ASP B 1 83  ? -24.949 93.437  7.699   1.00 20.24  ? 83   ASP B CB    1 
ATOM   5569  C CG    . ASP B 1 83  ? -25.080 92.518  6.491   1.00 20.47  ? 83   ASP B CG    1 
ATOM   5570  O OD1   . ASP B 1 83  ? -25.162 93.038  5.358   1.00 21.46  ? 83   ASP B OD1   1 
ATOM   5571  O OD2   . ASP B 1 83  ? -25.125 91.283  6.661   1.00 21.93  ? 83   ASP B OD2   1 
ATOM   5572  N N     . ARG B 1 84  ? -24.754 93.882  10.756  1.00 20.01  ? 84   ARG B N     1 
ATOM   5573  C CA    . ARG B 1 84  ? -24.877 94.879  11.841  1.00 20.22  ? 84   ARG B CA    1 
ATOM   5574  C C     . ARG B 1 84  ? -23.730 94.831  12.845  1.00 19.65  ? 84   ARG B C     1 
ATOM   5575  O O     . ARG B 1 84  ? -23.557 95.753  13.632  1.00 20.39  ? 84   ARG B O     1 
ATOM   5576  C CB    . ARG B 1 84  ? -26.237 94.782  12.555  1.00 20.23  ? 84   ARG B CB    1 
ATOM   5577  C CG    . ARG B 1 84  ? -26.455 93.508  13.386  1.00 19.94  ? 84   ARG B CG    1 
ATOM   5578  C CD    . ARG B 1 84  ? -27.679 93.671  14.280  1.00 20.28  ? 84   ARG B CD    1 
ATOM   5579  N NE    . ARG B 1 84  ? -27.986 92.482  15.076  1.00 21.22  ? 84   ARG B NE    1 
ATOM   5580  C CZ    . ARG B 1 84  ? -28.831 92.480  16.109  1.00 22.04  ? 84   ARG B CZ    1 
ATOM   5581  N NH1   . ARG B 1 84  ? -29.450 93.598  16.472  1.00 21.70  ? 84   ARG B NH1   1 
ATOM   5582  N NH2   . ARG B 1 84  ? -29.059 91.363  16.786  1.00 22.16  ? 84   ARG B NH2   1 
ATOM   5583  N N     . HIS B 1 85  ? -22.942 93.762  12.798  1.00 19.57  ? 85   HIS B N     1 
ATOM   5584  C CA    . HIS B 1 85  ? -21.812 93.581  13.715  1.00 18.95  ? 85   HIS B CA    1 
ATOM   5585  C C     . HIS B 1 85  ? -20.505 94.113  13.143  1.00 18.80  ? 85   HIS B C     1 
ATOM   5586  O O     . HIS B 1 85  ? -19.505 94.183  13.857  1.00 18.67  ? 85   HIS B O     1 
ATOM   5587  C CB    . HIS B 1 85  ? -21.625 92.106  14.073  1.00 18.67  ? 85   HIS B CB    1 
ATOM   5588  C CG    . HIS B 1 85  ? -22.849 91.458  14.642  1.00 18.73  ? 85   HIS B CG    1 
ATOM   5589  N ND1   . HIS B 1 85  ? -23.439 91.875  15.815  1.00 18.29  ? 85   HIS B ND1   1 
ATOM   5590  C CD2   . HIS B 1 85  ? -23.590 90.412  14.199  1.00 19.31  ? 85   HIS B CD2   1 
ATOM   5591  C CE1   . HIS B 1 85  ? -24.490 91.116  16.072  1.00 19.33  ? 85   HIS B CE1   1 
ATOM   5592  N NE2   . HIS B 1 85  ? -24.606 90.220  15.106  1.00 18.51  ? 85   HIS B NE2   1 
ATOM   5593  N N     . LEU B 1 86  ? -20.511 94.479  11.861  1.00 18.53  ? 86   LEU B N     1 
ATOM   5594  C CA    . LEU B 1 86  ? -19.278 94.877  11.174  1.00 18.31  ? 86   LEU B CA    1 
ATOM   5595  C C     . LEU B 1 86  ? -18.686 96.207  11.651  1.00 18.22  ? 86   LEU B C     1 
ATOM   5596  O O     . LEU B 1 86  ? -17.467 96.326  11.751  1.00 17.96  ? 86   LEU B O     1 
ATOM   5597  C CB    . LEU B 1 86  ? -19.466 94.902  9.653   1.00 18.00  ? 86   LEU B CB    1 
ATOM   5598  C CG    . LEU B 1 86  ? -19.803 93.575  8.965   1.00 18.49  ? 86   LEU B CG    1 
ATOM   5599  C CD1   . LEU B 1 86  ? -19.743 93.729  7.469   1.00 19.52  ? 86   LEU B CD1   1 
ATOM   5600  C CD2   . LEU B 1 86  ? -18.877 92.466  9.418   1.00 19.43  ? 86   LEU B CD2   1 
ATOM   5601  N N     . GLN B 1 87  ? -19.544 97.191  11.926  1.00 18.17  ? 87   GLN B N     1 
ATOM   5602  C CA    . GLN B 1 87  ? -19.095 98.554  12.261  1.00 18.25  ? 87   GLN B CA    1 
ATOM   5603  C C     . GLN B 1 87  ? -18.165 98.583  13.477  1.00 18.56  ? 87   GLN B C     1 
ATOM   5604  O O     . GLN B 1 87  ? -17.127 99.234  13.449  1.00 18.19  ? 87   GLN B O     1 
ATOM   5605  C CB    . GLN B 1 87  ? -20.286 99.499  12.480  1.00 18.17  ? 87   GLN B CB    1 
ATOM   5606  C CG    . GLN B 1 87  ? -19.887 100.944 12.836  1.00 17.92  ? 87   GLN B CG    1 
ATOM   5607  C CD    . GLN B 1 87  ? -21.067 101.891 13.001  1.00 17.99  ? 87   GLN B CD    1 
ATOM   5608  O OE1   . GLN B 1 87  ? -21.004 103.048 12.587  1.00 20.52  ? 87   GLN B OE1   1 
ATOM   5609  N NE2   . GLN B 1 87  ? -22.135 101.417 13.622  1.00 17.81  ? 87   GLN B NE2   1 
ATOM   5610  N N     . GLU B 1 88  ? -18.542 97.864  14.531  1.00 19.12  ? 88   GLU B N     1 
ATOM   5611  C CA    . GLU B 1 88  ? -17.767 97.852  15.767  1.00 20.22  ? 88   GLU B CA    1 
ATOM   5612  C C     . GLU B 1 88  ? -17.083 96.517  16.062  1.00 20.46  ? 88   GLU B C     1 
ATOM   5613  O O     . GLU B 1 88  ? -16.169 96.470  16.874  1.00 20.42  ? 88   GLU B O     1 
ATOM   5614  C CB    . GLU B 1 88  ? -18.646 98.270  16.951  1.00 19.92  ? 88   GLU B CB    1 
ATOM   5615  C CG    . GLU B 1 88  ? -19.256 99.664  16.800  1.00 20.95  ? 88   GLU B CG    1 
ATOM   5616  C CD    . GLU B 1 88  ? -20.107 100.052 17.996  1.00 21.26  ? 88   GLU B CD    1 
ATOM   5617  O OE1   . GLU B 1 88  ? -19.540 100.538 18.991  1.00 21.32  ? 88   GLU B OE1   1 
ATOM   5618  O OE2   . GLU B 1 88  ? -21.343 99.860  17.942  1.00 24.48  ? 88   GLU B OE2   1 
ATOM   5619  N N     . ASN B 1 89  ? -17.518 95.440  15.405  1.00 20.92  ? 89   ASN B N     1 
ATOM   5620  C CA    . ASN B 1 89  ? -16.982 94.103  15.689  1.00 21.37  ? 89   ASN B CA    1 
ATOM   5621  C C     . ASN B 1 89  ? -16.638 93.239  14.474  1.00 21.62  ? 89   ASN B C     1 
ATOM   5622  O O     . ASN B 1 89  ? -16.695 92.013  14.552  1.00 21.42  ? 89   ASN B O     1 
ATOM   5623  C CB    . ASN B 1 89  ? -17.926 93.345  16.631  1.00 21.22  ? 89   ASN B CB    1 
ATOM   5624  C CG    . ASN B 1 89  ? -17.904 93.907  18.039  1.00 21.93  ? 89   ASN B CG    1 
ATOM   5625  O OD1   . ASN B 1 89  ? -18.805 94.645  18.441  1.00 22.61  ? 89   ASN B OD1   1 
ATOM   5626  N ND2   . ASN B 1 89  ? -16.852 93.593  18.781  1.00 20.28  ? 89   ASN B ND2   1 
ATOM   5627  N N     . GLY B 1 90  ? -16.266 93.881  13.367  1.00 21.84  ? 90   GLY B N     1 
ATOM   5628  C CA    . GLY B 1 90  ? -15.851 93.170  12.150  1.00 22.75  ? 90   GLY B CA    1 
ATOM   5629  C C     . GLY B 1 90  ? -14.707 92.180  12.349  1.00 22.98  ? 90   GLY B C     1 
ATOM   5630  O O     . GLY B 1 90  ? -14.681 91.112  11.729  1.00 22.94  ? 90   GLY B O     1 
ATOM   5631  N N     . ASP B 1 91  ? -13.772 92.527  13.232  1.00 23.27  ? 91   ASP B N     1 
ATOM   5632  C CA    . ASP B 1 91  ? -12.596 91.700  13.498  1.00 23.77  ? 91   ASP B CA    1 
ATOM   5633  C C     . ASP B 1 91  ? -12.761 90.695  14.643  1.00 23.74  ? 91   ASP B C     1 
ATOM   5634  O O     . ASP B 1 91  ? -11.883 89.853  14.854  1.00 23.72  ? 91   ASP B O     1 
ATOM   5635  C CB    . ASP B 1 91  ? -11.379 92.586  13.746  1.00 24.17  ? 91   ASP B CB    1 
ATOM   5636  C CG    . ASP B 1 91  ? -11.052 93.468  12.552  1.00 26.02  ? 91   ASP B CG    1 
ATOM   5637  O OD1   . ASP B 1 91  ? -11.158 92.990  11.395  1.00 27.42  ? 91   ASP B OD1   1 
ATOM   5638  O OD2   . ASP B 1 91  ? -10.692 94.642  12.775  1.00 27.02  ? 91   ASP B OD2   1 
ATOM   5639  N N     . ARG B 1 92  ? -13.865 90.791  15.384  1.00 23.52  ? 92   ARG B N     1 
ATOM   5640  C CA    . ARG B 1 92  ? -14.219 89.760  16.366  1.00 23.95  ? 92   ARG B CA    1 
ATOM   5641  C C     . ARG B 1 92  ? -14.461 88.417  15.653  1.00 23.20  ? 92   ARG B C     1 
ATOM   5642  O O     . ARG B 1 92  ? -15.085 88.378  14.597  1.00 23.95  ? 92   ARG B O     1 
ATOM   5643  C CB    . ARG B 1 92  ? -15.448 90.204  17.171  1.00 23.70  ? 92   ARG B CB    1 
ATOM   5644  C CG    . ARG B 1 92  ? -16.063 89.161  18.109  1.00 24.68  ? 92   ARG B CG    1 
ATOM   5645  C CD    . ARG B 1 92  ? -17.002 89.822  19.116  1.00 25.54  ? 92   ARG B CD    1 
ATOM   5646  N NE    . ARG B 1 92  ? -16.277 90.680  20.060  1.00 29.73  ? 92   ARG B NE    1 
ATOM   5647  C CZ    . ARG B 1 92  ? -16.844 91.575  20.866  1.00 32.74  ? 92   ARG B CZ    1 
ATOM   5648  N NH1   . ARG B 1 92  ? -18.167 91.758  20.856  1.00 34.88  ? 92   ARG B NH1   1 
ATOM   5649  N NH2   . ARG B 1 92  ? -16.085 92.305  21.677  1.00 32.68  ? 92   ARG B NH2   1 
ATOM   5650  N N     . THR B 1 93  ? -13.930 87.331  16.206  1.00 22.66  ? 93   THR B N     1 
ATOM   5651  C CA    . THR B 1 93  ? -14.134 85.988  15.656  1.00 21.79  ? 93   THR B CA    1 
ATOM   5652  C C     . THR B 1 93  ? -15.607 85.595  15.775  1.00 21.54  ? 93   THR B C     1 
ATOM   5653  O O     . THR B 1 93  ? -16.177 85.636  16.865  1.00 21.31  ? 93   THR B O     1 
ATOM   5654  C CB    . THR B 1 93  ? -13.271 84.954  16.398  1.00 21.79  ? 93   THR B CB    1 
ATOM   5655  O OG1   . THR B 1 93  ? -11.907 85.387  16.403  1.00 20.34  ? 93   THR B OG1   1 
ATOM   5656  C CG2   . THR B 1 93  ? -13.379 83.569  15.744  1.00 21.68  ? 93   THR B CG2   1 
ATOM   5657  N N     . ALA B 1 94  ? -16.221 85.260  14.642  1.00 21.39  ? 94   ALA B N     1 
ATOM   5658  C CA    . ALA B 1 94  ? -17.616 84.823  14.606  1.00 21.36  ? 94   ALA B CA    1 
ATOM   5659  C C     . ALA B 1 94  ? -17.679 83.319  14.844  1.00 21.29  ? 94   ALA B C     1 
ATOM   5660  O O     . ALA B 1 94  ? -18.439 82.850  15.682  1.00 21.18  ? 94   ALA B O     1 
ATOM   5661  C CB    . ALA B 1 94  ? -18.269 85.188  13.270  1.00 21.44  ? 94   ALA B CB    1 
ATOM   5662  N N     . ILE B 1 95  ? -16.853 82.582  14.107  1.00 21.53  ? 95   ILE B N     1 
ATOM   5663  C CA    . ILE B 1 95  ? -16.769 81.121  14.199  1.00 21.40  ? 95   ILE B CA    1 
ATOM   5664  C C     . ILE B 1 95  ? -15.321 80.672  14.431  1.00 21.14  ? 95   ILE B C     1 
ATOM   5665  O O     . ILE B 1 95  ? -14.422 81.029  13.654  1.00 21.40  ? 95   ILE B O     1 
ATOM   5666  C CB    . ILE B 1 95  ? -17.327 80.446  12.909  1.00 21.42  ? 95   ILE B CB    1 
ATOM   5667  C CG1   . ILE B 1 95  ? -18.789 80.844  12.662  1.00 21.30  ? 95   ILE B CG1   1 
ATOM   5668  C CG2   . ILE B 1 95  ? -17.184 78.904  12.966  1.00 22.42  ? 95   ILE B CG2   1 
ATOM   5669  C CD1   . ILE B 1 95  ? -19.425 80.172  11.424  1.00 21.67  ? 95   ILE B CD1   1 
ATOM   5670  N N     . ILE B 1 96  ? -15.085 79.942  15.522  1.00 20.82  ? 96   ILE B N     1 
ATOM   5671  C CA    . ILE B 1 96  ? -13.861 79.140  15.667  1.00 20.65  ? 96   ILE B CA    1 
ATOM   5672  C C     . ILE B 1 96  ? -14.163 77.747  15.123  1.00 21.02  ? 96   ILE B C     1 
ATOM   5673  O O     . ILE B 1 96  ? -15.085 77.084  15.595  1.00 21.17  ? 96   ILE B O     1 
ATOM   5674  C CB    . ILE B 1 96  ? -13.394 78.989  17.151  1.00 20.90  ? 96   ILE B CB    1 
ATOM   5675  C CG1   . ILE B 1 96  ? -13.095 80.351  17.792  1.00 20.31  ? 96   ILE B CG1   1 
ATOM   5676  C CG2   . ILE B 1 96  ? -12.172 78.053  17.241  1.00 20.15  ? 96   ILE B CG2   1 
ATOM   5677  C CD1   . ILE B 1 96  ? -12.729 80.267  19.280  1.00 20.44  ? 96   ILE B CD1   1 
ATOM   5678  N N     . TRP B 1 97  ? -13.414 77.299  14.124  1.00 21.43  ? 97   TRP B N     1 
ATOM   5679  C CA    . TRP B 1 97  ? -13.606 75.941  13.619  1.00 22.09  ? 97   TRP B CA    1 
ATOM   5680  C C     . TRP B 1 97  ? -12.477 75.034  14.070  1.00 22.50  ? 97   TRP B C     1 
ATOM   5681  O O     . TRP B 1 97  ? -11.307 75.353  13.876  1.00 22.25  ? 97   TRP B O     1 
ATOM   5682  C CB    . TRP B 1 97  ? -13.716 75.911  12.091  1.00 22.07  ? 97   TRP B CB    1 
ATOM   5683  C CG    . TRP B 1 97  ? -13.866 74.513  11.532  1.00 22.49  ? 97   TRP B CG    1 
ATOM   5684  C CD1   . TRP B 1 97  ? -14.980 73.713  11.594  1.00 22.78  ? 97   TRP B CD1   1 
ATOM   5685  C CD2   . TRP B 1 97  ? -12.867 73.755  10.834  1.00 23.04  ? 97   TRP B CD2   1 
ATOM   5686  N NE1   . TRP B 1 97  ? -14.736 72.507  10.964  1.00 23.14  ? 97   TRP B NE1   1 
ATOM   5687  C CE2   . TRP B 1 97  ? -13.450 72.508  10.489  1.00 23.18  ? 97   TRP B CE2   1 
ATOM   5688  C CE3   . TRP B 1 97  ? -11.542 74.014  10.446  1.00 22.99  ? 97   TRP B CE3   1 
ATOM   5689  C CZ2   . TRP B 1 97  ? -12.745 71.518  9.789   1.00 22.03  ? 97   TRP B CZ2   1 
ATOM   5690  C CZ3   . TRP B 1 97  ? -10.845 73.028  9.752   1.00 23.08  ? 97   TRP B CZ3   1 
ATOM   5691  C CH2   . TRP B 1 97  ? -11.453 71.795  9.432   1.00 22.09  ? 97   TRP B CH2   1 
ATOM   5692  N N     . GLU B 1 98  ? -12.832 73.900  14.667  1.00 22.79  ? 98   GLU B N     1 
ATOM   5693  C CA    . GLU B 1 98  ? -11.840 72.928  15.125  1.00 23.04  ? 98   GLU B CA    1 
ATOM   5694  C C     . GLU B 1 98  ? -12.005 71.634  14.341  1.00 23.58  ? 98   GLU B C     1 
ATOM   5695  O O     . GLU B 1 98  ? -13.084 71.024  14.350  1.00 23.54  ? 98   GLU B O     1 
ATOM   5696  C CB    . GLU B 1 98  ? -11.985 72.685  16.631  1.00 22.98  ? 98   GLU B CB    1 
ATOM   5697  C CG    . GLU B 1 98  ? -11.220 71.478  17.197  1.00 22.79  ? 98   GLU B CG    1 
ATOM   5698  C CD    . GLU B 1 98  ? -9.741  71.734  17.436  1.00 22.28  ? 98   GLU B CD    1 
ATOM   5699  O OE1   . GLU B 1 98  ? -9.264  72.863  17.196  1.00 22.79  ? 98   GLU B OE1   1 
ATOM   5700  O OE2   . GLU B 1 98  ? -9.042  70.786  17.871  1.00 23.25  ? 98   GLU B OE2   1 
ATOM   5701  N N     . GLY B 1 99  ? -10.944 71.228  13.649  1.00 23.65  ? 99   GLY B N     1 
ATOM   5702  C CA    . GLY B 1 99  ? -10.992 70.033  12.809  1.00 24.06  ? 99   GLY B CA    1 
ATOM   5703  C C     . GLY B 1 99  ? -10.992 68.746  13.613  1.00 24.58  ? 99   GLY B C     1 
ATOM   5704  O O     . GLY B 1 99  ? -10.641 68.742  14.798  1.00 24.79  ? 99   GLY B O     1 
ATOM   5705  N N     . ASP B 1 100 ? -11.404 67.658  12.968  1.00 24.83  ? 100  ASP B N     1 
ATOM   5706  C CA    . ASP B 1 100 ? -11.320 66.319  13.545  1.00 25.14  ? 100  ASP B CA    1 
ATOM   5707  C C     . ASP B 1 100 ? -9.852  66.089  13.902  1.00 25.23  ? 100  ASP B C     1 
ATOM   5708  O O     . ASP B 1 100 ? -9.523  65.598  14.986  1.00 24.72  ? 100  ASP B O     1 
ATOM   5709  C CB    . ASP B 1 100 ? -11.808 65.271  12.533  1.00 25.03  ? 100  ASP B CB    1 
ATOM   5710  C CG    . ASP B 1 100 ? -12.001 63.892  13.154  1.00 26.12  ? 100  ASP B CG    1 
ATOM   5711  O OD1   . ASP B 1 100 ? -12.888 63.732  14.014  1.00 26.81  ? 100  ASP B OD1   1 
ATOM   5712  O OD2   . ASP B 1 100 ? -11.283 62.954  12.761  1.00 28.07  ? 100  ASP B OD2   1 
ATOM   5713  N N     . ASP B 1 101 ? -8.990  66.454  12.959  1.00 25.41  ? 101  ASP B N     1 
ATOM   5714  C CA    . ASP B 1 101 ? -7.556  66.533  13.167  1.00 25.59  ? 101  ASP B CA    1 
ATOM   5715  C C     . ASP B 1 101 ? -7.281  67.887  13.796  1.00 25.67  ? 101  ASP B C     1 
ATOM   5716  O O     . ASP B 1 101 ? -7.469  68.916  13.143  1.00 25.47  ? 101  ASP B O     1 
ATOM   5717  C CB    . ASP B 1 101 ? -6.855  66.406  11.809  1.00 25.99  ? 101  ASP B CB    1 
ATOM   5718  C CG    . ASP B 1 101 ? -5.342  66.541  11.896  1.00 26.65  ? 101  ASP B CG    1 
ATOM   5719  O OD1   . ASP B 1 101 ? -4.831  67.164  12.847  1.00 28.93  ? 101  ASP B OD1   1 
ATOM   5720  O OD2   . ASP B 1 101 ? -4.663  66.025  10.990  1.00 27.88  ? 101  ASP B OD2   1 
ATOM   5721  N N     . THR B 1 102 ? -6.841  67.890  15.059  1.00 26.09  ? 102  THR B N     1 
ATOM   5722  C CA    . THR B 1 102 ? -6.609  69.141  15.813  1.00 26.33  ? 102  THR B CA    1 
ATOM   5723  C C     . THR B 1 102 ? -5.606  70.122  15.159  1.00 27.01  ? 102  THR B C     1 
ATOM   5724  O O     . THR B 1 102 ? -5.651  71.327  15.429  1.00 27.54  ? 102  THR B O     1 
ATOM   5725  C CB    . THR B 1 102 ? -6.222  68.867  17.307  1.00 26.24  ? 102  THR B CB    1 
ATOM   5726  O OG1   . THR B 1 102 ? -6.379  70.067  18.075  1.00 27.09  ? 102  THR B OG1   1 
ATOM   5727  C CG2   . THR B 1 102 ? -4.791  68.358  17.446  1.00 25.53  ? 102  THR B CG2   1 
ATOM   5728  N N     . SER B 1 103 ? -4.717  69.617  14.299  1.00 26.90  ? 103  SER B N     1 
ATOM   5729  C CA    . SER B 1 103 ? -3.787  70.486  13.570  1.00 26.88  ? 103  SER B CA    1 
ATOM   5730  C C     . SER B 1 103 ? -4.525  71.377  12.565  1.00 27.02  ? 103  SER B C     1 
ATOM   5731  O O     . SER B 1 103 ? -3.960  72.344  12.037  1.00 26.61  ? 103  SER B O     1 
ATOM   5732  C CB    . SER B 1 103 ? -2.710  69.663  12.858  1.00 26.96  ? 103  SER B CB    1 
ATOM   5733  O OG    . SER B 1 103 ? -3.249  68.939  11.757  1.00 27.30  ? 103  SER B OG    1 
ATOM   5734  N N     . GLN B 1 104 ? -5.791  71.047  12.311  1.00 26.96  ? 104  GLN B N     1 
ATOM   5735  C CA    . GLN B 1 104 ? -6.610  71.799  11.368  1.00 27.54  ? 104  GLN B CA    1 
ATOM   5736  C C     . GLN B 1 104 ? -7.612  72.639  12.145  1.00 27.40  ? 104  GLN B C     1 
ATOM   5737  O O     . GLN B 1 104 ? -8.390  72.104  12.938  1.00 27.09  ? 104  GLN B O     1 
ATOM   5738  C CB    . GLN B 1 104 ? -7.327  70.855  10.386  1.00 27.18  ? 104  GLN B CB    1 
ATOM   5739  C CG    . GLN B 1 104 ? -6.396  70.105  9.419   1.00 28.06  ? 104  GLN B CG    1 
ATOM   5740  C CD    . GLN B 1 104 ? -7.140  69.209  8.396   1.00 28.94  ? 104  GLN B CD    1 
ATOM   5741  O OE1   . GLN B 1 104 ? -8.372  69.087  8.413   1.00 29.61  ? 104  GLN B OE1   1 
ATOM   5742  N NE2   . GLN B 1 104 ? -6.375  68.591  7.495   1.00 29.40  ? 104  GLN B NE2   1 
ATOM   5743  N N     . SER B 1 105 ? -7.563  73.956  11.946  1.00 27.77  ? 105  SER B N     1 
ATOM   5744  C CA    . SER B 1 105 ? -8.493  74.882  12.613  1.00 28.59  ? 105  SER B CA    1 
ATOM   5745  C C     . SER B 1 105 ? -8.441  76.296  12.033  1.00 28.53  ? 105  SER B C     1 
ATOM   5746  O O     . SER B 1 105 ? -7.421  76.711  11.486  1.00 28.79  ? 105  SER B O     1 
ATOM   5747  C CB    . SER B 1 105 ? -8.237  74.941  14.126  1.00 28.60  ? 105  SER B CB    1 
ATOM   5748  O OG    . SER B 1 105 ? -7.256  75.915  14.418  1.00 30.52  ? 105  SER B OG    1 
ATOM   5749  N N     . LYS B 1 106 ? -9.547  77.025  12.183  1.00 28.39  ? 106  LYS B N     1 
ATOM   5750  C CA    . LYS B 1 106 ? -9.697  78.396  11.685  1.00 28.33  ? 106  LYS B CA    1 
ATOM   5751  C C     . LYS B 1 106 ? -10.337 79.306  12.736  1.00 27.73  ? 106  LYS B C     1 
ATOM   5752  O O     . LYS B 1 106 ? -11.141 78.856  13.560  1.00 27.09  ? 106  LYS B O     1 
ATOM   5753  C CB    . LYS B 1 106 ? -10.604 78.422  10.443  1.00 28.17  ? 106  LYS B CB    1 
ATOM   5754  C CG    . LYS B 1 106 ? -10.002 77.883  9.166   1.00 28.92  ? 106  LYS B CG    1 
ATOM   5755  C CD    . LYS B 1 106 ? -11.044 77.861  8.041   1.00 29.68  ? 106  LYS B CD    1 
ATOM   5756  C CE    . LYS B 1 106 ? -10.396 77.450  6.720   1.00 33.04  ? 106  LYS B CE    1 
ATOM   5757  N NZ    . LYS B 1 106 ? -11.324 77.616  5.563   1.00 34.97  ? 106  LYS B NZ    1 
ATOM   5758  N N     . HIS B 1 107 ? -9.973  80.587  12.688  1.00 27.27  ? 107  HIS B N     1 
ATOM   5759  C CA    . HIS B 1 107 ? -10.711 81.645  13.358  1.00 26.94  ? 107  HIS B CA    1 
ATOM   5760  C C     . HIS B 1 107 ? -11.305 82.529  12.267  1.00 26.50  ? 107  HIS B C     1 
ATOM   5761  O O     . HIS B 1 107 ? -10.568 83.235  11.576  1.00 26.94  ? 107  HIS B O     1 
ATOM   5762  C CB    . HIS B 1 107 ? -9.790  82.471  14.255  1.00 27.18  ? 107  HIS B CB    1 
ATOM   5763  C CG    . HIS B 1 107 ? -9.498  81.840  15.582  1.00 28.04  ? 107  HIS B CG    1 
ATOM   5764  N ND1   . HIS B 1 107 ? -8.791  80.663  15.709  1.00 29.43  ? 107  HIS B ND1   1 
ATOM   5765  C CD2   . HIS B 1 107 ? -9.796  82.237  16.842  1.00 28.17  ? 107  HIS B CD2   1 
ATOM   5766  C CE1   . HIS B 1 107 ? -8.684  80.352  16.990  1.00 28.88  ? 107  HIS B CE1   1 
ATOM   5767  N NE2   . HIS B 1 107 ? -9.280  81.294  17.699  1.00 28.06  ? 107  HIS B NE2   1 
ATOM   5768  N N     . ILE B 1 108 ? -12.626 82.490  12.107  1.00 25.25  ? 108  ILE B N     1 
ATOM   5769  C CA    . ILE B 1 108 ? -13.301 83.263  11.064  1.00 24.37  ? 108  ILE B CA    1 
ATOM   5770  C C     . ILE B 1 108 ? -13.969 84.500  11.660  1.00 23.75  ? 108  ILE B C     1 
ATOM   5771  O O     . ILE B 1 108 ? -14.885 84.388  12.476  1.00 22.80  ? 108  ILE B O     1 
ATOM   5772  C CB    . ILE B 1 108 ? -14.331 82.388  10.285  1.00 24.73  ? 108  ILE B CB    1 
ATOM   5773  C CG1   . ILE B 1 108 ? -13.618 81.186  9.665   1.00 24.91  ? 108  ILE B CG1   1 
ATOM   5774  C CG2   . ILE B 1 108 ? -15.036 83.205  9.194   1.00 23.67  ? 108  ILE B CG2   1 
ATOM   5775  C CD1   . ILE B 1 108 ? -14.348 79.889  9.847   1.00 27.32  ? 108  ILE B CD1   1 
ATOM   5776  N N     . SER B 1 109 ? -13.492 85.679  11.258  1.00 23.05  ? 109  SER B N     1 
ATOM   5777  C CA    . SER B 1 109 ? -14.000 86.933  11.807  1.00 22.94  ? 109  SER B CA    1 
ATOM   5778  C C     . SER B 1 109 ? -15.386 87.212  11.251  1.00 23.09  ? 109  SER B C     1 
ATOM   5779  O O     . SER B 1 109 ? -15.799 86.593  10.267  1.00 22.95  ? 109  SER B O     1 
ATOM   5780  C CB    . SER B 1 109 ? -13.070 88.096  11.461  1.00 22.85  ? 109  SER B CB    1 
ATOM   5781  O OG    . SER B 1 109 ? -13.270 88.493  10.118  1.00 22.93  ? 109  SER B OG    1 
ATOM   5782  N N     . TYR B 1 110 ? -16.093 88.152  11.873  1.00 23.06  ? 110  TYR B N     1 
ATOM   5783  C CA    . TYR B 1 110 ? -17.382 88.594  11.356  1.00 23.33  ? 110  TYR B CA    1 
ATOM   5784  C C     . TYR B 1 110 ? -17.241 89.160  9.942   1.00 23.45  ? 110  TYR B C     1 
ATOM   5785  O O     . TYR B 1 110 ? -18.059 88.867  9.067   1.00 23.31  ? 110  TYR B O     1 
ATOM   5786  C CB    . TYR B 1 110 ? -18.068 89.587  12.312  1.00 22.89  ? 110  TYR B CB    1 
ATOM   5787  C CG    . TYR B 1 110 ? -18.935 88.879  13.311  1.00 23.16  ? 110  TYR B CG    1 
ATOM   5788  C CD1   . TYR B 1 110 ? -18.437 88.518  14.568  1.00 22.81  ? 110  TYR B CD1   1 
ATOM   5789  C CD2   . TYR B 1 110 ? -20.241 88.518  12.987  1.00 23.46  ? 110  TYR B CD2   1 
ATOM   5790  C CE1   . TYR B 1 110 ? -19.230 87.842  15.485  1.00 22.35  ? 110  TYR B CE1   1 
ATOM   5791  C CE2   . TYR B 1 110 ? -21.045 87.832  13.897  1.00 23.88  ? 110  TYR B CE2   1 
ATOM   5792  C CZ    . TYR B 1 110 ? -20.534 87.498  15.141  1.00 23.02  ? 110  TYR B CZ    1 
ATOM   5793  O OH    . TYR B 1 110 ? -21.328 86.822  16.027  1.00 21.70  ? 110  TYR B OH    1 
ATOM   5794  N N     . ARG B 1 111 ? -16.187 89.937  9.718   1.00 23.61  ? 111  ARG B N     1 
ATOM   5795  C CA    . ARG B 1 111 ? -15.931 90.493  8.399   1.00 24.41  ? 111  ARG B CA    1 
ATOM   5796  C C     . ARG B 1 111 ? -15.692 89.405  7.332   1.00 24.23  ? 111  ARG B C     1 
ATOM   5797  O O     . ARG B 1 111 ? -16.304 89.447  6.269   1.00 24.13  ? 111  ARG B O     1 
ATOM   5798  C CB    . ARG B 1 111 ? -14.790 91.514  8.444   1.00 24.56  ? 111  ARG B CB    1 
ATOM   5799  C CG    . ARG B 1 111 ? -14.695 92.379  7.189   1.00 26.43  ? 111  ARG B CG    1 
ATOM   5800  C CD    . ARG B 1 111 ? -13.784 93.579  7.388   1.00 29.63  ? 111  ARG B CD    1 
ATOM   5801  N NE    . ARG B 1 111 ? -14.516 94.716  7.952   1.00 32.50  ? 111  ARG B NE    1 
ATOM   5802  C CZ    . ARG B 1 111 ? -14.258 95.285  9.130   1.00 34.34  ? 111  ARG B CZ    1 
ATOM   5803  N NH1   . ARG B 1 111 ? -13.267 94.837  9.897   1.00 34.68  ? 111  ARG B NH1   1 
ATOM   5804  N NH2   . ARG B 1 111 ? -14.994 96.317  9.538   1.00 34.94  ? 111  ARG B NH2   1 
ATOM   5805  N N     . GLU B 1 112 ? -14.835 88.428  7.632   1.00 24.28  ? 112  GLU B N     1 
ATOM   5806  C CA    . GLU B 1 112 ? -14.583 87.296  6.716   1.00 24.64  ? 112  GLU B CA    1 
ATOM   5807  C C     . GLU B 1 112 ? -15.845 86.470  6.424   1.00 24.15  ? 112  GLU B C     1 
ATOM   5808  O O     . GLU B 1 112 ? -16.109 86.127  5.275   1.00 23.86  ? 112  GLU B O     1 
ATOM   5809  C CB    . GLU B 1 112 ? -13.453 86.388  7.234   1.00 24.50  ? 112  GLU B CB    1 
ATOM   5810  C CG    . GLU B 1 112 ? -12.156 87.128  7.482   1.00 25.52  ? 112  GLU B CG    1 
ATOM   5811  C CD    . GLU B 1 112 ? -11.077 86.280  8.129   1.00 26.37  ? 112  GLU B CD    1 
ATOM   5812  O OE1   . GLU B 1 112 ? -11.350 85.550  9.114   1.00 27.54  ? 112  GLU B OE1   1 
ATOM   5813  O OE2   . GLU B 1 112 ? -9.919  86.382  7.665   1.00 29.06  ? 112  GLU B OE2   1 
ATOM   5814  N N     . LEU B 1 113 ? -16.620 86.165  7.463   1.00 23.94  ? 113  LEU B N     1 
ATOM   5815  C CA    . LEU B 1 113 ? -17.859 85.413  7.297   1.00 23.88  ? 113  LEU B CA    1 
ATOM   5816  C C     . LEU B 1 113 ? -18.892 86.177  6.459   1.00 23.79  ? 113  LEU B C     1 
ATOM   5817  O O     . LEU B 1 113 ? -19.511 85.607  5.563   1.00 23.91  ? 113  LEU B O     1 
ATOM   5818  C CB    . LEU B 1 113 ? -18.441 85.004  8.664   1.00 23.92  ? 113  LEU B CB    1 
ATOM   5819  C CG    . LEU B 1 113 ? -19.587 83.981  8.694   1.00 24.13  ? 113  LEU B CG    1 
ATOM   5820  C CD1   . LEU B 1 113 ? -19.233 82.653  7.997   1.00 23.35  ? 113  LEU B CD1   1 
ATOM   5821  C CD2   . LEU B 1 113 ? -20.033 83.730  10.143  1.00 23.56  ? 113  LEU B CD2   1 
ATOM   5822  N N     . HIS B 1 114 ? -19.065 87.462  6.749   1.00 23.80  ? 114  HIS B N     1 
ATOM   5823  C CA    . HIS B 1 114 ? -19.923 88.338  5.947   1.00 24.13  ? 114  HIS B CA    1 
ATOM   5824  C C     . HIS B 1 114 ? -19.522 88.327  4.458   1.00 24.26  ? 114  HIS B C     1 
ATOM   5825  O O     . HIS B 1 114 ? -20.390 88.229  3.583   1.00 23.82  ? 114  HIS B O     1 
ATOM   5826  C CB    . HIS B 1 114 ? -19.904 89.770  6.514   1.00 24.34  ? 114  HIS B CB    1 
ATOM   5827  C CG    . HIS B 1 114 ? -20.605 90.787  5.658   1.00 24.29  ? 114  HIS B CG    1 
ATOM   5828  N ND1   . HIS B 1 114 ? -19.933 91.609  4.781   1.00 25.16  ? 114  HIS B ND1   1 
ATOM   5829  C CD2   . HIS B 1 114 ? -21.913 91.127  5.563   1.00 24.38  ? 114  HIS B CD2   1 
ATOM   5830  C CE1   . HIS B 1 114 ? -20.796 92.408  4.176   1.00 24.73  ? 114  HIS B CE1   1 
ATOM   5831  N NE2   . HIS B 1 114 ? -22.004 92.136  4.632   1.00 23.78  ? 114  HIS B NE2   1 
ATOM   5832  N N     . ARG B 1 115 ? -18.218 88.433  4.189   1.00 24.09  ? 115  ARG B N     1 
ATOM   5833  C CA    . ARG B 1 115 ? -17.703 88.434  2.820   1.00 24.55  ? 115  ARG B CA    1 
ATOM   5834  C C     . ARG B 1 115 ? -18.066 87.157  2.062   1.00 23.94  ? 115  ARG B C     1 
ATOM   5835  O O     . ARG B 1 115 ? -18.583 87.222  0.944   1.00 23.34  ? 115  ARG B O     1 
ATOM   5836  C CB    . ARG B 1 115 ? -16.184 88.632  2.785   1.00 24.37  ? 115  ARG B CB    1 
ATOM   5837  C CG    . ARG B 1 115 ? -15.635 88.576  1.358   1.00 25.71  ? 115  ARG B CG    1 
ATOM   5838  C CD    . ARG B 1 115 ? -14.125 88.748  1.269   1.00 26.55  ? 115  ARG B CD    1 
ATOM   5839  N NE    . ARG B 1 115 ? -13.708 88.931  -0.124  1.00 30.32  ? 115  ARG B NE    1 
ATOM   5840  C CZ    . ARG B 1 115 ? -13.555 90.114  -0.720  1.00 32.43  ? 115  ARG B CZ    1 
ATOM   5841  N NH1   . ARG B 1 115 ? -13.773 91.250  -0.053  1.00 32.64  ? 115  ARG B NH1   1 
ATOM   5842  N NH2   . ARG B 1 115 ? -13.173 90.165  -1.993  1.00 33.60  ? 115  ARG B NH2   1 
ATOM   5843  N N     . ASP B 1 116 ? -17.790 86.005  2.675   1.00 23.90  ? 116  ASP B N     1 
ATOM   5844  C CA    . ASP B 1 116 ? -18.110 84.717  2.061   1.00 24.00  ? 116  ASP B CA    1 
ATOM   5845  C C     . ASP B 1 116 ? -19.605 84.503  1.857   1.00 23.02  ? 116  ASP B C     1 
ATOM   5846  O O     . ASP B 1 116 ? -20.007 83.940  0.843   1.00 23.18  ? 116  ASP B O     1 
ATOM   5847  C CB    . ASP B 1 116 ? -17.477 83.557  2.828   1.00 24.80  ? 116  ASP B CB    1 
ATOM   5848  C CG    . ASP B 1 116 ? -15.989 83.399  2.522   1.00 27.96  ? 116  ASP B CG    1 
ATOM   5849  O OD1   . ASP B 1 116 ? -15.573 83.724  1.391   1.00 31.69  ? 116  ASP B OD1   1 
ATOM   5850  O OD2   . ASP B 1 116 ? -15.228 82.960  3.413   1.00 32.56  ? 116  ASP B OD2   1 
ATOM   5851  N N     . VAL B 1 117 ? -20.420 84.960  2.808   1.00 22.40  ? 117  VAL B N     1 
ATOM   5852  C CA    . VAL B 1 117 ? -21.888 84.861  2.708   1.00 21.70  ? 117  VAL B CA    1 
ATOM   5853  C C     . VAL B 1 117 ? -22.429 85.696  1.540   1.00 21.91  ? 117  VAL B C     1 
ATOM   5854  O O     . VAL B 1 117 ? -23.277 85.226  0.782   1.00 21.55  ? 117  VAL B O     1 
ATOM   5855  C CB    . VAL B 1 117 ? -22.594 85.238  4.045   1.00 21.77  ? 117  VAL B CB    1 
ATOM   5856  C CG1   . VAL B 1 117 ? -24.082 85.485  3.832   1.00 20.46  ? 117  VAL B CG1   1 
ATOM   5857  C CG2   . VAL B 1 117 ? -22.380 84.117  5.101   1.00 21.22  ? 117  VAL B CG2   1 
ATOM   5858  N N     . CYS B 1 118 ? -21.923 86.920  1.399   1.00 21.54  ? 118  CYS B N     1 
ATOM   5859  C CA    . CYS B 1 118 ? -22.241 87.761  0.245   1.00 22.53  ? 118  CYS B CA    1 
ATOM   5860  C C     . CYS B 1 118 ? -21.859 87.118  -1.095  1.00 22.32  ? 118  CYS B C     1 
ATOM   5861  O O     . CYS B 1 118 ? -22.654 87.110  -2.045  1.00 22.59  ? 118  CYS B O     1 
ATOM   5862  C CB    . CYS B 1 118 ? -21.554 89.121  0.375   1.00 22.28  ? 118  CYS B CB    1 
ATOM   5863  S SG    . CYS B 1 118 ? -22.268 90.133  1.655   1.00 25.29  ? 118  CYS B SG    1 
ATOM   5864  N N     . ARG B 1 119 ? -20.639 86.597  -1.175  1.00 22.11  ? 119  ARG B N     1 
ATOM   5865  C CA    . ARG B 1 119 ? -20.184 85.922  -2.385  1.00 22.38  ? 119  ARG B CA    1 
ATOM   5866  C C     . ARG B 1 119 ? -21.044 84.700  -2.702  1.00 21.65  ? 119  ARG B C     1 
ATOM   5867  O O     . ARG B 1 119 ? -21.403 84.474  -3.850  1.00 21.48  ? 119  ARG B O     1 
ATOM   5868  C CB    . ARG B 1 119 ? -18.715 85.534  -2.271  1.00 22.60  ? 119  ARG B CB    1 
ATOM   5869  C CG    . ARG B 1 119 ? -17.784 86.725  -2.304  1.00 24.83  ? 119  ARG B CG    1 
ATOM   5870  C CD    . ARG B 1 119 ? -16.391 86.326  -2.720  1.00 28.49  ? 119  ARG B CD    1 
ATOM   5871  N NE    . ARG B 1 119 ? -15.754 85.426  -1.760  1.00 31.12  ? 119  ARG B NE    1 
ATOM   5872  C CZ    . ARG B 1 119 ? -14.558 84.863  -1.936  1.00 33.15  ? 119  ARG B CZ    1 
ATOM   5873  N NH1   . ARG B 1 119 ? -13.863 85.093  -3.049  1.00 31.92  ? 119  ARG B NH1   1 
ATOM   5874  N NH2   . ARG B 1 119 ? -14.063 84.052  -1.003  1.00 33.72  ? 119  ARG B NH2   1 
ATOM   5875  N N     . PHE B 1 120 ? -21.391 83.935  -1.672  1.00 21.32  ? 120  PHE B N     1 
ATOM   5876  C CA    . PHE B 1 120 ? -22.232 82.763  -1.854  1.00 21.16  ? 120  PHE B CA    1 
ATOM   5877  C C     . PHE B 1 120 ? -23.703 83.102  -2.092  1.00 21.27  ? 120  PHE B C     1 
ATOM   5878  O O     . PHE B 1 120 ? -24.397 82.354  -2.773  1.00 21.19  ? 120  PHE B O     1 
ATOM   5879  C CB    . PHE B 1 120 ? -22.080 81.745  -0.717  1.00 20.84  ? 120  PHE B CB    1 
ATOM   5880  C CG    . PHE B 1 120 ? -22.561 80.360  -1.094  1.00 20.58  ? 120  PHE B CG    1 
ATOM   5881  C CD1   . PHE B 1 120 ? -21.807 79.561  -1.949  1.00 20.23  ? 120  PHE B CD1   1 
ATOM   5882  C CD2   . PHE B 1 120 ? -23.775 79.877  -0.622  1.00 19.39  ? 120  PHE B CD2   1 
ATOM   5883  C CE1   . PHE B 1 120 ? -22.253 78.294  -2.323  1.00 22.47  ? 120  PHE B CE1   1 
ATOM   5884  C CE2   . PHE B 1 120 ? -24.231 78.605  -0.979  1.00 21.85  ? 120  PHE B CE2   1 
ATOM   5885  C CZ    . PHE B 1 120 ? -23.463 77.808  -1.835  1.00 21.27  ? 120  PHE B CZ    1 
ATOM   5886  N N     . ALA B 1 121 ? -24.176 84.225  -1.549  1.00 21.30  ? 121  ALA B N     1 
ATOM   5887  C CA    . ALA B 1 121 ? -25.526 84.686  -1.867  1.00 20.80  ? 121  ALA B CA    1 
ATOM   5888  C C     . ALA B 1 121 ? -25.624 85.055  -3.361  1.00 20.43  ? 121  ALA B C     1 
ATOM   5889  O O     . ALA B 1 121 ? -26.614 84.746  -4.030  1.00 20.09  ? 121  ALA B O     1 
ATOM   5890  C CB    . ALA B 1 121 ? -25.927 85.838  -0.981  1.00 20.86  ? 121  ALA B CB    1 
ATOM   5891  N N     . ASN B 1 122 ? -24.576 85.676  -3.883  1.00 19.95  ? 122  ASN B N     1 
ATOM   5892  C CA    . ASN B 1 122 ? -24.510 85.998  -5.301  1.00 19.71  ? 122  ASN B CA    1 
ATOM   5893  C C     . ASN B 1 122 ? -24.414 84.742  -6.186  1.00 19.97  ? 122  ASN B C     1 
ATOM   5894  O O     . ASN B 1 122 ? -25.032 84.673  -7.259  1.00 19.71  ? 122  ASN B O     1 
ATOM   5895  C CB    . ASN B 1 122 ? -23.365 86.971  -5.568  1.00 19.22  ? 122  ASN B CB    1 
ATOM   5896  C CG    . ASN B 1 122 ? -23.755 88.407  -5.283  1.00 19.29  ? 122  ASN B CG    1 
ATOM   5897  O OD1   . ASN B 1 122 ? -24.894 88.815  -5.543  1.00 19.24  ? 122  ASN B OD1   1 
ATOM   5898  N ND2   . ASN B 1 122 ? -22.815 89.187  -4.760  1.00 15.23  ? 122  ASN B ND2   1 
ATOM   5899  N N     . THR B 1 123 ? -23.644 83.761  -5.716  1.00 20.07  ? 123  THR B N     1 
ATOM   5900  C CA    . THR B 1 123 ? -23.555 82.444  -6.344  1.00 20.35  ? 123  THR B CA    1 
ATOM   5901  C C     . THR B 1 123 ? -24.947 81.820  -6.488  1.00 20.53  ? 123  THR B C     1 
ATOM   5902  O O     . THR B 1 123 ? -25.333 81.384  -7.583  1.00 20.31  ? 123  THR B O     1 
ATOM   5903  C CB    . THR B 1 123 ? -22.620 81.496  -5.541  1.00 20.20  ? 123  THR B CB    1 
ATOM   5904  O OG1   . THR B 1 123 ? -21.309 82.072  -5.444  1.00 20.63  ? 123  THR B OG1   1 
ATOM   5905  C CG2   . THR B 1 123 ? -22.502 80.144  -6.213  1.00 20.27  ? 123  THR B CG2   1 
ATOM   5906  N N     . LEU B 1 124 ? -25.699 81.786  -5.387  1.00 20.84  ? 124  LEU B N     1 
ATOM   5907  C CA    . LEU B 1 124 ? -27.071 81.269  -5.412  1.00 21.04  ? 124  LEU B CA    1 
ATOM   5908  C C     . LEU B 1 124 ? -27.949 82.001  -6.442  1.00 21.56  ? 124  LEU B C     1 
ATOM   5909  O O     . LEU B 1 124 ? -28.673 81.366  -7.213  1.00 21.21  ? 124  LEU B O     1 
ATOM   5910  C CB    . LEU B 1 124 ? -27.702 81.317  -4.011  1.00 20.99  ? 124  LEU B CB    1 
ATOM   5911  C CG    . LEU B 1 124 ? -27.120 80.415  -2.904  1.00 20.96  ? 124  LEU B CG    1 
ATOM   5912  C CD1   . LEU B 1 124 ? -27.804 80.693  -1.574  1.00 20.90  ? 124  LEU B CD1   1 
ATOM   5913  C CD2   . LEU B 1 124 ? -27.212 78.919  -3.232  1.00 19.37  ? 124  LEU B CD2   1 
ATOM   5914  N N     . LEU B 1 125 ? -27.869 83.334  -6.464  1.00 22.08  ? 125  LEU B N     1 
ATOM   5915  C CA    . LEU B 1 125 ? -28.680 84.135  -7.391  1.00 22.54  ? 125  LEU B CA    1 
ATOM   5916  C C     . LEU B 1 125 ? -28.284 83.911  -8.845  1.00 22.99  ? 125  LEU B C     1 
ATOM   5917  O O     . LEU B 1 125 ? -29.149 83.835  -9.715  1.00 22.69  ? 125  LEU B O     1 
ATOM   5918  C CB    . LEU B 1 125 ? -28.628 85.625  -7.032  1.00 22.67  ? 125  LEU B CB    1 
ATOM   5919  C CG    . LEU B 1 125 ? -29.332 85.993  -5.721  1.00 21.83  ? 125  LEU B CG    1 
ATOM   5920  C CD1   . LEU B 1 125 ? -28.775 87.286  -5.177  1.00 21.78  ? 125  LEU B CD1   1 
ATOM   5921  C CD2   . LEU B 1 125 ? -30.865 86.070  -5.899  1.00 21.89  ? 125  LEU B CD2   1 
ATOM   5922  N N     . ASP B 1 126 ? -26.979 83.786  -9.090  1.00 24.01  ? 126  ASP B N     1 
ATOM   5923  C CA    . ASP B 1 126 ? -26.444 83.497  -10.429 1.00 24.88  ? 126  ASP B CA    1 
ATOM   5924  C C     . ASP B 1 126 ? -26.895 82.129  -10.950 1.00 25.11  ? 126  ASP B C     1 
ATOM   5925  O O     . ASP B 1 126 ? -26.992 81.917  -12.152 1.00 25.14  ? 126  ASP B O     1 
ATOM   5926  C CB    . ASP B 1 126 ? -24.919 83.588  -10.430 1.00 25.08  ? 126  ASP B CB    1 
ATOM   5927  C CG    . ASP B 1 126 ? -24.404 85.014  -10.180 1.00 26.75  ? 126  ASP B CG    1 
ATOM   5928  O OD1   . ASP B 1 126 ? -25.210 85.972  -10.191 1.00 28.22  ? 126  ASP B OD1   1 
ATOM   5929  O OD2   . ASP B 1 126 ? -23.179 85.178  -9.983  1.00 28.17  ? 126  ASP B OD2   1 
ATOM   5930  N N     . LEU B 1 127 ? -27.180 81.215  -10.031 1.00 25.52  ? 127  LEU B N     1 
ATOM   5931  C CA    . LEU B 1 127 ? -27.727 79.903  -10.367 1.00 26.02  ? 127  LEU B CA    1 
ATOM   5932  C C     . LEU B 1 127 ? -29.242 79.940  -10.570 1.00 26.06  ? 127  LEU B C     1 
ATOM   5933  O O     . LEU B 1 127 ? -29.852 78.926  -10.925 1.00 26.32  ? 127  LEU B O     1 
ATOM   5934  C CB    . LEU B 1 127 ? -27.364 78.886  -9.270  1.00 26.15  ? 127  LEU B CB    1 
ATOM   5935  C CG    . LEU B 1 127 ? -26.259 77.842  -9.493  1.00 26.64  ? 127  LEU B CG    1 
ATOM   5936  C CD1   . LEU B 1 127 ? -25.404 78.075  -10.733 1.00 27.71  ? 127  LEU B CD1   1 
ATOM   5937  C CD2   . LEU B 1 127 ? -25.387 77.728  -8.257  1.00 27.33  ? 127  LEU B CD2   1 
ATOM   5938  N N     . GLY B 1 128 ? -29.849 81.100  -10.333 1.00 25.99  ? 128  GLY B N     1 
ATOM   5939  C CA    . GLY B 1 128 ? -31.289 81.264  -10.537 1.00 26.12  ? 128  GLY B CA    1 
ATOM   5940  C C     . GLY B 1 128 ? -32.142 80.920  -9.325  1.00 26.13  ? 128  GLY B C     1 
ATOM   5941  O O     . GLY B 1 128 ? -33.362 80.781  -9.442  1.00 25.90  ? 128  GLY B O     1 
ATOM   5942  N N     . ILE B 1 129 ? -31.511 80.778  -8.160  1.00 26.01  ? 129  ILE B N     1 
ATOM   5943  C CA    . ILE B 1 129 ? -32.250 80.568  -6.911  1.00 25.97  ? 129  ILE B CA    1 
ATOM   5944  C C     . ILE B 1 129 ? -32.928 81.885  -6.523  1.00 26.59  ? 129  ILE B C     1 
ATOM   5945  O O     . ILE B 1 129 ? -32.340 82.959  -6.665  1.00 27.05  ? 129  ILE B O     1 
ATOM   5946  C CB    . ILE B 1 129 ? -31.323 80.058  -5.773  1.00 26.04  ? 129  ILE B CB    1 
ATOM   5947  C CG1   . ILE B 1 129 ? -30.576 78.785  -6.207  1.00 25.58  ? 129  ILE B CG1   1 
ATOM   5948  C CG2   . ILE B 1 129 ? -32.102 79.824  -4.458  1.00 24.93  ? 129  ILE B CG2   1 
ATOM   5949  C CD1   . ILE B 1 129 ? -31.486 77.593  -6.564  1.00 25.46  ? 129  ILE B CD1   1 
ATOM   5950  N N     . LYS B 1 130 ? -34.173 81.810  -6.068  1.00 26.70  ? 130  LYS B N     1 
ATOM   5951  C CA    . LYS B 1 130 ? -34.915 83.011  -5.718  1.00 27.52  ? 130  LYS B CA    1 
ATOM   5952  C C     . LYS B 1 130 ? -35.640 82.821  -4.389  1.00 27.00  ? 130  LYS B C     1 
ATOM   5953  O O     . LYS B 1 130 ? -35.734 81.706  -3.881  1.00 27.25  ? 130  LYS B O     1 
ATOM   5954  C CB    . LYS B 1 130 ? -35.902 83.384  -6.846  1.00 28.10  ? 130  LYS B CB    1 
ATOM   5955  C CG    . LYS B 1 130 ? -37.001 82.345  -7.086  1.00 28.55  ? 130  LYS B CG    1 
ATOM   5956  C CD    . LYS B 1 130 ? -37.859 82.664  -8.322  1.00 29.70  ? 130  LYS B CD    1 
ATOM   5957  C CE    . LYS B 1 130 ? -38.974 81.608  -8.485  1.00 31.49  ? 130  LYS B CE    1 
ATOM   5958  N NZ    . LYS B 1 130 ? -39.936 81.975  -9.578  1.00 36.06  ? 130  LYS B NZ    1 
ATOM   5959  N N     . LYS B 1 131 ? -36.141 83.917  -3.829  1.00 26.53  ? 131  LYS B N     1 
ATOM   5960  C CA    . LYS B 1 131 ? -36.924 83.883  -2.605  1.00 25.67  ? 131  LYS B CA    1 
ATOM   5961  C C     . LYS B 1 131 ? -38.016 82.826  -2.694  1.00 25.27  ? 131  LYS B C     1 
ATOM   5962  O O     . LYS B 1 131 ? -38.753 82.761  -3.684  1.00 25.06  ? 131  LYS B O     1 
ATOM   5963  C CB    . LYS B 1 131 ? -37.547 85.249  -2.349  1.00 25.71  ? 131  LYS B CB    1 
ATOM   5964  C CG    . LYS B 1 131 ? -38.201 85.377  -0.996  1.00 26.43  ? 131  LYS B CG    1 
ATOM   5965  C CD    . LYS B 1 131 ? -38.737 86.789  -0.784  1.00 26.48  ? 131  LYS B CD    1 
ATOM   5966  C CE    . LYS B 1 131 ? -39.668 86.819  0.404   1.00 25.91  ? 131  LYS B CE    1 
ATOM   5967  N NZ    . LYS B 1 131 ? -40.188 88.187  0.643   1.00 26.64  ? 131  LYS B NZ    1 
ATOM   5968  N N     . GLY B 1 132 ? -38.115 81.994  -1.662  1.00 24.46  ? 132  GLY B N     1 
ATOM   5969  C CA    . GLY B 1 132 ? -39.145 80.974  -1.634  1.00 24.03  ? 132  GLY B CA    1 
ATOM   5970  C C     . GLY B 1 132 ? -38.632 79.600  -2.022  1.00 23.77  ? 132  GLY B C     1 
ATOM   5971  O O     . GLY B 1 132 ? -39.174 78.603  -1.558  1.00 23.36  ? 132  GLY B O     1 
ATOM   5972  N N     . ASP B 1 133 ? -37.591 79.546  -2.862  1.00 23.21  ? 133  ASP B N     1 
ATOM   5973  C CA    . ASP B 1 133 ? -36.987 78.264  -3.261  1.00 22.96  ? 133  ASP B CA    1 
ATOM   5974  C C     . ASP B 1 133 ? -36.395 77.537  -2.063  1.00 22.69  ? 133  ASP B C     1 
ATOM   5975  O O     . ASP B 1 133 ? -35.786 78.165  -1.179  1.00 22.51  ? 133  ASP B O     1 
ATOM   5976  C CB    . ASP B 1 133 ? -35.864 78.458  -4.285  1.00 23.20  ? 133  ASP B CB    1 
ATOM   5977  C CG    . ASP B 1 133 ? -36.368 78.881  -5.656  1.00 24.27  ? 133  ASP B CG    1 
ATOM   5978  O OD1   . ASP B 1 133 ? -37.598 78.913  -5.889  1.00 25.36  ? 133  ASP B OD1   1 
ATOM   5979  O OD2   . ASP B 1 133 ? -35.514 79.177  -6.512  1.00 25.89  ? 133  ASP B OD2   1 
ATOM   5980  N N     . VAL B 1 134 ? -36.558 76.215  -2.066  1.00 21.97  ? 134  VAL B N     1 
ATOM   5981  C CA    . VAL B 1 134 ? -35.994 75.326  -1.052  1.00 21.66  ? 134  VAL B CA    1 
ATOM   5982  C C     . VAL B 1 134 ? -34.612 74.824  -1.508  1.00 21.69  ? 134  VAL B C     1 
ATOM   5983  O O     . VAL B 1 134 ? -34.458 74.285  -2.616  1.00 21.06  ? 134  VAL B O     1 
ATOM   5984  C CB    . VAL B 1 134 ? -36.930 74.124  -0.764  1.00 21.18  ? 134  VAL B CB    1 
ATOM   5985  C CG1   . VAL B 1 134 ? -36.262 73.107  0.168   1.00 22.05  ? 134  VAL B CG1   1 
ATOM   5986  C CG2   . VAL B 1 134 ? -38.253 74.597  -0.166  1.00 20.52  ? 134  VAL B CG2   1 
ATOM   5987  N N     . VAL B 1 135 ? -33.618 75.015  -0.646  1.00 21.07  ? 135  VAL B N     1 
ATOM   5988  C CA    . VAL B 1 135 ? -32.263 74.542  -0.910  1.00 20.81  ? 135  VAL B CA    1 
ATOM   5989  C C     . VAL B 1 135 ? -31.873 73.451  0.082   1.00 20.54  ? 135  VAL B C     1 
ATOM   5990  O O     . VAL B 1 135 ? -31.893 73.675  1.298   1.00 21.07  ? 135  VAL B O     1 
ATOM   5991  C CB    . VAL B 1 135 ? -31.231 75.697  -0.837  1.00 20.91  ? 135  VAL B CB    1 
ATOM   5992  C CG1   . VAL B 1 135 ? -29.819 75.168  -1.081  1.00 20.72  ? 135  VAL B CG1   1 
ATOM   5993  C CG2   . VAL B 1 135 ? -31.590 76.798  -1.854  1.00 20.52  ? 135  VAL B CG2   1 
ATOM   5994  N N     . ALA B 1 136 ? -31.519 72.279  -0.442  1.00 19.83  ? 136  ALA B N     1 
ATOM   5995  C CA    . ALA B 1 136 ? -31.068 71.162  0.393   1.00 19.20  ? 136  ALA B CA    1 
ATOM   5996  C C     . ALA B 1 136 ? -29.584 71.289  0.745   1.00 19.22  ? 136  ALA B C     1 
ATOM   5997  O O     . ALA B 1 136 ? -28.736 71.458  -0.132  1.00 18.60  ? 136  ALA B O     1 
ATOM   5998  C CB    . ALA B 1 136 ? -31.339 69.837  -0.292  1.00 18.44  ? 136  ALA B CB    1 
ATOM   5999  N N     . ILE B 1 137 ? -29.290 71.200  2.041   1.00 19.31  ? 137  ILE B N     1 
ATOM   6000  C CA    . ILE B 1 137 ? -27.922 71.263  2.541   1.00 19.22  ? 137  ILE B CA    1 
ATOM   6001  C C     . ILE B 1 137 ? -27.588 69.933  3.232   1.00 19.34  ? 137  ILE B C     1 
ATOM   6002  O O     . ILE B 1 137 ? -28.223 69.556  4.209   1.00 19.71  ? 137  ILE B O     1 
ATOM   6003  C CB    . ILE B 1 137 ? -27.713 72.503  3.452   1.00 18.99  ? 137  ILE B CB    1 
ATOM   6004  C CG1   . ILE B 1 137 ? -28.121 73.774  2.687   1.00 18.36  ? 137  ILE B CG1   1 
ATOM   6005  C CG2   . ILE B 1 137 ? -26.258 72.614  3.885   1.00 18.50  ? 137  ILE B CG2   1 
ATOM   6006  C CD1   . ILE B 1 137 ? -27.974 75.071  3.456   1.00 18.95  ? 137  ILE B CD1   1 
ATOM   6007  N N     . TYR B 1 138 ? -26.616 69.219  2.670   1.00 19.94  ? 138  TYR B N     1 
ATOM   6008  C CA    . TYR B 1 138 ? -26.188 67.897  3.124   1.00 20.28  ? 138  TYR B CA    1 
ATOM   6009  C C     . TYR B 1 138 ? -24.687 67.962  3.335   1.00 21.03  ? 138  TYR B C     1 
ATOM   6010  O O     . TYR B 1 138 ? -23.901 67.559  2.469   1.00 20.70  ? 138  TYR B O     1 
ATOM   6011  C CB    . TYR B 1 138 ? -26.549 66.861  2.061   1.00 20.01  ? 138  TYR B CB    1 
ATOM   6012  C CG    . TYR B 1 138 ? -26.306 65.398  2.396   1.00 19.43  ? 138  TYR B CG    1 
ATOM   6013  C CD1   . TYR B 1 138 ? -26.891 64.786  3.513   1.00 18.50  ? 138  TYR B CD1   1 
ATOM   6014  C CD2   . TYR B 1 138 ? -25.546 64.615  1.548   1.00 18.85  ? 138  TYR B CD2   1 
ATOM   6015  C CE1   . TYR B 1 138 ? -26.693 63.420  3.776   1.00 19.07  ? 138  TYR B CE1   1 
ATOM   6016  C CE2   . TYR B 1 138 ? -25.331 63.263  1.793   1.00 19.87  ? 138  TYR B CE2   1 
ATOM   6017  C CZ    . TYR B 1 138 ? -25.896 62.670  2.904   1.00 19.57  ? 138  TYR B CZ    1 
ATOM   6018  O OH    . TYR B 1 138 ? -25.668 61.335  3.103   1.00 18.54  ? 138  TYR B OH    1 
ATOM   6019  N N     . MET B 1 139 ? -24.308 68.468  4.507   1.00 22.01  ? 139  MET B N     1 
ATOM   6020  C CA    . MET B 1 139 ? -22.958 68.956  4.772   1.00 23.30  ? 139  MET B CA    1 
ATOM   6021  C C     . MET B 1 139 ? -22.392 68.447  6.093   1.00 23.84  ? 139  MET B C     1 
ATOM   6022  O O     . MET B 1 139 ? -23.147 68.163  7.031   1.00 23.99  ? 139  MET B O     1 
ATOM   6023  C CB    . MET B 1 139 ? -22.954 70.489  4.814   1.00 23.72  ? 139  MET B CB    1 
ATOM   6024  C CG    . MET B 1 139 ? -23.131 71.184  3.469   1.00 25.60  ? 139  MET B CG    1 
ATOM   6025  S SD    . MET B 1 139 ? -21.657 71.157  2.449   1.00 30.39  ? 139  MET B SD    1 
ATOM   6026  C CE    . MET B 1 139 ? -20.824 72.661  2.992   1.00 27.48  ? 139  MET B CE    1 
ATOM   6027  N N     . PRO B 1 140 ? -21.050 68.340  6.176   1.00 24.05  ? 140  PRO B N     1 
ATOM   6028  C CA    . PRO B 1 140 ? -20.467 67.980  7.450   1.00 24.12  ? 140  PRO B CA    1 
ATOM   6029  C C     . PRO B 1 140 ? -20.271 69.239  8.279   1.00 24.40  ? 140  PRO B C     1 
ATOM   6030  O O     . PRO B 1 140 ? -20.638 70.342  7.835   1.00 24.67  ? 140  PRO B O     1 
ATOM   6031  C CB    . PRO B 1 140 ? -19.127 67.357  7.053   1.00 23.85  ? 140  PRO B CB    1 
ATOM   6032  C CG    . PRO B 1 140 ? -18.737 68.050  5.794   1.00 24.17  ? 140  PRO B CG    1 
ATOM   6033  C CD    . PRO B 1 140 ? -20.023 68.530  5.127   1.00 24.16  ? 140  PRO B CD    1 
ATOM   6034  N N     . MET B 1 141 ? -19.686 69.078  9.460   1.00 24.16  ? 141  MET B N     1 
ATOM   6035  C CA    . MET B 1 141 ? -19.474 70.184  10.370  1.00 23.91  ? 141  MET B CA    1 
ATOM   6036  C C     . MET B 1 141 ? -18.232 70.984  9.979   1.00 24.02  ? 141  MET B C     1 
ATOM   6037  O O     . MET B 1 141 ? -17.174 70.910  10.621  1.00 23.96  ? 141  MET B O     1 
ATOM   6038  C CB    . MET B 1 141 ? -19.439 69.672  11.815  1.00 24.17  ? 141  MET B CB    1 
ATOM   6039  C CG    . MET B 1 141 ? -20.843 69.343  12.359  1.00 23.94  ? 141  MET B CG    1 
ATOM   6040  S SD    . MET B 1 141 ? -21.730 70.850  12.833  1.00 25.71  ? 141  MET B SD    1 
ATOM   6041  C CE    . MET B 1 141 ? -21.117 71.019  14.514  1.00 23.01  ? 141  MET B CE    1 
ATOM   6042  N N     . VAL B 1 142 ? -18.395 71.746  8.897   1.00 24.05  ? 142  VAL B N     1 
ATOM   6043  C CA    . VAL B 1 142 ? -17.399 72.679  8.376   1.00 23.44  ? 142  VAL B CA    1 
ATOM   6044  C C     . VAL B 1 142 ? -18.035 74.068  8.219   1.00 23.22  ? 142  VAL B C     1 
ATOM   6045  O O     . VAL B 1 142 ? -19.248 74.180  8.012   1.00 22.91  ? 142  VAL B O     1 
ATOM   6046  C CB    . VAL B 1 142 ? -16.808 72.200  7.007   1.00 23.88  ? 142  VAL B CB    1 
ATOM   6047  C CG1   . VAL B 1 142 ? -16.012 70.916  7.191   1.00 24.39  ? 142  VAL B CG1   1 
ATOM   6048  C CG2   . VAL B 1 142 ? -17.911 72.023  5.943   1.00 22.70  ? 142  VAL B CG2   1 
ATOM   6049  N N     . PRO B 1 143 ? -17.220 75.140  8.302   1.00 23.47  ? 143  PRO B N     1 
ATOM   6050  C CA    . PRO B 1 143 ? -17.793 76.495  8.302   1.00 23.19  ? 143  PRO B CA    1 
ATOM   6051  C C     . PRO B 1 143 ? -18.626 76.810  7.055   1.00 23.07  ? 143  PRO B C     1 
ATOM   6052  O O     . PRO B 1 143 ? -19.553 77.618  7.125   1.00 23.04  ? 143  PRO B O     1 
ATOM   6053  C CB    . PRO B 1 143 ? -16.557 77.400  8.365   1.00 23.64  ? 143  PRO B CB    1 
ATOM   6054  C CG    . PRO B 1 143 ? -15.459 76.520  8.894   1.00 23.81  ? 143  PRO B CG    1 
ATOM   6055  C CD    . PRO B 1 143 ? -15.748 75.161  8.379   1.00 23.07  ? 143  PRO B CD    1 
ATOM   6056  N N     . GLU B 1 144 ? -18.313 76.158  5.934   1.00 22.80  ? 144  GLU B N     1 
ATOM   6057  C CA    . GLU B 1 144 ? -19.055 76.344  4.679   1.00 22.77  ? 144  GLU B CA    1 
ATOM   6058  C C     . GLU B 1 144 ? -20.543 75.965  4.771   1.00 22.54  ? 144  GLU B C     1 
ATOM   6059  O O     . GLU B 1 144 ? -21.366 76.513  4.037   1.00 22.56  ? 144  GLU B O     1 
ATOM   6060  C CB    . GLU B 1 144 ? -18.382 75.600  3.516   1.00 22.91  ? 144  GLU B CB    1 
ATOM   6061  C CG    . GLU B 1 144 ? -17.025 76.169  3.086   1.00 22.76  ? 144  GLU B CG    1 
ATOM   6062  C CD    . GLU B 1 144 ? -15.846 75.605  3.875   1.00 23.81  ? 144  GLU B CD    1 
ATOM   6063  O OE1   . GLU B 1 144 ? -16.048 74.797  4.814   1.00 23.18  ? 144  GLU B OE1   1 
ATOM   6064  O OE2   . GLU B 1 144 ? -14.696 75.958  3.530   1.00 26.55  ? 144  GLU B OE2   1 
ATOM   6065  N N     . ALA B 1 145 ? -20.889 75.042  5.670   1.00 22.36  ? 145  ALA B N     1 
ATOM   6066  C CA    . ALA B 1 145 ? -22.297 74.723  5.931   1.00 22.07  ? 145  ALA B CA    1 
ATOM   6067  C C     . ALA B 1 145 ? -23.024 75.934  6.511   1.00 21.99  ? 145  ALA B C     1 
ATOM   6068  O O     . ALA B 1 145 ? -24.165 76.213  6.124   1.00 22.49  ? 145  ALA B O     1 
ATOM   6069  C CB    . ALA B 1 145 ? -22.431 73.520  6.855   1.00 22.16  ? 145  ALA B CB    1 
ATOM   6070  N N     . ALA B 1 146 ? -22.360 76.653  7.427   1.00 21.22  ? 146  ALA B N     1 
ATOM   6071  C CA    . ALA B 1 146 ? -22.894 77.895  7.989   1.00 20.58  ? 146  ALA B CA    1 
ATOM   6072  C C     . ALA B 1 146 ? -23.039 78.968  6.913   1.00 20.32  ? 146  ALA B C     1 
ATOM   6073  O O     . ALA B 1 146 ? -24.042 79.682  6.879   1.00 20.63  ? 146  ALA B O     1 
ATOM   6074  C CB    . ALA B 1 146 ? -22.010 78.403  9.143   1.00 20.00  ? 146  ALA B CB    1 
ATOM   6075  N N     . VAL B 1 147 ? -22.038 79.073  6.038   1.00 20.22  ? 147  VAL B N     1 
ATOM   6076  C CA    . VAL B 1 147 ? -22.071 80.022  4.915   1.00 20.02  ? 147  VAL B CA    1 
ATOM   6077  C C     . VAL B 1 147 ? -23.280 79.749  4.008   1.00 20.53  ? 147  VAL B C     1 
ATOM   6078  O O     . VAL B 1 147 ? -24.009 80.677  3.642   1.00 21.23  ? 147  VAL B O     1 
ATOM   6079  C CB    . VAL B 1 147 ? -20.770 79.963  4.068   1.00 19.69  ? 147  VAL B CB    1 
ATOM   6080  C CG1   . VAL B 1 147 ? -20.875 80.872  2.845   1.00 19.15  ? 147  VAL B CG1   1 
ATOM   6081  C CG2   . VAL B 1 147 ? -19.546 80.340  4.909   1.00 19.25  ? 147  VAL B CG2   1 
ATOM   6082  N N     . ALA B 1 148 ? -23.472 78.483  3.632   1.00 20.28  ? 148  ALA B N     1 
ATOM   6083  C CA    . ALA B 1 148 ? -24.605 78.090  2.794   1.00 20.69  ? 148  ALA B CA    1 
ATOM   6084  C C     . ALA B 1 148 ? -25.933 78.458  3.466   1.00 20.90  ? 148  ALA B C     1 
ATOM   6085  O O     . ALA B 1 148 ? -26.831 79.023  2.820   1.00 21.42  ? 148  ALA B O     1 
ATOM   6086  C CB    . ALA B 1 148 ? -24.548 76.585  2.481   1.00 19.69  ? 148  ALA B CB    1 
ATOM   6087  N N     . MET B 1 149 ? -26.042 78.149  4.760   1.00 21.08  ? 149  MET B N     1 
ATOM   6088  C CA    . MET B 1 149 ? -27.241 78.473  5.544   1.00 21.28  ? 149  MET B CA    1 
ATOM   6089  C C     . MET B 1 149 ? -27.523 79.975  5.604   1.00 20.64  ? 149  MET B C     1 
ATOM   6090  O O     . MET B 1 149 ? -28.647 80.402  5.351   1.00 20.04  ? 149  MET B O     1 
ATOM   6091  C CB    . MET B 1 149 ? -27.158 77.888  6.956   1.00 20.95  ? 149  MET B CB    1 
ATOM   6092  C CG    . MET B 1 149 ? -27.299 76.369  6.985   1.00 21.45  ? 149  MET B CG    1 
ATOM   6093  S SD    . MET B 1 149 ? -26.873 75.670  8.574   1.00 23.12  ? 149  MET B SD    1 
ATOM   6094  C CE    . MET B 1 149 ? -28.287 76.131  9.592   1.00 22.67  ? 149  MET B CE    1 
ATOM   6095  N N     . LEU B 1 150 ? -26.510 80.764  5.949   1.00 20.26  ? 150  LEU B N     1 
ATOM   6096  C CA    . LEU B 1 150 ? -26.679 82.219  6.051   1.00 20.51  ? 150  LEU B CA    1 
ATOM   6097  C C     . LEU B 1 150 ? -27.019 82.873  4.704   1.00 20.27  ? 150  LEU B C     1 
ATOM   6098  O O     . LEU B 1 150 ? -27.816 83.814  4.651   1.00 20.03  ? 150  LEU B O     1 
ATOM   6099  C CB    . LEU B 1 150 ? -25.433 82.878  6.665   1.00 20.06  ? 150  LEU B CB    1 
ATOM   6100  C CG    . LEU B 1 150 ? -25.219 82.594  8.158   1.00 21.04  ? 150  LEU B CG    1 
ATOM   6101  C CD1   . LEU B 1 150 ? -23.766 82.832  8.588   1.00 20.18  ? 150  LEU B CD1   1 
ATOM   6102  C CD2   . LEU B 1 150 ? -26.202 83.399  9.024   1.00 19.23  ? 150  LEU B CD2   1 
ATOM   6103  N N     . ALA B 1 151 ? -26.390 82.382  3.636   1.00 20.37  ? 151  ALA B N     1 
ATOM   6104  C CA    . ALA B 1 151 ? -26.585 82.919  2.289   1.00 20.69  ? 151  ALA B CA    1 
ATOM   6105  C C     . ALA B 1 151 ? -28.007 82.654  1.783   1.00 20.89  ? 151  ALA B C     1 
ATOM   6106  O O     . ALA B 1 151 ? -28.591 83.517  1.138   1.00 20.98  ? 151  ALA B O     1 
ATOM   6107  C CB    . ALA B 1 151 ? -25.555 82.348  1.327   1.00 20.57  ? 151  ALA B CB    1 
ATOM   6108  N N     . CYS B 1 152 ? -28.551 81.469  2.081   1.00 20.71  ? 152  CYS B N     1 
ATOM   6109  C CA    . CYS B 1 152 ? -29.970 81.166  1.810   1.00 20.80  ? 152  CYS B CA    1 
ATOM   6110  C C     . CYS B 1 152 ? -30.913 82.142  2.521   1.00 20.62  ? 152  CYS B C     1 
ATOM   6111  O O     . CYS B 1 152 ? -31.833 82.690  1.909   1.00 19.72  ? 152  CYS B O     1 
ATOM   6112  C CB    . CYS B 1 152 ? -30.317 79.748  2.246   1.00 20.91  ? 152  CYS B CB    1 
ATOM   6113  S SG    . CYS B 1 152 ? -29.669 78.443  1.187   1.00 22.76  ? 152  CYS B SG    1 
ATOM   6114  N N     . ALA B 1 153 ? -30.675 82.347  3.819   1.00 20.38  ? 153  ALA B N     1 
ATOM   6115  C CA    . ALA B 1 153 ? -31.498 83.243  4.625   1.00 20.22  ? 153  ALA B CA    1 
ATOM   6116  C C     . ALA B 1 153 ? -31.397 84.687  4.105   1.00 20.16  ? 153  ALA B C     1 
ATOM   6117  O O     . ALA B 1 153 ? -32.386 85.428  4.088   1.00 20.21  ? 153  ALA B O     1 
ATOM   6118  C CB    . ALA B 1 153 ? -31.082 83.165  6.088   1.00 19.89  ? 153  ALA B CB    1 
ATOM   6119  N N     . ARG B 1 154 ? -30.198 85.064  3.679   1.00 20.11  ? 154  ARG B N     1 
ATOM   6120  C CA    . ARG B 1 154 ? -29.941 86.395  3.130   1.00 20.65  ? 154  ARG B CA    1 
ATOM   6121  C C     . ARG B 1 154 ? -30.831 86.754  1.935   1.00 20.58  ? 154  ARG B C     1 
ATOM   6122  O O     . ARG B 1 154 ? -31.326 87.883  1.854   1.00 19.92  ? 154  ARG B O     1 
ATOM   6123  C CB    . ARG B 1 154 ? -28.458 86.561  2.769   1.00 20.69  ? 154  ARG B CB    1 
ATOM   6124  C CG    . ARG B 1 154 ? -28.034 88.013  2.675   1.00 21.57  ? 154  ARG B CG    1 
ATOM   6125  C CD    . ARG B 1 154 ? -26.567 88.155  2.283   1.00 23.13  ? 154  ARG B CD    1 
ATOM   6126  N NE    . ARG B 1 154 ? -26.193 89.560  2.123   1.00 24.11  ? 154  ARG B NE    1 
ATOM   6127  C CZ    . ARG B 1 154 ? -25.745 90.336  3.105   1.00 24.40  ? 154  ARG B CZ    1 
ATOM   6128  N NH1   . ARG B 1 154 ? -25.614 89.846  4.331   1.00 23.80  ? 154  ARG B NH1   1 
ATOM   6129  N NH2   . ARG B 1 154 ? -25.430 91.605  2.860   1.00 23.52  ? 154  ARG B NH2   1 
ATOM   6130  N N     . ILE B 1 155 ? -31.040 85.796  1.027   1.00 20.85  ? 155  ILE B N     1 
ATOM   6131  C CA    . ILE B 1 155 ? -31.852 86.028  -0.187  1.00 20.93  ? 155  ILE B CA    1 
ATOM   6132  C C     . ILE B 1 155 ? -33.300 85.545  -0.025  1.00 21.08  ? 155  ILE B C     1 
ATOM   6133  O O     . ILE B 1 155 ? -34.105 85.609  -0.961  1.00 21.21  ? 155  ILE B O     1 
ATOM   6134  C CB    . ILE B 1 155 ? -31.216 85.371  -1.455  1.00 21.24  ? 155  ILE B CB    1 
ATOM   6135  C CG1   . ILE B 1 155 ? -31.223 83.834  -1.351  1.00 21.44  ? 155  ILE B CG1   1 
ATOM   6136  C CG2   . ILE B 1 155 ? -29.804 85.918  -1.702  1.00 21.16  ? 155  ILE B CG2   1 
ATOM   6137  C CD1   . ILE B 1 155 ? -30.911 83.100  -2.658  1.00 20.67  ? 155  ILE B CD1   1 
ATOM   6138  N N     . GLY B 1 156 ? -33.620 85.045  1.161   1.00 20.90  ? 156  GLY B N     1 
ATOM   6139  C CA    . GLY B 1 156 ? -34.947 84.513  1.433   1.00 21.30  ? 156  GLY B CA    1 
ATOM   6140  C C     . GLY B 1 156 ? -35.248 83.160  0.816   1.00 21.56  ? 156  GLY B C     1 
ATOM   6141  O O     . GLY B 1 156 ? -36.417 82.788  0.682   1.00 21.93  ? 156  GLY B O     1 
ATOM   6142  N N     . ALA B 1 157 ? -34.205 82.433  0.420   1.00 21.73  ? 157  ALA B N     1 
ATOM   6143  C CA    . ALA B 1 157 ? -34.345 81.024  0.040   1.00 22.16  ? 157  ALA B CA    1 
ATOM   6144  C C     . ALA B 1 157 ? -34.577 80.236  1.324   1.00 22.52  ? 157  ALA B C     1 
ATOM   6145  O O     . ALA B 1 157 ? -34.158 80.663  2.399   1.00 23.64  ? 157  ALA B O     1 
ATOM   6146  C CB    . ALA B 1 157 ? -33.095 80.525  -0.687  1.00 21.17  ? 157  ALA B CB    1 
ATOM   6147  N N     . VAL B 1 158 ? -35.266 79.110  1.228   1.00 22.79  ? 158  VAL B N     1 
ATOM   6148  C CA    . VAL B 1 158 ? -35.588 78.325  2.413   1.00 22.83  ? 158  VAL B CA    1 
ATOM   6149  C C     . VAL B 1 158 ? -34.663 77.101  2.471   1.00 22.79  ? 158  VAL B C     1 
ATOM   6150  O O     . VAL B 1 158 ? -34.767 76.204  1.645   1.00 23.06  ? 158  VAL B O     1 
ATOM   6151  C CB    . VAL B 1 158 ? -37.068 77.875  2.392   1.00 22.98  ? 158  VAL B CB    1 
ATOM   6152  C CG1   . VAL B 1 158 ? -37.403 77.033  3.629   1.00 22.22  ? 158  VAL B CG1   1 
ATOM   6153  C CG2   . VAL B 1 158 ? -37.999 79.081  2.282   1.00 22.33  ? 158  VAL B CG2   1 
ATOM   6154  N N     . HIS B 1 159 ? -33.747 77.070  3.430   1.00 22.57  ? 159  HIS B N     1 
ATOM   6155  C CA    . HIS B 1 159 ? -32.869 75.913  3.525   1.00 22.02  ? 159  HIS B CA    1 
ATOM   6156  C C     . HIS B 1 159 ? -33.550 74.739  4.207   1.00 22.29  ? 159  HIS B C     1 
ATOM   6157  O O     . HIS B 1 159 ? -34.403 74.909  5.086   1.00 21.95  ? 159  HIS B O     1 
ATOM   6158  C CB    . HIS B 1 159 ? -31.485 76.225  4.133   1.00 21.46  ? 159  HIS B CB    1 
ATOM   6159  C CG    . HIS B 1 159 ? -31.496 76.693  5.566   1.00 21.04  ? 159  HIS B CG    1 
ATOM   6160  N ND1   . HIS B 1 159 ? -31.805 75.867  6.627   1.00 21.30  ? 159  HIS B ND1   1 
ATOM   6161  C CD2   . HIS B 1 159 ? -31.150 77.884  6.110   1.00 20.41  ? 159  HIS B CD2   1 
ATOM   6162  C CE1   . HIS B 1 159 ? -31.674 76.538  7.760   1.00 22.12  ? 159  HIS B CE1   1 
ATOM   6163  N NE2   . HIS B 1 159 ? -31.294 77.771  7.473   1.00 21.16  ? 159  HIS B NE2   1 
ATOM   6164  N N     . SER B 1 160 ? -33.172 73.549  3.759   1.00 22.34  ? 160  SER B N     1 
ATOM   6165  C CA    . SER B 1 160 ? -33.565 72.324  4.394   1.00 22.34  ? 160  SER B CA    1 
ATOM   6166  C C     . SER B 1 160 ? -32.298 71.496  4.591   1.00 22.62  ? 160  SER B C     1 
ATOM   6167  O O     . SER B 1 160 ? -31.822 70.804  3.666   1.00 23.21  ? 160  SER B O     1 
ATOM   6168  C CB    . SER B 1 160 ? -34.607 71.597  3.550   1.00 22.27  ? 160  SER B CB    1 
ATOM   6169  O OG    . SER B 1 160 ? -34.932 70.377  4.173   1.00 24.08  ? 160  SER B OG    1 
ATOM   6170  N N     . VAL B 1 161 ? -31.748 71.597  5.798   1.00 21.94  ? 161  VAL B N     1 
ATOM   6171  C CA    . VAL B 1 161 ? -30.527 70.917  6.150   1.00 22.60  ? 161  VAL B CA    1 
ATOM   6172  C C     . VAL B 1 161 ? -30.815 69.427  6.449   1.00 22.64  ? 161  VAL B C     1 
ATOM   6173  O O     . VAL B 1 161 ? -31.666 69.096  7.277   1.00 23.17  ? 161  VAL B O     1 
ATOM   6174  C CB    . VAL B 1 161 ? -29.798 71.649  7.327   1.00 22.54  ? 161  VAL B CB    1 
ATOM   6175  C CG1   . VAL B 1 161 ? -28.482 70.971  7.696   1.00 22.55  ? 161  VAL B CG1   1 
ATOM   6176  C CG2   . VAL B 1 161 ? -29.536 73.119  6.953   1.00 21.96  ? 161  VAL B CG2   1 
ATOM   6177  N N     . ILE B 1 162 ? -30.121 68.554  5.726   1.00 22.44  ? 162  ILE B N     1 
ATOM   6178  C CA    . ILE B 1 162 ? -30.202 67.108  5.898   1.00 21.76  ? 162  ILE B CA    1 
ATOM   6179  C C     . ILE B 1 162 ? -28.945 66.615  6.625   1.00 22.42  ? 162  ILE B C     1 
ATOM   6180  O O     . ILE B 1 162 ? -27.823 66.740  6.109   1.00 22.81  ? 162  ILE B O     1 
ATOM   6181  C CB    . ILE B 1 162 ? -30.351 66.413  4.538   1.00 21.73  ? 162  ILE B CB    1 
ATOM   6182  C CG1   . ILE B 1 162 ? -31.576 66.984  3.797   1.00 20.42  ? 162  ILE B CG1   1 
ATOM   6183  C CG2   . ILE B 1 162 ? -30.448 64.890  4.713   1.00 21.39  ? 162  ILE B CG2   1 
ATOM   6184  C CD1   . ILE B 1 162 ? -31.659 66.622  2.314   1.00 21.02  ? 162  ILE B CD1   1 
ATOM   6185  N N     . PHE B 1 163 ? -29.138 66.103  7.840   1.00 21.97  ? 163  PHE B N     1 
ATOM   6186  C CA    . PHE B 1 163 ? -28.067 65.479  8.631   1.00 21.62  ? 163  PHE B CA    1 
ATOM   6187  C C     . PHE B 1 163 ? -27.237 64.563  7.753   1.00 21.32  ? 163  PHE B C     1 
ATOM   6188  O O     . PHE B 1 163 ? -27.790 63.703  7.047   1.00 21.48  ? 163  PHE B O     1 
ATOM   6189  C CB    . PHE B 1 163 ? -28.689 64.681  9.788   1.00 21.52  ? 163  PHE B CB    1 
ATOM   6190  C CG    . PHE B 1 163 ? -27.687 63.908  10.630  1.00 21.67  ? 163  PHE B CG    1 
ATOM   6191  C CD1   . PHE B 1 163 ? -26.673 64.565  11.323  1.00 21.17  ? 163  PHE B CD1   1 
ATOM   6192  C CD2   . PHE B 1 163 ? -27.793 62.513  10.749  1.00 21.23  ? 163  PHE B CD2   1 
ATOM   6193  C CE1   . PHE B 1 163 ? -25.754 63.839  12.117  1.00 23.37  ? 163  PHE B CE1   1 
ATOM   6194  C CE2   . PHE B 1 163 ? -26.899 61.777  11.556  1.00 20.73  ? 163  PHE B CE2   1 
ATOM   6195  C CZ    . PHE B 1 163 ? -25.875 62.441  12.235  1.00 21.57  ? 163  PHE B CZ    1 
ATOM   6196  N N     . GLY B 1 164 ? -25.918 64.743  7.802   1.00 20.89  ? 164  GLY B N     1 
ATOM   6197  C CA    . GLY B 1 164 ? -24.987 63.999  6.954   1.00 21.07  ? 164  GLY B CA    1 
ATOM   6198  C C     . GLY B 1 164 ? -24.919 62.496  7.199   1.00 21.45  ? 164  GLY B C     1 
ATOM   6199  O O     . GLY B 1 164 ? -24.320 61.777  6.413   1.00 22.37  ? 164  GLY B O     1 
ATOM   6200  N N     . GLY B 1 165 ? -25.526 62.023  8.285   1.00 21.24  ? 165  GLY B N     1 
ATOM   6201  C CA    . GLY B 1 165 ? -25.572 60.591  8.601   1.00 20.76  ? 165  GLY B CA    1 
ATOM   6202  C C     . GLY B 1 165 ? -26.780 59.871  8.004   1.00 20.64  ? 165  GLY B C     1 
ATOM   6203  O O     . GLY B 1 165 ? -26.932 58.658  8.189   1.00 20.17  ? 165  GLY B O     1 
ATOM   6204  N N     . PHE B 1 166 ? -27.635 60.613  7.293   1.00 20.00  ? 166  PHE B N     1 
ATOM   6205  C CA    . PHE B 1 166 ? -28.737 60.012  6.531   1.00 19.96  ? 166  PHE B CA    1 
ATOM   6206  C C     . PHE B 1 166 ? -28.253 59.388  5.233   1.00 20.17  ? 166  PHE B C     1 
ATOM   6207  O O     . PHE B 1 166 ? -27.360 59.923  4.559   1.00 19.53  ? 166  PHE B O     1 
ATOM   6208  C CB    . PHE B 1 166 ? -29.836 61.032  6.211   1.00 19.70  ? 166  PHE B CB    1 
ATOM   6209  C CG    . PHE B 1 166 ? -30.797 61.274  7.346   1.00 20.46  ? 166  PHE B CG    1 
ATOM   6210  C CD1   . PHE B 1 166 ? -30.978 62.559  7.860   1.00 20.58  ? 166  PHE B CD1   1 
ATOM   6211  C CD2   . PHE B 1 166 ? -31.527 60.216  7.897   1.00 20.43  ? 166  PHE B CD2   1 
ATOM   6212  C CE1   . PHE B 1 166 ? -31.884 62.791  8.902   1.00 21.47  ? 166  PHE B CE1   1 
ATOM   6213  C CE2   . PHE B 1 166 ? -32.429 60.425  8.935   1.00 21.70  ? 166  PHE B CE2   1 
ATOM   6214  C CZ    . PHE B 1 166 ? -32.612 61.714  9.443   1.00 21.39  ? 166  PHE B CZ    1 
ATOM   6215  N N     . SER B 1 167 ? -28.882 58.272  4.883   1.00 19.79  ? 167  SER B N     1 
ATOM   6216  C CA    . SER B 1 167 ? -28.534 57.494  3.724   1.00 20.05  ? 167  SER B CA    1 
ATOM   6217  C C     . SER B 1 167 ? -29.117 58.115  2.438   1.00 20.31  ? 167  SER B C     1 
ATOM   6218  O O     . SER B 1 167 ? -29.985 58.976  2.515   1.00 20.51  ? 167  SER B O     1 
ATOM   6219  C CB    . SER B 1 167 ? -29.075 56.074  3.919   1.00 20.41  ? 167  SER B CB    1 
ATOM   6220  O OG    . SER B 1 167 ? -30.482 56.026  3.667   1.00 21.02  ? 167  SER B OG    1 
ATOM   6221  N N     . PRO B 1 168 ? -28.638 57.682  1.253   1.00 20.03  ? 168  PRO B N     1 
ATOM   6222  C CA    . PRO B 1 168 ? -29.221 58.170  -0.007  1.00 20.07  ? 168  PRO B CA    1 
ATOM   6223  C C     . PRO B 1 168 ? -30.754 58.107  -0.082  1.00 20.41  ? 168  PRO B C     1 
ATOM   6224  O O     . PRO B 1 168 ? -31.393 59.031  -0.604  1.00 20.50  ? 168  PRO B O     1 
ATOM   6225  C CB    . PRO B 1 168 ? -28.605 57.246  -1.062  1.00 20.02  ? 168  PRO B CB    1 
ATOM   6226  C CG    . PRO B 1 168 ? -27.287 56.814  -0.469  1.00 20.25  ? 168  PRO B CG    1 
ATOM   6227  C CD    . PRO B 1 168 ? -27.499 56.764  1.027   1.00 19.91  ? 168  PRO B CD    1 
ATOM   6228  N N     . GLU B 1 169 ? -31.341 57.022  0.411   1.00 20.37  ? 169  GLU B N     1 
ATOM   6229  C CA    . GLU B 1 169 ? -32.792 56.872  0.363   1.00 21.05  ? 169  GLU B CA    1 
ATOM   6230  C C     . GLU B 1 169 ? -33.489 57.998  1.137   1.00 20.52  ? 169  GLU B C     1 
ATOM   6231  O O     . GLU B 1 169 ? -34.456 58.575  0.644   1.00 20.33  ? 169  GLU B O     1 
ATOM   6232  C CB    . GLU B 1 169 ? -33.210 55.495  0.894   1.00 21.30  ? 169  GLU B CB    1 
ATOM   6233  C CG    . GLU B 1 169 ? -34.698 55.254  0.839   1.00 24.25  ? 169  GLU B CG    1 
ATOM   6234  C CD    . GLU B 1 169 ? -35.234 55.178  -0.590  1.00 28.74  ? 169  GLU B CD    1 
ATOM   6235  O OE1   . GLU B 1 169 ? -34.526 54.651  -1.491  1.00 30.51  ? 169  GLU B OE1   1 
ATOM   6236  O OE2   . GLU B 1 169 ? -36.368 55.650  -0.810  1.00 30.22  ? 169  GLU B OE2   1 
ATOM   6237  N N     . ALA B 1 170 ? -32.980 58.295  2.335   1.00 19.91  ? 170  ALA B N     1 
ATOM   6238  C CA    . ALA B 1 170 ? -33.498 59.356  3.197   1.00 20.26  ? 170  ALA B CA    1 
ATOM   6239  C C     . ALA B 1 170 ? -33.267 60.739  2.596   1.00 20.41  ? 170  ALA B C     1 
ATOM   6240  O O     . ALA B 1 170 ? -34.152 61.591  2.643   1.00 19.67  ? 170  ALA B O     1 
ATOM   6241  C CB    . ALA B 1 170 ? -32.860 59.281  4.591   1.00 20.13  ? 170  ALA B CB    1 
ATOM   6242  N N     . VAL B 1 171 ? -32.068 60.958  2.047   1.00 20.64  ? 171  VAL B N     1 
ATOM   6243  C CA    . VAL B 1 171 ? -31.768 62.195  1.318   1.00 20.83  ? 171  VAL B CA    1 
ATOM   6244  C C     . VAL B 1 171 ? -32.793 62.414  0.196   1.00 21.17  ? 171  VAL B C     1 
ATOM   6245  O O     . VAL B 1 171 ? -33.401 63.493  0.108   1.00 21.32  ? 171  VAL B O     1 
ATOM   6246  C CB    . VAL B 1 171 ? -30.322 62.203  0.739   1.00 21.02  ? 171  VAL B CB    1 
ATOM   6247  C CG1   . VAL B 1 171 ? -30.089 63.455  -0.124  1.00 21.37  ? 171  VAL B CG1   1 
ATOM   6248  C CG2   . VAL B 1 171 ? -29.310 62.158  1.857   1.00 19.44  ? 171  VAL B CG2   1 
ATOM   6249  N N     . ALA B 1 172 ? -33.003 61.380  -0.623  1.00 21.26  ? 172  ALA B N     1 
ATOM   6250  C CA    . ALA B 1 172 ? -33.954 61.429  -1.737  1.00 22.07  ? 172  ALA B CA    1 
ATOM   6251  C C     . ALA B 1 172 ? -35.350 61.852  -1.297  1.00 22.29  ? 172  ALA B C     1 
ATOM   6252  O O     . ALA B 1 172 ? -35.940 62.763  -1.887  1.00 22.67  ? 172  ALA B O     1 
ATOM   6253  C CB    . ALA B 1 172 ? -34.025 60.074  -2.465  1.00 21.60  ? 172  ALA B CB    1 
ATOM   6254  N N     . GLY B 1 173 ? -35.874 61.176  -0.275  1.00 22.35  ? 173  GLY B N     1 
ATOM   6255  C CA    . GLY B 1 173 ? -37.221 61.439  0.242   1.00 22.28  ? 173  GLY B CA    1 
ATOM   6256  C C     . GLY B 1 173 ? -37.420 62.869  0.696   1.00 22.27  ? 173  GLY B C     1 
ATOM   6257  O O     . GLY B 1 173 ? -38.471 63.454  0.462   1.00 21.85  ? 173  GLY B O     1 
ATOM   6258  N N     . ARG B 1 174 ? -36.404 63.423  1.356   1.00 22.57  ? 174  ARG B N     1 
ATOM   6259  C CA    . ARG B 1 174 ? -36.415 64.816  1.792   1.00 22.62  ? 174  ARG B CA    1 
ATOM   6260  C C     . ARG B 1 174 ? -36.355 65.769  0.605   1.00 22.86  ? 174  ARG B C     1 
ATOM   6261  O O     . ARG B 1 174 ? -37.067 66.770  0.588   1.00 23.34  ? 174  ARG B O     1 
ATOM   6262  C CB    . ARG B 1 174 ? -35.275 65.086  2.782   1.00 22.47  ? 174  ARG B CB    1 
ATOM   6263  C CG    . ARG B 1 174 ? -35.560 64.523  4.173   1.00 21.86  ? 174  ARG B CG    1 
ATOM   6264  C CD    . ARG B 1 174 ? -34.300 64.394  5.034   1.00 21.60  ? 174  ARG B CD    1 
ATOM   6265  N NE    . ARG B 1 174 ? -34.639 63.883  6.357   1.00 21.87  ? 174  ARG B NE    1 
ATOM   6266  C CZ    . ARG B 1 174 ? -35.055 62.643  6.612   1.00 24.83  ? 174  ARG B CZ    1 
ATOM   6267  N NH1   . ARG B 1 174 ? -35.153 61.734  5.640   1.00 22.80  ? 174  ARG B NH1   1 
ATOM   6268  N NH2   . ARG B 1 174 ? -35.371 62.309  7.856   1.00 27.28  ? 174  ARG B NH2   1 
ATOM   6269  N N     . ILE B 1 175 ? -35.511 65.464  -0.380  1.00 22.93  ? 175  ILE B N     1 
ATOM   6270  C CA    . ILE B 1 175 ? -35.448 66.256  -1.619  1.00 23.42  ? 175  ILE B CA    1 
ATOM   6271  C C     . ILE B 1 175 ? -36.772 66.232  -2.387  1.00 23.84  ? 175  ILE B C     1 
ATOM   6272  O O     . ILE B 1 175 ? -37.230 67.272  -2.875  1.00 24.11  ? 175  ILE B O     1 
ATOM   6273  C CB    . ILE B 1 175 ? -34.294 65.799  -2.558  1.00 23.43  ? 175  ILE B CB    1 
ATOM   6274  C CG1   . ILE B 1 175 ? -32.937 66.246  -1.989  1.00 23.47  ? 175  ILE B CG1   1 
ATOM   6275  C CG2   . ILE B 1 175 ? -34.493 66.341  -3.987  1.00 23.33  ? 175  ILE B CG2   1 
ATOM   6276  C CD1   . ILE B 1 175 ? -31.756 65.545  -2.624  1.00 22.96  ? 175  ILE B CD1   1 
ATOM   6277  N N     . ILE B 1 176 ? -37.391 65.057  -2.485  1.00 24.11  ? 176  ILE B N     1 
ATOM   6278  C CA    . ILE B 1 176 ? -38.687 64.930  -3.179  1.00 24.69  ? 176  ILE B CA    1 
ATOM   6279  C C     . ILE B 1 176 ? -39.802 65.734  -2.484  1.00 25.22  ? 176  ILE B C     1 
ATOM   6280  O O     . ILE B 1 176 ? -40.523 66.476  -3.144  1.00 25.17  ? 176  ILE B O     1 
ATOM   6281  C CB    . ILE B 1 176 ? -39.088 63.441  -3.379  1.00 24.63  ? 176  ILE B CB    1 
ATOM   6282  C CG1   . ILE B 1 176 ? -38.105 62.762  -4.343  1.00 23.88  ? 176  ILE B CG1   1 
ATOM   6283  C CG2   . ILE B 1 176 ? -40.552 63.302  -3.900  1.00 24.78  ? 176  ILE B CG2   1 
ATOM   6284  C CD1   . ILE B 1 176 ? -38.064 61.243  -4.234  1.00 23.74  ? 176  ILE B CD1   1 
ATOM   6285  N N     . ASP B 1 177 ? -39.919 65.597  -1.160  1.00 25.65  ? 177  ASP B N     1 
ATOM   6286  C CA    . ASP B 1 177 ? -40.991 66.245  -0.395  1.00 26.39  ? 177  ASP B CA    1 
ATOM   6287  C C     . ASP B 1 177 ? -40.925 67.780  -0.491  1.00 26.39  ? 177  ASP B C     1 
ATOM   6288  O O     . ASP B 1 177 ? -41.949 68.459  -0.617  1.00 26.20  ? 177  ASP B O     1 
ATOM   6289  C CB    . ASP B 1 177 ? -40.920 65.817  1.079   1.00 26.88  ? 177  ASP B CB    1 
ATOM   6290  C CG    . ASP B 1 177 ? -42.118 66.310  1.892   1.00 29.04  ? 177  ASP B CG    1 
ATOM   6291  O OD1   . ASP B 1 177 ? -41.994 67.333  2.607   1.00 28.89  ? 177  ASP B OD1   1 
ATOM   6292  O OD2   . ASP B 1 177 ? -43.197 65.683  1.796   1.00 30.78  ? 177  ASP B OD2   1 
ATOM   6293  N N     . SER B 1 178 ? -39.709 68.313  -0.435  1.00 26.22  ? 178  SER B N     1 
ATOM   6294  C CA    . SER B 1 178 ? -39.487 69.762  -0.411  1.00 26.09  ? 178  SER B CA    1 
ATOM   6295  C C     . SER B 1 178 ? -39.318 70.401  -1.799  1.00 26.07  ? 178  SER B C     1 
ATOM   6296  O O     . SER B 1 178 ? -39.213 71.630  -1.910  1.00 26.49  ? 178  SER B O     1 
ATOM   6297  C CB    . SER B 1 178 ? -38.250 70.057  0.425   1.00 25.58  ? 178  SER B CB    1 
ATOM   6298  O OG    . SER B 1 178 ? -37.086 69.579  -0.235  1.00 25.43  ? 178  SER B OG    1 
ATOM   6299  N N     . SER B 1 179 ? -39.281 69.575  -2.843  1.00 25.88  ? 179  SER B N     1 
ATOM   6300  C CA    . SER B 1 179 ? -38.910 70.012  -4.193  1.00 26.30  ? 179  SER B CA    1 
ATOM   6301  C C     . SER B 1 179 ? -37.641 70.878  -4.207  1.00 26.09  ? 179  SER B C     1 
ATOM   6302  O O     . SER B 1 179 ? -37.622 71.943  -4.828  1.00 26.25  ? 179  SER B O     1 
ATOM   6303  C CB    . SER B 1 179 ? -40.075 70.738  -4.896  1.00 26.43  ? 179  SER B CB    1 
ATOM   6304  O OG    . SER B 1 179 ? -41.186 69.875  -5.090  1.00 28.24  ? 179  SER B OG    1 
ATOM   6305  N N     . SER B 1 180 ? -36.586 70.432  -3.521  1.00 25.70  ? 180  SER B N     1 
ATOM   6306  C CA    . SER B 1 180 ? -35.326 71.193  -3.483  1.00 25.54  ? 180  SER B CA    1 
ATOM   6307  C C     . SER B 1 180 ? -34.786 71.414  -4.899  1.00 25.20  ? 180  SER B C     1 
ATOM   6308  O O     . SER B 1 180 ? -34.700 70.472  -5.685  1.00 24.18  ? 180  SER B O     1 
ATOM   6309  C CB    . SER B 1 180 ? -34.269 70.488  -2.622  1.00 25.50  ? 180  SER B CB    1 
ATOM   6310  O OG    . SER B 1 180 ? -34.667 70.399  -1.260  1.00 27.05  ? 180  SER B OG    1 
ATOM   6311  N N     . ARG B 1 181 ? -34.438 72.662  -5.212  1.00 25.41  ? 181  ARG B N     1 
ATOM   6312  C CA    . ARG B 1 181 ? -33.922 73.035  -6.539  1.00 25.84  ? 181  ARG B CA    1 
ATOM   6313  C C     . ARG B 1 181 ? -32.430 72.779  -6.662  1.00 25.22  ? 181  ARG B C     1 
ATOM   6314  O O     . ARG B 1 181 ? -31.896 72.670  -7.769  1.00 25.46  ? 181  ARG B O     1 
ATOM   6315  C CB    . ARG B 1 181 ? -34.194 74.517  -6.824  1.00 26.37  ? 181  ARG B CB    1 
ATOM   6316  C CG    . ARG B 1 181 ? -35.633 74.946  -6.539  1.00 29.80  ? 181  ARG B CG    1 
ATOM   6317  C CD    . ARG B 1 181 ? -36.589 74.343  -7.574  1.00 34.80  ? 181  ARG B CD    1 
ATOM   6318  N NE    . ARG B 1 181 ? -37.933 74.135  -7.031  1.00 38.08  ? 181  ARG B NE    1 
ATOM   6319  C CZ    . ARG B 1 181 ? -38.925 73.533  -7.685  1.00 40.17  ? 181  ARG B CZ    1 
ATOM   6320  N NH1   . ARG B 1 181 ? -38.744 73.071  -8.924  1.00 40.39  ? 181  ARG B NH1   1 
ATOM   6321  N NH2   . ARG B 1 181 ? -40.107 73.398  -7.098  1.00 41.32  ? 181  ARG B NH2   1 
ATOM   6322  N N     . LEU B 1 182 ? -31.770 72.703  -5.509  1.00 24.43  ? 182  LEU B N     1 
ATOM   6323  C CA    . LEU B 1 182 ? -30.324 72.660  -5.421  1.00 23.44  ? 182  LEU B CA    1 
ATOM   6324  C C     . LEU B 1 182 ? -29.914 71.777  -4.242  1.00 23.02  ? 182  LEU B C     1 
ATOM   6325  O O     . LEU B 1 182 ? -30.581 71.770  -3.204  1.00 22.52  ? 182  LEU B O     1 
ATOM   6326  C CB    . LEU B 1 182 ? -29.784 74.089  -5.228  1.00 23.30  ? 182  LEU B CB    1 
ATOM   6327  C CG    . LEU B 1 182 ? -28.302 74.316  -4.907  1.00 23.45  ? 182  LEU B CG    1 
ATOM   6328  C CD1   . LEU B 1 182 ? -27.390 73.920  -6.097  1.00 22.74  ? 182  LEU B CD1   1 
ATOM   6329  C CD2   . LEU B 1 182 ? -28.059 75.758  -4.490  1.00 23.13  ? 182  LEU B CD2   1 
ATOM   6330  N N     . VAL B 1 183 ? -28.820 71.029  -4.407  1.00 22.57  ? 183  VAL B N     1 
ATOM   6331  C CA    . VAL B 1 183 ? -28.197 70.348  -3.273  1.00 22.00  ? 183  VAL B CA    1 
ATOM   6332  C C     . VAL B 1 183 ? -26.810 70.943  -3.031  1.00 21.89  ? 183  VAL B C     1 
ATOM   6333  O O     . VAL B 1 183 ? -26.046 71.154  -3.972  1.00 21.87  ? 183  VAL B O     1 
ATOM   6334  C CB    . VAL B 1 183 ? -28.084 68.803  -3.481  1.00 22.14  ? 183  VAL B CB    1 
ATOM   6335  C CG1   . VAL B 1 183 ? -27.467 68.142  -2.249  1.00 21.17  ? 183  VAL B CG1   1 
ATOM   6336  C CG2   . VAL B 1 183 ? -29.442 68.187  -3.771  1.00 20.32  ? 183  VAL B CG2   1 
ATOM   6337  N N     . ILE B 1 184 ? -26.495 71.213  -1.770  1.00 21.35  ? 184  ILE B N     1 
ATOM   6338  C CA    . ILE B 1 184 ? -25.160 71.675  -1.389  1.00 21.04  ? 184  ILE B CA    1 
ATOM   6339  C C     . ILE B 1 184 ? -24.519 70.615  -0.500  1.00 21.01  ? 184  ILE B C     1 
ATOM   6340  O O     . ILE B 1 184 ? -25.096 70.205  0.521   1.00 21.47  ? 184  ILE B O     1 
ATOM   6341  C CB    . ILE B 1 184 ? -25.192 73.048  -0.685  1.00 21.43  ? 184  ILE B CB    1 
ATOM   6342  C CG1   . ILE B 1 184 ? -25.897 74.090  -1.577  1.00 20.98  ? 184  ILE B CG1   1 
ATOM   6343  C CG2   . ILE B 1 184 ? -23.750 73.512  -0.302  1.00 21.11  ? 184  ILE B CG2   1 
ATOM   6344  C CD1   . ILE B 1 184 ? -26.208 75.414  -0.880  1.00 20.72  ? 184  ILE B CD1   1 
ATOM   6345  N N     . THR B 1 185 ? -23.344 70.151  -0.910  1.00 20.16  ? 185  THR B N     1 
ATOM   6346  C CA    . THR B 1 185 ? -22.688 69.049  -0.226  1.00 20.20  ? 185  THR B CA    1 
ATOM   6347  C C     . THR B 1 185 ? -21.159 69.152  -0.296  1.00 20.18  ? 185  THR B C     1 
ATOM   6348  O O     . THR B 1 185 ? -20.621 70.163  -0.766  1.00 19.77  ? 185  THR B O     1 
ATOM   6349  C CB    . THR B 1 185 ? -23.223 67.663  -0.715  1.00 20.04  ? 185  THR B CB    1 
ATOM   6350  O OG1   . THR B 1 185 ? -22.800 66.637  0.192   1.00 21.41  ? 185  THR B OG1   1 
ATOM   6351  C CG2   . THR B 1 185 ? -22.781 67.329  -2.155  1.00 19.79  ? 185  THR B CG2   1 
ATOM   6352  N N     . ALA B 1 186 ? -20.474 68.132  0.231   1.00 20.18  ? 186  ALA B N     1 
ATOM   6353  C CA    . ALA B 1 186 ? -19.009 68.048  0.173   1.00 20.45  ? 186  ALA B CA    1 
ATOM   6354  C C     . ALA B 1 186 ? -18.618 66.711  -0.436  1.00 20.58  ? 186  ALA B C     1 
ATOM   6355  O O     . ALA B 1 186 ? -19.429 65.774  -0.430  1.00 20.91  ? 186  ALA B O     1 
ATOM   6356  C CB    . ALA B 1 186 ? -18.396 68.199  1.575   1.00 20.04  ? 186  ALA B CB    1 
ATOM   6357  N N     . ASP B 1 187 ? -17.391 66.601  -0.949  1.00 20.63  ? 187  ASP B N     1 
ATOM   6358  C CA    . ASP B 1 187 ? -16.938 65.301  -1.465  1.00 21.28  ? 187  ASP B CA    1 
ATOM   6359  C C     . ASP B 1 187 ? -17.031 64.209  -0.389  1.00 22.09  ? 187  ASP B C     1 
ATOM   6360  O O     . ASP B 1 187 ? -17.626 63.146  -0.621  1.00 22.30  ? 187  ASP B O     1 
ATOM   6361  C CB    . ASP B 1 187 ? -15.555 65.354  -2.143  1.00 20.34  ? 187  ASP B CB    1 
ATOM   6362  C CG    . ASP B 1 187 ? -14.459 65.998  -1.279  1.00 19.73  ? 187  ASP B CG    1 
ATOM   6363  O OD1   . ASP B 1 187 ? -14.650 66.278  -0.072  1.00 17.49  ? 187  ASP B OD1   1 
ATOM   6364  O OD2   . ASP B 1 187 ? -13.369 66.225  -1.844  1.00 18.48  ? 187  ASP B OD2   1 
ATOM   6365  N N     . GLU B 1 188 ? -16.481 64.504  0.783   1.00 22.78  ? 188  GLU B N     1 
ATOM   6366  C CA    . GLU B 1 188 ? -16.579 63.638  1.956   1.00 24.67  ? 188  GLU B CA    1 
ATOM   6367  C C     . GLU B 1 188 ? -16.628 64.481  3.231   1.00 25.32  ? 188  GLU B C     1 
ATOM   6368  O O     . GLU B 1 188 ? -16.148 65.621  3.262   1.00 25.37  ? 188  GLU B O     1 
ATOM   6369  C CB    . GLU B 1 188 ? -15.379 62.693  2.043   1.00 24.33  ? 188  GLU B CB    1 
ATOM   6370  C CG    . GLU B 1 188 ? -15.418 61.503  1.121   1.00 25.43  ? 188  GLU B CG    1 
ATOM   6371  C CD    . GLU B 1 188 ? -14.111 60.723  1.134   1.00 25.82  ? 188  GLU B CD    1 
ATOM   6372  O OE1   . GLU B 1 188 ? -13.096 61.242  1.646   1.00 28.36  ? 188  GLU B OE1   1 
ATOM   6373  O OE2   . GLU B 1 188 ? -14.095 59.589  0.630   1.00 28.21  ? 188  GLU B OE2   1 
ATOM   6374  N N     . GLY B 1 189 ? -17.230 63.922  4.274   1.00 26.47  ? 189  GLY B N     1 
ATOM   6375  C CA    . GLY B 1 189 ? -17.076 64.467  5.615   1.00 28.09  ? 189  GLY B CA    1 
ATOM   6376  C C     . GLY B 1 189 ? -16.003 63.670  6.334   1.00 29.13  ? 189  GLY B C     1 
ATOM   6377  O O     . GLY B 1 189 ? -15.691 62.547  5.943   1.00 28.80  ? 189  GLY B O     1 
ATOM   6378  N N     . VAL B 1 190 ? -15.436 64.261  7.379   1.00 30.50  ? 190  VAL B N     1 
ATOM   6379  C CA    . VAL B 1 190 ? -14.405 63.615  8.191   1.00 31.84  ? 190  VAL B CA    1 
ATOM   6380  C C     . VAL B 1 190 ? -14.851 63.662  9.654   1.00 32.89  ? 190  VAL B C     1 
ATOM   6381  O O     . VAL B 1 190 ? -15.109 64.736  10.203  1.00 33.12  ? 190  VAL B O     1 
ATOM   6382  C CB    . VAL B 1 190 ? -13.040 64.323  8.055   1.00 31.61  ? 190  VAL B CB    1 
ATOM   6383  C CG1   . VAL B 1 190 ? -11.985 63.644  8.930   1.00 31.78  ? 190  VAL B CG1   1 
ATOM   6384  C CG2   . VAL B 1 190 ? -12.594 64.369  6.601   1.00 31.60  ? 190  VAL B CG2   1 
ATOM   6385  N N     . ARG B 1 191 ? -14.944 62.496  10.280  1.00 33.93  ? 191  ARG B N     1 
ATOM   6386  C CA    . ARG B 1 191 ? -15.448 62.403  11.642  1.00 35.53  ? 191  ARG B CA    1 
ATOM   6387  C C     . ARG B 1 191 ? -14.761 61.228  12.323  1.00 35.52  ? 191  ARG B C     1 
ATOM   6388  O O     . ARG B 1 191 ? -14.645 60.146  11.741  1.00 35.72  ? 191  ARG B O     1 
ATOM   6389  C CB    . ARG B 1 191 ? -16.972 62.232  11.619  1.00 35.59  ? 191  ARG B CB    1 
ATOM   6390  C CG    . ARG B 1 191 ? -17.678 62.223  12.973  1.00 37.36  ? 191  ARG B CG    1 
ATOM   6391  C CD    . ARG B 1 191 ? -19.163 61.934  12.763  1.00 37.48  ? 191  ARG B CD    1 
ATOM   6392  N NE    . ARG B 1 191 ? -19.908 61.674  14.001  1.00 42.34  ? 191  ARG B NE    1 
ATOM   6393  C CZ    . ARG B 1 191 ? -19.990 60.487  14.607  1.00 43.56  ? 191  ARG B CZ    1 
ATOM   6394  N NH1   . ARG B 1 191 ? -19.341 59.429  14.122  1.00 44.50  ? 191  ARG B NH1   1 
ATOM   6395  N NH2   . ARG B 1 191 ? -20.708 60.359  15.719  1.00 44.46  ? 191  ARG B NH2   1 
ATOM   6396  N N     . ALA B 1 192 ? -14.263 61.470  13.537  1.00 35.86  ? 192  ALA B N     1 
ATOM   6397  C CA    . ALA B 1 192 ? -13.572 60.457  14.341  1.00 35.79  ? 192  ALA B CA    1 
ATOM   6398  C C     . ALA B 1 192 ? -12.579 59.630  13.525  1.00 35.88  ? 192  ALA B C     1 
ATOM   6399  O O     . ALA B 1 192 ? -12.520 58.408  13.664  1.00 36.01  ? 192  ALA B O     1 
ATOM   6400  C CB    . ALA B 1 192 ? -14.592 59.549  15.045  1.00 35.84  ? 192  ALA B CB    1 
ATOM   6401  N N     . GLY B 1 193 ? -11.816 60.305  12.665  1.00 36.02  ? 193  GLY B N     1 
ATOM   6402  C CA    . GLY B 1 193 ? -10.807 59.655  11.828  1.00 36.05  ? 193  GLY B CA    1 
ATOM   6403  C C     . GLY B 1 193 ? -11.340 58.912  10.610  1.00 36.45  ? 193  GLY B C     1 
ATOM   6404  O O     . GLY B 1 193 ? -10.570 58.265  9.898   1.00 36.38  ? 193  GLY B O     1 
ATOM   6405  N N     . ALA B 1 194 ? -12.648 59.013  10.360  1.00 36.49  ? 194  ALA B N     1 
ATOM   6406  C CA    . ALA B 1 194 ? -13.289 58.288  9.255   1.00 36.47  ? 194  ALA B CA    1 
ATOM   6407  C C     . ALA B 1 194 ? -13.997 59.200  8.243   1.00 36.22  ? 194  ALA B C     1 
ATOM   6408  O O     . ALA B 1 194 ? -14.447 60.301  8.592   1.00 36.37  ? 194  ALA B O     1 
ATOM   6409  C CB    . ALA B 1 194 ? -14.271 57.249  9.810   1.00 36.74  ? 194  ALA B CB    1 
ATOM   6410  N N     . SER B 1 195 ? -14.107 58.712  7.003   1.00 35.54  ? 195  SER B N     1 
ATOM   6411  C CA    . SER B 1 195 ? -14.760 59.413  5.891   1.00 34.62  ? 195  SER B CA    1 
ATOM   6412  C C     . SER B 1 195 ? -16.231 59.047  5.736   1.00 33.64  ? 195  SER B C     1 
ATOM   6413  O O     . SER B 1 195 ? -16.600 57.882  5.814   1.00 33.61  ? 195  SER B O     1 
ATOM   6414  C CB    . SER B 1 195 ? -14.060 59.089  4.573   1.00 34.60  ? 195  SER B CB    1 
ATOM   6415  O OG    . SER B 1 195 ? -12.933 59.922  4.380   1.00 36.86  ? 195  SER B OG    1 
ATOM   6416  N N     . ILE B 1 196 ? -17.060 60.058  5.502   1.00 32.41  ? 196  ILE B N     1 
ATOM   6417  C CA    . ILE B 1 196 ? -18.463 59.866  5.132   1.00 31.22  ? 196  ILE B CA    1 
ATOM   6418  C C     . ILE B 1 196 ? -18.568 60.239  3.649   1.00 29.84  ? 196  ILE B C     1 
ATOM   6419  O O     . ILE B 1 196 ? -18.182 61.343  3.277   1.00 28.84  ? 196  ILE B O     1 
ATOM   6420  C CB    . ILE B 1 196 ? -19.414 60.783  5.971   1.00 31.34  ? 196  ILE B CB    1 
ATOM   6421  C CG1   . ILE B 1 196 ? -19.080 60.735  7.470   1.00 32.71  ? 196  ILE B CG1   1 
ATOM   6422  C CG2   . ILE B 1 196 ? -20.898 60.453  5.717   1.00 31.85  ? 196  ILE B CG2   1 
ATOM   6423  C CD1   . ILE B 1 196 ? -19.022 59.325  8.075   1.00 35.32  ? 196  ILE B CD1   1 
ATOM   6424  N N     . PRO B 1 197 ? -19.086 59.323  2.801   1.00 28.97  ? 197  PRO B N     1 
ATOM   6425  C CA    . PRO B 1 197 ? -19.142 59.578  1.355   1.00 28.31  ? 197  PRO B CA    1 
ATOM   6426  C C     . PRO B 1 197 ? -20.354 60.440  0.952   1.00 27.51  ? 197  PRO B C     1 
ATOM   6427  O O     . PRO B 1 197 ? -21.235 59.983  0.194   1.00 27.90  ? 197  PRO B O     1 
ATOM   6428  C CB    . PRO B 1 197 ? -19.254 58.165  0.763   1.00 28.15  ? 197  PRO B CB    1 
ATOM   6429  C CG    . PRO B 1 197 ? -20.035 57.400  1.806   1.00 28.92  ? 197  PRO B CG    1 
ATOM   6430  C CD    . PRO B 1 197 ? -19.647 57.999  3.152   1.00 29.02  ? 197  PRO B CD    1 
ATOM   6431  N N     . LEU B 1 198 ? -20.385 61.677  1.439   1.00 25.79  ? 198  LEU B N     1 
ATOM   6432  C CA    . LEU B 1 198 ? -21.502 62.589  1.186   1.00 24.81  ? 198  LEU B CA    1 
ATOM   6433  C C     . LEU B 1 198 ? -21.882 62.760  -0.286  1.00 24.16  ? 198  LEU B C     1 
ATOM   6434  O O     . LEU B 1 198 ? -23.049 62.579  -0.639  1.00 24.39  ? 198  LEU B O     1 
ATOM   6435  C CB    . LEU B 1 198 ? -21.257 63.954  1.845   1.00 24.37  ? 198  LEU B CB    1 
ATOM   6436  C CG    . LEU B 1 198 ? -21.137 63.953  3.375   1.00 24.51  ? 198  LEU B CG    1 
ATOM   6437  C CD1   . LEU B 1 198 ? -20.763 65.334  3.886   1.00 23.13  ? 198  LEU B CD1   1 
ATOM   6438  C CD2   . LEU B 1 198 ? -22.435 63.450  4.044   1.00 23.42  ? 198  LEU B CD2   1 
ATOM   6439  N N     . LYS B 1 199 ? -20.917 63.100  -1.142  1.00 23.32  ? 199  LYS B N     1 
ATOM   6440  C CA    . LYS B 1 199 ? -21.218 63.365  -2.566  1.00 23.19  ? 199  LYS B CA    1 
ATOM   6441  C C     . LYS B 1 199 ? -21.717 62.114  -3.298  1.00 22.86  ? 199  LYS B C     1 
ATOM   6442  O O     . LYS B 1 199 ? -22.704 62.180  -4.053  1.00 22.29  ? 199  LYS B O     1 
ATOM   6443  C CB    . LYS B 1 199 ? -20.032 64.021  -3.299  1.00 22.67  ? 199  LYS B CB    1 
ATOM   6444  C CG    . LYS B 1 199 ? -20.017 63.864  -4.845  1.00 24.44  ? 199  LYS B CG    1 
ATOM   6445  C CD    . LYS B 1 199 ? -21.050 64.733  -5.559  1.00 25.72  ? 199  LYS B CD    1 
ATOM   6446  C CE    . LYS B 1 199 ? -20.659 65.059  -7.017  1.00 22.91  ? 199  LYS B CE    1 
ATOM   6447  N NZ    . LYS B 1 199 ? -21.044 64.023  -8.012  1.00 23.19  ? 199  LYS B NZ    1 
ATOM   6448  N N     . LYS B 1 200 ? -21.040 60.987  -3.071  1.00 22.57  ? 200  LYS B N     1 
ATOM   6449  C CA    . LYS B 1 200 ? -21.502 59.701  -3.598  1.00 23.24  ? 200  LYS B CA    1 
ATOM   6450  C C     . LYS B 1 200 ? -22.929 59.364  -3.126  1.00 21.99  ? 200  LYS B C     1 
ATOM   6451  O O     . LYS B 1 200 ? -23.703 58.791  -3.885  1.00 22.53  ? 200  LYS B O     1 
ATOM   6452  C CB    . LYS B 1 200 ? -20.530 58.558  -3.259  1.00 23.25  ? 200  LYS B CB    1 
ATOM   6453  C CG    . LYS B 1 200 ? -20.877 57.234  -3.976  1.00 25.33  ? 200  LYS B CG    1 
ATOM   6454  C CD    . LYS B 1 200 ? -19.862 56.126  -3.670  1.00 25.43  ? 200  LYS B CD    1 
ATOM   6455  C CE    . LYS B 1 200 ? -20.319 54.770  -4.206  1.00 26.89  ? 200  LYS B CE    1 
ATOM   6456  N NZ    . LYS B 1 200 ? -20.233 54.717  -5.693  1.00 28.25  ? 200  LYS B NZ    1 
ATOM   6457  N N     . ASN B 1 201 ? -23.269 59.718  -1.885  1.00 21.17  ? 201  ASN B N     1 
ATOM   6458  C CA    . ASN B 1 201 ? -24.624 59.497  -1.349  1.00 19.84  ? 201  ASN B CA    1 
ATOM   6459  C C     . ASN B 1 201 ? -25.635 60.331  -2.133  1.00 19.46  ? 201  ASN B C     1 
ATOM   6460  O O     . ASN B 1 201 ? -26.700 59.835  -2.490  1.00 18.86  ? 201  ASN B O     1 
ATOM   6461  C CB    . ASN B 1 201 ? -24.702 59.842  0.152   1.00 19.32  ? 201  ASN B CB    1 
ATOM   6462  C CG    . ASN B 1 201 ? -24.117 58.730  1.057   1.00 20.04  ? 201  ASN B CG    1 
ATOM   6463  O OD1   . ASN B 1 201 ? -23.719 57.682  0.574   1.00 20.66  ? 201  ASN B OD1   1 
ATOM   6464  N ND2   . ASN B 1 201 ? -24.089 58.969  2.370   1.00 17.00  ? 201  ASN B ND2   1 
ATOM   6465  N N     . VAL B 1 202 ? -25.286 61.596  -2.390  1.00 18.86  ? 202  VAL B N     1 
ATOM   6466  C CA    . VAL B 1 202 ? -26.095 62.503  -3.227  1.00 19.27  ? 202  VAL B CA    1 
ATOM   6467  C C     . VAL B 1 202 ? -26.263 61.985  -4.666  1.00 19.62  ? 202  VAL B C     1 
ATOM   6468  O O     . VAL B 1 202 ? -27.361 62.044  -5.226  1.00 19.97  ? 202  VAL B O     1 
ATOM   6469  C CB    . VAL B 1 202 ? -25.529 63.957  -3.219  1.00 18.68  ? 202  VAL B CB    1 
ATOM   6470  C CG1   . VAL B 1 202 ? -26.263 64.856  -4.221  1.00 18.95  ? 202  VAL B CG1   1 
ATOM   6471  C CG2   . VAL B 1 202 ? -25.621 64.541  -1.837  1.00 18.63  ? 202  VAL B CG2   1 
ATOM   6472  N N     . ASP B 1 203 ? -25.190 61.468  -5.259  1.00 20.84  ? 203  ASP B N     1 
ATOM   6473  C CA    . ASP B 1 203 ? -25.277 60.840  -6.587  1.00 21.88  ? 203  ASP B CA    1 
ATOM   6474  C C     . ASP B 1 203 ? -26.300 59.699  -6.577  1.00 21.87  ? 203  ASP B C     1 
ATOM   6475  O O     . ASP B 1 203 ? -27.150 59.605  -7.457  1.00 21.02  ? 203  ASP B O     1 
ATOM   6476  C CB    . ASP B 1 203 ? -23.926 60.271  -7.020  1.00 22.38  ? 203  ASP B CB    1 
ATOM   6477  C CG    . ASP B 1 203 ? -22.927 61.336  -7.414  1.00 24.36  ? 203  ASP B CG    1 
ATOM   6478  O OD1   . ASP B 1 203 ? -23.327 62.503  -7.631  1.00 26.00  ? 203  ASP B OD1   1 
ATOM   6479  O OD2   . ASP B 1 203 ? -21.728 60.986  -7.521  1.00 25.44  ? 203  ASP B OD2   1 
ATOM   6480  N N     . ASP B 1 204 ? -26.195 58.836  -5.567  1.00 22.36  ? 204  ASP B N     1 
ATOM   6481  C CA    . ASP B 1 204 ? -27.130 57.728  -5.378  1.00 22.86  ? 204  ASP B CA    1 
ATOM   6482  C C     . ASP B 1 204 ? -28.576 58.220  -5.130  1.00 22.86  ? 204  ASP B C     1 
ATOM   6483  O O     . ASP B 1 204 ? -29.516 57.709  -5.731  1.00 22.69  ? 204  ASP B O     1 
ATOM   6484  C CB    . ASP B 1 204 ? -26.632 56.808  -4.257  1.00 23.17  ? 204  ASP B CB    1 
ATOM   6485  C CG    . ASP B 1 204 ? -25.353 56.027  -4.656  1.00 26.36  ? 204  ASP B CG    1 
ATOM   6486  O OD1   . ASP B 1 204 ? -24.769 55.333  -3.788  1.00 27.64  ? 204  ASP B OD1   1 
ATOM   6487  O OD2   . ASP B 1 204 ? -24.932 56.100  -5.841  1.00 27.97  ? 204  ASP B OD2   1 
ATOM   6488  N N     . ALA B 1 205 ? -28.745 59.234  -4.283  1.00 22.83  ? 205  ALA B N     1 
ATOM   6489  C CA    . ALA B 1 205 ? -30.069 59.845  -4.077  1.00 23.10  ? 205  ALA B CA    1 
ATOM   6490  C C     . ALA B 1 205 ? -30.699 60.342  -5.388  1.00 23.45  ? 205  ALA B C     1 
ATOM   6491  O O     . ALA B 1 205 ? -31.890 60.139  -5.627  1.00 23.28  ? 205  ALA B O     1 
ATOM   6492  C CB    . ALA B 1 205 ? -29.982 60.989  -3.052  1.00 22.31  ? 205  ALA B CB    1 
ATOM   6493  N N     . LEU B 1 206 ? -29.895 60.983  -6.239  1.00 23.95  ? 206  LEU B N     1 
ATOM   6494  C CA    . LEU B 1 206 ? -30.421 61.610  -7.452  1.00 24.77  ? 206  LEU B CA    1 
ATOM   6495  C C     . LEU B 1 206 ? -30.743 60.620  -8.575  1.00 25.15  ? 206  LEU B C     1 
ATOM   6496  O O     . LEU B 1 206 ? -31.384 60.991  -9.555  1.00 25.56  ? 206  LEU B O     1 
ATOM   6497  C CB    . LEU B 1 206 ? -29.513 62.756  -7.946  1.00 24.60  ? 206  LEU B CB    1 
ATOM   6498  C CG    . LEU B 1 206 ? -29.311 63.947  -6.992  1.00 25.90  ? 206  LEU B CG    1 
ATOM   6499  C CD1   . LEU B 1 206 ? -28.467 65.023  -7.635  1.00 25.86  ? 206  LEU B CD1   1 
ATOM   6500  C CD2   . LEU B 1 206 ? -30.620 64.548  -6.455  1.00 25.20  ? 206  LEU B CD2   1 
ATOM   6501  N N     . LYS B 1 207 ? -30.325 59.366  -8.428  1.00 25.71  ? 207  LYS B N     1 
ATOM   6502  C CA    . LYS B 1 207 ? -30.733 58.314  -9.375  1.00 26.79  ? 207  LYS B CA    1 
ATOM   6503  C C     . LYS B 1 207 ? -32.189 57.870  -9.174  1.00 26.76  ? 207  LYS B C     1 
ATOM   6504  O O     . LYS B 1 207 ? -32.747 57.167  -10.017 1.00 26.63  ? 207  LYS B O     1 
ATOM   6505  C CB    . LYS B 1 207 ? -29.775 57.119  -9.322  1.00 26.52  ? 207  LYS B CB    1 
ATOM   6506  C CG    . LYS B 1 207 ? -28.408 57.412  -9.931  1.00 27.68  ? 207  LYS B CG    1 
ATOM   6507  C CD    . LYS B 1 207 ? -27.407 56.286  -9.670  1.00 28.31  ? 207  LYS B CD    1 
ATOM   6508  C CE    . LYS B 1 207 ? -25.992 56.672  -10.139 1.00 30.87  ? 207  LYS B CE    1 
ATOM   6509  N NZ    . LYS B 1 207 ? -25.016 55.558  -9.927  1.00 32.03  ? 207  LYS B NZ    1 
ATOM   6510  N N     . ASN B 1 208 ? -32.787 58.271  -8.048  1.00 27.16  ? 208  ASN B N     1 
ATOM   6511  C CA    . ASN B 1 208 ? -34.205 58.048  -7.776  1.00 27.46  ? 208  ASN B CA    1 
ATOM   6512  C C     . ASN B 1 208 ? -35.013 58.823  -8.824  1.00 27.84  ? 208  ASN B C     1 
ATOM   6513  O O     . ASN B 1 208 ? -34.870 60.042  -8.930  1.00 27.71  ? 208  ASN B O     1 
ATOM   6514  C CB    . ASN B 1 208 ? -34.550 58.502  -6.349  1.00 27.61  ? 208  ASN B CB    1 
ATOM   6515  C CG    . ASN B 1 208 ? -35.950 58.061  -5.889  1.00 28.08  ? 208  ASN B CG    1 
ATOM   6516  O OD1   . ASN B 1 208 ? -36.944 58.252  -6.589  1.00 27.48  ? 208  ASN B OD1   1 
ATOM   6517  N ND2   . ASN B 1 208 ? -36.023 57.499  -4.687  1.00 26.42  ? 208  ASN B ND2   1 
ATOM   6518  N N     . PRO B 1 209 ? -35.845 58.114  -9.617  1.00 28.05  ? 209  PRO B N     1 
ATOM   6519  C CA    . PRO B 1 209 ? -36.575 58.749  -10.721 1.00 28.36  ? 209  PRO B CA    1 
ATOM   6520  C C     . PRO B 1 209 ? -37.644 59.724  -10.230 1.00 28.17  ? 209  PRO B C     1 
ATOM   6521  O O     . PRO B 1 209 ? -38.137 60.526  -11.007 1.00 28.67  ? 209  PRO B O     1 
ATOM   6522  C CB    . PRO B 1 209 ? -37.217 57.561  -11.450 1.00 28.22  ? 209  PRO B CB    1 
ATOM   6523  C CG    . PRO B 1 209 ? -37.394 56.532  -10.400 1.00 28.78  ? 209  PRO B CG    1 
ATOM   6524  C CD    . PRO B 1 209 ? -36.171 56.679  -9.505  1.00 28.38  ? 209  PRO B CD    1 
ATOM   6525  N N     . ASN B 1 210 ? -37.979 59.660  -8.947  1.00 28.16  ? 210  ASN B N     1 
ATOM   6526  C CA    . ASN B 1 210 ? -38.934 60.594  -8.353  1.00 28.17  ? 210  ASN B CA    1 
ATOM   6527  C C     . ASN B 1 210 ? -38.302 61.944  -7.967  1.00 27.76  ? 210  ASN B C     1 
ATOM   6528  O O     . ASN B 1 210 ? -39.005 62.885  -7.583  1.00 27.62  ? 210  ASN B O     1 
ATOM   6529  C CB    . ASN B 1 210 ? -39.649 59.937  -7.167  1.00 28.26  ? 210  ASN B CB    1 
ATOM   6530  C CG    . ASN B 1 210 ? -40.586 58.808  -7.597  1.00 30.31  ? 210  ASN B CG    1 
ATOM   6531  O OD1   . ASN B 1 210 ? -41.558 59.036  -8.328  1.00 31.93  ? 210  ASN B OD1   1 
ATOM   6532  N ND2   . ASN B 1 210 ? -40.297 57.588  -7.150  1.00 30.57  ? 210  ASN B ND2   1 
ATOM   6533  N N     . VAL B 1 211 ? -36.976 62.041  -8.075  1.00 27.26  ? 211  VAL B N     1 
ATOM   6534  C CA    . VAL B 1 211 ? -36.295 63.320  -7.890  1.00 26.83  ? 211  VAL B CA    1 
ATOM   6535  C C     . VAL B 1 211 ? -36.299 64.072  -9.225  1.00 27.18  ? 211  VAL B C     1 
ATOM   6536  O O     . VAL B 1 211 ? -35.631 63.664  -10.172 1.00 27.33  ? 211  VAL B O     1 
ATOM   6537  C CB    . VAL B 1 211 ? -34.866 63.129  -7.339  1.00 26.69  ? 211  VAL B CB    1 
ATOM   6538  C CG1   . VAL B 1 211 ? -34.164 64.467  -7.161  1.00 26.11  ? 211  VAL B CG1   1 
ATOM   6539  C CG2   . VAL B 1 211 ? -34.907 62.385  -6.021  1.00 25.80  ? 211  VAL B CG2   1 
ATOM   6540  N N     . THR B 1 212 ? -37.080 65.152  -9.295  1.00 27.15  ? 212  THR B N     1 
ATOM   6541  C CA    . THR B 1 212 ? -37.274 65.913  -10.542 1.00 27.43  ? 212  THR B CA    1 
ATOM   6542  C C     . THR B 1 212 ? -36.893 67.399  -10.409 1.00 26.90  ? 212  THR B C     1 
ATOM   6543  O O     . THR B 1 212 ? -36.829 68.125  -11.405 1.00 26.79  ? 212  THR B O     1 
ATOM   6544  C CB    . THR B 1 212 ? -38.750 65.853  -11.021 1.00 27.44  ? 212  THR B CB    1 
ATOM   6545  O OG1   . THR B 1 212 ? -39.609 66.377  -9.995  1.00 28.52  ? 212  THR B OG1   1 
ATOM   6546  C CG2   . THR B 1 212 ? -39.168 64.429  -11.333 1.00 28.15  ? 212  THR B CG2   1 
ATOM   6547  N N     . SER B 1 213 ? -36.649 67.839  -9.179  1.00 26.29  ? 213  SER B N     1 
ATOM   6548  C CA    . SER B 1 213 ? -36.500 69.263  -8.876  1.00 25.86  ? 213  SER B CA    1 
ATOM   6549  C C     . SER B 1 213 ? -35.048 69.751  -8.868  1.00 25.74  ? 213  SER B C     1 
ATOM   6550  O O     . SER B 1 213 ? -34.797 70.962  -8.906  1.00 25.72  ? 213  SER B O     1 
ATOM   6551  C CB    . SER B 1 213 ? -37.135 69.560  -7.518  1.00 26.04  ? 213  SER B CB    1 
ATOM   6552  O OG    . SER B 1 213 ? -36.515 68.768  -6.509  1.00 26.05  ? 213  SER B OG    1 
ATOM   6553  N N     . VAL B 1 214 ? -34.097 68.821  -8.811  1.00 25.37  ? 214  VAL B N     1 
ATOM   6554  C CA    . VAL B 1 214 ? -32.685 69.191  -8.637  1.00 24.87  ? 214  VAL B CA    1 
ATOM   6555  C C     . VAL B 1 214 ? -32.011 69.539  -9.963  1.00 24.99  ? 214  VAL B C     1 
ATOM   6556  O O     . VAL B 1 214 ? -31.904 68.702  -10.869 1.00 24.63  ? 214  VAL B O     1 
ATOM   6557  C CB    . VAL B 1 214 ? -31.878 68.117  -7.861  1.00 25.02  ? 214  VAL B CB    1 
ATOM   6558  C CG1   . VAL B 1 214 ? -30.389 68.497  -7.798  1.00 24.36  ? 214  VAL B CG1   1 
ATOM   6559  C CG2   . VAL B 1 214 ? -32.432 67.955  -6.444  1.00 23.29  ? 214  VAL B CG2   1 
ATOM   6560  N N     . GLU B 1 215 ? -31.559 70.787  -10.051 1.00 25.06  ? 215  GLU B N     1 
ATOM   6561  C CA    . GLU B 1 215 ? -30.911 71.312  -11.247 1.00 25.86  ? 215  GLU B CA    1 
ATOM   6562  C C     . GLU B 1 215 ? -29.386 71.256  -11.123 1.00 25.18  ? 215  GLU B C     1 
ATOM   6563  O O     . GLU B 1 215 ? -28.692 70.933  -12.100 1.00 26.01  ? 215  GLU B O     1 
ATOM   6564  C CB    . GLU B 1 215 ? -31.407 72.738  -11.535 1.00 25.49  ? 215  GLU B CB    1 
ATOM   6565  C CG    . GLU B 1 215 ? -32.895 72.783  -11.952 1.00 27.39  ? 215  GLU B CG    1 
ATOM   6566  C CD    . GLU B 1 215 ? -33.517 74.181  -11.893 1.00 28.56  ? 215  GLU B CD    1 
ATOM   6567  O OE1   . GLU B 1 215 ? -34.732 74.277  -11.588 1.00 32.32  ? 215  GLU B OE1   1 
ATOM   6568  O OE2   . GLU B 1 215 ? -32.804 75.186  -12.143 1.00 31.37  ? 215  GLU B OE2   1 
ATOM   6569  N N     . HIS B 1 216 ? -28.870 71.548  -9.929  1.00 24.04  ? 216  HIS B N     1 
ATOM   6570  C CA    . HIS B 1 216 ? -27.428 71.537  -9.686  1.00 23.18  ? 216  HIS B CA    1 
ATOM   6571  C C     . HIS B 1 216 ? -27.069 70.969  -8.324  1.00 22.61  ? 216  HIS B C     1 
ATOM   6572  O O     . HIS B 1 216 ? -27.895 70.934  -7.423  1.00 22.21  ? 216  HIS B O     1 
ATOM   6573  C CB    . HIS B 1 216 ? -26.849 72.946  -9.777  1.00 23.38  ? 216  HIS B CB    1 
ATOM   6574  C CG    . HIS B 1 216 ? -26.976 73.571  -11.128 1.00 23.82  ? 216  HIS B CG    1 
ATOM   6575  N ND1   . HIS B 1 216 ? -26.194 73.193  -12.198 1.00 24.01  ? 216  HIS B ND1   1 
ATOM   6576  C CD2   . HIS B 1 216 ? -27.785 74.559  -11.578 1.00 24.69  ? 216  HIS B CD2   1 
ATOM   6577  C CE1   . HIS B 1 216 ? -26.523 73.918  -13.253 1.00 25.25  ? 216  HIS B CE1   1 
ATOM   6578  N NE2   . HIS B 1 216 ? -27.482 74.758  -12.902 1.00 25.05  ? 216  HIS B NE2   1 
ATOM   6579  N N     . VAL B 1 217 ? -25.820 70.525  -8.202  1.00 22.18  ? 217  VAL B N     1 
ATOM   6580  C CA    . VAL B 1 217 ? -25.231 70.100  -6.941  1.00 21.85  ? 217  VAL B CA    1 
ATOM   6581  C C     . VAL B 1 217 ? -23.920 70.884  -6.773  1.00 22.43  ? 217  VAL B C     1 
ATOM   6582  O O     . VAL B 1 217 ? -23.012 70.800  -7.617  1.00 21.77  ? 217  VAL B O     1 
ATOM   6583  C CB    . VAL B 1 217 ? -24.963 68.570  -6.899  1.00 21.94  ? 217  VAL B CB    1 
ATOM   6584  C CG1   . VAL B 1 217 ? -24.381 68.148  -5.548  1.00 21.67  ? 217  VAL B CG1   1 
ATOM   6585  C CG2   . VAL B 1 217 ? -26.247 67.774  -7.192  1.00 21.14  ? 217  VAL B CG2   1 
ATOM   6586  N N     . ILE B 1 218 ? -23.846 71.664  -5.694  1.00 22.43  ? 218  ILE B N     1 
ATOM   6587  C CA    . ILE B 1 218 ? -22.626 72.374  -5.355  1.00 22.43  ? 218  ILE B CA    1 
ATOM   6588  C C     . ILE B 1 218 ? -21.839 71.509  -4.391  1.00 22.43  ? 218  ILE B C     1 
ATOM   6589  O O     . ILE B 1 218 ? -22.375 71.038  -3.384  1.00 22.68  ? 218  ILE B O     1 
ATOM   6590  C CB    . ILE B 1 218 ? -22.913 73.768  -4.766  1.00 22.59  ? 218  ILE B CB    1 
ATOM   6591  C CG1   . ILE B 1 218 ? -23.566 74.667  -5.832  1.00 22.07  ? 218  ILE B CG1   1 
ATOM   6592  C CG2   . ILE B 1 218 ? -21.628 74.403  -4.221  1.00 23.06  ? 218  ILE B CG2   1 
ATOM   6593  C CD1   . ILE B 1 218 ? -24.094 75.997  -5.295  1.00 21.95  ? 218  ILE B CD1   1 
ATOM   6594  N N     . VAL B 1 219 ? -20.568 71.290  -4.720  1.00 22.18  ? 219  VAL B N     1 
ATOM   6595  C CA    . VAL B 1 219 ? -19.719 70.383  -3.961  1.00 21.70  ? 219  VAL B CA    1 
ATOM   6596  C C     . VAL B 1 219 ? -18.494 71.115  -3.425  1.00 21.76  ? 219  VAL B C     1 
ATOM   6597  O O     . VAL B 1 219 ? -17.741 71.725  -4.186  1.00 21.96  ? 219  VAL B O     1 
ATOM   6598  C CB    . VAL B 1 219 ? -19.266 69.177  -4.825  1.00 21.48  ? 219  VAL B CB    1 
ATOM   6599  C CG1   . VAL B 1 219 ? -18.525 68.143  -3.984  1.00 20.79  ? 219  VAL B CG1   1 
ATOM   6600  C CG2   . VAL B 1 219 ? -20.463 68.537  -5.560  1.00 21.33  ? 219  VAL B CG2   1 
ATOM   6601  N N     . LEU B 1 220 ? -18.307 71.045  -2.111  1.00 21.77  ? 220  LEU B N     1 
ATOM   6602  C CA    . LEU B 1 220 ? -17.088 71.504  -1.464  1.00 21.62  ? 220  LEU B CA    1 
ATOM   6603  C C     . LEU B 1 220 ? -16.018 70.420  -1.520  1.00 21.52  ? 220  LEU B C     1 
ATOM   6604  O O     . LEU B 1 220 ? -16.261 69.280  -1.101  1.00 21.37  ? 220  LEU B O     1 
ATOM   6605  C CB    . LEU B 1 220 ? -17.380 71.865  0.001   1.00 21.73  ? 220  LEU B CB    1 
ATOM   6606  C CG    . LEU B 1 220 ? -16.214 72.356  0.870   1.00 22.82  ? 220  LEU B CG    1 
ATOM   6607  C CD1   . LEU B 1 220 ? -15.713 73.733  0.395   1.00 24.27  ? 220  LEU B CD1   1 
ATOM   6608  C CD2   . LEU B 1 220 ? -16.612 72.405  2.342   1.00 21.91  ? 220  LEU B CD2   1 
ATOM   6609  N N     . LYS B 1 221 ? -14.831 70.768  -2.016  1.00 21.69  ? 221  LYS B N     1 
ATOM   6610  C CA    . LYS B 1 221 ? -13.698 69.858  -1.928  1.00 22.02  ? 221  LYS B CA    1 
ATOM   6611  C C     . LYS B 1 221 ? -13.120 69.927  -0.521  1.00 22.41  ? 221  LYS B C     1 
ATOM   6612  O O     . LYS B 1 221 ? -12.259 70.766  -0.210  1.00 22.63  ? 221  LYS B O     1 
ATOM   6613  C CB    . LYS B 1 221 ? -12.623 70.167  -2.974  1.00 22.14  ? 221  LYS B CB    1 
ATOM   6614  C CG    . LYS B 1 221 ? -11.621 69.024  -3.203  1.00 22.30  ? 221  LYS B CG    1 
ATOM   6615  C CD    . LYS B 1 221 ? -10.606 69.340  -4.322  1.00 22.44  ? 221  LYS B CD    1 
ATOM   6616  C CE    . LYS B 1 221 ? -11.169 69.042  -5.731  1.00 23.12  ? 221  LYS B CE    1 
ATOM   6617  N NZ    . LYS B 1 221 ? -11.293 67.580  -6.092  1.00 21.10  ? 221  LYS B NZ    1 
ATOM   6618  N N     . ARG B 1 222 ? -13.608 69.035  0.333   1.00 22.36  ? 222  ARG B N     1 
ATOM   6619  C CA    . ARG B 1 222 ? -13.122 68.937  1.696   1.00 22.23  ? 222  ARG B CA    1 
ATOM   6620  C C     . ARG B 1 222 ? -11.902 68.014  1.774   1.00 22.33  ? 222  ARG B C     1 
ATOM   6621  O O     . ARG B 1 222 ? -10.867 68.398  2.327   1.00 22.61  ? 222  ARG B O     1 
ATOM   6622  C CB    . ARG B 1 222 ? -14.269 68.483  2.616   1.00 22.34  ? 222  ARG B CB    1 
ATOM   6623  C CG    . ARG B 1 222 ? -13.893 68.121  4.047   1.00 22.87  ? 222  ARG B CG    1 
ATOM   6624  C CD    . ARG B 1 222 ? -13.360 69.308  4.849   1.00 23.26  ? 222  ARG B CD    1 
ATOM   6625  N NE    . ARG B 1 222 ? -12.834 68.851  6.132   1.00 24.97  ? 222  ARG B NE    1 
ATOM   6626  C CZ    . ARG B 1 222 ? -11.560 68.555  6.370   1.00 27.39  ? 222  ARG B CZ    1 
ATOM   6627  N NH1   . ARG B 1 222 ? -10.638 68.675  5.411   1.00 28.40  ? 222  ARG B NH1   1 
ATOM   6628  N NH2   . ARG B 1 222 ? -11.203 68.143  7.576   1.00 27.56  ? 222  ARG B NH2   1 
ATOM   6629  N N     . THR B 1 223 ? -12.003 66.819  1.193   1.00 22.49  ? 223  THR B N     1 
ATOM   6630  C CA    . THR B 1 223 ? -10.930 65.817  1.310   1.00 22.81  ? 223  THR B CA    1 
ATOM   6631  C C     . THR B 1 223 ? -10.076 65.645  0.048   1.00 23.22  ? 223  THR B C     1 
ATOM   6632  O O     . THR B 1 223 ? -8.907  65.269  0.138   1.00 23.11  ? 223  THR B O     1 
ATOM   6633  C CB    . THR B 1 223 ? -11.467 64.421  1.733   1.00 22.97  ? 223  THR B CB    1 
ATOM   6634  O OG1   . THR B 1 223 ? -12.283 63.872  0.687   1.00 22.39  ? 223  THR B OG1   1 
ATOM   6635  C CG2   . THR B 1 223 ? -12.267 64.511  3.042   1.00 22.37  ? 223  THR B CG2   1 
ATOM   6636  N N     . GLY B 1 224 ? -10.655 65.911  -1.121  1.00 23.35  ? 224  GLY B N     1 
ATOM   6637  C CA    . GLY B 1 224 ? -9.933  65.717  -2.379  1.00 24.24  ? 224  GLY B CA    1 
ATOM   6638  C C     . GLY B 1 224 ? -10.029 64.295  -2.903  1.00 24.63  ? 224  GLY B C     1 
ATOM   6639  O O     . GLY B 1 224 ? -9.337  63.927  -3.845  1.00 24.26  ? 224  GLY B O     1 
ATOM   6640  N N     . SER B 1 225 ? -10.901 63.504  -2.293  1.00 25.40  ? 225  SER B N     1 
ATOM   6641  C CA    . SER B 1 225 ? -11.110 62.105  -2.679  1.00 26.68  ? 225  SER B CA    1 
ATOM   6642  C C     . SER B 1 225 ? -11.656 61.960  -4.091  1.00 26.75  ? 225  SER B C     1 
ATOM   6643  O O     . SER B 1 225 ? -12.287 62.879  -4.632  1.00 26.26  ? 225  SER B O     1 
ATOM   6644  C CB    . SER B 1 225 ? -12.079 61.425  -1.716  1.00 27.09  ? 225  SER B CB    1 
ATOM   6645  O OG    . SER B 1 225 ? -13.413 61.846  -1.985  1.00 29.24  ? 225  SER B OG    1 
ATOM   6646  N N     . ASP B 1 226 ? -11.393 60.795  -4.677  1.00 27.24  ? 226  ASP B N     1 
ATOM   6647  C CA    . ASP B 1 226 ? -11.893 60.454  -5.995  1.00 27.80  ? 226  ASP B CA    1 
ATOM   6648  C C     . ASP B 1 226 ? -13.411 60.458  -5.970  1.00 27.51  ? 226  ASP B C     1 
ATOM   6649  O O     . ASP B 1 226 ? -14.018 59.786  -5.139  1.00 28.09  ? 226  ASP B O     1 
ATOM   6650  C CB    . ASP B 1 226 ? -11.387 59.067  -6.409  1.00 28.11  ? 226  ASP B CB    1 
ATOM   6651  C CG    . ASP B 1 226 ? -9.876  59.020  -6.585  1.00 29.86  ? 226  ASP B CG    1 
ATOM   6652  O OD1   . ASP B 1 226 ? -9.257  60.084  -6.816  1.00 31.52  ? 226  ASP B OD1   1 
ATOM   6653  O OD2   . ASP B 1 226 ? -9.303  57.907  -6.508  1.00 32.14  ? 226  ASP B OD2   1 
ATOM   6654  N N     . ILE B 1 227 ? -14.027 61.242  -6.853  1.00 27.11  ? 227  ILE B N     1 
ATOM   6655  C CA    . ILE B 1 227 ? -15.479 61.195  -7.007  1.00 26.57  ? 227  ILE B CA    1 
ATOM   6656  C C     . ILE B 1 227 ? -15.895 61.119  -8.464  1.00 26.00  ? 227  ILE B C     1 
ATOM   6657  O O     . ILE B 1 227 ? -15.069 61.235  -9.375  1.00 25.73  ? 227  ILE B O     1 
ATOM   6658  C CB    . ILE B 1 227 ? -16.237 62.364  -6.277  1.00 27.01  ? 227  ILE B CB    1 
ATOM   6659  C CG1   . ILE B 1 227 ? -15.753 63.740  -6.737  1.00 27.34  ? 227  ILE B CG1   1 
ATOM   6660  C CG2   . ILE B 1 227 ? -16.126 62.239  -4.756  1.00 28.42  ? 227  ILE B CG2   1 
ATOM   6661  C CD1   . ILE B 1 227 ? -16.664 64.869  -6.290  1.00 26.76  ? 227  ILE B CD1   1 
ATOM   6662  N N     . ASP B 1 228 ? -17.187 60.882  -8.666  1.00 25.24  ? 228  ASP B N     1 
ATOM   6663  C CA    . ASP B 1 228 ? -17.773 60.889  -9.981  1.00 24.73  ? 228  ASP B CA    1 
ATOM   6664  C C     . ASP B 1 228 ? -18.328 62.294  -10.198 1.00 24.18  ? 228  ASP B C     1 
ATOM   6665  O O     . ASP B 1 228 ? -18.694 62.983  -9.242  1.00 24.36  ? 228  ASP B O     1 
ATOM   6666  C CB    . ASP B 1 228 ? -18.869 59.826  -10.085 1.00 24.62  ? 228  ASP B CB    1 
ATOM   6667  C CG    . ASP B 1 228 ? -18.363 58.421  -9.743  1.00 25.66  ? 228  ASP B CG    1 
ATOM   6668  O OD1   . ASP B 1 228 ? -19.022 57.727  -8.939  1.00 26.02  ? 228  ASP B OD1   1 
ATOM   6669  O OD2   . ASP B 1 228 ? -17.302 58.005  -10.267 1.00 26.67  ? 228  ASP B OD2   1 
ATOM   6670  N N     . TRP B 1 229 ? -18.369 62.730  -11.446 1.00 23.02  ? 229  TRP B N     1 
ATOM   6671  C CA    . TRP B 1 229 ? -18.674 64.116  -11.724 1.00 22.55  ? 229  TRP B CA    1 
ATOM   6672  C C     . TRP B 1 229 ? -19.623 64.204  -12.895 1.00 22.76  ? 229  TRP B C     1 
ATOM   6673  O O     . TRP B 1 229 ? -19.284 63.778  -14.005 1.00 22.41  ? 229  TRP B O     1 
ATOM   6674  C CB    . TRP B 1 229 ? -17.385 64.901  -12.011 1.00 21.71  ? 229  TRP B CB    1 
ATOM   6675  C CG    . TRP B 1 229 ? -17.563 66.392  -11.911 1.00 20.75  ? 229  TRP B CG    1 
ATOM   6676  C CD1   . TRP B 1 229 ? -17.611 67.288  -12.945 1.00 20.08  ? 229  TRP B CD1   1 
ATOM   6677  C CD2   . TRP B 1 229 ? -17.724 67.154  -10.714 1.00 19.58  ? 229  TRP B CD2   1 
ATOM   6678  N NE1   . TRP B 1 229 ? -17.788 68.563  -12.460 1.00 19.34  ? 229  TRP B NE1   1 
ATOM   6679  C CE2   . TRP B 1 229 ? -17.864 68.509  -11.095 1.00 19.51  ? 229  TRP B CE2   1 
ATOM   6680  C CE3   . TRP B 1 229 ? -17.768 66.824  -9.348  1.00 20.63  ? 229  TRP B CE3   1 
ATOM   6681  C CZ2   . TRP B 1 229 ? -18.038 69.532  -10.163 1.00 20.54  ? 229  TRP B CZ2   1 
ATOM   6682  C CZ3   . TRP B 1 229 ? -17.952 67.846  -8.422  1.00 20.21  ? 229  TRP B CZ3   1 
ATOM   6683  C CH2   . TRP B 1 229 ? -18.090 69.180  -8.832  1.00 20.43  ? 229  TRP B CH2   1 
ATOM   6684  N N     . GLN B 1 230 ? -20.814 64.740  -12.645 1.00 22.99  ? 230  GLN B N     1 
ATOM   6685  C CA    . GLN B 1 230 ? -21.778 64.926  -13.725 1.00 23.95  ? 230  GLN B CA    1 
ATOM   6686  C C     . GLN B 1 230 ? -21.688 66.329  -14.299 1.00 23.69  ? 230  GLN B C     1 
ATOM   6687  O O     . GLN B 1 230 ? -22.165 67.295  -13.701 1.00 23.64  ? 230  GLN B O     1 
ATOM   6688  C CB    . GLN B 1 230 ? -23.214 64.606  -13.289 1.00 23.70  ? 230  GLN B CB    1 
ATOM   6689  C CG    . GLN B 1 230 ? -24.183 64.592  -14.481 1.00 25.06  ? 230  GLN B CG    1 
ATOM   6690  C CD    . GLN B 1 230 ? -25.572 64.093  -14.139 1.00 25.48  ? 230  GLN B CD    1 
ATOM   6691  O OE1   . GLN B 1 230 ? -25.737 63.101  -13.425 1.00 28.12  ? 230  GLN B OE1   1 
ATOM   6692  N NE2   . GLN B 1 230 ? -26.583 64.768  -14.673 1.00 27.04  ? 230  GLN B NE2   1 
ATOM   6693  N N     . GLU B 1 231 ? -21.074 66.430  -15.467 1.00 24.23  ? 231  GLU B N     1 
ATOM   6694  C CA    . GLU B 1 231 ? -20.863 67.716  -16.107 1.00 25.28  ? 231  GLU B CA    1 
ATOM   6695  C C     . GLU B 1 231 ? -22.188 68.411  -16.399 1.00 25.24  ? 231  GLU B C     1 
ATOM   6696  O O     . GLU B 1 231 ? -23.127 67.791  -16.910 1.00 25.17  ? 231  GLU B O     1 
ATOM   6697  C CB    . GLU B 1 231 ? -20.050 67.558  -17.397 1.00 25.80  ? 231  GLU B CB    1 
ATOM   6698  C CG    . GLU B 1 231 ? -18.906 68.575  -17.509 1.00 28.32  ? 231  GLU B CG    1 
ATOM   6699  C CD    . GLU B 1 231 ? -17.779 68.278  -16.520 1.00 31.67  ? 231  GLU B CD    1 
ATOM   6700  O OE1   . GLU B 1 231 ? -17.065 67.250  -16.705 1.00 30.06  ? 231  GLU B OE1   1 
ATOM   6701  O OE2   . GLU B 1 231 ? -17.612 69.076  -15.554 1.00 34.42  ? 231  GLU B OE2   1 
ATOM   6702  N N     . GLY B 1 232 ? -22.254 69.700  -16.069 1.00 25.25  ? 232  GLY B N     1 
ATOM   6703  C CA    . GLY B 1 232 ? -23.489 70.469  -16.218 1.00 24.77  ? 232  GLY B CA    1 
ATOM   6704  C C     . GLY B 1 232 ? -24.213 70.607  -14.895 1.00 24.42  ? 232  GLY B C     1 
ATOM   6705  O O     . GLY B 1 232 ? -24.562 71.718  -14.492 1.00 25.60  ? 232  GLY B O     1 
ATOM   6706  N N     . ARG B 1 233 ? -24.413 69.486  -14.201 1.00 23.44  ? 233  ARG B N     1 
ATOM   6707  C CA    . ARG B 1 233 ? -25.116 69.466  -12.914 1.00 21.73  ? 233  ARG B CA    1 
ATOM   6708  C C     . ARG B 1 233 ? -24.220 69.876  -11.741 1.00 21.45  ? 233  ARG B C     1 
ATOM   6709  O O     . ARG B 1 233 ? -24.589 70.721  -10.918 1.00 20.66  ? 233  ARG B O     1 
ATOM   6710  C CB    . ARG B 1 233 ? -25.682 68.063  -12.650 1.00 22.12  ? 233  ARG B CB    1 
ATOM   6711  C CG    . ARG B 1 233 ? -26.573 67.960  -11.400 1.00 20.97  ? 233  ARG B CG    1 
ATOM   6712  C CD    . ARG B 1 233 ? -26.850 66.511  -11.003 1.00 21.22  ? 233  ARG B CD    1 
ATOM   6713  N NE    . ARG B 1 233 ? -25.650 65.844  -10.487 1.00 19.51  ? 233  ARG B NE    1 
ATOM   6714  C CZ    . ARG B 1 233 ? -25.573 64.550  -10.181 1.00 20.04  ? 233  ARG B CZ    1 
ATOM   6715  N NH1   . ARG B 1 233 ? -26.632 63.751  -10.334 1.00 21.04  ? 233  ARG B NH1   1 
ATOM   6716  N NH2   . ARG B 1 233 ? -24.434 64.049  -9.715  1.00 19.10  ? 233  ARG B NH2   1 
ATOM   6717  N N     . ASP B 1 234 ? -23.049 69.246  -11.673 1.00 20.75  ? 234  ASP B N     1 
ATOM   6718  C CA    . ASP B 1 234 ? -22.148 69.353  -10.538 1.00 20.09  ? 234  ASP B CA    1 
ATOM   6719  C C     . ASP B 1 234 ? -21.232 70.558  -10.692 1.00 19.90  ? 234  ASP B C     1 
ATOM   6720  O O     . ASP B 1 234 ? -20.684 70.788  -11.764 1.00 19.61  ? 234  ASP B O     1 
ATOM   6721  C CB    . ASP B 1 234 ? -21.317 68.079  -10.413 1.00 19.71  ? 234  ASP B CB    1 
ATOM   6722  C CG    . ASP B 1 234 ? -22.157 66.861  -10.061 1.00 19.26  ? 234  ASP B CG    1 
ATOM   6723  O OD1   . ASP B 1 234 ? -23.304 67.020  -9.605  1.00 17.72  ? 234  ASP B OD1   1 
ATOM   6724  O OD2   . ASP B 1 234 ? -21.659 65.734  -10.229 1.00 20.27  ? 234  ASP B OD2   1 
ATOM   6725  N N     . LEU B 1 235 ? -21.085 71.322  -9.613  1.00 19.61  ? 235  LEU B N     1 
ATOM   6726  C CA    . LEU B 1 235 ? -20.267 72.546  -9.607  1.00 19.74  ? 235  LEU B CA    1 
ATOM   6727  C C     . LEU B 1 235 ? -19.419 72.569  -8.337  1.00 19.91  ? 235  LEU B C     1 
ATOM   6728  O O     . LEU B 1 235 ? -19.915 72.243  -7.265  1.00 20.29  ? 235  LEU B O     1 
ATOM   6729  C CB    . LEU B 1 235 ? -21.163 73.793  -9.654  1.00 19.11  ? 235  LEU B CB    1 
ATOM   6730  C CG    . LEU B 1 235 ? -22.195 73.925  -10.794 1.00 18.63  ? 235  LEU B CG    1 
ATOM   6731  C CD1   . LEU B 1 235 ? -23.094 75.123  -10.555 1.00 18.06  ? 235  LEU B CD1   1 
ATOM   6732  C CD2   . LEU B 1 235 ? -21.520 74.031  -12.157 1.00 17.24  ? 235  LEU B CD2   1 
ATOM   6733  N N     . TRP B 1 236 ? -18.150 72.942  -8.461  1.00 19.93  ? 236  TRP B N     1 
ATOM   6734  C CA    . TRP B 1 236 ? -17.275 73.044  -7.302  1.00 20.48  ? 236  TRP B CA    1 
ATOM   6735  C C     . TRP B 1 236 ? -17.506 74.350  -6.548  1.00 21.19  ? 236  TRP B C     1 
ATOM   6736  O O     . TRP B 1 236 ? -17.495 75.438  -7.143  1.00 20.87  ? 236  TRP B O     1 
ATOM   6737  C CB    . TRP B 1 236 ? -15.808 72.927  -7.714  1.00 20.12  ? 236  TRP B CB    1 
ATOM   6738  C CG    . TRP B 1 236 ? -15.378 71.531  -8.092  1.00 19.56  ? 236  TRP B CG    1 
ATOM   6739  C CD1   . TRP B 1 236 ? -15.041 71.081  -9.343  1.00 19.26  ? 236  TRP B CD1   1 
ATOM   6740  C CD2   . TRP B 1 236 ? -15.214 70.413  -7.210  1.00 18.78  ? 236  TRP B CD2   1 
ATOM   6741  N NE1   . TRP B 1 236 ? -14.682 69.756  -9.291  1.00 18.56  ? 236  TRP B NE1   1 
ATOM   6742  C CE2   . TRP B 1 236 ? -14.778 69.319  -7.996  1.00 19.22  ? 236  TRP B CE2   1 
ATOM   6743  C CE3   . TRP B 1 236 ? -15.386 70.228  -5.827  1.00 19.50  ? 236  TRP B CE3   1 
ATOM   6744  C CZ2   . TRP B 1 236 ? -14.521 68.057  -7.449  1.00 19.42  ? 236  TRP B CZ2   1 
ATOM   6745  C CZ3   . TRP B 1 236 ? -15.139 68.972  -5.285  1.00 19.18  ? 236  TRP B CZ3   1 
ATOM   6746  C CH2   . TRP B 1 236 ? -14.710 67.902  -6.096  1.00 19.39  ? 236  TRP B CH2   1 
ATOM   6747  N N     . TRP B 1 237 ? -17.710 74.227  -5.238  1.00 21.86  ? 237  TRP B N     1 
ATOM   6748  C CA    . TRP B 1 237 ? -17.861 75.376  -4.337  1.00 22.71  ? 237  TRP B CA    1 
ATOM   6749  C C     . TRP B 1 237 ? -16.833 76.483  -4.627  1.00 23.43  ? 237  TRP B C     1 
ATOM   6750  O O     . TRP B 1 237 ? -17.202 77.635  -4.845  1.00 23.61  ? 237  TRP B O     1 
ATOM   6751  C CB    . TRP B 1 237 ? -17.764 74.908  -2.878  1.00 22.48  ? 237  TRP B CB    1 
ATOM   6752  C CG    . TRP B 1 237 ? -17.803 76.013  -1.846  1.00 22.35  ? 237  TRP B CG    1 
ATOM   6753  C CD1   . TRP B 1 237 ? -16.803 76.901  -1.545  1.00 23.23  ? 237  TRP B CD1   1 
ATOM   6754  C CD2   . TRP B 1 237 ? -18.882 76.313  -0.953  1.00 22.30  ? 237  TRP B CD2   1 
ATOM   6755  N NE1   . TRP B 1 237 ? -17.208 77.752  -0.541  1.00 22.72  ? 237  TRP B NE1   1 
ATOM   6756  C CE2   . TRP B 1 237 ? -18.477 77.409  -0.157  1.00 22.36  ? 237  TRP B CE2   1 
ATOM   6757  C CE3   . TRP B 1 237 ? -20.160 75.769  -0.757  1.00 22.14  ? 237  TRP B CE3   1 
ATOM   6758  C CZ2   . TRP B 1 237 ? -19.307 77.977  0.817   1.00 22.69  ? 237  TRP B CZ2   1 
ATOM   6759  C CZ3   . TRP B 1 237 ? -20.983 76.335  0.216   1.00 23.11  ? 237  TRP B CZ3   1 
ATOM   6760  C CH2   . TRP B 1 237 ? -20.552 77.427  0.984   1.00 22.67  ? 237  TRP B CH2   1 
ATOM   6761  N N     . ARG B 1 238 ? -15.553 76.121  -4.647  1.00 24.48  ? 238  ARG B N     1 
ATOM   6762  C CA    . ARG B 1 238 ? -14.477 77.105  -4.775  1.00 25.60  ? 238  ARG B CA    1 
ATOM   6763  C C     . ARG B 1 238 ? -14.508 77.822  -6.121  1.00 26.21  ? 238  ARG B C     1 
ATOM   6764  O O     . ARG B 1 238 ? -14.429 79.052  -6.165  1.00 26.46  ? 238  ARG B O     1 
ATOM   6765  C CB    . ARG B 1 238 ? -13.112 76.457  -4.518  1.00 25.39  ? 238  ARG B CB    1 
ATOM   6766  C CG    . ARG B 1 238 ? -11.914 77.332  -4.849  1.00 26.47  ? 238  ARG B CG    1 
ATOM   6767  C CD    . ARG B 1 238 ? -10.644 76.659  -4.382  1.00 28.62  ? 238  ARG B CD    1 
ATOM   6768  N NE    . ARG B 1 238 ? -9.433  77.345  -4.815  1.00 28.87  ? 238  ARG B NE    1 
ATOM   6769  C CZ    . ARG B 1 238 ? -8.215  76.822  -4.719  1.00 29.79  ? 238  ARG B CZ    1 
ATOM   6770  N NH1   . ARG B 1 238 ? -8.054  75.608  -4.203  1.00 29.69  ? 238  ARG B NH1   1 
ATOM   6771  N NH2   . ARG B 1 238 ? -7.158  77.505  -5.145  1.00 30.71  ? 238  ARG B NH2   1 
ATOM   6772  N N     . ASP B 1 239 ? -14.630 77.067  -7.214  1.00 27.11  ? 239  ASP B N     1 
ATOM   6773  C CA    . ASP B 1 239 ? -14.749 77.674  -8.546  1.00 27.68  ? 239  ASP B CA    1 
ATOM   6774  C C     . ASP B 1 239 ? -15.882 78.697  -8.590  1.00 27.39  ? 239  ASP B C     1 
ATOM   6775  O O     . ASP B 1 239 ? -15.745 79.765  -9.187  1.00 27.22  ? 239  ASP B O     1 
ATOM   6776  C CB    . ASP B 1 239 ? -14.989 76.613  -9.626  1.00 28.56  ? 239  ASP B CB    1 
ATOM   6777  C CG    . ASP B 1 239 ? -13.711 75.897  -10.045 1.00 30.70  ? 239  ASP B CG    1 
ATOM   6778  O OD1   . ASP B 1 239 ? -12.668 76.574  -10.222 1.00 32.66  ? 239  ASP B OD1   1 
ATOM   6779  O OD2   . ASP B 1 239 ? -13.762 74.650  -10.214 1.00 33.20  ? 239  ASP B OD2   1 
ATOM   6780  N N     . LEU B 1 240 ? -16.996 78.364  -7.951  1.00 26.96  ? 240  LEU B N     1 
ATOM   6781  C CA    . LEU B 1 240 ? -18.167 79.234  -7.947  1.00 26.97  ? 240  LEU B CA    1 
ATOM   6782  C C     . LEU B 1 240 ? -17.952 80.506  -7.142  1.00 26.95  ? 240  LEU B C     1 
ATOM   6783  O O     . LEU B 1 240 ? -18.187 81.597  -7.653  1.00 27.05  ? 240  LEU B O     1 
ATOM   6784  C CB    . LEU B 1 240 ? -19.407 78.496  -7.427  1.00 26.62  ? 240  LEU B CB    1 
ATOM   6785  C CG    . LEU B 1 240 ? -20.094 77.469  -8.325  1.00 25.88  ? 240  LEU B CG    1 
ATOM   6786  C CD1   . LEU B 1 240 ? -21.298 76.901  -7.593  1.00 24.42  ? 240  LEU B CD1   1 
ATOM   6787  C CD2   . LEU B 1 240 ? -20.520 78.091  -9.639  1.00 26.53  ? 240  LEU B CD2   1 
ATOM   6788  N N     . ILE B 1 241 ? -17.492 80.361  -5.901  1.00 27.34  ? 241  ILE B N     1 
ATOM   6789  C CA    . ILE B 1 241 ? -17.431 81.485  -4.958  1.00 28.00  ? 241  ILE B CA    1 
ATOM   6790  C C     . ILE B 1 241 ? -16.352 82.526  -5.307  1.00 28.69  ? 241  ILE B C     1 
ATOM   6791  O O     . ILE B 1 241 ? -16.522 83.728  -5.046  1.00 28.45  ? 241  ILE B O     1 
ATOM   6792  C CB    . ILE B 1 241 ? -17.289 80.996  -3.485  1.00 28.00  ? 241  ILE B CB    1 
ATOM   6793  C CG1   . ILE B 1 241 ? -17.841 82.047  -2.510  1.00 28.20  ? 241  ILE B CG1   1 
ATOM   6794  C CG2   . ILE B 1 241 ? -15.838 80.575  -3.158  1.00 27.60  ? 241  ILE B CG2   1 
ATOM   6795  C CD1   . ILE B 1 241 ? -18.077 81.537  -1.070  1.00 28.29  ? 241  ILE B CD1   1 
ATOM   6796  N N     . GLU B 1 242 ? -15.255 82.063  -5.906  1.00 29.17  ? 242  GLU B N     1 
ATOM   6797  C CA    . GLU B 1 242 ? -14.159 82.951  -6.270  1.00 30.11  ? 242  GLU B CA    1 
ATOM   6798  C C     . GLU B 1 242 ? -14.548 83.860  -7.446  1.00 29.89  ? 242  GLU B C     1 
ATOM   6799  O O     . GLU B 1 242 ? -14.038 84.976  -7.561  1.00 30.35  ? 242  GLU B O     1 
ATOM   6800  C CB    . GLU B 1 242 ? -12.867 82.157  -6.532  1.00 30.03  ? 242  GLU B CB    1 
ATOM   6801  C CG    . GLU B 1 242 ? -12.302 81.476  -5.263  1.00 31.11  ? 242  GLU B CG    1 
ATOM   6802  C CD    . GLU B 1 242 ? -10.959 80.749  -5.470  1.00 31.64  ? 242  GLU B CD    1 
ATOM   6803  O OE1   . GLU B 1 242 ? -10.475 80.644  -6.624  1.00 34.17  ? 242  GLU B OE1   1 
ATOM   6804  O OE2   . GLU B 1 242 ? -10.386 80.279  -4.459  1.00 33.00  ? 242  GLU B OE2   1 
ATOM   6805  N N     . LYS B 1 243 ? -15.474 83.391  -8.284  1.00 29.77  ? 243  LYS B N     1 
ATOM   6806  C CA    . LYS B 1 243 ? -16.008 84.173  -9.408  1.00 29.73  ? 243  LYS B CA    1 
ATOM   6807  C C     . LYS B 1 243 ? -17.108 85.177  -9.017  1.00 29.82  ? 243  LYS B C     1 
ATOM   6808  O O     . LYS B 1 243 ? -17.422 86.084  -9.788  1.00 30.01  ? 243  LYS B O     1 
ATOM   6809  C CB    . LYS B 1 243 ? -16.531 83.243  -10.514 1.00 29.75  ? 243  LYS B CB    1 
ATOM   6810  N N     . ALA B 1 244 ? -17.692 85.019  -7.830  1.00 29.66  ? 244  ALA B N     1 
ATOM   6811  C CA    . ALA B 1 244 ? -18.825 85.857  -7.413  1.00 29.41  ? 244  ALA B CA    1 
ATOM   6812  C C     . ALA B 1 244 ? -18.412 87.137  -6.678  1.00 29.36  ? 244  ALA B C     1 
ATOM   6813  O O     . ALA B 1 244 ? -17.412 87.160  -5.954  1.00 29.17  ? 244  ALA B O     1 
ATOM   6814  C CB    . ALA B 1 244 ? -19.797 85.047  -6.566  1.00 28.99  ? 244  ALA B CB    1 
ATOM   6815  N N     . SER B 1 245 ? -19.209 88.189  -6.857  1.00 29.34  ? 245  SER B N     1 
ATOM   6816  C CA    . SER B 1 245 ? -18.960 89.483  -6.220  1.00 29.41  ? 245  SER B CA    1 
ATOM   6817  C C     . SER B 1 245 ? -19.154 89.425  -4.707  1.00 29.22  ? 245  SER B C     1 
ATOM   6818  O O     . SER B 1 245 ? -20.109 88.810  -4.231  1.00 28.75  ? 245  SER B O     1 
ATOM   6819  C CB    . SER B 1 245 ? -19.856 90.575  -6.821  1.00 29.48  ? 245  SER B CB    1 
ATOM   6820  O OG    . SER B 1 245 ? -19.882 91.726  -5.986  1.00 29.91  ? 245  SER B OG    1 
ATOM   6821  N N     . PRO B 1 246 ? -18.235 90.059  -3.949  1.00 29.33  ? 246  PRO B N     1 
ATOM   6822  C CA    . PRO B 1 246 ? -18.318 90.138  -2.481  1.00 29.52  ? 246  PRO B CA    1 
ATOM   6823  C C     . PRO B 1 246 ? -19.335 91.149  -1.969  1.00 29.72  ? 246  PRO B C     1 
ATOM   6824  O O     . PRO B 1 246 ? -19.535 91.260  -0.750  1.00 29.66  ? 246  PRO B O     1 
ATOM   6825  C CB    . PRO B 1 246 ? -16.908 90.576  -2.072  1.00 29.54  ? 246  PRO B CB    1 
ATOM   6826  C CG    . PRO B 1 246 ? -16.393 91.323  -3.239  1.00 29.49  ? 246  PRO B CG    1 
ATOM   6827  C CD    . PRO B 1 246 ? -17.017 90.707  -4.469  1.00 29.29  ? 246  PRO B CD    1 
ATOM   6828  N N     . GLU B 1 247 ? -19.944 91.899  -2.884  1.00 29.81  ? 247  GLU B N     1 
ATOM   6829  C CA    . GLU B 1 247 ? -20.955 92.882  -2.513  1.00 30.28  ? 247  GLU B CA    1 
ATOM   6830  C C     . GLU B 1 247 ? -22.341 92.314  -2.759  1.00 29.90  ? 247  GLU B C     1 
ATOM   6831  O O     . GLU B 1 247 ? -22.659 91.871  -3.869  1.00 29.45  ? 247  GLU B O     1 
ATOM   6832  C CB    . GLU B 1 247 ? -20.782 94.195  -3.289  1.00 30.45  ? 247  GLU B CB    1 
ATOM   6833  C CG    . GLU B 1 247 ? -19.385 94.809  -3.222  1.00 33.44  ? 247  GLU B CG    1 
ATOM   6834  C CD    . GLU B 1 247 ? -18.966 95.201  -1.812  1.00 36.88  ? 247  GLU B CD    1 
ATOM   6835  O OE1   . GLU B 1 247 ? -19.844 95.538  -0.981  1.00 37.92  ? 247  GLU B OE1   1 
ATOM   6836  O OE2   . GLU B 1 247 ? -17.744 95.179  -1.539  1.00 39.18  ? 247  GLU B OE2   1 
ATOM   6837  N N     . HIS B 1 248 ? -23.151 92.317  -1.706  1.00 29.90  ? 248  HIS B N     1 
ATOM   6838  C CA    . HIS B 1 248 ? -24.543 91.919  -1.800  1.00 30.27  ? 248  HIS B CA    1 
ATOM   6839  C C     . HIS B 1 248 ? -25.401 92.760  -0.865  1.00 30.79  ? 248  HIS B C     1 
ATOM   6840  O O     . HIS B 1 248 ? -25.137 92.845  0.333   1.00 30.59  ? 248  HIS B O     1 
ATOM   6841  C CB    . HIS B 1 248 ? -24.730 90.425  -1.495  1.00 30.12  ? 248  HIS B CB    1 
ATOM   6842  C CG    . HIS B 1 248 ? -26.143 89.962  -1.659  1.00 29.74  ? 248  HIS B CG    1 
ATOM   6843  N ND1   . HIS B 1 248 ? -27.061 89.998  -0.632  1.00 28.60  ? 248  HIS B ND1   1 
ATOM   6844  C CD2   . HIS B 1 248 ? -26.809 89.501  -2.743  1.00 29.93  ? 248  HIS B CD2   1 
ATOM   6845  C CE1   . HIS B 1 248 ? -28.227 89.558  -1.069  1.00 29.31  ? 248  HIS B CE1   1 
ATOM   6846  N NE2   . HIS B 1 248 ? -28.101 89.247  -2.347  1.00 30.97  ? 248  HIS B NE2   1 
ATOM   6847  N N     . GLN B 1 249 ? -26.423 93.386  -1.435  1.00 31.89  ? 249  GLN B N     1 
ATOM   6848  C CA    . GLN B 1 249 ? -27.371 94.213  -0.689  1.00 33.01  ? 249  GLN B CA    1 
ATOM   6849  C C     . GLN B 1 249 ? -28.477 93.303  -0.149  1.00 33.41  ? 249  GLN B C     1 
ATOM   6850  O O     . GLN B 1 249 ? -29.143 92.608  -0.921  1.00 33.60  ? 249  GLN B O     1 
ATOM   6851  C CB    . GLN B 1 249 ? -27.916 95.325  -1.607  1.00 33.36  ? 249  GLN B CB    1 
ATOM   6852  C CG    . GLN B 1 249 ? -29.328 95.857  -1.310  1.00 34.76  ? 249  GLN B CG    1 
ATOM   6853  C CD    . GLN B 1 249 ? -29.380 96.841  -0.152  1.00 36.02  ? 249  GLN B CD    1 
ATOM   6854  O OE1   . GLN B 1 249 ? -30.205 96.700  0.749   1.00 36.82  ? 249  GLN B OE1   1 
ATOM   6855  N NE2   . GLN B 1 249 ? -28.505 97.842  -0.173  1.00 35.66  ? 249  GLN B NE2   1 
ATOM   6856  N N     . PRO B 1 250 ? -28.661 93.277  1.185   1.00 33.87  ? 250  PRO B N     1 
ATOM   6857  C CA    . PRO B 1 250 ? -29.720 92.408  1.702   1.00 34.06  ? 250  PRO B CA    1 
ATOM   6858  C C     . PRO B 1 250 ? -31.095 93.057  1.526   1.00 34.30  ? 250  PRO B C     1 
ATOM   6859  O O     . PRO B 1 250 ? -31.231 94.282  1.631   1.00 34.40  ? 250  PRO B O     1 
ATOM   6860  C CB    . PRO B 1 250 ? -29.371 92.241  3.186   1.00 34.02  ? 250  PRO B CB    1 
ATOM   6861  C CG    . PRO B 1 250 ? -28.242 93.215  3.471   1.00 34.27  ? 250  PRO B CG    1 
ATOM   6862  C CD    . PRO B 1 250 ? -27.975 94.028  2.251   1.00 33.81  ? 250  PRO B CD    1 
ATOM   6863  N N     . GLU B 1 251 ? -32.098 92.238  1.248   1.00 34.40  ? 251  GLU B N     1 
ATOM   6864  C CA    . GLU B 1 251 ? -33.447 92.730  1.012   1.00 34.77  ? 251  GLU B CA    1 
ATOM   6865  C C     . GLU B 1 251 ? -34.344 92.372  2.190   1.00 33.82  ? 251  GLU B C     1 
ATOM   6866  O O     . GLU B 1 251 ? -34.152 91.341  2.850   1.00 34.09  ? 251  GLU B O     1 
ATOM   6867  C CB    . GLU B 1 251 ? -34.025 92.145  -0.287  1.00 35.55  ? 251  GLU B CB    1 
ATOM   6868  C CG    . GLU B 1 251 ? -33.166 92.360  -1.547  1.00 38.16  ? 251  GLU B CG    1 
ATOM   6869  C CD    . GLU B 1 251 ? -33.430 93.680  -2.229  1.00 42.11  ? 251  GLU B CD    1 
ATOM   6870  O OE1   . GLU B 1 251 ? -34.380 94.385  -1.820  1.00 43.78  ? 251  GLU B OE1   1 
ATOM   6871  O OE2   . GLU B 1 251 ? -32.686 94.016  -3.183  1.00 44.12  ? 251  GLU B OE2   1 
ATOM   6872  N N     . ALA B 1 252 ? -35.327 93.228  2.444   1.00 32.62  ? 252  ALA B N     1 
ATOM   6873  C CA    . ALA B 1 252 ? -36.255 93.024  3.540   1.00 31.16  ? 252  ALA B CA    1 
ATOM   6874  C C     . ALA B 1 252 ? -37.136 91.800  3.304   1.00 30.20  ? 252  ALA B C     1 
ATOM   6875  O O     . ALA B 1 252 ? -37.741 91.647  2.241   1.00 29.94  ? 252  ALA B O     1 
ATOM   6876  C CB    . ALA B 1 252 ? -37.096 94.276  3.754   1.00 31.29  ? 252  ALA B CB    1 
ATOM   6877  N N     . MET B 1 253 ? -37.165 90.920  4.299   1.00 28.88  ? 253  MET B N     1 
ATOM   6878  C CA    . MET B 1 253 ? -38.069 89.786  4.330   1.00 28.20  ? 253  MET B CA    1 
ATOM   6879  C C     . MET B 1 253 ? -39.168 90.120  5.318   1.00 27.68  ? 253  MET B C     1 
ATOM   6880  O O     . MET B 1 253 ? -38.896 90.758  6.336   1.00 27.37  ? 253  MET B O     1 
ATOM   6881  C CB    . MET B 1 253 ? -37.333 88.520  4.814   1.00 28.35  ? 253  MET B CB    1 
ATOM   6882  C CG    . MET B 1 253 ? -36.138 88.104  3.957   1.00 28.94  ? 253  MET B CG    1 
ATOM   6883  S SD    . MET B 1 253 ? -36.582 87.954  2.203   1.00 31.72  ? 253  MET B SD    1 
ATOM   6884  C CE    . MET B 1 253 ? -35.061 88.458  1.386   1.00 30.87  ? 253  MET B CE    1 
ATOM   6885  N N     . ASN B 1 254 ? -40.399 89.688  5.041   1.00 26.65  ? 254  ASN B N     1 
ATOM   6886  C CA    . ASN B 1 254 ? -41.448 89.785  6.049   1.00 26.17  ? 254  ASN B CA    1 
ATOM   6887  C C     . ASN B 1 254 ? -41.123 88.843  7.208   1.00 25.30  ? 254  ASN B C     1 
ATOM   6888  O O     . ASN B 1 254 ? -40.532 87.793  6.997   1.00 24.92  ? 254  ASN B O     1 
ATOM   6889  C CB    . ASN B 1 254 ? -42.825 89.459  5.466   1.00 26.82  ? 254  ASN B CB    1 
ATOM   6890  C CG    . ASN B 1 254 ? -43.955 89.669  6.478   1.00 28.24  ? 254  ASN B CG    1 
ATOM   6891  O OD1   . ASN B 1 254 ? -44.520 88.702  7.014   1.00 28.98  ? 254  ASN B OD1   1 
ATOM   6892  N ND2   . ASN B 1 254 ? -44.274 90.940  6.761   1.00 29.12  ? 254  ASN B ND2   1 
ATOM   6893  N N     . ALA B 1 255 ? -41.501 89.241  8.421   1.00 24.53  ? 255  ALA B N     1 
ATOM   6894  C CA    . ALA B 1 255 ? -41.308 88.439  9.629   1.00 24.15  ? 255  ALA B CA    1 
ATOM   6895  C C     . ALA B 1 255 ? -41.863 87.022  9.501   1.00 23.82  ? 255  ALA B C     1 
ATOM   6896  O O     . ALA B 1 255 ? -41.319 86.089  10.095  1.00 24.23  ? 255  ALA B O     1 
ATOM   6897  C CB    . ALA B 1 255 ? -41.919 89.139  10.838  1.00 23.63  ? 255  ALA B CB    1 
ATOM   6898  N N     . GLU B 1 256 ? -42.933 86.871  8.720   1.00 23.46  ? 256  GLU B N     1 
ATOM   6899  C CA    . GLU B 1 256 ? -43.600 85.582  8.544   1.00 22.90  ? 256  GLU B CA    1 
ATOM   6900  C C     . GLU B 1 256 ? -43.215 84.853  7.255   1.00 22.81  ? 256  GLU B C     1 
ATOM   6901  O O     . GLU B 1 256 ? -43.809 83.816  6.927   1.00 22.57  ? 256  GLU B O     1 
ATOM   6902  C CB    . GLU B 1 256 ? -45.130 85.717  8.674   1.00 22.89  ? 256  GLU B CB    1 
ATOM   6903  C CG    . GLU B 1 256 ? -45.631 85.970  10.110  1.00 22.46  ? 256  GLU B CG    1 
ATOM   6904  C CD    . GLU B 1 256 ? -45.208 84.888  11.120  1.00 22.56  ? 256  GLU B CD    1 
ATOM   6905  O OE1   . GLU B 1 256 ? -44.917 83.736  10.719  1.00 21.92  ? 256  GLU B OE1   1 
ATOM   6906  O OE2   . GLU B 1 256 ? -45.168 85.195  12.329  1.00 22.62  ? 256  GLU B OE2   1 
ATOM   6907  N N     . ASP B 1 257 ? -42.218 85.382  6.544   1.00 22.23  ? 257  ASP B N     1 
ATOM   6908  C CA    . ASP B 1 257 ? -41.593 84.657  5.433   1.00 22.40  ? 257  ASP B CA    1 
ATOM   6909  C C     . ASP B 1 257 ? -40.861 83.422  5.954   1.00 22.29  ? 257  ASP B C     1 
ATOM   6910  O O     . ASP B 1 257 ? -40.142 83.513  6.953   1.00 22.02  ? 257  ASP B O     1 
ATOM   6911  C CB    . ASP B 1 257 ? -40.615 85.548  4.661   1.00 22.40  ? 257  ASP B CB    1 
ATOM   6912  C CG    . ASP B 1 257 ? -41.322 86.494  3.689   1.00 22.75  ? 257  ASP B CG    1 
ATOM   6913  O OD1   . ASP B 1 257 ? -42.488 86.228  3.333   1.00 22.83  ? 257  ASP B OD1   1 
ATOM   6914  O OD2   . ASP B 1 257 ? -40.702 87.496  3.277   1.00 22.49  ? 257  ASP B OD2   1 
ATOM   6915  N N     . PRO B 1 258 ? -41.041 82.267  5.273   1.00 22.26  ? 258  PRO B N     1 
ATOM   6916  C CA    . PRO B 1 258 ? -40.421 81.022  5.727   1.00 22.40  ? 258  PRO B CA    1 
ATOM   6917  C C     . PRO B 1 258 ? -38.905 81.172  5.731   1.00 22.58  ? 258  PRO B C     1 
ATOM   6918  O O     . PRO B 1 258 ? -38.343 81.725  4.777   1.00 22.84  ? 258  PRO B O     1 
ATOM   6919  C CB    . PRO B 1 258 ? -40.849 79.995  4.669   1.00 22.14  ? 258  PRO B CB    1 
ATOM   6920  C CG    . PRO B 1 258 ? -41.253 80.826  3.456   1.00 22.95  ? 258  PRO B CG    1 
ATOM   6921  C CD    . PRO B 1 258 ? -41.813 82.092  4.023   1.00 21.89  ? 258  PRO B CD    1 
ATOM   6922  N N     . LEU B 1 259 ? -38.263 80.689  6.795   1.00 21.87  ? 259  LEU B N     1 
ATOM   6923  C CA    . LEU B 1 259 ? -36.811 80.734  6.920   1.00 21.53  ? 259  LEU B CA    1 
ATOM   6924  C C     . LEU B 1 259 ? -36.188 79.377  6.628   1.00 21.71  ? 259  LEU B C     1 
ATOM   6925  O O     . LEU B 1 259 ? -35.247 79.278  5.846   1.00 22.27  ? 259  LEU B O     1 
ATOM   6926  C CB    . LEU B 1 259 ? -36.400 81.212  8.315   1.00 21.42  ? 259  LEU B CB    1 
ATOM   6927  C CG    . LEU B 1 259 ? -34.906 81.164  8.675   1.00 21.61  ? 259  LEU B CG    1 
ATOM   6928  C CD1   . LEU B 1 259 ? -34.068 82.149  7.839   1.00 22.07  ? 259  LEU B CD1   1 
ATOM   6929  C CD2   . LEU B 1 259 ? -34.712 81.398  10.166  1.00 20.58  ? 259  LEU B CD2   1 
ATOM   6930  N N     . PHE B 1 260 ? -36.707 78.333  7.261   1.00 21.57  ? 260  PHE B N     1 
ATOM   6931  C CA    . PHE B 1 260 ? -36.208 76.982  7.021   1.00 21.70  ? 260  PHE B CA    1 
ATOM   6932  C C     . PHE B 1 260 ? -37.217 75.869  7.303   1.00 21.66  ? 260  PHE B C     1 
ATOM   6933  O O     . PHE B 1 260 ? -38.236 76.068  7.976   1.00 21.26  ? 260  PHE B O     1 
ATOM   6934  C CB    . PHE B 1 260 ? -34.865 76.722  7.752   1.00 21.68  ? 260  PHE B CB    1 
ATOM   6935  C CG    . PHE B 1 260 ? -34.966 76.626  9.257   1.00 22.18  ? 260  PHE B CG    1 
ATOM   6936  C CD1   . PHE B 1 260 ? -35.467 75.477  9.867   1.00 21.43  ? 260  PHE B CD1   1 
ATOM   6937  C CD2   . PHE B 1 260 ? -34.497 77.668  10.065  1.00 22.71  ? 260  PHE B CD2   1 
ATOM   6938  C CE1   . PHE B 1 260 ? -35.539 75.378  11.253  1.00 23.06  ? 260  PHE B CE1   1 
ATOM   6939  C CE2   . PHE B 1 260 ? -34.576 77.587  11.459  1.00 23.09  ? 260  PHE B CE2   1 
ATOM   6940  C CZ    . PHE B 1 260 ? -35.095 76.439  12.055  1.00 23.59  ? 260  PHE B CZ    1 
ATOM   6941  N N     . ILE B 1 261 ? -36.899 74.696  6.769   1.00 21.94  ? 261  ILE B N     1 
ATOM   6942  C CA    . ILE B 1 261 ? -37.654 73.474  6.998   1.00 22.26  ? 261  ILE B CA    1 
ATOM   6943  C C     . ILE B 1 261 ? -36.682 72.445  7.573   1.00 22.33  ? 261  ILE B C     1 
ATOM   6944  O O     . ILE B 1 261 ? -35.528 72.339  7.118   1.00 21.97  ? 261  ILE B O     1 
ATOM   6945  C CB    . ILE B 1 261 ? -38.292 72.962  5.683   1.00 22.37  ? 261  ILE B CB    1 
ATOM   6946  C CG1   . ILE B 1 261 ? -39.395 73.924  5.214   1.00 22.91  ? 261  ILE B CG1   1 
ATOM   6947  C CG2   . ILE B 1 261 ? -38.877 71.562  5.867   1.00 24.00  ? 261  ILE B CG2   1 
ATOM   6948  C CD1   . ILE B 1 261 ? -39.645 73.872  3.713   1.00 24.04  ? 261  ILE B CD1   1 
ATOM   6949  N N     . LEU B 1 262 ? -37.133 71.724  8.594   1.00 22.08  ? 262  LEU B N     1 
ATOM   6950  C CA    . LEU B 1 262 ? -36.347 70.633  9.182   1.00 22.53  ? 262  LEU B CA    1 
ATOM   6951  C C     . LEU B 1 262 ? -37.210 69.409  9.299   1.00 22.10  ? 262  LEU B C     1 
ATOM   6952  O O     . LEU B 1 262 ? -38.200 69.413  10.032  1.00 21.83  ? 262  LEU B O     1 
ATOM   6953  C CB    . LEU B 1 262 ? -35.821 70.983  10.577  1.00 22.38  ? 262  LEU B CB    1 
ATOM   6954  C CG    . LEU B 1 262 ? -34.365 71.361  10.753  1.00 23.73  ? 262  LEU B CG    1 
ATOM   6955  C CD1   . LEU B 1 262 ? -34.091 71.570  12.233  1.00 21.54  ? 262  LEU B CD1   1 
ATOM   6956  C CD2   . LEU B 1 262 ? -33.408 70.302  10.149  1.00 23.11  ? 262  LEU B CD2   1 
ATOM   6957  N N     . TYR B 1 263 ? -36.831 68.368  8.574   1.00 22.14  ? 263  TYR B N     1 
ATOM   6958  C CA    . TYR B 1 263 ? -37.544 67.114  8.638   1.00 22.71  ? 263  TYR B CA    1 
ATOM   6959  C C     . TYR B 1 263 ? -37.355 66.469  9.994   1.00 22.79  ? 263  TYR B C     1 
ATOM   6960  O O     . TYR B 1 263 ? -36.224 66.308  10.479  1.00 22.29  ? 263  TYR B O     1 
ATOM   6961  C CB    . TYR B 1 263 ? -37.191 66.206  7.453   1.00 22.99  ? 263  TYR B CB    1 
ATOM   6962  C CG    . TYR B 1 263 ? -37.869 66.746  6.208   1.00 24.42  ? 263  TYR B CG    1 
ATOM   6963  C CD1   . TYR B 1 263 ? -37.261 67.738  5.436   1.00 24.71  ? 263  TYR B CD1   1 
ATOM   6964  C CD2   . TYR B 1 263 ? -39.154 66.330  5.860   1.00 24.58  ? 263  TYR B CD2   1 
ATOM   6965  C CE1   . TYR B 1 263 ? -37.897 68.274  4.325   1.00 25.55  ? 263  TYR B CE1   1 
ATOM   6966  C CE2   . TYR B 1 263 ? -39.806 66.856  4.745   1.00 25.07  ? 263  TYR B CE2   1 
ATOM   6967  C CZ    . TYR B 1 263 ? -39.167 67.829  3.985   1.00 25.61  ? 263  TYR B CZ    1 
ATOM   6968  O OH    . TYR B 1 263 ? -39.796 68.368  2.888   1.00 24.98  ? 263  TYR B OH    1 
ATOM   6969  N N     . THR B 1 264 ? -38.499 66.154  10.600  1.00 22.46  ? 264  THR B N     1 
ATOM   6970  C CA    . THR B 1 264 ? -38.586 65.741  11.985  1.00 22.23  ? 264  THR B CA    1 
ATOM   6971  C C     . THR B 1 264 ? -39.508 64.532  12.091  1.00 22.34  ? 264  THR B C     1 
ATOM   6972  O O     . THR B 1 264 ? -40.617 64.533  11.564  1.00 21.78  ? 264  THR B O     1 
ATOM   6973  C CB    . THR B 1 264 ? -39.132 66.894  12.874  1.00 22.26  ? 264  THR B CB    1 
ATOM   6974  O OG1   . THR B 1 264 ? -38.401 68.098  12.603  1.00 21.83  ? 264  THR B OG1   1 
ATOM   6975  C CG2   . THR B 1 264 ? -38.994 66.542  14.367  1.00 20.98  ? 264  THR B CG2   1 
ATOM   6976  N N     . SER B 1 265 ? -39.025 63.506  12.778  1.00 22.96  ? 265  SER B N     1 
ATOM   6977  C CA    . SER B 1 265 ? -39.787 62.286  13.010  1.00 23.72  ? 265  SER B CA    1 
ATOM   6978  C C     . SER B 1 265 ? -40.951 62.514  13.960  1.00 24.06  ? 265  SER B C     1 
ATOM   6979  O O     . SER B 1 265 ? -40.821 63.241  14.946  1.00 23.94  ? 265  SER B O     1 
ATOM   6980  C CB    . SER B 1 265 ? -38.877 61.213  13.602  1.00 23.49  ? 265  SER B CB    1 
ATOM   6981  O OG    . SER B 1 265 ? -37.841 60.858  12.703  1.00 24.26  ? 265  SER B OG    1 
ATOM   6982  N N     . GLY B 1 266 ? -42.078 61.878  13.662  1.00 24.77  ? 266  GLY B N     1 
ATOM   6983  C CA    . GLY B 1 266 ? -43.258 61.928  14.528  1.00 26.25  ? 266  GLY B CA    1 
ATOM   6984  C C     . GLY B 1 266 ? -43.760 60.559  14.985  1.00 27.30  ? 266  GLY B C     1 
ATOM   6985  O O     . GLY B 1 266 ? -43.207 59.519  14.610  1.00 26.26  ? 266  GLY B O     1 
ATOM   6986  N N     . SER B 1 267 ? -44.818 60.579  15.796  1.00 28.80  ? 267  SER B N     1 
ATOM   6987  C CA    . SER B 1 267 ? -45.432 59.375  16.355  1.00 31.17  ? 267  SER B CA    1 
ATOM   6988  C C     . SER B 1 267 ? -46.001 58.463  15.274  1.00 32.08  ? 267  SER B C     1 
ATOM   6989  O O     . SER B 1 267 ? -46.008 57.239  15.430  1.00 33.16  ? 267  SER B O     1 
ATOM   6990  C CB    . SER B 1 267 ? -46.539 59.752  17.358  1.00 31.44  ? 267  SER B CB    1 
ATOM   6991  O OG    . SER B 1 267 ? -46.977 58.614  18.088  1.00 33.24  ? 267  SER B OG    1 
ATOM   6992  N N     . THR B 1 268 ? -46.468 59.059  14.178  1.00 32.63  ? 268  THR B N     1 
ATOM   6993  C CA    . THR B 1 268 ? -47.021 58.297  13.061  1.00 33.39  ? 268  THR B CA    1 
ATOM   6994  C C     . THR B 1 268 ? -46.551 58.899  11.742  1.00 33.35  ? 268  THR B C     1 
ATOM   6995  O O     . THR B 1 268 ? -46.319 60.102  11.651  1.00 34.03  ? 268  THR B O     1 
ATOM   6996  C CB    . THR B 1 268 ? -48.577 58.291  13.073  1.00 33.66  ? 268  THR B CB    1 
ATOM   6997  O OG1   . THR B 1 268 ? -49.065 59.637  13.088  1.00 34.15  ? 268  THR B OG1   1 
ATOM   6998  C CG2   . THR B 1 268 ? -49.138 57.523  14.284  1.00 33.76  ? 268  THR B CG2   1 
ATOM   6999  N N     . GLY B 1 269 ? -46.416 58.057  10.726  1.00 33.09  ? 269  GLY B N     1 
ATOM   7000  C CA    . GLY B 1 269 ? -45.947 58.483  9.417   1.00 32.57  ? 269  GLY B CA    1 
ATOM   7001  C C     . GLY B 1 269 ? -44.462 58.780  9.331   1.00 32.58  ? 269  GLY B C     1 
ATOM   7002  O O     . GLY B 1 269 ? -43.742 58.752  10.339  1.00 32.95  ? 269  GLY B O     1 
ATOM   7003  N N     . LYS B 1 270 ? -44.015 59.060  8.109   1.00 32.05  ? 270  LYS B N     1 
ATOM   7004  C CA    . LYS B 1 270 ? -42.653 59.498  7.813   1.00 32.16  ? 270  LYS B CA    1 
ATOM   7005  C C     . LYS B 1 270 ? -42.364 60.905  8.374   1.00 30.55  ? 270  LYS B C     1 
ATOM   7006  O O     . LYS B 1 270 ? -43.300 61.651  8.685   1.00 30.22  ? 270  LYS B O     1 
ATOM   7007  C CB    . LYS B 1 270 ? -42.443 59.502  6.298   1.00 32.18  ? 270  LYS B CB    1 
ATOM   7008  C CG    . LYS B 1 270 ? -42.296 58.110  5.667   1.00 35.17  ? 270  LYS B CG    1 
ATOM   7009  C CD    . LYS B 1 270 ? -42.163 58.187  4.128   1.00 34.86  ? 270  LYS B CD    1 
ATOM   7010  C CE    . LYS B 1 270 ? -40.797 58.758  3.685   1.00 38.09  ? 270  LYS B CE    1 
ATOM   7011  N NZ    . LYS B 1 270 ? -40.716 58.926  2.185   1.00 38.40  ? 270  LYS B NZ    1 
ATOM   7012  N N     . PRO B 1 271 ? -41.070 61.267  8.517   1.00 29.17  ? 271  PRO B N     1 
ATOM   7013  C CA    . PRO B 1 271 ? -40.692 62.623  8.938   1.00 28.25  ? 271  PRO B CA    1 
ATOM   7014  C C     . PRO B 1 271 ? -41.351 63.743  8.106   1.00 27.72  ? 271  PRO B C     1 
ATOM   7015  O O     . PRO B 1 271 ? -41.474 63.618  6.884   1.00 27.71  ? 271  PRO B O     1 
ATOM   7016  C CB    . PRO B 1 271 ? -39.170 62.629  8.764   1.00 27.80  ? 271  PRO B CB    1 
ATOM   7017  C CG    . PRO B 1 271 ? -38.774 61.210  8.987   1.00 28.92  ? 271  PRO B CG    1 
ATOM   7018  C CD    . PRO B 1 271 ? -39.884 60.405  8.342   1.00 29.24  ? 271  PRO B CD    1 
ATOM   7019  N N     . LYS B 1 272 ? -41.793 64.805  8.778   1.00 26.69  ? 272  LYS B N     1 
ATOM   7020  C CA    . LYS B 1 272 ? -42.391 65.965  8.107   1.00 26.30  ? 272  LYS B CA    1 
ATOM   7021  C C     . LYS B 1 272 ? -41.537 67.201  8.295   1.00 25.33  ? 272  LYS B C     1 
ATOM   7022  O O     . LYS B 1 272 ? -40.764 67.295  9.250   1.00 25.32  ? 272  LYS B O     1 
ATOM   7023  C CB    . LYS B 1 272 ? -43.806 66.253  8.615   1.00 26.16  ? 272  LYS B CB    1 
ATOM   7024  C CG    . LYS B 1 272 ? -44.767 65.070  8.561   1.00 28.73  ? 272  LYS B CG    1 
ATOM   7025  C CD    . LYS B 1 272 ? -45.043 64.559  7.152   1.00 30.19  ? 272  LYS B CD    1 
ATOM   7026  C CE    . LYS B 1 272 ? -45.932 63.313  7.245   1.00 33.68  ? 272  LYS B CE    1 
ATOM   7027  N NZ    . LYS B 1 272 ? -46.363 62.779  5.924   1.00 35.16  ? 272  LYS B NZ    1 
ATOM   7028  N N     . GLY B 1 273 ? -41.678 68.147  7.375   1.00 24.59  ? 273  GLY B N     1 
ATOM   7029  C CA    . GLY B 1 273 ? -40.881 69.356  7.395   1.00 24.40  ? 273  GLY B CA    1 
ATOM   7030  C C     . GLY B 1 273 ? -41.435 70.415  8.332   1.00 23.84  ? 273  GLY B C     1 
ATOM   7031  O O     . GLY B 1 273 ? -42.356 71.139  7.979   1.00 24.66  ? 273  GLY B O     1 
ATOM   7032  N N     . VAL B 1 274 ? -40.868 70.495  9.530   1.00 22.74  ? 274  VAL B N     1 
ATOM   7033  C CA    . VAL B 1 274 ? -41.238 71.517  10.490  1.00 21.59  ? 274  VAL B CA    1 
ATOM   7034  C C     . VAL B 1 274 ? -40.748 72.858  9.951   1.00 21.44  ? 274  VAL B C     1 
ATOM   7035  O O     . VAL B 1 274 ? -39.553 73.025  9.711   1.00 21.34  ? 274  VAL B O     1 
ATOM   7036  C CB    . VAL B 1 274 ? -40.652 71.224  11.883  1.00 21.67  ? 274  VAL B CB    1 
ATOM   7037  C CG1   . VAL B 1 274 ? -40.946 72.379  12.856  1.00 21.53  ? 274  VAL B CG1   1 
ATOM   7038  C CG2   . VAL B 1 274 ? -41.214 69.886  12.433  1.00 20.45  ? 274  VAL B CG2   1 
ATOM   7039  N N     . LEU B 1 275 ? -41.682 73.789  9.750   1.00 20.63  ? 275  LEU B N     1 
ATOM   7040  C CA    . LEU B 1 275 ? -41.372 75.077  9.134   1.00 20.82  ? 275  LEU B CA    1 
ATOM   7041  C C     . LEU B 1 275 ? -41.301 76.203  10.160  1.00 20.57  ? 275  LEU B C     1 
ATOM   7042  O O     . LEU B 1 275 ? -42.249 76.420  10.929  1.00 20.64  ? 275  LEU B O     1 
ATOM   7043  C CB    . LEU B 1 275 ? -42.403 75.420  8.042   1.00 20.66  ? 275  LEU B CB    1 
ATOM   7044  C CG    . LEU B 1 275 ? -42.094 76.587  7.089   1.00 20.92  ? 275  LEU B CG    1 
ATOM   7045  C CD1   . LEU B 1 275 ? -42.800 76.414  5.738   1.00 21.58  ? 275  LEU B CD1   1 
ATOM   7046  C CD2   . LEU B 1 275 ? -42.473 77.918  7.714   1.00 21.09  ? 275  LEU B CD2   1 
ATOM   7047  N N     . HIS B 1 276 ? -40.176 76.918  10.143  1.00 19.82  ? 276  HIS B N     1 
ATOM   7048  C CA    . HIS B 1 276 ? -40.003 78.123  10.931  1.00 19.35  ? 276  HIS B CA    1 
ATOM   7049  C C     . HIS B 1 276 ? -39.973 79.342  10.032  1.00 19.31  ? 276  HIS B C     1 
ATOM   7050  O O     . HIS B 1 276 ? -39.406 79.305  8.935   1.00 18.54  ? 276  HIS B O     1 
ATOM   7051  C CB    . HIS B 1 276 ? -38.727 78.046  11.778  1.00 19.08  ? 276  HIS B CB    1 
ATOM   7052  C CG    . HIS B 1 276 ? -38.889 77.209  13.010  1.00 18.21  ? 276  HIS B CG    1 
ATOM   7053  N ND1   . HIS B 1 276 ? -39.501 77.679  14.151  1.00 17.45  ? 276  HIS B ND1   1 
ATOM   7054  C CD2   . HIS B 1 276 ? -38.546 75.924  13.270  1.00 17.16  ? 276  HIS B CD2   1 
ATOM   7055  C CE1   . HIS B 1 276 ? -39.522 76.726  15.065  1.00 17.26  ? 276  HIS B CE1   1 
ATOM   7056  N NE2   . HIS B 1 276 ? -38.952 75.649  14.554  1.00 17.86  ? 276  HIS B NE2   1 
ATOM   7057  N N     . THR B 1 277 ? -40.610 80.416  10.493  1.00 19.28  ? 277  THR B N     1 
ATOM   7058  C CA    . THR B 1 277 ? -40.531 81.695  9.789   1.00 19.24  ? 277  THR B CA    1 
ATOM   7059  C C     . THR B 1 277 ? -39.369 82.521  10.355  1.00 19.31  ? 277  THR B C     1 
ATOM   7060  O O     . THR B 1 277 ? -38.480 81.959  10.986  1.00 19.12  ? 277  THR B O     1 
ATOM   7061  C CB    . THR B 1 277 ? -41.902 82.414  9.714   1.00 19.29  ? 277  THR B CB    1 
ATOM   7062  O OG1   . THR B 1 277 ? -42.414 82.662  11.032  1.00 18.91  ? 277  THR B OG1   1 
ATOM   7063  C CG2   . THR B 1 277 ? -42.903 81.526  8.953   1.00 18.87  ? 277  THR B CG2   1 
ATOM   7064  N N     . THR B 1 278 ? -39.339 83.829  10.103  1.00 19.77  ? 278  THR B N     1 
ATOM   7065  C CA    . THR B 1 278 ? -38.093 84.601  10.287  1.00 20.10  ? 278  THR B CA    1 
ATOM   7066  C C     . THR B 1 278 ? -38.016 85.432  11.583  1.00 20.33  ? 278  THR B C     1 
ATOM   7067  O O     . THR B 1 278 ? -37.055 85.294  12.351  1.00 20.67  ? 278  THR B O     1 
ATOM   7068  C CB    . THR B 1 278 ? -37.793 85.507  9.043   1.00 20.15  ? 278  THR B CB    1 
ATOM   7069  O OG1   . THR B 1 278 ? -37.816 84.717  7.841   1.00 21.32  ? 278  THR B OG1   1 
ATOM   7070  C CG2   . THR B 1 278 ? -36.440 86.207  9.161   1.00 19.17  ? 278  THR B CG2   1 
ATOM   7071  N N     . GLY B 1 279 ? -39.006 86.301  11.799  1.00 19.89  ? 279  GLY B N     1 
ATOM   7072  C CA    . GLY B 1 279 ? -38.967 87.298  12.877  1.00 20.11  ? 279  GLY B CA    1 
ATOM   7073  C C     . GLY B 1 279 ? -39.027 86.749  14.288  1.00 20.40  ? 279  GLY B C     1 
ATOM   7074  O O     . GLY B 1 279 ? -38.078 86.905  15.062  1.00 20.47  ? 279  GLY B O     1 
ATOM   7075  N N     . GLY B 1 280 ? -40.150 86.114  14.624  1.00 20.43  ? 280  GLY B N     1 
ATOM   7076  C CA    . GLY B 1 280 ? -40.324 85.470  15.919  1.00 20.45  ? 280  GLY B CA    1 
ATOM   7077  C C     . GLY B 1 280 ? -39.235 84.455  16.227  1.00 20.62  ? 280  GLY B C     1 
ATOM   7078  O O     . GLY B 1 280 ? -38.683 84.463  17.324  1.00 20.72  ? 280  GLY B O     1 
ATOM   7079  N N     . TYR B 1 281 ? -38.925 83.590  15.256  1.00 20.28  ? 281  TYR B N     1 
ATOM   7080  C CA    . TYR B 1 281 ? -37.877 82.593  15.416  1.00 20.36  ? 281  TYR B CA    1 
ATOM   7081  C C     . TYR B 1 281 ? -36.563 83.207  15.896  1.00 20.52  ? 281  TYR B C     1 
ATOM   7082  O O     . TYR B 1 281 ? -36.003 82.768  16.905  1.00 20.69  ? 281  TYR B O     1 
ATOM   7083  C CB    . TYR B 1 281 ? -37.636 81.776  14.128  1.00 19.99  ? 281  TYR B CB    1 
ATOM   7084  C CG    . TYR B 1 281 ? -36.394 80.896  14.239  1.00 19.61  ? 281  TYR B CG    1 
ATOM   7085  C CD1   . TYR B 1 281 ? -36.441 79.663  14.903  1.00 19.53  ? 281  TYR B CD1   1 
ATOM   7086  C CD2   . TYR B 1 281 ? -35.166 81.328  13.734  1.00 17.76  ? 281  TYR B CD2   1 
ATOM   7087  C CE1   . TYR B 1 281 ? -35.301 78.875  15.038  1.00 20.16  ? 281  TYR B CE1   1 
ATOM   7088  C CE2   . TYR B 1 281 ? -34.026 80.565  13.862  1.00 18.58  ? 281  TYR B CE2   1 
ATOM   7089  C CZ    . TYR B 1 281 ? -34.091 79.335  14.517  1.00 20.02  ? 281  TYR B CZ    1 
ATOM   7090  O OH    . TYR B 1 281 ? -32.952 78.574  14.629  1.00 19.14  ? 281  TYR B OH    1 
ATOM   7091  N N     . LEU B 1 282 ? -36.077 84.214  15.168  1.00 20.13  ? 282  LEU B N     1 
ATOM   7092  C CA    . LEU B 1 282 ? -34.775 84.803  15.462  1.00 20.20  ? 282  LEU B CA    1 
ATOM   7093  C C     . LEU B 1 282 ? -34.778 85.642  16.752  1.00 20.39  ? 282  LEU B C     1 
ATOM   7094  O O     . LEU B 1 282 ? -33.797 85.641  17.495  1.00 20.21  ? 282  LEU B O     1 
ATOM   7095  C CB    . LEU B 1 282 ? -34.235 85.610  14.262  1.00 19.99  ? 282  LEU B CB    1 
ATOM   7096  C CG    . LEU B 1 282 ? -32.763 86.056  14.374  1.00 20.50  ? 282  LEU B CG    1 
ATOM   7097  C CD1   . LEU B 1 282 ? -31.821 84.851  14.461  1.00 18.70  ? 282  LEU B CD1   1 
ATOM   7098  C CD2   . LEU B 1 282 ? -32.345 86.986  13.244  1.00 19.65  ? 282  LEU B CD2   1 
ATOM   7099  N N     . VAL B 1 283 ? -35.869 86.359  17.014  1.00 20.57  ? 283  VAL B N     1 
ATOM   7100  C CA    . VAL B 1 283 ? -36.010 87.065  18.297  1.00 20.67  ? 283  VAL B CA    1 
ATOM   7101  C C     . VAL B 1 283 ? -35.892 86.031  19.433  1.00 21.00  ? 283  VAL B C     1 
ATOM   7102  O O     . VAL B 1 283 ? -35.139 86.226  20.403  1.00 21.17  ? 283  VAL B O     1 
ATOM   7103  C CB    . VAL B 1 283 ? -37.365 87.831  18.403  1.00 20.59  ? 283  VAL B CB    1 
ATOM   7104  C CG1   . VAL B 1 283 ? -37.658 88.252  19.846  1.00 19.81  ? 283  VAL B CG1   1 
ATOM   7105  C CG2   . VAL B 1 283 ? -37.386 89.048  17.478  1.00 19.30  ? 283  VAL B CG2   1 
ATOM   7106  N N     . TYR B 1 284 ? -36.634 84.934  19.297  1.00 20.75  ? 284  TYR B N     1 
ATOM   7107  C CA    . TYR B 1 284 ? -36.678 83.915  20.339  1.00 20.80  ? 284  TYR B CA    1 
ATOM   7108  C C     . TYR B 1 284 ? -35.325 83.200  20.515  1.00 20.63  ? 284  TYR B C     1 
ATOM   7109  O O     . TYR B 1 284 ? -34.849 83.043  21.640  1.00 20.79  ? 284  TYR B O     1 
ATOM   7110  C CB    . TYR B 1 284 ? -37.841 82.932  20.097  1.00 20.81  ? 284  TYR B CB    1 
ATOM   7111  C CG    . TYR B 1 284 ? -38.268 82.205  21.356  1.00 20.39  ? 284  TYR B CG    1 
ATOM   7112  C CD1   . TYR B 1 284 ? -37.980 80.847  21.531  1.00 19.59  ? 284  TYR B CD1   1 
ATOM   7113  C CD2   . TYR B 1 284 ? -38.930 82.884  22.381  1.00 19.54  ? 284  TYR B CD2   1 
ATOM   7114  C CE1   . TYR B 1 284 ? -38.351 80.170  22.695  1.00 19.05  ? 284  TYR B CE1   1 
ATOM   7115  C CE2   . TYR B 1 284 ? -39.303 82.229  23.552  1.00 20.58  ? 284  TYR B CE2   1 
ATOM   7116  C CZ    . TYR B 1 284 ? -39.008 80.864  23.705  1.00 20.83  ? 284  TYR B CZ    1 
ATOM   7117  O OH    . TYR B 1 284 ? -39.376 80.211  24.868  1.00 20.30  ? 284  TYR B OH    1 
ATOM   7118  N N     . ALA B 1 285 ? -34.693 82.796  19.411  1.00 21.05  ? 285  ALA B N     1 
ATOM   7119  C CA    . ALA B 1 285 ? -33.341 82.195  19.470  1.00 21.02  ? 285  ALA B CA    1 
ATOM   7120  C C     . ALA B 1 285 ? -32.314 83.107  20.159  1.00 21.27  ? 285  ALA B C     1 
ATOM   7121  O O     . ALA B 1 285 ? -31.553 82.665  21.029  1.00 21.22  ? 285  ALA B O     1 
ATOM   7122  C CB    . ALA B 1 285 ? -32.859 81.798  18.084  1.00 20.83  ? 285  ALA B CB    1 
ATOM   7123  N N     . ALA B 1 286 ? -32.304 84.383  19.777  1.00 21.18  ? 286  ALA B N     1 
ATOM   7124  C CA    . ALA B 1 286 ? -31.357 85.345  20.342  1.00 20.96  ? 286  ALA B CA    1 
ATOM   7125  C C     . ALA B 1 286 ? -31.622 85.609  21.832  1.00 21.04  ? 286  ALA B C     1 
ATOM   7126  O O     . ALA B 1 286 ? -30.687 85.612  22.646  1.00 20.48  ? 286  ALA B O     1 
ATOM   7127  C CB    . ALA B 1 286 ? -31.377 86.657  19.539  1.00 20.64  ? 286  ALA B CB    1 
ATOM   7128  N N     . THR B 1 287 ? -32.897 85.814  22.178  1.00 21.04  ? 287  THR B N     1 
ATOM   7129  C CA    . THR B 1 287 ? -33.296 86.092  23.559  1.00 21.41  ? 287  THR B CA    1 
ATOM   7130  C C     . THR B 1 287 ? -32.959 84.927  24.495  1.00 21.54  ? 287  THR B C     1 
ATOM   7131  O O     . THR B 1 287 ? -32.337 85.134  25.544  1.00 21.65  ? 287  THR B O     1 
ATOM   7132  C CB    . THR B 1 287 ? -34.800 86.463  23.659  1.00 21.62  ? 287  THR B CB    1 
ATOM   7133  O OG1   . THR B 1 287 ? -35.067 87.631  22.857  1.00 21.40  ? 287  THR B OG1   1 
ATOM   7134  C CG2   . THR B 1 287 ? -35.204 86.744  25.117  1.00 21.99  ? 287  THR B CG2   1 
ATOM   7135  N N     . THR B 1 288 ? -33.347 83.710  24.103  1.00 21.62  ? 288  THR B N     1 
ATOM   7136  C CA    . THR B 1 288 ? -33.043 82.509  24.888  1.00 21.50  ? 288  THR B CA    1 
ATOM   7137  C C     . THR B 1 288 ? -31.531 82.294  24.988  1.00 21.79  ? 288  THR B C     1 
ATOM   7138  O O     . THR B 1 288 ? -31.009 82.090  26.082  1.00 21.55  ? 288  THR B O     1 
ATOM   7139  C CB    . THR B 1 288 ? -33.719 81.235  24.315  1.00 21.33  ? 288  THR B CB    1 
ATOM   7140  O OG1   . THR B 1 288 ? -33.399 81.111  22.934  1.00 21.01  ? 288  THR B OG1   1 
ATOM   7141  C CG2   . THR B 1 288 ? -35.231 81.290  24.461  1.00 21.36  ? 288  THR B CG2   1 
ATOM   7142  N N     . PHE B 1 289 ? -30.828 82.370  23.855  1.00 22.37  ? 289  PHE B N     1 
ATOM   7143  C CA    . PHE B 1 289 ? -29.362 82.257  23.857  1.00 22.73  ? 289  PHE B CA    1 
ATOM   7144  C C     . PHE B 1 289 ? -28.730 83.166  24.892  1.00 23.07  ? 289  PHE B C     1 
ATOM   7145  O O     . PHE B 1 289 ? -27.996 82.710  25.768  1.00 23.53  ? 289  PHE B O     1 
ATOM   7146  C CB    . PHE B 1 289 ? -28.739 82.602  22.491  1.00 22.53  ? 289  PHE B CB    1 
ATOM   7147  C CG    . PHE B 1 289 ? -27.235 82.660  22.531  1.00 22.37  ? 289  PHE B CG    1 
ATOM   7148  C CD1   . PHE B 1 289 ? -26.486 81.484  22.515  1.00 22.12  ? 289  PHE B CD1   1 
ATOM   7149  C CD2   . PHE B 1 289 ? -26.567 83.883  22.648  1.00 22.37  ? 289  PHE B CD2   1 
ATOM   7150  C CE1   . PHE B 1 289 ? -25.094 81.528  22.587  1.00 22.48  ? 289  PHE B CE1   1 
ATOM   7151  C CE2   . PHE B 1 289 ? -25.176 83.935  22.719  1.00 22.21  ? 289  PHE B CE2   1 
ATOM   7152  C CZ    . PHE B 1 289 ? -24.440 82.752  22.687  1.00 21.64  ? 289  PHE B CZ    1 
ATOM   7153  N N     . LYS B 1 290 ? -29.012 84.458  24.753  1.00 23.22  ? 290  LYS B N     1 
ATOM   7154  C CA    . LYS B 1 290 ? -28.396 85.504  25.558  1.00 23.70  ? 290  LYS B CA    1 
ATOM   7155  C C     . LYS B 1 290 ? -28.606 85.264  27.053  1.00 23.67  ? 290  LYS B C     1 
ATOM   7156  O O     . LYS B 1 290 ? -27.651 85.227  27.823  1.00 23.95  ? 290  LYS B O     1 
ATOM   7157  C CB    . LYS B 1 290 ? -28.966 86.869  25.136  1.00 23.38  ? 290  LYS B CB    1 
ATOM   7158  C CG    . LYS B 1 290 ? -28.410 88.073  25.877  1.00 24.73  ? 290  LYS B CG    1 
ATOM   7159  C CD    . LYS B 1 290 ? -29.084 89.342  25.358  1.00 23.99  ? 290  LYS B CD    1 
ATOM   7160  C CE    . LYS B 1 290 ? -28.404 90.591  25.844  1.00 27.07  ? 290  LYS B CE    1 
ATOM   7161  N NZ    . LYS B 1 290 ? -29.016 91.806  25.200  1.00 27.26  ? 290  LYS B NZ    1 
ATOM   7162  N N     . TYR B 1 291 ? -29.855 85.070  27.446  1.00 23.61  ? 291  TYR B N     1 
ATOM   7163  C CA    . TYR B 1 291 ? -30.205 85.024  28.853  1.00 23.95  ? 291  TYR B CA    1 
ATOM   7164  C C     . TYR B 1 291 ? -29.943 83.685  29.546  1.00 23.95  ? 291  TYR B C     1 
ATOM   7165  O O     . TYR B 1 291 ? -29.530 83.659  30.702  1.00 23.89  ? 291  TYR B O     1 
ATOM   7166  C CB    . TYR B 1 291 ? -31.645 85.479  29.041  1.00 23.83  ? 291  TYR B CB    1 
ATOM   7167  C CG    . TYR B 1 291 ? -31.854 86.961  28.762  1.00 24.77  ? 291  TYR B CG    1 
ATOM   7168  C CD1   . TYR B 1 291 ? -32.960 87.405  28.037  1.00 25.01  ? 291  TYR B CD1   1 
ATOM   7169  C CD2   . TYR B 1 291 ? -30.955 87.918  29.237  1.00 24.48  ? 291  TYR B CD2   1 
ATOM   7170  C CE1   . TYR B 1 291 ? -33.163 88.761  27.792  1.00 24.95  ? 291  TYR B CE1   1 
ATOM   7171  C CE2   . TYR B 1 291 ? -31.153 89.274  28.993  1.00 24.87  ? 291  TYR B CE2   1 
ATOM   7172  C CZ    . TYR B 1 291 ? -32.252 89.687  28.268  1.00 24.73  ? 291  TYR B CZ    1 
ATOM   7173  O OH    . TYR B 1 291 ? -32.448 91.033  28.026  1.00 25.42  ? 291  TYR B OH    1 
ATOM   7174  N N     . VAL B 1 292 ? -30.162 82.577  28.841  1.00 24.03  ? 292  VAL B N     1 
ATOM   7175  C CA    . VAL B 1 292 ? -29.954 81.245  29.433  1.00 23.74  ? 292  VAL B CA    1 
ATOM   7176  C C     . VAL B 1 292 ? -28.468 80.885  29.586  1.00 23.96  ? 292  VAL B C     1 
ATOM   7177  O O     . VAL B 1 292 ? -28.093 80.240  30.564  1.00 23.91  ? 292  VAL B O     1 
ATOM   7178  C CB    . VAL B 1 292 ? -30.736 80.140  28.677  1.00 23.73  ? 292  VAL B CB    1 
ATOM   7179  C CG1   . VAL B 1 292 ? -30.402 78.751  29.219  1.00 22.19  ? 292  VAL B CG1   1 
ATOM   7180  C CG2   . VAL B 1 292 ? -32.236 80.404  28.784  1.00 24.22  ? 292  VAL B CG2   1 
ATOM   7181  N N     . PHE B 1 293 ? -27.636 81.296  28.626  1.00 24.07  ? 293  PHE B N     1 
ATOM   7182  C CA    . PHE B 1 293 ? -26.189 81.075  28.709  1.00 23.96  ? 293  PHE B CA    1 
ATOM   7183  C C     . PHE B 1 293 ? -25.459 82.259  29.351  1.00 24.21  ? 293  PHE B C     1 
ATOM   7184  O O     . PHE B 1 293 ? -24.233 82.238  29.495  1.00 24.07  ? 293  PHE B O     1 
ATOM   7185  C CB    . PHE B 1 293 ? -25.598 80.761  27.323  1.00 24.09  ? 293  PHE B CB    1 
ATOM   7186  C CG    . PHE B 1 293 ? -26.089 79.463  26.735  1.00 23.75  ? 293  PHE B CG    1 
ATOM   7187  C CD1   . PHE B 1 293 ? -26.786 79.454  25.531  1.00 23.31  ? 293  PHE B CD1   1 
ATOM   7188  C CD2   . PHE B 1 293 ? -25.877 78.254  27.399  1.00 23.06  ? 293  PHE B CD2   1 
ATOM   7189  C CE1   . PHE B 1 293 ? -27.256 78.254  24.987  1.00 22.76  ? 293  PHE B CE1   1 
ATOM   7190  C CE2   . PHE B 1 293 ? -26.350 77.052  26.864  1.00 23.81  ? 293  PHE B CE2   1 
ATOM   7191  C CZ    . PHE B 1 293 ? -27.040 77.057  25.660  1.00 23.55  ? 293  PHE B CZ    1 
ATOM   7192  N N     . ASP B 1 294 ? -26.224 83.284  29.729  1.00 24.88  ? 294  ASP B N     1 
ATOM   7193  C CA    . ASP B 1 294 ? -25.707 84.495  30.368  1.00 25.41  ? 294  ASP B CA    1 
ATOM   7194  C C     . ASP B 1 294 ? -24.575 85.097  29.534  1.00 25.86  ? 294  ASP B C     1 
ATOM   7195  O O     . ASP B 1 294 ? -23.549 85.505  30.082  1.00 25.64  ? 294  ASP B O     1 
ATOM   7196  C CB    . ASP B 1 294 ? -25.219 84.176  31.791  1.00 25.58  ? 294  ASP B CB    1 
ATOM   7197  C CG    . ASP B 1 294 ? -25.173 85.400  32.688  1.00 26.58  ? 294  ASP B CG    1 
ATOM   7198  O OD1   . ASP B 1 294 ? -24.124 85.621  33.333  1.00 27.28  ? 294  ASP B OD1   1 
ATOM   7199  O OD2   . ASP B 1 294 ? -26.182 86.140  32.748  1.00 27.02  ? 294  ASP B OD2   1 
ATOM   7200  N N     . TYR B 1 295 ? -24.757 85.135  28.211  1.00 26.23  ? 295  TYR B N     1 
ATOM   7201  C CA    . TYR B 1 295 ? -23.673 85.532  27.318  1.00 26.61  ? 295  TYR B CA    1 
ATOM   7202  C C     . TYR B 1 295 ? -23.241 86.966  27.555  1.00 26.81  ? 295  TYR B C     1 
ATOM   7203  O O     . TYR B 1 295 ? -24.055 87.884  27.498  1.00 27.12  ? 295  TYR B O     1 
ATOM   7204  C CB    . TYR B 1 295 ? -24.000 85.307  25.834  1.00 26.23  ? 295  TYR B CB    1 
ATOM   7205  C CG    . TYR B 1 295 ? -22.759 85.424  24.966  1.00 26.34  ? 295  TYR B CG    1 
ATOM   7206  C CD1   . TYR B 1 295 ? -21.969 84.307  24.694  1.00 25.90  ? 295  TYR B CD1   1 
ATOM   7207  C CD2   . TYR B 1 295 ? -22.350 86.664  24.451  1.00 26.18  ? 295  TYR B CD2   1 
ATOM   7208  C CE1   . TYR B 1 295 ? -20.803 84.418  23.918  1.00 26.07  ? 295  TYR B CE1   1 
ATOM   7209  C CE2   . TYR B 1 295 ? -21.191 86.788  23.672  1.00 25.81  ? 295  TYR B CE2   1 
ATOM   7210  C CZ    . TYR B 1 295 ? -20.418 85.666  23.417  1.00 26.70  ? 295  TYR B CZ    1 
ATOM   7211  O OH    . TYR B 1 295 ? -19.264 85.785  22.646  1.00 26.36  ? 295  TYR B OH    1 
ATOM   7212  N N     . HIS B 1 296 ? -21.955 87.129  27.849  1.00 27.25  ? 296  HIS B N     1 
ATOM   7213  C CA    . HIS B 1 296 ? -21.307 88.436  27.931  1.00 27.47  ? 296  HIS B CA    1 
ATOM   7214  C C     . HIS B 1 296 ? -20.359 88.533  26.745  1.00 27.35  ? 296  HIS B C     1 
ATOM   7215  O O     . HIS B 1 296 ? -19.747 87.530  26.380  1.00 27.50  ? 296  HIS B O     1 
ATOM   7216  C CB    . HIS B 1 296 ? -20.517 88.557  29.233  1.00 27.43  ? 296  HIS B CB    1 
ATOM   7217  C CG    . HIS B 1 296 ? -21.380 88.706  30.445  1.00 28.35  ? 296  HIS B CG    1 
ATOM   7218  N ND1   . HIS B 1 296 ? -22.239 87.717  30.872  1.00 27.72  ? 296  HIS B ND1   1 
ATOM   7219  C CD2   . HIS B 1 296 ? -21.523 89.733  31.317  1.00 28.20  ? 296  HIS B CD2   1 
ATOM   7220  C CE1   . HIS B 1 296 ? -22.877 88.128  31.952  1.00 28.37  ? 296  HIS B CE1   1 
ATOM   7221  N NE2   . HIS B 1 296 ? -22.461 89.347  32.244  1.00 28.72  ? 296  HIS B NE2   1 
ATOM   7222  N N     . PRO B 1 297 ? -20.235 89.731  26.135  1.00 27.17  ? 297  PRO B N     1 
ATOM   7223  C CA    . PRO B 1 297 ? -19.328 89.916  24.995  1.00 26.74  ? 297  PRO B CA    1 
ATOM   7224  C C     . PRO B 1 297 ? -17.936 89.374  25.308  1.00 26.34  ? 297  PRO B C     1 
ATOM   7225  O O     . PRO B 1 297 ? -17.447 89.548  26.419  1.00 26.35  ? 297  PRO B O     1 
ATOM   7226  C CB    . PRO B 1 297 ? -19.280 91.441  24.834  1.00 26.73  ? 297  PRO B CB    1 
ATOM   7227  C CG    . PRO B 1 297 ? -20.582 91.905  25.335  1.00 26.91  ? 297  PRO B CG    1 
ATOM   7228  C CD    . PRO B 1 297 ? -20.944 90.981  26.474  1.00 27.42  ? 297  PRO B CD    1 
ATOM   7229  N N     . GLY B 1 298 ? -17.322 88.691  24.349  1.00 26.27  ? 298  GLY B N     1 
ATOM   7230  C CA    . GLY B 1 298 ? -16.022 88.059  24.585  1.00 26.19  ? 298  GLY B CA    1 
ATOM   7231  C C     . GLY B 1 298 ? -16.066 86.623  25.107  1.00 26.03  ? 298  GLY B C     1 
ATOM   7232  O O     . GLY B 1 298 ? -15.036 85.933  25.106  1.00 26.27  ? 298  GLY B O     1 
ATOM   7233  N N     . ASP B 1 299 ? -17.229 86.167  25.571  1.00 25.26  ? 299  ASP B N     1 
ATOM   7234  C CA    . ASP B 1 299 ? -17.361 84.760  25.996  1.00 25.39  ? 299  ASP B CA    1 
ATOM   7235  C C     . ASP B 1 299 ? -17.163 83.824  24.799  1.00 25.16  ? 299  ASP B C     1 
ATOM   7236  O O     . ASP B 1 299 ? -17.691 84.079  23.708  1.00 25.73  ? 299  ASP B O     1 
ATOM   7237  C CB    . ASP B 1 299 ? -18.721 84.477  26.655  1.00 24.85  ? 299  ASP B CB    1 
ATOM   7238  C CG    . ASP B 1 299 ? -18.854 85.082  28.052  1.00 24.50  ? 299  ASP B CG    1 
ATOM   7239  O OD1   . ASP B 1 299 ? -17.849 85.542  28.621  1.00 25.41  ? 299  ASP B OD1   1 
ATOM   7240  O OD2   . ASP B 1 299 ? -19.978 85.096  28.594  1.00 24.08  ? 299  ASP B OD2   1 
ATOM   7241  N N     . ILE B 1 300 ? -16.395 82.754  24.992  1.00 24.80  ? 300  ILE B N     1 
ATOM   7242  C CA    . ILE B 1 300 ? -16.264 81.723  23.956  1.00 24.33  ? 300  ILE B CA    1 
ATOM   7243  C C     . ILE B 1 300 ? -17.334 80.654  24.185  1.00 24.15  ? 300  ILE B C     1 
ATOM   7244  O O     . ILE B 1 300 ? -17.378 80.008  25.235  1.00 24.02  ? 300  ILE B O     1 
ATOM   7245  C CB    . ILE B 1 300 ? -14.839 81.090  23.917  1.00 24.42  ? 300  ILE B CB    1 
ATOM   7246  C CG1   . ILE B 1 300 ? -13.743 82.176  23.815  1.00 24.61  ? 300  ILE B CG1   1 
ATOM   7247  C CG2   . ILE B 1 300 ? -14.722 80.064  22.784  1.00 24.41  ? 300  ILE B CG2   1 
ATOM   7248  C CD1   . ILE B 1 300 ? -13.909 83.159  22.643  1.00 23.61  ? 300  ILE B CD1   1 
ATOM   7249  N N     . TYR B 1 301 ? -18.210 80.482  23.200  1.00 24.21  ? 301  TYR B N     1 
ATOM   7250  C CA    . TYR B 1 301 ? -19.351 79.577  23.350  1.00 23.50  ? 301  TYR B CA    1 
ATOM   7251  C C     . TYR B 1 301 ? -19.240 78.359  22.444  1.00 23.18  ? 301  TYR B C     1 
ATOM   7252  O O     . TYR B 1 301 ? -18.974 78.483  21.244  1.00 23.34  ? 301  TYR B O     1 
ATOM   7253  C CB    . TYR B 1 301 ? -20.647 80.345  23.105  1.00 23.53  ? 301  TYR B CB    1 
ATOM   7254  C CG    . TYR B 1 301 ? -21.874 79.489  22.881  1.00 23.02  ? 301  TYR B CG    1 
ATOM   7255  C CD1   . TYR B 1 301 ? -22.278 79.159  21.588  1.00 22.72  ? 301  TYR B CD1   1 
ATOM   7256  C CD2   . TYR B 1 301 ? -22.643 79.035  23.957  1.00 21.77  ? 301  TYR B CD2   1 
ATOM   7257  C CE1   . TYR B 1 301 ? -23.412 78.382  21.368  1.00 23.32  ? 301  TYR B CE1   1 
ATOM   7258  C CE2   . TYR B 1 301 ? -23.780 78.255  23.752  1.00 23.61  ? 301  TYR B CE2   1 
ATOM   7259  C CZ    . TYR B 1 301 ? -24.158 77.928  22.451  1.00 23.60  ? 301  TYR B CZ    1 
ATOM   7260  O OH    . TYR B 1 301 ? -25.290 77.174  22.224  1.00 23.18  ? 301  TYR B OH    1 
ATOM   7261  N N     . TRP B 1 302 ? -19.452 77.179  23.022  1.00 22.71  ? 302  TRP B N     1 
ATOM   7262  C CA    . TRP B 1 302 ? -19.436 75.949  22.244  1.00 22.10  ? 302  TRP B CA    1 
ATOM   7263  C C     . TRP B 1 302 ? -20.696 75.090  22.412  1.00 22.29  ? 302  TRP B C     1 
ATOM   7264  O O     . TRP B 1 302 ? -20.949 74.526  23.482  1.00 22.26  ? 302  TRP B O     1 
ATOM   7265  C CB    . TRP B 1 302 ? -18.178 75.141  22.547  1.00 21.31  ? 302  TRP B CB    1 
ATOM   7266  C CG    . TRP B 1 302 ? -18.026 73.888  21.721  1.00 21.03  ? 302  TRP B CG    1 
ATOM   7267  C CD1   . TRP B 1 302 ? -18.605 73.609  20.502  1.00 19.24  ? 302  TRP B CD1   1 
ATOM   7268  C CD2   . TRP B 1 302 ? -17.210 72.756  22.041  1.00 20.41  ? 302  TRP B CD2   1 
ATOM   7269  N NE1   . TRP B 1 302 ? -18.215 72.366  20.070  1.00 19.00  ? 302  TRP B NE1   1 
ATOM   7270  C CE2   . TRP B 1 302 ? -17.357 71.822  20.988  1.00 19.97  ? 302  TRP B CE2   1 
ATOM   7271  C CE3   . TRP B 1 302 ? -16.389 72.427  23.130  1.00 20.23  ? 302  TRP B CE3   1 
ATOM   7272  C CZ2   . TRP B 1 302 ? -16.698 70.586  20.987  1.00 20.36  ? 302  TRP B CZ2   1 
ATOM   7273  C CZ3   . TRP B 1 302 ? -15.743 71.197  23.129  1.00 19.77  ? 302  TRP B CZ3   1 
ATOM   7274  C CH2   . TRP B 1 302 ? -15.901 70.294  22.062  1.00 19.92  ? 302  TRP B CH2   1 
ATOM   7275  N N     . CYS B 1 303 ? -21.481 75.013  21.341  1.00 22.28  ? 303  CYS B N     1 
ATOM   7276  C CA    . CYS B 1 303 ? -22.563 74.049  21.237  1.00 22.61  ? 303  CYS B CA    1 
ATOM   7277  C C     . CYS B 1 303 ? -22.063 72.853  20.413  1.00 22.61  ? 303  CYS B C     1 
ATOM   7278  O O     . CYS B 1 303 ? -21.547 73.035  19.306  1.00 23.17  ? 303  CYS B O     1 
ATOM   7279  C CB    . CYS B 1 303 ? -23.774 74.677  20.554  1.00 22.40  ? 303  CYS B CB    1 
ATOM   7280  S SG    . CYS B 1 303 ? -25.046 73.448  20.162  1.00 23.28  ? 303  CYS B SG    1 
ATOM   7281  N N     . THR B 1 304 ? -22.206 71.642  20.941  1.00 22.45  ? 304  THR B N     1 
ATOM   7282  C CA    . THR B 1 304 ? -21.674 70.443  20.266  1.00 23.05  ? 304  THR B CA    1 
ATOM   7283  C C     . THR B 1 304 ? -22.629 69.807  19.231  1.00 23.28  ? 304  THR B C     1 
ATOM   7284  O O     . THR B 1 304 ? -22.259 68.866  18.523  1.00 23.12  ? 304  THR B O     1 
ATOM   7285  C CB    . THR B 1 304 ? -21.259 69.344  21.284  1.00 22.84  ? 304  THR B CB    1 
ATOM   7286  O OG1   . THR B 1 304 ? -22.420 68.900  21.994  1.00 23.44  ? 304  THR B OG1   1 
ATOM   7287  C CG2   . THR B 1 304 ? -20.221 69.866  22.276  1.00 22.94  ? 304  THR B CG2   1 
ATOM   7288  N N     . ALA B 1 305 ? -23.857 70.309  19.158  1.00 23.92  ? 305  ALA B N     1 
ATOM   7289  C CA    . ALA B 1 305 ? -24.878 69.730  18.280  1.00 23.86  ? 305  ALA B CA    1 
ATOM   7290  C C     . ALA B 1 305 ? -24.544 69.878  16.795  1.00 23.97  ? 305  ALA B C     1 
ATOM   7291  O O     . ALA B 1 305 ? -23.995 70.897  16.366  1.00 23.74  ? 305  ALA B O     1 
ATOM   7292  C CB    . ALA B 1 305 ? -26.217 70.349  18.561  1.00 23.49  ? 305  ALA B CB    1 
ATOM   7293  N N     . ASP B 1 306 ? -24.901 68.859  16.017  1.00 24.07  ? 306  ASP B N     1 
ATOM   7294  C CA    . ASP B 1 306 ? -24.713 68.904  14.584  1.00 24.63  ? 306  ASP B CA    1 
ATOM   7295  C C     . ASP B 1 306 ? -25.619 69.963  13.984  1.00 24.84  ? 306  ASP B C     1 
ATOM   7296  O O     . ASP B 1 306 ? -26.725 70.211  14.464  1.00 25.11  ? 306  ASP B O     1 
ATOM   7297  C CB    . ASP B 1 306 ? -24.961 67.541  13.940  1.00 24.41  ? 306  ASP B CB    1 
ATOM   7298  C CG    . ASP B 1 306 ? -24.367 67.446  12.540  1.00 25.57  ? 306  ASP B CG    1 
ATOM   7299  O OD1   . ASP B 1 306 ? -25.037 67.857  11.553  1.00 27.00  ? 306  ASP B OD1   1 
ATOM   7300  O OD2   . ASP B 1 306 ? -23.227 66.948  12.421  1.00 24.05  ? 306  ASP B OD2   1 
ATOM   7301  N N     . VAL B 1 307 ? -25.110 70.600  12.938  1.00 24.92  ? 307  VAL B N     1 
ATOM   7302  C CA    . VAL B 1 307 ? -25.836 71.600  12.187  1.00 24.91  ? 307  VAL B CA    1 
ATOM   7303  C C     . VAL B 1 307 ? -27.093 71.026  11.513  1.00 24.57  ? 307  VAL B C     1 
ATOM   7304  O O     . VAL B 1 307 ? -28.025 71.772  11.205  1.00 24.58  ? 307  VAL B O     1 
ATOM   7305  C CB    . VAL B 1 307 ? -24.886 72.300  11.176  1.00 25.57  ? 307  VAL B CB    1 
ATOM   7306  C CG1   . VAL B 1 307 ? -24.426 71.332  10.065  1.00 25.54  ? 307  VAL B CG1   1 
ATOM   7307  C CG2   . VAL B 1 307 ? -25.523 73.540  10.625  1.00 26.12  ? 307  VAL B CG2   1 
ATOM   7308  N N     . GLY B 1 308 ? -27.127 69.702  11.343  1.00 24.22  ? 308  GLY B N     1 
ATOM   7309  C CA    . GLY B 1 308 ? -28.283 68.990  10.766  1.00 23.81  ? 308  GLY B CA    1 
ATOM   7310  C C     . GLY B 1 308 ? -29.510 68.860  11.659  1.00 23.69  ? 308  GLY B C     1 
ATOM   7311  O O     . GLY B 1 308 ? -30.570 68.388  11.212  1.00 23.37  ? 308  GLY B O     1 
ATOM   7312  N N     . TRP B 1 309 ? -29.372 69.270  12.925  1.00 23.17  ? 309  TRP B N     1 
ATOM   7313  C CA    . TRP B 1 309 ? -30.490 69.259  13.859  1.00 22.65  ? 309  TRP B CA    1 
ATOM   7314  C C     . TRP B 1 309 ? -30.818 70.667  14.362  1.00 21.92  ? 309  TRP B C     1 
ATOM   7315  O O     . TRP B 1 309 ? -30.011 71.584  14.233  1.00 21.38  ? 309  TRP B O     1 
ATOM   7316  C CB    . TRP B 1 309 ? -30.216 68.311  15.033  1.00 23.48  ? 309  TRP B CB    1 
ATOM   7317  C CG    . TRP B 1 309 ? -29.739 66.920  14.634  1.00 24.66  ? 309  TRP B CG    1 
ATOM   7318  C CD1   . TRP B 1 309 ? -28.565 66.324  14.998  1.00 24.88  ? 309  TRP B CD1   1 
ATOM   7319  C CD2   . TRP B 1 309 ? -30.425 65.973  13.798  1.00 24.53  ? 309  TRP B CD2   1 
ATOM   7320  N NE1   . TRP B 1 309 ? -28.483 65.066  14.446  1.00 25.54  ? 309  TRP B NE1   1 
ATOM   7321  C CE2   . TRP B 1 309 ? -29.608 64.827  13.706  1.00 25.06  ? 309  TRP B CE2   1 
ATOM   7322  C CE3   . TRP B 1 309 ? -31.650 65.981  13.123  1.00 25.49  ? 309  TRP B CE3   1 
ATOM   7323  C CZ2   . TRP B 1 309 ? -29.982 63.690  12.972  1.00 25.69  ? 309  TRP B CZ2   1 
ATOM   7324  C CZ3   . TRP B 1 309 ? -32.016 64.848  12.375  1.00 25.35  ? 309  TRP B CZ3   1 
ATOM   7325  C CH2   . TRP B 1 309 ? -31.182 63.723  12.312  1.00 24.57  ? 309  TRP B CH2   1 
ATOM   7326  N N     . VAL B 1 310 ? -32.005 70.824  14.944  1.00 21.32  ? 310  VAL B N     1 
ATOM   7327  C CA    . VAL B 1 310 ? -32.509 72.146  15.353  1.00 20.18  ? 310  VAL B CA    1 
ATOM   7328  C C     . VAL B 1 310 ? -31.594 72.839  16.366  1.00 20.19  ? 310  VAL B C     1 
ATOM   7329  O O     . VAL B 1 310 ? -31.462 74.066  16.348  1.00 20.09  ? 310  VAL B O     1 
ATOM   7330  C CB    . VAL B 1 310 ? -33.976 72.066  15.889  1.00 20.05  ? 310  VAL B CB    1 
ATOM   7331  C CG1   . VAL B 1 310 ? -34.033 71.302  17.230  1.00 18.29  ? 310  VAL B CG1   1 
ATOM   7332  C CG2   . VAL B 1 310 ? -34.600 73.477  15.997  1.00 19.43  ? 310  VAL B CG2   1 
ATOM   7333  N N     . THR B 1 311 ? -30.936 72.061  17.224  1.00 20.20  ? 311  THR B N     1 
ATOM   7334  C CA    . THR B 1 311 ? -30.031 72.653  18.213  1.00 20.90  ? 311  THR B CA    1 
ATOM   7335  C C     . THR B 1 311 ? -28.868 73.334  17.505  1.00 20.93  ? 311  THR B C     1 
ATOM   7336  O O     . THR B 1 311 ? -28.417 74.395  17.930  1.00 20.71  ? 311  THR B O     1 
ATOM   7337  C CB    . THR B 1 311 ? -29.493 71.628  19.232  1.00 20.77  ? 311  THR B CB    1 
ATOM   7338  O OG1   . THR B 1 311 ? -30.593 70.932  19.832  1.00 20.81  ? 311  THR B OG1   1 
ATOM   7339  C CG2   . THR B 1 311 ? -28.686 72.343  20.326  1.00 21.60  ? 311  THR B CG2   1 
ATOM   7340  N N     . GLY B 1 312 ? -28.408 72.713  16.421  1.00 21.00  ? 312  GLY B N     1 
ATOM   7341  C CA    . GLY B 1 312 ? -27.377 73.290  15.570  1.00 21.77  ? 312  GLY B CA    1 
ATOM   7342  C C     . GLY B 1 312 ? -27.855 74.541  14.850  1.00 22.24  ? 312  GLY B C     1 
ATOM   7343  O O     . GLY B 1 312 ? -27.082 75.482  14.683  1.00 23.48  ? 312  GLY B O     1 
ATOM   7344  N N     . HIS B 1 313 ? -29.120 74.566  14.428  1.00 21.49  ? 313  HIS B N     1 
ATOM   7345  C CA    . HIS B 1 313 ? -29.689 75.762  13.778  1.00 21.35  ? 313  HIS B CA    1 
ATOM   7346  C C     . HIS B 1 313 ? -29.763 76.924  14.769  1.00 21.44  ? 313  HIS B C     1 
ATOM   7347  O O     . HIS B 1 313 ? -29.211 78.005  14.523  1.00 21.08  ? 313  HIS B O     1 
ATOM   7348  C CB    . HIS B 1 313 ? -31.102 75.503  13.234  1.00 21.01  ? 313  HIS B CB    1 
ATOM   7349  C CG    . HIS B 1 313 ? -31.157 74.707  11.961  1.00 20.74  ? 313  HIS B CG    1 
ATOM   7350  N ND1   . HIS B 1 313 ? -30.379 73.593  11.730  1.00 19.68  ? 313  HIS B ND1   1 
ATOM   7351  C CD2   . HIS B 1 313 ? -31.950 74.841  10.869  1.00 21.10  ? 313  HIS B CD2   1 
ATOM   7352  C CE1   . HIS B 1 313 ? -30.675 73.089  10.544  1.00 21.53  ? 313  HIS B CE1   1 
ATOM   7353  N NE2   . HIS B 1 313 ? -31.636 73.819  10.007  1.00 20.30  ? 313  HIS B NE2   1 
ATOM   7354  N N     . SER B 1 314 ? -30.455 76.695  15.888  1.00 21.42  ? 314  SER B N     1 
ATOM   7355  C CA    . SER B 1 314 ? -30.764 77.767  16.827  1.00 21.71  ? 314  SER B CA    1 
ATOM   7356  C C     . SER B 1 314 ? -29.592 78.162  17.728  1.00 22.24  ? 314  SER B C     1 
ATOM   7357  O O     . SER B 1 314 ? -29.452 79.338  18.076  1.00 22.06  ? 314  SER B O     1 
ATOM   7358  C CB    . SER B 1 314 ? -31.981 77.391  17.682  1.00 21.42  ? 314  SER B CB    1 
ATOM   7359  O OG    . SER B 1 314 ? -33.124 77.206  16.868  1.00 22.22  ? 314  SER B OG    1 
ATOM   7360  N N     . TYR B 1 315 ? -28.768 77.189  18.122  1.00 22.73  ? 315  TYR B N     1 
ATOM   7361  C CA    . TYR B 1 315 ? -27.774 77.443  19.180  1.00 24.04  ? 315  TYR B CA    1 
ATOM   7362  C C     . TYR B 1 315 ? -26.313 77.178  18.837  1.00 24.70  ? 315  TYR B C     1 
ATOM   7363  O O     . TYR B 1 315 ? -25.438 77.425  19.655  1.00 25.76  ? 315  TYR B O     1 
ATOM   7364  C CB    . TYR B 1 315 ? -28.188 76.761  20.495  1.00 23.03  ? 315  TYR B CB    1 
ATOM   7365  C CG    . TYR B 1 315 ? -29.544 77.252  20.960  1.00 23.06  ? 315  TYR B CG    1 
ATOM   7366  C CD1   . TYR B 1 315 ? -30.673 76.442  20.859  1.00 22.29  ? 315  TYR B CD1   1 
ATOM   7367  C CD2   . TYR B 1 315 ? -29.705 78.551  21.443  1.00 21.86  ? 315  TYR B CD2   1 
ATOM   7368  C CE1   . TYR B 1 315 ? -31.939 76.908  21.263  1.00 22.17  ? 315  TYR B CE1   1 
ATOM   7369  C CE2   . TYR B 1 315 ? -30.953 79.027  21.855  1.00 22.78  ? 315  TYR B CE2   1 
ATOM   7370  C CZ    . TYR B 1 315 ? -32.065 78.204  21.760  1.00 22.91  ? 315  TYR B CZ    1 
ATOM   7371  O OH    . TYR B 1 315 ? -33.295 78.671  22.165  1.00 22.27  ? 315  TYR B OH    1 
ATOM   7372  N N     . LEU B 1 316 ? -26.050 76.680  17.637  1.00 25.49  ? 316  LEU B N     1 
ATOM   7373  C CA    . LEU B 1 316 ? -24.701 76.725  17.084  1.00 25.48  ? 316  LEU B CA    1 
ATOM   7374  C C     . LEU B 1 316 ? -24.558 78.024  16.291  1.00 25.18  ? 316  LEU B C     1 
ATOM   7375  O O     . LEU B 1 316 ? -23.519 78.695  16.351  1.00 24.99  ? 316  LEU B O     1 
ATOM   7376  C CB    . LEU B 1 316 ? -24.449 75.505  16.183  1.00 25.52  ? 316  LEU B CB    1 
ATOM   7377  C CG    . LEU B 1 316 ? -23.094 75.229  15.504  1.00 26.73  ? 316  LEU B CG    1 
ATOM   7378  C CD1   . LEU B 1 316 ? -22.120 74.521  16.454  1.00 29.02  ? 316  LEU B CD1   1 
ATOM   7379  C CD2   . LEU B 1 316 ? -23.291 74.351  14.268  1.00 26.38  ? 316  LEU B CD2   1 
ATOM   7380  N N     . LEU B 1 317 ? -25.622 78.390  15.582  1.00 25.03  ? 317  LEU B N     1 
ATOM   7381  C CA    . LEU B 1 317 ? -25.559 79.444  14.566  1.00 25.28  ? 317  LEU B CA    1 
ATOM   7382  C C     . LEU B 1 317 ? -26.380 80.692  14.854  1.00 24.51  ? 317  LEU B C     1 
ATOM   7383  O O     . LEU B 1 317 ? -25.842 81.727  15.210  1.00 24.54  ? 317  LEU B O     1 
ATOM   7384  C CB    . LEU B 1 317 ? -26.026 78.879  13.232  1.00 25.78  ? 317  LEU B CB    1 
ATOM   7385  C CG    . LEU B 1 317 ? -25.148 79.137  12.022  1.00 28.51  ? 317  LEU B CG    1 
ATOM   7386  C CD1   . LEU B 1 317 ? -24.045 78.101  12.079  1.00 31.40  ? 317  LEU B CD1   1 
ATOM   7387  C CD2   . LEU B 1 317 ? -25.970 78.964  10.751  1.00 31.40  ? 317  LEU B CD2   1 
ATOM   7388  N N     . TYR B 1 318 ? -27.691 80.587  14.676  1.00 24.59  ? 318  TYR B N     1 
ATOM   7389  C CA    . TYR B 1 318 ? -28.558 81.767  14.596  1.00 24.51  ? 318  TYR B CA    1 
ATOM   7390  C C     . TYR B 1 318 ? -28.602 82.634  15.866  1.00 24.32  ? 318  TYR B C     1 
ATOM   7391  O O     . TYR B 1 318 ? -28.348 83.835  15.796  1.00 24.46  ? 318  TYR B O     1 
ATOM   7392  C CB    . TYR B 1 318 ? -29.951 81.375  14.090  1.00 24.24  ? 318  TYR B CB    1 
ATOM   7393  C CG    . TYR B 1 318 ? -29.936 80.926  12.631  1.00 24.34  ? 318  TYR B CG    1 
ATOM   7394  C CD1   . TYR B 1 318 ? -29.102 81.552  11.703  1.00 24.86  ? 318  TYR B CD1   1 
ATOM   7395  C CD2   . TYR B 1 318 ? -30.757 79.894  12.184  1.00 23.64  ? 318  TYR B CD2   1 
ATOM   7396  C CE1   . TYR B 1 318 ? -29.075 81.158  10.369  1.00 25.19  ? 318  TYR B CE1   1 
ATOM   7397  C CE2   . TYR B 1 318 ? -30.739 79.482  10.838  1.00 24.85  ? 318  TYR B CE2   1 
ATOM   7398  C CZ    . TYR B 1 318 ? -29.896 80.133  9.936   1.00 24.42  ? 318  TYR B CZ    1 
ATOM   7399  O OH    . TYR B 1 318 ? -29.858 79.771  8.611   1.00 23.96  ? 318  TYR B OH    1 
ATOM   7400  N N     . GLY B 1 319 ? -28.897 82.024  17.011  1.00 24.19  ? 319  GLY B N     1 
ATOM   7401  C CA    . GLY B 1 319 ? -28.893 82.745  18.295  1.00 23.35  ? 319  GLY B CA    1 
ATOM   7402  C C     . GLY B 1 319 ? -27.560 83.434  18.605  1.00 23.29  ? 319  GLY B C     1 
ATOM   7403  O O     . GLY B 1 319 ? -27.536 84.652  18.840  1.00 22.81  ? 319  GLY B O     1 
ATOM   7404  N N     . PRO B 1 320 ? -26.446 82.659  18.622  1.00 23.10  ? 320  PRO B N     1 
ATOM   7405  C CA    . PRO B 1 320 ? -25.105 83.199  18.878  1.00 23.01  ? 320  PRO B CA    1 
ATOM   7406  C C     . PRO B 1 320 ? -24.688 84.322  17.921  1.00 23.01  ? 320  PRO B C     1 
ATOM   7407  O O     . PRO B 1 320 ? -24.251 85.381  18.382  1.00 22.71  ? 320  PRO B O     1 
ATOM   7408  C CB    . PRO B 1 320 ? -24.192 81.983  18.710  1.00 22.75  ? 320  PRO B CB    1 
ATOM   7409  C CG    . PRO B 1 320 ? -25.063 80.819  18.969  1.00 23.35  ? 320  PRO B CG    1 
ATOM   7410  C CD    . PRO B 1 320 ? -26.410 81.194  18.445  1.00 22.88  ? 320  PRO B CD    1 
ATOM   7411  N N     . LEU B 1 321 ? -24.840 84.106  16.616  1.00 22.87  ? 321  LEU B N     1 
ATOM   7412  C CA    . LEU B 1 321 ? -24.447 85.124  15.645  1.00 23.07  ? 321  LEU B CA    1 
ATOM   7413  C C     . LEU B 1 321 ? -25.327 86.374  15.739  1.00 22.88  ? 321  LEU B C     1 
ATOM   7414  O O     . LEU B 1 321 ? -24.821 87.496  15.627  1.00 23.03  ? 321  LEU B O     1 
ATOM   7415  C CB    . LEU B 1 321 ? -24.389 84.560  14.216  1.00 22.75  ? 321  LEU B CB    1 
ATOM   7416  C CG    . LEU B 1 321 ? -23.393 83.410  13.978  1.00 23.78  ? 321  LEU B CG    1 
ATOM   7417  C CD1   . LEU B 1 321 ? -23.379 82.955  12.510  1.00 23.14  ? 321  LEU B CD1   1 
ATOM   7418  C CD2   . LEU B 1 321 ? -21.961 83.724  14.456  1.00 22.99  ? 321  LEU B CD2   1 
ATOM   7419  N N     . ALA B 1 322 ? -26.625 86.189  15.984  1.00 22.55  ? 322  ALA B N     1 
ATOM   7420  C CA    . ALA B 1 322 ? -27.517 87.337  16.224  1.00 22.54  ? 322  ALA B CA    1 
ATOM   7421  C C     . ALA B 1 322 ? -27.012 88.223  17.365  1.00 22.57  ? 322  ALA B C     1 
ATOM   7422  O O     . ALA B 1 322 ? -27.139 89.455  17.306  1.00 22.40  ? 322  ALA B O     1 
ATOM   7423  C CB    . ALA B 1 322 ? -28.944 86.880  16.510  1.00 22.29  ? 322  ALA B CB    1 
ATOM   7424  N N     . CYS B 1 323 ? -26.459 87.584  18.397  1.00 22.54  ? 323  CYS B N     1 
ATOM   7425  C CA    . CYS B 1 323 ? -25.943 88.285  19.570  1.00 22.94  ? 323  CYS B CA    1 
ATOM   7426  C C     . CYS B 1 323 ? -24.484 88.732  19.417  1.00 22.89  ? 323  CYS B C     1 
ATOM   7427  O O     . CYS B 1 323 ? -23.912 89.299  20.343  1.00 22.90  ? 323  CYS B O     1 
ATOM   7428  C CB    . CYS B 1 323 ? -26.127 87.434  20.835  1.00 22.91  ? 323  CYS B CB    1 
ATOM   7429  S SG    . CYS B 1 323 ? -27.866 87.115  21.284  1.00 22.60  ? 323  CYS B SG    1 
ATOM   7430  N N     . GLY B 1 324 ? -23.888 88.485  18.250  1.00 23.02  ? 324  GLY B N     1 
ATOM   7431  C CA    . GLY B 1 324 ? -22.499 88.890  17.997  1.00 23.20  ? 324  GLY B CA    1 
ATOM   7432  C C     . GLY B 1 324 ? -21.490 88.096  18.814  1.00 23.43  ? 324  GLY B C     1 
ATOM   7433  O O     . GLY B 1 324 ? -20.398 88.577  19.121  1.00 23.53  ? 324  GLY B O     1 
ATOM   7434  N N     . ALA B 1 325 ? -21.864 86.868  19.158  1.00 23.67  ? 325  ALA B N     1 
ATOM   7435  C CA    . ALA B 1 325 ? -21.021 85.962  19.930  1.00 23.82  ? 325  ALA B CA    1 
ATOM   7436  C C     . ALA B 1 325 ? -19.904 85.315  19.098  1.00 23.90  ? 325  ALA B C     1 
ATOM   7437  O O     . ALA B 1 325 ? -19.884 85.419  17.871  1.00 23.81  ? 325  ALA B O     1 
ATOM   7438  C CB    . ALA B 1 325 ? -21.895 84.877  20.582  1.00 24.07  ? 325  ALA B CB    1 
ATOM   7439  N N     . THR B 1 326 ? -18.968 84.662  19.790  1.00 23.71  ? 326  THR B N     1 
ATOM   7440  C CA    . THR B 1 326 ? -18.016 83.752  19.169  1.00 22.64  ? 326  THR B CA    1 
ATOM   7441  C C     . THR B 1 326 ? -18.484 82.324  19.431  1.00 22.68  ? 326  THR B C     1 
ATOM   7442  O O     . THR B 1 326 ? -18.455 81.843  20.571  1.00 22.66  ? 326  THR B O     1 
ATOM   7443  C CB    . THR B 1 326 ? -16.581 83.963  19.717  1.00 22.77  ? 326  THR B CB    1 
ATOM   7444  O OG1   . THR B 1 326 ? -16.141 85.286  19.386  1.00 21.44  ? 326  THR B OG1   1 
ATOM   7445  C CG2   . THR B 1 326 ? -15.605 82.942  19.118  1.00 22.09  ? 326  THR B CG2   1 
ATOM   7446  N N     . THR B 1 327 ? -18.920 81.653  18.371  1.00 22.17  ? 327  THR B N     1 
ATOM   7447  C CA    . THR B 1 327 ? -19.437 80.298  18.486  1.00 22.74  ? 327  THR B CA    1 
ATOM   7448  C C     . THR B 1 327 ? -18.420 79.304  17.910  1.00 22.93  ? 327  THR B C     1 
ATOM   7449  O O     . THR B 1 327 ? -17.785 79.577  16.894  1.00 23.24  ? 327  THR B O     1 
ATOM   7450  C CB    . THR B 1 327 ? -20.847 80.161  17.837  1.00 22.34  ? 327  THR B CB    1 
ATOM   7451  O OG1   . THR B 1 327 ? -21.399 78.871  18.131  1.00 22.73  ? 327  THR B OG1   1 
ATOM   7452  C CG2   . THR B 1 327 ? -20.799 80.354  16.320  1.00 22.72  ? 327  THR B CG2   1 
ATOM   7453  N N     . LEU B 1 328 ? -18.245 78.169  18.578  1.00 23.16  ? 328  LEU B N     1 
ATOM   7454  C CA    . LEU B 1 328 ? -17.299 77.157  18.114  1.00 23.39  ? 328  LEU B CA    1 
ATOM   7455  C C     . LEU B 1 328 ? -17.992 76.052  17.321  1.00 23.72  ? 328  LEU B C     1 
ATOM   7456  O O     . LEU B 1 328 ? -19.001 75.504  17.763  1.00 23.52  ? 328  LEU B O     1 
ATOM   7457  C CB    . LEU B 1 328 ? -16.516 76.568  19.298  1.00 23.23  ? 328  LEU B CB    1 
ATOM   7458  C CG    . LEU B 1 328 ? -15.196 75.811  19.072  1.00 23.78  ? 328  LEU B CG    1 
ATOM   7459  C CD1   . LEU B 1 328 ? -14.373 75.819  20.364  1.00 23.03  ? 328  LEU B CD1   1 
ATOM   7460  C CD2   . LEU B 1 328 ? -15.425 74.368  18.614  1.00 23.72  ? 328  LEU B CD2   1 
ATOM   7461  N N     . MET B 1 329 ? -17.434 75.730  16.155  1.00 24.04  ? 329  MET B N     1 
ATOM   7462  C CA    . MET B 1 329 ? -17.887 74.588  15.363  1.00 25.22  ? 329  MET B CA    1 
ATOM   7463  C C     . MET B 1 329 ? -16.802 73.510  15.310  1.00 24.16  ? 329  MET B C     1 
ATOM   7464  O O     . MET B 1 329 ? -15.698 73.722  14.774  1.00 23.81  ? 329  MET B O     1 
ATOM   7465  C CB    . MET B 1 329 ? -18.307 75.012  13.948  1.00 24.87  ? 329  MET B CB    1 
ATOM   7466  C CG    . MET B 1 329 ? -18.713 73.841  13.061  1.00 26.62  ? 329  MET B CG    1 
ATOM   7467  S SD    . MET B 1 329 ? -19.064 74.313  11.358  1.00 29.46  ? 329  MET B SD    1 
ATOM   7468  C CE    . MET B 1 329 ? -20.809 74.722  11.375  1.00 28.65  ? 329  MET B CE    1 
ATOM   7469  N N     . PHE B 1 330 ? -17.130 72.354  15.879  1.00 23.51  ? 330  PHE B N     1 
ATOM   7470  C CA    . PHE B 1 330 ? -16.207 71.224  15.962  1.00 23.07  ? 330  PHE B CA    1 
ATOM   7471  C C     . PHE B 1 330 ? -16.599 70.194  14.918  1.00 23.13  ? 330  PHE B C     1 
ATOM   7472  O O     . PHE B 1 330 ? -17.756 69.779  14.856  1.00 22.85  ? 330  PHE B O     1 
ATOM   7473  C CB    . PHE B 1 330 ? -16.264 70.632  17.380  1.00 22.82  ? 330  PHE B CB    1 
ATOM   7474  C CG    . PHE B 1 330 ? -15.411 69.414  17.591  1.00 22.44  ? 330  PHE B CG    1 
ATOM   7475  C CD1   . PHE B 1 330 ? -14.089 69.367  17.152  1.00 22.60  ? 330  PHE B CD1   1 
ATOM   7476  C CD2   . PHE B 1 330 ? -15.919 68.319  18.288  1.00 22.58  ? 330  PHE B CD2   1 
ATOM   7477  C CE1   . PHE B 1 330 ? -13.299 68.238  17.371  1.00 21.33  ? 330  PHE B CE1   1 
ATOM   7478  C CE2   . PHE B 1 330 ? -15.128 67.192  18.522  1.00 23.57  ? 330  PHE B CE2   1 
ATOM   7479  C CZ    . PHE B 1 330 ? -13.816 67.151  18.051  1.00 22.53  ? 330  PHE B CZ    1 
ATOM   7480  N N     . GLU B 1 331 ? -15.623 69.780  14.115  1.00 23.39  ? 331  GLU B N     1 
ATOM   7481  C CA    . GLU B 1 331 ? -15.830 68.824  13.030  1.00 23.82  ? 331  GLU B CA    1 
ATOM   7482  C C     . GLU B 1 331 ? -16.012 67.372  13.504  1.00 23.87  ? 331  GLU B C     1 
ATOM   7483  O O     . GLU B 1 331 ? -16.664 66.586  12.826  1.00 23.67  ? 331  GLU B O     1 
ATOM   7484  C CB    . GLU B 1 331 ? -14.660 68.904  12.039  1.00 24.10  ? 331  GLU B CB    1 
ATOM   7485  C CG    . GLU B 1 331 ? -14.807 68.008  10.798  1.00 23.99  ? 331  GLU B CG    1 
ATOM   7486  C CD    . GLU B 1 331 ? -13.591 68.026  9.892   1.00 24.64  ? 331  GLU B CD    1 
ATOM   7487  O OE1   . GLU B 1 331 ? -12.436 67.992  10.394  1.00 24.96  ? 331  GLU B OE1   1 
ATOM   7488  O OE2   . GLU B 1 331 ? -13.790 68.061  8.660   1.00 27.49  ? 331  GLU B OE2   1 
ATOM   7489  N N     . GLY B 1 332 ? -15.439 67.023  14.657  1.00 24.09  ? 332  GLY B N     1 
ATOM   7490  C CA    . GLY B 1 332 ? -15.351 65.627  15.090  1.00 24.12  ? 332  GLY B CA    1 
ATOM   7491  C C     . GLY B 1 332 ? -16.316 65.182  16.175  1.00 24.66  ? 332  GLY B C     1 
ATOM   7492  O O     . GLY B 1 332 ? -17.465 65.655  16.245  1.00 24.47  ? 332  GLY B O     1 
ATOM   7493  N N     . VAL B 1 333 ? -15.849 64.252  17.010  1.00 25.03  ? 333  VAL B N     1 
ATOM   7494  C CA    . VAL B 1 333 ? -16.636 63.709  18.131  1.00 25.85  ? 333  VAL B CA    1 
ATOM   7495  C C     . VAL B 1 333 ? -15.925 63.907  19.488  1.00 25.90  ? 333  VAL B C     1 
ATOM   7496  O O     . VAL B 1 333 ? -14.689 63.942  19.546  1.00 25.89  ? 333  VAL B O     1 
ATOM   7497  C CB    . VAL B 1 333 ? -16.998 62.204  17.928  1.00 26.26  ? 333  VAL B CB    1 
ATOM   7498  C CG1   . VAL B 1 333 ? -17.896 62.007  16.700  1.00 26.66  ? 333  VAL B CG1   1 
ATOM   7499  C CG2   . VAL B 1 333 ? -15.767 61.338  17.827  1.00 26.35  ? 333  VAL B CG2   1 
ATOM   7500  N N     . PRO B 1 334 ? -16.703 64.037  20.584  1.00 26.17  ? 334  PRO B N     1 
ATOM   7501  C CA    . PRO B 1 334 ? -16.144 64.321  21.921  1.00 26.15  ? 334  PRO B CA    1 
ATOM   7502  C C     . PRO B 1 334 ? -15.095 63.343  22.453  1.00 25.77  ? 334  PRO B C     1 
ATOM   7503  O O     . PRO B 1 334 ? -14.419 63.654  23.437  1.00 25.88  ? 334  PRO B O     1 
ATOM   7504  C CB    . PRO B 1 334 ? -17.381 64.292  22.833  1.00 25.91  ? 334  PRO B CB    1 
ATOM   7505  C CG    . PRO B 1 334 ? -18.413 63.553  22.049  1.00 26.42  ? 334  PRO B CG    1 
ATOM   7506  C CD    . PRO B 1 334 ? -18.174 63.949  20.635  1.00 25.85  ? 334  PRO B CD    1 
ATOM   7507  N N     . ASN B 1 335 ? -14.947 62.185  21.815  1.00 25.76  ? 335  ASN B N     1 
ATOM   7508  C CA    . ASN B 1 335 ? -14.068 61.145  22.348  1.00 25.81  ? 335  ASN B CA    1 
ATOM   7509  C C     . ASN B 1 335 ? -13.104 60.503  21.347  1.00 25.63  ? 335  ASN B C     1 
ATOM   7510  O O     . ASN B 1 335 ? -12.709 59.343  21.504  1.00 25.00  ? 335  ASN B O     1 
ATOM   7511  C CB    . ASN B 1 335 ? -14.890 60.077  23.081  1.00 26.31  ? 335  ASN B CB    1 
ATOM   7512  C CG    . ASN B 1 335 ? -15.866 59.324  22.161  1.00 28.02  ? 335  ASN B CG    1 
ATOM   7513  O OD1   . ASN B 1 335 ? -16.584 58.438  22.627  1.00 31.89  ? 335  ASN B OD1   1 
ATOM   7514  N ND2   . ASN B 1 335 ? -15.892 59.664  20.869  1.00 26.29  ? 335  ASN B ND2   1 
ATOM   7515  N N     . TRP B 1 336 ? -12.732 61.266  20.322  1.00 25.63  ? 336  TRP B N     1 
ATOM   7516  C CA    . TRP B 1 336 ? -11.719 60.836  19.357  1.00 25.33  ? 336  TRP B CA    1 
ATOM   7517  C C     . TRP B 1 336 ? -10.704 61.950  19.131  1.00 25.16  ? 336  TRP B C     1 
ATOM   7518  O O     . TRP B 1 336 ? -11.097 63.104  18.933  1.00 25.40  ? 336  TRP B O     1 
ATOM   7519  C CB    . TRP B 1 336 ? -12.335 60.394  18.013  1.00 25.43  ? 336  TRP B CB    1 
ATOM   7520  C CG    . TRP B 1 336 ? -11.343 59.610  17.195  1.00 25.38  ? 336  TRP B CG    1 
ATOM   7521  C CD1   . TRP B 1 336 ? -11.129 58.261  17.251  1.00 25.77  ? 336  TRP B CD1   1 
ATOM   7522  C CD2   . TRP B 1 336 ? -10.381 60.129  16.264  1.00 25.40  ? 336  TRP B CD2   1 
ATOM   7523  N NE1   . TRP B 1 336 ? -10.115 57.905  16.398  1.00 26.07  ? 336  TRP B NE1   1 
ATOM   7524  C CE2   . TRP B 1 336 ? -9.634  59.030  15.780  1.00 26.06  ? 336  TRP B CE2   1 
ATOM   7525  C CE3   . TRP B 1 336 ? -10.079 61.415  15.790  1.00 25.67  ? 336  TRP B CE3   1 
ATOM   7526  C CZ2   . TRP B 1 336 ? -8.605  59.173  14.840  1.00 25.61  ? 336  TRP B CZ2   1 
ATOM   7527  C CZ3   . TRP B 1 336 ? -9.067  61.561  14.852  1.00 25.51  ? 336  TRP B CZ3   1 
ATOM   7528  C CH2   . TRP B 1 336 ? -8.336  60.439  14.386  1.00 26.25  ? 336  TRP B CH2   1 
ATOM   7529  N N     . PRO B 1 337 ? -9.397  61.615  19.136  1.00 25.25  ? 337  PRO B N     1 
ATOM   7530  C CA    . PRO B 1 337 ? -8.776  60.282  19.323  1.00 25.13  ? 337  PRO B CA    1 
ATOM   7531  C C     . PRO B 1 337 ? -8.925  59.616  20.709  1.00 25.25  ? 337  PRO B C     1 
ATOM   7532  O O     . PRO B 1 337 ? -8.759  58.394  20.813  1.00 25.54  ? 337  PRO B O     1 
ATOM   7533  C CB    . PRO B 1 337 ? -7.290  60.531  19.000  1.00 24.95  ? 337  PRO B CB    1 
ATOM   7534  C CG    . PRO B 1 337 ? -7.255  61.862  18.277  1.00 25.11  ? 337  PRO B CG    1 
ATOM   7535  C CD    . PRO B 1 337 ? -8.380  62.649  18.874  1.00 24.94  ? 337  PRO B CD    1 
ATOM   7536  N N     . THR B 1 338 ? -9.213  60.396  21.754  1.00 24.91  ? 338  THR B N     1 
ATOM   7537  C CA    . THR B 1 338 ? -9.336  59.864  23.127  1.00 24.13  ? 338  THR B CA    1 
ATOM   7538  C C     . THR B 1 338 ? -10.537 60.481  23.861  1.00 24.03  ? 338  THR B C     1 
ATOM   7539  O O     . THR B 1 338 ? -11.031 61.535  23.448  1.00 24.10  ? 338  THR B O     1 
ATOM   7540  C CB    . THR B 1 338 ? -8.066  60.114  23.992  1.00 24.57  ? 338  THR B CB    1 
ATOM   7541  O OG1   . THR B 1 338 ? -8.025  61.484  24.413  1.00 24.16  ? 338  THR B OG1   1 
ATOM   7542  C CG2   . THR B 1 338 ? -6.762  59.726  23.255  1.00 24.13  ? 338  THR B CG2   1 
ATOM   7543  N N     . PRO B 1 339 ? -11.013 59.831  24.951  1.00 23.55  ? 339  PRO B N     1 
ATOM   7544  C CA    . PRO B 1 339 ? -12.161 60.360  25.712  1.00 23.54  ? 339  PRO B CA    1 
ATOM   7545  C C     . PRO B 1 339 ? -11.965 61.797  26.207  1.00 23.66  ? 339  PRO B C     1 
ATOM   7546  O O     . PRO B 1 339 ? -12.952 62.496  26.508  1.00 23.99  ? 339  PRO B O     1 
ATOM   7547  C CB    . PRO B 1 339 ? -12.265 59.403  26.904  1.00 23.71  ? 339  PRO B CB    1 
ATOM   7548  C CG    . PRO B 1 339 ? -11.613 58.136  26.433  1.00 23.56  ? 339  PRO B CG    1 
ATOM   7549  C CD    . PRO B 1 339 ? -10.521 58.557  25.511  1.00 23.15  ? 339  PRO B CD    1 
ATOM   7550  N N     . ALA B 1 340 ? -10.710 62.236  26.270  1.00 22.93  ? 340  ALA B N     1 
ATOM   7551  C CA    . ALA B 1 340 ? -10.390 63.575  26.764  1.00 22.87  ? 340  ALA B CA    1 
ATOM   7552  C C     . ALA B 1 340 ? -10.527 64.673  25.704  1.00 22.60  ? 340  ALA B C     1 
ATOM   7553  O O     . ALA B 1 340 ? -10.329 65.843  26.011  1.00 22.48  ? 340  ALA B O     1 
ATOM   7554  C CB    . ALA B 1 340 ? -8.988  63.596  27.384  1.00 22.60  ? 340  ALA B CB    1 
ATOM   7555  N N     . ARG B 1 341 ? -10.868 64.305  24.469  1.00 22.66  ? 341  ARG B N     1 
ATOM   7556  C CA    . ARG B 1 341 ? -10.935 65.285  23.373  1.00 22.55  ? 341  ARG B CA    1 
ATOM   7557  C C     . ARG B 1 341 ? -11.815 66.514  23.643  1.00 22.68  ? 341  ARG B C     1 
ATOM   7558  O O     . ARG B 1 341 ? -11.384 67.641  23.395  1.00 23.04  ? 341  ARG B O     1 
ATOM   7559  C CB    . ARG B 1 341 ? -11.353 64.639  22.052  1.00 22.69  ? 341  ARG B CB    1 
ATOM   7560  C CG    . ARG B 1 341 ? -11.324 65.624  20.875  1.00 22.13  ? 341  ARG B CG    1 
ATOM   7561  C CD    . ARG B 1 341 ? -9.887  65.978  20.513  1.00 22.69  ? 341  ARG B CD    1 
ATOM   7562  N NE    . ARG B 1 341 ? -9.759  67.057  19.530  1.00 21.58  ? 341  ARG B NE    1 
ATOM   7563  C CZ    . ARG B 1 341 ? -9.915  66.908  18.216  1.00 23.06  ? 341  ARG B CZ    1 
ATOM   7564  N NH1   . ARG B 1 341 ? -10.255 65.725  17.699  1.00 22.94  ? 341  ARG B NH1   1 
ATOM   7565  N NH2   . ARG B 1 341 ? -9.745  67.951  17.413  1.00 22.65  ? 341  ARG B NH2   1 
ATOM   7566  N N     . MET B 1 342 ? -13.036 66.306  24.137  1.00 22.13  ? 342  MET B N     1 
ATOM   7567  C CA    . MET B 1 342 ? -13.927 67.433  24.399  1.00 22.30  ? 342  MET B CA    1 
ATOM   7568  C C     . MET B 1 342 ? -13.258 68.468  25.303  1.00 21.84  ? 342  MET B C     1 
ATOM   7569  O O     . MET B 1 342 ? -13.275 69.654  24.996  1.00 21.95  ? 342  MET B O     1 
ATOM   7570  C CB    . MET B 1 342 ? -15.250 66.976  25.018  1.00 21.85  ? 342  MET B CB    1 
ATOM   7571  C CG    . MET B 1 342 ? -16.269 68.100  25.164  1.00 22.01  ? 342  MET B CG    1 
ATOM   7572  S SD    . MET B 1 342 ? -17.804 67.584  25.974  1.00 23.82  ? 342  MET B SD    1 
ATOM   7573  C CE    . MET B 1 342 ? -17.261 67.497  27.688  1.00 23.78  ? 342  MET B CE    1 
ATOM   7574  N N     . CYS B 1 343 ? -12.677 68.018  26.417  1.00 21.47  ? 343  CYS B N     1 
ATOM   7575  C CA    . CYS B 1 343 ? -12.028 68.933  27.346  1.00 21.62  ? 343  CYS B CA    1 
ATOM   7576  C C     . CYS B 1 343 ? -10.729 69.509  26.772  1.00 21.49  ? 343  CYS B C     1 
ATOM   7577  O O     . CYS B 1 343 ? -10.330 70.616  27.132  1.00 21.08  ? 343  CYS B O     1 
ATOM   7578  C CB    . CYS B 1 343 ? -11.803 68.267  28.711  1.00 21.72  ? 343  CYS B CB    1 
ATOM   7579  S SG    . CYS B 1 343 ? -13.354 67.828  29.550  1.00 23.29  ? 343  CYS B SG    1 
ATOM   7580  N N     . GLN B 1 344 ? -10.086 68.769  25.869  1.00 21.42  ? 344  GLN B N     1 
ATOM   7581  C CA    . GLN B 1 344 ? -8.948  69.308  25.111  1.00 21.69  ? 344  GLN B CA    1 
ATOM   7582  C C     . GLN B 1 344 ? -9.357  70.467  24.189  1.00 22.02  ? 344  GLN B C     1 
ATOM   7583  O O     . GLN B 1 344 ? -8.619  71.449  24.073  1.00 22.29  ? 344  GLN B O     1 
ATOM   7584  C CB    . GLN B 1 344 ? -8.228  68.212  24.321  1.00 21.54  ? 344  GLN B CB    1 
ATOM   7585  C CG    . GLN B 1 344 ? -7.522  67.186  25.202  1.00 21.03  ? 344  GLN B CG    1 
ATOM   7586  C CD    . GLN B 1 344 ? -7.028  65.970  24.434  1.00 21.76  ? 344  GLN B CD    1 
ATOM   7587  O OE1   . GLN B 1 344 ? -6.279  65.151  24.970  1.00 21.84  ? 344  GLN B OE1   1 
ATOM   7588  N NE2   . GLN B 1 344 ? -7.447  65.842  23.185  1.00 22.26  ? 344  GLN B NE2   1 
ATOM   7589  N N     . VAL B 1 345 ? -10.527 70.360  23.549  1.00 22.23  ? 345  VAL B N     1 
ATOM   7590  C CA    . VAL B 1 345 ? -11.071 71.471  22.755  1.00 22.33  ? 345  VAL B CA    1 
ATOM   7591  C C     . VAL B 1 345 ? -11.373 72.673  23.661  1.00 22.32  ? 345  VAL B C     1 
ATOM   7592  O O     . VAL B 1 345 ? -11.014 73.818  23.328  1.00 21.84  ? 345  VAL B O     1 
ATOM   7593  C CB    . VAL B 1 345 ? -12.332 71.078  21.936  1.00 22.46  ? 345  VAL B CB    1 
ATOM   7594  C CG1   . VAL B 1 345 ? -12.827 72.265  21.116  1.00 21.95  ? 345  VAL B CG1   1 
ATOM   7595  C CG2   . VAL B 1 345 ? -12.047 69.906  21.002  1.00 22.61  ? 345  VAL B CG2   1 
ATOM   7596  N N     . VAL B 1 346 ? -12.014 72.393  24.802  1.00 22.51  ? 346  VAL B N     1 
ATOM   7597  C CA    . VAL B 1 346 ? -12.304 73.396  25.838  1.00 22.63  ? 346  VAL B CA    1 
ATOM   7598  C C     . VAL B 1 346 ? -11.037 74.178  26.206  1.00 23.32  ? 346  VAL B C     1 
ATOM   7599  O O     . VAL B 1 346 ? -11.039 75.409  26.181  1.00 23.41  ? 346  VAL B O     1 
ATOM   7600  C CB    . VAL B 1 346 ? -12.960 72.758  27.117  1.00 22.60  ? 346  VAL B CB    1 
ATOM   7601  C CG1   . VAL B 1 346 ? -12.963 73.725  28.309  1.00 21.54  ? 346  VAL B CG1   1 
ATOM   7602  C CG2   . VAL B 1 346 ? -14.381 72.279  26.823  1.00 22.72  ? 346  VAL B CG2   1 
ATOM   7603  N N     . ASP B 1 347 ? -9.956  73.461  26.516  1.00 23.74  ? 347  ASP B N     1 
ATOM   7604  C CA    . ASP B 1 347 ? -8.691  74.103  26.876  1.00 24.15  ? 347  ASP B CA    1 
ATOM   7605  C C     . ASP B 1 347 ? -8.024  74.849  25.712  1.00 24.19  ? 347  ASP B C     1 
ATOM   7606  O O     . ASP B 1 347 ? -7.547  75.970  25.891  1.00 24.65  ? 347  ASP B O     1 
ATOM   7607  C CB    . ASP B 1 347 ? -7.716  73.083  27.465  1.00 24.24  ? 347  ASP B CB    1 
ATOM   7608  C CG    . ASP B 1 347 ? -8.118  72.615  28.850  1.00 25.60  ? 347  ASP B CG    1 
ATOM   7609  O OD1   . ASP B 1 347 ? -8.936  73.289  29.516  1.00 25.78  ? 347  ASP B OD1   1 
ATOM   7610  O OD2   . ASP B 1 347 ? -7.591  71.572  29.284  1.00 27.15  ? 347  ASP B OD2   1 
ATOM   7611  N N     . LYS B 1 348 ? -7.975  74.218  24.539  1.00 23.98  ? 348  LYS B N     1 
ATOM   7612  C CA    . LYS B 1 348 ? -7.328  74.804  23.362  1.00 24.19  ? 348  LYS B CA    1 
ATOM   7613  C C     . LYS B 1 348 ? -7.929  76.166  23.013  1.00 23.96  ? 348  LYS B C     1 
ATOM   7614  O O     . LYS B 1 348 ? -7.203  77.143  22.802  1.00 23.62  ? 348  LYS B O     1 
ATOM   7615  C CB    . LYS B 1 348 ? -7.434  73.854  22.157  1.00 24.27  ? 348  LYS B CB    1 
ATOM   7616  C CG    . LYS B 1 348 ? -6.743  74.367  20.903  1.00 24.52  ? 348  LYS B CG    1 
ATOM   7617  C CD    . LYS B 1 348 ? -6.793  73.349  19.768  1.00 24.51  ? 348  LYS B CD    1 
ATOM   7618  C CE    . LYS B 1 348 ? -6.163  73.901  18.475  1.00 25.77  ? 348  LYS B CE    1 
ATOM   7619  N NZ    . LYS B 1 348 ? -6.376  72.949  17.335  1.00 26.17  ? 348  LYS B NZ    1 
ATOM   7620  N N     . HIS B 1 349 ? -9.259  76.227  22.964  1.00 23.77  ? 349  HIS B N     1 
ATOM   7621  C CA    . HIS B 1 349 ? -9.941  77.447  22.559  1.00 23.65  ? 349  HIS B CA    1 
ATOM   7622  C C     . HIS B 1 349 ? -10.518 78.236  23.732  1.00 23.33  ? 349  HIS B C     1 
ATOM   7623  O O     . HIS B 1 349 ? -11.253 79.203  23.534  1.00 23.80  ? 349  HIS B O     1 
ATOM   7624  C CB    . HIS B 1 349 ? -10.988 77.126  21.489  1.00 23.78  ? 349  HIS B CB    1 
ATOM   7625  C CG    . HIS B 1 349 ? -10.392 76.525  20.250  1.00 23.97  ? 349  HIS B CG    1 
ATOM   7626  N ND1   . HIS B 1 349 ? -9.498  77.209  19.451  1.00 23.91  ? 349  HIS B ND1   1 
ATOM   7627  C CD2   . HIS B 1 349 ? -10.537 75.300  19.690  1.00 23.40  ? 349  HIS B CD2   1 
ATOM   7628  C CE1   . HIS B 1 349 ? -9.123  76.433  18.450  1.00 24.25  ? 349  HIS B CE1   1 
ATOM   7629  N NE2   . HIS B 1 349 ? -9.742  75.271  18.570  1.00 25.34  ? 349  HIS B NE2   1 
ATOM   7630  N N     . GLN B 1 350 ? -10.169 77.818  24.947  1.00 22.95  ? 350  GLN B N     1 
ATOM   7631  C CA    . GLN B 1 350 ? -10.558 78.515  26.175  1.00 22.39  ? 350  GLN B CA    1 
ATOM   7632  C C     . GLN B 1 350 ? -12.066 78.758  26.216  1.00 21.80  ? 350  GLN B C     1 
ATOM   7633  O O     . GLN B 1 350 ? -12.523 79.891  26.393  1.00 21.49  ? 350  GLN B O     1 
ATOM   7634  C CB    . GLN B 1 350 ? -9.777  79.831  26.326  1.00 22.98  ? 350  GLN B CB    1 
ATOM   7635  C CG    . GLN B 1 350 ? -8.294  79.653  26.644  1.00 23.98  ? 350  GLN B CG    1 
ATOM   7636  C CD    . GLN B 1 350 ? -8.063  79.143  28.064  1.00 24.48  ? 350  GLN B CD    1 
ATOM   7637  O OE1   . GLN B 1 350 ? -7.701  77.981  28.262  1.00 25.72  ? 350  GLN B OE1   1 
ATOM   7638  N NE2   . GLN B 1 350 ? -8.292  80.001  29.053  1.00 23.27  ? 350  GLN B NE2   1 
ATOM   7639  N N     . VAL B 1 351 ? -12.829 77.685  26.027  1.00 20.74  ? 351  VAL B N     1 
ATOM   7640  C CA    . VAL B 1 351 ? -14.293 77.746  26.061  1.00 20.25  ? 351  VAL B CA    1 
ATOM   7641  C C     . VAL B 1 351 ? -14.828 78.175  27.443  1.00 20.28  ? 351  VAL B C     1 
ATOM   7642  O O     . VAL B 1 351 ? -14.367 77.678  28.477  1.00 19.58  ? 351  VAL B O     1 
ATOM   7643  C CB    . VAL B 1 351 ? -14.910 76.385  25.623  1.00 20.10  ? 351  VAL B CB    1 
ATOM   7644  C CG1   . VAL B 1 351 ? -16.425 76.406  25.722  1.00 18.81  ? 351  VAL B CG1   1 
ATOM   7645  C CG2   . VAL B 1 351 ? -14.480 76.051  24.200  1.00 19.18  ? 351  VAL B CG2   1 
ATOM   7646  N N     . ASN B 1 352 ? -15.798 79.095  27.434  1.00 20.83  ? 352  ASN B N     1 
ATOM   7647  C CA    . ASN B 1 352 ? -16.449 79.608  28.652  1.00 21.18  ? 352  ASN B CA    1 
ATOM   7648  C C     . ASN B 1 352 ? -17.848 79.032  28.893  1.00 21.29  ? 352  ASN B C     1 
ATOM   7649  O O     . ASN B 1 352 ? -18.323 78.990  30.031  1.00 20.87  ? 352  ASN B O     1 
ATOM   7650  C CB    . ASN B 1 352 ? -16.551 81.136  28.605  1.00 20.79  ? 352  ASN B CB    1 
ATOM   7651  C CG    . ASN B 1 352 ? -15.204 81.811  28.451  1.00 21.75  ? 352  ASN B CG    1 
ATOM   7652  O OD1   . ASN B 1 352 ? -15.007 82.617  27.541  1.00 22.73  ? 352  ASN B OD1   1 
ATOM   7653  N ND2   . ASN B 1 352 ? -14.270 81.490  29.336  1.00 21.39  ? 352  ASN B ND2   1 
ATOM   7654  N N     . ILE B 1 353 ? -18.510 78.636  27.806  1.00 21.67  ? 353  ILE B N     1 
ATOM   7655  C CA    . ILE B 1 353 ? -19.859 78.057  27.854  1.00 21.45  ? 353  ILE B CA    1 
ATOM   7656  C C     . ILE B 1 353 ? -19.892 76.800  26.996  1.00 21.62  ? 353  ILE B C     1 
ATOM   7657  O O     . ILE B 1 353 ? -19.580 76.851  25.808  1.00 21.52  ? 353  ILE B O     1 
ATOM   7658  C CB    . ILE B 1 353 ? -20.937 79.041  27.342  1.00 21.51  ? 353  ILE B CB    1 
ATOM   7659  C CG1   . ILE B 1 353 ? -20.811 80.411  28.028  1.00 21.75  ? 353  ILE B CG1   1 
ATOM   7660  C CG2   . ILE B 1 353 ? -22.339 78.460  27.550  1.00 21.17  ? 353  ILE B CG2   1 
ATOM   7661  C CD1   . ILE B 1 353 ? -21.342 81.572  27.184  1.00 21.77  ? 353  ILE B CD1   1 
ATOM   7662  N N     . LEU B 1 354 ? -20.270 75.678  27.609  1.00 21.84  ? 354  LEU B N     1 
ATOM   7663  C CA    . LEU B 1 354 ? -20.329 74.390  26.933  1.00 21.61  ? 354  LEU B CA    1 
ATOM   7664  C C     . LEU B 1 354 ? -21.747 73.846  26.986  1.00 21.65  ? 354  LEU B C     1 
ATOM   7665  O O     . LEU B 1 354 ? -22.337 73.717  28.062  1.00 21.54  ? 354  LEU B O     1 
ATOM   7666  C CB    . LEU B 1 354 ? -19.344 73.390  27.558  1.00 21.51  ? 354  LEU B CB    1 
ATOM   7667  C CG    . LEU B 1 354 ? -19.332 71.947  27.027  1.00 21.59  ? 354  LEU B CG    1 
ATOM   7668  C CD1   . LEU B 1 354 ? -18.962 71.861  25.523  1.00 21.01  ? 354  LEU B CD1   1 
ATOM   7669  C CD2   . LEU B 1 354 ? -18.377 71.069  27.864  1.00 21.35  ? 354  LEU B CD2   1 
ATOM   7670  N N     . TYR B 1 355 ? -22.279 73.524  25.808  1.00 21.07  ? 355  TYR B N     1 
ATOM   7671  C CA    . TYR B 1 355 ? -23.659 73.087  25.668  1.00 20.83  ? 355  TYR B CA    1 
ATOM   7672  C C     . TYR B 1 355 ? -23.638 71.774  24.888  1.00 20.84  ? 355  TYR B C     1 
ATOM   7673  O O     . TYR B 1 355 ? -23.328 71.767  23.701  1.00 20.84  ? 355  TYR B O     1 
ATOM   7674  C CB    . TYR B 1 355 ? -24.445 74.168  24.922  1.00 20.28  ? 355  TYR B CB    1 
ATOM   7675  C CG    . TYR B 1 355 ? -25.928 73.935  24.758  1.00 20.08  ? 355  TYR B CG    1 
ATOM   7676  C CD1   . TYR B 1 355 ? -26.700 73.407  25.797  1.00 21.31  ? 355  TYR B CD1   1 
ATOM   7677  C CD2   . TYR B 1 355 ? -26.573 74.280  23.573  1.00 21.58  ? 355  TYR B CD2   1 
ATOM   7678  C CE1   . TYR B 1 355 ? -28.062 73.222  25.657  1.00 19.50  ? 355  TYR B CE1   1 
ATOM   7679  C CE2   . TYR B 1 355 ? -27.952 74.099  23.423  1.00 19.83  ? 355  TYR B CE2   1 
ATOM   7680  C CZ    . TYR B 1 355 ? -28.678 73.576  24.471  1.00 19.99  ? 355  TYR B CZ    1 
ATOM   7681  O OH    . TYR B 1 355 ? -30.024 73.380  24.329  1.00 19.90  ? 355  TYR B OH    1 
ATOM   7682  N N     . THR B 1 356 ? -23.937 70.669  25.568  1.00 20.78  ? 356  THR B N     1 
ATOM   7683  C CA    . THR B 1 356 ? -23.851 69.341  24.967  1.00 20.75  ? 356  THR B CA    1 
ATOM   7684  C C     . THR B 1 356 ? -25.025 68.423  25.368  1.00 21.10  ? 356  THR B C     1 
ATOM   7685  O O     . THR B 1 356 ? -26.048 68.883  25.882  1.00 20.54  ? 356  THR B O     1 
ATOM   7686  C CB    . THR B 1 356 ? -22.433 68.681  25.200  1.00 21.12  ? 356  THR B CB    1 
ATOM   7687  O OG1   . THR B 1 356 ? -22.255 67.579  24.299  1.00 21.77  ? 356  THR B OG1   1 
ATOM   7688  C CG2   . THR B 1 356 ? -22.225 68.221  26.653  1.00 20.05  ? 356  THR B CG2   1 
ATOM   7689  N N     . ALA B 1 357 ? -24.875 67.126  25.109  1.00 20.90  ? 357  ALA B N     1 
ATOM   7690  C CA    . ALA B 1 357 ? -25.994 66.200  25.179  1.00 21.00  ? 357  ALA B CA    1 
ATOM   7691  C C     . ALA B 1 357 ? -25.700 65.116  26.204  1.00 20.51  ? 357  ALA B C     1 
ATOM   7692  O O     . ALA B 1 357 ? -24.538 64.731  26.363  1.00 20.10  ? 357  ALA B O     1 
ATOM   7693  C CB    . ALA B 1 357 ? -26.216 65.571  23.794  1.00 21.17  ? 357  ALA B CB    1 
ATOM   7694  N N     . PRO B 1 358 ? -26.740 64.634  26.918  1.00 20.64  ? 358  PRO B N     1 
ATOM   7695  C CA    . PRO B 1 358 ? -26.529 63.512  27.840  1.00 21.01  ? 358  PRO B CA    1 
ATOM   7696  C C     . PRO B 1 358 ? -25.909 62.246  27.236  1.00 21.38  ? 358  PRO B C     1 
ATOM   7697  O O     . PRO B 1 358 ? -25.164 61.573  27.936  1.00 21.53  ? 358  PRO B O     1 
ATOM   7698  C CB    . PRO B 1 358 ? -27.930 63.269  28.422  1.00 20.87  ? 358  PRO B CB    1 
ATOM   7699  C CG    . PRO B 1 358 ? -28.562 64.642  28.362  1.00 20.17  ? 358  PRO B CG    1 
ATOM   7700  C CD    . PRO B 1 358 ? -28.122 65.143  27.016  1.00 20.44  ? 358  PRO B CD    1 
ATOM   7701  N N     . THR B 1 359 ? -26.185 61.921  25.971  1.00 21.71  ? 359  THR B N     1 
ATOM   7702  C CA    . THR B 1 359 ? -25.498 60.784  25.329  1.00 22.58  ? 359  THR B CA    1 
ATOM   7703  C C     . THR B 1 359 ? -23.974 60.954  25.363  1.00 22.63  ? 359  THR B C     1 
ATOM   7704  O O     . THR B 1 359 ? -23.247 60.009  25.672  1.00 22.23  ? 359  THR B O     1 
ATOM   7705  C CB    . THR B 1 359 ? -25.971 60.530  23.860  1.00 23.24  ? 359  THR B CB    1 
ATOM   7706  O OG1   . THR B 1 359 ? -27.364 60.195  23.857  1.00 24.48  ? 359  THR B OG1   1 
ATOM   7707  C CG2   . THR B 1 359 ? -25.181 59.380  23.222  1.00 23.26  ? 359  THR B CG2   1 
ATOM   7708  N N     . ALA B 1 360 ? -23.503 62.165  25.056  1.00 22.42  ? 360  ALA B N     1 
ATOM   7709  C CA    . ALA B 1 360 ? -22.074 62.482  25.143  1.00 21.92  ? 360  ALA B CA    1 
ATOM   7710  C C     . ALA B 1 360 ? -21.558 62.441  26.600  1.00 21.56  ? 360  ALA B C     1 
ATOM   7711  O O     . ALA B 1 360 ? -20.518 61.847  26.877  1.00 21.58  ? 360  ALA B O     1 
ATOM   7712  C CB    . ALA B 1 360 ? -21.778 63.832  24.473  1.00 21.40  ? 360  ALA B CB    1 
ATOM   7713  N N     . ILE B 1 361 ? -22.303 63.044  27.527  1.00 21.39  ? 361  ILE B N     1 
ATOM   7714  C CA    . ILE B 1 361 ? -21.957 63.013  28.956  1.00 20.67  ? 361  ILE B CA    1 
ATOM   7715  C C     . ILE B 1 361 ? -21.852 61.580  29.484  1.00 20.76  ? 361  ILE B C     1 
ATOM   7716  O O     . ILE B 1 361 ? -20.871 61.235  30.160  1.00 20.75  ? 361  ILE B O     1 
ATOM   7717  C CB    . ILE B 1 361 ? -22.974 63.840  29.800  1.00 20.83  ? 361  ILE B CB    1 
ATOM   7718  C CG1   . ILE B 1 361 ? -22.883 65.335  29.439  1.00 19.72  ? 361  ILE B CG1   1 
ATOM   7719  C CG2   . ILE B 1 361 ? -22.761 63.642  31.299  1.00 19.83  ? 361  ILE B CG2   1 
ATOM   7720  C CD1   . ILE B 1 361 ? -24.070 66.133  29.933  1.00 19.44  ? 361  ILE B CD1   1 
ATOM   7721  N N     . ARG B 1 362 ? -22.841 60.742  29.166  1.00 20.54  ? 362  ARG B N     1 
ATOM   7722  C CA    . ARG B 1 362 ? -22.807 59.327  29.580  1.00 21.72  ? 362  ARG B CA    1 
ATOM   7723  C C     . ARG B 1 362 ? -21.600 58.563  29.010  1.00 21.74  ? 362  ARG B C     1 
ATOM   7724  O O     . ARG B 1 362 ? -21.008 57.741  29.707  1.00 21.51  ? 362  ARG B O     1 
ATOM   7725  C CB    . ARG B 1 362 ? -24.111 58.594  29.232  1.00 21.44  ? 362  ARG B CB    1 
ATOM   7726  C CG    . ARG B 1 362 ? -25.318 58.998  30.078  1.00 22.79  ? 362  ARG B CG    1 
ATOM   7727  C CD    . ARG B 1 362 ? -26.558 58.118  29.809  1.00 22.97  ? 362  ARG B CD    1 
ATOM   7728  N NE    . ARG B 1 362 ? -26.823 57.907  28.380  1.00 26.00  ? 362  ARG B NE    1 
ATOM   7729  C CZ    . ARG B 1 362 ? -27.697 58.615  27.665  1.00 26.93  ? 362  ARG B CZ    1 
ATOM   7730  N NH1   . ARG B 1 362 ? -28.385 59.594  28.237  1.00 26.40  ? 362  ARG B NH1   1 
ATOM   7731  N NH2   . ARG B 1 362 ? -27.884 58.346  26.378  1.00 25.97  ? 362  ARG B NH2   1 
ATOM   7732  N N     . ALA B 1 363 ? -21.258 58.834  27.747  1.00 21.90  ? 363  ALA B N     1 
ATOM   7733  C CA    . ALA B 1 363 ? -20.114 58.197  27.092  1.00 22.70  ? 363  ALA B CA    1 
ATOM   7734  C C     . ALA B 1 363 ? -18.776 58.607  27.724  1.00 23.25  ? 363  ALA B C     1 
ATOM   7735  O O     . ALA B 1 363 ? -17.878 57.772  27.887  1.00 23.54  ? 363  ALA B O     1 
ATOM   7736  C CB    . ALA B 1 363 ? -20.109 58.479  25.592  1.00 22.08  ? 363  ALA B CB    1 
ATOM   7737  N N     . LEU B 1 364 ? -18.642 59.882  28.081  1.00 23.72  ? 364  LEU B N     1 
ATOM   7738  C CA    . LEU B 1 364 ? -17.445 60.346  28.799  1.00 23.80  ? 364  LEU B CA    1 
ATOM   7739  C C     . LEU B 1 364 ? -17.413 59.815  30.229  1.00 23.50  ? 364  LEU B C     1 
ATOM   7740  O O     . LEU B 1 364 ? -16.362 59.397  30.717  1.00 23.33  ? 364  LEU B O     1 
ATOM   7741  C CB    . LEU B 1 364 ? -17.342 61.879  28.777  1.00 24.33  ? 364  LEU B CB    1 
ATOM   7742  C CG    . LEU B 1 364 ? -17.316 62.523  27.378  1.00 25.43  ? 364  LEU B CG    1 
ATOM   7743  C CD1   . LEU B 1 364 ? -17.165 64.017  27.458  1.00 26.78  ? 364  LEU B CD1   1 
ATOM   7744  C CD2   . LEU B 1 364 ? -16.217 61.930  26.497  1.00 27.64  ? 364  LEU B CD2   1 
ATOM   7745  N N     . MET B 1 365 ? -18.569 59.824  30.886  1.00 23.34  ? 365  MET B N     1 
ATOM   7746  C CA    . MET B 1 365 ? -18.712 59.293  32.237  1.00 23.77  ? 365  MET B CA    1 
ATOM   7747  C C     . MET B 1 365 ? -18.332 57.807  32.336  1.00 23.06  ? 365  MET B C     1 
ATOM   7748  O O     . MET B 1 365 ? -17.740 57.386  33.322  1.00 22.53  ? 365  MET B O     1 
ATOM   7749  C CB    . MET B 1 365 ? -20.138 59.505  32.758  1.00 23.58  ? 365  MET B CB    1 
ATOM   7750  C CG    . MET B 1 365 ? -20.295 59.167  34.234  1.00 25.16  ? 365  MET B CG    1 
ATOM   7751  S SD    . MET B 1 365 ? -21.904 59.577  34.927  1.00 25.90  ? 365  MET B SD    1 
ATOM   7752  C CE    . MET B 1 365 ? -23.013 58.528  33.983  1.00 30.85  ? 365  MET B CE    1 
ATOM   7753  N N     . ALA B 1 366 ? -18.669 57.032  31.308  1.00 22.75  ? 366  ALA B N     1 
ATOM   7754  C CA    . ALA B 1 366 ? -18.321 55.618  31.252  1.00 22.54  ? 366  ALA B CA    1 
ATOM   7755  C C     . ALA B 1 366 ? -16.802 55.394  31.311  1.00 22.69  ? 366  ALA B C     1 
ATOM   7756  O O     . ALA B 1 366 ? -16.347 54.323  31.734  1.00 22.28  ? 366  ALA B O     1 
ATOM   7757  C CB    . ALA B 1 366 ? -18.922 54.965  30.003  1.00 22.43  ? 366  ALA B CB    1 
ATOM   7758  N N     . GLU B 1 367 ? -16.037 56.409  30.900  1.00 22.80  ? 367  GLU B N     1 
ATOM   7759  C CA    . GLU B 1 367 ? -14.566 56.358  30.910  1.00 22.83  ? 367  GLU B CA    1 
ATOM   7760  C C     . GLU B 1 367 ? -13.962 56.950  32.181  1.00 22.29  ? 367  GLU B C     1 
ATOM   7761  O O     . GLU B 1 367 ? -12.740 56.902  32.381  1.00 21.70  ? 367  GLU B O     1 
ATOM   7762  C CB    . GLU B 1 367 ? -13.988 57.068  29.681  1.00 23.04  ? 367  GLU B CB    1 
ATOM   7763  C CG    . GLU B 1 367 ? -14.532 56.569  28.345  1.00 26.57  ? 367  GLU B CG    1 
ATOM   7764  C CD    . GLU B 1 367 ? -14.374 55.060  28.153  1.00 32.09  ? 367  GLU B CD    1 
ATOM   7765  O OE1   . GLU B 1 367 ? -13.296 54.521  28.492  1.00 33.28  ? 367  GLU B OE1   1 
ATOM   7766  O OE2   . GLU B 1 367 ? -15.330 54.411  27.658  1.00 34.51  ? 367  GLU B OE2   1 
ATOM   7767  N N     . GLY B 1 368 ? -14.814 57.512  33.035  1.00 21.89  ? 368  GLY B N     1 
ATOM   7768  C CA    . GLY B 1 368 ? -14.368 58.053  34.319  1.00 21.76  ? 368  GLY B CA    1 
ATOM   7769  C C     . GLY B 1 368 ? -13.383 59.198  34.135  1.00 21.91  ? 368  GLY B C     1 
ATOM   7770  O O     . GLY B 1 368 ? -13.572 60.059  33.268  1.00 21.75  ? 368  GLY B O     1 
ATOM   7771  N N     . ASP B 1 369 ? -12.317 59.188  34.927  1.00 21.81  ? 369  ASP B N     1 
ATOM   7772  C CA    . ASP B 1 369 ? -11.324 60.265  34.904  1.00 22.43  ? 369  ASP B CA    1 
ATOM   7773  C C     . ASP B 1 369 ? -10.501 60.354  33.611  1.00 22.38  ? 369  ASP B C     1 
ATOM   7774  O O     . ASP B 1 369 ? -9.829  61.360  33.374  1.00 22.52  ? 369  ASP B O     1 
ATOM   7775  C CB    . ASP B 1 369 ? -10.415 60.181  36.131  1.00 22.82  ? 369  ASP B CB    1 
ATOM   7776  C CG    . ASP B 1 369 ? -11.098 60.682  37.400  1.00 24.04  ? 369  ASP B CG    1 
ATOM   7777  O OD1   . ASP B 1 369 ? -12.227 61.231  37.327  1.00 23.97  ? 369  ASP B OD1   1 
ATOM   7778  O OD2   . ASP B 1 369 ? -10.492 60.534  38.479  1.00 26.58  ? 369  ASP B OD2   1 
ATOM   7779  N N     . LYS B 1 370 ? -10.578 59.326  32.766  1.00 22.28  ? 370  LYS B N     1 
ATOM   7780  C CA    . LYS B 1 370 ? -9.933  59.368  31.444  1.00 22.36  ? 370  LYS B CA    1 
ATOM   7781  C C     . LYS B 1 370 ? -10.546 60.449  30.558  1.00 22.21  ? 370  LYS B C     1 
ATOM   7782  O O     . LYS B 1 370 ? -9.922  60.902  29.598  1.00 22.27  ? 370  LYS B O     1 
ATOM   7783  C CB    . LYS B 1 370 ? -10.024 58.013  30.743  1.00 22.56  ? 370  LYS B CB    1 
ATOM   7784  C CG    . LYS B 1 370 ? -9.211  56.904  31.400  1.00 23.54  ? 370  LYS B CG    1 
ATOM   7785  C CD    . LYS B 1 370 ? -7.694  57.100  31.208  1.00 26.76  ? 370  LYS B CD    1 
ATOM   7786  C CE    . LYS B 1 370 ? -6.892  56.111  32.066  1.00 27.33  ? 370  LYS B CE    1 
ATOM   7787  N NZ    . LYS B 1 370 ? -5.455  56.507  32.200  1.00 28.96  ? 370  LYS B NZ    1 
ATOM   7788  N N     . ALA B 1 371 ? -11.769 60.865  30.888  1.00 21.72  ? 371  ALA B N     1 
ATOM   7789  C CA    . ALA B 1 371 ? -12.448 61.934  30.159  1.00 21.59  ? 371  ALA B CA    1 
ATOM   7790  C C     . ALA B 1 371 ? -11.855 63.318  30.431  1.00 21.44  ? 371  ALA B C     1 
ATOM   7791  O O     . ALA B 1 371 ? -12.080 64.255  29.651  1.00 20.88  ? 371  ALA B O     1 
ATOM   7792  C CB    . ALA B 1 371 ? -13.958 61.918  30.476  1.00 21.51  ? 371  ALA B CB    1 
ATOM   7793  N N     . ILE B 1 372 ? -11.113 63.449  31.535  1.00 21.31  ? 372  ILE B N     1 
ATOM   7794  C CA    . ILE B 1 372 ? -10.550 64.752  31.941  1.00 22.12  ? 372  ILE B CA    1 
ATOM   7795  C C     . ILE B 1 372 ? -9.027  64.751  32.150  1.00 22.80  ? 372  ILE B C     1 
ATOM   7796  O O     . ILE B 1 372 ? -8.411  65.802  32.373  1.00 22.31  ? 372  ILE B O     1 
ATOM   7797  C CB    . ILE B 1 372 ? -11.252 65.324  33.218  1.00 21.99  ? 372  ILE B CB    1 
ATOM   7798  C CG1   . ILE B 1 372 ? -11.012 64.420  34.441  1.00 22.05  ? 372  ILE B CG1   1 
ATOM   7799  C CG2   . ILE B 1 372 ? -12.755 65.598  32.947  1.00 20.96  ? 372  ILE B CG2   1 
ATOM   7800  C CD1   . ILE B 1 372 ? -11.322 65.094  35.802  1.00 22.02  ? 372  ILE B CD1   1 
ATOM   7801  N N     . GLU B 1 373 ? -8.431  63.566  32.075  1.00 23.89  ? 373  GLU B N     1 
ATOM   7802  C CA    . GLU B 1 373 ? -6.993  63.395  32.285  1.00 25.17  ? 373  GLU B CA    1 
ATOM   7803  C C     . GLU B 1 373 ? -6.152  64.263  31.343  1.00 24.98  ? 373  GLU B C     1 
ATOM   7804  O O     . GLU B 1 373 ? -6.316  64.208  30.119  1.00 25.13  ? 373  GLU B O     1 
ATOM   7805  C CB    . GLU B 1 373 ? -6.622  61.925  32.132  1.00 25.42  ? 373  GLU B CB    1 
ATOM   7806  C CG    . GLU B 1 373 ? -5.161  61.622  32.385  1.00 29.30  ? 373  GLU B CG    1 
ATOM   7807  C CD    . GLU B 1 373 ? -4.830  60.166  32.130  1.00 34.04  ? 373  GLU B CD    1 
ATOM   7808  O OE1   . GLU B 1 373 ? -5.625  59.295  32.549  1.00 36.02  ? 373  GLU B OE1   1 
ATOM   7809  O OE2   . GLU B 1 373 ? -3.778  59.894  31.512  1.00 35.87  ? 373  GLU B OE2   1 
ATOM   7810  N N     . GLY B 1 374 ? -5.266  65.063  31.933  1.00 25.00  ? 374  GLY B N     1 
ATOM   7811  C CA    . GLY B 1 374 ? -4.382  65.959  31.185  1.00 24.85  ? 374  GLY B CA    1 
ATOM   7812  C C     . GLY B 1 374 ? -4.995  67.315  30.857  1.00 24.86  ? 374  GLY B C     1 
ATOM   7813  O O     . GLY B 1 374 ? -4.327  68.185  30.298  1.00 24.73  ? 374  GLY B O     1 
ATOM   7814  N N     . THR B 1 375 ? -6.265  67.503  31.204  1.00 24.36  ? 375  THR B N     1 
ATOM   7815  C CA    . THR B 1 375 ? -6.954  68.754  30.888  1.00 23.79  ? 375  THR B CA    1 
ATOM   7816  C C     . THR B 1 375 ? -7.174  69.614  32.124  1.00 23.88  ? 375  THR B C     1 
ATOM   7817  O O     . THR B 1 375 ? -7.172  69.110  33.250  1.00 23.65  ? 375  THR B O     1 
ATOM   7818  C CB    . THR B 1 375 ? -8.305  68.511  30.168  1.00 23.53  ? 375  THR B CB    1 
ATOM   7819  O OG1   . THR B 1 375 ? -9.222  67.874  31.062  1.00 22.85  ? 375  THR B OG1   1 
ATOM   7820  C CG2   . THR B 1 375 ? -8.104  67.641  28.940  1.00 22.58  ? 375  THR B CG2   1 
ATOM   7821  N N     . ASP B 1 376 ? -7.387  70.906  31.888  1.00 23.90  ? 376  ASP B N     1 
ATOM   7822  C CA    . ASP B 1 376 ? -7.562  71.901  32.938  1.00 24.33  ? 376  ASP B CA    1 
ATOM   7823  C C     . ASP B 1 376 ? -9.038  72.289  33.166  1.00 24.20  ? 376  ASP B C     1 
ATOM   7824  O O     . ASP B 1 376 ? -9.531  72.235  34.302  1.00 23.91  ? 376  ASP B O     1 
ATOM   7825  C CB    . ASP B 1 376 ? -6.726  73.132  32.591  1.00 25.03  ? 376  ASP B CB    1 
ATOM   7826  C CG    . ASP B 1 376 ? -6.617  74.097  33.728  1.00 26.82  ? 376  ASP B CG    1 
ATOM   7827  O OD1   . ASP B 1 376 ? -7.265  75.160  33.648  1.00 29.28  ? 376  ASP B OD1   1 
ATOM   7828  O OD2   . ASP B 1 376 ? -5.898  73.796  34.707  1.00 30.00  ? 376  ASP B OD2   1 
ATOM   7829  N N     . ARG B 1 377 ? -9.731  72.671  32.086  1.00 23.93  ? 377  ARG B N     1 
ATOM   7830  C CA    . ARG B 1 377 ? -11.156 73.068  32.110  1.00 23.60  ? 377  ARG B CA    1 
ATOM   7831  C C     . ARG B 1 377 ? -11.449 74.375  32.867  1.00 23.59  ? 377  ARG B C     1 
ATOM   7832  O O     . ARG B 1 377 ? -12.610 74.724  33.076  1.00 23.86  ? 377  ARG B O     1 
ATOM   7833  C CB    . ARG B 1 377 ? -12.044 71.920  32.646  1.00 23.30  ? 377  ARG B CB    1 
ATOM   7834  C CG    . ARG B 1 377 ? -12.063 70.671  31.761  1.00 23.21  ? 377  ARG B CG    1 
ATOM   7835  C CD    . ARG B 1 377 ? -12.103 69.383  32.573  1.00 23.01  ? 377  ARG B CD    1 
ATOM   7836  N NE    . ARG B 1 377 ? -10.817 69.122  33.222  1.00 23.45  ? 377  ARG B NE    1 
ATOM   7837  C CZ    . ARG B 1 377 ? -10.649 68.905  34.524  1.00 22.11  ? 377  ARG B CZ    1 
ATOM   7838  N NH1   . ARG B 1 377 ? -11.688 68.879  35.349  1.00 22.58  ? 377  ARG B NH1   1 
ATOM   7839  N NH2   . ARG B 1 377 ? -9.433  68.687  34.996  1.00 21.65  ? 377  ARG B NH2   1 
ATOM   7840  N N     . SER B 1 378 ? -10.410 75.112  33.259  1.00 23.73  ? 378  SER B N     1 
ATOM   7841  C CA    . SER B 1 378 ? -10.589 76.283  34.140  1.00 23.62  ? 378  SER B CA    1 
ATOM   7842  C C     . SER B 1 378 ? -11.336 77.450  33.497  1.00 23.14  ? 378  SER B C     1 
ATOM   7843  O O     . SER B 1 378 ? -11.864 78.317  34.204  1.00 22.85  ? 378  SER B O     1 
ATOM   7844  C CB    . SER B 1 378 ? -9.242  76.764  34.693  1.00 24.19  ? 378  SER B CB    1 
ATOM   7845  O OG    . SER B 1 378 ? -8.801  75.917  35.744  1.00 25.23  ? 378  SER B OG    1 
ATOM   7846  N N     . SER B 1 379 ? -11.381 77.465  32.165  1.00 22.46  ? 379  SER B N     1 
ATOM   7847  C CA    . SER B 1 379 ? -12.039 78.536  31.424  1.00 21.99  ? 379  SER B CA    1 
ATOM   7848  C C     . SER B 1 379 ? -13.580 78.472  31.487  1.00 21.69  ? 379  SER B C     1 
ATOM   7849  O O     . SER B 1 379 ? -14.263 79.456  31.197  1.00 21.32  ? 379  SER B O     1 
ATOM   7850  C CB    . SER B 1 379 ? -11.543 78.554  29.973  1.00 22.27  ? 379  SER B CB    1 
ATOM   7851  O OG    . SER B 1 379 ? -11.827 77.332  29.289  1.00 23.21  ? 379  SER B OG    1 
ATOM   7852  N N     . LEU B 1 380 ? -14.122 77.323  31.878  1.00 21.61  ? 380  LEU B N     1 
ATOM   7853  C CA    . LEU B 1 380 ? -15.578 77.120  31.875  1.00 21.59  ? 380  LEU B CA    1 
ATOM   7854  C C     . LEU B 1 380 ? -16.282 77.925  32.971  1.00 22.21  ? 380  LEU B C     1 
ATOM   7855  O O     . LEU B 1 380 ? -15.801 77.999  34.112  1.00 21.41  ? 380  LEU B O     1 
ATOM   7856  C CB    . LEU B 1 380 ? -15.917 75.632  31.991  1.00 21.43  ? 380  LEU B CB    1 
ATOM   7857  C CG    . LEU B 1 380 ? -15.612 74.746  30.768  1.00 21.00  ? 380  LEU B CG    1 
ATOM   7858  C CD1   . LEU B 1 380 ? -15.855 73.287  31.107  1.00 20.66  ? 380  LEU B CD1   1 
ATOM   7859  C CD2   . LEU B 1 380 ? -16.417 75.143  29.531  1.00 20.27  ? 380  LEU B CD2   1 
ATOM   7860  N N     . ARG B 1 381 ? -17.412 78.532  32.602  1.00 22.35  ? 381  ARG B N     1 
ATOM   7861  C CA    . ARG B 1 381 ? -18.244 79.304  33.529  1.00 23.33  ? 381  ARG B CA    1 
ATOM   7862  C C     . ARG B 1 381 ? -19.673 78.749  33.593  1.00 22.41  ? 381  ARG B C     1 
ATOM   7863  O O     . ARG B 1 381 ? -20.301 78.745  34.650  1.00 21.95  ? 381  ARG B O     1 
ATOM   7864  C CB    . ARG B 1 381 ? -18.287 80.782  33.121  1.00 22.99  ? 381  ARG B CB    1 
ATOM   7865  C CG    . ARG B 1 381 ? -17.055 81.579  33.518  1.00 25.69  ? 381  ARG B CG    1 
ATOM   7866  C CD    . ARG B 1 381 ? -17.274 83.086  33.349  1.00 25.83  ? 381  ARG B CD    1 
ATOM   7867  N NE    . ARG B 1 381 ? -17.206 83.500  31.944  1.00 31.56  ? 381  ARG B NE    1 
ATOM   7868  C CZ    . ARG B 1 381 ? -16.105 83.952  31.341  1.00 32.75  ? 381  ARG B CZ    1 
ATOM   7869  N NH1   . ARG B 1 381 ? -14.958 84.052  32.013  1.00 32.75  ? 381  ARG B NH1   1 
ATOM   7870  N NH2   . ARG B 1 381 ? -16.152 84.311  30.063  1.00 31.99  ? 381  ARG B NH2   1 
ATOM   7871  N N     . ILE B 1 382 ? -20.169 78.285  32.448  1.00 21.98  ? 382  ILE B N     1 
ATOM   7872  C CA    . ILE B 1 382 ? -21.543 77.793  32.314  1.00 21.66  ? 382  ILE B CA    1 
ATOM   7873  C C     . ILE B 1 382 ? -21.519 76.472  31.556  1.00 21.38  ? 382  ILE B C     1 
ATOM   7874  O O     . ILE B 1 382 ? -20.782 76.336  30.584  1.00 21.45  ? 382  ILE B O     1 
ATOM   7875  C CB    . ILE B 1 382 ? -22.442 78.815  31.532  1.00 21.59  ? 382  ILE B CB    1 
ATOM   7876  C CG1   . ILE B 1 382 ? -22.455 80.199  32.205  1.00 20.85  ? 382  ILE B CG1   1 
ATOM   7877  C CG2   . ILE B 1 382 ? -23.870 78.262  31.271  1.00 21.34  ? 382  ILE B CG2   1 
ATOM   7878  C CD1   . ILE B 1 382 ? -23.378 80.334  33.421  1.00 19.95  ? 382  ILE B CD1   1 
ATOM   7879  N N     . LEU B 1 383 ? -22.315 75.509  32.016  1.00 21.38  ? 383  LEU B N     1 
ATOM   7880  C CA    . LEU B 1 383 ? -22.547 74.248  31.309  1.00 21.74  ? 383  LEU B CA    1 
ATOM   7881  C C     . LEU B 1 383 ? -24.012 74.115  30.915  1.00 22.00  ? 383  LEU B C     1 
ATOM   7882  O O     . LEU B 1 383 ? -24.896 74.750  31.514  1.00 22.11  ? 383  LEU B O     1 
ATOM   7883  C CB    . LEU B 1 383 ? -22.172 73.040  32.175  1.00 21.66  ? 383  LEU B CB    1 
ATOM   7884  C CG    . LEU B 1 383 ? -20.757 72.960  32.744  1.00 22.49  ? 383  LEU B CG    1 
ATOM   7885  C CD1   . LEU B 1 383 ? -20.656 71.799  33.737  1.00 22.29  ? 383  LEU B CD1   1 
ATOM   7886  C CD2   . LEU B 1 383 ? -19.720 72.849  31.640  1.00 22.19  ? 383  LEU B CD2   1 
ATOM   7887  N N     . GLY B 1 384 ? -24.264 73.272  29.917  1.00 21.82  ? 384  GLY B N     1 
ATOM   7888  C CA    . GLY B 1 384 ? -25.608 73.041  29.435  1.00 21.47  ? 384  GLY B CA    1 
ATOM   7889  C C     . GLY B 1 384 ? -25.814 71.631  28.935  1.00 21.85  ? 384  GLY B C     1 
ATOM   7890  O O     . GLY B 1 384 ? -24.867 70.951  28.509  1.00 21.01  ? 384  GLY B O     1 
ATOM   7891  N N     . SER B 1 385 ? -27.074 71.209  28.981  1.00 22.06  ? 385  SER B N     1 
ATOM   7892  C CA    . SER B 1 385 ? -27.473 69.880  28.584  1.00 22.65  ? 385  SER B CA    1 
ATOM   7893  C C     . SER B 1 385 ? -28.781 69.978  27.805  1.00 22.99  ? 385  SER B C     1 
ATOM   7894  O O     . SER B 1 385 ? -29.653 70.787  28.152  1.00 23.30  ? 385  SER B O     1 
ATOM   7895  C CB    . SER B 1 385 ? -27.652 69.002  29.817  1.00 22.63  ? 385  SER B CB    1 
ATOM   7896  O OG    . SER B 1 385 ? -27.818 67.646  29.438  1.00 23.70  ? 385  SER B OG    1 
ATOM   7897  N N     . VAL B 1 386 ? -28.912 69.167  26.753  1.00 22.80  ? 386  VAL B N     1 
ATOM   7898  C CA    . VAL B 1 386 ? -30.111 69.185  25.903  1.00 23.17  ? 386  VAL B CA    1 
ATOM   7899  C C     . VAL B 1 386 ? -30.399 67.842  25.222  1.00 23.16  ? 386  VAL B C     1 
ATOM   7900  O O     . VAL B 1 386 ? -29.478 67.106  24.903  1.00 22.86  ? 386  VAL B O     1 
ATOM   7901  C CB    . VAL B 1 386 ? -30.012 70.285  24.813  1.00 22.88  ? 386  VAL B CB    1 
ATOM   7902  C CG1   . VAL B 1 386 ? -28.756 70.099  23.950  1.00 23.39  ? 386  VAL B CG1   1 
ATOM   7903  C CG2   . VAL B 1 386 ? -31.287 70.336  23.948  1.00 23.06  ? 386  VAL B CG2   1 
ATOM   7904  N N     . GLY B 1 387 ? -31.680 67.543  25.003  1.00 23.34  ? 387  GLY B N     1 
ATOM   7905  C CA    . GLY B 1 387 ? -32.066 66.561  24.001  1.00 23.89  ? 387  GLY B CA    1 
ATOM   7906  C C     . GLY B 1 387 ? -32.651 65.294  24.569  1.00 25.10  ? 387  GLY B C     1 
ATOM   7907  O O     . GLY B 1 387 ? -33.336 64.543  23.866  1.00 24.17  ? 387  GLY B O     1 
ATOM   7908  N N     . GLU B 1 388 ? -32.356 65.047  25.842  1.00 25.80  ? 388  GLU B N     1 
ATOM   7909  C CA    . GLU B 1 388 ? -32.828 63.865  26.532  1.00 27.64  ? 388  GLU B CA    1 
ATOM   7910  C C     . GLU B 1 388 ? -32.851 64.138  28.031  1.00 27.76  ? 388  GLU B C     1 
ATOM   7911  O O     . GLU B 1 388 ? -32.144 65.037  28.505  1.00 27.62  ? 388  GLU B O     1 
ATOM   7912  C CB    . GLU B 1 388 ? -31.930 62.658  26.206  1.00 27.41  ? 388  GLU B CB    1 
ATOM   7913  C CG    . GLU B 1 388 ? -30.487 63.051  25.983  1.00 29.75  ? 388  GLU B CG    1 
ATOM   7914  C CD    . GLU B 1 388 ? -29.603 61.975  25.370  1.00 29.58  ? 388  GLU B CD    1 
ATOM   7915  O OE1   . GLU B 1 388 ? -29.703 60.785  25.769  1.00 30.26  ? 388  GLU B OE1   1 
ATOM   7916  O OE2   . GLU B 1 388 ? -28.767 62.355  24.513  1.00 30.92  ? 388  GLU B OE2   1 
ATOM   7917  N N     . PRO B 1 389 ? -33.676 63.376  28.782  1.00 28.32  ? 389  PRO B N     1 
ATOM   7918  C CA    . PRO B 1 389 ? -33.620 63.483  30.230  1.00 28.64  ? 389  PRO B CA    1 
ATOM   7919  C C     . PRO B 1 389 ? -32.205 63.192  30.709  1.00 29.14  ? 389  PRO B C     1 
ATOM   7920  O O     . PRO B 1 389 ? -31.507 62.363  30.118  1.00 29.03  ? 389  PRO B O     1 
ATOM   7921  C CB    . PRO B 1 389 ? -34.579 62.393  30.694  1.00 29.14  ? 389  PRO B CB    1 
ATOM   7922  C CG    . PRO B 1 389 ? -35.532 62.224  29.553  1.00 28.72  ? 389  PRO B CG    1 
ATOM   7923  C CD    . PRO B 1 389 ? -34.692 62.397  28.342  1.00 28.22  ? 389  PRO B CD    1 
ATOM   7924  N N     . ILE B 1 390 ? -31.765 63.917  31.730  1.00 29.29  ? 390  ILE B N     1 
ATOM   7925  C CA    . ILE B 1 390 ? -30.464 63.648  32.330  1.00 29.52  ? 390  ILE B CA    1 
ATOM   7926  C C     . ILE B 1 390 ? -30.645 63.095  33.739  1.00 29.66  ? 390  ILE B C     1 
ATOM   7927  O O     . ILE B 1 390 ? -31.266 63.710  34.605  1.00 29.38  ? 390  ILE B O     1 
ATOM   7928  C CB    . ILE B 1 390 ? -29.501 64.876  32.291  1.00 29.52  ? 390  ILE B CB    1 
ATOM   7929  C CG1   . ILE B 1 390 ? -28.098 64.471  32.758  1.00 29.18  ? 390  ILE B CG1   1 
ATOM   7930  C CG2   . ILE B 1 390 ? -30.062 66.064  33.084  1.00 28.83  ? 390  ILE B CG2   1 
ATOM   7931  C CD1   . ILE B 1 390 ? -27.011 65.395  32.276  1.00 28.76  ? 390  ILE B CD1   1 
ATOM   7932  N N     . ASN B 1 391 ? -30.128 61.890  33.918  1.00 29.73  ? 391  ASN B N     1 
ATOM   7933  C CA    . ASN B 1 391 ? -30.079 61.225  35.191  1.00 29.56  ? 391  ASN B CA    1 
ATOM   7934  C C     . ASN B 1 391 ? -29.278 62.082  36.193  1.00 28.75  ? 391  ASN B C     1 
ATOM   7935  O O     . ASN B 1 391 ? -28.241 62.641  35.842  1.00 28.50  ? 391  ASN B O     1 
ATOM   7936  C CB    . ASN B 1 391 ? -29.463 59.848  34.938  1.00 30.45  ? 391  ASN B CB    1 
ATOM   7937  C CG    . ASN B 1 391 ? -29.133 59.112  36.190  1.00 32.56  ? 391  ASN B CG    1 
ATOM   7938  O OD1   . ASN B 1 391 ? -28.191 59.462  36.882  1.00 36.70  ? 391  ASN B OD1   1 
ATOM   7939  N ND2   . ASN B 1 391 ? -29.884 58.053  36.478  1.00 35.39  ? 391  ASN B ND2   1 
ATOM   7940  N N     . PRO B 1 392 ? -29.791 62.237  37.430  1.00 28.28  ? 392  PRO B N     1 
ATOM   7941  C CA    . PRO B 1 392 ? -29.099 63.007  38.475  1.00 27.39  ? 392  PRO B CA    1 
ATOM   7942  C C     . PRO B 1 392 ? -27.608 62.673  38.666  1.00 26.69  ? 392  PRO B C     1 
ATOM   7943  O O     . PRO B 1 392 ? -26.803 63.578  38.929  1.00 26.18  ? 392  PRO B O     1 
ATOM   7944  C CB    . PRO B 1 392 ? -29.892 62.667  39.739  1.00 27.39  ? 392  PRO B CB    1 
ATOM   7945  C CG    . PRO B 1 392 ? -31.274 62.425  39.236  1.00 28.15  ? 392  PRO B CG    1 
ATOM   7946  C CD    . PRO B 1 392 ? -31.099 61.737  37.902  1.00 28.22  ? 392  PRO B CD    1 
ATOM   7947  N N     . GLU B 1 393 ? -27.256 61.396  38.544  1.00 25.55  ? 393  GLU B N     1 
ATOM   7948  C CA    . GLU B 1 393 ? -25.884 60.940  38.746  1.00 25.65  ? 393  GLU B CA    1 
ATOM   7949  C C     . GLU B 1 393 ? -24.992 61.387  37.589  1.00 24.59  ? 393  GLU B C     1 
ATOM   7950  O O     . GLU B 1 393 ? -23.814 61.709  37.790  1.00 23.89  ? 393  GLU B O     1 
ATOM   7951  C CB    . GLU B 1 393 ? -25.837 59.412  38.871  1.00 25.45  ? 393  GLU B CB    1 
ATOM   7952  C CG    . GLU B 1 393 ? -26.479 58.846  40.142  1.00 27.76  ? 393  GLU B CG    1 
ATOM   7953  C CD    . GLU B 1 393 ? -26.575 57.327  40.125  1.00 28.66  ? 393  GLU B CD    1 
ATOM   7954  O OE1   . GLU B 1 393 ? -26.625 56.740  39.013  1.00 32.12  ? 393  GLU B OE1   1 
ATOM   7955  O OE2   . GLU B 1 393 ? -26.605 56.718  41.226  1.00 33.40  ? 393  GLU B OE2   1 
ATOM   7956  N N     . ALA B 1 394 ? -25.559 61.382  36.381  1.00 23.17  ? 394  ALA B N     1 
ATOM   7957  C CA    . ALA B 1 394 ? -24.892 61.925  35.199  1.00 22.54  ? 394  ALA B CA    1 
ATOM   7958  C C     . ALA B 1 394 ? -24.744 63.455  35.307  1.00 21.98  ? 394  ALA B C     1 
ATOM   7959  O O     . ALA B 1 394 ? -23.690 64.005  34.993  1.00 21.59  ? 394  ALA B O     1 
ATOM   7960  C CB    . ALA B 1 394 ? -25.653 61.530  33.922  1.00 22.14  ? 394  ALA B CB    1 
ATOM   7961  N N     . TRP B 1 395 ? -25.805 64.122  35.755  1.00 21.53  ? 395  TRP B N     1 
ATOM   7962  C CA    . TRP B 1 395 ? -25.802 65.574  36.005  1.00 21.79  ? 395  TRP B CA    1 
ATOM   7963  C C     . TRP B 1 395 ? -24.700 65.984  36.984  1.00 21.71  ? 395  TRP B C     1 
ATOM   7964  O O     . TRP B 1 395 ? -23.930 66.909  36.696  1.00 22.29  ? 395  TRP B O     1 
ATOM   7965  C CB    . TRP B 1 395 ? -27.180 66.017  36.519  1.00 21.69  ? 395  TRP B CB    1 
ATOM   7966  C CG    . TRP B 1 395 ? -27.429 67.512  36.592  1.00 22.12  ? 395  TRP B CG    1 
ATOM   7967  C CD1   . TRP B 1 395 ? -28.206 68.252  35.742  1.00 22.45  ? 395  TRP B CD1   1 
ATOM   7968  C CD2   . TRP B 1 395 ? -26.936 68.433  37.586  1.00 22.22  ? 395  TRP B CD2   1 
ATOM   7969  N NE1   . TRP B 1 395 ? -28.230 69.569  36.146  1.00 23.13  ? 395  TRP B NE1   1 
ATOM   7970  C CE2   . TRP B 1 395 ? -27.449 69.710  37.264  1.00 22.11  ? 395  TRP B CE2   1 
ATOM   7971  C CE3   . TRP B 1 395 ? -26.106 68.304  38.707  1.00 22.61  ? 395  TRP B CE3   1 
ATOM   7972  C CZ2   . TRP B 1 395 ? -27.162 70.848  38.023  1.00 22.44  ? 395  TRP B CZ2   1 
ATOM   7973  C CZ3   . TRP B 1 395 ? -25.818 69.444  39.468  1.00 23.07  ? 395  TRP B CZ3   1 
ATOM   7974  C CH2   . TRP B 1 395 ? -26.351 70.698  39.119  1.00 22.26  ? 395  TRP B CH2   1 
ATOM   7975  N N     . GLU B 1 396 ? -24.622 65.293  38.125  1.00 21.84  ? 396  GLU B N     1 
ATOM   7976  C CA    . GLU B 1 396 ? -23.584 65.546  39.150  1.00 21.92  ? 396  GLU B CA    1 
ATOM   7977  C C     . GLU B 1 396 ? -22.166 65.277  38.631  1.00 21.76  ? 396  GLU B C     1 
ATOM   7978  O O     . GLU B 1 396 ? -21.234 66.028  38.942  1.00 21.73  ? 396  GLU B O     1 
ATOM   7979  C CB    . GLU B 1 396 ? -23.840 64.710  40.419  1.00 21.96  ? 396  GLU B CB    1 
ATOM   7980  C CG    . GLU B 1 396 ? -25.081 65.112  41.238  1.00 24.69  ? 396  GLU B CG    1 
ATOM   7981  C CD    . GLU B 1 396 ? -24.928 66.453  41.968  1.00 27.91  ? 396  GLU B CD    1 
ATOM   7982  O OE1   . GLU B 1 396 ? -23.784 66.955  42.064  1.00 29.79  ? 396  GLU B OE1   1 
ATOM   7983  O OE2   . GLU B 1 396 ? -25.949 67.001  42.458  1.00 28.62  ? 396  GLU B OE2   1 
ATOM   7984  N N     . TRP B 1 397 ? -22.002 64.206  37.848  1.00 21.21  ? 397  TRP B N     1 
ATOM   7985  C CA    . TRP B 1 397 ? -20.709 63.902  37.234  1.00 20.65  ? 397  TRP B CA    1 
ATOM   7986  C C     . TRP B 1 397 ? -20.263 65.038  36.300  1.00 20.33  ? 397  TRP B C     1 
ATOM   7987  O O     . TRP B 1 397 ? -19.124 65.516  36.365  1.00 19.87  ? 397  TRP B O     1 
ATOM   7988  C CB    . TRP B 1 397 ? -20.756 62.570  36.482  1.00 20.60  ? 397  TRP B CB    1 
ATOM   7989  C CG    . TRP B 1 397 ? -19.396 62.133  35.976  1.00 20.42  ? 397  TRP B CG    1 
ATOM   7990  C CD1   . TRP B 1 397 ? -18.515 61.302  36.607  1.00 19.96  ? 397  TRP B CD1   1 
ATOM   7991  C CD2   . TRP B 1 397 ? -18.774 62.511  34.736  1.00 19.86  ? 397  TRP B CD2   1 
ATOM   7992  N NE1   . TRP B 1 397 ? -17.381 61.139  35.838  1.00 19.10  ? 397  TRP B NE1   1 
ATOM   7993  C CE2   . TRP B 1 397 ? -17.517 61.873  34.688  1.00 19.32  ? 397  TRP B CE2   1 
ATOM   7994  C CE3   . TRP B 1 397 ? -19.155 63.343  33.667  1.00 20.04  ? 397  TRP B CE3   1 
ATOM   7995  C CZ2   . TRP B 1 397 ? -16.637 62.035  33.612  1.00 20.11  ? 397  TRP B CZ2   1 
ATOM   7996  C CZ3   . TRP B 1 397 ? -18.293 63.494  32.603  1.00 20.10  ? 397  TRP B CZ3   1 
ATOM   7997  C CH2   . TRP B 1 397 ? -17.042 62.840  32.579  1.00 20.04  ? 397  TRP B CH2   1 
ATOM   7998  N N     . TYR B 1 398 ? -21.177 65.463  35.438  1.00 20.28  ? 398  TYR B N     1 
ATOM   7999  C CA    . TYR B 1 398 ? -20.970 66.591  34.533  1.00 20.32  ? 398  TYR B CA    1 
ATOM   8000  C C     . TYR B 1 398 ? -20.562 67.852  35.298  1.00 20.40  ? 398  TYR B C     1 
ATOM   8001  O O     . TYR B 1 398 ? -19.529 68.464  35.015  1.00 20.29  ? 398  TYR B O     1 
ATOM   8002  C CB    . TYR B 1 398 ? -22.281 66.836  33.787  1.00 20.39  ? 398  TYR B CB    1 
ATOM   8003  C CG    . TYR B 1 398 ? -22.231 67.818  32.648  1.00 20.26  ? 398  TYR B CG    1 
ATOM   8004  C CD1   . TYR B 1 398 ? -21.131 67.881  31.778  1.00 19.73  ? 398  TYR B CD1   1 
ATOM   8005  C CD2   . TYR B 1 398 ? -23.322 68.654  32.395  1.00 20.74  ? 398  TYR B CD2   1 
ATOM   8006  C CE1   . TYR B 1 398 ? -21.120 68.778  30.710  1.00 19.20  ? 398  TYR B CE1   1 
ATOM   8007  C CE2   . TYR B 1 398 ? -23.321 69.535  31.324  1.00 19.55  ? 398  TYR B CE2   1 
ATOM   8008  C CZ    . TYR B 1 398 ? -22.224 69.592  30.489  1.00 20.81  ? 398  TYR B CZ    1 
ATOM   8009  O OH    . TYR B 1 398 ? -22.241 70.483  29.432  1.00 20.52  ? 398  TYR B OH    1 
ATOM   8010  N N     . TRP B 1 399 ? -21.391 68.206  36.278  1.00 20.97  ? 399  TRP B N     1 
ATOM   8011  C CA    . TRP B 1 399 ? -21.194 69.354  37.162  1.00 21.21  ? 399  TRP B CA    1 
ATOM   8012  C C     . TRP B 1 399 ? -19.860 69.315  37.901  1.00 21.26  ? 399  TRP B C     1 
ATOM   8013  O O     . TRP B 1 399 ? -19.214 70.361  38.071  1.00 21.38  ? 399  TRP B O     1 
ATOM   8014  C CB    . TRP B 1 399 ? -22.353 69.414  38.162  1.00 21.61  ? 399  TRP B CB    1 
ATOM   8015  C CG    . TRP B 1 399 ? -22.325 70.575  39.118  1.00 22.64  ? 399  TRP B CG    1 
ATOM   8016  C CD1   . TRP B 1 399 ? -22.725 71.853  38.867  1.00 23.30  ? 399  TRP B CD1   1 
ATOM   8017  C CD2   . TRP B 1 399 ? -21.903 70.549  40.488  1.00 22.31  ? 399  TRP B CD2   1 
ATOM   8018  N NE1   . TRP B 1 399 ? -22.567 72.626  39.989  1.00 22.74  ? 399  TRP B NE1   1 
ATOM   8019  C CE2   . TRP B 1 399 ? -22.062 71.852  40.997  1.00 22.18  ? 399  TRP B CE2   1 
ATOM   8020  C CE3   . TRP B 1 399 ? -21.396 69.553  41.329  1.00 23.21  ? 399  TRP B CE3   1 
ATOM   8021  C CZ2   . TRP B 1 399 ? -21.729 72.191  42.319  1.00 23.44  ? 399  TRP B CZ2   1 
ATOM   8022  C CZ3   . TRP B 1 399 ? -21.073 69.888  42.649  1.00 22.98  ? 399  TRP B CZ3   1 
ATOM   8023  C CH2   . TRP B 1 399 ? -21.242 71.195  43.126  1.00 22.63  ? 399  TRP B CH2   1 
ATOM   8024  N N     . LYS B 1 400 ? -19.452 68.120  38.337  1.00 21.05  ? 400  LYS B N     1 
ATOM   8025  C CA    . LYS B 1 400 ? -18.214 67.954  39.115  1.00 21.08  ? 400  LYS B CA    1 
ATOM   8026  C C     . LYS B 1 400 ? -16.965 67.834  38.242  1.00 20.67  ? 400  LYS B C     1 
ATOM   8027  O O     . LYS B 1 400 ? -16.005 68.581  38.421  1.00 20.85  ? 400  LYS B O     1 
ATOM   8028  C CB    . LYS B 1 400 ? -18.303 66.747  40.052  1.00 20.71  ? 400  LYS B CB    1 
ATOM   8029  C CG    . LYS B 1 400 ? -17.011 66.493  40.830  1.00 22.25  ? 400  LYS B CG    1 
ATOM   8030  C CD    . LYS B 1 400 ? -17.126 65.336  41.825  1.00 22.09  ? 400  LYS B CD    1 
ATOM   8031  C CE    . LYS B 1 400 ? -15.829 65.203  42.630  1.00 23.73  ? 400  LYS B CE    1 
ATOM   8032  N NZ    . LYS B 1 400 ? -15.798 63.952  43.432  1.00 24.98  ? 400  LYS B NZ    1 
ATOM   8033  N N     . LYS B 1 401 ? -16.980 66.885  37.311  1.00 20.23  ? 401  LYS B N     1 
ATOM   8034  C CA    . LYS B 1 401 ? -15.803 66.574  36.509  1.00 19.80  ? 401  LYS B CA    1 
ATOM   8035  C C     . LYS B 1 401 ? -15.552 67.600  35.405  1.00 19.92  ? 401  LYS B C     1 
ATOM   8036  O O     . LYS B 1 401 ? -14.410 68.028  35.206  1.00 19.60  ? 401  LYS B O     1 
ATOM   8037  C CB    . LYS B 1 401 ? -15.897 65.163  35.925  1.00 19.57  ? 401  LYS B CB    1 
ATOM   8038  C CG    . LYS B 1 401 ? -15.992 64.062  36.966  1.00 19.13  ? 401  LYS B CG    1 
ATOM   8039  C CD    . LYS B 1 401 ? -14.654 63.867  37.648  1.00 19.16  ? 401  LYS B CD    1 
ATOM   8040  C CE    . LYS B 1 401 ? -14.773 62.989  38.879  1.00 18.84  ? 401  LYS B CE    1 
ATOM   8041  N NZ    . LYS B 1 401 ? -13.417 62.729  39.414  1.00 18.24  ? 401  LYS B NZ    1 
ATOM   8042  N N     . ILE B 1 402 ? -16.608 67.995  34.693  1.00 19.36  ? 402  ILE B N     1 
ATOM   8043  C CA    . ILE B 1 402 ? -16.447 68.973  33.607  1.00 19.46  ? 402  ILE B CA    1 
ATOM   8044  C C     . ILE B 1 402 ? -16.442 70.408  34.149  1.00 19.56  ? 402  ILE B C     1 
ATOM   8045  O O     . ILE B 1 402 ? -15.565 71.194  33.809  1.00 19.62  ? 402  ILE B O     1 
ATOM   8046  C CB    . ILE B 1 402 ? -17.491 68.773  32.457  1.00 19.40  ? 402  ILE B CB    1 
ATOM   8047  C CG1   . ILE B 1 402 ? -17.483 67.317  31.946  1.00 19.21  ? 402  ILE B CG1   1 
ATOM   8048  C CG2   . ILE B 1 402 ? -17.286 69.775  31.318  1.00 18.38  ? 402  ILE B CG2   1 
ATOM   8049  C CD1   . ILE B 1 402 ? -16.131 66.769  31.543  1.00 19.86  ? 402  ILE B CD1   1 
ATOM   8050  N N     . GLY B 1 403 ? -17.393 70.726  35.023  1.00 20.02  ? 403  GLY B N     1 
ATOM   8051  C CA    . GLY B 1 403 ? -17.545 72.089  35.527  1.00 20.41  ? 403  GLY B CA    1 
ATOM   8052  C C     . GLY B 1 403 ? -16.783 72.428  36.791  1.00 21.11  ? 403  GLY B C     1 
ATOM   8053  O O     . GLY B 1 403 ? -16.846 73.569  37.261  1.00 21.08  ? 403  GLY B O     1 
ATOM   8054  N N     . LYS B 1 404 ? -16.061 71.447  37.335  1.00 21.77  ? 404  LYS B N     1 
ATOM   8055  C CA    . LYS B 1 404 ? -15.251 71.612  38.557  1.00 22.40  ? 404  LYS B CA    1 
ATOM   8056  C C     . LYS B 1 404 ? -16.042 72.207  39.730  1.00 22.96  ? 404  LYS B C     1 
ATOM   8057  O O     . LYS B 1 404 ? -15.489 72.946  40.545  1.00 22.55  ? 404  LYS B O     1 
ATOM   8058  C CB    . LYS B 1 404 ? -13.980 72.431  38.279  1.00 22.39  ? 404  LYS B CB    1 
ATOM   8059  C CG    . LYS B 1 404 ? -13.157 71.914  37.100  1.00 23.33  ? 404  LYS B CG    1 
ATOM   8060  C CD    . LYS B 1 404 ? -11.963 72.808  36.778  1.00 22.35  ? 404  LYS B CD    1 
ATOM   8061  C CE    . LYS B 1 404 ? -10.741 72.377  37.554  1.00 22.57  ? 404  LYS B CE    1 
ATOM   8062  N NZ    . LYS B 1 404 ? -9.632  73.331  37.340  1.00 23.28  ? 404  LYS B NZ    1 
ATOM   8063  N N     . GLU B 1 405 ? -17.334 71.875  39.798  1.00 23.50  ? 405  GLU B N     1 
ATOM   8064  C CA    . GLU B 1 405 ? -18.244 72.345  40.854  1.00 24.81  ? 405  GLU B CA    1 
ATOM   8065  C C     . GLU B 1 405 ? -18.510 73.865  40.827  1.00 24.84  ? 405  GLU B C     1 
ATOM   8066  O O     . GLU B 1 405 ? -19.100 74.425  41.765  1.00 24.82  ? 405  GLU B O     1 
ATOM   8067  C CB    . GLU B 1 405 ? -17.763 71.880  42.248  1.00 24.64  ? 405  GLU B CB    1 
ATOM   8068  C CG    . GLU B 1 405 ? -17.559 70.352  42.370  1.00 25.72  ? 405  GLU B CG    1 
ATOM   8069  C CD    . GLU B 1 405 ? -17.241 69.880  43.795  1.00 26.62  ? 405  GLU B CD    1 
ATOM   8070  O OE1   . GLU B 1 405 ? -16.799 68.723  43.948  1.00 29.10  ? 405  GLU B OE1   1 
ATOM   8071  O OE2   . GLU B 1 405 ? -17.426 70.655  44.766  1.00 28.92  ? 405  GLU B OE2   1 
ATOM   8072  N N     . LYS B 1 406 ? -18.114 74.521  39.735  1.00 24.78  ? 406  LYS B N     1 
ATOM   8073  C CA    . LYS B 1 406 ? -18.172 75.980  39.657  1.00 24.71  ? 406  LYS B CA    1 
ATOM   8074  C C     . LYS B 1 406 ? -19.257 76.503  38.736  1.00 24.41  ? 406  LYS B C     1 
ATOM   8075  O O     . LYS B 1 406 ? -19.613 77.683  38.793  1.00 24.39  ? 406  LYS B O     1 
ATOM   8076  C CB    . LYS B 1 406 ? -16.833 76.522  39.178  1.00 25.20  ? 406  LYS B CB    1 
ATOM   8077  C CG    . LYS B 1 406 ? -15.758 76.509  40.240  1.00 26.71  ? 406  LYS B CG    1 
ATOM   8078  C CD    . LYS B 1 406 ? -14.493 77.160  39.700  1.00 30.70  ? 406  LYS B CD    1 
ATOM   8079  C CE    . LYS B 1 406 ? -13.344 76.960  40.662  1.00 33.70  ? 406  LYS B CE    1 
ATOM   8080  N NZ    . LYS B 1 406 ? -13.126 75.500  40.900  1.00 36.21  ? 406  LYS B NZ    1 
ATOM   8081  N N     . CYS B 1 407 ? -19.775 75.629  37.882  1.00 23.80  ? 407  CYS B N     1 
ATOM   8082  C CA    . CYS B 1 407 ? -20.583 76.058  36.754  1.00 23.60  ? 407  CYS B CA    1 
ATOM   8083  C C     . CYS B 1 407 ? -22.011 75.605  36.913  1.00 23.44  ? 407  CYS B C     1 
ATOM   8084  O O     . CYS B 1 407 ? -22.258 74.414  37.082  1.00 23.96  ? 407  CYS B O     1 
ATOM   8085  C CB    . CYS B 1 407 ? -20.024 75.491  35.439  1.00 23.49  ? 407  CYS B CB    1 
ATOM   8086  S SG    . CYS B 1 407 ? -18.336 75.972  35.079  1.00 21.98  ? 407  CYS B SG    1 
ATOM   8087  N N     . PRO B 1 408 ? -22.960 76.552  36.857  1.00 23.27  ? 408  PRO B N     1 
ATOM   8088  C CA    . PRO B 1 408 ? -24.372 76.201  36.702  1.00 22.88  ? 408  PRO B CA    1 
ATOM   8089  C C     . PRO B 1 408 ? -24.585 75.338  35.453  1.00 22.82  ? 408  PRO B C     1 
ATOM   8090  O O     . PRO B 1 408 ? -23.924 75.558  34.434  1.00 22.48  ? 408  PRO B O     1 
ATOM   8091  C CB    . PRO B 1 408 ? -25.044 77.554  36.513  1.00 22.38  ? 408  PRO B CB    1 
ATOM   8092  C CG    . PRO B 1 408 ? -24.125 78.528  37.209  1.00 23.03  ? 408  PRO B CG    1 
ATOM   8093  C CD    . PRO B 1 408 ? -22.755 78.011  36.952  1.00 23.33  ? 408  PRO B CD    1 
ATOM   8094  N N     . VAL B 1 409 ? -25.496 74.363  35.546  1.00 22.66  ? 409  VAL B N     1 
ATOM   8095  C CA    . VAL B 1 409 ? -25.834 73.493  34.419  1.00 22.19  ? 409  VAL B CA    1 
ATOM   8096  C C     . VAL B 1 409 ? -27.228 73.879  33.949  1.00 22.42  ? 409  VAL B C     1 
ATOM   8097  O O     . VAL B 1 409 ? -28.195 73.773  34.716  1.00 22.63  ? 409  VAL B O     1 
ATOM   8098  C CB    . VAL B 1 409 ? -25.770 71.969  34.804  1.00 22.21  ? 409  VAL B CB    1 
ATOM   8099  C CG1   . VAL B 1 409 ? -26.311 71.082  33.674  1.00 21.58  ? 409  VAL B CG1   1 
ATOM   8100  C CG2   . VAL B 1 409 ? -24.349 71.555  35.174  1.00 20.78  ? 409  VAL B CG2   1 
ATOM   8101  N N     . VAL B 1 410 ? -27.326 74.374  32.712  1.00 22.12  ? 410  VAL B N     1 
ATOM   8102  C CA    . VAL B 1 410 ? -28.633 74.664  32.112  1.00 21.85  ? 410  VAL B CA    1 
ATOM   8103  C C     . VAL B 1 410 ? -29.165 73.450  31.333  1.00 22.13  ? 410  VAL B C     1 
ATOM   8104  O O     . VAL B 1 410 ? -28.697 73.134  30.224  1.00 21.83  ? 410  VAL B O     1 
ATOM   8105  C CB    . VAL B 1 410 ? -28.679 76.007  31.297  1.00 21.92  ? 410  VAL B CB    1 
ATOM   8106  C CG1   . VAL B 1 410 ? -28.494 77.203  32.233  1.00 21.80  ? 410  VAL B CG1   1 
ATOM   8107  C CG2   . VAL B 1 410 ? -27.641 76.047  30.141  1.00 21.66  ? 410  VAL B CG2   1 
ATOM   8108  N N     . ASP B 1 411 ? -30.112 72.748  31.962  1.00 21.94  ? 411  ASP B N     1 
ATOM   8109  C CA    . ASP B 1 411 ? -30.804 71.621  31.344  1.00 22.04  ? 411  ASP B CA    1 
ATOM   8110  C C     . ASP B 1 411 ? -31.997 72.195  30.595  1.00 22.00  ? 411  ASP B C     1 
ATOM   8111  O O     . ASP B 1 411 ? -32.999 72.558  31.208  1.00 21.78  ? 411  ASP B O     1 
ATOM   8112  C CB    . ASP B 1 411 ? -31.243 70.616  32.416  1.00 22.33  ? 411  ASP B CB    1 
ATOM   8113  C CG    . ASP B 1 411 ? -32.027 69.429  31.845  1.00 23.24  ? 411  ASP B CG    1 
ATOM   8114  O OD1   . ASP B 1 411 ? -32.052 69.253  30.606  1.00 23.47  ? 411  ASP B OD1   1 
ATOM   8115  O OD2   . ASP B 1 411 ? -32.618 68.667  32.647  1.00 22.43  ? 411  ASP B OD2   1 
ATOM   8116  N N     . THR B 1 412 ? -31.872 72.300  29.272  1.00 21.63  ? 412  THR B N     1 
ATOM   8117  C CA    . THR B 1 412 ? -32.858 73.022  28.460  1.00 21.33  ? 412  THR B CA    1 
ATOM   8118  C C     . THR B 1 412 ? -33.812 72.051  27.790  1.00 21.04  ? 412  THR B C     1 
ATOM   8119  O O     . THR B 1 412 ? -33.393 71.249  26.940  1.00 20.64  ? 412  THR B O     1 
ATOM   8120  C CB    . THR B 1 412 ? -32.197 73.884  27.341  1.00 21.27  ? 412  THR B CB    1 
ATOM   8121  O OG1   . THR B 1 412 ? -31.445 73.032  26.471  1.00 21.58  ? 412  THR B OG1   1 
ATOM   8122  C CG2   . THR B 1 412 ? -31.265 74.948  27.928  1.00 21.73  ? 412  THR B CG2   1 
ATOM   8123  N N     . TRP B 1 413 ? -35.087 72.122  28.175  1.00 20.37  ? 413  TRP B N     1 
ATOM   8124  C CA    . TRP B 1 413 ? -36.125 71.355  27.497  1.00 20.31  ? 413  TRP B CA    1 
ATOM   8125  C C     . TRP B 1 413 ? -36.758 72.190  26.399  1.00 20.18  ? 413  TRP B C     1 
ATOM   8126  O O     . TRP B 1 413 ? -37.160 73.351  26.614  1.00 19.72  ? 413  TRP B O     1 
ATOM   8127  C CB    . TRP B 1 413 ? -37.200 70.790  28.459  1.00 20.46  ? 413  TRP B CB    1 
ATOM   8128  C CG    . TRP B 1 413 ? -38.267 70.059  27.677  1.00 20.72  ? 413  TRP B CG    1 
ATOM   8129  C CD1   . TRP B 1 413 ? -38.228 68.763  27.246  1.00 20.09  ? 413  TRP B CD1   1 
ATOM   8130  C CD2   . TRP B 1 413 ? -39.480 70.620  27.159  1.00 21.09  ? 413  TRP B CD2   1 
ATOM   8131  N NE1   . TRP B 1 413 ? -39.351 68.477  26.511  1.00 21.76  ? 413  TRP B NE1   1 
ATOM   8132  C CE2   . TRP B 1 413 ? -40.135 69.600  26.437  1.00 21.48  ? 413  TRP B CE2   1 
ATOM   8133  C CE3   . TRP B 1 413 ? -40.081 71.887  27.244  1.00 20.65  ? 413  TRP B CE3   1 
ATOM   8134  C CZ2   . TRP B 1 413 ? -41.373 69.800  25.806  1.00 21.40  ? 413  TRP B CZ2   1 
ATOM   8135  C CZ3   . TRP B 1 413 ? -41.309 72.090  26.606  1.00 20.67  ? 413  TRP B CZ3   1 
ATOM   8136  C CH2   . TRP B 1 413 ? -41.940 71.048  25.900  1.00 21.39  ? 413  TRP B CH2   1 
ATOM   8137  N N     . TRP B 1 414 ? -36.816 71.591  25.213  1.00 20.10  ? 414  TRP B N     1 
ATOM   8138  C CA    . TRP B 1 414 ? -37.491 72.173  24.049  1.00 20.13  ? 414  TRP B CA    1 
ATOM   8139  C C     . TRP B 1 414 ? -37.531 71.121  22.945  1.00 20.57  ? 414  TRP B C     1 
ATOM   8140  O O     . TRP B 1 414 ? -37.164 69.974  23.187  1.00 20.38  ? 414  TRP B O     1 
ATOM   8141  C CB    . TRP B 1 414 ? -36.846 73.495  23.582  1.00 19.60  ? 414  TRP B CB    1 
ATOM   8142  C CG    . TRP B 1 414 ? -35.413 73.405  23.158  1.00 19.70  ? 414  TRP B CG    1 
ATOM   8143  C CD1   . TRP B 1 414 ? -34.349 73.064  23.942  1.00 19.06  ? 414  TRP B CD1   1 
ATOM   8144  C CD2   . TRP B 1 414 ? -34.876 73.692  21.852  1.00 18.80  ? 414  TRP B CD2   1 
ATOM   8145  N NE1   . TRP B 1 414 ? -33.188 73.101  23.200  1.00 20.07  ? 414  TRP B NE1   1 
ATOM   8146  C CE2   . TRP B 1 414 ? -33.483 73.486  21.920  1.00 18.82  ? 414  TRP B CE2   1 
ATOM   8147  C CE3   . TRP B 1 414 ? -35.440 74.099  20.633  1.00 19.54  ? 414  TRP B CE3   1 
ATOM   8148  C CZ2   . TRP B 1 414 ? -32.641 73.660  20.814  1.00 19.23  ? 414  TRP B CZ2   1 
ATOM   8149  C CZ3   . TRP B 1 414 ? -34.603 74.275  19.535  1.00 19.77  ? 414  TRP B CZ3   1 
ATOM   8150  C CH2   . TRP B 1 414 ? -33.216 74.057  19.636  1.00 18.88  ? 414  TRP B CH2   1 
ATOM   8151  N N     . GLN B 1 415 ? -37.990 71.513  21.755  1.00 20.83  ? 415  GLN B N     1 
ATOM   8152  C CA    . GLN B 1 415 ? -38.191 70.605  20.625  1.00 21.00  ? 415  GLN B CA    1 
ATOM   8153  C C     . GLN B 1 415 ? -38.010 71.364  19.333  1.00 20.81  ? 415  GLN B C     1 
ATOM   8154  O O     . GLN B 1 415 ? -38.040 72.590  19.320  1.00 20.79  ? 415  GLN B O     1 
ATOM   8155  C CB    . GLN B 1 415 ? -39.628 70.054  20.602  1.00 21.28  ? 415  GLN B CB    1 
ATOM   8156  C CG    . GLN B 1 415 ? -40.206 69.664  21.942  1.00 23.04  ? 415  GLN B CG    1 
ATOM   8157  C CD    . GLN B 1 415 ? -41.638 69.252  21.819  1.00 24.09  ? 415  GLN B CD    1 
ATOM   8158  O OE1   . GLN B 1 415 ? -42.519 70.074  21.519  1.00 23.39  ? 415  GLN B OE1   1 
ATOM   8159  N NE2   . GLN B 1 415 ? -41.890 67.967  22.023  1.00 22.62  ? 415  GLN B NE2   1 
ATOM   8160  N N     . THR B 1 416 ? -37.893 70.629  18.228  1.00 20.94  ? 416  THR B N     1 
ATOM   8161  C CA    . THR B 1 416 ? -37.820 71.251  16.900  1.00 20.72  ? 416  THR B CA    1 
ATOM   8162  C C     . THR B 1 416 ? -38.972 72.233  16.674  1.00 20.75  ? 416  THR B C     1 
ATOM   8163  O O     . THR B 1 416 ? -38.770 73.340  16.168  1.00 20.85  ? 416  THR B O     1 
ATOM   8164  C CB    . THR B 1 416 ? -37.850 70.184  15.783  1.00 20.61  ? 416  THR B CB    1 
ATOM   8165  O OG1   . THR B 1 416 ? -36.837 69.205  16.045  1.00 18.98  ? 416  THR B OG1   1 
ATOM   8166  C CG2   . THR B 1 416 ? -37.589 70.841  14.413  1.00 20.25  ? 416  THR B CG2   1 
ATOM   8167  N N     . GLU B 1 417 ? -40.174 71.814  17.063  1.00 20.63  ? 417  GLU B N     1 
ATOM   8168  C CA    . GLU B 1 417 ? -41.392 72.596  16.860  1.00 20.55  ? 417  GLU B CA    1 
ATOM   8169  C C     . GLU B 1 417 ? -41.477 73.851  17.737  1.00 20.31  ? 417  GLU B C     1 
ATOM   8170  O O     . GLU B 1 417 ? -42.361 74.677  17.529  1.00 20.45  ? 417  GLU B O     1 
ATOM   8171  C CB    . GLU B 1 417 ? -42.635 71.717  17.088  1.00 20.66  ? 417  GLU B CB    1 
ATOM   8172  C CG    . GLU B 1 417 ? -42.760 70.497  16.150  1.00 21.71  ? 417  GLU B CG    1 
ATOM   8173  C CD    . GLU B 1 417 ? -42.082 69.220  16.678  1.00 22.52  ? 417  GLU B CD    1 
ATOM   8174  O OE1   . GLU B 1 417 ? -41.204 69.299  17.571  1.00 19.30  ? 417  GLU B OE1   1 
ATOM   8175  O OE2   . GLU B 1 417 ? -42.435 68.123  16.182  1.00 23.44  ? 417  GLU B OE2   1 
ATOM   8176  N N     . THR B 1 418 ? -40.584 73.994  18.718  1.00 20.24  ? 418  THR B N     1 
ATOM   8177  C CA    . THR B 1 418 ? -40.643 75.153  19.631  1.00 19.77  ? 418  THR B CA    1 
ATOM   8178  C C     . THR B 1 418 ? -39.632 76.257  19.282  1.00 20.20  ? 418  THR B C     1 
ATOM   8179  O O     . THR B 1 418 ? -39.692 77.372  19.840  1.00 20.05  ? 418  THR B O     1 
ATOM   8180  C CB    . THR B 1 418 ? -40.482 74.753  21.129  1.00 19.75  ? 418  THR B CB    1 
ATOM   8181  O OG1   . THR B 1 418 ? -39.113 74.437  21.423  1.00 19.59  ? 418  THR B OG1   1 
ATOM   8182  C CG2   . THR B 1 418 ? -41.374 73.572  21.495  1.00 18.98  ? 418  THR B CG2   1 
ATOM   8183  N N     . GLY B 1 419 ? -38.690 75.943  18.391  1.00 19.50  ? 419  GLY B N     1 
ATOM   8184  C CA    . GLY B 1 419 ? -37.754 76.946  17.879  1.00 19.56  ? 419  GLY B CA    1 
ATOM   8185  C C     . GLY B 1 419 ? -36.593 77.286  18.797  1.00 19.59  ? 419  GLY B C     1 
ATOM   8186  O O     . GLY B 1 419 ? -35.483 77.544  18.332  1.00 19.29  ? 419  GLY B O     1 
ATOM   8187  N N     . GLY B 1 420 ? -36.864 77.311  20.099  1.00 19.77  ? 420  GLY B N     1 
ATOM   8188  C CA    . GLY B 1 420 ? -35.852 77.573  21.123  1.00 20.05  ? 420  GLY B CA    1 
ATOM   8189  C C     . GLY B 1 420 ? -36.310 77.097  22.501  1.00 20.29  ? 420  GLY B C     1 
ATOM   8190  O O     . GLY B 1 420 ? -37.395 76.499  22.622  1.00 20.03  ? 420  GLY B O     1 
ATOM   8191  N N     . PHE B 1 421 ? -35.505 77.410  23.527  1.00 19.95  ? 421  PHE B N     1 
ATOM   8192  C CA    . PHE B 1 421 ? -35.667 76.894  24.895  1.00 19.67  ? 421  PHE B CA    1 
ATOM   8193  C C     . PHE B 1 421 ? -37.048 77.193  25.466  1.00 19.85  ? 421  PHE B C     1 
ATOM   8194  O O     . PHE B 1 421 ? -37.538 78.314  25.331  1.00 19.59  ? 421  PHE B O     1 
ATOM   8195  C CB    . PHE B 1 421 ? -34.617 77.502  25.850  1.00 19.90  ? 421  PHE B CB    1 
ATOM   8196  C CG    . PHE B 1 421 ? -33.170 77.286  25.435  1.00 19.63  ? 421  PHE B CG    1 
ATOM   8197  C CD1   . PHE B 1 421 ? -32.180 78.151  25.895  1.00 19.19  ? 421  PHE B CD1   1 
ATOM   8198  C CD2   . PHE B 1 421 ? -32.799 76.222  24.610  1.00 19.46  ? 421  PHE B CD2   1 
ATOM   8199  C CE1   . PHE B 1 421 ? -30.836 77.970  25.534  1.00 20.79  ? 421  PHE B CE1   1 
ATOM   8200  C CE2   . PHE B 1 421 ? -31.468 76.032  24.238  1.00 20.07  ? 421  PHE B CE2   1 
ATOM   8201  C CZ    . PHE B 1 421 ? -30.481 76.913  24.697  1.00 19.84  ? 421  PHE B CZ    1 
ATOM   8202  N N     . MET B 1 422 ? -37.651 76.208  26.131  1.00 19.49  ? 422  MET B N     1 
ATOM   8203  C CA    . MET B 1 422 ? -39.008 76.348  26.668  1.00 20.19  ? 422  MET B CA    1 
ATOM   8204  C C     . MET B 1 422 ? -39.072 76.278  28.193  1.00 20.75  ? 422  MET B C     1 
ATOM   8205  O O     . MET B 1 422 ? -39.736 77.105  28.841  1.00 20.59  ? 422  MET B O     1 
ATOM   8206  C CB    . MET B 1 422 ? -39.939 75.286  26.064  1.00 20.41  ? 422  MET B CB    1 
ATOM   8207  C CG    . MET B 1 422 ? -40.108 75.417  24.571  1.00 19.88  ? 422  MET B CG    1 
ATOM   8208  S SD    . MET B 1 422 ? -40.997 76.923  24.127  1.00 22.65  ? 422  MET B SD    1 
ATOM   8209  C CE    . MET B 1 422 ? -42.674 76.316  24.249  1.00 20.20  ? 422  MET B CE    1 
ATOM   8210  N N     . ILE B 1 423 ? -38.398 75.271  28.750  1.00 20.97  ? 423  ILE B N     1 
ATOM   8211  C CA    . ILE B 1 423 ? -38.250 75.115  30.193  1.00 21.25  ? 423  ILE B CA    1 
ATOM   8212  C C     . ILE B 1 423 ? -36.760 74.889  30.471  1.00 21.51  ? 423  ILE B C     1 
ATOM   8213  O O     . ILE B 1 423 ? -36.140 73.964  29.936  1.00 21.06  ? 423  ILE B O     1 
ATOM   8214  C CB    . ILE B 1 423 ? -39.098 73.945  30.744  1.00 20.65  ? 423  ILE B CB    1 
ATOM   8215  C CG1   . ILE B 1 423 ? -40.563 74.100  30.308  1.00 21.20  ? 423  ILE B CG1   1 
ATOM   8216  C CG2   . ILE B 1 423 ? -38.990 73.901  32.246  1.00 21.03  ? 423  ILE B CG2   1 
ATOM   8217  C CD1   . ILE B 1 423 ? -41.493 72.939  30.742  1.00 21.45  ? 423  ILE B CD1   1 
ATOM   8218  N N     . THR B 1 424 ? -36.192 75.746  31.306  1.00 21.60  ? 424  THR B N     1 
ATOM   8219  C CA    . THR B 1 424 ? -34.743 75.817  31.452  1.00 22.05  ? 424  THR B CA    1 
ATOM   8220  C C     . THR B 1 424 ? -34.384 76.705  32.641  1.00 22.42  ? 424  THR B C     1 
ATOM   8221  O O     . THR B 1 424 ? -35.106 77.666  32.938  1.00 22.17  ? 424  THR B O     1 
ATOM   8222  C CB    . THR B 1 424 ? -34.075 76.410  30.173  1.00 22.14  ? 424  THR B CB    1 
ATOM   8223  O OG1   . THR B 1 424 ? -32.679 76.621  30.406  1.00 22.49  ? 424  THR B OG1   1 
ATOM   8224  C CG2   . THR B 1 424 ? -34.713 77.733  29.784  1.00 22.15  ? 424  THR B CG2   1 
ATOM   8225  N N     . PRO B 1 425 ? -33.269 76.394  33.322  1.00 22.36  ? 425  PRO B N     1 
ATOM   8226  C CA    . PRO B 1 425 ? -32.822 77.360  34.316  1.00 22.38  ? 425  PRO B CA    1 
ATOM   8227  C C     . PRO B 1 425 ? -32.226 78.593  33.638  1.00 22.83  ? 425  PRO B C     1 
ATOM   8228  O O     . PRO B 1 425 ? -31.872 78.554  32.451  1.00 22.28  ? 425  PRO B O     1 
ATOM   8229  C CB    . PRO B 1 425 ? -31.721 76.615  35.089  1.00 22.07  ? 425  PRO B CB    1 
ATOM   8230  C CG    . PRO B 1 425 ? -31.696 75.218  34.579  1.00 22.07  ? 425  PRO B CG    1 
ATOM   8231  C CD    . PRO B 1 425 ? -32.385 75.219  33.241  1.00 22.15  ? 425  PRO B CD    1 
ATOM   8232  N N     . LEU B 1 426 ? -32.161 79.687  34.388  1.00 23.20  ? 426  LEU B N     1 
ATOM   8233  C CA    . LEU B 1 426 ? -31.328 80.810  34.033  1.00 23.50  ? 426  LEU B CA    1 
ATOM   8234  C C     . LEU B 1 426 ? -30.257 80.847  35.117  1.00 23.73  ? 426  LEU B C     1 
ATOM   8235  O O     . LEU B 1 426 ? -30.591 80.831  36.301  1.00 24.12  ? 426  LEU B O     1 
ATOM   8236  C CB    . LEU B 1 426 ? -32.143 82.100  33.984  1.00 23.71  ? 426  LEU B CB    1 
ATOM   8237  C CG    . LEU B 1 426 ? -32.727 82.479  32.615  1.00 24.46  ? 426  LEU B CG    1 
ATOM   8238  C CD1   . LEU B 1 426 ? -33.972 81.671  32.275  1.00 25.70  ? 426  LEU B CD1   1 
ATOM   8239  C CD2   . LEU B 1 426 ? -33.059 83.941  32.603  1.00 25.37  ? 426  LEU B CD2   1 
ATOM   8240  N N     . PRO B 1 427 ? -28.971 80.879  34.722  1.00 23.64  ? 427  PRO B N     1 
ATOM   8241  C CA    . PRO B 1 427 ? -27.848 80.565  35.624  1.00 24.10  ? 427  PRO B CA    1 
ATOM   8242  C C     . PRO B 1 427 ? -27.790 81.426  36.890  1.00 24.36  ? 427  PRO B C     1 
ATOM   8243  O O     . PRO B 1 427 ? -27.343 80.946  37.937  1.00 24.80  ? 427  PRO B O     1 
ATOM   8244  C CB    . PRO B 1 427 ? -26.610 80.853  34.768  1.00 24.06  ? 427  PRO B CB    1 
ATOM   8245  C CG    . PRO B 1 427 ? -27.078 80.835  33.357  1.00 23.12  ? 427  PRO B CG    1 
ATOM   8246  C CD    . PRO B 1 427 ? -28.508 81.272  33.377  1.00 23.86  ? 427  PRO B CD    1 
ATOM   8247  N N     . GLY B 1 428 ? -28.224 82.682  36.786  1.00 24.43  ? 428  GLY B N     1 
ATOM   8248  C CA    . GLY B 1 428 ? -28.182 83.613  37.918  1.00 24.19  ? 428  GLY B CA    1 
ATOM   8249  C C     . GLY B 1 428 ? -29.526 83.874  38.571  1.00 24.24  ? 428  GLY B C     1 
ATOM   8250  O O     . GLY B 1 428 ? -29.614 84.654  39.521  1.00 24.46  ? 428  GLY B O     1 
ATOM   8251  N N     . ALA B 1 429 ? -30.575 83.220  38.077  1.00 24.23  ? 429  ALA B N     1 
ATOM   8252  C CA    . ALA B 1 429 ? -31.922 83.461  38.582  1.00 24.40  ? 429  ALA B CA    1 
ATOM   8253  C C     . ALA B 1 429 ? -32.564 82.251  39.257  1.00 24.53  ? 429  ALA B C     1 
ATOM   8254  O O     . ALA B 1 429 ? -33.388 82.409  40.158  1.00 24.41  ? 429  ALA B O     1 
ATOM   8255  C CB    . ALA B 1 429 ? -32.816 83.982  37.460  1.00 24.42  ? 429  ALA B CB    1 
ATOM   8256  N N     . ILE B 1 430 ? -32.196 81.049  38.814  1.00 24.42  ? 430  ILE B N     1 
ATOM   8257  C CA    . ILE B 1 430 ? -32.861 79.828  39.264  1.00 24.58  ? 430  ILE B CA    1 
ATOM   8258  C C     . ILE B 1 430 ? -31.878 78.833  39.905  1.00 24.59  ? 430  ILE B C     1 
ATOM   8259  O O     . ILE B 1 430 ? -30.859 78.464  39.302  1.00 24.02  ? 430  ILE B O     1 
ATOM   8260  C CB    . ILE B 1 430 ? -33.637 79.150  38.091  1.00 24.88  ? 430  ILE B CB    1 
ATOM   8261  C CG1   . ILE B 1 430 ? -34.729 80.094  37.567  1.00 24.84  ? 430  ILE B CG1   1 
ATOM   8262  C CG2   . ILE B 1 430 ? -34.226 77.801  38.519  1.00 24.43  ? 430  ILE B CG2   1 
ATOM   8263  C CD1   . ILE B 1 430 ? -35.284 79.721  36.202  1.00 24.85  ? 430  ILE B CD1   1 
ATOM   8264  N N     . GLU B 1 431 ? -32.196 78.423  41.131  1.00 24.29  ? 431  GLU B N     1 
ATOM   8265  C CA    . GLU B 1 431 ? -31.430 77.400  41.843  1.00 24.60  ? 431  GLU B CA    1 
ATOM   8266  C C     . GLU B 1 431 ? -31.695 76.042  41.219  1.00 24.19  ? 431  GLU B C     1 
ATOM   8267  O O     . GLU B 1 431 ? -32.824 75.750  40.810  1.00 24.52  ? 431  GLU B O     1 
ATOM   8268  C CB    . GLU B 1 431 ? -31.797 77.368  43.321  1.00 24.43  ? 431  GLU B CB    1 
ATOM   8269  C CG    . GLU B 1 431 ? -31.290 78.557  44.094  1.00 25.88  ? 431  GLU B CG    1 
ATOM   8270  C CD    . GLU B 1 431 ? -31.707 78.522  45.553  1.00 27.78  ? 431  GLU B CD    1 
ATOM   8271  O OE1   . GLU B 1 431 ? -32.760 77.920  45.873  1.00 28.67  ? 431  GLU B OE1   1 
ATOM   8272  O OE2   . GLU B 1 431 ? -30.979 79.109  46.377  1.00 28.68  ? 431  GLU B OE2   1 
ATOM   8273  N N     . LEU B 1 432 ? -30.662 75.208  41.166  1.00 23.38  ? 432  LEU B N     1 
ATOM   8274  C CA    . LEU B 1 432 ? -30.718 73.997  40.350  1.00 23.13  ? 432  LEU B CA    1 
ATOM   8275  C C     . LEU B 1 432 ? -31.059 72.752  41.129  1.00 22.73  ? 432  LEU B C     1 
ATOM   8276  O O     . LEU B 1 432 ? -30.726 72.633  42.310  1.00 22.64  ? 432  LEU B O     1 
ATOM   8277  C CB    . LEU B 1 432 ? -29.390 73.776  39.624  1.00 22.77  ? 432  LEU B CB    1 
ATOM   8278  C CG    . LEU B 1 432 ? -28.819 74.970  38.867  1.00 22.98  ? 432  LEU B CG    1 
ATOM   8279  C CD1   . LEU B 1 432 ? -27.466 74.596  38.290  1.00 21.79  ? 432  LEU B CD1   1 
ATOM   8280  C CD2   . LEU B 1 432 ? -29.783 75.437  37.774  1.00 22.30  ? 432  LEU B CD2   1 
ATOM   8281  N N     . LYS B 1 433 ? -31.729 71.829  40.447  1.00 22.17  ? 433  LYS B N     1 
ATOM   8282  C CA    . LYS B 1 433 ? -31.928 70.475  40.953  1.00 22.15  ? 433  LYS B CA    1 
ATOM   8283  C C     . LYS B 1 433 ? -31.476 69.523  39.860  1.00 21.62  ? 433  LYS B C     1 
ATOM   8284  O O     . LYS B 1 433 ? -31.937 69.619  38.711  1.00 21.75  ? 433  LYS B O     1 
ATOM   8285  C CB    . LYS B 1 433 ? -33.391 70.207  41.314  1.00 21.93  ? 433  LYS B CB    1 
ATOM   8286  C CG    . LYS B 1 433 ? -34.043 71.217  42.262  1.00 22.43  ? 433  LYS B CG    1 
ATOM   8287  C CD    . LYS B 1 433 ? -35.422 70.722  42.695  1.00 22.44  ? 433  LYS B CD    1 
ATOM   8288  C CE    . LYS B 1 433 ? -36.146 71.752  43.576  1.00 23.21  ? 433  LYS B CE    1 
ATOM   8289  N NZ    . LYS B 1 433 ? -37.451 71.238  44.072  1.00 23.12  ? 433  LYS B NZ    1 
ATOM   8290  N N     . ALA B 1 434 ? -30.576 68.615  40.225  1.00 21.16  ? 434  ALA B N     1 
ATOM   8291  C CA    . ALA B 1 434 ? -29.996 67.646  39.302  1.00 21.12  ? 434  ALA B CA    1 
ATOM   8292  C C     . ALA B 1 434 ? -31.075 66.825  38.590  1.00 21.39  ? 434  ALA B C     1 
ATOM   8293  O O     . ALA B 1 434 ? -31.821 66.074  39.230  1.00 21.37  ? 434  ALA B O     1 
ATOM   8294  C CB    . ALA B 1 434 ? -29.008 66.730  40.047  1.00 21.04  ? 434  ALA B CB    1 
ATOM   8295  N N     . GLY B 1 435 ? -31.159 66.987  37.272  1.00 21.20  ? 435  GLY B N     1 
ATOM   8296  C CA    . GLY B 1 435 ? -32.161 66.281  36.469  1.00 21.54  ? 435  GLY B CA    1 
ATOM   8297  C C     . GLY B 1 435 ? -33.439 67.052  36.154  1.00 21.75  ? 435  GLY B C     1 
ATOM   8298  O O     . GLY B 1 435 ? -34.293 66.552  35.411  1.00 22.31  ? 435  GLY B O     1 
ATOM   8299  N N     . SER B 1 436 ? -33.587 68.259  36.709  1.00 21.22  ? 436  SER B N     1 
ATOM   8300  C CA    . SER B 1 436 ? -34.778 69.077  36.452  1.00 20.99  ? 436  SER B CA    1 
ATOM   8301  C C     . SER B 1 436 ? -34.500 70.196  35.444  1.00 20.73  ? 436  SER B C     1 
ATOM   8302  O O     . SER B 1 436 ? -33.477 70.889  35.537  1.00 20.83  ? 436  SER B O     1 
ATOM   8303  C CB    . SER B 1 436 ? -35.327 69.668  37.767  1.00 21.18  ? 436  SER B CB    1 
ATOM   8304  O OG    . SER B 1 436 ? -36.408 70.566  37.537  1.00 20.78  ? 436  SER B OG    1 
ATOM   8305  N N     . ALA B 1 437 ? -35.425 70.390  34.506  1.00 20.59  ? 437  ALA B N     1 
ATOM   8306  C CA    . ALA B 1 437 ? -35.354 71.523  33.561  1.00 20.42  ? 437  ALA B CA    1 
ATOM   8307  C C     . ALA B 1 437 ? -35.732 72.831  34.248  1.00 20.55  ? 437  ALA B C     1 
ATOM   8308  O O     . ALA B 1 437 ? -35.449 73.917  33.742  1.00 20.68  ? 437  ALA B O     1 
ATOM   8309  C CB    . ALA B 1 437 ? -36.249 71.271  32.326  1.00 20.06  ? 437  ALA B CB    1 
ATOM   8310  N N     . THR B 1 438 ? -36.372 72.708  35.409  1.00 20.46  ? 438  THR B N     1 
ATOM   8311  C CA    . THR B 1 438 ? -36.781 73.828  36.272  1.00 20.14  ? 438  THR B CA    1 
ATOM   8312  C C     . THR B 1 438 ? -38.024 74.588  35.769  1.00 20.56  ? 438  THR B C     1 
ATOM   8313  O O     . THR B 1 438 ? -39.109 73.997  35.686  1.00 20.55  ? 438  THR B O     1 
ATOM   8314  C CB    . THR B 1 438 ? -35.603 74.763  36.692  1.00 20.50  ? 438  THR B CB    1 
ATOM   8315  O OG1   . THR B 1 438 ? -35.301 75.704  35.648  1.00 20.08  ? 438  THR B OG1   1 
ATOM   8316  C CG2   . THR B 1 438 ? -34.355 73.945  37.044  1.00 20.12  ? 438  THR B CG2   1 
ATOM   8317  N N     . ARG B 1 439 ? -37.875 75.871  35.431  1.00 20.26  ? 439  ARG B N     1 
ATOM   8318  C CA    . ARG B 1 439 ? -39.030 76.759  35.224  1.00 20.43  ? 439  ARG B CA    1 
ATOM   8319  C C     . ARG B 1 439 ? -39.202 77.180  33.761  1.00 20.22  ? 439  ARG B C     1 
ATOM   8320  O O     . ARG B 1 439 ? -38.213 77.278  33.041  1.00 20.16  ? 439  ARG B O     1 
ATOM   8321  C CB    . ARG B 1 439 ? -38.877 78.031  36.083  1.00 20.40  ? 439  ARG B CB    1 
ATOM   8322  C CG    . ARG B 1 439 ? -38.745 77.810  37.584  1.00 21.11  ? 439  ARG B CG    1 
ATOM   8323  C CD    . ARG B 1 439 ? -39.255 79.048  38.322  1.00 23.91  ? 439  ARG B CD    1 
ATOM   8324  N NE    . ARG B 1 439 ? -39.108 78.977  39.777  1.00 27.15  ? 439  ARG B NE    1 
ATOM   8325  C CZ    . ARG B 1 439 ? -39.947 78.337  40.591  1.00 29.55  ? 439  ARG B CZ    1 
ATOM   8326  N NH1   . ARG B 1 439 ? -40.998 77.687  40.099  1.00 30.23  ? 439  ARG B NH1   1 
ATOM   8327  N NH2   . ARG B 1 439 ? -39.730 78.330  41.905  1.00 29.34  ? 439  ARG B NH2   1 
ATOM   8328  N N     . PRO B 1 440 ? -40.453 77.475  33.327  1.00 20.12  ? 440  PRO B N     1 
ATOM   8329  C CA    . PRO B 1 440 ? -40.665 77.931  31.949  1.00 19.97  ? 440  PRO B CA    1 
ATOM   8330  C C     . PRO B 1 440 ? -39.890 79.213  31.610  1.00 20.20  ? 440  PRO B C     1 
ATOM   8331  O O     . PRO B 1 440 ? -39.692 80.075  32.481  1.00 20.35  ? 440  PRO B O     1 
ATOM   8332  C CB    . PRO B 1 440 ? -42.171 78.204  31.895  1.00 19.88  ? 440  PRO B CB    1 
ATOM   8333  C CG    . PRO B 1 440 ? -42.583 78.389  33.345  1.00 20.07  ? 440  PRO B CG    1 
ATOM   8334  C CD    . PRO B 1 440 ? -41.726 77.413  34.075  1.00 20.10  ? 440  PRO B CD    1 
ATOM   8335  N N     . PHE B 1 441 ? -39.452 79.333  30.357  1.00 19.94  ? 441  PHE B N     1 
ATOM   8336  C CA    . PHE B 1 441 ? -38.828 80.563  29.884  1.00 19.83  ? 441  PHE B CA    1 
ATOM   8337  C C     . PHE B 1 441 ? -39.871 81.667  29.732  1.00 20.28  ? 441  PHE B C     1 
ATOM   8338  O O     . PHE B 1 441 ? -41.077 81.399  29.743  1.00 20.28  ? 441  PHE B O     1 
ATOM   8339  C CB    . PHE B 1 441 ? -38.100 80.339  28.545  1.00 19.60  ? 441  PHE B CB    1 
ATOM   8340  C CG    . PHE B 1 441 ? -37.191 81.477  28.164  1.00 19.12  ? 441  PHE B CG    1 
ATOM   8341  C CD1   . PHE B 1 441 ? -36.001 81.692  28.865  1.00 19.06  ? 441  PHE B CD1   1 
ATOM   8342  C CD2   . PHE B 1 441 ? -37.548 82.369  27.147  1.00 17.98  ? 441  PHE B CD2   1 
ATOM   8343  C CE1   . PHE B 1 441 ? -35.163 82.761  28.536  1.00 18.46  ? 441  PHE B CE1   1 
ATOM   8344  C CE2   . PHE B 1 441 ? -36.723 83.438  26.818  1.00 17.35  ? 441  PHE B CE2   1 
ATOM   8345  C CZ    . PHE B 1 441 ? -35.526 83.634  27.514  1.00 17.89  ? 441  PHE B CZ    1 
ATOM   8346  N N     . PHE B 1 442 ? -39.410 82.906  29.592  1.00 20.60  ? 442  PHE B N     1 
ATOM   8347  C CA    . PHE B 1 442 ? -40.301 84.031  29.281  1.00 21.69  ? 442  PHE B CA    1 
ATOM   8348  C C     . PHE B 1 442 ? -41.261 83.713  28.126  1.00 21.82  ? 442  PHE B C     1 
ATOM   8349  O O     . PHE B 1 442 ? -40.848 83.186  27.086  1.00 21.81  ? 442  PHE B O     1 
ATOM   8350  C CB    . PHE B 1 442 ? -39.489 85.289  28.963  1.00 21.79  ? 442  PHE B CB    1 
ATOM   8351  C CG    . PHE B 1 442 ? -38.480 85.663  30.036  1.00 22.95  ? 442  PHE B CG    1 
ATOM   8352  C CD1   . PHE B 1 442 ? -37.202 86.083  29.684  1.00 23.56  ? 442  PHE B CD1   1 
ATOM   8353  C CD2   . PHE B 1 442 ? -38.807 85.588  31.387  1.00 23.22  ? 442  PHE B CD2   1 
ATOM   8354  C CE1   . PHE B 1 442 ? -36.263 86.431  30.659  1.00 23.43  ? 442  PHE B CE1   1 
ATOM   8355  C CE2   . PHE B 1 442 ? -37.872 85.920  32.371  1.00 23.47  ? 442  PHE B CE2   1 
ATOM   8356  C CZ    . PHE B 1 442 ? -36.602 86.354  32.002  1.00 23.78  ? 442  PHE B CZ    1 
ATOM   8357  N N     . GLY B 1 443 ? -42.540 84.017  28.326  1.00 21.85  ? 443  GLY B N     1 
ATOM   8358  C CA    . GLY B 1 443 ? -43.562 83.807  27.296  1.00 22.02  ? 443  GLY B CA    1 
ATOM   8359  C C     . GLY B 1 443 ? -44.101 82.389  27.169  1.00 22.30  ? 443  GLY B C     1 
ATOM   8360  O O     . GLY B 1 443 ? -45.009 82.150  26.367  1.00 23.02  ? 443  GLY B O     1 
ATOM   8361  N N     . VAL B 1 444 ? -43.561 81.457  27.957  1.00 22.07  ? 444  VAL B N     1 
ATOM   8362  C CA    . VAL B 1 444 ? -43.972 80.040  27.917  1.00 22.19  ? 444  VAL B CA    1 
ATOM   8363  C C     . VAL B 1 444 ? -44.941 79.690  29.051  1.00 22.29  ? 444  VAL B C     1 
ATOM   8364  O O     . VAL B 1 444 ? -44.636 79.910  30.228  1.00 22.18  ? 444  VAL B O     1 
ATOM   8365  C CB    . VAL B 1 444 ? -42.748 79.072  27.933  1.00 22.05  ? 444  VAL B CB    1 
ATOM   8366  C CG1   . VAL B 1 444 ? -43.190 77.599  27.838  1.00 21.98  ? 444  VAL B CG1   1 
ATOM   8367  C CG2   . VAL B 1 444 ? -41.781 79.404  26.805  1.00 20.84  ? 444  VAL B CG2   1 
ATOM   8368  N N     . GLN B 1 445 ? -46.104 79.144  28.686  1.00 22.47  ? 445  GLN B N     1 
ATOM   8369  C CA    . GLN B 1 445 ? -47.119 78.744  29.665  1.00 22.92  ? 445  GLN B CA    1 
ATOM   8370  C C     . GLN B 1 445 ? -47.400 77.246  29.588  1.00 22.67  ? 445  GLN B C     1 
ATOM   8371  O O     . GLN B 1 445 ? -48.248 76.808  28.800  1.00 22.92  ? 445  GLN B O     1 
ATOM   8372  C CB    . GLN B 1 445 ? -48.415 79.535  29.474  1.00 22.95  ? 445  GLN B CB    1 
ATOM   8373  C CG    . GLN B 1 445 ? -48.232 81.048  29.537  1.00 23.36  ? 445  GLN B CG    1 
ATOM   8374  C CD    . GLN B 1 445 ? -49.483 81.809  29.136  1.00 24.86  ? 445  GLN B CD    1 
ATOM   8375  O OE1   . GLN B 1 445 ? -50.511 81.757  29.823  1.00 25.70  ? 445  GLN B OE1   1 
ATOM   8376  N NE2   . GLN B 1 445 ? -49.395 82.544  28.025  1.00 27.56  ? 445  GLN B NE2   1 
ATOM   8377  N N     . PRO B 1 446 ? -46.684 76.451  30.402  1.00 22.15  ? 446  PRO B N     1 
ATOM   8378  C CA    . PRO B 1 446 ? -46.890 75.021  30.375  1.00 21.81  ? 446  PRO B CA    1 
ATOM   8379  C C     . PRO B 1 446 ? -47.998 74.597  31.325  1.00 21.57  ? 446  PRO B C     1 
ATOM   8380  O O     . PRO B 1 446 ? -48.312 75.318  32.277  1.00 21.07  ? 446  PRO B O     1 
ATOM   8381  C CB    . PRO B 1 446 ? -45.542 74.460  30.849  1.00 22.00  ? 446  PRO B CB    1 
ATOM   8382  C CG    . PRO B 1 446 ? -44.917 75.541  31.647  1.00 22.09  ? 446  PRO B CG    1 
ATOM   8383  C CD    . PRO B 1 446 ? -45.639 76.840  31.365  1.00 22.37  ? 446  PRO B CD    1 
ATOM   8384  N N     . ALA B 1 447 ? -48.588 73.439  31.042  1.00 21.01  ? 447  ALA B N     1 
ATOM   8385  C CA    . ALA B 1 447 ? -49.514 72.786  31.958  1.00 21.09  ? 447  ALA B CA    1 
ATOM   8386  C C     . ALA B 1 447 ? -49.391 71.270  31.814  1.00 21.04  ? 447  ALA B C     1 
ATOM   8387  O O     . ALA B 1 447 ? -48.895 70.770  30.794  1.00 21.30  ? 447  ALA B O     1 
ATOM   8388  C CB    . ALA B 1 447 ? -50.947 73.247  31.697  1.00 20.58  ? 447  ALA B CB    1 
ATOM   8389  N N     . LEU B 1 448 ? -49.828 70.540  32.837  1.00 20.90  ? 448  LEU B N     1 
ATOM   8390  C CA    . LEU B 1 448 ? -49.862 69.082  32.763  1.00 21.12  ? 448  LEU B CA    1 
ATOM   8391  C C     . LEU B 1 448 ? -51.311 68.606  32.788  1.00 21.24  ? 448  LEU B C     1 
ATOM   8392  O O     . LEU B 1 448 ? -52.070 68.959  33.694  1.00 21.36  ? 448  LEU B O     1 
ATOM   8393  C CB    . LEU B 1 448 ? -49.063 68.444  33.907  1.00 20.73  ? 448  LEU B CB    1 
ATOM   8394  C CG    . LEU B 1 448 ? -47.608 68.882  34.108  1.00 20.88  ? 448  LEU B CG    1 
ATOM   8395  C CD1   . LEU B 1 448 ? -47.078 68.349  35.429  1.00 21.05  ? 448  LEU B CD1   1 
ATOM   8396  C CD2   . LEU B 1 448 ? -46.722 68.459  32.951  1.00 18.55  ? 448  LEU B CD2   1 
ATOM   8397  N N     . VAL B 1 449 ? -51.694 67.813  31.792  1.00 21.38  ? 449  VAL B N     1 
ATOM   8398  C CA    . VAL B 1 449 ? -53.073 67.318  31.702  1.00 21.58  ? 449  VAL B CA    1 
ATOM   8399  C C     . VAL B 1 449 ? -53.093 65.797  31.783  1.00 22.06  ? 449  VAL B C     1 
ATOM   8400  O O     . VAL B 1 449 ? -52.126 65.137  31.372  1.00 21.94  ? 449  VAL B O     1 
ATOM   8401  C CB    . VAL B 1 449 ? -53.779 67.794  30.400  1.00 21.73  ? 449  VAL B CB    1 
ATOM   8402  C CG1   . VAL B 1 449 ? -53.857 69.326  30.345  1.00 21.59  ? 449  VAL B CG1   1 
ATOM   8403  C CG2   . VAL B 1 449 ? -53.095 67.238  29.134  1.00 20.79  ? 449  VAL B CG2   1 
ATOM   8404  N N     . ASP B 1 450 ? -54.172 65.231  32.316  1.00 22.46  ? 450  ASP B N     1 
ATOM   8405  C CA    . ASP B 1 450 ? -54.314 63.773  32.292  1.00 23.05  ? 450  ASP B CA    1 
ATOM   8406  C C     . ASP B 1 450 ? -54.689 63.325  30.868  1.00 23.22  ? 450  ASP B C     1 
ATOM   8407  O O     . ASP B 1 450 ? -54.777 64.159  29.960  1.00 22.90  ? 450  ASP B O     1 
ATOM   8408  C CB    . ASP B 1 450 ? -55.275 63.261  33.391  1.00 23.11  ? 450  ASP B CB    1 
ATOM   8409  C CG    . ASP B 1 450 ? -56.748 63.566  33.109  1.00 24.40  ? 450  ASP B CG    1 
ATOM   8410  O OD1   . ASP B 1 450 ? -57.103 63.942  31.972  1.00 25.86  ? 450  ASP B OD1   1 
ATOM   8411  O OD2   . ASP B 1 450 ? -57.570 63.408  34.043  1.00 25.39  ? 450  ASP B OD2   1 
ATOM   8412  N N     . ASN B 1 451 ? -54.901 62.031  30.660  1.00 23.66  ? 451  ASN B N     1 
ATOM   8413  C CA    . ASN B 1 451 ? -55.171 61.539  29.300  1.00 24.92  ? 451  ASN B CA    1 
ATOM   8414  C C     . ASN B 1 451 ? -56.490 62.033  28.684  1.00 25.60  ? 451  ASN B C     1 
ATOM   8415  O O     . ASN B 1 451 ? -56.659 61.990  27.458  1.00 25.72  ? 451  ASN B O     1 
ATOM   8416  C CB    . ASN B 1 451 ? -55.050 60.020  29.223  1.00 24.46  ? 451  ASN B CB    1 
ATOM   8417  C CG    . ASN B 1 451 ? -53.628 59.547  29.402  1.00 25.77  ? 451  ASN B CG    1 
ATOM   8418  O OD1   . ASN B 1 451 ? -52.669 60.263  29.075  1.00 25.65  ? 451  ASN B OD1   1 
ATOM   8419  N ND2   . ASN B 1 451 ? -53.473 58.335  29.939  1.00 27.06  ? 451  ASN B ND2   1 
ATOM   8420  N N     . GLU B 1 452 ? -57.399 62.505  29.539  1.00 26.18  ? 452  GLU B N     1 
ATOM   8421  C CA    . GLU B 1 452 ? -58.683 63.064  29.112  1.00 27.22  ? 452  GLU B CA    1 
ATOM   8422  C C     . GLU B 1 452 ? -58.622 64.594  29.021  1.00 27.09  ? 452  GLU B C     1 
ATOM   8423  O O     . GLU B 1 452 ? -59.636 65.248  28.772  1.00 27.11  ? 452  GLU B O     1 
ATOM   8424  C CB    . GLU B 1 452 ? -59.813 62.621  30.058  1.00 27.61  ? 452  GLU B CB    1 
ATOM   8425  C CG    . GLU B 1 452 ? -60.080 61.102  30.093  1.00 30.42  ? 452  GLU B CG    1 
ATOM   8426  C CD    . GLU B 1 452 ? -58.970 60.305  30.793  1.00 34.32  ? 452  GLU B CD    1 
ATOM   8427  O OE1   . GLU B 1 452 ? -58.609 60.650  31.945  1.00 36.15  ? 452  GLU B OE1   1 
ATOM   8428  O OE2   . GLU B 1 452 ? -58.459 59.330  30.191  1.00 35.17  ? 452  GLU B OE2   1 
ATOM   8429  N N     . GLY B 1 453 ? -57.429 65.156  29.215  1.00 26.88  ? 453  GLY B N     1 
ATOM   8430  C CA    . GLY B 1 453 ? -57.213 66.598  29.059  1.00 26.81  ? 453  GLY B CA    1 
ATOM   8431  C C     . GLY B 1 453 ? -57.557 67.483  30.252  1.00 26.84  ? 453  GLY B C     1 
ATOM   8432  O O     . GLY B 1 453 ? -57.530 68.714  30.142  1.00 26.85  ? 453  GLY B O     1 
ATOM   8433  N N     . HIS B 1 454 ? -57.876 66.873  31.392  1.00 26.52  ? 454  HIS B N     1 
ATOM   8434  C CA    . HIS B 1 454 ? -58.120 67.630  32.621  1.00 26.70  ? 454  HIS B CA    1 
ATOM   8435  C C     . HIS B 1 454 ? -56.786 68.153  33.169  1.00 26.57  ? 454  HIS B C     1 
ATOM   8436  O O     . HIS B 1 454 ? -55.902 67.364  33.468  1.00 26.53  ? 454  HIS B O     1 
ATOM   8437  C CB    . HIS B 1 454 ? -58.814 66.759  33.677  1.00 26.75  ? 454  HIS B CB    1 
ATOM   8438  C CG    . HIS B 1 454 ? -60.126 66.180  33.236  1.00 27.32  ? 454  HIS B CG    1 
ATOM   8439  N ND1   . HIS B 1 454 ? -60.351 64.822  33.155  1.00 27.96  ? 454  HIS B ND1   1 
ATOM   8440  C CD2   . HIS B 1 454 ? -61.287 66.775  32.869  1.00 27.63  ? 454  HIS B CD2   1 
ATOM   8441  C CE1   . HIS B 1 454 ? -61.592 64.604  32.751  1.00 28.04  ? 454  HIS B CE1   1 
ATOM   8442  N NE2   . HIS B 1 454 ? -62.182 65.773  32.573  1.00 27.85  ? 454  HIS B NE2   1 
ATOM   8443  N N     . PRO B 1 455 ? -56.634 69.485  33.288  1.00 26.88  ? 455  PRO B N     1 
ATOM   8444  C CA    . PRO B 1 455 ? -55.405 70.044  33.852  1.00 26.76  ? 455  PRO B CA    1 
ATOM   8445  C C     . PRO B 1 455 ? -55.162 69.536  35.265  1.00 26.69  ? 455  PRO B C     1 
ATOM   8446  O O     . PRO B 1 455 ? -56.098 69.408  36.052  1.00 27.12  ? 455  PRO B O     1 
ATOM   8447  C CB    . PRO B 1 455 ? -55.676 71.554  33.876  1.00 26.62  ? 455  PRO B CB    1 
ATOM   8448  C CG    . PRO B 1 455 ? -56.736 71.772  32.860  1.00 27.02  ? 455  PRO B CG    1 
ATOM   8449  C CD    . PRO B 1 455 ? -57.591 70.543  32.903  1.00 26.83  ? 455  PRO B CD    1 
ATOM   8450  N N     . GLN B 1 456 ? -53.909 69.232  35.571  1.00 26.44  ? 456  GLN B N     1 
ATOM   8451  C CA    . GLN B 1 456 ? -53.530 68.723  36.882  1.00 25.94  ? 456  GLN B CA    1 
ATOM   8452  C C     . GLN B 1 456 ? -52.801 69.832  37.637  1.00 25.73  ? 456  GLN B C     1 
ATOM   8453  O O     . GLN B 1 456 ? -51.824 70.407  37.131  1.00 25.84  ? 456  GLN B O     1 
ATOM   8454  C CB    . GLN B 1 456 ? -52.642 67.484  36.732  1.00 25.86  ? 456  GLN B CB    1 
ATOM   8455  C CG    . GLN B 1 456 ? -53.265 66.342  35.935  1.00 26.53  ? 456  GLN B CG    1 
ATOM   8456  C CD    . GLN B 1 456 ? -54.526 65.796  36.580  1.00 28.42  ? 456  GLN B CD    1 
ATOM   8457  O OE1   . GLN B 1 456 ? -55.619 65.905  36.021  1.00 28.81  ? 456  GLN B OE1   1 
ATOM   8458  N NE2   . GLN B 1 456 ? -54.384 65.226  37.773  1.00 28.88  ? 456  GLN B NE2   1 
ATOM   8459  N N     . GLU B 1 457 ? -53.281 70.134  38.836  1.00 25.22  ? 457  GLU B N     1 
ATOM   8460  C CA    . GLU B 1 457 ? -52.764 71.250  39.624  1.00 25.24  ? 457  GLU B CA    1 
ATOM   8461  C C     . GLU B 1 457 ? -51.870 70.776  40.758  1.00 25.21  ? 457  GLU B C     1 
ATOM   8462  O O     . GLU B 1 457 ? -51.978 69.628  41.204  1.00 25.08  ? 457  GLU B O     1 
ATOM   8463  C CB    . GLU B 1 457 ? -53.924 72.079  40.189  1.00 25.64  ? 457  GLU B CB    1 
ATOM   8464  N N     . GLY B 1 458 ? -50.991 71.662  41.223  1.00 25.16  ? 458  GLY B N     1 
ATOM   8465  C CA    . GLY B 1 458 ? -50.074 71.333  42.316  1.00 25.57  ? 458  GLY B CA    1 
ATOM   8466  C C     . GLY B 1 458 ? -48.963 70.397  41.881  1.00 25.53  ? 458  GLY B C     1 
ATOM   8467  O O     . GLY B 1 458 ? -48.644 70.303  40.689  1.00 25.62  ? 458  GLY B O     1 
ATOM   8468  N N     . ALA B 1 459 ? -48.352 69.732  42.857  1.00 25.55  ? 459  ALA B N     1 
ATOM   8469  C CA    . ALA B 1 459 ? -47.379 68.683  42.601  1.00 25.67  ? 459  ALA B CA    1 
ATOM   8470  C C     . ALA B 1 459 ? -48.114 67.517  41.950  1.00 25.94  ? 459  ALA B C     1 
ATOM   8471  O O     . ALA B 1 459 ? -49.022 66.926  42.544  1.00 25.79  ? 459  ALA B O     1 
ATOM   8472  C CB    . ALA B 1 459 ? -46.698 68.243  43.905  1.00 25.74  ? 459  ALA B CB    1 
ATOM   8473  N N     . THR B 1 460 ? -47.738 67.203  40.713  1.00 25.83  ? 460  THR B N     1 
ATOM   8474  C CA    . THR B 1 460 ? -48.480 66.217  39.933  1.00 25.67  ? 460  THR B CA    1 
ATOM   8475  C C     . THR B 1 460 ? -47.633 65.712  38.772  1.00 25.56  ? 460  THR B C     1 
ATOM   8476  O O     . THR B 1 460 ? -46.482 66.107  38.637  1.00 25.43  ? 460  THR B O     1 
ATOM   8477  C CB    . THR B 1 460 ? -49.811 66.830  39.410  1.00 25.71  ? 460  THR B CB    1 
ATOM   8478  O OG1   . THR B 1 460 ? -50.667 65.794  38.923  1.00 25.70  ? 460  THR B OG1   1 
ATOM   8479  C CG2   . THR B 1 460 ? -49.553 67.856  38.312  1.00 25.28  ? 460  THR B CG2   1 
ATOM   8480  N N     . GLU B 1 461 ? -48.205 64.830  37.955  1.00 25.50  ? 461  GLU B N     1 
ATOM   8481  C CA    . GLU B 1 461 ? -47.616 64.440  36.677  1.00 26.17  ? 461  GLU B CA    1 
ATOM   8482  C C     . GLU B 1 461 ? -48.701 64.351  35.594  1.00 24.71  ? 461  GLU B C     1 
ATOM   8483  O O     . GLU B 1 461 ? -49.895 64.218  35.893  1.00 24.51  ? 461  GLU B O     1 
ATOM   8484  C CB    . GLU B 1 461 ? -46.835 63.116  36.803  1.00 26.12  ? 461  GLU B CB    1 
ATOM   8485  C CG    . GLU B 1 461 ? -47.600 61.995  37.502  1.00 29.21  ? 461  GLU B CG    1 
ATOM   8486  C CD    . GLU B 1 461 ? -46.871 60.649  37.496  1.00 30.22  ? 461  GLU B CD    1 
ATOM   8487  O OE1   . GLU B 1 461 ? -47.510 59.653  37.070  1.00 36.12  ? 461  GLU B OE1   1 
ATOM   8488  O OE2   . GLU B 1 461 ? -45.682 60.574  37.918  1.00 33.80  ? 461  GLU B OE2   1 
ATOM   8489  N N     . GLY B 1 462 ? -48.283 64.447  34.339  1.00 23.32  ? 462  GLY B N     1 
ATOM   8490  C CA    . GLY B 1 462 ? -49.188 64.264  33.220  1.00 21.88  ? 462  GLY B CA    1 
ATOM   8491  C C     . GLY B 1 462 ? -48.555 64.584  31.880  1.00 21.04  ? 462  GLY B C     1 
ATOM   8492  O O     . GLY B 1 462 ? -47.328 64.613  31.742  1.00 19.98  ? 462  GLY B O     1 
ATOM   8493  N N     . ASN B 1 463 ? -49.415 64.818  30.891  1.00 20.32  ? 463  ASN B N     1 
ATOM   8494  C CA    . ASN B 1 463 ? -48.989 65.161  29.549  1.00 20.22  ? 463  ASN B CA    1 
ATOM   8495  C C     . ASN B 1 463 ? -48.649 66.636  29.493  1.00 20.21  ? 463  ASN B C     1 
ATOM   8496  O O     . ASN B 1 463 ? -49.415 67.474  29.963  1.00 19.89  ? 463  ASN B O     1 
ATOM   8497  C CB    . ASN B 1 463 ? -50.086 64.825  28.542  1.00 20.53  ? 463  ASN B CB    1 
ATOM   8498  C CG    . ASN B 1 463 ? -50.499 63.357  28.599  1.00 20.97  ? 463  ASN B CG    1 
ATOM   8499  O OD1   . ASN B 1 463 ? -49.727 62.471  28.212  1.00 21.37  ? 463  ASN B OD1   1 
ATOM   8500  N ND2   . ASN B 1 463 ? -51.710 63.094  29.096  1.00 18.62  ? 463  ASN B ND2   1 
ATOM   8501  N N     . LEU B 1 464 ? -47.484 66.939  28.927  1.00 20.20  ? 464  LEU B N     1 
ATOM   8502  C CA    . LEU B 1 464 ? -46.963 68.292  28.899  1.00 19.95  ? 464  LEU B CA    1 
ATOM   8503  C C     . LEU B 1 464 ? -47.479 69.034  27.677  1.00 20.10  ? 464  LEU B C     1 
ATOM   8504  O O     . LEU B 1 464 ? -47.206 68.641  26.535  1.00 20.40  ? 464  LEU B O     1 
ATOM   8505  C CB    . LEU B 1 464 ? -45.428 68.277  28.902  1.00 19.67  ? 464  LEU B CB    1 
ATOM   8506  C CG    . LEU B 1 464 ? -44.703 69.620  28.797  1.00 19.43  ? 464  LEU B CG    1 
ATOM   8507  C CD1   . LEU B 1 464 ? -45.130 70.602  29.897  1.00 17.76  ? 464  LEU B CD1   1 
ATOM   8508  C CD2   . LEU B 1 464 ? -43.211 69.352  28.871  1.00 19.68  ? 464  LEU B CD2   1 
ATOM   8509  N N     . VAL B 1 465 ? -48.226 70.101  27.935  1.00 19.37  ? 465  VAL B N     1 
ATOM   8510  C CA    . VAL B 1 465 ? -48.761 70.957  26.883  1.00 19.05  ? 465  VAL B CA    1 
ATOM   8511  C C     . VAL B 1 465 ? -48.314 72.389  27.135  1.00 19.23  ? 465  VAL B C     1 
ATOM   8512  O O     . VAL B 1 465 ? -47.898 72.723  28.258  1.00 18.54  ? 465  VAL B O     1 
ATOM   8513  C CB    . VAL B 1 465 ? -50.331 70.914  26.819  1.00 19.03  ? 465  VAL B CB    1 
ATOM   8514  C CG1   . VAL B 1 465 ? -50.832 69.520  26.425  1.00 18.25  ? 465  VAL B CG1   1 
ATOM   8515  C CG2   . VAL B 1 465 ? -50.963 71.385  28.126  1.00 18.37  ? 465  VAL B CG2   1 
ATOM   8516  N N     . ILE B 1 466 ? -48.380 73.213  26.085  1.00 19.31  ? 466  ILE B N     1 
ATOM   8517  C CA    . ILE B 1 466 ? -48.165 74.663  26.187  1.00 19.80  ? 466  ILE B CA    1 
ATOM   8518  C C     . ILE B 1 466 ? -49.478 75.332  25.764  1.00 20.33  ? 466  ILE B C     1 
ATOM   8519  O O     . ILE B 1 466 ? -50.004 75.038  24.684  1.00 20.03  ? 466  ILE B O     1 
ATOM   8520  C CB    . ILE B 1 466 ? -46.992 75.166  25.286  1.00 19.46  ? 466  ILE B CB    1 
ATOM   8521  C CG1   . ILE B 1 466 ? -45.752 74.234  25.348  1.00 20.13  ? 466  ILE B CG1   1 
ATOM   8522  C CG2   . ILE B 1 466 ? -46.631 76.605  25.624  1.00 19.32  ? 466  ILE B CG2   1 
ATOM   8523  C CD1   . ILE B 1 466 ? -45.010 74.157  26.708  1.00 18.79  ? 466  ILE B CD1   1 
ATOM   8524  N N     . THR B 1 467 ? -49.996 76.233  26.603  1.00 20.58  ? 467  THR B N     1 
ATOM   8525  C CA    . THR B 1 467 ? -51.395 76.691  26.483  1.00 20.93  ? 467  THR B CA    1 
ATOM   8526  C C     . THR B 1 467 ? -51.570 77.994  25.692  1.00 21.46  ? 467  THR B C     1 
ATOM   8527  O O     . THR B 1 467 ? -52.699 78.483  25.503  1.00 21.02  ? 467  THR B O     1 
ATOM   8528  C CB    . THR B 1 467 ? -52.032 76.858  27.881  1.00 21.10  ? 467  THR B CB    1 
ATOM   8529  O OG1   . THR B 1 467 ? -51.370 77.917  28.576  1.00 20.28  ? 467  THR B OG1   1 
ATOM   8530  C CG2   . THR B 1 467 ? -51.899 75.572  28.691  1.00 21.58  ? 467  THR B CG2   1 
ATOM   8531  N N     . ASP B 1 468 ? -50.447 78.572  25.265  1.00 21.54  ? 468  ASP B N     1 
ATOM   8532  C CA    . ASP B 1 468 ? -50.459 79.762  24.417  1.00 21.72  ? 468  ASP B CA    1 
ATOM   8533  C C     . ASP B 1 468 ? -49.192 79.779  23.587  1.00 21.10  ? 468  ASP B C     1 
ATOM   8534  O O     . ASP B 1 468 ? -48.278 79.004  23.844  1.00 21.00  ? 468  ASP B O     1 
ATOM   8535  C CB    . ASP B 1 468 ? -50.569 81.043  25.259  1.00 22.02  ? 468  ASP B CB    1 
ATOM   8536  C CG    . ASP B 1 468 ? -51.264 82.191  24.507  1.00 23.84  ? 468  ASP B CG    1 
ATOM   8537  O OD1   . ASP B 1 468 ? -51.362 82.151  23.257  1.00 24.69  ? 468  ASP B OD1   1 
ATOM   8538  O OD2   . ASP B 1 468 ? -51.731 83.135  25.179  1.00 26.96  ? 468  ASP B OD2   1 
ATOM   8539  N N     . SER B 1 469 ? -49.141 80.659  22.594  1.00 20.64  ? 469  SER B N     1 
ATOM   8540  C CA    . SER B 1 469 ? -47.990 80.757  21.707  1.00 20.10  ? 469  SER B CA    1 
ATOM   8541  C C     . SER B 1 469 ? -46.819 81.510  22.346  1.00 19.85  ? 469  SER B C     1 
ATOM   8542  O O     . SER B 1 469 ? -46.971 82.164  23.384  1.00 19.59  ? 469  SER B O     1 
ATOM   8543  C CB    . SER B 1 469 ? -48.394 81.408  20.382  1.00 20.21  ? 469  SER B CB    1 
ATOM   8544  O OG    . SER B 1 469 ? -47.373 81.279  19.401  1.00 20.76  ? 469  SER B OG    1 
ATOM   8545  N N     . TRP B 1 470 ? -45.653 81.370  21.716  1.00 19.47  ? 470  TRP B N     1 
ATOM   8546  C CA    . TRP B 1 470 ? -44.410 82.068  22.051  1.00 19.11  ? 470  TRP B CA    1 
ATOM   8547  C C     . TRP B 1 470 ? -43.771 82.372  20.675  1.00 19.57  ? 470  TRP B C     1 
ATOM   8548  O O     . TRP B 1 470 ? -44.073 81.676  19.695  1.00 19.56  ? 470  TRP B O     1 
ATOM   8549  C CB    . TRP B 1 470 ? -43.500 81.191  22.923  1.00 18.83  ? 470  TRP B CB    1 
ATOM   8550  C CG    . TRP B 1 470 ? -43.116 79.899  22.233  1.00 18.32  ? 470  TRP B CG    1 
ATOM   8551  C CD1   . TRP B 1 470 ? -41.928 79.622  21.604  1.00 17.65  ? 470  TRP B CD1   1 
ATOM   8552  C CD2   . TRP B 1 470 ? -43.942 78.743  22.063  1.00 17.75  ? 470  TRP B CD2   1 
ATOM   8553  N NE1   . TRP B 1 470 ? -41.967 78.361  21.061  1.00 18.35  ? 470  TRP B NE1   1 
ATOM   8554  C CE2   . TRP B 1 470 ? -43.192 77.798  21.319  1.00 18.43  ? 470  TRP B CE2   1 
ATOM   8555  C CE3   . TRP B 1 470 ? -45.247 78.406  22.468  1.00 18.89  ? 470  TRP B CE3   1 
ATOM   8556  C CZ2   . TRP B 1 470 ? -43.705 76.536  20.971  1.00 17.92  ? 470  TRP B CZ2   1 
ATOM   8557  C CZ3   . TRP B 1 470 ? -45.759 77.144  22.126  1.00 17.79  ? 470  TRP B CZ3   1 
ATOM   8558  C CH2   . TRP B 1 470 ? -44.987 76.227  21.388  1.00 18.43  ? 470  TRP B CH2   1 
ATOM   8559  N N     . PRO B 1 471 ? -42.929 83.428  20.579  1.00 19.47  ? 471  PRO B N     1 
ATOM   8560  C CA    . PRO B 1 471 ? -42.408 83.884  19.279  1.00 19.05  ? 471  PRO B CA    1 
ATOM   8561  C C     . PRO B 1 471 ? -41.670 82.844  18.401  1.00 19.32  ? 471  PRO B C     1 
ATOM   8562  O O     . PRO B 1 471 ? -41.708 82.948  17.174  1.00 19.41  ? 471  PRO B O     1 
ATOM   8563  C CB    . PRO B 1 471 ? -41.482 85.048  19.667  1.00 18.84  ? 471  PRO B CB    1 
ATOM   8564  C CG    . PRO B 1 471 ? -42.081 85.570  20.966  1.00 19.09  ? 471  PRO B CG    1 
ATOM   8565  C CD    . PRO B 1 471 ? -42.456 84.292  21.682  1.00 19.57  ? 471  PRO B CD    1 
ATOM   8566  N N     . GLY B 1 472 ? -41.010 81.865  19.009  1.00 19.04  ? 472  GLY B N     1 
ATOM   8567  C CA    . GLY B 1 472 ? -40.224 80.901  18.239  1.00 19.49  ? 472  GLY B CA    1 
ATOM   8568  C C     . GLY B 1 472 ? -40.980 79.684  17.725  1.00 19.64  ? 472  GLY B C     1 
ATOM   8569  O O     . GLY B 1 472 ? -40.395 78.821  17.087  1.00 19.93  ? 472  GLY B O     1 
ATOM   8570  N N     . GLN B 1 473 ? -42.282 79.620  17.986  1.00 19.60  ? 473  GLN B N     1 
ATOM   8571  C CA    . GLN B 1 473 ? -43.074 78.455  17.615  1.00 19.82  ? 473  GLN B CA    1 
ATOM   8572  C C     . GLN B 1 473 ? -43.069 78.173  16.113  1.00 20.07  ? 473  GLN B C     1 
ATOM   8573  O O     . GLN B 1 473 ? -43.268 79.088  15.305  1.00 19.98  ? 473  GLN B O     1 
ATOM   8574  C CB    . GLN B 1 473 ? -44.513 78.618  18.112  1.00 19.61  ? 473  GLN B CB    1 
ATOM   8575  C CG    . GLN B 1 473 ? -45.351 77.350  17.947  1.00 19.48  ? 473  GLN B CG    1 
ATOM   8576  C CD    . GLN B 1 473 ? -46.717 77.451  18.618  1.00 19.71  ? 473  GLN B CD    1 
ATOM   8577  O OE1   . GLN B 1 473 ? -47.200 78.547  18.937  1.00 20.25  ? 473  GLN B OE1   1 
ATOM   8578  N NE2   . GLN B 1 473 ? -47.348 76.308  18.823  1.00 18.05  ? 473  GLN B NE2   1 
ATOM   8579  N N     . ALA B 1 474 ? -42.854 76.905  15.742  1.00 20.12  ? 474  ALA B N     1 
ATOM   8580  C CA    . ALA B 1 474 ? -43.045 76.473  14.349  1.00 20.00  ? 474  ALA B CA    1 
ATOM   8581  C C     . ALA B 1 474 ? -44.435 76.868  13.895  1.00 19.98  ? 474  ALA B C     1 
ATOM   8582  O O     . ALA B 1 474 ? -45.403 76.743  14.660  1.00 20.18  ? 474  ALA B O     1 
ATOM   8583  C CB    . ALA B 1 474 ? -42.863 74.968  14.204  1.00 19.53  ? 474  ALA B CB    1 
ATOM   8584  N N     . ARG B 1 475 ? -44.533 77.331  12.652  1.00 19.95  ? 475  ARG B N     1 
ATOM   8585  C CA    . ARG B 1 475 ? -45.777 77.909  12.133  1.00 20.17  ? 475  ARG B CA    1 
ATOM   8586  C C     . ARG B 1 475 ? -46.673 76.892  11.436  1.00 20.16  ? 475  ARG B C     1 
ATOM   8587  O O     . ARG B 1 475 ? -47.887 77.080  11.354  1.00 19.92  ? 475  ARG B O     1 
ATOM   8588  C CB    . ARG B 1 475 ? -45.473 79.085  11.186  1.00 20.45  ? 475  ARG B CB    1 
ATOM   8589  C CG    . ARG B 1 475 ? -44.565 80.173  11.794  1.00 20.16  ? 475  ARG B CG    1 
ATOM   8590  C CD    . ARG B 1 475 ? -45.203 80.819  13.031  1.00 20.05  ? 475  ARG B CD    1 
ATOM   8591  N NE    . ARG B 1 475 ? -44.728 82.187  13.225  1.00 20.18  ? 475  ARG B NE    1 
ATOM   8592  C CZ    . ARG B 1 475 ? -44.008 82.612  14.259  1.00 20.50  ? 475  ARG B CZ    1 
ATOM   8593  N NH1   . ARG B 1 475 ? -43.679 81.790  15.244  1.00 20.00  ? 475  ARG B NH1   1 
ATOM   8594  N NH2   . ARG B 1 475 ? -43.619 83.878  14.311  1.00 20.67  ? 475  ARG B NH2   1 
ATOM   8595  N N     . THR B 1 476 ? -46.070 75.817  10.938  1.00 20.53  ? 476  THR B N     1 
ATOM   8596  C CA    . THR B 1 476 ? -46.790 74.803  10.183  1.00 20.66  ? 476  THR B CA    1 
ATOM   8597  C C     . THR B 1 476 ? -45.892 73.602  9.888   1.00 20.97  ? 476  THR B C     1 
ATOM   8598  O O     . THR B 1 476 ? -44.737 73.556  10.330  1.00 20.80  ? 476  THR B O     1 
ATOM   8599  C CB    . THR B 1 476 ? -47.412 75.401  8.866   1.00 20.71  ? 476  THR B CB    1 
ATOM   8600  O OG1   . THR B 1 476 ? -48.302 74.449  8.277   1.00 21.57  ? 476  THR B OG1   1 
ATOM   8601  C CG2   . THR B 1 476 ? -46.340 75.800  7.857   1.00 20.86  ? 476  THR B CG2   1 
ATOM   8602  N N     . LEU B 1 477 ? -46.447 72.621  9.179   1.00 21.75  ? 477  LEU B N     1 
ATOM   8603  C CA    . LEU B 1 477 ? -45.660 71.582  8.508   1.00 22.81  ? 477  LEU B CA    1 
ATOM   8604  C C     . LEU B 1 477 ? -45.693 71.892  7.019   1.00 23.52  ? 477  LEU B C     1 
ATOM   8605  O O     . LEU B 1 477 ? -46.755 72.222  6.483   1.00 23.45  ? 477  LEU B O     1 
ATOM   8606  C CB    . LEU B 1 477 ? -46.231 70.181  8.758   1.00 22.50  ? 477  LEU B CB    1 
ATOM   8607  C CG    . LEU B 1 477 ? -46.104 69.608  10.173  1.00 23.23  ? 477  LEU B CG    1 
ATOM   8608  C CD1   . LEU B 1 477 ? -46.766 68.223  10.255  1.00 21.46  ? 477  LEU B CD1   1 
ATOM   8609  C CD2   . LEU B 1 477 ? -44.641 69.539  10.642  1.00 21.67  ? 477  LEU B CD2   1 
ATOM   8610  N N     . PHE B 1 478 ? -44.532 71.794  6.369   1.00 24.24  ? 478  PHE B N     1 
ATOM   8611  C CA    . PHE B 1 478 ? -44.382 72.161  4.966   1.00 25.27  ? 478  PHE B CA    1 
ATOM   8612  C C     . PHE B 1 478 ? -45.381 71.438  4.059   1.00 25.28  ? 478  PHE B C     1 
ATOM   8613  O O     . PHE B 1 478 ? -45.376 70.213  3.981   1.00 25.24  ? 478  PHE B O     1 
ATOM   8614  C CB    . PHE B 1 478 ? -42.939 71.924  4.480   1.00 26.00  ? 478  PHE B CB    1 
ATOM   8615  C CG    . PHE B 1 478 ? -42.728 72.263  3.018   1.00 27.54  ? 478  PHE B CG    1 
ATOM   8616  C CD1   . PHE B 1 478 ? -42.680 73.592  2.596   1.00 28.21  ? 478  PHE B CD1   1 
ATOM   8617  C CD2   . PHE B 1 478 ? -42.592 71.252  2.068   1.00 28.28  ? 478  PHE B CD2   1 
ATOM   8618  C CE1   . PHE B 1 478 ? -42.488 73.913  1.245   1.00 29.80  ? 478  PHE B CE1   1 
ATOM   8619  C CE2   . PHE B 1 478 ? -42.411 71.562  0.719   1.00 29.67  ? 478  PHE B CE2   1 
ATOM   8620  C CZ    . PHE B 1 478 ? -42.353 72.895  0.305   1.00 28.48  ? 478  PHE B CZ    1 
ATOM   8621  N N     . GLY B 1 479 ? -46.233 72.221  3.398   1.00 25.03  ? 479  GLY B N     1 
ATOM   8622  C CA    . GLY B 1 479 ? -47.251 71.712  2.486   1.00 25.07  ? 479  GLY B CA    1 
ATOM   8623  C C     . GLY B 1 479 ? -48.434 70.989  3.123   1.00 24.95  ? 479  GLY B C     1 
ATOM   8624  O O     . GLY B 1 479 ? -49.218 70.344  2.418   1.00 24.36  ? 479  GLY B O     1 
ATOM   8625  N N     . ASP B 1 480 ? -48.574 71.089  4.445   1.00 24.52  ? 480  ASP B N     1 
ATOM   8626  C CA    . ASP B 1 480 ? -49.629 70.353  5.140   1.00 24.53  ? 480  ASP B CA    1 
ATOM   8627  C C     . ASP B 1 480 ? -50.010 70.938  6.502   1.00 24.29  ? 480  ASP B C     1 
ATOM   8628  O O     . ASP B 1 480 ? -49.716 70.346  7.546   1.00 23.54  ? 480  ASP B O     1 
ATOM   8629  C CB    . ASP B 1 480 ? -49.239 68.877  5.296   1.00 24.77  ? 480  ASP B CB    1 
ATOM   8630  C CG    . ASP B 1 480 ? -50.452 67.956  5.360   1.00 26.35  ? 480  ASP B CG    1 
ATOM   8631  O OD1   . ASP B 1 480 ? -51.583 68.461  5.498   1.00 26.58  ? 480  ASP B OD1   1 
ATOM   8632  O OD2   . ASP B 1 480 ? -50.270 66.720  5.284   1.00 28.62  ? 480  ASP B OD2   1 
ATOM   8633  N N     . HIS B 1 481 ? -50.702 72.074  6.477   1.00 23.99  ? 481  HIS B N     1 
ATOM   8634  C CA    . HIS B 1 481 ? -51.163 72.726  7.702   1.00 24.39  ? 481  HIS B CA    1 
ATOM   8635  C C     . HIS B 1 481 ? -52.221 71.933  8.490   1.00 24.70  ? 481  HIS B C     1 
ATOM   8636  O O     . HIS B 1 481 ? -52.267 72.004  9.717   1.00 24.67  ? 481  HIS B O     1 
ATOM   8637  C CB    . HIS B 1 481 ? -51.675 74.140  7.403   1.00 24.08  ? 481  HIS B CB    1 
ATOM   8638  C CG    . HIS B 1 481 ? -51.830 74.988  8.627   1.00 25.02  ? 481  HIS B CG    1 
ATOM   8639  N ND1   . HIS B 1 481 ? -50.754 75.427  9.371   1.00 26.40  ? 481  HIS B ND1   1 
ATOM   8640  C CD2   . HIS B 1 481 ? -52.935 75.469  9.244   1.00 25.63  ? 481  HIS B CD2   1 
ATOM   8641  C CE1   . HIS B 1 481 ? -51.192 76.146  10.390  1.00 25.84  ? 481  HIS B CE1   1 
ATOM   8642  N NE2   . HIS B 1 481 ? -52.512 76.181  10.339  1.00 25.65  ? 481  HIS B NE2   1 
ATOM   8643  N N     . GLU B 1 482 ? -53.060 71.179  7.784   1.00 25.13  ? 482  GLU B N     1 
ATOM   8644  C CA    . GLU B 1 482 ? -54.074 70.328  8.414   1.00 25.83  ? 482  GLU B CA    1 
ATOM   8645  C C     . GLU B 1 482 ? -53.451 69.204  9.251   1.00 25.35  ? 482  GLU B C     1 
ATOM   8646  O O     . GLU B 1 482 ? -53.942 68.863  10.336  1.00 25.70  ? 482  GLU B O     1 
ATOM   8647  C CB    . GLU B 1 482 ? -55.004 69.756  7.338   1.00 26.31  ? 482  GLU B CB    1 
ATOM   8648  C CG    . GLU B 1 482 ? -56.183 68.977  7.870   1.00 29.32  ? 482  GLU B CG    1 
ATOM   8649  C CD    . GLU B 1 482 ? -57.499 69.420  7.244   1.00 34.02  ? 482  GLU B CD    1 
ATOM   8650  O OE1   . GLU B 1 482 ? -58.544 68.780  7.519   1.00 33.82  ? 482  GLU B OE1   1 
ATOM   8651  O OE2   . GLU B 1 482 ? -57.490 70.417  6.471   1.00 35.80  ? 482  GLU B OE2   1 
ATOM   8652  N N     . ARG B 1 483 ? -52.372 68.632  8.737   1.00 24.73  ? 483  ARG B N     1 
ATOM   8653  C CA    . ARG B 1 483 ? -51.595 67.641  9.466   1.00 24.38  ? 483  ARG B CA    1 
ATOM   8654  C C     . ARG B 1 483 ? -50.879 68.289  10.665  1.00 23.39  ? 483  ARG B C     1 
ATOM   8655  O O     . ARG B 1 483 ? -50.775 67.687  11.731  1.00 22.57  ? 483  ARG B O     1 
ATOM   8656  C CB    . ARG B 1 483 ? -50.600 66.979  8.516   1.00 24.88  ? 483  ARG B CB    1 
ATOM   8657  C CG    . ARG B 1 483 ? -49.606 66.038  9.153   1.00 28.58  ? 483  ARG B CG    1 
ATOM   8658  C CD    . ARG B 1 483 ? -50.275 64.827  9.780   1.00 35.35  ? 483  ARG B CD    1 
ATOM   8659  N NE    . ARG B 1 483 ? -49.235 63.892  10.198  1.00 42.34  ? 483  ARG B NE    1 
ATOM   8660  C CZ    . ARG B 1 483 ? -48.676 62.986  9.402   1.00 44.50  ? 483  ARG B CZ    1 
ATOM   8661  N NH1   . ARG B 1 483 ? -49.082 62.862  8.137   1.00 45.03  ? 483  ARG B NH1   1 
ATOM   8662  N NH2   . ARG B 1 483 ? -47.714 62.198  9.877   1.00 45.58  ? 483  ARG B NH2   1 
ATOM   8663  N N     . PHE B 1 484 ? -50.392 69.512  10.473  1.00 22.52  ? 484  PHE B N     1 
ATOM   8664  C CA    . PHE B 1 484 ? -49.849 70.318  11.564  1.00 22.52  ? 484  PHE B CA    1 
ATOM   8665  C C     . PHE B 1 484 ? -50.884 70.445  12.684  1.00 22.76  ? 484  PHE B C     1 
ATOM   8666  O O     . PHE B 1 484 ? -50.594 70.151  13.846  1.00 22.40  ? 484  PHE B O     1 
ATOM   8667  C CB    . PHE B 1 484 ? -49.431 71.691  11.029  1.00 21.96  ? 484  PHE B CB    1 
ATOM   8668  C CG    . PHE B 1 484 ? -48.921 72.647  12.081  1.00 21.80  ? 484  PHE B CG    1 
ATOM   8669  C CD1   . PHE B 1 484 ? -47.646 72.507  12.614  1.00 22.10  ? 484  PHE B CD1   1 
ATOM   8670  C CD2   . PHE B 1 484 ? -49.712 73.714  12.516  1.00 22.05  ? 484  PHE B CD2   1 
ATOM   8671  C CE1   . PHE B 1 484 ? -47.164 73.414  13.579  1.00 22.23  ? 484  PHE B CE1   1 
ATOM   8672  C CE2   . PHE B 1 484 ? -49.242 74.627  13.480  1.00 21.45  ? 484  PHE B CE2   1 
ATOM   8673  C CZ    . PHE B 1 484 ? -47.972 74.481  14.001  1.00 21.63  ? 484  PHE B CZ    1 
ATOM   8674  N N     . GLU B 1 485 ? -52.099 70.856  12.319  1.00 23.26  ? 485  GLU B N     1 
ATOM   8675  C CA    . GLU B 1 485 ? -53.186 71.017  13.282  1.00 24.36  ? 485  GLU B CA    1 
ATOM   8676  C C     . GLU B 1 485 ? -53.498 69.674  13.966  1.00 24.51  ? 485  GLU B C     1 
ATOM   8677  O O     . GLU B 1 485 ? -53.628 69.613  15.195  1.00 24.27  ? 485  GLU B O     1 
ATOM   8678  C CB    . GLU B 1 485 ? -54.434 71.633  12.611  1.00 24.13  ? 485  GLU B CB    1 
ATOM   8679  C CG    . GLU B 1 485 ? -54.217 73.064  12.032  1.00 25.28  ? 485  GLU B CG    1 
ATOM   8680  C CD    . GLU B 1 485 ? -55.442 73.648  11.283  1.00 26.16  ? 485  GLU B CD    1 
ATOM   8681  O OE1   . GLU B 1 485 ? -55.984 72.985  10.359  1.00 28.11  ? 485  GLU B OE1   1 
ATOM   8682  O OE2   . GLU B 1 485 ? -55.847 74.796  11.603  1.00 26.53  ? 485  GLU B OE2   1 
ATOM   8683  N N     . GLN B 1 486 ? -53.579 68.603  13.173  1.00 24.96  ? 486  GLN B N     1 
ATOM   8684  C CA    . GLN B 1 486 ? -53.907 67.269  13.693  1.00 26.01  ? 486  GLN B CA    1 
ATOM   8685  C C     . GLN B 1 486 ? -52.857 66.740  14.683  1.00 25.04  ? 486  GLN B C     1 
ATOM   8686  O O     . GLN B 1 486 ? -53.207 66.184  15.724  1.00 25.42  ? 486  GLN B O     1 
ATOM   8687  C CB    . GLN B 1 486 ? -54.129 66.263  12.554  1.00 25.64  ? 486  GLN B CB    1 
ATOM   8688  C CG    . GLN B 1 486 ? -54.576 64.876  13.031  1.00 28.60  ? 486  GLN B CG    1 
ATOM   8689  C CD    . GLN B 1 486 ? -54.572 63.798  11.935  1.00 29.23  ? 486  GLN B CD    1 
ATOM   8690  O OE1   . GLN B 1 486 ? -55.597 63.150  11.691  1.00 33.42  ? 486  GLN B OE1   1 
ATOM   8691  N NE2   . GLN B 1 486 ? -53.415 63.591  11.288  1.00 33.42  ? 486  GLN B NE2   1 
ATOM   8692  N N     . THR B 1 487 ? -51.582 66.925  14.353  1.00 24.14  ? 487  THR B N     1 
ATOM   8693  C CA    . THR B 1 487 ? -50.480 66.390  15.146  1.00 23.67  ? 487  THR B CA    1 
ATOM   8694  C C     . THR B 1 487 ? -50.332 67.060  16.522  1.00 23.34  ? 487  THR B C     1 
ATOM   8695  O O     . THR B 1 487 ? -50.146 66.383  17.536  1.00 22.92  ? 487  THR B O     1 
ATOM   8696  C CB    . THR B 1 487 ? -49.156 66.469  14.350  1.00 23.69  ? 487  THR B CB    1 
ATOM   8697  O OG1   . THR B 1 487 ? -49.300 65.735  13.126  1.00 23.78  ? 487  THR B OG1   1 
ATOM   8698  C CG2   . THR B 1 487 ? -47.968 65.894  15.151  1.00 24.11  ? 487  THR B CG2   1 
ATOM   8699  N N     . TYR B 1 488 ? -50.426 68.385  16.547  1.00 22.75  ? 488  TYR B N     1 
ATOM   8700  C CA    . TYR B 1 488 ? -50.077 69.156  17.743  1.00 22.56  ? 488  TYR B CA    1 
ATOM   8701  C C     . TYR B 1 488 ? -51.274 69.728  18.504  1.00 22.19  ? 488  TYR B C     1 
ATOM   8702  O O     . TYR B 1 488 ? -51.164 70.023  19.691  1.00 22.51  ? 488  TYR B O     1 
ATOM   8703  C CB    . TYR B 1 488 ? -49.070 70.265  17.384  1.00 22.58  ? 488  TYR B CB    1 
ATOM   8704  C CG    . TYR B 1 488 ? -47.842 69.723  16.673  1.00 23.05  ? 488  TYR B CG    1 
ATOM   8705  C CD1   . TYR B 1 488 ? -47.696 69.857  15.292  1.00 21.04  ? 488  TYR B CD1   1 
ATOM   8706  C CD2   . TYR B 1 488 ? -46.854 69.025  17.379  1.00 22.11  ? 488  TYR B CD2   1 
ATOM   8707  C CE1   . TYR B 1 488 ? -46.591 69.347  14.636  1.00 21.71  ? 488  TYR B CE1   1 
ATOM   8708  C CE2   . TYR B 1 488 ? -45.743 68.496  16.725  1.00 22.81  ? 488  TYR B CE2   1 
ATOM   8709  C CZ    . TYR B 1 488 ? -45.624 68.660  15.355  1.00 23.13  ? 488  TYR B CZ    1 
ATOM   8710  O OH    . TYR B 1 488 ? -44.527 68.147  14.704  1.00 23.49  ? 488  TYR B OH    1 
ATOM   8711  N N     . PHE B 1 489 ? -52.412 69.867  17.838  1.00 21.72  ? 489  PHE B N     1 
ATOM   8712  C CA    . PHE B 1 489 ? -53.520 70.623  18.425  1.00 22.14  ? 489  PHE B CA    1 
ATOM   8713  C C     . PHE B 1 489 ? -54.861 69.904  18.494  1.00 22.17  ? 489  PHE B C     1 
ATOM   8714  O O     . PHE B 1 489 ? -55.888 70.552  18.686  1.00 22.19  ? 489  PHE B O     1 
ATOM   8715  C CB    . PHE B 1 489 ? -53.692 71.950  17.671  1.00 21.38  ? 489  PHE B CB    1 
ATOM   8716  C CG    . PHE B 1 489 ? -52.467 72.798  17.660  1.00 20.81  ? 489  PHE B CG    1 
ATOM   8717  C CD1   . PHE B 1 489 ? -51.533 72.681  16.632  1.00 19.24  ? 489  PHE B CD1   1 
ATOM   8718  C CD2   . PHE B 1 489 ? -52.238 73.717  18.676  1.00 19.63  ? 489  PHE B CD2   1 
ATOM   8719  C CE1   . PHE B 1 489 ? -50.397 73.467  16.621  1.00 19.05  ? 489  PHE B CE1   1 
ATOM   8720  C CE2   . PHE B 1 489 ? -51.106 74.511  18.665  1.00 18.80  ? 489  PHE B CE2   1 
ATOM   8721  C CZ    . PHE B 1 489 ? -50.182 74.388  17.641  1.00 19.60  ? 489  PHE B CZ    1 
ATOM   8722  N N     . SER B 1 490 ? -54.862 68.579  18.338  1.00 23.00  ? 490  SER B N     1 
ATOM   8723  C CA    . SER B 1 490 ? -56.130 67.826  18.319  1.00 23.46  ? 490  SER B CA    1 
ATOM   8724  C C     . SER B 1 490 ? -56.341 66.922  19.528  1.00 23.46  ? 490  SER B C     1 
ATOM   8725  O O     . SER B 1 490 ? -57.476 66.636  19.882  1.00 23.69  ? 490  SER B O     1 
ATOM   8726  C CB    . SER B 1 490 ? -56.295 67.026  17.021  1.00 23.50  ? 490  SER B CB    1 
ATOM   8727  O OG    . SER B 1 490 ? -55.379 65.941  16.953  1.00 24.14  ? 490  SER B OG    1 
ATOM   8728  N N     . THR B 1 491 ? -55.257 66.471  20.155  1.00 23.80  ? 491  THR B N     1 
ATOM   8729  C CA    . THR B 1 491 ? -55.357 65.619  21.354  1.00 23.58  ? 491  THR B CA    1 
ATOM   8730  C C     . THR B 1 491 ? -55.982 66.420  22.486  1.00 23.43  ? 491  THR B C     1 
ATOM   8731  O O     . THR B 1 491 ? -56.873 65.938  23.183  1.00 23.45  ? 491  THR B O     1 
ATOM   8732  C CB    . THR B 1 491 ? -53.975 65.106  21.797  1.00 23.97  ? 491  THR B CB    1 
ATOM   8733  O OG1   . THR B 1 491 ? -53.283 64.565  20.666  1.00 24.19  ? 491  THR B OG1   1 
ATOM   8734  C CG2   . THR B 1 491 ? -54.096 64.025  22.877  1.00 23.81  ? 491  THR B CG2   1 
ATOM   8735  N N     . PHE B 1 492 ? -55.511 67.655  22.646  1.00 23.12  ? 492  PHE B N     1 
ATOM   8736  C CA    . PHE B 1 492 ? -55.950 68.533  23.715  1.00 23.00  ? 492  PHE B CA    1 
ATOM   8737  C C     . PHE B 1 492 ? -56.256 69.884  23.096  1.00 23.22  ? 492  PHE B C     1 
ATOM   8738  O O     . PHE B 1 492 ? -55.358 70.688  22.827  1.00 22.51  ? 492  PHE B O     1 
ATOM   8739  C CB    . PHE B 1 492 ? -54.871 68.648  24.803  1.00 22.66  ? 492  PHE B CB    1 
ATOM   8740  C CG    . PHE B 1 492 ? -54.412 67.319  25.349  1.00 22.67  ? 492  PHE B CG    1 
ATOM   8741  C CD1   . PHE B 1 492 ? -53.082 66.926  25.225  1.00 21.10  ? 492  PHE B CD1   1 
ATOM   8742  C CD2   . PHE B 1 492 ? -55.319 66.451  25.980  1.00 22.25  ? 492  PHE B CD2   1 
ATOM   8743  C CE1   . PHE B 1 492 ? -52.650 65.695  25.733  1.00 22.14  ? 492  PHE B CE1   1 
ATOM   8744  C CE2   . PHE B 1 492 ? -54.896 65.213  26.484  1.00 21.37  ? 492  PHE B CE2   1 
ATOM   8745  C CZ    . PHE B 1 492 ? -53.565 64.835  26.357  1.00 21.13  ? 492  PHE B CZ    1 
ATOM   8746  N N     . LYS B 1 493 ? -57.542 70.105  22.852  1.00 23.67  ? 493  LYS B N     1 
ATOM   8747  C CA    . LYS B 1 493 ? -58.008 71.244  22.077  1.00 24.66  ? 493  LYS B CA    1 
ATOM   8748  C C     . LYS B 1 493 ? -57.630 72.558  22.728  1.00 24.16  ? 493  LYS B C     1 
ATOM   8749  O O     . LYS B 1 493 ? -57.688 72.695  23.958  1.00 23.87  ? 493  LYS B O     1 
ATOM   8750  C CB    . LYS B 1 493 ? -59.519 71.132  21.815  1.00 24.86  ? 493  LYS B CB    1 
ATOM   8751  C CG    . LYS B 1 493 ? -59.811 70.050  20.762  1.00 26.45  ? 493  LYS B CG    1 
ATOM   8752  C CD    . LYS B 1 493 ? -61.291 69.869  20.431  1.00 26.82  ? 493  LYS B CD    1 
ATOM   8753  C CE    . LYS B 1 493 ? -61.466 69.409  18.965  1.00 30.66  ? 493  LYS B CE    1 
ATOM   8754  N NZ    . LYS B 1 493 ? -60.253 68.701  18.380  1.00 30.43  ? 493  LYS B NZ    1 
ATOM   8755  N N     . ASN B 1 494 ? -57.224 73.505  21.882  1.00 23.90  ? 494  ASN B N     1 
ATOM   8756  C CA    . ASN B 1 494 ? -56.750 74.830  22.299  1.00 24.14  ? 494  ASN B CA    1 
ATOM   8757  C C     . ASN B 1 494 ? -55.381 74.803  22.978  1.00 23.85  ? 494  ASN B C     1 
ATOM   8758  O O     . ASN B 1 494 ? -54.947 75.791  23.574  1.00 23.44  ? 494  ASN B O     1 
ATOM   8759  C CB    . ASN B 1 494 ? -57.783 75.532  23.185  1.00 24.15  ? 494  ASN B CB    1 
ATOM   8760  C CG    . ASN B 1 494 ? -59.044 75.879  22.434  1.00 25.63  ? 494  ASN B CG    1 
ATOM   8761  O OD1   . ASN B 1 494 ? -59.016 76.660  21.476  1.00 26.30  ? 494  ASN B OD1   1 
ATOM   8762  N ND2   . ASN B 1 494 ? -60.166 75.304  22.867  1.00 24.62  ? 494  ASN B ND2   1 
ATOM   8763  N N     . MET B 1 495 ? -54.700 73.667  22.859  1.00 24.07  ? 495  MET B N     1 
ATOM   8764  C CA    . MET B 1 495 ? -53.388 73.488  23.459  1.00 24.84  ? 495  MET B CA    1 
ATOM   8765  C C     . MET B 1 495 ? -52.400 72.835  22.505  1.00 23.27  ? 495  MET B C     1 
ATOM   8766  O O     . MET B 1 495 ? -52.773 71.963  21.725  1.00 22.80  ? 495  MET B O     1 
ATOM   8767  C CB    . MET B 1 495 ? -53.522 72.640  24.722  1.00 24.36  ? 495  MET B CB    1 
ATOM   8768  C CG    . MET B 1 495 ? -54.069 73.394  25.923  1.00 25.78  ? 495  MET B CG    1 
ATOM   8769  S SD    . MET B 1 495 ? -54.475 72.121  27.100  1.00 30.69  ? 495  MET B SD    1 
ATOM   8770  C CE    . MET B 1 495 ? -56.278 72.146  27.019  1.00 32.72  ? 495  MET B CE    1 
ATOM   8771  N N     . TYR B 1 496 ? -51.143 73.269  22.588  1.00 22.52  ? 496  TYR B N     1 
ATOM   8772  C CA    . TYR B 1 496 ? -50.032 72.614  21.919  1.00 21.92  ? 496  TYR B CA    1 
ATOM   8773  C C     . TYR B 1 496 ? -49.580 71.387  22.738  1.00 21.89  ? 496  TYR B C     1 
ATOM   8774  O O     . TYR B 1 496 ? -49.153 71.534  23.889  1.00 21.26  ? 496  TYR B O     1 
ATOM   8775  C CB    . TYR B 1 496 ? -48.860 73.592  21.709  1.00 21.76  ? 496  TYR B CB    1 
ATOM   8776  C CG    . TYR B 1 496 ? -47.614 72.902  21.184  1.00 21.26  ? 496  TYR B CG    1 
ATOM   8777  C CD1   . TYR B 1 496 ? -47.452 72.651  19.821  1.00 20.75  ? 496  TYR B CD1   1 
ATOM   8778  C CD2   . TYR B 1 496 ? -46.609 72.477  22.056  1.00 21.57  ? 496  TYR B CD2   1 
ATOM   8779  C CE1   . TYR B 1 496 ? -46.315 71.987  19.334  1.00 22.21  ? 496  TYR B CE1   1 
ATOM   8780  C CE2   . TYR B 1 496 ? -45.461 71.824  21.583  1.00 21.46  ? 496  TYR B CE2   1 
ATOM   8781  C CZ    . TYR B 1 496 ? -45.326 71.579  20.221  1.00 22.80  ? 496  TYR B CZ    1 
ATOM   8782  O OH    . TYR B 1 496 ? -44.206 70.927  19.743  1.00 22.56  ? 496  TYR B OH    1 
ATOM   8783  N N     . PHE B 1 497 ? -49.701 70.190  22.154  1.00 21.41  ? 497  PHE B N     1 
ATOM   8784  C CA    . PHE B 1 497 ? -49.234 68.958  22.804  1.00 21.23  ? 497  PHE B CA    1 
ATOM   8785  C C     . PHE B 1 497 ? -47.819 68.603  22.338  1.00 21.24  ? 497  PHE B C     1 
ATOM   8786  O O     . PHE B 1 497 ? -47.582 68.397  21.141  1.00 21.09  ? 497  PHE B O     1 
ATOM   8787  C CB    . PHE B 1 497 ? -50.207 67.790  22.564  1.00 21.11  ? 497  PHE B CB    1 
ATOM   8788  C CG    . PHE B 1 497 ? -49.811 66.492  23.260  1.00 21.03  ? 497  PHE B CG    1 
ATOM   8789  C CD1   . PHE B 1 497 ? -49.187 66.501  24.515  1.00 20.31  ? 497  PHE B CD1   1 
ATOM   8790  C CD2   . PHE B 1 497 ? -50.104 65.263  22.675  1.00 21.01  ? 497  PHE B CD2   1 
ATOM   8791  C CE1   . PHE B 1 497 ? -48.832 65.308  25.162  1.00 21.65  ? 497  PHE B CE1   1 
ATOM   8792  C CE2   . PHE B 1 497 ? -49.756 64.059  23.319  1.00 21.82  ? 497  PHE B CE2   1 
ATOM   8793  C CZ    . PHE B 1 497 ? -49.125 64.084  24.570  1.00 20.29  ? 497  PHE B CZ    1 
ATOM   8794  N N     . SER B 1 498 ? -46.889 68.543  23.292  1.00 20.91  ? 498  SER B N     1 
ATOM   8795  C CA    . SER B 1 498 ? -45.478 68.309  22.993  1.00 20.97  ? 498  SER B CA    1 
ATOM   8796  C C     . SER B 1 498 ? -45.169 66.847  22.696  1.00 21.16  ? 498  SER B C     1 
ATOM   8797  O O     . SER B 1 498 ? -44.195 66.557  22.012  1.00 21.96  ? 498  SER B O     1 
ATOM   8798  C CB    . SER B 1 498 ? -44.607 68.764  24.156  1.00 20.87  ? 498  SER B CB    1 
ATOM   8799  O OG    . SER B 1 498 ? -44.904 67.987  25.296  1.00 19.86  ? 498  SER B OG    1 
ATOM   8800  N N     . GLY B 1 499 ? -45.990 65.935  23.206  1.00 21.20  ? 499  GLY B N     1 
ATOM   8801  C CA    . GLY B 1 499 ? -45.707 64.502  23.121  1.00 20.84  ? 499  GLY B CA    1 
ATOM   8802  C C     . GLY B 1 499 ? -44.825 63.983  24.254  1.00 21.06  ? 499  GLY B C     1 
ATOM   8803  O O     . GLY B 1 499 ? -44.467 62.799  24.296  1.00 20.84  ? 499  GLY B O     1 
ATOM   8804  N N     . ASP B 1 500 ? -44.467 64.871  25.174  1.00 21.25  ? 500  ASP B N     1 
ATOM   8805  C CA    . ASP B 1 500 ? -43.711 64.502  26.354  1.00 21.85  ? 500  ASP B CA    1 
ATOM   8806  C C     . ASP B 1 500 ? -44.611 64.373  27.578  1.00 21.98  ? 500  ASP B C     1 
ATOM   8807  O O     . ASP B 1 500 ? -45.689 64.989  27.657  1.00 22.02  ? 500  ASP B O     1 
ATOM   8808  C CB    . ASP B 1 500 ? -42.623 65.548  26.641  1.00 21.79  ? 500  ASP B CB    1 
ATOM   8809  C CG    . ASP B 1 500 ? -41.457 65.448  25.695  1.00 22.99  ? 500  ASP B CG    1 
ATOM   8810  O OD1   . ASP B 1 500 ? -40.967 64.320  25.473  1.00 24.60  ? 500  ASP B OD1   1 
ATOM   8811  O OD2   . ASP B 1 500 ? -41.021 66.498  25.178  1.00 23.71  ? 500  ASP B OD2   1 
ATOM   8812  N N     . GLY B 1 501 ? -44.162 63.561  28.523  1.00 21.83  ? 501  GLY B N     1 
ATOM   8813  C CA    . GLY B 1 501 ? -44.735 63.524  29.855  1.00 22.55  ? 501  GLY B CA    1 
ATOM   8814  C C     . GLY B 1 501 ? -43.764 64.215  30.793  1.00 23.23  ? 501  GLY B C     1 
ATOM   8815  O O     . GLY B 1 501 ? -42.554 64.295  30.510  1.00 23.54  ? 501  GLY B O     1 
ATOM   8816  N N     . ALA B 1 502 ? -44.286 64.733  31.899  1.00 23.53  ? 502  ALA B N     1 
ATOM   8817  C CA    . ALA B 1 502 ? -43.466 65.434  32.887  1.00 23.81  ? 502  ALA B CA    1 
ATOM   8818  C C     . ALA B 1 502 ? -44.110 65.356  34.254  1.00 24.37  ? 502  ALA B C     1 
ATOM   8819  O O     . ALA B 1 502 ? -45.302 65.062  34.375  1.00 24.46  ? 502  ALA B O     1 
ATOM   8820  C CB    . ALA B 1 502 ? -43.260 66.887  32.483  1.00 23.33  ? 502  ALA B CB    1 
ATOM   8821  N N     . ARG B 1 503 ? -43.318 65.597  35.290  1.00 24.94  ? 503  ARG B N     1 
ATOM   8822  C CA    . ARG B 1 503 ? -43.888 65.885  36.590  1.00 26.35  ? 503  ARG B CA    1 
ATOM   8823  C C     . ARG B 1 503 ? -43.447 67.273  37.045  1.00 25.71  ? 503  ARG B C     1 
ATOM   8824  O O     . ARG B 1 503 ? -42.402 67.771  36.617  1.00 25.94  ? 503  ARG B O     1 
ATOM   8825  C CB    . ARG B 1 503 ? -43.576 64.785  37.623  1.00 26.50  ? 503  ARG B CB    1 
ATOM   8826  C CG    . ARG B 1 503 ? -42.166 64.746  38.140  1.00 28.91  ? 503  ARG B CG    1 
ATOM   8827  C CD    . ARG B 1 503 ? -41.975 63.706  39.269  1.00 28.92  ? 503  ARG B CD    1 
ATOM   8828  N NE    . ARG B 1 503 ? -40.550 63.567  39.602  1.00 34.00  ? 503  ARG B NE    1 
ATOM   8829  C CZ    . ARG B 1 503 ? -39.639 62.965  38.828  1.00 35.84  ? 503  ARG B CZ    1 
ATOM   8830  N NH1   . ARG B 1 503 ? -39.980 62.422  37.662  1.00 34.26  ? 503  ARG B NH1   1 
ATOM   8831  N NH2   . ARG B 1 503 ? -38.369 62.902  39.224  1.00 37.43  ? 503  ARG B NH2   1 
ATOM   8832  N N     . ARG B 1 504 ? -44.287 67.902  37.861  1.00 25.31  ? 504  ARG B N     1 
ATOM   8833  C CA    . ARG B 1 504 ? -44.013 69.200  38.459  1.00 24.79  ? 504  ARG B CA    1 
ATOM   8834  C C     . ARG B 1 504 ? -43.955 68.965  39.966  1.00 24.91  ? 504  ARG B C     1 
ATOM   8835  O O     . ARG B 1 504 ? -44.883 68.379  40.536  1.00 24.69  ? 504  ARG B O     1 
ATOM   8836  C CB    . ARG B 1 504 ? -45.124 70.205  38.101  1.00 25.12  ? 504  ARG B CB    1 
ATOM   8837  C CG    . ARG B 1 504 ? -44.880 71.642  38.562  1.00 24.31  ? 504  ARG B CG    1 
ATOM   8838  C CD    . ARG B 1 504 ? -45.974 72.617  38.123  1.00 24.32  ? 504  ARG B CD    1 
ATOM   8839  N NE    . ARG B 1 504 ? -47.309 72.164  38.504  1.00 24.02  ? 504  ARG B NE    1 
ATOM   8840  C CZ    . ARG B 1 504 ? -48.336 72.018  37.666  1.00 23.78  ? 504  ARG B CZ    1 
ATOM   8841  N NH1   . ARG B 1 504 ? -48.216 72.324  36.373  1.00 20.68  ? 504  ARG B NH1   1 
ATOM   8842  N NH2   . ARG B 1 504 ? -49.503 71.582  38.133  1.00 22.49  ? 504  ARG B NH2   1 
ATOM   8843  N N     . ASP B 1 505 ? -42.866 69.395  40.604  1.00 24.49  ? 505  ASP B N     1 
ATOM   8844  C CA    . ASP B 1 505 ? -42.736 69.240  42.055  1.00 24.80  ? 505  ASP B CA    1 
ATOM   8845  C C     . ASP B 1 505 ? -43.373 70.409  42.807  1.00 25.05  ? 505  ASP B C     1 
ATOM   8846  O O     . ASP B 1 505 ? -44.001 71.279  42.192  1.00 24.98  ? 505  ASP B O     1 
ATOM   8847  C CB    . ASP B 1 505 ? -41.277 68.981  42.488  1.00 24.41  ? 505  ASP B CB    1 
ATOM   8848  C CG    . ASP B 1 505 ? -40.355 70.175  42.253  1.00 24.77  ? 505  ASP B CG    1 
ATOM   8849  O OD1   . ASP B 1 505 ? -40.834 71.337  42.194  1.00 23.96  ? 505  ASP B OD1   1 
ATOM   8850  O OD2   . ASP B 1 505 ? -39.130 69.943  42.153  1.00 23.15  ? 505  ASP B OD2   1 
ATOM   8851  N N     . GLU B 1 506 ? -43.202 70.416  44.129  1.00 25.46  ? 506  GLU B N     1 
ATOM   8852  C CA    . GLU B 1 506 ? -43.809 71.409  45.021  1.00 25.71  ? 506  GLU B CA    1 
ATOM   8853  C C     . GLU B 1 506 ? -43.294 72.841  44.813  1.00 25.90  ? 506  GLU B C     1 
ATOM   8854  O O     . GLU B 1 506 ? -43.995 73.810  45.135  1.00 26.01  ? 506  GLU B O     1 
ATOM   8855  C CB    . GLU B 1 506 ? -43.625 70.987  46.483  1.00 25.86  ? 506  GLU B CB    1 
ATOM   8856  N N     . ASP B 1 507 ? -42.078 72.964  44.278  1.00 25.57  ? 507  ASP B N     1 
ATOM   8857  C CA    . ASP B 1 507 ? -41.493 74.263  43.943  1.00 25.47  ? 507  ASP B CA    1 
ATOM   8858  C C     . ASP B 1 507 ? -41.903 74.760  42.559  1.00 24.69  ? 507  ASP B C     1 
ATOM   8859  O O     . ASP B 1 507 ? -41.526 75.874  42.164  1.00 25.03  ? 507  ASP B O     1 
ATOM   8860  C CB    . ASP B 1 507 ? -39.960 74.206  44.035  1.00 25.90  ? 507  ASP B CB    1 
ATOM   8861  C CG    . ASP B 1 507 ? -39.469 73.959  45.449  1.00 27.48  ? 507  ASP B CG    1 
ATOM   8862  O OD1   . ASP B 1 507 ? -40.071 74.510  46.400  1.00 28.98  ? 507  ASP B OD1   1 
ATOM   8863  O OD2   . ASP B 1 507 ? -38.474 73.213  45.608  1.00 28.68  ? 507  ASP B OD2   1 
ATOM   8864  N N     . GLY B 1 508 ? -42.673 73.947  41.831  1.00 23.82  ? 508  GLY B N     1 
ATOM   8865  C CA    . GLY B 1 508 ? -43.119 74.296  40.482  1.00 23.20  ? 508  GLY B CA    1 
ATOM   8866  C C     . GLY B 1 508 ? -42.103 73.922  39.403  1.00 23.03  ? 508  GLY B C     1 
ATOM   8867  O O     . GLY B 1 508 ? -42.271 74.275  38.228  1.00 23.25  ? 508  GLY B O     1 
ATOM   8868  N N     . TYR B 1 509 ? -41.055 73.205  39.806  1.00 22.17  ? 509  TYR B N     1 
ATOM   8869  C CA    . TYR B 1 509 ? -40.010 72.740  38.897  1.00 21.86  ? 509  TYR B CA    1 
ATOM   8870  C C     . TYR B 1 509 ? -40.519 71.586  38.037  1.00 21.34  ? 509  TYR B C     1 
ATOM   8871  O O     . TYR B 1 509 ? -41.205 70.691  38.537  1.00 21.02  ? 509  TYR B O     1 
ATOM   8872  C CB    . TYR B 1 509 ? -38.780 72.280  39.696  1.00 21.89  ? 509  TYR B CB    1 
ATOM   8873  C CG    . TYR B 1 509 ? -37.844 73.395  40.151  1.00 22.18  ? 509  TYR B CG    1 
ATOM   8874  C CD1   . TYR B 1 509 ? -38.340 74.586  40.697  1.00 22.25  ? 509  TYR B CD1   1 
ATOM   8875  C CD2   . TYR B 1 509 ? -36.461 73.243  40.065  1.00 21.66  ? 509  TYR B CD2   1 
ATOM   8876  C CE1   . TYR B 1 509 ? -37.487 75.595  41.123  1.00 22.66  ? 509  TYR B CE1   1 
ATOM   8877  C CE2   . TYR B 1 509 ? -35.593 74.245  40.498  1.00 21.96  ? 509  TYR B CE2   1 
ATOM   8878  C CZ    . TYR B 1 509 ? -36.112 75.416  41.021  1.00 23.00  ? 509  TYR B CZ    1 
ATOM   8879  O OH    . TYR B 1 509 ? -35.267 76.411  41.450  1.00 23.08  ? 509  TYR B OH    1 
ATOM   8880  N N     . TYR B 1 510 ? -40.168 71.598  36.753  1.00 20.97  ? 510  TYR B N     1 
ATOM   8881  C CA    . TYR B 1 510 ? -40.566 70.513  35.866  1.00 21.15  ? 510  TYR B CA    1 
ATOM   8882  C C     . TYR B 1 510 ? -39.483 69.451  35.700  1.00 21.50  ? 510  TYR B C     1 
ATOM   8883  O O     . TYR B 1 510 ? -38.289 69.758  35.617  1.00 21.68  ? 510  TYR B O     1 
ATOM   8884  C CB    . TYR B 1 510 ? -41.020 71.049  34.518  1.00 20.70  ? 510  TYR B CB    1 
ATOM   8885  C CG    . TYR B 1 510 ? -42.359 71.749  34.573  1.00 20.29  ? 510  TYR B CG    1 
ATOM   8886  C CD1   . TYR B 1 510 ? -42.456 73.112  34.890  1.00 20.66  ? 510  TYR B CD1   1 
ATOM   8887  C CD2   . TYR B 1 510 ? -43.534 71.051  34.293  1.00 19.28  ? 510  TYR B CD2   1 
ATOM   8888  C CE1   . TYR B 1 510 ? -43.714 73.758  34.942  1.00 19.96  ? 510  TYR B CE1   1 
ATOM   8889  C CE2   . TYR B 1 510 ? -44.770 71.674  34.329  1.00 20.59  ? 510  TYR B CE2   1 
ATOM   8890  C CZ    . TYR B 1 510 ? -44.864 73.021  34.663  1.00 20.59  ? 510  TYR B CZ    1 
ATOM   8891  O OH    . TYR B 1 510 ? -46.110 73.609  34.679  1.00 19.83  ? 510  TYR B OH    1 
ATOM   8892  N N     . TRP B 1 511 ? -39.912 68.196  35.674  1.00 22.11  ? 511  TRP B N     1 
ATOM   8893  C CA    . TRP B 1 511 ? -39.013 67.072  35.427  1.00 22.66  ? 511  TRP B CA    1 
ATOM   8894  C C     . TRP B 1 511 ? -39.557 66.336  34.219  1.00 23.30  ? 511  TRP B C     1 
ATOM   8895  O O     . TRP B 1 511 ? -40.592 65.674  34.310  1.00 22.54  ? 511  TRP B O     1 
ATOM   8896  C CB    . TRP B 1 511 ? -38.951 66.135  36.641  1.00 22.53  ? 511  TRP B CB    1 
ATOM   8897  C CG    . TRP B 1 511 ? -38.515 66.806  37.921  1.00 22.87  ? 511  TRP B CG    1 
ATOM   8898  C CD1   . TRP B 1 511 ? -39.231 67.704  38.673  1.00 22.77  ? 511  TRP B CD1   1 
ATOM   8899  C CD2   . TRP B 1 511 ? -37.271 66.617  38.603  1.00 23.10  ? 511  TRP B CD2   1 
ATOM   8900  N NE1   . TRP B 1 511 ? -38.500 68.093  39.772  1.00 23.10  ? 511  TRP B NE1   1 
ATOM   8901  C CE2   . TRP B 1 511 ? -37.296 67.437  39.757  1.00 23.51  ? 511  TRP B CE2   1 
ATOM   8902  C CE3   . TRP B 1 511 ? -36.134 65.837  38.349  1.00 22.89  ? 511  TRP B CE3   1 
ATOM   8903  C CZ2   . TRP B 1 511 ? -36.219 67.505  40.652  1.00 23.19  ? 511  TRP B CZ2   1 
ATOM   8904  C CZ3   . TRP B 1 511 ? -35.072 65.898  39.242  1.00 23.23  ? 511  TRP B CZ3   1 
ATOM   8905  C CH2   . TRP B 1 511 ? -35.122 66.730  40.380  1.00 23.13  ? 511  TRP B CH2   1 
ATOM   8906  N N     . ILE B 1 512 ? -38.867 66.469  33.089  1.00 24.49  ? 512  ILE B N     1 
ATOM   8907  C CA    . ILE B 1 512 ? -39.323 65.872  31.842  1.00 25.99  ? 512  ILE B CA    1 
ATOM   8908  C C     . ILE B 1 512 ? -38.887 64.419  31.809  1.00 26.78  ? 512  ILE B C     1 
ATOM   8909  O O     . ILE B 1 512 ? -37.692 64.106  31.877  1.00 27.32  ? 512  ILE B O     1 
ATOM   8910  C CB    . ILE B 1 512 ? -38.849 66.664  30.585  1.00 26.66  ? 512  ILE B CB    1 
ATOM   8911  C CG1   . ILE B 1 512 ? -39.627 67.983  30.447  1.00 27.51  ? 512  ILE B CG1   1 
ATOM   8912  C CG2   . ILE B 1 512 ? -39.065 65.832  29.298  1.00 26.94  ? 512  ILE B CG2   1 
ATOM   8913  C CD1   . ILE B 1 512 ? -39.070 69.133  31.252  1.00 29.60  ? 512  ILE B CD1   1 
ATOM   8914  N N     . THR B 1 513 ? -39.871 63.529  31.724  1.00 27.53  ? 513  THR B N     1 
ATOM   8915  C CA    . THR B 1 513 ? -39.612 62.099  31.798  1.00 28.09  ? 513  THR B CA    1 
ATOM   8916  C C     . THR B 1 513 ? -39.469 61.423  30.432  1.00 27.94  ? 513  THR B C     1 
ATOM   8917  O O     . THR B 1 513 ? -38.877 60.353  30.334  1.00 29.30  ? 513  THR B O     1 
ATOM   8918  C CB    . THR B 1 513 ? -40.661 61.390  32.670  1.00 28.39  ? 513  THR B CB    1 
ATOM   8919  O OG1   . THR B 1 513 ? -41.972 61.742  32.216  1.00 28.83  ? 513  THR B OG1   1 
ATOM   8920  C CG2   . THR B 1 513 ? -40.503 61.827  34.141  1.00 28.93  ? 513  THR B CG2   1 
ATOM   8921  N N     . GLY B 1 514 ? -39.979 62.048  29.378  1.00 27.72  ? 514  GLY B N     1 
ATOM   8922  C CA    . GLY B 1 514 ? -39.794 61.527  28.015  1.00 26.86  ? 514  GLY B CA    1 
ATOM   8923  C C     . GLY B 1 514 ? -41.074 61.459  27.202  1.00 26.21  ? 514  GLY B C     1 
ATOM   8924  O O     . GLY B 1 514 ? -42.128 61.861  27.672  1.00 25.85  ? 514  GLY B O     1 
ATOM   8925  N N     . ARG B 1 515 ? -40.976 60.944  25.978  1.00 25.55  ? 515  ARG B N     1 
ATOM   8926  C CA    . ARG B 1 515 ? -42.129 60.857  25.079  1.00 25.01  ? 515  ARG B CA    1 
ATOM   8927  C C     . ARG B 1 515 ? -43.198 59.932  25.649  1.00 25.08  ? 515  ARG B C     1 
ATOM   8928  O O     . ARG B 1 515 ? -42.878 58.868  26.198  1.00 24.99  ? 515  ARG B O     1 
ATOM   8929  C CB    . ARG B 1 515 ? -41.725 60.383  23.662  1.00 24.29  ? 515  ARG B CB    1 
ATOM   8930  C CG    . ARG B 1 515 ? -40.587 61.168  22.985  1.00 23.90  ? 515  ARG B CG    1 
ATOM   8931  C CD    . ARG B 1 515 ? -40.943 62.633  22.619  1.00 23.54  ? 515  ARG B CD    1 
ATOM   8932  N NE    . ARG B 1 515 ? -42.051 62.726  21.665  1.00 23.93  ? 515  ARG B NE    1 
ATOM   8933  C CZ    . ARG B 1 515 ? -42.256 63.744  20.830  1.00 24.89  ? 515  ARG B CZ    1 
ATOM   8934  N NH1   . ARG B 1 515 ? -41.428 64.792  20.801  1.00 23.79  ? 515  ARG B NH1   1 
ATOM   8935  N NH2   . ARG B 1 515 ? -43.297 63.707  20.007  1.00 23.90  ? 515  ARG B NH2   1 
ATOM   8936  N N     . VAL B 1 516 ? -44.461 60.351  25.524  1.00 25.07  ? 516  VAL B N     1 
ATOM   8937  C CA    . VAL B 1 516 ? -45.614 59.487  25.847  1.00 25.05  ? 516  VAL B CA    1 
ATOM   8938  C C     . VAL B 1 516 ? -46.311 58.970  24.578  1.00 25.19  ? 516  VAL B C     1 
ATOM   8939  O O     . VAL B 1 516 ? -47.203 58.146  24.662  1.00 24.92  ? 516  VAL B O     1 
ATOM   8940  C CB    . VAL B 1 516 ? -46.649 60.190  26.771  1.00 25.20  ? 516  VAL B CB    1 
ATOM   8941  C CG1   . VAL B 1 516 ? -46.014 60.581  28.094  1.00 24.49  ? 516  VAL B CG1   1 
ATOM   8942  C CG2   . VAL B 1 516 ? -47.264 61.413  26.082  1.00 25.19  ? 516  VAL B CG2   1 
ATOM   8943  N N     . ASP B 1 517 ? -45.908 59.487  23.417  1.00 25.74  ? 517  ASP B N     1 
ATOM   8944  C CA    . ASP B 1 517 ? -46.360 58.986  22.117  1.00 26.35  ? 517  ASP B CA    1 
ATOM   8945  C C     . ASP B 1 517 ? -45.343 57.945  21.627  1.00 26.69  ? 517  ASP B C     1 
ATOM   8946  O O     . ASP B 1 517 ? -44.506 57.485  22.406  1.00 27.48  ? 517  ASP B O     1 
ATOM   8947  C CB    . ASP B 1 517 ? -46.539 60.142  21.111  1.00 26.28  ? 517  ASP B CB    1 
ATOM   8948  C CG    . ASP B 1 517 ? -45.257 60.973  20.914  1.00 27.27  ? 517  ASP B CG    1 
ATOM   8949  O OD1   . ASP B 1 517 ? -45.315 62.032  20.245  1.00 25.66  ? 517  ASP B OD1   1 
ATOM   8950  O OD2   . ASP B 1 517 ? -44.193 60.574  21.433  1.00 28.65  ? 517  ASP B OD2   1 
ATOM   8951  N N     . ASP B 1 518 ? -45.405 57.564  20.356  1.00 26.34  ? 518  ASP B N     1 
ATOM   8952  C CA    . ASP B 1 518 ? -44.569 56.470  19.871  1.00 26.12  ? 518  ASP B CA    1 
ATOM   8953  C C     . ASP B 1 518 ? -43.232 56.940  19.289  1.00 25.37  ? 518  ASP B C     1 
ATOM   8954  O O     . ASP B 1 518 ? -42.717 56.350  18.351  1.00 25.75  ? 518  ASP B O     1 
ATOM   8955  C CB    . ASP B 1 518 ? -45.349 55.620  18.854  1.00 26.30  ? 518  ASP B CB    1 
ATOM   8956  C CG    . ASP B 1 518 ? -46.497 54.860  19.494  1.00 28.20  ? 518  ASP B CG    1 
ATOM   8957  O OD1   . ASP B 1 518 ? -46.274 54.251  20.566  1.00 29.85  ? 518  ASP B OD1   1 
ATOM   8958  O OD2   . ASP B 1 518 ? -47.619 54.873  18.930  1.00 29.62  ? 518  ASP B OD2   1 
ATOM   8959  N N     . VAL B 1 519 ? -42.674 58.003  19.854  1.00 24.78  ? 519  VAL B N     1 
ATOM   8960  C CA    . VAL B 1 519 ? -41.410 58.559  19.372  1.00 23.92  ? 519  VAL B CA    1 
ATOM   8961  C C     . VAL B 1 519 ? -40.268 58.061  20.250  1.00 23.75  ? 519  VAL B C     1 
ATOM   8962  O O     . VAL B 1 519 ? -40.404 57.980  21.481  1.00 23.52  ? 519  VAL B O     1 
ATOM   8963  C CB    . VAL B 1 519 ? -41.457 60.104  19.330  1.00 23.88  ? 519  VAL B CB    1 
ATOM   8964  C CG1   . VAL B 1 519 ? -40.108 60.688  18.941  1.00 23.19  ? 519  VAL B CG1   1 
ATOM   8965  C CG2   . VAL B 1 519 ? -42.534 60.572  18.345  1.00 23.11  ? 519  VAL B CG2   1 
ATOM   8966  N N     . LEU B 1 520 ? -39.159 57.707  19.606  1.00 23.26  ? 520  LEU B N     1 
ATOM   8967  C CA    . LEU B 1 520 ? -37.998 57.164  20.291  1.00 23.56  ? 520  LEU B CA    1 
ATOM   8968  C C     . LEU B 1 520 ? -36.912 58.215  20.437  1.00 23.37  ? 520  LEU B C     1 
ATOM   8969  O O     . LEU B 1 520 ? -36.890 59.194  19.697  1.00 22.98  ? 520  LEU B O     1 
ATOM   8970  C CB    . LEU B 1 520 ? -37.433 55.962  19.529  1.00 23.52  ? 520  LEU B CB    1 
ATOM   8971  C CG    . LEU B 1 520 ? -38.393 54.865  19.035  1.00 25.79  ? 520  LEU B CG    1 
ATOM   8972  C CD1   . LEU B 1 520 ? -37.611 53.870  18.176  1.00 26.63  ? 520  LEU B CD1   1 
ATOM   8973  C CD2   . LEU B 1 520 ? -39.103 54.160  20.185  1.00 25.74  ? 520  LEU B CD2   1 
ATOM   8974  N N     . ASN B 1 521 ? -36.018 57.999  21.398  1.00 23.29  ? 521  ASN B N     1 
ATOM   8975  C CA    . ASN B 1 521 ? -34.822 58.813  21.543  1.00 23.80  ? 521  ASN B CA    1 
ATOM   8976  C C     . ASN B 1 521 ? -33.600 57.927  21.695  1.00 23.23  ? 521  ASN B C     1 
ATOM   8977  O O     . ASN B 1 521 ? -33.374 57.334  22.759  1.00 22.85  ? 521  ASN B O     1 
ATOM   8978  C CB    . ASN B 1 521 ? -34.912 59.771  22.730  1.00 24.64  ? 521  ASN B CB    1 
ATOM   8979  C CG    . ASN B 1 521 ? -33.560 60.430  23.043  1.00 26.96  ? 521  ASN B CG    1 
ATOM   8980  O OD1   . ASN B 1 521 ? -32.951 61.055  22.184  1.00 27.33  ? 521  ASN B OD1   1 
ATOM   8981  N ND2   . ASN B 1 521 ? -33.073 60.241  24.266  1.00 31.15  ? 521  ASN B ND2   1 
ATOM   8982  N N     . VAL B 1 522 ? -32.821 57.846  20.623  1.00 22.75  ? 522  VAL B N     1 
ATOM   8983  C CA    . VAL B 1 522 ? -31.716 56.906  20.525  1.00 23.10  ? 522  VAL B CA    1 
ATOM   8984  C C     . VAL B 1 522 ? -30.424 57.686  20.272  1.00 23.78  ? 522  VAL B C     1 
ATOM   8985  O O     . VAL B 1 522 ? -30.267 58.331  19.223  1.00 23.59  ? 522  VAL B O     1 
ATOM   8986  C CB    . VAL B 1 522 ? -31.987 55.862  19.406  1.00 23.42  ? 522  VAL B CB    1 
ATOM   8987  C CG1   . VAL B 1 522 ? -30.845 54.835  19.302  1.00 22.24  ? 522  VAL B CG1   1 
ATOM   8988  C CG2   . VAL B 1 522 ? -33.355 55.157  19.625  1.00 23.20  ? 522  VAL B CG2   1 
ATOM   8989  N N     . SER B 1 523 ? -29.512 57.640  21.249  1.00 24.16  ? 523  SER B N     1 
ATOM   8990  C CA    . SER B 1 523 ? -28.274 58.430  21.224  1.00 24.70  ? 523  SER B CA    1 
ATOM   8991  C C     . SER B 1 523 ? -28.564 59.889  20.896  1.00 24.75  ? 523  SER B C     1 
ATOM   8992  O O     . SER B 1 523 ? -27.902 60.481  20.042  1.00 25.38  ? 523  SER B O     1 
ATOM   8993  C CB    . SER B 1 523 ? -27.270 57.861  20.208  1.00 24.67  ? 523  SER B CB    1 
ATOM   8994  O OG    . SER B 1 523 ? -26.942 56.525  20.506  1.00 26.13  ? 523  SER B OG    1 
ATOM   8995  N N     . GLY B 1 524 ? -29.576 60.448  21.552  1.00 24.78  ? 524  GLY B N     1 
ATOM   8996  C CA    . GLY B 1 524 ? -30.018 61.816  21.299  1.00 24.60  ? 524  GLY B CA    1 
ATOM   8997  C C     . GLY B 1 524 ? -30.596 62.082  19.913  1.00 24.45  ? 524  GLY B C     1 
ATOM   8998  O O     . GLY B 1 524 ? -30.606 63.228  19.463  1.00 25.13  ? 524  GLY B O     1 
ATOM   8999  N N     . HIS B 1 525 ? -31.062 61.042  19.224  1.00 23.50  ? 525  HIS B N     1 
ATOM   9000  C CA    . HIS B 1 525 ? -31.742 61.239  17.948  1.00 23.00  ? 525  HIS B CA    1 
ATOM   9001  C C     . HIS B 1 525 ? -33.211 60.872  18.084  1.00 22.19  ? 525  HIS B C     1 
ATOM   9002  O O     . HIS B 1 525 ? -33.551 59.778  18.568  1.00 21.38  ? 525  HIS B O     1 
ATOM   9003  C CB    . HIS B 1 525 ? -31.081 60.456  16.797  1.00 23.21  ? 525  HIS B CB    1 
ATOM   9004  C CG    . HIS B 1 525 ? -29.672 60.885  16.510  1.00 25.67  ? 525  HIS B CG    1 
ATOM   9005  N ND1   . HIS B 1 525 ? -28.616 59.999  16.469  1.00 27.47  ? 525  HIS B ND1   1 
ATOM   9006  C CD2   . HIS B 1 525 ? -29.141 62.114  16.285  1.00 27.44  ? 525  HIS B CD2   1 
ATOM   9007  C CE1   . HIS B 1 525 ? -27.498 60.660  16.214  1.00 28.11  ? 525  HIS B CE1   1 
ATOM   9008  N NE2   . HIS B 1 525 ? -27.789 61.945  16.100  1.00 28.37  ? 525  HIS B NE2   1 
ATOM   9009  N N     . ARG B 1 526 ? -34.060 61.814  17.674  1.00 20.78  ? 526  ARG B N     1 
ATOM   9010  C CA    . ARG B 1 526 ? -35.498 61.644  17.642  1.00 19.60  ? 526  ARG B CA    1 
ATOM   9011  C C     . ARG B 1 526 ? -35.897 60.864  16.384  1.00 20.27  ? 526  ARG B C     1 
ATOM   9012  O O     . ARG B 1 526 ? -35.709 61.326  15.257  1.00 19.79  ? 526  ARG B O     1 
ATOM   9013  C CB    . ARG B 1 526 ? -36.175 63.015  17.688  1.00 19.66  ? 526  ARG B CB    1 
ATOM   9014  C CG    . ARG B 1 526 ? -37.683 63.017  17.568  1.00 17.69  ? 526  ARG B CG    1 
ATOM   9015  C CD    . ARG B 1 526 ? -38.220 64.452  17.680  1.00 17.67  ? 526  ARG B CD    1 
ATOM   9016  N NE    . ARG B 1 526 ? -39.574 64.550  17.152  1.00 13.23  ? 526  ARG B NE    1 
ATOM   9017  C CZ    . ARG B 1 526 ? -40.370 65.614  17.244  1.00 12.81  ? 526  ARG B CZ    1 
ATOM   9018  N NH1   . ARG B 1 526 ? -39.958 66.727  17.862  1.00 9.45   ? 526  ARG B NH1   1 
ATOM   9019  N NH2   . ARG B 1 526 ? -41.596 65.555  16.702  1.00 9.01   ? 526  ARG B NH2   1 
ATOM   9020  N N     . LEU B 1 527 ? -36.461 59.681  16.606  1.00 20.63  ? 527  LEU B N     1 
ATOM   9021  C CA    . LEU B 1 527 ? -36.831 58.752  15.541  1.00 21.45  ? 527  LEU B CA    1 
ATOM   9022  C C     . LEU B 1 527 ? -38.258 58.271  15.745  1.00 21.97  ? 527  LEU B C     1 
ATOM   9023  O O     . LEU B 1 527 ? -38.715 58.130  16.890  1.00 21.99  ? 527  LEU B O     1 
ATOM   9024  C CB    . LEU B 1 527 ? -35.902 57.536  15.557  1.00 21.01  ? 527  LEU B CB    1 
ATOM   9025  C CG    . LEU B 1 527 ? -34.442 57.707  15.132  1.00 22.90  ? 527  LEU B CG    1 
ATOM   9026  C CD1   . LEU B 1 527 ? -33.640 56.440  15.453  1.00 22.31  ? 527  LEU B CD1   1 
ATOM   9027  C CD2   . LEU B 1 527 ? -34.367 58.020  13.646  1.00 23.86  ? 527  LEU B CD2   1 
ATOM   9028  N N     . GLY B 1 528 ? -38.948 58.006  14.641  1.00 22.27  ? 528  GLY B N     1 
ATOM   9029  C CA    . GLY B 1 528 ? -40.314 57.497  14.679  1.00 23.62  ? 528  GLY B CA    1 
ATOM   9030  C C     . GLY B 1 528 ? -40.329 55.996  14.459  1.00 24.69  ? 528  GLY B C     1 
ATOM   9031  O O     . GLY B 1 528 ? -39.556 55.470  13.663  1.00 24.08  ? 528  GLY B O     1 
ATOM   9032  N N     . THR B 1 529 ? -41.200 55.291  15.177  1.00 25.98  ? 529  THR B N     1 
ATOM   9033  C CA    . THR B 1 529 ? -41.285 53.834  15.008  1.00 27.11  ? 529  THR B CA    1 
ATOM   9034  C C     . THR B 1 529 ? -41.834 53.488  13.625  1.00 27.17  ? 529  THR B C     1 
ATOM   9035  O O     . THR B 1 529 ? -41.458 52.475  13.055  1.00 27.00  ? 529  THR B O     1 
ATOM   9036  C CB    . THR B 1 529 ? -42.123 53.134  16.107  1.00 27.24  ? 529  THR B CB    1 
ATOM   9037  O OG1   . THR B 1 529 ? -43.514 53.400  15.904  1.00 28.46  ? 529  THR B OG1   1 
ATOM   9038  C CG2   . THR B 1 529 ? -41.703 53.590  17.500  1.00 26.84  ? 529  THR B CG2   1 
ATOM   9039  N N     . ALA B 1 530 ? -42.683 54.356  13.073  1.00 27.59  ? 530  ALA B N     1 
ATOM   9040  C CA    . ALA B 1 530 ? -43.312 54.086  11.766  1.00 27.92  ? 530  ALA B CA    1 
ATOM   9041  C C     . ALA B 1 530 ? -42.343 54.067  10.589  1.00 28.04  ? 530  ALA B C     1 
ATOM   9042  O O     . ALA B 1 530 ? -42.477 53.222  9.689   1.00 28.30  ? 530  ALA B O     1 
ATOM   9043  C CB    . ALA B 1 530 ? -44.472 55.055  11.493  1.00 28.21  ? 530  ALA B CB    1 
ATOM   9044  N N     . GLU B 1 531 ? -41.389 55.000  10.571  1.00 26.99  ? 531  GLU B N     1 
ATOM   9045  C CA    . GLU B 1 531 ? -40.373 55.001  9.523   1.00 26.85  ? 531  GLU B CA    1 
ATOM   9046  C C     . GLU B 1 531 ? -39.457 53.775  9.582   1.00 25.59  ? 531  GLU B C     1 
ATOM   9047  O O     . GLU B 1 531 ? -39.018 53.278  8.544   1.00 26.07  ? 531  GLU B O     1 
ATOM   9048  C CB    . GLU B 1 531 ? -39.537 56.285  9.541   1.00 27.65  ? 531  GLU B CB    1 
ATOM   9049  C CG    . GLU B 1 531 ? -39.764 57.183  10.758  1.00 30.43  ? 531  GLU B CG    1 
ATOM   9050  C CD    . GLU B 1 531 ? -38.537 57.973  11.123  1.00 34.46  ? 531  GLU B CD    1 
ATOM   9051  O OE1   . GLU B 1 531 ? -37.527 57.908  10.388  1.00 38.83  ? 531  GLU B OE1   1 
ATOM   9052  O OE2   . GLU B 1 531 ? -38.568 58.658  12.155  1.00 35.42  ? 531  GLU B OE2   1 
ATOM   9053  N N     . ILE B 1 532 ? -39.164 53.295  10.786  1.00 23.91  ? 532  ILE B N     1 
ATOM   9054  C CA    . ILE B 1 532 ? -38.293 52.129  10.949  1.00 22.73  ? 532  ILE B CA    1 
ATOM   9055  C C     . ILE B 1 532 ? -39.050 50.879  10.511  1.00 22.19  ? 532  ILE B C     1 
ATOM   9056  O O     . ILE B 1 532 ? -38.519 50.055  9.759   1.00 21.99  ? 532  ILE B O     1 
ATOM   9057  C CB    . ILE B 1 532 ? -37.762 51.999  12.391  1.00 22.65  ? 532  ILE B CB    1 
ATOM   9058  C CG1   . ILE B 1 532 ? -36.999 53.275  12.777  1.00 22.43  ? 532  ILE B CG1   1 
ATOM   9059  C CG2   . ILE B 1 532 ? -36.864 50.752  12.530  1.00 21.38  ? 532  ILE B CG2   1 
ATOM   9060  C CD1   . ILE B 1 532 ? -36.429 53.256  14.154  1.00 21.90  ? 532  ILE B CD1   1 
ATOM   9061  N N     . GLU B 1 533 ? -40.308 50.776  10.944  1.00 21.79  ? 533  GLU B N     1 
ATOM   9062  C CA    . GLU B 1 533 ? -41.230 49.747  10.458  1.00 21.92  ? 533  GLU B CA    1 
ATOM   9063  C C     . GLU B 1 533 ? -41.368 49.704  8.929   1.00 21.74  ? 533  GLU B C     1 
ATOM   9064  O O     . GLU B 1 533 ? -41.325 48.615  8.333   1.00 21.51  ? 533  GLU B O     1 
ATOM   9065  C CB    . GLU B 1 533 ? -42.595 49.894  11.136  1.00 21.61  ? 533  GLU B CB    1 
ATOM   9066  C CG    . GLU B 1 533 ? -42.570 49.436  12.595  1.00 22.43  ? 533  GLU B CG    1 
ATOM   9067  C CD    . GLU B 1 533 ? -43.805 49.834  13.398  1.00 23.23  ? 533  GLU B CD    1 
ATOM   9068  O OE1   . GLU B 1 533 ? -44.794 50.334  12.818  1.00 26.04  ? 533  GLU B OE1   1 
ATOM   9069  O OE2   . GLU B 1 533 ? -43.785 49.636  14.628  1.00 24.15  ? 533  GLU B OE2   1 
ATOM   9070  N N     . SER B 1 534 ? -41.536 50.878  8.305   1.00 21.34  ? 534  SER B N     1 
ATOM   9071  C CA    . SER B 1 534 ? -41.639 51.001  6.836   1.00 21.27  ? 534  SER B CA    1 
ATOM   9072  C C     . SER B 1 534 ? -40.406 50.474  6.133   1.00 20.48  ? 534  SER B C     1 
ATOM   9073  O O     . SER B 1 534 ? -40.512 49.707  5.178   1.00 20.35  ? 534  SER B O     1 
ATOM   9074  C CB    . SER B 1 534 ? -41.814 52.466  6.408   1.00 21.31  ? 534  SER B CB    1 
ATOM   9075  O OG    . SER B 1 534 ? -43.137 52.897  6.620   1.00 24.61  ? 534  SER B OG    1 
ATOM   9076  N N     . ALA B 1 535 ? -39.238 50.938  6.579   1.00 20.17  ? 535  ALA B N     1 
ATOM   9077  C CA    . ALA B 1 535 ? -37.950 50.423  6.109   1.00 20.02  ? 535  ALA B CA    1 
ATOM   9078  C C     . ALA B 1 535 ? -37.922 48.894  6.173   1.00 20.03  ? 535  ALA B C     1 
ATOM   9079  O O     . ALA B 1 535 ? -37.589 48.239  5.189   1.00 20.49  ? 535  ALA B O     1 
ATOM   9080  C CB    . ALA B 1 535 ? -36.799 51.004  6.941   1.00 20.09  ? 535  ALA B CB    1 
ATOM   9081  N N     . LEU B 1 536 ? -38.287 48.339  7.330   1.00 19.84  ? 536  LEU B N     1 
ATOM   9082  C CA    . LEU B 1 536 ? -38.222 46.893  7.544   1.00 19.78  ? 536  LEU B CA    1 
ATOM   9083  C C     . LEU B 1 536 ? -39.143 46.145  6.585   1.00 20.11  ? 536  LEU B C     1 
ATOM   9084  O O     . LEU B 1 536 ? -38.713 45.206  5.913   1.00 19.71  ? 536  LEU B O     1 
ATOM   9085  C CB    . LEU B 1 536 ? -38.527 46.546  9.000   1.00 19.16  ? 536  LEU B CB    1 
ATOM   9086  C CG    . LEU B 1 536 ? -37.407 46.866  9.993   1.00 18.66  ? 536  LEU B CG    1 
ATOM   9087  C CD1   . LEU B 1 536 ? -37.958 46.923  11.412  1.00 16.90  ? 536  LEU B CD1   1 
ATOM   9088  C CD2   . LEU B 1 536 ? -36.277 45.832  9.892   1.00 18.28  ? 536  LEU B CD2   1 
ATOM   9089  N N     . VAL B 1 537 ? -40.393 46.592  6.484   1.00 20.78  ? 537  VAL B N     1 
ATOM   9090  C CA    . VAL B 1 537 ? -41.363 45.939  5.593   1.00 21.46  ? 537  VAL B CA    1 
ATOM   9091  C C     . VAL B 1 537 ? -40.999 46.084  4.103   1.00 21.74  ? 537  VAL B C     1 
ATOM   9092  O O     . VAL B 1 537 ? -41.449 45.293  3.275   1.00 22.06  ? 537  VAL B O     1 
ATOM   9093  C CB    . VAL B 1 537 ? -42.819 46.377  5.889   1.00 21.77  ? 537  VAL B CB    1 
ATOM   9094  C CG1   . VAL B 1 537 ? -43.791 45.841  4.820   1.00 23.18  ? 537  VAL B CG1   1 
ATOM   9095  C CG2   . VAL B 1 537 ? -43.237 45.898  7.282   1.00 21.30  ? 537  VAL B CG2   1 
ATOM   9096  N N     . ALA B 1 538 ? -40.157 47.064  3.769   1.00 21.61  ? 538  ALA B N     1 
ATOM   9097  C CA    . ALA B 1 538 ? -39.652 47.190  2.393   1.00 21.52  ? 538  ALA B CA    1 
ATOM   9098  C C     . ALA B 1 538 ? -38.743 46.027  1.961   1.00 21.24  ? 538  ALA B C     1 
ATOM   9099  O O     . ALA B 1 538 ? -38.639 45.734  0.770   1.00 20.97  ? 538  ALA B O     1 
ATOM   9100  C CB    . ALA B 1 538 ? -38.946 48.532  2.180   1.00 21.41  ? 538  ALA B CB    1 
ATOM   9101  N N     . HIS B 1 539 ? -38.076 45.387  2.922   1.00 21.14  ? 539  HIS B N     1 
ATOM   9102  C CA    . HIS B 1 539 ? -37.180 44.260  2.637   1.00 20.92  ? 539  HIS B CA    1 
ATOM   9103  C C     . HIS B 1 539 ? -37.988 43.127  2.006   1.00 20.52  ? 539  HIS B C     1 
ATOM   9104  O O     . HIS B 1 539 ? -39.084 42.825  2.482   1.00 20.16  ? 539  HIS B O     1 
ATOM   9105  C CB    . HIS B 1 539 ? -36.511 43.770  3.928   1.00 21.06  ? 539  HIS B CB    1 
ATOM   9106  C CG    . HIS B 1 539 ? -35.383 42.815  3.695   1.00 22.04  ? 539  HIS B CG    1 
ATOM   9107  N ND1   . HIS B 1 539 ? -35.581 41.469  3.469   1.00 23.79  ? 539  HIS B ND1   1 
ATOM   9108  C CD2   . HIS B 1 539 ? -34.047 43.014  3.632   1.00 22.43  ? 539  HIS B CD2   1 
ATOM   9109  C CE1   . HIS B 1 539 ? -34.414 40.879  3.279   1.00 23.03  ? 539  HIS B CE1   1 
ATOM   9110  N NE2   . HIS B 1 539 ? -33.466 41.794  3.382   1.00 23.29  ? 539  HIS B NE2   1 
ATOM   9111  N N     . PRO B 1 540 ? -37.467 42.504  0.929   1.00 20.66  ? 540  PRO B N     1 
ATOM   9112  C CA    . PRO B 1 540 ? -38.281 41.509  0.200   1.00 20.45  ? 540  PRO B CA    1 
ATOM   9113  C C     . PRO B 1 540 ? -38.677 40.271  1.019   1.00 20.40  ? 540  PRO B C     1 
ATOM   9114  O O     . PRO B 1 540 ? -39.613 39.575  0.641   1.00 20.55  ? 540  PRO B O     1 
ATOM   9115  C CB    . PRO B 1 540 ? -37.389 41.107  -0.986  1.00 20.59  ? 540  PRO B CB    1 
ATOM   9116  C CG    . PRO B 1 540 ? -36.337 42.173  -1.088  1.00 20.61  ? 540  PRO B CG    1 
ATOM   9117  C CD    . PRO B 1 540 ? -36.134 42.674  0.317   1.00 20.79  ? 540  PRO B CD    1 
ATOM   9118  N N     . LYS B 1 541 ? -37.977 40.003  2.119   1.00 20.07  ? 541  LYS B N     1 
ATOM   9119  C CA    . LYS B 1 541 ? -38.235 38.807  2.929   1.00 19.92  ? 541  LYS B CA    1 
ATOM   9120  C C     . LYS B 1 541 ? -39.097 39.095  4.155   1.00 19.69  ? 541  LYS B C     1 
ATOM   9121  O O     . LYS B 1 541 ? -39.503 38.166  4.864   1.00 19.69  ? 541  LYS B O     1 
ATOM   9122  C CB    . LYS B 1 541 ? -36.923 38.151  3.378   1.00 20.11  ? 541  LYS B CB    1 
ATOM   9123  C CG    . LYS B 1 541 ? -36.118 37.449  2.276   1.00 20.71  ? 541  LYS B CG    1 
ATOM   9124  C CD    . LYS B 1 541 ? -34.966 36.683  2.921   1.00 22.84  ? 541  LYS B CD    1 
ATOM   9125  C CE    . LYS B 1 541 ? -34.411 35.565  2.032   1.00 26.21  ? 541  LYS B CE    1 
ATOM   9126  N NZ    . LYS B 1 541 ? -34.146 36.019  0.640   1.00 26.93  ? 541  LYS B NZ    1 
ATOM   9127  N N     . ILE B 1 542 ? -39.389 40.373  4.396   1.00 19.02  ? 542  ILE B N     1 
ATOM   9128  C CA    . ILE B 1 542 ? -40.158 40.769  5.573   1.00 18.79  ? 542  ILE B CA    1 
ATOM   9129  C C     . ILE B 1 542 ? -41.636 41.034  5.241   1.00 19.17  ? 542  ILE B C     1 
ATOM   9130  O O     . ILE B 1 542 ? -41.942 41.816  4.342   1.00 19.64  ? 542  ILE B O     1 
ATOM   9131  C CB    . ILE B 1 542 ? -39.481 41.979  6.291   1.00 18.83  ? 542  ILE B CB    1 
ATOM   9132  C CG1   . ILE B 1 542 ? -38.113 41.556  6.870   1.00 18.54  ? 542  ILE B CG1   1 
ATOM   9133  C CG2   . ILE B 1 542 ? -40.373 42.547  7.377   1.00 18.79  ? 542  ILE B CG2   1 
ATOM   9134  C CD1   . ILE B 1 542 ? -37.287 42.698  7.440   1.00 17.95  ? 542  ILE B CD1   1 
ATOM   9135  N N     . ALA B 1 543 ? -42.537 40.372  5.969   1.00 18.90  ? 543  ALA B N     1 
ATOM   9136  C CA    . ALA B 1 543 ? -43.991 40.563  5.824   1.00 19.82  ? 543  ALA B CA    1 
ATOM   9137  C C     . ALA B 1 543 ? -44.515 41.677  6.730   1.00 20.24  ? 543  ALA B C     1 
ATOM   9138  O O     . ALA B 1 543 ? -45.332 42.505  6.313   1.00 20.83  ? 543  ALA B O     1 
ATOM   9139  C CB    . ALA B 1 543 ? -44.730 39.269  6.146   1.00 19.26  ? 543  ALA B CB    1 
ATOM   9140  N N     . GLU B 1 544 ? -44.052 41.674  7.977   1.00 20.33  ? 544  GLU B N     1 
ATOM   9141  C CA    . GLU B 1 544 ? -44.569 42.574  8.991   1.00 20.88  ? 544  GLU B CA    1 
ATOM   9142  C C     . GLU B 1 544 ? -43.502 42.896  10.026  1.00 20.47  ? 544  GLU B C     1 
ATOM   9143  O O     . GLU B 1 544 ? -42.596 42.100  10.246  1.00 19.95  ? 544  GLU B O     1 
ATOM   9144  C CB    . GLU B 1 544 ? -45.799 41.942  9.656   1.00 21.26  ? 544  GLU B CB    1 
ATOM   9145  C CG    . GLU B 1 544 ? -46.760 42.968  10.192  1.00 25.33  ? 544  GLU B CG    1 
ATOM   9146  C CD    . GLU B 1 544 ? -48.209 42.503  10.218  1.00 29.94  ? 544  GLU B CD    1 
ATOM   9147  O OE1   . GLU B 1 544 ? -48.474 41.279  10.063  1.00 27.89  ? 544  GLU B OE1   1 
ATOM   9148  O OE2   . GLU B 1 544 ? -49.078 43.400  10.402  1.00 31.76  ? 544  GLU B OE2   1 
ATOM   9149  N N     . ALA B 1 545 ? -43.603 44.077  10.642  1.00 20.43  ? 545  ALA B N     1 
ATOM   9150  C CA    . ALA B 1 545 ? -42.646 44.506  11.665  1.00 20.06  ? 545  ALA B CA    1 
ATOM   9151  C C     . ALA B 1 545 ? -43.277 45.456  12.669  1.00 19.85  ? 545  ALA B C     1 
ATOM   9152  O O     . ALA B 1 545 ? -44.128 46.270  12.323  1.00 20.08  ? 545  ALA B O     1 
ATOM   9153  C CB    . ALA B 1 545 ? -41.419 45.167  11.026  1.00 19.56  ? 545  ALA B CB    1 
ATOM   9154  N N     . ALA B 1 546 ? -42.844 45.350  13.916  1.00 19.65  ? 546  ALA B N     1 
ATOM   9155  C CA    . ALA B 1 546 ? -43.255 46.295  14.942  1.00 19.52  ? 546  ALA B CA    1 
ATOM   9156  C C     . ALA B 1 546 ? -42.039 46.700  15.761  1.00 19.19  ? 546  ALA B C     1 
ATOM   9157  O O     . ALA B 1 546 ? -41.267 45.849  16.238  1.00 19.09  ? 546  ALA B O     1 
ATOM   9158  C CB    . ALA B 1 546 ? -44.343 45.705  15.819  1.00 18.94  ? 546  ALA B CB    1 
ATOM   9159  N N     . VAL B 1 547 ? -41.878 48.010  15.915  1.00 18.84  ? 547  VAL B N     1 
ATOM   9160  C CA    . VAL B 1 547 ? -40.674 48.566  16.508  1.00 18.62  ? 547  VAL B CA    1 
ATOM   9161  C C     . VAL B 1 547 ? -41.011 49.242  17.819  1.00 19.05  ? 547  VAL B C     1 
ATOM   9162  O O     . VAL B 1 547 ? -42.010 49.975  17.899  1.00 19.04  ? 547  VAL B O     1 
ATOM   9163  C CB    . VAL B 1 547 ? -39.988 49.546  15.533  1.00 18.40  ? 547  VAL B CB    1 
ATOM   9164  C CG1   . VAL B 1 547 ? -38.925 50.394  16.244  1.00 18.58  ? 547  VAL B CG1   1 
ATOM   9165  C CG2   . VAL B 1 547 ? -39.375 48.754  14.369  1.00 18.08  ? 547  VAL B CG2   1 
ATOM   9166  N N     . VAL B 1 548 ? -40.216 48.953  18.851  1.00 19.02  ? 548  VAL B N     1 
ATOM   9167  C CA    . VAL B 1 548 ? -40.347 49.636  20.146  1.00 19.79  ? 548  VAL B CA    1 
ATOM   9168  C C     . VAL B 1 548 ? -38.986 50.049  20.668  1.00 20.31  ? 548  VAL B C     1 
ATOM   9169  O O     . VAL B 1 548 ? -37.957 49.544  20.212  1.00 20.11  ? 548  VAL B O     1 
ATOM   9170  C CB    . VAL B 1 548 ? -41.075 48.777  21.234  1.00 19.77  ? 548  VAL B CB    1 
ATOM   9171  C CG1   . VAL B 1 548 ? -42.473 48.350  20.759  1.00 19.44  ? 548  VAL B CG1   1 
ATOM   9172  C CG2   . VAL B 1 548 ? -40.221 47.552  21.651  1.00 19.71  ? 548  VAL B CG2   1 
ATOM   9173  N N     . GLY B 1 549 ? -38.986 50.977  21.622  1.00 20.91  ? 549  GLY B N     1 
ATOM   9174  C CA    . GLY B 1 549 ? -37.767 51.341  22.321  1.00 20.93  ? 549  GLY B CA    1 
ATOM   9175  C C     . GLY B 1 549 ? -37.612 50.546  23.608  1.00 21.43  ? 549  GLY B C     1 
ATOM   9176  O O     . GLY B 1 549 ? -38.614 50.155  24.243  1.00 21.53  ? 549  GLY B O     1 
ATOM   9177  N N     . ILE B 1 550 ? -36.361 50.288  23.985  1.00 20.84  ? 550  ILE B N     1 
ATOM   9178  C CA    . ILE B 1 550 ? -36.059 49.710  25.304  1.00 21.18  ? 550  ILE B CA    1 
ATOM   9179  C C     . ILE B 1 550 ? -34.996 50.534  26.022  1.00 20.93  ? 550  ILE B C     1 
ATOM   9180  O O     . ILE B 1 550 ? -34.194 51.200  25.363  1.00 20.17  ? 550  ILE B O     1 
ATOM   9181  C CB    . ILE B 1 550 ? -35.614 48.219  25.232  1.00 21.34  ? 550  ILE B CB    1 
ATOM   9182  C CG1   . ILE B 1 550 ? -34.376 48.054  24.333  1.00 20.64  ? 550  ILE B CG1   1 
ATOM   9183  C CG2   . ILE B 1 550 ? -36.789 47.340  24.810  1.00 22.07  ? 550  ILE B CG2   1 
ATOM   9184  C CD1   . ILE B 1 550 ? -33.688 46.684  24.464  1.00 20.91  ? 550  ILE B CD1   1 
ATOM   9185  N N     . PRO B 1 551 ? -35.016 50.531  27.372  1.00 21.27  ? 551  PRO B N     1 
ATOM   9186  C CA    . PRO B 1 551 ? -33.955 51.206  28.119  1.00 21.54  ? 551  PRO B CA    1 
ATOM   9187  C C     . PRO B 1 551 ? -32.576 50.708  27.711  1.00 21.79  ? 551  PRO B C     1 
ATOM   9188  O O     . PRO B 1 551 ? -32.405 49.528  27.425  1.00 22.69  ? 551  PRO B O     1 
ATOM   9189  C CB    . PRO B 1 551 ? -34.253 50.827  29.572  1.00 21.50  ? 551  PRO B CB    1 
ATOM   9190  C CG    . PRO B 1 551 ? -35.726 50.583  29.603  1.00 21.17  ? 551  PRO B CG    1 
ATOM   9191  C CD    . PRO B 1 551 ? -36.031 49.946  28.275  1.00 21.52  ? 551  PRO B CD    1 
ATOM   9192  N N     . HIS B 1 552 ? -31.615 51.619  27.659  1.00 21.93  ? 552  HIS B N     1 
ATOM   9193  C CA    . HIS B 1 552 ? -30.245 51.303  27.281  1.00 22.31  ? 552  HIS B CA    1 
ATOM   9194  C C     . HIS B 1 552 ? -29.370 52.342  27.961  1.00 22.35  ? 552  HIS B C     1 
ATOM   9195  O O     . HIS B 1 552 ? -29.582 53.539  27.775  1.00 22.17  ? 552  HIS B O     1 
ATOM   9196  C CB    . HIS B 1 552 ? -30.090 51.367  25.760  1.00 22.13  ? 552  HIS B CB    1 
ATOM   9197  C CG    . HIS B 1 552 ? -28.776 50.860  25.258  1.00 23.55  ? 552  HIS B CG    1 
ATOM   9198  N ND1   . HIS B 1 552 ? -28.602 49.572  24.788  1.00 24.06  ? 552  HIS B ND1   1 
ATOM   9199  C CD2   . HIS B 1 552 ? -27.566 51.463  25.160  1.00 23.42  ? 552  HIS B CD2   1 
ATOM   9200  C CE1   . HIS B 1 552 ? -27.342 49.409  24.418  1.00 24.96  ? 552  HIS B CE1   1 
ATOM   9201  N NE2   . HIS B 1 552 ? -26.694 50.543  24.632  1.00 24.40  ? 552  HIS B NE2   1 
ATOM   9202  N N     . ALA B 1 553 ? -28.406 51.897  28.767  1.00 22.47  ? 553  ALA B N     1 
ATOM   9203  C CA    . ALA B 1 553 ? -27.593 52.829  29.560  1.00 22.93  ? 553  ALA B CA    1 
ATOM   9204  C C     . ALA B 1 553 ? -26.731 53.771  28.705  1.00 23.16  ? 553  ALA B C     1 
ATOM   9205  O O     . ALA B 1 553 ? -26.450 54.896  29.114  1.00 23.51  ? 553  ALA B O     1 
ATOM   9206  C CB    . ALA B 1 553 ? -26.725 52.071  30.580  1.00 23.06  ? 553  ALA B CB    1 
ATOM   9207  N N     . ILE B 1 554 ? -26.320 53.309  27.527  1.00 23.30  ? 554  ILE B N     1 
ATOM   9208  C CA    . ILE B 1 554 ? -25.450 54.093  26.635  1.00 23.29  ? 554  ILE B CA    1 
ATOM   9209  C C     . ILE B 1 554 ? -26.288 54.999  25.710  1.00 22.68  ? 554  ILE B C     1 
ATOM   9210  O O     . ILE B 1 554 ? -26.090 56.209  25.653  1.00 22.63  ? 554  ILE B O     1 
ATOM   9211  C CB    . ILE B 1 554 ? -24.496 53.154  25.804  1.00 23.39  ? 554  ILE B CB    1 
ATOM   9212  C CG1   . ILE B 1 554 ? -23.498 52.422  26.721  1.00 24.06  ? 554  ILE B CG1   1 
ATOM   9213  C CG2   . ILE B 1 554 ? -23.743 53.928  24.707  1.00 23.89  ? 554  ILE B CG2   1 
ATOM   9214  C CD1   . ILE B 1 554 ? -22.825 51.191  26.064  1.00 23.81  ? 554  ILE B CD1   1 
ATOM   9215  N N     . LYS B 1 555 ? -27.242 54.403  25.010  1.00 22.15  ? 555  LYS B N     1 
ATOM   9216  C CA    . LYS B 1 555 ? -28.012 55.116  23.998  1.00 21.84  ? 555  LYS B CA    1 
ATOM   9217  C C     . LYS B 1 555 ? -29.246 55.811  24.565  1.00 21.17  ? 555  LYS B C     1 
ATOM   9218  O O     . LYS B 1 555 ? -29.871 56.620  23.869  1.00 21.26  ? 555  LYS B O     1 
ATOM   9219  C CB    . LYS B 1 555 ? -28.408 54.147  22.884  1.00 22.06  ? 555  LYS B CB    1 
ATOM   9220  C CG    . LYS B 1 555 ? -27.216 53.430  22.254  1.00 23.79  ? 555  LYS B CG    1 
ATOM   9221  C CD    . LYS B 1 555 ? -27.637 52.318  21.325  1.00 27.44  ? 555  LYS B CD    1 
ATOM   9222  C CE    . LYS B 1 555 ? -26.439 51.888  20.487  1.00 30.89  ? 555  LYS B CE    1 
ATOM   9223  N NZ    . LYS B 1 555 ? -26.839 51.533  19.103  1.00 32.44  ? 555  LYS B NZ    1 
ATOM   9224  N N     . GLY B 1 556 ? -29.590 55.504  25.821  1.00 20.14  ? 556  GLY B N     1 
ATOM   9225  C CA    . GLY B 1 556 ? -30.836 55.994  26.435  1.00 19.16  ? 556  GLY B CA    1 
ATOM   9226  C C     . GLY B 1 556 ? -31.979 55.044  26.115  1.00 18.59  ? 556  GLY B C     1 
ATOM   9227  O O     . GLY B 1 556 ? -32.574 54.437  27.013  1.00 18.28  ? 556  GLY B O     1 
ATOM   9228  N N     . GLN B 1 557 ? -32.276 54.914  24.824  1.00 17.65  ? 557  GLN B N     1 
ATOM   9229  C CA    . GLN B 1 557 ? -33.157 53.872  24.322  1.00 17.68  ? 557  GLN B CA    1 
ATOM   9230  C C     . GLN B 1 557 ? -32.455 53.145  23.197  1.00 17.83  ? 557  GLN B C     1 
ATOM   9231  O O     . GLN B 1 557 ? -31.721 53.755  22.429  1.00 17.30  ? 557  GLN B O     1 
ATOM   9232  C CB    . GLN B 1 557 ? -34.455 54.448  23.767  1.00 17.75  ? 557  GLN B CB    1 
ATOM   9233  C CG    . GLN B 1 557 ? -35.491 54.827  24.774  1.00 19.05  ? 557  GLN B CG    1 
ATOM   9234  C CD    . GLN B 1 557 ? -36.813 55.168  24.102  1.00 21.45  ? 557  GLN B CD    1 
ATOM   9235  O OE1   . GLN B 1 557 ? -36.874 56.020  23.208  1.00 20.44  ? 557  GLN B OE1   1 
ATOM   9236  N NE2   . GLN B 1 557 ? -37.878 54.506  24.537  1.00 22.23  ? 557  GLN B NE2   1 
ATOM   9237  N N     . ALA B 1 558 ? -32.683 51.839  23.112  1.00 18.42  ? 558  ALA B N     1 
ATOM   9238  C CA    . ALA B 1 558 ? -32.215 51.049  21.981  1.00 19.27  ? 558  ALA B CA    1 
ATOM   9239  C C     . ALA B 1 558 ? -33.423 50.657  21.133  1.00 19.41  ? 558  ALA B C     1 
ATOM   9240  O O     . ALA B 1 558 ? -34.560 50.691  21.617  1.00 19.90  ? 558  ALA B O     1 
ATOM   9241  C CB    . ALA B 1 558 ? -31.447 49.810  22.465  1.00 19.05  ? 558  ALA B CB    1 
ATOM   9242  N N     . ILE B 1 559 ? -33.176 50.302  19.872  1.00 19.64  ? 559  ILE B N     1 
ATOM   9243  C CA    . ILE B 1 559 ? -34.245 49.975  18.939  1.00 19.25  ? 559  ILE B CA    1 
ATOM   9244  C C     . ILE B 1 559 ? -34.479 48.464  18.930  1.00 19.34  ? 559  ILE B C     1 
ATOM   9245  O O     . ILE B 1 559 ? -33.581 47.692  18.615  1.00 19.12  ? 559  ILE B O     1 
ATOM   9246  C CB    . ILE B 1 559 ? -33.931 50.492  17.524  1.00 19.60  ? 559  ILE B CB    1 
ATOM   9247  C CG1   . ILE B 1 559 ? -33.748 52.019  17.529  1.00 19.13  ? 559  ILE B CG1   1 
ATOM   9248  C CG2   . ILE B 1 559 ? -35.026 50.084  16.523  1.00 18.55  ? 559  ILE B CG2   1 
ATOM   9249  C CD1   . ILE B 1 559 ? -33.158 52.554  16.210  1.00 19.55  ? 559  ILE B CD1   1 
ATOM   9250  N N     . TYR B 1 560 ? -35.692 48.058  19.298  1.00 19.48  ? 560  TYR B N     1 
ATOM   9251  C CA    . TYR B 1 560 ? -36.045 46.641  19.392  1.00 19.51  ? 560  TYR B CA    1 
ATOM   9252  C C     . TYR B 1 560 ? -37.154 46.351  18.384  1.00 19.54  ? 560  TYR B C     1 
ATOM   9253  O O     . TYR B 1 560 ? -38.254 46.911  18.473  1.00 18.87  ? 560  TYR B O     1 
ATOM   9254  C CB    . TYR B 1 560 ? -36.468 46.320  20.825  1.00 19.56  ? 560  TYR B CB    1 
ATOM   9255  C CG    . TYR B 1 560 ? -36.723 44.865  21.153  1.00 19.76  ? 560  TYR B CG    1 
ATOM   9256  C CD1   . TYR B 1 560 ? -37.766 44.164  20.551  1.00 18.68  ? 560  TYR B CD1   1 
ATOM   9257  C CD2   . TYR B 1 560 ? -35.956 44.207  22.115  1.00 20.57  ? 560  TYR B CD2   1 
ATOM   9258  C CE1   . TYR B 1 560 ? -38.024 42.839  20.883  1.00 19.66  ? 560  TYR B CE1   1 
ATOM   9259  C CE2   . TYR B 1 560 ? -36.206 42.872  22.456  1.00 20.49  ? 560  TYR B CE2   1 
ATOM   9260  C CZ    . TYR B 1 560 ? -37.240 42.203  21.833  1.00 19.48  ? 560  TYR B CZ    1 
ATOM   9261  O OH    . TYR B 1 560 ? -37.496 40.898  22.149  1.00 21.00  ? 560  TYR B OH    1 
ATOM   9262  N N     . ALA B 1 561 ? -36.848 45.501  17.408  1.00 19.17  ? 561  ALA B N     1 
ATOM   9263  C CA    . ALA B 1 561 ? -37.763 45.269  16.297  1.00 19.57  ? 561  ALA B CA    1 
ATOM   9264  C C     . ALA B 1 561 ? -38.269 43.836  16.262  1.00 19.70  ? 561  ALA B C     1 
ATOM   9265  O O     . ALA B 1 561 ? -37.482 42.891  16.133  1.00 19.57  ? 561  ALA B O     1 
ATOM   9266  C CB    . ALA B 1 561 ? -37.101 45.641  14.955  1.00 19.20  ? 561  ALA B CB    1 
ATOM   9267  N N     . TYR B 1 562 ? -39.586 43.679  16.385  1.00 19.67  ? 562  TYR B N     1 
ATOM   9268  C CA    . TYR B 1 562 ? -40.212 42.377  16.154  1.00 19.29  ? 562  TYR B CA    1 
ATOM   9269  C C     . TYR B 1 562 ? -40.456 42.253  14.648  1.00 19.52  ? 562  TYR B C     1 
ATOM   9270  O O     . TYR B 1 562 ? -41.033 43.154  14.028  1.00 19.23  ? 562  TYR B O     1 
ATOM   9271  C CB    . TYR B 1 562 ? -41.536 42.248  16.897  1.00 18.68  ? 562  TYR B CB    1 
ATOM   9272  C CG    . TYR B 1 562 ? -41.503 42.370  18.401  1.00 18.08  ? 562  TYR B CG    1 
ATOM   9273  C CD1   . TYR B 1 562 ? -41.433 43.614  19.019  1.00 18.02  ? 562  TYR B CD1   1 
ATOM   9274  C CD2   . TYR B 1 562 ? -41.616 41.234  19.215  1.00 17.87  ? 562  TYR B CD2   1 
ATOM   9275  C CE1   . TYR B 1 562 ? -41.446 43.725  20.413  1.00 18.41  ? 562  TYR B CE1   1 
ATOM   9276  C CE2   . TYR B 1 562 ? -41.622 41.335  20.597  1.00 16.52  ? 562  TYR B CE2   1 
ATOM   9277  C CZ    . TYR B 1 562 ? -41.549 42.581  21.187  1.00 17.64  ? 562  TYR B CZ    1 
ATOM   9278  O OH    . TYR B 1 562 ? -41.557 42.681  22.557  1.00 18.60  ? 562  TYR B OH    1 
ATOM   9279  N N     . VAL B 1 563 ? -40.007 41.145  14.060  1.00 19.76  ? 563  VAL B N     1 
ATOM   9280  C CA    . VAL B 1 563 ? -40.042 40.981  12.612  1.00 19.69  ? 563  VAL B CA    1 
ATOM   9281  C C     . VAL B 1 563 ? -40.679 39.648  12.232  1.00 19.61  ? 563  VAL B C     1 
ATOM   9282  O O     . VAL B 1 563 ? -40.306 38.584  12.748  1.00 19.03  ? 563  VAL B O     1 
ATOM   9283  C CB    . VAL B 1 563 ? -38.611 41.101  12.001  1.00 20.49  ? 563  VAL B CB    1 
ATOM   9284  C CG1   . VAL B 1 563 ? -38.621 40.819  10.487  1.00 20.55  ? 563  VAL B CG1   1 
ATOM   9285  C CG2   . VAL B 1 563 ? -37.990 42.507  12.302  1.00 20.18  ? 563  VAL B CG2   1 
ATOM   9286  N N     . THR B 1 564 ? -41.651 39.726  11.332  1.00 19.34  ? 564  THR B N     1 
ATOM   9287  C CA    . THR B 1 564 ? -42.330 38.551  10.790  1.00 19.52  ? 564  THR B CA    1 
ATOM   9288  C C     . THR B 1 564 ? -41.913 38.409  9.340   1.00 19.63  ? 564  THR B C     1 
ATOM   9289  O O     . THR B 1 564 ? -42.135 39.309  8.527   1.00 19.75  ? 564  THR B O     1 
ATOM   9290  C CB    . THR B 1 564 ? -43.879 38.674  10.900  1.00 19.11  ? 564  THR B CB    1 
ATOM   9291  O OG1   . THR B 1 564 ? -44.234 38.826  12.276  1.00 19.95  ? 564  THR B OG1   1 
ATOM   9292  C CG2   . THR B 1 564 ? -44.584 37.417  10.361  1.00 19.71  ? 564  THR B CG2   1 
ATOM   9293  N N     . LEU B 1 565 ? -41.300 37.275  9.028   1.00 19.60  ? 565  LEU B N     1 
ATOM   9294  C CA    . LEU B 1 565 ? -40.843 36.988  7.670   1.00 19.87  ? 565  LEU B CA    1 
ATOM   9295  C C     . LEU B 1 565 ? -41.979 36.507  6.783   1.00 19.73  ? 565  LEU B C     1 
ATOM   9296  O O     . LEU B 1 565 ? -42.966 35.959  7.277   1.00 18.87  ? 565  LEU B O     1 
ATOM   9297  C CB    . LEU B 1 565 ? -39.752 35.917  7.700   1.00 19.43  ? 565  LEU B CB    1 
ATOM   9298  C CG    . LEU B 1 565 ? -38.465 36.283  8.428   1.00 20.34  ? 565  LEU B CG    1 
ATOM   9299  C CD1   . LEU B 1 565 ? -37.505 35.127  8.367   1.00 19.01  ? 565  LEU B CD1   1 
ATOM   9300  C CD2   . LEU B 1 565 ? -37.840 37.557  7.841   1.00 21.62  ? 565  LEU B CD2   1 
ATOM   9301  N N     . ASN B 1 566 ? -41.828 36.720  5.475   1.00 20.10  ? 566  ASN B N     1 
ATOM   9302  C CA    . ASN B 1 566 ? -42.740 36.133  4.478   1.00 20.17  ? 566  ASN B CA    1 
ATOM   9303  C C     . ASN B 1 566 ? -42.803 34.606  4.602   1.00 19.87  ? 566  ASN B C     1 
ATOM   9304  O O     . ASN B 1 566 ? -41.830 33.970  5.006   1.00 19.28  ? 566  ASN B O     1 
ATOM   9305  C CB    . ASN B 1 566 ? -42.319 36.539  3.056   1.00 20.20  ? 566  ASN B CB    1 
ATOM   9306  C CG    . ASN B 1 566 ? -42.693 37.983  2.720   1.00 21.24  ? 566  ASN B CG    1 
ATOM   9307  O OD1   . ASN B 1 566 ? -43.728 38.480  3.146   1.00 23.36  ? 566  ASN B OD1   1 
ATOM   9308  N ND2   . ASN B 1 566 ? -41.857 38.649  1.937   1.00 21.47  ? 566  ASN B ND2   1 
ATOM   9309  N N     . HIS B 1 567 ? -43.949 34.016  4.280   1.00 20.21  ? 567  HIS B N     1 
ATOM   9310  C CA    . HIS B 1 567 ? -44.079 32.554  4.348   1.00 20.46  ? 567  HIS B CA    1 
ATOM   9311  C C     . HIS B 1 567 ? -42.996 31.878  3.508   1.00 20.88  ? 567  HIS B C     1 
ATOM   9312  O O     . HIS B 1 567 ? -42.722 32.296  2.381   1.00 21.01  ? 567  HIS B O     1 
ATOM   9313  C CB    . HIS B 1 567 ? -45.462 32.084  3.888   1.00 20.22  ? 567  HIS B CB    1 
ATOM   9314  C CG    . HIS B 1 567 ? -46.594 32.598  4.723   1.00 19.94  ? 567  HIS B CG    1 
ATOM   9315  N ND1   . HIS B 1 567 ? -47.905 32.532  4.310   1.00 19.08  ? 567  HIS B ND1   1 
ATOM   9316  C CD2   . HIS B 1 567 ? -46.614 33.198  5.939   1.00 20.94  ? 567  HIS B CD2   1 
ATOM   9317  C CE1   . HIS B 1 567 ? -48.686 33.059  5.236   1.00 19.95  ? 567  HIS B CE1   1 
ATOM   9318  N NE2   . HIS B 1 567 ? -47.927 33.478  6.230   1.00 20.54  ? 567  HIS B NE2   1 
ATOM   9319  N N     . GLY B 1 568 ? -42.371 30.847  4.070   1.00 21.36  ? 568  GLY B N     1 
ATOM   9320  C CA    . GLY B 1 568 ? -41.315 30.119  3.378   1.00 21.65  ? 568  GLY B CA    1 
ATOM   9321  C C     . GLY B 1 568 ? -39.922 30.646  3.661   1.00 22.28  ? 568  GLY B C     1 
ATOM   9322  O O     . GLY B 1 568 ? -38.933 29.989  3.333   1.00 22.61  ? 568  GLY B O     1 
ATOM   9323  N N     . GLU B 1 569 ? -39.831 31.828  4.271   1.00 22.44  ? 569  GLU B N     1 
ATOM   9324  C CA    . GLU B 1 569 ? -38.539 32.365  4.684   1.00 22.98  ? 569  GLU B CA    1 
ATOM   9325  C C     . GLU B 1 569 ? -38.200 31.895  6.101   1.00 23.46  ? 569  GLU B C     1 
ATOM   9326  O O     . GLU B 1 569 ? -39.086 31.729  6.944   1.00 23.90  ? 569  GLU B O     1 
ATOM   9327  C CB    . GLU B 1 569 ? -38.497 33.901  4.603   1.00 22.77  ? 569  GLU B CB    1 
ATOM   9328  C CG    . GLU B 1 569 ? -38.815 34.513  3.223   1.00 23.33  ? 569  GLU B CG    1 
ATOM   9329  C CD    . GLU B 1 569 ? -37.914 34.022  2.092   1.00 25.10  ? 569  GLU B CD    1 
ATOM   9330  O OE1   . GLU B 1 569 ? -36.804 33.506  2.364   1.00 25.35  ? 569  GLU B OE1   1 
ATOM   9331  O OE2   . GLU B 1 569 ? -38.330 34.146  0.916   1.00 26.05  ? 569  GLU B OE2   1 
ATOM   9332  N N     . GLU B 1 570 ? -36.914 31.692  6.349   1.00 23.45  ? 570  GLU B N     1 
ATOM   9333  C CA    . GLU B 1 570 ? -36.421 31.217  7.634   1.00 24.02  ? 570  GLU B CA    1 
ATOM   9334  C C     . GLU B 1 570 ? -35.375 32.197  8.156   1.00 24.03  ? 570  GLU B C     1 
ATOM   9335  O O     . GLU B 1 570 ? -34.630 32.774  7.363   1.00 24.46  ? 570  GLU B O     1 
ATOM   9336  C CB    . GLU B 1 570 ? -35.786 29.832  7.468   1.00 24.12  ? 570  GLU B CB    1 
ATOM   9337  N N     . PRO B 1 571 ? -35.307 32.387  9.489   1.00 24.16  ? 571  PRO B N     1 
ATOM   9338  C CA    . PRO B 1 571 ? -34.290 33.269  10.066  1.00 23.97  ? 571  PRO B CA    1 
ATOM   9339  C C     . PRO B 1 571 ? -32.900 32.638  10.027  1.00 23.63  ? 571  PRO B C     1 
ATOM   9340  O O     . PRO B 1 571 ? -32.782 31.419  9.981   1.00 23.62  ? 571  PRO B O     1 
ATOM   9341  C CB    . PRO B 1 571 ? -34.739 33.422  11.527  1.00 23.81  ? 571  PRO B CB    1 
ATOM   9342  C CG    . PRO B 1 571 ? -36.117 32.846  11.596  1.00 24.58  ? 571  PRO B CG    1 
ATOM   9343  C CD    . PRO B 1 571 ? -36.165 31.801  10.535  1.00 24.13  ? 571  PRO B CD    1 
ATOM   9344  N N     . SER B 1 572 ? -31.864 33.475  10.053  1.00 23.36  ? 572  SER B N     1 
ATOM   9345  C CA    . SER B 1 572 ? -30.473 33.034  10.113  1.00 22.64  ? 572  SER B CA    1 
ATOM   9346  C C     . SER B 1 572 ? -29.631 34.241  10.533  1.00 22.45  ? 572  SER B C     1 
ATOM   9347  O O     . SER B 1 572 ? -30.091 35.381  10.387  1.00 22.46  ? 572  SER B O     1 
ATOM   9348  C CB    . SER B 1 572 ? -30.005 32.529  8.741   1.00 22.88  ? 572  SER B CB    1 
ATOM   9349  O OG    . SER B 1 572 ? -29.962 33.595  7.798   1.00 22.91  ? 572  SER B OG    1 
ATOM   9350  N N     . PRO B 1 573 ? -28.395 34.010  11.033  1.00 21.80  ? 573  PRO B N     1 
ATOM   9351  C CA    . PRO B 1 573 ? -27.510 35.134  11.344  1.00 21.51  ? 573  PRO B CA    1 
ATOM   9352  C C     . PRO B 1 573 ? -27.234 36.002  10.120  1.00 21.10  ? 573  PRO B C     1 
ATOM   9353  O O     . PRO B 1 573 ? -27.136 37.228  10.244  1.00 20.86  ? 573  PRO B O     1 
ATOM   9354  C CB    . PRO B 1 573 ? -26.202 34.454  11.805  1.00 21.78  ? 573  PRO B CB    1 
ATOM   9355  C CG    . PRO B 1 573 ? -26.584 33.077  12.183  1.00 21.63  ? 573  PRO B CG    1 
ATOM   9356  C CD    . PRO B 1 573 ? -27.770 32.709  11.348  1.00 21.83  ? 573  PRO B CD    1 
ATOM   9357  N N     . GLU B 1 574 ? -27.115 35.369  8.954   1.00 20.63  ? 574  GLU B N     1 
ATOM   9358  C CA    . GLU B 1 574 ? -26.901 36.084  7.700   1.00 20.81  ? 574  GLU B CA    1 
ATOM   9359  C C     . GLU B 1 574 ? -28.054 37.045  7.423   1.00 20.23  ? 574  GLU B C     1 
ATOM   9360  O O     . GLU B 1 574 ? -27.837 38.200  7.048   1.00 20.09  ? 574  GLU B O     1 
ATOM   9361  C CB    . GLU B 1 574 ? -26.714 35.108  6.533   1.00 20.62  ? 574  GLU B CB    1 
ATOM   9362  C CG    . GLU B 1 574 ? -26.636 35.787  5.160   1.00 22.03  ? 574  GLU B CG    1 
ATOM   9363  C CD    . GLU B 1 574 ? -26.354 34.834  3.988   1.00 22.71  ? 574  GLU B CD    1 
ATOM   9364  O OE1   . GLU B 1 574 ? -26.039 33.641  4.211   1.00 23.59  ? 574  GLU B OE1   1 
ATOM   9365  O OE2   . GLU B 1 574 ? -26.433 35.309  2.823   1.00 26.61  ? 574  GLU B OE2   1 
ATOM   9366  N N     . LEU B 1 575 ? -29.279 36.567  7.624   1.00 19.91  ? 575  LEU B N     1 
ATOM   9367  C CA    . LEU B 1 575 ? -30.465 37.385  7.389   1.00 19.55  ? 575  LEU B CA    1 
ATOM   9368  C C     . LEU B 1 575 ? -30.568 38.493  8.433   1.00 19.53  ? 575  LEU B C     1 
ATOM   9369  O O     . LEU B 1 575 ? -30.973 39.606  8.120   1.00 19.23  ? 575  LEU B O     1 
ATOM   9370  C CB    . LEU B 1 575 ? -31.738 36.534  7.379   1.00 19.01  ? 575  LEU B CB    1 
ATOM   9371  C CG    . LEU B 1 575 ? -33.044 37.294  7.063   1.00 20.08  ? 575  LEU B CG    1 
ATOM   9372  C CD1   . LEU B 1 575 ? -33.000 37.899  5.648   1.00 17.77  ? 575  LEU B CD1   1 
ATOM   9373  C CD2   . LEU B 1 575 ? -34.247 36.376  7.229   1.00 18.80  ? 575  LEU B CD2   1 
ATOM   9374  N N     . TYR B 1 576 ? -30.189 38.175  9.666   1.00 19.96  ? 576  TYR B N     1 
ATOM   9375  C CA    . TYR B 1 576 ? -30.126 39.144  10.763  1.00 20.04  ? 576  TYR B CA    1 
ATOM   9376  C C     . TYR B 1 576 ? -29.258 40.353  10.371  1.00 19.84  ? 576  TYR B C     1 
ATOM   9377  O O     . TYR B 1 576 ? -29.691 41.511  10.454  1.00 19.65  ? 576  TYR B O     1 
ATOM   9378  C CB    . TYR B 1 576 ? -29.536 38.450  11.998  1.00 20.78  ? 576  TYR B CB    1 
ATOM   9379  C CG    . TYR B 1 576 ? -29.779 39.149  13.311  1.00 22.11  ? 576  TYR B CG    1 
ATOM   9380  C CD1   . TYR B 1 576 ? -30.805 38.728  14.160  1.00 21.31  ? 576  TYR B CD1   1 
ATOM   9381  C CD2   . TYR B 1 576 ? -28.975 40.223  13.721  1.00 21.73  ? 576  TYR B CD2   1 
ATOM   9382  C CE1   . TYR B 1 576 ? -31.037 39.365  15.371  1.00 23.09  ? 576  TYR B CE1   1 
ATOM   9383  C CE2   . TYR B 1 576 ? -29.196 40.864  14.939  1.00 21.68  ? 576  TYR B CE2   1 
ATOM   9384  C CZ    . TYR B 1 576 ? -30.230 40.431  15.758  1.00 23.41  ? 576  TYR B CZ    1 
ATOM   9385  O OH    . TYR B 1 576 ? -30.472 41.040  16.982  1.00 24.52  ? 576  TYR B OH    1 
ATOM   9386  N N     . ALA B 1 577 ? -28.037 40.074  9.924   1.00 19.23  ? 577  ALA B N     1 
ATOM   9387  C CA    . ALA B 1 577 ? -27.106 41.139  9.544   1.00 18.97  ? 577  ALA B CA    1 
ATOM   9388  C C     . ALA B 1 577 ? -27.615 41.875  8.300   1.00 18.74  ? 577  ALA B C     1 
ATOM   9389  O O     . ALA B 1 577 ? -27.462 43.099  8.186   1.00 18.11  ? 577  ALA B O     1 
ATOM   9390  C CB    . ALA B 1 577 ? -25.721 40.577  9.314   1.00 18.12  ? 577  ALA B CB    1 
ATOM   9391  N N     . GLU B 1 578 ? -28.219 41.118  7.377   1.00 18.35  ? 578  GLU B N     1 
ATOM   9392  C CA    . GLU B 1 578 ? -28.804 41.682  6.164   1.00 18.97  ? 578  GLU B CA    1 
ATOM   9393  C C     . GLU B 1 578 ? -29.904 42.704  6.458   1.00 19.05  ? 578  GLU B C     1 
ATOM   9394  O O     . GLU B 1 578 ? -29.960 43.778  5.839   1.00 19.07  ? 578  GLU B O     1 
ATOM   9395  C CB    . GLU B 1 578 ? -29.372 40.574  5.276   1.00 18.95  ? 578  GLU B CB    1 
ATOM   9396  C CG    . GLU B 1 578 ? -29.732 41.035  3.870   1.00 19.60  ? 578  GLU B CG    1 
ATOM   9397  C CD    . GLU B 1 578 ? -30.265 39.915  3.009   1.00 20.51  ? 578  GLU B CD    1 
ATOM   9398  O OE1   . GLU B 1 578 ? -29.570 38.877  2.869   1.00 23.22  ? 578  GLU B OE1   1 
ATOM   9399  O OE2   . GLU B 1 578 ? -31.382 40.070  2.473   1.00 22.24  ? 578  GLU B OE2   1 
ATOM   9400  N N     . VAL B 1 579 ? -30.781 42.359  7.394   1.00 19.13  ? 579  VAL B N     1 
ATOM   9401  C CA    . VAL B 1 579 ? -31.900 43.224  7.758   1.00 19.14  ? 579  VAL B CA    1 
ATOM   9402  C C     . VAL B 1 579 ? -31.413 44.505  8.437   1.00 19.64  ? 579  VAL B C     1 
ATOM   9403  O O     . VAL B 1 579 ? -31.879 45.604  8.100   1.00 20.01  ? 579  VAL B O     1 
ATOM   9404  C CB    . VAL B 1 579 ? -32.936 42.470  8.626   1.00 19.52  ? 579  VAL B CB    1 
ATOM   9405  C CG1   . VAL B 1 579 ? -34.009 43.427  9.150   1.00 17.92  ? 579  VAL B CG1   1 
ATOM   9406  C CG2   . VAL B 1 579 ? -33.576 41.328  7.816   1.00 17.87  ? 579  VAL B CG2   1 
ATOM   9407  N N     . ARG B 1 580 ? -30.464 44.377  9.365   1.00 19.68  ? 580  ARG B N     1 
ATOM   9408  C CA    . ARG B 1 580 ? -29.862 45.548  10.011  1.00 20.54  ? 580  ARG B CA    1 
ATOM   9409  C C     . ARG B 1 580 ? -29.230 46.489  8.981   1.00 20.40  ? 580  ARG B C     1 
ATOM   9410  O O     . ARG B 1 580 ? -29.456 47.709  9.027   1.00 20.29  ? 580  ARG B O     1 
ATOM   9411  C CB    . ARG B 1 580 ? -28.827 45.140  11.065  1.00 20.90  ? 580  ARG B CB    1 
ATOM   9412  C CG    . ARG B 1 580 ? -29.434 44.438  12.287  1.00 24.28  ? 580  ARG B CG    1 
ATOM   9413  C CD    . ARG B 1 580 ? -28.832 44.957  13.598  1.00 29.98  ? 580  ARG B CD    1 
ATOM   9414  N NE    . ARG B 1 580 ? -27.376 44.940  13.584  1.00 35.86  ? 580  ARG B NE    1 
ATOM   9415  C CZ    . ARG B 1 580 ? -26.589 45.729  14.309  1.00 37.86  ? 580  ARG B CZ    1 
ATOM   9416  N NH1   . ARG B 1 580 ? -27.093 46.641  15.133  1.00 38.54  ? 580  ARG B NH1   1 
ATOM   9417  N NH2   . ARG B 1 580 ? -25.277 45.602  14.200  1.00 40.85  ? 580  ARG B NH2   1 
ATOM   9418  N N     . ASN B 1 581 ? -28.460 45.911  8.052   1.00 19.91  ? 581  ASN B N     1 
ATOM   9419  C CA    . ASN B 1 581 ? -27.857 46.647  6.939   1.00 19.65  ? 581  ASN B CA    1 
ATOM   9420  C C     . ASN B 1 581 ? -28.903 47.294  6.034   1.00 20.03  ? 581  ASN B C     1 
ATOM   9421  O O     . ASN B 1 581 ? -28.673 48.378  5.497   1.00 19.78  ? 581  ASN B O     1 
ATOM   9422  C CB    . ASN B 1 581 ? -26.923 45.740  6.133   1.00 19.26  ? 581  ASN B CB    1 
ATOM   9423  C CG    . ASN B 1 581 ? -25.535 45.610  6.773   1.00 19.95  ? 581  ASN B CG    1 
ATOM   9424  O OD1   . ASN B 1 581 ? -25.040 46.553  7.392   1.00 18.22  ? 581  ASN B OD1   1 
ATOM   9425  N ND2   . ASN B 1 581 ? -24.901 44.447  6.606   1.00 17.42  ? 581  ASN B ND2   1 
ATOM   9426  N N     . TRP B 1 582 ? -30.049 46.627  5.882   1.00 19.92  ? 582  TRP B N     1 
ATOM   9427  C CA    . TRP B 1 582 ? -31.164 47.154  5.086   1.00 19.98  ? 582  TRP B CA    1 
ATOM   9428  C C     . TRP B 1 582 ? -31.686 48.476  5.668   1.00 19.55  ? 582  TRP B C     1 
ATOM   9429  O O     . TRP B 1 582 ? -31.888 49.432  4.946   1.00 19.31  ? 582  TRP B O     1 
ATOM   9430  C CB    . TRP B 1 582 ? -32.301 46.126  4.988   1.00 19.93  ? 582  TRP B CB    1 
ATOM   9431  C CG    . TRP B 1 582 ? -33.477 46.605  4.182   1.00 20.19  ? 582  TRP B CG    1 
ATOM   9432  C CD1   . TRP B 1 582 ? -34.640 47.153  4.661   1.00 20.51  ? 582  TRP B CD1   1 
ATOM   9433  C CD2   . TRP B 1 582 ? -33.610 46.571  2.751   1.00 20.40  ? 582  TRP B CD2   1 
ATOM   9434  N NE1   . TRP B 1 582 ? -35.485 47.469  3.607   1.00 19.91  ? 582  TRP B NE1   1 
ATOM   9435  C CE2   . TRP B 1 582 ? -34.876 47.123  2.431   1.00 19.65  ? 582  TRP B CE2   1 
ATOM   9436  C CE3   . TRP B 1 582 ? -32.783 46.132  1.711   1.00 20.06  ? 582  TRP B CE3   1 
ATOM   9437  C CZ2   . TRP B 1 582 ? -35.331 47.242  1.112   1.00 21.49  ? 582  TRP B CZ2   1 
ATOM   9438  C CZ3   . TRP B 1 582 ? -33.239 46.247  0.399   1.00 21.19  ? 582  TRP B CZ3   1 
ATOM   9439  C CH2   . TRP B 1 582 ? -34.500 46.809  0.113   1.00 20.61  ? 582  TRP B CH2   1 
ATOM   9440  N N     . VAL B 1 583 ? -31.892 48.516  6.973   1.00 19.51  ? 583  VAL B N     1 
ATOM   9441  C CA    . VAL B 1 583 ? -32.309 49.749  7.639   1.00 19.99  ? 583  VAL B CA    1 
ATOM   9442  C C     . VAL B 1 583 ? -31.220 50.832  7.588   1.00 20.47  ? 583  VAL B C     1 
ATOM   9443  O O     . VAL B 1 583 ? -31.538 52.012  7.418   1.00 20.13  ? 583  VAL B O     1 
ATOM   9444  C CB    . VAL B 1 583 ? -32.750 49.482  9.088   1.00 19.95  ? 583  VAL B CB    1 
ATOM   9445  C CG1   . VAL B 1 583 ? -33.282 50.759  9.729   1.00 19.96  ? 583  VAL B CG1   1 
ATOM   9446  C CG2   . VAL B 1 583 ? -33.810 48.374  9.116   1.00 18.84  ? 583  VAL B CG2   1 
ATOM   9447  N N     . ARG B 1 584 ? -29.948 50.438  7.704   1.00 21.02  ? 584  ARG B N     1 
ATOM   9448  C CA    . ARG B 1 584 ? -28.840 51.381  7.488   1.00 22.88  ? 584  ARG B CA    1 
ATOM   9449  C C     . ARG B 1 584 ? -28.929 52.026  6.116   1.00 22.49  ? 584  ARG B C     1 
ATOM   9450  O O     . ARG B 1 584 ? -28.692 53.221  5.980   1.00 22.60  ? 584  ARG B O     1 
ATOM   9451  C CB    . ARG B 1 584 ? -27.466 50.719  7.632   1.00 22.36  ? 584  ARG B CB    1 
ATOM   9452  C CG    . ARG B 1 584 ? -27.125 50.354  9.050   1.00 25.37  ? 584  ARG B CG    1 
ATOM   9453  C CD    . ARG B 1 584 ? -25.716 49.733  9.184   1.00 25.92  ? 584  ARG B CD    1 
ATOM   9454  N NE    . ARG B 1 584 ? -25.304 49.869  10.578  1.00 30.71  ? 584  ARG B NE    1 
ATOM   9455  C CZ    . ARG B 1 584 ? -24.357 50.696  11.004  1.00 33.93  ? 584  ARG B CZ    1 
ATOM   9456  N NH1   . ARG B 1 584 ? -23.655 51.430  10.131  1.00 34.12  ? 584  ARG B NH1   1 
ATOM   9457  N NH2   . ARG B 1 584 ? -24.087 50.761  12.306  1.00 35.14  ? 584  ARG B NH2   1 
ATOM   9458  N N     . LYS B 1 585 ? -29.264 51.225  5.109   1.00 22.35  ? 585  LYS B N     1 
ATOM   9459  C CA    . LYS B 1 585 ? -29.398 51.708  3.732   1.00 23.16  ? 585  LYS B CA    1 
ATOM   9460  C C     . LYS B 1 585 ? -30.641 52.577  3.545   1.00 22.11  ? 585  LYS B C     1 
ATOM   9461  O O     . LYS B 1 585 ? -30.597 53.588  2.841   1.00 21.91  ? 585  LYS B O     1 
ATOM   9462  C CB    . LYS B 1 585 ? -29.440 50.521  2.750   1.00 22.99  ? 585  LYS B CB    1 
ATOM   9463  C CG    . LYS B 1 585 ? -29.787 50.893  1.295   1.00 24.64  ? 585  LYS B CG    1 
ATOM   9464  C CD    . LYS B 1 585 ? -30.345 49.682  0.516   1.00 25.91  ? 585  LYS B CD    1 
ATOM   9465  C CE    . LYS B 1 585 ? -30.254 49.902  -1.006  1.00 30.91  ? 585  LYS B CE    1 
ATOM   9466  N NZ    . LYS B 1 585 ? -30.624 48.658  -1.773  1.00 33.99  ? 585  LYS B NZ    1 
ATOM   9467  N N     . GLU B 1 586 ? -31.748 52.160  4.156   1.00 21.22  ? 586  GLU B N     1 
ATOM   9468  C CA    . GLU B 1 586 ? -33.037 52.831  3.980   1.00 20.77  ? 586  GLU B CA    1 
ATOM   9469  C C     . GLU B 1 586 ? -33.158 54.177  4.712   1.00 19.88  ? 586  GLU B C     1 
ATOM   9470  O O     . GLU B 1 586 ? -33.822 55.082  4.227   1.00 19.38  ? 586  GLU B O     1 
ATOM   9471  C CB    . GLU B 1 586 ? -34.171 51.903  4.404   1.00 21.05  ? 586  GLU B CB    1 
ATOM   9472  C CG    . GLU B 1 586 ? -34.383 50.740  3.450   1.00 23.90  ? 586  GLU B CG    1 
ATOM   9473  C CD    . GLU B 1 586 ? -34.863 51.206  2.088   1.00 27.76  ? 586  GLU B CD    1 
ATOM   9474  O OE1   . GLU B 1 586 ? -36.078 51.460  1.960   1.00 30.06  ? 586  GLU B OE1   1 
ATOM   9475  O OE2   . GLU B 1 586 ? -34.025 51.333  1.164   1.00 28.07  ? 586  GLU B OE2   1 
ATOM   9476  N N     . ILE B 1 587 ? -32.524 54.294  5.877   1.00 18.79  ? 587  ILE B N     1 
ATOM   9477  C CA    . ILE B 1 587 ? -32.606 55.510  6.691   1.00 18.01  ? 587  ILE B CA    1 
ATOM   9478  C C     . ILE B 1 587 ? -31.202 56.032  7.032   1.00 18.07  ? 587  ILE B C     1 
ATOM   9479  O O     . ILE B 1 587 ? -30.863 57.166  6.721   1.00 18.34  ? 587  ILE B O     1 
ATOM   9480  C CB    . ILE B 1 587 ? -33.450 55.289  8.000   1.00 18.28  ? 587  ILE B CB    1 
ATOM   9481  C CG1   . ILE B 1 587 ? -34.870 54.769  7.685   1.00 18.05  ? 587  ILE B CG1   1 
ATOM   9482  C CG2   . ILE B 1 587 ? -33.525 56.592  8.836   1.00 17.49  ? 587  ILE B CG2   1 
ATOM   9483  C CD1   . ILE B 1 587 ? -35.693 54.365  8.932   1.00 16.89  ? 587  ILE B CD1   1 
ATOM   9484  N N     . GLY B 1 588 ? -30.393 55.193  7.667   1.00 17.89  ? 588  GLY B N     1 
ATOM   9485  C CA    . GLY B 1 588 ? -29.053 55.568  8.099   1.00 18.06  ? 588  GLY B CA    1 
ATOM   9486  C C     . GLY B 1 588 ? -28.644 54.766  9.325   1.00 18.77  ? 588  GLY B C     1 
ATOM   9487  O O     . GLY B 1 588 ? -29.502 54.164  9.980   1.00 18.15  ? 588  GLY B O     1 
ATOM   9488  N N     . PRO B 1 589 ? -27.329 54.751  9.652   1.00 19.61  ? 589  PRO B N     1 
ATOM   9489  C CA    . PRO B 1 589 ? -26.841 54.052  10.852  1.00 20.02  ? 589  PRO B CA    1 
ATOM   9490  C C     . PRO B 1 589 ? -27.605 54.429  12.130  1.00 20.75  ? 589  PRO B C     1 
ATOM   9491  O O     . PRO B 1 589 ? -27.760 53.598  13.005  1.00 20.81  ? 589  PRO B O     1 
ATOM   9492  C CB    . PRO B 1 589 ? -25.382 54.517  10.961  1.00 19.77  ? 589  PRO B CB    1 
ATOM   9493  C CG    . PRO B 1 589 ? -24.981 54.808  9.555   1.00 20.63  ? 589  PRO B CG    1 
ATOM   9494  C CD    . PRO B 1 589 ? -26.225 55.380  8.898   1.00 19.67  ? 589  PRO B CD    1 
ATOM   9495  N N     . LEU B 1 590 ? -28.090 55.670  12.213  1.00 21.62  ? 590  LEU B N     1 
ATOM   9496  C CA    . LEU B 1 590 ? -28.757 56.189  13.409  1.00 22.24  ? 590  LEU B CA    1 
ATOM   9497  C C     . LEU B 1 590 ? -30.032 55.438  13.758  1.00 23.02  ? 590  LEU B C     1 
ATOM   9498  O O     . LEU B 1 590 ? -30.434 55.420  14.918  1.00 24.03  ? 590  LEU B O     1 
ATOM   9499  C CB    . LEU B 1 590 ? -29.057 57.693  13.255  1.00 22.43  ? 590  LEU B CB    1 
ATOM   9500  C CG    . LEU B 1 590 ? -30.288 58.180  12.462  1.00 22.17  ? 590  LEU B CG    1 
ATOM   9501  C CD1   . LEU B 1 590 ? -30.485 59.684  12.647  1.00 22.79  ? 590  LEU B CD1   1 
ATOM   9502  C CD2   . LEU B 1 590 ? -30.222 57.826  10.976  1.00 19.79  ? 590  LEU B CD2   1 
ATOM   9503  N N     . ALA B 1 591 ? -30.658 54.816  12.762  1.00 23.31  ? 591  ALA B N     1 
ATOM   9504  C CA    . ALA B 1 591 ? -31.892 54.073  12.977  1.00 23.85  ? 591  ALA B CA    1 
ATOM   9505  C C     . ALA B 1 591 ? -31.728 52.553  12.907  1.00 23.81  ? 591  ALA B C     1 
ATOM   9506  O O     . ALA B 1 591 ? -32.710 51.834  12.816  1.00 24.01  ? 591  ALA B O     1 
ATOM   9507  C CB    . ALA B 1 591 ? -32.972 54.547  12.002  1.00 23.65  ? 591  ALA B CB    1 
ATOM   9508  N N     . THR B 1 592 ? -30.498 52.058  12.961  1.00 24.14  ? 592  THR B N     1 
ATOM   9509  C CA    . THR B 1 592 ? -30.279 50.605  12.884  1.00 24.92  ? 592  THR B CA    1 
ATOM   9510  C C     . THR B 1 592 ? -30.806 49.903  14.123  1.00 24.24  ? 592  THR B C     1 
ATOM   9511  O O     . THR B 1 592 ? -30.405 50.249  15.226  1.00 24.15  ? 592  THR B O     1 
ATOM   9512  C CB    . THR B 1 592 ? -28.791 50.237  12.783  1.00 25.25  ? 592  THR B CB    1 
ATOM   9513  O OG1   . THR B 1 592 ? -28.110 51.200  11.977  1.00 26.97  ? 592  THR B OG1   1 
ATOM   9514  C CG2   . THR B 1 592 ? -28.630 48.821  12.187  1.00 25.32  ? 592  THR B CG2   1 
ATOM   9515  N N     . PRO B 1 593 ? -31.695 48.908  13.939  1.00 24.31  ? 593  PRO B N     1 
ATOM   9516  C CA    . PRO B 1 593 ? -32.224 48.155  15.080  1.00 24.19  ? 593  PRO B CA    1 
ATOM   9517  C C     . PRO B 1 593 ? -31.110 47.512  15.890  1.00 24.36  ? 593  PRO B C     1 
ATOM   9518  O O     . PRO B 1 593 ? -30.124 47.051  15.321  1.00 24.53  ? 593  PRO B O     1 
ATOM   9519  C CB    . PRO B 1 593 ? -33.110 47.095  14.419  1.00 23.98  ? 593  PRO B CB    1 
ATOM   9520  C CG    . PRO B 1 593 ? -33.535 47.745  13.113  1.00 24.16  ? 593  PRO B CG    1 
ATOM   9521  C CD    . PRO B 1 593 ? -32.279 48.444  12.662  1.00 23.99  ? 593  PRO B CD    1 
ATOM   9522  N N     . ASP B 1 594 ? -31.251 47.527  17.210  1.00 23.99  ? 594  ASP B N     1 
ATOM   9523  C CA    . ASP B 1 594 ? -30.243 46.966  18.081  1.00 24.17  ? 594  ASP B CA    1 
ATOM   9524  C C     . ASP B 1 594 ? -30.550 45.496  18.326  1.00 23.84  ? 594  ASP B C     1 
ATOM   9525  O O     . ASP B 1 594 ? -29.647 44.698  18.575  1.00 23.44  ? 594  ASP B O     1 
ATOM   9526  C CB    . ASP B 1 594 ? -30.164 47.773  19.386  1.00 24.43  ? 594  ASP B CB    1 
ATOM   9527  C CG    . ASP B 1 594 ? -29.657 49.199  19.156  1.00 26.62  ? 594  ASP B CG    1 
ATOM   9528  O OD1   . ASP B 1 594 ? -28.428 49.357  18.972  1.00 28.37  ? 594  ASP B OD1   1 
ATOM   9529  O OD2   . ASP B 1 594 ? -30.477 50.161  19.127  1.00 27.02  ? 594  ASP B OD2   1 
ATOM   9530  N N     . VAL B 1 595 ? -31.835 45.143  18.226  1.00 23.43  ? 595  VAL B N     1 
ATOM   9531  C CA    . VAL B 1 595 ? -32.294 43.772  18.406  1.00 22.89  ? 595  VAL B CA    1 
ATOM   9532  C C     . VAL B 1 595 ? -33.321 43.467  17.329  1.00 22.64  ? 595  VAL B C     1 
ATOM   9533  O O     . VAL B 1 595 ? -34.162 44.312  17.025  1.00 22.86  ? 595  VAL B O     1 
ATOM   9534  C CB    . VAL B 1 595 ? -32.983 43.582  19.790  1.00 22.98  ? 595  VAL B CB    1 
ATOM   9535  C CG1   . VAL B 1 595 ? -33.608 42.188  19.911  1.00 23.29  ? 595  VAL B CG1   1 
ATOM   9536  C CG2   . VAL B 1 595 ? -32.015 43.835  20.928  1.00 23.12  ? 595  VAL B CG2   1 
ATOM   9537  N N     . LEU B 1 596 ? -33.254 42.268  16.752  1.00 21.52  ? 596  LEU B N     1 
ATOM   9538  C CA    . LEU B 1 596 ? -34.336 41.778  15.910  1.00 20.80  ? 596  LEU B CA    1 
ATOM   9539  C C     . LEU B 1 596 ? -34.927 40.545  16.585  1.00 21.11  ? 596  LEU B C     1 
ATOM   9540  O O     . LEU B 1 596 ? -34.213 39.590  16.899  1.00 21.57  ? 596  LEU B O     1 
ATOM   9541  C CB    . LEU B 1 596 ? -33.849 41.438  14.495  1.00 20.65  ? 596  LEU B CB    1 
ATOM   9542  C CG    . LEU B 1 596 ? -33.069 42.476  13.658  1.00 20.18  ? 596  LEU B CG    1 
ATOM   9543  C CD1   . LEU B 1 596 ? -32.593 41.810  12.383  1.00 18.82  ? 596  LEU B CD1   1 
ATOM   9544  C CD2   . LEU B 1 596 ? -33.919 43.688  13.319  1.00 18.83  ? 596  LEU B CD2   1 
ATOM   9545  N N     . HIS B 1 597 ? -36.228 40.588  16.826  1.00 20.72  ? 597  HIS B N     1 
ATOM   9546  C CA    . HIS B 1 597 ? -36.955 39.510  17.477  1.00 20.54  ? 597  HIS B CA    1 
ATOM   9547  C C     . HIS B 1 597 ? -37.809 38.862  16.388  1.00 20.32  ? 597  HIS B C     1 
ATOM   9548  O O     . HIS B 1 597 ? -38.832 39.434  15.984  1.00 19.73  ? 597  HIS B O     1 
ATOM   9549  C CB    . HIS B 1 597 ? -37.811 40.108  18.603  1.00 20.49  ? 597  HIS B CB    1 
ATOM   9550  C CG    . HIS B 1 597 ? -38.707 39.128  19.302  1.00 22.07  ? 597  HIS B CG    1 
ATOM   9551  N ND1   . HIS B 1 597 ? -38.911 39.160  20.667  1.00 21.00  ? 597  HIS B ND1   1 
ATOM   9552  C CD2   . HIS B 1 597 ? -39.468 38.109  18.832  1.00 21.34  ? 597  HIS B CD2   1 
ATOM   9553  C CE1   . HIS B 1 597 ? -39.756 38.202  21.006  1.00 22.22  ? 597  HIS B CE1   1 
ATOM   9554  N NE2   . HIS B 1 597 ? -40.117 37.557  19.911  1.00 22.32  ? 597  HIS B NE2   1 
ATOM   9555  N N     . TRP B 1 598 ? -37.363 37.703  15.888  1.00 19.83  ? 598  TRP B N     1 
ATOM   9556  C CA    . TRP B 1 598 ? -38.088 36.959  14.862  1.00 20.62  ? 598  TRP B CA    1 
ATOM   9557  C C     . TRP B 1 598 ? -39.343 36.352  15.486  1.00 20.86  ? 598  TRP B C     1 
ATOM   9558  O O     . TRP B 1 598 ? -39.260 35.639  16.476  1.00 20.94  ? 598  TRP B O     1 
ATOM   9559  C CB    . TRP B 1 598 ? -37.244 35.808  14.277  1.00 20.61  ? 598  TRP B CB    1 
ATOM   9560  C CG    . TRP B 1 598 ? -35.862 36.158  13.753  1.00 20.62  ? 598  TRP B CG    1 
ATOM   9561  C CD1   . TRP B 1 598 ? -34.659 35.683  14.225  1.00 21.72  ? 598  TRP B CD1   1 
ATOM   9562  C CD2   . TRP B 1 598 ? -35.547 37.011  12.642  1.00 21.49  ? 598  TRP B CD2   1 
ATOM   9563  N NE1   . TRP B 1 598 ? -33.626 36.202  13.483  1.00 22.14  ? 598  TRP B NE1   1 
ATOM   9564  C CE2   . TRP B 1 598 ? -34.142 37.017  12.504  1.00 21.57  ? 598  TRP B CE2   1 
ATOM   9565  C CE3   . TRP B 1 598 ? -36.319 37.787  11.755  1.00 21.44  ? 598  TRP B CE3   1 
ATOM   9566  C CZ2   . TRP B 1 598 ? -33.486 37.777  11.524  1.00 21.50  ? 598  TRP B CZ2   1 
ATOM   9567  C CZ3   . TRP B 1 598 ? -35.666 38.533  10.774  1.00 22.18  ? 598  TRP B CZ3   1 
ATOM   9568  C CH2   . TRP B 1 598 ? -34.260 38.525  10.672  1.00 20.86  ? 598  TRP B CH2   1 
ATOM   9569  N N     . THR B 1 599 ? -40.504 36.631  14.915  1.00 21.26  ? 599  THR B N     1 
ATOM   9570  C CA    . THR B 1 599 ? -41.747 36.096  15.477  1.00 22.28  ? 599  THR B CA    1 
ATOM   9571  C C     . THR B 1 599 ? -42.807 35.888  14.403  1.00 22.86  ? 599  THR B C     1 
ATOM   9572  O O     . THR B 1 599 ? -42.786 36.553  13.360  1.00 22.86  ? 599  THR B O     1 
ATOM   9573  C CB    . THR B 1 599 ? -42.287 36.995  16.663  1.00 22.00  ? 599  THR B CB    1 
ATOM   9574  O OG1   . THR B 1 599 ? -43.357 36.323  17.354  1.00 21.96  ? 599  THR B OG1   1 
ATOM   9575  C CG2   . THR B 1 599 ? -42.767 38.357  16.166  1.00 22.16  ? 599  THR B CG2   1 
ATOM   9576  N N     . ASP B 1 600 ? -43.722 34.953  14.652  1.00 23.74  ? 600  ASP B N     1 
ATOM   9577  C CA    . ASP B 1 600 ? -44.940 34.850  13.847  1.00 24.69  ? 600  ASP B CA    1 
ATOM   9578  C C     . ASP B 1 600 ? -46.139 35.229  14.705  1.00 24.75  ? 600  ASP B C     1 
ATOM   9579  O O     . ASP B 1 600 ? -47.284 34.960  14.336  1.00 25.00  ? 600  ASP B O     1 
ATOM   9580  C CB    . ASP B 1 600 ? -45.122 33.428  13.300  1.00 25.45  ? 600  ASP B CB    1 
ATOM   9581  C CG    . ASP B 1 600 ? -44.111 33.079  12.215  1.00 27.56  ? 600  ASP B CG    1 
ATOM   9582  O OD1   . ASP B 1 600 ? -43.896 33.904  11.298  1.00 29.19  ? 600  ASP B OD1   1 
ATOM   9583  O OD2   . ASP B 1 600 ? -43.536 31.970  12.284  1.00 29.63  ? 600  ASP B OD2   1 
ATOM   9584  N N     . SER B 1 601 ? -45.866 35.869  15.840  1.00 24.56  ? 601  SER B N     1 
ATOM   9585  C CA    . SER B 1 601 ? -46.871 36.068  16.886  1.00 24.23  ? 601  SER B CA    1 
ATOM   9586  C C     . SER B 1 601 ? -47.143 37.533  17.262  1.00 24.13  ? 601  SER B C     1 
ATOM   9587  O O     . SER B 1 601 ? -47.356 37.849  18.438  1.00 24.20  ? 601  SER B O     1 
ATOM   9588  C CB    . SER B 1 601 ? -46.480 35.258  18.132  1.00 24.25  ? 601  SER B CB    1 
ATOM   9589  O OG    . SER B 1 601 ? -46.487 33.863  17.862  1.00 23.98  ? 601  SER B OG    1 
ATOM   9590  N N     . LEU B 1 602 ? -47.147 38.429  16.275  1.00 23.83  ? 602  LEU B N     1 
ATOM   9591  C CA    . LEU B 1 602 ? -47.493 39.830  16.544  1.00 23.86  ? 602  LEU B CA    1 
ATOM   9592  C C     . LEU B 1 602 ? -48.905 39.930  17.124  1.00 23.73  ? 602  LEU B C     1 
ATOM   9593  O O     . LEU B 1 602 ? -49.836 39.346  16.573  1.00 23.63  ? 602  LEU B O     1 
ATOM   9594  C CB    . LEU B 1 602 ? -47.379 40.700  15.285  1.00 23.63  ? 602  LEU B CB    1 
ATOM   9595  C CG    . LEU B 1 602 ? -45.959 41.008  14.786  1.00 23.87  ? 602  LEU B CG    1 
ATOM   9596  C CD1   . LEU B 1 602 ? -46.008 41.686  13.426  1.00 23.56  ? 602  LEU B CD1   1 
ATOM   9597  C CD2   . LEU B 1 602 ? -45.172 41.852  15.792  1.00 22.59  ? 602  LEU B CD2   1 
ATOM   9598  N N     . PRO B 1 603 ? -49.061 40.657  18.246  1.00 23.73  ? 603  PRO B N     1 
ATOM   9599  C CA    . PRO B 1 603 ? -50.384 40.815  18.845  1.00 23.66  ? 603  PRO B CA    1 
ATOM   9600  C C     . PRO B 1 603 ? -51.168 41.884  18.094  1.00 23.81  ? 603  PRO B C     1 
ATOM   9601  O O     . PRO B 1 603 ? -50.681 43.011  17.908  1.00 24.11  ? 603  PRO B O     1 
ATOM   9602  C CB    . PRO B 1 603 ? -50.083 41.238  20.285  1.00 23.42  ? 603  PRO B CB    1 
ATOM   9603  C CG    . PRO B 1 603 ? -48.733 41.867  20.233  1.00 23.70  ? 603  PRO B CG    1 
ATOM   9604  C CD    . PRO B 1 603 ? -48.014 41.370  19.001  1.00 23.67  ? 603  PRO B CD    1 
ATOM   9605  N N     . LYS B 1 604 ? -52.351 41.501  17.631  1.00 23.55  ? 604  LYS B N     1 
ATOM   9606  C CA    . LYS B 1 604 ? -53.189 42.366  16.817  1.00 23.67  ? 604  LYS B CA    1 
ATOM   9607  C C     . LYS B 1 604 ? -54.599 42.422  17.359  1.00 23.00  ? 604  LYS B C     1 
ATOM   9608  O O     . LYS B 1 604 ? -55.082 41.462  17.971  1.00 22.30  ? 604  LYS B O     1 
ATOM   9609  C CB    . LYS B 1 604 ? -53.235 41.864  15.372  1.00 24.20  ? 604  LYS B CB    1 
ATOM   9610  C CG    . LYS B 1 604 ? -51.896 41.928  14.640  1.00 26.37  ? 604  LYS B CG    1 
ATOM   9611  C CD    . LYS B 1 604 ? -52.078 41.444  13.223  1.00 30.44  ? 604  LYS B CD    1 
ATOM   9612  C CE    . LYS B 1 604 ? -50.765 41.410  12.473  1.00 33.30  ? 604  LYS B CE    1 
ATOM   9613  N NZ    . LYS B 1 604 ? -51.027 41.567  11.012  1.00 34.83  ? 604  LYS B NZ    1 
ATOM   9614  N N     . THR B 1 605 ? -55.251 43.558  17.129  1.00 22.64  ? 605  THR B N     1 
ATOM   9615  C CA    . THR B 1 605 ? -56.679 43.691  17.380  1.00 22.47  ? 605  THR B CA    1 
ATOM   9616  C C     . THR B 1 605 ? -57.398 42.905  16.290  1.00 22.14  ? 605  THR B C     1 
ATOM   9617  O O     . THR B 1 605 ? -56.765 42.375  15.373  1.00 21.07  ? 605  THR B O     1 
ATOM   9618  C CB    . THR B 1 605 ? -57.150 45.160  17.332  1.00 22.50  ? 605  THR B CB    1 
ATOM   9619  O OG1   . THR B 1 605 ? -57.203 45.600  15.967  1.00 22.97  ? 605  THR B OG1   1 
ATOM   9620  C CG2   . THR B 1 605 ? -56.224 46.082  18.157  1.00 22.25  ? 605  THR B CG2   1 
ATOM   9621  N N     . ARG B 1 606 ? -58.720 42.844  16.384  1.00 22.22  ? 606  ARG B N     1 
ATOM   9622  C CA    . ARG B 1 606 ? -59.506 42.082  15.426  1.00 22.66  ? 606  ARG B CA    1 
ATOM   9623  C C     . ARG B 1 606 ? -59.621 42.779  14.061  1.00 23.64  ? 606  ARG B C     1 
ATOM   9624  O O     . ARG B 1 606 ? -59.957 42.146  13.061  1.00 23.90  ? 606  ARG B O     1 
ATOM   9625  C CB    . ARG B 1 606 ? -60.870 41.710  16.019  1.00 22.32  ? 606  ARG B CB    1 
ATOM   9626  C CG    . ARG B 1 606 ? -60.759 40.565  17.031  1.00 20.60  ? 606  ARG B CG    1 
ATOM   9627  C CD    . ARG B 1 606 ? -62.065 40.232  17.716  1.00 18.67  ? 606  ARG B CD    1 
ATOM   9628  N NE    . ARG B 1 606 ? -61.862 39.176  18.704  1.00 16.31  ? 606  ARG B NE    1 
ATOM   9629  C CZ    . ARG B 1 606 ? -61.540 39.379  19.979  1.00 16.07  ? 606  ARG B CZ    1 
ATOM   9630  N NH1   . ARG B 1 606 ? -61.402 40.616  20.466  1.00 15.29  ? 606  ARG B NH1   1 
ATOM   9631  N NH2   . ARG B 1 606 ? -61.378 38.336  20.780  1.00 15.23  ? 606  ARG B NH2   1 
ATOM   9632  N N     . SER B 1 607 ? -59.318 44.074  14.018  1.00 24.41  ? 607  SER B N     1 
ATOM   9633  C CA    . SER B 1 607 ? -59.271 44.785  12.747  1.00 25.70  ? 607  SER B CA    1 
ATOM   9634  C C     . SER B 1 607 ? -57.835 44.846  12.184  1.00 26.09  ? 607  SER B C     1 
ATOM   9635  O O     . SER B 1 607 ? -57.578 45.538  11.199  1.00 26.54  ? 607  SER B O     1 
ATOM   9636  C CB    . SER B 1 607 ? -59.907 46.173  12.872  1.00 25.72  ? 607  SER B CB    1 
ATOM   9637  O OG    . SER B 1 607 ? -59.121 47.013  13.699  1.00 27.93  ? 607  SER B OG    1 
ATOM   9638  N N     . GLY B 1 608 ? -56.913 44.121  12.817  1.00 26.21  ? 608  GLY B N     1 
ATOM   9639  C CA    . GLY B 1 608 ? -55.559 43.957  12.302  1.00 26.81  ? 608  GLY B CA    1 
ATOM   9640  C C     . GLY B 1 608 ? -54.520 44.981  12.745  1.00 27.11  ? 608  GLY B C     1 
ATOM   9641  O O     . GLY B 1 608 ? -53.390 44.975  12.243  1.00 27.32  ? 608  GLY B O     1 
ATOM   9642  N N     . LYS B 1 609 ? -54.895 45.858  13.676  1.00 27.28  ? 609  LYS B N     1 
ATOM   9643  C CA    . LYS B 1 609 ? -53.968 46.834  14.232  1.00 27.41  ? 609  LYS B CA    1 
ATOM   9644  C C     . LYS B 1 609 ? -53.037 46.179  15.243  1.00 27.69  ? 609  LYS B C     1 
ATOM   9645  O O     . LYS B 1 609 ? -53.473 45.419  16.110  1.00 27.32  ? 609  LYS B O     1 
ATOM   9646  C CB    . LYS B 1 609 ? -54.717 47.985  14.899  1.00 27.59  ? 609  LYS B CB    1 
ATOM   9647  N N     . ILE B 1 610 ? -51.751 46.488  15.128  1.00 27.79  ? 610  ILE B N     1 
ATOM   9648  C CA    . ILE B 1 610 ? -50.756 45.961  16.039  1.00 28.33  ? 610  ILE B CA    1 
ATOM   9649  C C     . ILE B 1 610 ? -50.898 46.611  17.431  1.00 28.15  ? 610  ILE B C     1 
ATOM   9650  O O     . ILE B 1 610 ? -51.088 47.825  17.538  1.00 27.45  ? 610  ILE B O     1 
ATOM   9651  C CB    . ILE B 1 610 ? -49.332 46.098  15.422  1.00 28.81  ? 610  ILE B CB    1 
ATOM   9652  C CG1   . ILE B 1 610 ? -48.300 45.250  16.166  1.00 29.54  ? 610  ILE B CG1   1 
ATOM   9653  C CG2   . ILE B 1 610 ? -48.905 47.564  15.322  1.00 30.84  ? 610  ILE B CG2   1 
ATOM   9654  C CD1   . ILE B 1 610 ? -47.698 45.937  17.340  1.00 30.53  ? 610  ILE B CD1   1 
ATOM   9655  N N     . MET B 1 611 ? -50.839 45.784  18.477  1.00 27.97  ? 611  MET B N     1 
ATOM   9656  C CA    . MET B 1 611 ? -50.964 46.234  19.870  1.00 28.08  ? 611  MET B CA    1 
ATOM   9657  C C     . MET B 1 611 ? -49.599 46.509  20.514  1.00 28.35  ? 611  MET B C     1 
ATOM   9658  O O     . MET B 1 611 ? -48.986 45.627  21.117  1.00 28.06  ? 611  MET B O     1 
ATOM   9659  C CB    . MET B 1 611 ? -51.751 45.204  20.692  1.00 27.99  ? 611  MET B CB    1 
ATOM   9660  N N     . ARG B 1 612 ? -49.151 47.755  20.413  1.00 28.69  ? 612  ARG B N     1 
ATOM   9661  C CA    . ARG B 1 612 ? -47.771 48.122  20.729  1.00 29.15  ? 612  ARG B CA    1 
ATOM   9662  C C     . ARG B 1 612 ? -47.388 48.140  22.205  1.00 28.95  ? 612  ARG B C     1 
ATOM   9663  O O     . ARG B 1 612 ? -46.230 47.892  22.541  1.00 28.63  ? 612  ARG B O     1 
ATOM   9664  C CB    . ARG B 1 612 ? -47.437 49.464  20.084  1.00 29.89  ? 612  ARG B CB    1 
ATOM   9665  C CG    . ARG B 1 612 ? -47.147 49.348  18.602  1.00 32.30  ? 612  ARG B CG    1 
ATOM   9666  C CD    . ARG B 1 612 ? -47.100 50.712  17.913  1.00 36.95  ? 612  ARG B CD    1 
ATOM   9667  N NE    . ARG B 1 612 ? -46.658 50.562  16.523  1.00 40.44  ? 612  ARG B NE    1 
ATOM   9668  C CZ    . ARG B 1 612 ? -47.464 50.659  15.468  1.00 42.11  ? 612  ARG B CZ    1 
ATOM   9669  N NH1   . ARG B 1 612 ? -48.755 50.923  15.633  1.00 43.65  ? 612  ARG B NH1   1 
ATOM   9670  N NH2   . ARG B 1 612 ? -46.983 50.497  14.243  1.00 42.58  ? 612  ARG B NH2   1 
ATOM   9671  N N     . ARG B 1 613 ? -48.354 48.430  23.078  1.00 28.83  ? 613  ARG B N     1 
ATOM   9672  C CA    . ARG B 1 613 ? -48.107 48.526  24.523  1.00 28.70  ? 613  ARG B CA    1 
ATOM   9673  C C     . ARG B 1 613 ? -47.627 47.207  25.141  1.00 28.41  ? 613  ARG B C     1 
ATOM   9674  O O     . ARG B 1 613 ? -46.748 47.205  26.003  1.00 28.30  ? 613  ARG B O     1 
ATOM   9675  C CB    . ARG B 1 613 ? -49.349 49.047  25.259  1.00 28.53  ? 613  ARG B CB    1 
ATOM   9676  N N     . ILE B 1 614 ? -48.206 46.094  24.697  1.00 27.91  ? 614  ILE B N     1 
ATOM   9677  C CA    . ILE B 1 614 ? -47.751 44.770  25.123  1.00 27.73  ? 614  ILE B CA    1 
ATOM   9678  C C     . ILE B 1 614 ? -46.340 44.449  24.582  1.00 26.92  ? 614  ILE B C     1 
ATOM   9679  O O     . ILE B 1 614 ? -45.505 43.922  25.306  1.00 26.84  ? 614  ILE B O     1 
ATOM   9680  C CB    . ILE B 1 614 ? -48.795 43.642  24.807  1.00 28.04  ? 614  ILE B CB    1 
ATOM   9681  C CG1   . ILE B 1 614 ? -48.207 42.252  25.037  1.00 29.18  ? 614  ILE B CG1   1 
ATOM   9682  C CG2   . ILE B 1 614 ? -49.308 43.721  23.390  1.00 28.54  ? 614  ILE B CG2   1 
ATOM   9683  C CD1   . ILE B 1 614 ? -48.523 41.675  26.409  1.00 31.74  ? 614  ILE B CD1   1 
ATOM   9684  N N     . LEU B 1 615 ? -46.071 44.797  23.329  1.00 26.14  ? 615  LEU B N     1 
ATOM   9685  C CA    . LEU B 1 615 ? -44.732 44.613  22.763  1.00 25.97  ? 615  LEU B CA    1 
ATOM   9686  C C     . LEU B 1 615 ? -43.668 45.408  23.529  1.00 26.16  ? 615  LEU B C     1 
ATOM   9687  O O     . LEU B 1 615 ? -42.558 44.918  23.780  1.00 25.42  ? 615  LEU B O     1 
ATOM   9688  C CB    . LEU B 1 615 ? -44.711 44.983  21.281  1.00 25.22  ? 615  LEU B CB    1 
ATOM   9689  C CG    . LEU B 1 615 ? -45.529 44.094  20.335  1.00 25.19  ? 615  LEU B CG    1 
ATOM   9690  C CD1   . LEU B 1 615 ? -45.372 44.599  18.922  1.00 23.65  ? 615  LEU B CD1   1 
ATOM   9691  C CD2   . LEU B 1 615 ? -45.115 42.638  20.432  1.00 23.13  ? 615  LEU B CD2   1 
ATOM   9692  N N     . ARG B 1 616 ? -44.035 46.634  23.893  1.00 26.36  ? 616  ARG B N     1 
ATOM   9693  C CA    . ARG B 1 616 ? -43.199 47.522  24.681  1.00 27.12  ? 616  ARG B CA    1 
ATOM   9694  C C     . ARG B 1 616 ? -42.799 46.871  25.996  1.00 26.40  ? 616  ARG B C     1 
ATOM   9695  O O     . ARG B 1 616 ? -41.623 46.864  26.345  1.00 26.71  ? 616  ARG B O     1 
ATOM   9696  C CB    . ARG B 1 616 ? -43.954 48.828  24.935  1.00 27.44  ? 616  ARG B CB    1 
ATOM   9697  C CG    . ARG B 1 616 ? -43.123 49.960  25.483  1.00 30.85  ? 616  ARG B CG    1 
ATOM   9698  C CD    . ARG B 1 616 ? -43.833 51.293  25.245  1.00 35.62  ? 616  ARG B CD    1 
ATOM   9699  N NE    . ARG B 1 616 ? -43.969 51.590  23.814  1.00 38.96  ? 616  ARG B NE    1 
ATOM   9700  C CZ    . ARG B 1 616 ? -45.119 51.826  23.179  1.00 41.12  ? 616  ARG B CZ    1 
ATOM   9701  N NH1   . ARG B 1 616 ? -46.280 51.830  23.834  1.00 40.56  ? 616  ARG B NH1   1 
ATOM   9702  N NH2   . ARG B 1 616 ? -45.104 52.077  21.872  1.00 42.28  ? 616  ARG B NH2   1 
ATOM   9703  N N     . LYS B 1 617 ? -43.778 46.311  26.703  1.00 25.99  ? 617  LYS B N     1 
ATOM   9704  C CA    . LYS B 1 617 ? -43.553 45.714  28.022  1.00 25.77  ? 617  LYS B CA    1 
ATOM   9705  C C     . LYS B 1 617 ? -42.756 44.412  27.943  1.00 25.52  ? 617  LYS B C     1 
ATOM   9706  O O     . LYS B 1 617 ? -41.862 44.172  28.748  1.00 24.87  ? 617  LYS B O     1 
ATOM   9707  C CB    . LYS B 1 617 ? -44.886 45.500  28.758  1.00 25.90  ? 617  LYS B CB    1 
ATOM   9708  N N     . ILE B 1 618 ? -43.074 43.576  26.962  1.00 25.62  ? 618  ILE B N     1 
ATOM   9709  C CA    . ILE B 1 618 ? -42.338 42.322  26.770  1.00 25.62  ? 618  ILE B CA    1 
ATOM   9710  C C     . ILE B 1 618 ? -40.858 42.610  26.476  1.00 25.74  ? 618  ILE B C     1 
ATOM   9711  O O     . ILE B 1 618 ? -39.968 42.022  27.100  1.00 25.31  ? 618  ILE B O     1 
ATOM   9712  C CB    . ILE B 1 618 ? -42.989 41.438  25.666  1.00 25.71  ? 618  ILE B CB    1 
ATOM   9713  C CG1   . ILE B 1 618 ? -44.347 40.901  26.156  1.00 25.55  ? 618  ILE B CG1   1 
ATOM   9714  C CG2   . ILE B 1 618 ? -42.062 40.288  25.274  1.00 25.50  ? 618  ILE B CG2   1 
ATOM   9715  C CD1   . ILE B 1 618 ? -45.221 40.273  25.074  1.00 25.35  ? 618  ILE B CD1   1 
ATOM   9716  N N     . ALA B 1 619 ? -40.610 43.542  25.555  1.00 25.66  ? 619  ALA B N     1 
ATOM   9717  C CA    . ALA B 1 619 ? -39.251 43.895  25.143  1.00 26.00  ? 619  ALA B CA    1 
ATOM   9718  C C     . ALA B 1 619 ? -38.409 44.475  26.285  1.00 26.47  ? 619  ALA B C     1 
ATOM   9719  O O     . ALA B 1 619 ? -37.202 44.255  26.337  1.00 26.20  ? 619  ALA B O     1 
ATOM   9720  C CB    . ALA B 1 619 ? -39.282 44.859  23.948  1.00 25.63  ? 619  ALA B CB    1 
ATOM   9721  N N     . ALA B 1 620 ? -39.051 45.218  27.186  1.00 27.31  ? 620  ALA B N     1 
ATOM   9722  C CA    . ALA B 1 620 ? -38.387 45.751  28.382  1.00 28.35  ? 620  ALA B CA    1 
ATOM   9723  C C     . ALA B 1 620 ? -38.116 44.678  29.466  1.00 29.15  ? 620  ALA B C     1 
ATOM   9724  O O     . ALA B 1 620 ? -37.338 44.912  30.392  1.00 29.39  ? 620  ALA B O     1 
ATOM   9725  C CB    . ALA B 1 620 ? -39.194 46.906  28.962  1.00 28.05  ? 620  ALA B CB    1 
ATOM   9726  N N     . GLY B 1 621 ? -38.737 43.508  29.343  1.00 29.52  ? 621  GLY B N     1 
ATOM   9727  C CA    . GLY B 1 621 ? -38.581 42.453  30.348  1.00 30.72  ? 621  GLY B CA    1 
ATOM   9728  C C     . GLY B 1 621 ? -39.747 42.346  31.323  1.00 31.61  ? 621  GLY B C     1 
ATOM   9729  O O     . GLY B 1 621 ? -39.797 41.421  32.145  1.00 31.70  ? 621  GLY B O     1 
ATOM   9730  N N     . ASP B 1 622 ? -40.686 43.289  31.221  1.00 32.32  ? 622  ASP B N     1 
ATOM   9731  C CA    . ASP B 1 622 ? -41.875 43.350  32.082  1.00 33.22  ? 622  ASP B CA    1 
ATOM   9732  C C     . ASP B 1 622 ? -42.954 42.347  31.662  1.00 33.64  ? 622  ASP B C     1 
ATOM   9733  O O     . ASP B 1 622 ? -42.659 41.250  31.152  1.00 34.58  ? 622  ASP B O     1 
ATOM   9734  C CB    . ASP B 1 622 ? -42.458 44.770  32.081  1.00 33.03  ? 622  ASP B CB    1 
ATOM   9735  N N     . ALA B 1 633 ? -57.018 39.452  19.597  1.00 30.10  ? 633  ALA B N     1 
ATOM   9736  C CA    . ALA B 1 633 ? -57.487 38.519  18.562  1.00 30.55  ? 633  ALA B CA    1 
ATOM   9737  C C     . ALA B 1 633 ? -57.048 37.067  18.794  1.00 30.70  ? 633  ALA B C     1 
ATOM   9738  O O     . ALA B 1 633 ? -57.877 36.152  18.749  1.00 30.49  ? 633  ALA B O     1 
ATOM   9739  C CB    . ALA B 1 633 ? -57.075 38.991  17.171  1.00 30.30  ? 633  ALA B CB    1 
ATOM   9740  N N     . ASP B 1 634 ? -55.748 36.863  19.010  1.00 30.90  ? 634  ASP B N     1 
ATOM   9741  C CA    . ASP B 1 634 ? -55.216 35.567  19.451  1.00 31.31  ? 634  ASP B CA    1 
ATOM   9742  C C     . ASP B 1 634 ? -54.387 35.761  20.719  1.00 31.21  ? 634  ASP B C     1 
ATOM   9743  O O     . ASP B 1 634 ? -53.196 36.083  20.638  1.00 31.26  ? 634  ASP B O     1 
ATOM   9744  C CB    . ASP B 1 634 ? -54.375 34.894  18.357  1.00 31.87  ? 634  ASP B CB    1 
ATOM   9745  C CG    . ASP B 1 634 ? -53.827 33.525  18.788  1.00 32.85  ? 634  ASP B CG    1 
ATOM   9746  O OD1   . ASP B 1 634 ? -54.273 32.986  19.830  1.00 34.16  ? 634  ASP B OD1   1 
ATOM   9747  O OD2   . ASP B 1 634 ? -52.949 32.988  18.080  1.00 32.81  ? 634  ASP B OD2   1 
ATOM   9748  N N     . PRO B 1 635 ? -55.013 35.555  21.895  1.00 31.08  ? 635  PRO B N     1 
ATOM   9749  C CA    . PRO B 1 635 ? -54.377 35.829  23.193  1.00 30.85  ? 635  PRO B CA    1 
ATOM   9750  C C     . PRO B 1 635 ? -53.185 34.911  23.490  1.00 30.34  ? 635  PRO B C     1 
ATOM   9751  O O     . PRO B 1 635 ? -52.342 35.243  24.331  1.00 30.31  ? 635  PRO B O     1 
ATOM   9752  C CB    . PRO B 1 635 ? -55.515 35.595  24.205  1.00 30.97  ? 635  PRO B CB    1 
ATOM   9753  C CG    . PRO B 1 635 ? -56.779 35.590  23.388  1.00 31.07  ? 635  PRO B CG    1 
ATOM   9754  C CD    . PRO B 1 635 ? -56.380 35.030  22.065  1.00 31.02  ? 635  PRO B CD    1 
ATOM   9755  N N     . GLY B 1 636 ? -53.115 33.782  22.786  1.00 29.72  ? 636  GLY B N     1 
ATOM   9756  C CA    . GLY B 1 636 ? -51.992 32.854  22.895  1.00 29.14  ? 636  GLY B CA    1 
ATOM   9757  C C     . GLY B 1 636 ? -50.650 33.327  22.337  1.00 28.73  ? 636  GLY B C     1 
ATOM   9758  O O     . GLY B 1 636 ? -49.644 32.633  22.503  1.00 28.66  ? 636  GLY B O     1 
ATOM   9759  N N     . VAL B 1 637 ? -50.622 34.490  21.678  1.00 28.24  ? 637  VAL B N     1 
ATOM   9760  C CA    . VAL B 1 637 ? -49.356 35.083  21.203  1.00 27.76  ? 637  VAL B CA    1 
ATOM   9761  C C     . VAL B 1 637 ? -48.483 35.591  22.350  1.00 27.74  ? 637  VAL B C     1 
ATOM   9762  O O     . VAL B 1 637 ? -47.260 35.621  22.229  1.00 27.61  ? 637  VAL B O     1 
ATOM   9763  C CB    . VAL B 1 637 ? -49.542 36.226  20.142  1.00 27.72  ? 637  VAL B CB    1 
ATOM   9764  C CG1   . VAL B 1 637 ? -50.310 35.731  18.908  1.00 27.29  ? 637  VAL B CG1   1 
ATOM   9765  C CG2   . VAL B 1 637 ? -50.196 37.483  20.749  1.00 27.91  ? 637  VAL B CG2   1 
ATOM   9766  N N     . VAL B 1 638 ? -49.116 35.977  23.455  1.00 27.70  ? 638  VAL B N     1 
ATOM   9767  C CA    . VAL B 1 638 ? -48.418 36.558  24.603  1.00 28.30  ? 638  VAL B CA    1 
ATOM   9768  C C     . VAL B 1 638 ? -47.384 35.587  25.196  1.00 28.88  ? 638  VAL B C     1 
ATOM   9769  O O     . VAL B 1 638 ? -46.235 35.978  25.460  1.00 28.77  ? 638  VAL B O     1 
ATOM   9770  C CB    . VAL B 1 638 ? -49.418 37.061  25.699  1.00 28.29  ? 638  VAL B CB    1 
ATOM   9771  C CG1   . VAL B 1 638 ? -48.678 37.680  26.883  1.00 28.14  ? 638  VAL B CG1   1 
ATOM   9772  C CG2   . VAL B 1 638 ? -50.404 38.068  25.111  1.00 27.90  ? 638  VAL B CG2   1 
ATOM   9773  N N     . GLU B 1 639 ? -47.791 34.329  25.379  1.00 29.24  ? 639  GLU B N     1 
ATOM   9774  C CA    . GLU B 1 639 ? -46.913 33.281  25.895  1.00 30.10  ? 639  GLU B CA    1 
ATOM   9775  C C     . GLU B 1 639 ? -45.779 32.965  24.921  1.00 29.72  ? 639  GLU B C     1 
ATOM   9776  O O     . GLU B 1 639 ? -44.636 32.767  25.342  1.00 30.04  ? 639  GLU B O     1 
ATOM   9777  C CB    . GLU B 1 639 ? -47.710 32.001  26.212  1.00 30.16  ? 639  GLU B CB    1 
ATOM   9778  C CG    . GLU B 1 639 ? -46.943 30.990  27.076  1.00 31.53  ? 639  GLU B CG    1 
ATOM   9779  C CD    . GLU B 1 639 ? -47.525 29.571  27.037  1.00 31.80  ? 639  GLU B CD    1 
ATOM   9780  O OE1   . GLU B 1 639 ? -48.748 29.398  27.260  1.00 34.82  ? 639  GLU B OE1   1 
ATOM   9781  O OE2   . GLU B 1 639 ? -46.746 28.621  26.801  1.00 33.85  ? 639  GLU B OE2   1 
ATOM   9782  N N     . LYS B 1 640 ? -46.098 32.914  23.628  1.00 29.41  ? 640  LYS B N     1 
ATOM   9783  C CA    . LYS B 1 640 ? -45.094 32.690  22.586  1.00 29.27  ? 640  LYS B CA    1 
ATOM   9784  C C     . LYS B 1 640 ? -44.057 33.827  22.499  1.00 29.34  ? 640  LYS B C     1 
ATOM   9785  O O     . LYS B 1 640 ? -42.855 33.566  22.397  1.00 29.11  ? 640  LYS B O     1 
ATOM   9786  C CB    . LYS B 1 640 ? -45.764 32.454  21.230  1.00 29.43  ? 640  LYS B CB    1 
ATOM   9787  N N     . LEU B 1 641 ? -44.509 35.080  22.561  1.00 29.21  ? 641  LEU B N     1 
ATOM   9788  C CA    . LEU B 1 641 ? -43.582 36.225  22.522  1.00 29.36  ? 641  LEU B CA    1 
ATOM   9789  C C     . LEU B 1 641 ? -42.663 36.238  23.740  1.00 29.92  ? 641  LEU B C     1 
ATOM   9790  O O     . LEU B 1 641 ? -41.494 36.593  23.629  1.00 29.75  ? 641  LEU B O     1 
ATOM   9791  C CB    . LEU B 1 641 ? -44.328 37.563  22.409  1.00 28.84  ? 641  LEU B CB    1 
ATOM   9792  C CG    . LEU B 1 641 ? -45.112 37.855  21.126  1.00 27.31  ? 641  LEU B CG    1 
ATOM   9793  C CD1   . LEU B 1 641 ? -46.167 38.924  21.369  1.00 26.37  ? 641  LEU B CD1   1 
ATOM   9794  C CD2   . LEU B 1 641 ? -44.189 38.236  19.980  1.00 26.36  ? 641  LEU B CD2   1 
ATOM   9795  N N     . LEU B 1 642 ? -43.205 35.846  24.892  1.00 30.71  ? 642  LEU B N     1 
ATOM   9796  C CA    . LEU B 1 642 ? -42.450 35.772  26.145  1.00 31.66  ? 642  LEU B CA    1 
ATOM   9797  C C     . LEU B 1 642 ? -41.323 34.742  26.103  1.00 32.45  ? 642  LEU B C     1 
ATOM   9798  O O     . LEU B 1 642 ? -40.194 35.040  26.509  1.00 32.56  ? 642  LEU B O     1 
ATOM   9799  C CB    . LEU B 1 642 ? -43.383 35.495  27.326  1.00 31.36  ? 642  LEU B CB    1 
ATOM   9800  C CG    . LEU B 1 642 ? -44.130 36.705  27.893  1.00 31.52  ? 642  LEU B CG    1 
ATOM   9801  C CD1   . LEU B 1 642 ? -45.169 36.272  28.925  1.00 31.98  ? 642  LEU B CD1   1 
ATOM   9802  C CD2   . LEU B 1 642 ? -43.166 37.718  28.493  1.00 30.78  ? 642  LEU B CD2   1 
ATOM   9803  N N     . GLU B 1 643 ? -41.634 33.542  25.608  1.00 33.23  ? 643  GLU B N     1 
ATOM   9804  C CA    . GLU B 1 643 ? -40.633 32.493  25.400  1.00 34.38  ? 643  GLU B CA    1 
ATOM   9805  C C     . GLU B 1 643 ? -39.544 32.965  24.434  1.00 34.25  ? 643  GLU B C     1 
ATOM   9806  O O     . GLU B 1 643 ? -38.354 32.894  24.745  1.00 34.12  ? 643  GLU B O     1 
ATOM   9807  C CB    . GLU B 1 643 ? -41.278 31.226  24.838  1.00 34.30  ? 643  GLU B CB    1 
ATOM   9808  C CG    . GLU B 1 643 ? -42.087 30.411  25.831  1.00 35.69  ? 643  GLU B CG    1 
ATOM   9809  C CD    . GLU B 1 643 ? -42.738 29.196  25.177  1.00 36.03  ? 643  GLU B CD    1 
ATOM   9810  O OE1   . GLU B 1 643 ? -42.862 28.150  25.852  1.00 38.23  ? 643  GLU B OE1   1 
ATOM   9811  O OE2   . GLU B 1 643 ? -43.118 29.287  23.984  1.00 38.20  ? 643  GLU B OE2   1 
ATOM   9812  N N     . GLU B 1 644 ? -39.967 33.450  23.268  1.00 34.27  ? 644  GLU B N     1 
ATOM   9813  C CA    . GLU B 1 644 ? -39.049 33.962  22.255  1.00 34.57  ? 644  GLU B CA    1 
ATOM   9814  C C     . GLU B 1 644 ? -38.113 35.020  22.836  1.00 35.12  ? 644  GLU B C     1 
ATOM   9815  O O     . GLU B 1 644 ? -36.914 35.019  22.552  1.00 34.91  ? 644  GLU B O     1 
ATOM   9816  C CB    . GLU B 1 644 ? -39.828 34.531  21.065  1.00 34.30  ? 644  GLU B CB    1 
ATOM   9817  C CG    . GLU B 1 644 ? -40.566 33.483  20.246  1.00 33.85  ? 644  GLU B CG    1 
ATOM   9818  C CD    . GLU B 1 644 ? -41.613 34.077  19.313  1.00 34.45  ? 644  GLU B CD    1 
ATOM   9819  O OE1   . GLU B 1 644 ? -41.861 35.301  19.373  1.00 34.30  ? 644  GLU B OE1   1 
ATOM   9820  O OE2   . GLU B 1 644 ? -42.199 33.311  18.515  1.00 34.60  ? 644  GLU B OE2   1 
ATOM   9821  N N     . LYS B 1 645 ? -38.668 35.904  23.662  1.00 35.95  ? 645  LYS B N     1 
ATOM   9822  C CA    . LYS B 1 645 ? -37.916 37.004  24.252  1.00 37.30  ? 645  LYS B CA    1 
ATOM   9823  C C     . LYS B 1 645 ? -36.833 36.502  25.215  1.00 38.08  ? 645  LYS B C     1 
ATOM   9824  O O     . LYS B 1 645 ? -35.696 36.993  25.199  1.00 38.31  ? 645  LYS B O     1 
ATOM   9825  C CB    . LYS B 1 645 ? -38.863 37.975  24.963  1.00 37.19  ? 645  LYS B CB    1 
ATOM   9826  C CG    . LYS B 1 645 ? -38.352 39.405  25.035  1.00 38.04  ? 645  LYS B CG    1 
ATOM   9827  C CD    . LYS B 1 645 ? -37.395 39.592  26.176  1.00 38.61  ? 645  LYS B CD    1 
ATOM   9828  C CE    . LYS B 1 645 ? -36.523 40.808  25.980  1.00 39.00  ? 645  LYS B CE    1 
ATOM   9829  N NZ    . LYS B 1 645 ? -35.555 40.893  27.112  1.00 39.01  ? 645  LYS B NZ    1 
ATOM   9830  N N     . GLN B 1 646 ? -37.185 35.520  26.040  1.00 38.82  ? 646  GLN B N     1 
ATOM   9831  C CA    . GLN B 1 646 ? -36.251 34.958  27.012  1.00 39.68  ? 646  GLN B CA    1 
ATOM   9832  C C     . GLN B 1 646 ? -35.053 34.268  26.336  1.00 39.66  ? 646  GLN B C     1 
ATOM   9833  O O     . GLN B 1 646 ? -33.955 34.225  26.905  1.00 39.63  ? 646  GLN B O     1 
ATOM   9834  C CB    . GLN B 1 646 ? -36.979 34.002  27.966  1.00 40.12  ? 646  GLN B CB    1 
ATOM   9835  C CG    . GLN B 1 646 ? -36.656 34.234  29.448  1.00 42.13  ? 646  GLN B CG    1 
ATOM   9836  C CD    . GLN B 1 646 ? -35.288 33.700  29.857  1.00 44.95  ? 646  GLN B CD    1 
ATOM   9837  O OE1   . GLN B 1 646 ? -35.036 32.492  29.802  1.00 46.69  ? 646  GLN B OE1   1 
ATOM   9838  N NE2   . GLN B 1 646 ? -34.403 34.599  30.289  1.00 45.16  ? 646  GLN B NE2   1 
ATOM   9839  N N     . ALA B 1 647 ? -35.266 33.751  25.123  1.00 39.65  ? 647  ALA B N     1 
ATOM   9840  C CA    . ALA B 1 647 ? -34.194 33.151  24.318  1.00 39.59  ? 647  ALA B CA    1 
ATOM   9841  C C     . ALA B 1 647 ? -33.217 34.183  23.725  1.00 39.70  ? 647  ALA B C     1 
ATOM   9842  O O     . ALA B 1 647 ? -33.607 35.285  23.303  1.00 39.64  ? 647  ALA B O     1 
ATOM   9843  C CB    . ALA B 1 647 ? -34.784 32.271  23.219  1.00 39.55  ? 647  ALA B CB    1 
HETATM 9844  O "O2'" . PRX C 2 .   ? -9.716  26.333  25.579  1.00 12.96  ? 998  PRX A "O2'" 1 
HETATM 9845  C "C2'" . PRX C 2 .   ? -8.838  26.101  24.473  1.00 13.29  ? 998  PRX A "C2'" 1 
HETATM 9846  C "C1'" . PRX C 2 .   ? -8.886  27.351  23.622  1.00 14.08  ? 998  PRX A "C1'" 1 
HETATM 9847  O "O4'" . PRX C 2 .   ? -7.747  28.157  23.981  1.00 13.73  ? 998  PRX A "O4'" 1 
HETATM 9848  C "C4'" . PRX C 2 .   ? -6.975  27.500  24.984  1.00 14.99  ? 998  PRX A "C4'" 1 
HETATM 9849  C "C5'" . PRX C 2 .   ? -5.483  27.729  24.765  1.00 15.32  ? 998  PRX A "C5'" 1 
HETATM 9850  O "O5'" . PRX C 2 .   ? -5.227  29.133  24.705  1.00 14.62  ? 998  PRX A "O5'" 1 
HETATM 9851  P P     . PRX C 2 .   ? -3.722  29.651  24.484  1.00 15.25  ? 998  PRX A P     1 
HETATM 9852  O O1P   . PRX C 2 .   ? -2.796  28.768  25.286  1.00 12.42  ? 998  PRX A O1P   1 
HETATM 9853  O O2P   . PRX C 2 .   ? -3.735  31.150  24.649  1.00 14.46  ? 998  PRX A O2P   1 
HETATM 9854  O O3P   . PRX C 2 .   ? -3.449  29.318  22.933  1.00 16.34  ? 998  PRX A O3P   1 
HETATM 9855  C C1P   . PRX C 2 .   ? -4.201  29.905  21.877  1.00 17.09  ? 998  PRX A C1P   1 
HETATM 9856  C C2P   . PRX C 2 .   ? -3.659  29.327  20.575  1.00 17.88  ? 998  PRX A C2P   1 
HETATM 9857  C C3P   . PRX C 2 .   ? -4.176  27.934  20.335  1.00 16.16  ? 998  PRX A C3P   1 
HETATM 9858  C "C3'" . PRX C 2 .   ? -7.377  26.039  24.877  1.00 14.17  ? 998  PRX A "C3'" 1 
HETATM 9859  O "O3'" . PRX C 2 .   ? -7.176  25.311  26.088  1.00 15.12  ? 998  PRX A "O3'" 1 
HETATM 9860  N N9    . PRX C 2 .   ? -8.851  26.941  22.195  1.00 14.42  ? 998  PRX A N9    1 
HETATM 9861  C C8    . PRX C 2 .   ? -7.811  27.069  21.374  1.00 13.20  ? 998  PRX A C8    1 
HETATM 9862  N N7    . PRX C 2 .   ? -8.157  26.593  20.160  1.00 14.04  ? 998  PRX A N7    1 
HETATM 9863  C C5    . PRX C 2 .   ? -9.430  26.157  20.223  1.00 13.45  ? 998  PRX A C5    1 
HETATM 9864  C C4    . PRX C 2 .   ? -9.870  26.377  21.513  1.00 13.32  ? 998  PRX A C4    1 
HETATM 9865  N N3    . PRX C 2 .   ? -11.133 26.003  21.853  1.00 13.50  ? 998  PRX A N3    1 
HETATM 9866  C C2    . PRX C 2 .   ? -11.956 25.448  20.946  1.00 13.40  ? 998  PRX A C2    1 
HETATM 9867  N N1    . PRX C 2 .   ? -11.548 25.227  19.685  1.00 13.36  ? 998  PRX A N1    1 
HETATM 9868  C C6    . PRX C 2 .   ? -10.298 25.579  19.298  1.00 14.09  ? 998  PRX A C6    1 
HETATM 9869  N N6    . PRX C 2 .   ? -9.883  25.375  18.028  1.00 14.03  ? 998  PRX A N6    1 
HETATM 9870  O "O2'" . PRX D 2 .   ? -38.602 64.247  24.532  1.00 16.25  ? 999  PRX B "O2'" 1 
HETATM 9871  C "C2'" . PRX D 2 .   ? -37.995 65.556  24.518  1.00 16.68  ? 999  PRX B "C2'" 1 
HETATM 9872  C "C1'" . PRX D 2 .   ? -36.522 65.368  24.262  1.00 16.88  ? 999  PRX B "C1'" 1 
HETATM 9873  O "O4'" . PRX D 2 .   ? -36.321 65.520  22.839  1.00 14.40  ? 999  PRX B "O4'" 1 
HETATM 9874  C "C4'" . PRX D 2 .   ? -37.543 65.865  22.194  1.00 15.81  ? 999  PRX B "C4'" 1 
HETATM 9875  C "C5'" . PRX D 2 .   ? -37.316 66.912  21.104  1.00 14.75  ? 999  PRX B "C5'" 1 
HETATM 9876  O "O5'" . PRX D 2 .   ? -36.466 66.385  20.069  1.00 14.18  ? 999  PRX B "O5'" 1 
HETATM 9877  P P     . PRX D 2 .   ? -36.018 67.310  18.827  1.00 15.74  ? 999  PRX B P     1 
HETATM 9878  O O1P   . PRX D 2 .   ? -37.297 67.855  18.221  1.00 14.00  ? 999  PRX B O1P   1 
HETATM 9879  O O2P   . PRX D 2 .   ? -35.101 66.519  17.943  1.00 14.03  ? 999  PRX B O2P   1 
HETATM 9880  O O3P   . PRX D 2 .   ? -35.216 68.530  19.540  1.00 17.09  ? 999  PRX B O3P   1 
HETATM 9881  C C1P   . PRX D 2 .   ? -33.927 68.317  20.113  1.00 19.63  ? 999  PRX B C1P   1 
HETATM 9882  C C2P   . PRX D 2 .   ? -33.378 69.601  20.713  1.00 20.23  ? 999  PRX B C2P   1 
HETATM 9883  C C3P   . PRX D 2 .   ? -34.222 70.057  21.879  1.00 21.95  ? 999  PRX B C3P   1 
HETATM 9884  C "C3'" . PRX D 2 .   ? -38.437 66.367  23.321  1.00 15.97  ? 999  PRX B "C3'" 1 
HETATM 9885  O "O3'" . PRX D 2 .   ? -39.813 66.138  23.035  1.00 15.78  ? 999  PRX B "O3'" 1 
HETATM 9886  N N9    . PRX D 2 .   ? -35.793 66.414  25.032  1.00 17.56  ? 999  PRX B N9    1 
HETATM 9887  C C8    . PRX D 2 .   ? -35.223 67.514  24.500  1.00 17.18  ? 999  PRX B C8    1 
HETATM 9888  N N7    . PRX D 2 .   ? -34.652 68.237  25.483  1.00 17.39  ? 999  PRX B N7    1 
HETATM 9889  C C5    . PRX D 2 .   ? -34.871 67.572  26.643  1.00 16.67  ? 999  PRX B C5    1 
HETATM 9890  C C4    . PRX D 2 .   ? -35.593 66.430  26.353  1.00 15.67  ? 999  PRX B C4    1 
HETATM 9891  N N3    . PRX D 2 .   ? -35.950 65.585  27.356  1.00 16.99  ? 999  PRX B N3    1 
HETATM 9892  C C2    . PRX D 2 .   ? -35.607 65.858  28.628  1.00 16.82  ? 999  PRX B C2    1 
HETATM 9893  N N1    . PRX D 2 .   ? -34.898 66.958  28.927  1.00 17.50  ? 999  PRX B N1    1 
HETATM 9894  C C6    . PRX D 2 .   ? -34.514 67.821  27.962  1.00 17.36  ? 999  PRX B C6    1 
HETATM 9895  N N6    . PRX D 2 .   ? -33.803 68.933  28.285  1.00 17.97  ? 999  PRX B N6    1 
HETATM 9896  O O     . HOH E 3 .   ? 6.033   36.335  27.599  1.00 17.88  ? 999  HOH A O     1 
HETATM 9897  O O     . HOH E 3 .   ? 16.088  47.933  10.806  1.00 24.21  ? 1000 HOH A O     1 
HETATM 9898  O O     . HOH E 3 .   ? -20.965 20.655  9.015   1.00 19.15  ? 1001 HOH A O     1 
HETATM 9899  O O     . HOH E 3 .   ? 22.511  35.932  0.438   1.00 40.32  ? 1002 HOH A O     1 
HETATM 9900  O O     . HOH E 3 .   ? -14.403 20.519  10.963  1.00 15.86  ? 1003 HOH A O     1 
HETATM 9901  O O     . HOH E 3 .   ? -14.751 22.653  1.718   1.00 21.11  ? 1004 HOH A O     1 
HETATM 9902  O O     . HOH E 3 .   ? -13.766 20.364  2.853   1.00 24.52  ? 1005 HOH A O     1 
HETATM 9903  O O     . HOH E 3 .   ? -12.066 11.430  4.556   1.00 22.28  ? 1006 HOH A O     1 
HETATM 9904  O O     . HOH E 3 .   ? -11.746 18.970  3.969   1.00 14.04  ? 1007 HOH A O     1 
HETATM 9905  O O     . HOH E 3 .   ? -8.140  13.858  -1.014  1.00 26.23  ? 1008 HOH A O     1 
HETATM 9906  O O     . HOH E 3 .   ? -10.006 25.552  -2.174  1.00 13.80  ? 1009 HOH A O     1 
HETATM 9907  O O     . HOH E 3 .   ? -4.648  17.305  3.475   1.00 14.85  ? 1010 HOH A O     1 
HETATM 9908  O O     . HOH E 3 .   ? 6.390   59.393  26.953  1.00 50.26  ? 1011 HOH A O     1 
HETATM 9909  O O     . HOH E 3 .   ? -6.138  13.228  -2.994  1.00 23.64  ? 1012 HOH A O     1 
HETATM 9910  O O     . HOH E 3 .   ? 0.579   12.129  -1.579  1.00 124.42 ? 1013 HOH A O     1 
HETATM 9911  O O     . HOH E 3 .   ? 3.526   11.921  0.861   1.00 23.55  ? 1014 HOH A O     1 
HETATM 9912  O O     . HOH E 3 .   ? -1.691  10.389  -4.620  1.00 46.09  ? 1015 HOH A O     1 
HETATM 9913  O O     . HOH E 3 .   ? -9.525  9.531   7.485   1.00 29.87  ? 1016 HOH A O     1 
HETATM 9914  O O     . HOH E 3 .   ? 6.502   53.268  8.471   1.00 39.17  ? 1017 HOH A O     1 
HETATM 9915  O O     . HOH E 3 .   ? 7.703   17.126  5.349   1.00 20.09  ? 1018 HOH A O     1 
HETATM 9916  O O     . HOH E 3 .   ? 19.337  11.877  12.302  1.00 28.67  ? 1019 HOH A O     1 
HETATM 9917  O O     . HOH E 3 .   ? 15.629  51.144  34.351  1.00 32.84  ? 1020 HOH A O     1 
HETATM 9918  O O     . HOH E 3 .   ? 15.513  12.595  22.627  1.00 20.21  ? 1021 HOH A O     1 
HETATM 9919  O O     . HOH E 3 .   ? 5.130   14.993  39.258  1.00 34.83  ? 1022 HOH A O     1 
HETATM 9920  O O     . HOH E 3 .   ? 13.971  19.089  20.896  1.00 16.37  ? 1023 HOH A O     1 
HETATM 9921  O O     . HOH E 3 .   ? 19.641  17.480  25.073  1.00 63.71  ? 1024 HOH A O     1 
HETATM 9922  O O     . HOH E 3 .   ? 27.249  20.749  17.145  1.00 29.45  ? 1025 HOH A O     1 
HETATM 9923  O O     . HOH E 3 .   ? 20.702  23.841  11.805  1.00 16.43  ? 1026 HOH A O     1 
HETATM 9924  O O     . HOH E 3 .   ? 18.388  28.472  17.383  1.00 16.38  ? 1027 HOH A O     1 
HETATM 9925  O O     . HOH E 3 .   ? 18.175  27.699  -0.713  1.00 24.62  ? 1028 HOH A O     1 
HETATM 9926  O O     . HOH E 3 .   ? 18.076  50.173  33.649  1.00 36.42  ? 1029 HOH A O     1 
HETATM 9927  O O     . HOH E 3 .   ? 21.172  35.184  -1.555  1.00 35.36  ? 1030 HOH A O     1 
HETATM 9928  O O     . HOH E 3 .   ? 10.971  39.923  -1.949  1.00 24.52  ? 1031 HOH A O     1 
HETATM 9929  O O     . HOH E 3 .   ? 5.721   35.528  -2.470  1.00 20.74  ? 1032 HOH A O     1 
HETATM 9930  O O     . HOH E 3 .   ? 1.104   35.349  8.498   1.00 13.44  ? 1033 HOH A O     1 
HETATM 9931  O O     . HOH E 3 .   ? -6.304  48.331  10.667  1.00 15.03  ? 1034 HOH A O     1 
HETATM 9932  O O     . HOH E 3 .   ? -5.750  51.846  5.918   1.00 19.78  ? 1035 HOH A O     1 
HETATM 9933  O O     . HOH E 3 .   ? -5.585  46.543  2.823   1.00 25.71  ? 1036 HOH A O     1 
HETATM 9934  O O     . HOH E 3 .   ? 25.525  32.820  21.424  1.00 22.64  ? 1037 HOH A O     1 
HETATM 9935  O O     . HOH E 3 .   ? 19.292  28.879  24.755  1.00 17.39  ? 1038 HOH A O     1 
HETATM 9936  O O     . HOH E 3 .   ? 17.476  29.807  21.815  1.00 20.52  ? 1039 HOH A O     1 
HETATM 9937  O O     . HOH E 3 .   ? 5.267   42.330  21.663  1.00 18.08  ? 1040 HOH A O     1 
HETATM 9938  O O     . HOH E 3 .   ? 2.272   49.585  14.908  1.00 27.61  ? 1041 HOH A O     1 
HETATM 9939  O O     . HOH E 3 .   ? 0.554   46.769  15.517  1.00 24.57  ? 1042 HOH A O     1 
HETATM 9940  O O     . HOH E 3 .   ? 8.270   34.543  23.638  1.00 14.98  ? 1043 HOH A O     1 
HETATM 9941  O O     . HOH E 3 .   ? 2.622   37.843  25.540  1.00 13.40  ? 1044 HOH A O     1 
HETATM 9942  O O     . HOH E 3 .   ? 2.646   37.146  28.081  1.00 25.16  ? 1045 HOH A O     1 
HETATM 9943  O O     . HOH E 3 .   ? 14.016  42.276  37.306  1.00 24.14  ? 1046 HOH A O     1 
HETATM 9944  O O     . HOH E 3 .   ? 14.098  39.700  38.652  1.00 27.20  ? 1047 HOH A O     1 
HETATM 9945  O O     . HOH E 3 .   ? 5.333   55.670  24.396  1.00 16.23  ? 1048 HOH A O     1 
HETATM 9946  O O     . HOH E 3 .   ? 11.951  54.291  33.675  1.00 22.71  ? 1049 HOH A O     1 
HETATM 9947  O O     . HOH E 3 .   ? 25.689  27.058  21.508  1.00 23.64  ? 1050 HOH A O     1 
HETATM 9948  O O     . HOH E 3 .   ? -2.925  33.245  35.553  1.00 15.85  ? 1051 HOH A O     1 
HETATM 9949  O O     . HOH E 3 .   ? 9.075   22.724  23.321  1.00 17.12  ? 1052 HOH A O     1 
HETATM 9950  O O     . HOH E 3 .   ? 11.052  21.401  21.670  1.00 18.28  ? 1053 HOH A O     1 
HETATM 9951  O O     . HOH E 3 .   ? 5.502   23.390  17.700  1.00 14.26  ? 1054 HOH A O     1 
HETATM 9952  O O     . HOH E 3 .   ? -2.154  18.403  3.465   1.00 19.44  ? 1055 HOH A O     1 
HETATM 9953  O O     . HOH E 3 .   ? -11.327 49.167  4.849   1.00 15.40  ? 1056 HOH A O     1 
HETATM 9954  O O     . HOH E 3 .   ? -13.283 41.547  5.642   1.00 11.25  ? 1057 HOH A O     1 
HETATM 9955  O O     . HOH E 3 .   ? -8.323  37.408  -3.639  1.00 13.53  ? 1058 HOH A O     1 
HETATM 9956  O O     . HOH E 3 .   ? -21.693 37.772  14.871  1.00 19.78  ? 1059 HOH A O     1 
HETATM 9957  O O     . HOH E 3 .   ? -25.701 42.039  12.751  1.00 16.46  ? 1060 HOH A O     1 
HETATM 9958  O O     . HOH E 3 .   ? -23.362 38.280  5.168   1.00 15.80  ? 1061 HOH A O     1 
HETATM 9959  O O     . HOH E 3 .   ? -25.577 41.908  4.955   1.00 11.74  ? 1062 HOH A O     1 
HETATM 9960  O O     . HOH E 3 .   ? -13.996 47.050  -0.497  1.00 27.10  ? 1063 HOH A O     1 
HETATM 9961  O O     . HOH E 3 .   ? -8.274  38.146  -6.328  1.00 27.35  ? 1064 HOH A O     1 
HETATM 9962  O O     . HOH E 3 .   ? -12.713 32.904  -1.469  1.00 19.35  ? 1065 HOH A O     1 
HETATM 9963  O O     . HOH E 3 .   ? -11.966 30.727  -2.850  1.00 23.03  ? 1066 HOH A O     1 
HETATM 9964  O O     . HOH E 3 .   ? -10.054 28.141  -4.370  1.00 32.38  ? 1067 HOH A O     1 
HETATM 9965  O O     . HOH E 3 .   ? -11.619 27.825  16.173  1.00 12.02  ? 1068 HOH A O     1 
HETATM 9966  O O     . HOH E 3 .   ? -15.012 23.564  13.219  1.00 27.50  ? 1069 HOH A O     1 
HETATM 9967  O O     . HOH E 3 .   ? -13.089 22.845  10.514  1.00 11.89  ? 1070 HOH A O     1 
HETATM 9968  O O     . HOH E 3 .   ? -15.043 28.017  1.844   1.00 19.95  ? 1071 HOH A O     1 
HETATM 9969  O O     . HOH E 3 .   ? -5.157  15.862  12.305  1.00 17.93  ? 1072 HOH A O     1 
HETATM 9970  O O     . HOH E 3 .   ? -13.097 12.184  6.821   1.00 18.83  ? 1073 HOH A O     1 
HETATM 9971  O O     . HOH E 3 .   ? -14.404 21.666  18.281  1.00 12.01  ? 1074 HOH A O     1 
HETATM 9972  O O     . HOH E 3 .   ? 0.317   12.094  22.074  1.00 11.45  ? 1075 HOH A O     1 
HETATM 9973  O O     . HOH E 3 .   ? -11.385 8.471   25.722  1.00 18.77  ? 1076 HOH A O     1 
HETATM 9974  O O     . HOH E 3 .   ? 2.891   24.413  42.492  1.00 46.73  ? 1077 HOH A O     1 
HETATM 9975  O O     . HOH E 3 .   ? -2.796  15.289  34.710  1.00 17.67  ? 1078 HOH A O     1 
HETATM 9976  O O     . HOH E 3 .   ? -4.513  22.885  33.786  1.00 36.92  ? 1079 HOH A O     1 
HETATM 9977  O O     . HOH E 3 .   ? -8.591  46.061  48.570  1.00 14.39  ? 1080 HOH A O     1 
HETATM 9978  O O     . HOH E 3 .   ? -0.024  49.591  34.972  1.00 25.43  ? 1081 HOH A O     1 
HETATM 9979  O O     . HOH E 3 .   ? -22.059 32.140  33.449  1.00 27.73  ? 1082 HOH A O     1 
HETATM 9980  O O     . HOH E 3 .   ? 13.699  49.510  39.194  1.00 33.23  ? 1083 HOH A O     1 
HETATM 9981  O O     . HOH E 3 .   ? 14.651  49.417  36.050  1.00 28.47  ? 1084 HOH A O     1 
HETATM 9982  O O     . HOH E 3 .   ? -9.598  56.164  37.756  1.00 27.01  ? 1085 HOH A O     1 
HETATM 9983  O O     . HOH E 3 .   ? 13.349  54.270  36.048  1.00 28.59  ? 1086 HOH A O     1 
HETATM 9984  O O     . HOH E 3 .   ? -34.886 25.201  41.629  1.00 40.56  ? 1087 HOH A O     1 
HETATM 9985  O O     . HOH E 3 .   ? 4.733   12.527  2.933   1.00 53.71  ? 1088 HOH A O     1 
HETATM 9986  O O     . HOH E 3 .   ? -20.338 18.599  1.022   1.00 26.53  ? 1089 HOH A O     1 
HETATM 9987  O O     . HOH E 3 .   ? -15.033 13.768  0.647   1.00 25.80  ? 1090 HOH A O     1 
HETATM 9988  O O     . HOH E 3 .   ? -13.254 11.213  2.147   1.00 34.38  ? 1091 HOH A O     1 
HETATM 9989  O O     . HOH E 3 .   ? -3.839  12.100  -3.088  1.00 27.18  ? 1092 HOH A O     1 
HETATM 9990  O O     . HOH E 3 .   ? -2.457  7.265   -1.205  1.00 34.35  ? 1093 HOH A O     1 
HETATM 9991  O O     . HOH E 3 .   ? 3.918   6.356   7.688   1.00 28.22  ? 1094 HOH A O     1 
HETATM 9992  O O     . HOH E 3 .   ? 9.326   3.916   18.492  1.00 32.69  ? 1095 HOH A O     1 
HETATM 9993  O O     . HOH E 3 .   ? 7.557   10.298  8.759   1.00 23.09  ? 1096 HOH A O     1 
HETATM 9994  O O     . HOH E 3 .   ? 15.555  19.725  5.779   1.00 29.22  ? 1097 HOH A O     1 
HETATM 9995  O O     . HOH E 3 .   ? 17.863  17.237  7.464   1.00 36.57  ? 1098 HOH A O     1 
HETATM 9996  O O     . HOH E 3 .   ? 9.751   7.651   25.604  1.00 28.94  ? 1099 HOH A O     1 
HETATM 9997  O O     . HOH E 3 .   ? 5.610   10.458  27.412  1.00 38.57  ? 1100 HOH A O     1 
HETATM 9998  O O     . HOH E 3 .   ? 1.806   12.156  36.490  1.00 23.59  ? 1101 HOH A O     1 
HETATM 9999  O O     . HOH E 3 .   ? 9.911   18.111  31.153  1.00 29.02  ? 1102 HOH A O     1 
HETATM 10000 O O     . HOH E 3 .   ? 21.159  29.018  1.441   1.00 23.99  ? 1103 HOH A O     1 
HETATM 10001 O O     . HOH E 3 .   ? 8.188   36.242  -3.665  1.00 27.21  ? 1104 HOH A O     1 
HETATM 10002 O O     . HOH E 3 .   ? 0.328   52.292  9.034   1.00 17.40  ? 1105 HOH A O     1 
HETATM 10003 O O     . HOH E 3 .   ? -3.070  54.428  10.740  1.00 23.01  ? 1106 HOH A O     1 
HETATM 10004 O O     . HOH E 3 .   ? 1.851   41.550  -2.391  1.00 27.20  ? 1107 HOH A O     1 
HETATM 10005 O O     . HOH E 3 .   ? 1.606   38.992  -2.784  1.00 24.30  ? 1108 HOH A O     1 
HETATM 10006 O O     . HOH E 3 .   ? 25.303  47.868  17.148  1.00 27.10  ? 1109 HOH A O     1 
HETATM 10007 O O     . HOH E 3 .   ? 28.752  44.226  14.603  1.00 31.68  ? 1110 HOH A O     1 
HETATM 10008 O O     . HOH E 3 .   ? 27.621  39.178  24.231  1.00 27.94  ? 1111 HOH A O     1 
HETATM 10009 O O     . HOH E 3 .   ? 18.031  36.440  31.919  1.00 25.23  ? 1112 HOH A O     1 
HETATM 10010 O O     . HOH E 3 .   ? 7.730   49.394  10.799  1.00 33.80  ? 1113 HOH A O     1 
HETATM 10011 O O     . HOH E 3 .   ? 15.121  33.086  21.378  1.00 29.16  ? 1114 HOH A O     1 
HETATM 10012 O O     . HOH E 3 .   ? 24.805  31.844  16.686  1.00 21.47  ? 1115 HOH A O     1 
HETATM 10013 O O     . HOH E 3 .   ? 20.658  28.192  26.920  1.00 23.64  ? 1116 HOH A O     1 
HETATM 10014 O O     . HOH E 3 .   ? 19.478  28.310  29.329  1.00 33.04  ? 1117 HOH A O     1 
HETATM 10015 O O     . HOH E 3 .   ? 2.279   42.814  20.757  1.00 20.29  ? 1118 HOH A O     1 
HETATM 10016 O O     . HOH E 3 .   ? -2.366  41.793  16.248  1.00 34.08  ? 1119 HOH A O     1 
HETATM 10017 O O     . HOH E 3 .   ? -5.141  44.813  26.324  1.00 24.19  ? 1120 HOH A O     1 
HETATM 10018 O O     . HOH E 3 .   ? 4.726   48.999  37.924  1.00 36.89  ? 1121 HOH A O     1 
HETATM 10019 O O     . HOH E 3 .   ? 6.317   38.972  39.040  1.00 29.20  ? 1122 HOH A O     1 
HETATM 10020 O O     . HOH E 3 .   ? -4.405  55.515  8.666   1.00 37.13  ? 1123 HOH A O     1 
HETATM 10021 O O     . HOH E 3 .   ? 8.414   57.603  27.193  1.00 46.03  ? 1124 HOH A O     1 
HETATM 10022 O O     . HOH E 3 .   ? -1.088  52.961  29.135  1.00 34.54  ? 1125 HOH A O     1 
HETATM 10023 O O     . HOH E 3 .   ? 12.164  56.904  32.127  1.00 32.73  ? 1126 HOH A O     1 
HETATM 10024 O O     . HOH E 3 .   ? 14.887  53.618  15.510  1.00 12.73  ? 1127 HOH A O     1 
HETATM 10025 O O     . HOH E 3 .   ? 15.919  56.595  15.172  1.00 34.07  ? 1128 HOH A O     1 
HETATM 10026 O O     . HOH E 3 .   ? 10.007  58.915  18.850  1.00 25.98  ? 1129 HOH A O     1 
HETATM 10027 O O     . HOH E 3 .   ? 13.716  62.660  28.392  1.00 36.59  ? 1130 HOH A O     1 
HETATM 10028 O O     . HOH E 3 .   ? 25.417  57.290  27.357  1.00 44.98  ? 1131 HOH A O     1 
HETATM 10029 O O     . HOH E 3 .   ? 29.926  47.164  10.176  1.00 35.66  ? 1132 HOH A O     1 
HETATM 10030 O O     . HOH E 3 .   ? 30.839  39.880  12.465  1.00 26.30  ? 1133 HOH A O     1 
HETATM 10031 O O     . HOH E 3 .   ? -2.230  32.773  26.391  1.00 15.89  ? 1134 HOH A O     1 
HETATM 10032 O O     . HOH E 3 .   ? -2.755  33.590  28.797  1.00 13.55  ? 1135 HOH A O     1 
HETATM 10033 O O     . HOH E 3 .   ? -5.483  33.103  37.606  1.00 27.19  ? 1136 HOH A O     1 
HETATM 10034 O O     . HOH E 3 .   ? -0.953  30.593  36.549  1.00 22.12  ? 1137 HOH A O     1 
HETATM 10035 O O     . HOH E 3 .   ? -8.431  31.311  37.993  1.00 28.53  ? 1138 HOH A O     1 
HETATM 10036 O O     . HOH E 3 .   ? -2.200  38.908  36.256  1.00 30.26  ? 1139 HOH A O     1 
HETATM 10037 O O     . HOH E 3 .   ? 7.138   31.663  35.281  1.00 29.94  ? 1140 HOH A O     1 
HETATM 10038 O O     . HOH E 3 .   ? 14.050  22.692  29.744  1.00 30.51  ? 1141 HOH A O     1 
HETATM 10039 O O     . HOH E 3 .   ? 17.821  27.905  19.937  1.00 24.26  ? 1142 HOH A O     1 
HETATM 10040 O O     . HOH E 3 .   ? -3.323  23.756  -1.340  1.00 32.36  ? 1143 HOH A O     1 
HETATM 10041 O O     . HOH E 3 .   ? 4.112   33.688  -4.501  1.00 28.00  ? 1144 HOH A O     1 
HETATM 10042 O O     . HOH E 3 .   ? 4.090   25.176  -5.990  1.00 38.08  ? 1145 HOH A O     1 
HETATM 10043 O O     . HOH E 3 .   ? -0.073  32.440  23.775  1.00 25.03  ? 1146 HOH A O     1 
HETATM 10044 O O     . HOH E 3 .   ? -2.301  43.044  13.750  1.00 16.99  ? 1147 HOH A O     1 
HETATM 10045 O O     . HOH E 3 .   ? -16.691 44.506  12.290  1.00 31.72  ? 1148 HOH A O     1 
HETATM 10046 O O     . HOH E 3 .   ? -17.206 47.170  12.487  1.00 31.05  ? 1149 HOH A O     1 
HETATM 10047 O O     . HOH E 3 .   ? -18.944 44.155  14.361  1.00 20.59  ? 1150 HOH A O     1 
HETATM 10048 O O     . HOH E 3 .   ? -17.544 47.664  3.984   1.00 22.05  ? 1151 HOH A O     1 
HETATM 10049 O O     . HOH E 3 .   ? -15.429 48.978  2.423   1.00 33.02  ? 1152 HOH A O     1 
HETATM 10050 O O     . HOH E 3 .   ? -7.683  45.102  -1.936  1.00 20.01  ? 1153 HOH A O     1 
HETATM 10051 O O     . HOH E 3 .   ? -10.522 44.434  -2.765  1.00 26.62  ? 1154 HOH A O     1 
HETATM 10052 O O     . HOH E 3 .   ? -11.909 46.705  -2.574  1.00 30.15  ? 1155 HOH A O     1 
HETATM 10053 O O     . HOH E 3 .   ? -13.622 46.939  -5.312  1.00 35.67  ? 1156 HOH A O     1 
HETATM 10054 O O     . HOH E 3 .   ? -7.828  48.804  2.268   1.00 23.86  ? 1157 HOH A O     1 
HETATM 10055 O O     . HOH E 3 .   ? -0.827  34.433  -4.671  1.00 25.10  ? 1158 HOH A O     1 
HETATM 10056 O O     . HOH E 3 .   ? -3.606  33.115  -6.527  1.00 36.68  ? 1159 HOH A O     1 
HETATM 10057 O O     . HOH E 3 .   ? -6.724  29.454  -6.365  1.00 33.43  ? 1160 HOH A O     1 
HETATM 10058 O O     . HOH E 3 .   ? -18.311 31.681  17.248  1.00 21.43  ? 1161 HOH A O     1 
HETATM 10059 O O     . HOH E 3 .   ? -20.160 34.032  20.916  1.00 30.33  ? 1162 HOH A O     1 
HETATM 10060 O O     . HOH E 3 .   ? -24.279 30.885  8.989   1.00 24.01  ? 1163 HOH A O     1 
HETATM 10061 O O     . HOH E 3 .   ? -25.686 28.528  9.108   1.00 41.10  ? 1164 HOH A O     1 
HETATM 10062 O O     . HOH E 3 .   ? -23.865 31.121  6.085   1.00 27.70  ? 1165 HOH A O     1 
HETATM 10063 O O     . HOH E 3 .   ? -13.038 24.246  -4.204  1.00 27.75  ? 1166 HOH A O     1 
HETATM 10064 O O     . HOH E 3 .   ? -3.846  24.599  29.824  1.00 25.16  ? 1167 HOH A O     1 
HETATM 10065 O O     . HOH E 3 .   ? -22.158 21.080  13.126  1.00 20.47  ? 1168 HOH A O     1 
HETATM 10066 O O     . HOH E 3 .   ? -22.653 21.512  16.999  1.00 33.09  ? 1169 HOH A O     1 
HETATM 10067 O O     . HOH E 3 .   ? -0.394  5.985   25.613  1.00 40.85  ? 1170 HOH A O     1 
HETATM 10068 O O     . HOH E 3 .   ? -17.113 12.411  31.579  1.00 31.65  ? 1171 HOH A O     1 
HETATM 10069 O O     . HOH E 3 .   ? -17.194 13.229  35.804  1.00 40.76  ? 1172 HOH A O     1 
HETATM 10070 O O     . HOH E 3 .   ? -17.155 14.436  33.260  1.00 43.79  ? 1173 HOH A O     1 
HETATM 10071 O O     . HOH E 3 .   ? -17.467 14.409  39.563  1.00 39.69  ? 1174 HOH A O     1 
HETATM 10072 O O     . HOH E 3 .   ? -15.951 7.673   19.625  1.00 27.19  ? 1175 HOH A O     1 
HETATM 10073 O O     . HOH E 3 .   ? -20.955 12.372  21.781  1.00 22.60  ? 1176 HOH A O     1 
HETATM 10074 O O     . HOH E 3 .   ? 12.324  24.428  34.897  1.00 24.99  ? 1177 HOH A O     1 
HETATM 10075 O O     . HOH E 3 .   ? 13.473  26.785  33.651  1.00 25.59  ? 1178 HOH A O     1 
HETATM 10076 O O     . HOH E 3 .   ? 9.559   31.286  38.077  1.00 35.21  ? 1179 HOH A O     1 
HETATM 10077 O O     . HOH E 3 .   ? 6.738   22.706  44.771  1.00 37.59  ? 1180 HOH A O     1 
HETATM 10078 O O     . HOH E 3 .   ? -2.850  18.340  36.444  1.00 30.62  ? 1181 HOH A O     1 
HETATM 10079 O O     . HOH E 3 .   ? -15.624 5.731   14.990  1.00 33.79  ? 1182 HOH A O     1 
HETATM 10080 O O     . HOH E 3 .   ? -15.593 27.653  30.140  1.00 27.74  ? 1183 HOH A O     1 
HETATM 10081 O O     . HOH E 3 .   ? -13.219 28.297  27.493  1.00 17.68  ? 1184 HOH A O     1 
HETATM 10082 O O     . HOH E 3 .   ? -10.692 31.805  40.334  1.00 36.37  ? 1185 HOH A O     1 
HETATM 10083 O O     . HOH E 3 .   ? -13.694 29.567  29.702  1.00 18.20  ? 1186 HOH A O     1 
HETATM 10084 O O     . HOH E 3 .   ? -9.927  40.449  25.890  1.00 29.82  ? 1187 HOH A O     1 
HETATM 10085 O O     . HOH E 3 .   ? -4.299  36.855  27.758  1.00 27.84  ? 1188 HOH A O     1 
HETATM 10086 O O     . HOH E 3 .   ? -2.892  36.699  29.993  1.00 23.10  ? 1189 HOH A O     1 
HETATM 10087 O O     . HOH E 3 .   ? -2.527  38.462  32.347  1.00 25.43  ? 1190 HOH A O     1 
HETATM 10088 O O     . HOH E 3 .   ? -3.407  39.860  38.692  1.00 28.15  ? 1191 HOH A O     1 
HETATM 10089 O O     . HOH E 3 .   ? -4.793  41.440  45.542  1.00 29.68  ? 1192 HOH A O     1 
HETATM 10090 O O     . HOH E 3 .   ? -6.497  47.186  48.610  1.00 34.31  ? 1193 HOH A O     1 
HETATM 10091 O O     . HOH E 3 .   ? -8.998  46.818  51.146  1.00 28.32  ? 1194 HOH A O     1 
HETATM 10092 O O     . HOH E 3 .   ? -16.629 43.564  53.228  1.00 42.50  ? 1195 HOH A O     1 
HETATM 10093 O O     . HOH E 3 .   ? -16.052 31.025  35.048  1.00 31.63  ? 1196 HOH A O     1 
HETATM 10094 O O     . HOH E 3 .   ? -19.572 31.534  29.868  1.00 29.54  ? 1197 HOH A O     1 
HETATM 10095 O O     . HOH E 3 .   ? -20.442 45.826  48.842  1.00 33.11  ? 1198 HOH A O     1 
HETATM 10096 O O     . HOH E 3 .   ? -19.061 48.282  58.840  1.00 39.48  ? 1199 HOH A O     1 
HETATM 10097 O O     . HOH E 3 .   ? -8.956  53.759  38.661  1.00 25.46  ? 1200 HOH A O     1 
HETATM 10098 O O     . HOH E 3 .   ? -12.730 42.380  28.640  1.00 33.01  ? 1201 HOH A O     1 
HETATM 10099 O O     . HOH E 3 .   ? -25.650 41.929  49.188  1.00 33.33  ? 1202 HOH A O     1 
HETATM 10100 O O     . HOH E 3 .   ? -26.905 43.302  51.020  1.00 37.69  ? 1203 HOH A O     1 
HETATM 10101 O O     . HOH E 3 .   ? 9.966   58.380  33.020  1.00 38.47  ? 1204 HOH A O     1 
HETATM 10102 O O     . HOH E 3 .   ? -14.490 57.406  38.033  1.00 35.46  ? 1205 HOH A O     1 
HETATM 10103 O O     . HOH E 3 .   ? 0.734   19.027  -5.508  1.00 33.61  ? 1206 HOH A O     1 
HETATM 10104 O O     . HOH E 3 .   ? 6.485   18.718  0.356   1.00 40.99  ? 1207 HOH A O     1 
HETATM 10105 O O     . HOH E 3 .   ? 27.057  45.279  16.317  1.00 44.23  ? 1208 HOH A O     1 
HETATM 10106 O O     . HOH E 3 .   ? 29.803  38.245  14.702  1.00 33.86  ? 1209 HOH A O     1 
HETATM 10107 O O     . HOH E 3 .   ? -12.614 14.443  -2.955  1.00 28.59  ? 1210 HOH A O     1 
HETATM 10108 O O     . HOH E 3 .   ? -19.188 20.932  0.856   1.00 31.01  ? 1211 HOH A O     1 
HETATM 10109 O O     . HOH E 3 .   ? -15.705 23.207  -0.653  1.00 34.60  ? 1212 HOH A O     1 
HETATM 10110 O O     . HOH E 3 .   ? -15.255 19.251  -6.169  1.00 35.65  ? 1213 HOH A O     1 
HETATM 10111 O O     . HOH E 3 .   ? -5.986  21.607  -7.846  1.00 38.08  ? 1214 HOH A O     1 
HETATM 10112 O O     . HOH E 3 .   ? -7.212  25.340  -6.424  1.00 27.51  ? 1215 HOH A O     1 
HETATM 10113 O O     . HOH E 3 .   ? -2.445  25.604  0.442   1.00 29.86  ? 1216 HOH A O     1 
HETATM 10114 O O     . HOH E 3 .   ? -8.140  9.733   -2.183  1.00 39.35  ? 1217 HOH A O     1 
HETATM 10115 O O     . HOH E 3 .   ? 2.740   9.340   1.619   1.00 29.28  ? 1218 HOH A O     1 
HETATM 10116 O O     . HOH E 3 .   ? 4.832   7.707   1.743   1.00 25.43  ? 1219 HOH A O     1 
HETATM 10117 O O     . HOH E 3 .   ? 1.312   2.696   9.265   1.00 27.88  ? 1220 HOH A O     1 
HETATM 10118 O O     . HOH E 3 .   ? -5.623  8.303   21.328  1.00 28.82  ? 1221 HOH A O     1 
HETATM 10119 O O     . HOH E 3 .   ? 7.738   1.868   11.586  1.00 32.27  ? 1222 HOH A O     1 
HETATM 10120 O O     . HOH E 3 .   ? 13.838  6.942   10.797  1.00 55.27  ? 1223 HOH A O     1 
HETATM 10121 O O     . HOH E 3 .   ? -13.306 51.722  30.326  1.00 43.89  ? 1224 HOH A O     1 
HETATM 10122 O O     . HOH E 3 .   ? -8.026  56.650  35.212  1.00 29.71  ? 1225 HOH A O     1 
HETATM 10123 O O     . HOH E 3 .   ? 5.812   57.835  31.822  1.00 38.17  ? 1226 HOH A O     1 
HETATM 10124 O O     . HOH E 3 .   ? 29.864  35.483  13.396  1.00 32.01  ? 1227 HOH A O     1 
HETATM 10125 O O     . HOH E 3 .   ? 29.069  33.222  15.513  1.00 32.88  ? 1228 HOH A O     1 
HETATM 10126 O O     . HOH E 3 .   ? -0.431  36.145  30.042  1.00 33.06  ? 1229 HOH A O     1 
HETATM 10127 O O     . HOH E 3 .   ? -5.087  31.547  42.746  1.00 33.27  ? 1230 HOH A O     1 
HETATM 10128 O O     . HOH E 3 .   ? -1.125  39.539  10.653  1.00 19.45  ? 1231 HOH A O     1 
HETATM 10129 O O     . HOH E 3 .   ? -4.280  37.930  18.120  1.00 22.23  ? 1232 HOH A O     1 
HETATM 10130 O O     . HOH E 3 .   ? -6.618  37.289  15.249  1.00 33.24  ? 1233 HOH A O     1 
HETATM 10131 O O     . HOH E 3 .   ? -3.154  40.706  12.315  1.00 22.80  ? 1234 HOH A O     1 
HETATM 10132 O O     . HOH E 3 .   ? -2.715  32.586  20.133  1.00 26.78  ? 1235 HOH A O     1 
HETATM 10133 O O     . HOH E 3 .   ? -11.088 51.624  3.596   1.00 26.81  ? 1236 HOH A O     1 
HETATM 10134 O O     . HOH E 3 .   ? 1.156   36.075  -5.598  1.00 32.93  ? 1237 HOH A O     1 
HETATM 10135 O O     . HOH E 3 .   ? -10.271 42.210  20.441  1.00 40.74  ? 1238 HOH A O     1 
HETATM 10136 O O     . HOH E 3 .   ? -16.638 39.496  18.159  1.00 29.08  ? 1239 HOH A O     1 
HETATM 10137 O O     . HOH E 3 .   ? -17.267 23.070  20.323  1.00 28.95  ? 1240 HOH A O     1 
HETATM 10138 O O     . HOH E 3 .   ? -19.850 21.742  20.597  1.00 37.92  ? 1241 HOH A O     1 
HETATM 10139 O O     . HOH E 3 .   ? -23.377 24.147  4.218   1.00 26.91  ? 1242 HOH A O     1 
HETATM 10140 O O     . HOH E 3 .   ? -24.170 24.661  1.458   1.00 36.37  ? 1243 HOH A O     1 
HETATM 10141 O O     . HOH E 3 .   ? -24.954 25.656  10.900  1.00 37.20  ? 1244 HOH A O     1 
HETATM 10142 O O     . HOH E 3 .   ? -23.076 28.220  4.711   1.00 32.44  ? 1245 HOH A O     1 
HETATM 10143 O O     . HOH E 3 .   ? 3.082   20.592  27.965  1.00 41.90  ? 1246 HOH A O     1 
HETATM 10144 O O     . HOH E 3 .   ? -10.523 12.574  -1.408  1.00 36.33  ? 1247 HOH A O     1 
HETATM 10145 O O     . HOH E 3 .   ? -13.253 24.111  17.923  1.00 28.89  ? 1248 HOH A O     1 
HETATM 10146 O O     . HOH E 3 .   ? -7.176  9.032   14.111  1.00 30.60  ? 1249 HOH A O     1 
HETATM 10147 O O     . HOH E 3 .   ? -9.226  9.573   19.672  1.00 26.96  ? 1250 HOH A O     1 
HETATM 10148 O O     . HOH E 3 .   ? -9.252  6.382   25.444  1.00 26.84  ? 1251 HOH A O     1 
HETATM 10149 O O     . HOH E 3 .   ? -16.725 16.570  32.109  1.00 40.98  ? 1252 HOH A O     1 
HETATM 10150 O O     . HOH E 3 .   ? 11.038  23.594  40.443  1.00 36.52  ? 1253 HOH A O     1 
HETATM 10151 O O     . HOH E 3 .   ? 12.906  23.961  38.029  1.00 30.04  ? 1254 HOH A O     1 
HETATM 10152 O O     . HOH E 3 .   ? 5.748   18.561  41.559  1.00 40.09  ? 1255 HOH A O     1 
HETATM 10153 O O     . HOH E 3 .   ? -4.068  21.674  38.673  1.00 38.38  ? 1256 HOH A O     1 
HETATM 10154 O O     . HOH E 3 .   ? -21.036 11.300  14.557  1.00 35.84  ? 1257 HOH A O     1 
HETATM 10155 O O     . HOH E 3 .   ? -11.375 23.618  38.379  1.00 43.24  ? 1258 HOH A O     1 
HETATM 10156 O O     . HOH E 3 .   ? -3.264  35.523  42.016  1.00 40.91  ? 1259 HOH A O     1 
HETATM 10157 O O     . HOH E 3 .   ? -9.281  42.523  51.150  1.00 31.00  ? 1260 HOH A O     1 
HETATM 10158 O O     . HOH E 3 .   ? -7.765  44.320  50.431  1.00 33.70  ? 1261 HOH A O     1 
HETATM 10159 O O     . HOH E 3 .   ? -24.230 39.388  24.175  1.00 28.29  ? 1262 HOH A O     1 
HETATM 10160 O O     . HOH E 3 .   ? -21.505 42.691  29.219  1.00 45.32  ? 1263 HOH A O     1 
HETATM 10161 O O     . HOH E 3 .   ? -21.625 36.623  52.134  1.00 42.65  ? 1264 HOH A O     1 
HETATM 10162 O O     . HOH E 3 .   ? 2.224   54.709  30.359  1.00 36.33  ? 1265 HOH A O     1 
HETATM 10163 O O     . HOH E 3 .   ? -34.383 43.504  42.646  1.00 44.53  ? 1266 HOH A O     1 
HETATM 10164 O O     . HOH E 3 .   ? 8.875   11.697  6.904   1.00 27.20  ? 1267 HOH A O     1 
HETATM 10165 O O     . HOH E 3 .   ? 7.490   7.527   8.125   1.00 32.30  ? 1268 HOH A O     1 
HETATM 10166 O O     . HOH E 3 .   ? 15.730  24.443  1.743   1.00 42.55  ? 1269 HOH A O     1 
HETATM 10167 O O     . HOH E 3 .   ? 20.726  25.221  7.490   1.00 39.57  ? 1270 HOH A O     1 
HETATM 10168 O O     . HOH E 3 .   ? 22.070  24.497  9.756   1.00 25.36  ? 1271 HOH A O     1 
HETATM 10169 O O     . HOH E 3 .   ? 20.193  17.833  8.217   1.00 25.43  ? 1272 HOH A O     1 
HETATM 10170 O O     . HOH E 3 .   ? 6.641   5.650   23.506  1.00 33.33  ? 1273 HOH A O     1 
HETATM 10171 O O     . HOH E 3 .   ? 13.352  12.568  29.206  1.00 32.86  ? 1274 HOH A O     1 
HETATM 10172 O O     . HOH E 3 .   ? 4.023   8.803   29.287  1.00 46.45  ? 1275 HOH A O     1 
HETATM 10173 O O     . HOH E 3 .   ? 18.940  17.483  27.210  1.00 40.33  ? 1276 HOH A O     1 
HETATM 10174 O O     . HOH E 3 .   ? 13.500  27.486  0.637   1.00 32.21  ? 1277 HOH A O     1 
HETATM 10175 O O     . HOH E 3 .   ? 24.970  33.830  7.528   1.00 24.69  ? 1278 HOH A O     1 
HETATM 10176 O O     . HOH E 3 .   ? -25.931 24.616  5.186   1.00 44.17  ? 1279 HOH A O     1 
HETATM 10177 O O     . HOH E 3 .   ? 12.671  32.477  -5.618  1.00 38.32  ? 1280 HOH A O     1 
HETATM 10178 O O     . HOH E 3 .   ? 8.092   31.626  -4.276  1.00 36.22  ? 1281 HOH A O     1 
HETATM 10179 O O     . HOH E 3 .   ? 16.471  40.375  -2.109  1.00 35.00  ? 1282 HOH A O     1 
HETATM 10180 O O     . HOH E 3 .   ? 14.752  41.354  -3.759  1.00 40.24  ? 1283 HOH A O     1 
HETATM 10181 O O     . HOH E 3 .   ? 16.033  33.866  -5.229  1.00 36.34  ? 1284 HOH A O     1 
HETATM 10182 O O     . HOH E 3 .   ? 13.853  43.043  0.539   1.00 21.74  ? 1285 HOH A O     1 
HETATM 10183 O O     . HOH E 3 .   ? 5.049   51.669  1.357   1.00 27.08  ? 1286 HOH A O     1 
HETATM 10184 O O     . HOH E 3 .   ? 6.085   51.721  4.522   1.00 36.01  ? 1287 HOH A O     1 
HETATM 10185 O O     . HOH E 3 .   ? -0.500  56.901  8.340   1.00 33.63  ? 1288 HOH A O     1 
HETATM 10186 O O     . HOH E 3 .   ? -0.238  54.658  10.008  1.00 35.49  ? 1289 HOH A O     1 
HETATM 10187 O O     . HOH E 3 .   ? -7.585  50.685  4.054   1.00 31.27  ? 1290 HOH A O     1 
HETATM 10188 O O     . HOH E 3 .   ? 3.821   50.116  -0.468  1.00 48.48  ? 1291 HOH A O     1 
HETATM 10189 O O     . HOH E 3 .   ? 23.988  39.328  4.665   1.00 34.58  ? 1292 HOH A O     1 
HETATM 10190 O O     . HOH E 3 .   ? 21.626  38.476  3.712   1.00 26.07  ? 1293 HOH A O     1 
HETATM 10191 O O     . HOH E 3 .   ? 26.638  33.831  23.633  1.00 26.89  ? 1294 HOH A O     1 
HETATM 10192 O O     . HOH E 3 .   ? 16.777  34.567  33.295  1.00 27.57  ? 1295 HOH A O     1 
HETATM 10193 O O     . HOH E 3 .   ? 26.104  33.017  18.593  1.00 30.23  ? 1296 HOH A O     1 
HETATM 10194 O O     . HOH F 3 .   ? -25.983 39.244  5.544   1.00 19.25  ? 1000 HOH B O     1 
HETATM 10195 O O     . HOH F 3 .   ? -29.638 68.652  42.955  1.00 21.02  ? 1001 HOH B O     1 
HETATM 10196 O O     . HOH F 3 .   ? -23.810 75.735  40.246  1.00 19.63  ? 1002 HOH B O     1 
HETATM 10197 O O     . HOH F 3 .   ? -28.043 78.375  38.842  1.00 22.52  ? 1003 HOH B O     1 
HETATM 10198 O O     . HOH F 3 .   ? -16.702 84.154  36.673  1.00 33.75  ? 1004 HOH B O     1 
HETATM 10199 O O     . HOH F 3 .   ? -50.737 91.782  25.242  1.00 36.43  ? 1005 HOH B O     1 
HETATM 10200 O O     . HOH F 3 .   ? -55.416 84.449  14.955  1.00 34.43  ? 1006 HOH B O     1 
HETATM 10201 O O     . HOH F 3 .   ? -48.290 89.452  14.393  1.00 22.79  ? 1007 HOH B O     1 
HETATM 10202 O O     . HOH F 3 .   ? -52.874 81.312  21.083  1.00 36.91  ? 1008 HOH B O     1 
HETATM 10203 O O     . HOH F 3 .   ? -57.007 72.918  19.298  1.00 17.97  ? 1009 HOH B O     1 
HETATM 10204 O O     . HOH F 3 .   ? -42.365 86.238  12.936  1.00 22.57  ? 1010 HOH B O     1 
HETATM 10205 O O     . HOH F 3 .   ? -40.795 82.884  13.447  1.00 18.80  ? 1011 HOH B O     1 
HETATM 10206 O O     . HOH F 3 .   ? -33.047 93.437  9.633   1.00 31.62  ? 1012 HOH B O     1 
HETATM 10207 O O     . HOH F 3 .   ? -22.086 97.317  10.726  1.00 28.69  ? 1013 HOH B O     1 
HETATM 10208 O O     . HOH F 3 .   ? -44.035 33.180  16.777  1.00 20.61  ? 1014 HOH B O     1 
HETATM 10209 O O     . HOH F 3 .   ? -37.511 52.685  26.690  1.00 27.97  ? 1015 HOH B O     1 
HETATM 10210 O O     . HOH F 3 .   ? -39.862 48.832  26.298  1.00 24.61  ? 1016 HOH B O     1 
HETATM 10211 O O     . HOH F 3 .   ? -39.681 50.651  27.969  1.00 35.36  ? 1017 HOH B O     1 
HETATM 10212 O O     . HOH F 3 .   ? -41.215 35.063  10.765  1.00 27.20  ? 1018 HOH B O     1 
HETATM 10213 O O     . HOH F 3 .   ? -39.701 33.349  11.869  1.00 32.78  ? 1019 HOH B O     1 
HETATM 10214 O O     . HOH F 3 .   ? -46.010 35.765  3.495   1.00 20.63  ? 1020 HOH B O     1 
HETATM 10215 O O     . HOH F 3 .   ? -47.760 34.608  1.480   1.00 16.20  ? 1021 HOH B O     1 
HETATM 10216 O O     . HOH F 3 .   ? -29.038 44.493  3.291   1.00 15.41  ? 1022 HOH B O     1 
HETATM 10217 O O     . HOH F 3 .   ? -29.012 46.852  2.176   1.00 21.52  ? 1023 HOH B O     1 
HETATM 10218 O O     . HOH F 3 .   ? -13.184 63.729  16.768  1.00 18.50  ? 1024 HOH B O     1 
HETATM 10219 O O     . HOH F 3 .   ? -17.244 91.537  4.698   1.00 29.34  ? 1025 HOH B O     1 
HETATM 10220 O O     . HOH F 3 .   ? -38.644 83.030  2.199   1.00 19.89  ? 1026 HOH B O     1 
HETATM 10221 O O     . HOH F 3 .   ? -40.905 83.152  0.576   1.00 29.54  ? 1027 HOH B O     1 
HETATM 10222 O O     . HOH F 3 .   ? -25.997 68.767  6.719   1.00 23.32  ? 1028 HOH B O     1 
HETATM 10223 O O     . HOH F 3 .   ? -16.120 66.999  7.954   1.00 16.93  ? 1029 HOH B O     1 
HETATM 10224 O O     . HOH F 3 .   ? -18.189 66.550  10.417  1.00 21.87  ? 1030 HOH B O     1 
HETATM 10225 O O     . HOH F 3 .   ? -35.795 83.002  4.209   1.00 16.48  ? 1031 HOH B O     1 
HETATM 10226 O O     . HOH F 3 .   ? -31.723 89.999  0.370   1.00 24.34  ? 1032 HOH B O     1 
HETATM 10227 O O     . HOH F 3 .   ? -33.050 73.335  7.663   1.00 13.51  ? 1033 HOH B O     1 
HETATM 10228 O O     . HOH F 3 .   ? -34.424 69.029  6.566   1.00 17.36  ? 1034 HOH B O     1 
HETATM 10229 O O     . HOH F 3 .   ? -31.552 66.954  9.161   1.00 16.36  ? 1035 HOH B O     1 
HETATM 10230 O O     . HOH F 3 .   ? -24.774 67.103  8.891   1.00 23.07  ? 1036 HOH B O     1 
HETATM 10231 O O     . HOH F 3 .   ? -29.957 54.466  0.407   1.00 18.35  ? 1037 HOH B O     1 
HETATM 10232 O O     . HOH F 3 .   ? -33.144 56.486  -3.371  1.00 30.79  ? 1038 HOH B O     1 
HETATM 10233 O O     . HOH F 3 .   ? -12.944 65.533  -4.400  1.00 21.67  ? 1039 HOH B O     1 
HETATM 10234 O O     . HOH F 3 .   ? -18.490 60.931  -1.788  1.00 20.65  ? 1040 HOH B O     1 
HETATM 10235 O O     . HOH F 3 .   ? -9.032  55.965  7.308   1.00 27.85  ? 1041 HOH B O     1 
HETATM 10236 O O     . HOH F 3 .   ? -26.656 61.044  -9.818  1.00 22.10  ? 1042 HOH B O     1 
HETATM 10237 O O     . HOH F 3 .   ? -37.864 66.496  -6.696  1.00 28.76  ? 1043 HOH B O     1 
HETATM 10238 O O     . HOH F 3 .   ? -14.349 73.312  -3.449  1.00 8.29   ? 1044 HOH B O     1 
HETATM 10239 O O     . HOH F 3 .   ? -12.385 73.063  -4.945  1.00 27.44  ? 1045 HOH B O     1 
HETATM 10240 O O     . HOH F 3 .   ? -15.414 62.725  -14.881 1.00 27.74  ? 1046 HOH B O     1 
HETATM 10241 O O     . HOH F 3 .   ? -17.140 64.425  -15.765 1.00 32.95  ? 1047 HOH B O     1 
HETATM 10242 O O     . HOH F 3 .   ? -34.045 68.666  14.628  1.00 19.71  ? 1048 HOH B O     1 
HETATM 10243 O O     . HOH F 3 .   ? -35.227 65.838  15.242  1.00 17.22  ? 1049 HOH B O     1 
HETATM 10244 O O     . HOH F 3 .   ? -36.561 63.713  14.249  1.00 16.24  ? 1050 HOH B O     1 
HETATM 10245 O O     . HOH F 3 .   ? -35.366 61.513  11.978  1.00 18.21  ? 1051 HOH B O     1 
HETATM 10246 O O     . HOH F 3 .   ? -41.720 60.076  11.455  1.00 19.77  ? 1052 HOH B O     1 
HETATM 10247 O O     . HOH F 3 .   ? -43.098 57.353  12.933  1.00 28.16  ? 1053 HOH B O     1 
HETATM 10248 O O     . HOH F 3 .   ? -44.472 62.056  11.135  1.00 26.15  ? 1054 HOH B O     1 
HETATM 10249 O O     . HOH F 3 .   ? -41.133 79.916  13.613  1.00 16.40  ? 1055 HOH B O     1 
HETATM 10250 O O     . HOH F 3 .   ? -36.354 80.315  18.219  1.00 17.07  ? 1056 HOH B O     1 
HETATM 10251 O O     . HOH F 3 .   ? -15.209 92.685  24.499  1.00 37.93  ? 1057 HOH B O     1 
HETATM 10252 O O     . HOH F 3 .   ? -21.033 76.446  19.162  1.00 17.03  ? 1058 HOH B O     1 
HETATM 10253 O O     . HOH F 3 .   ? -19.514 71.817  17.608  1.00 19.15  ? 1059 HOH B O     1 
HETATM 10254 O O     . HOH F 3 .   ? -19.752 68.834  17.706  1.00 24.92  ? 1060 HOH B O     1 
HETATM 10255 O O     . HOH F 3 .   ? -25.868 66.440  17.423  1.00 22.68  ? 1061 HOH B O     1 
HETATM 10256 O O     . HOH F 3 .   ? -31.122 69.159  18.006  1.00 27.29  ? 1062 HOH B O     1 
HETATM 10257 O O     . HOH F 3 .   ? -15.823 58.426  25.735  1.00 40.14  ? 1063 HOH B O     1 
HETATM 10258 O O     . HOH F 3 .   ? -7.768  63.054  22.364  1.00 20.27  ? 1064 HOH B O     1 
HETATM 10259 O O     . HOH F 3 .   ? -8.605  69.678  20.509  1.00 21.97  ? 1065 HOH B O     1 
HETATM 10260 O O     . HOH F 3 .   ? -13.496 65.020  27.360  1.00 19.71  ? 1066 HOH B O     1 
HETATM 10261 O O     . HOH F 3 .   ? -10.152 75.525  30.062  1.00 30.74  ? 1067 HOH B O     1 
HETATM 10262 O O     . HOH F 3 .   ? -28.261 60.470  31.701  1.00 24.53  ? 1068 HOH B O     1 
HETATM 10263 O O     . HOH F 3 .   ? -30.772 67.351  29.003  1.00 16.79  ? 1069 HOH B O     1 
HETATM 10264 O O     . HOH F 3 .   ? -29.296 64.613  22.927  1.00 35.73  ? 1070 HOH B O     1 
HETATM 10265 O O     . HOH F 3 .   ? -23.683 57.119  25.747  1.00 22.18  ? 1071 HOH B O     1 
HETATM 10266 O O     . HOH F 3 .   ? -19.620 54.209  26.208  1.00 28.41  ? 1072 HOH B O     1 
HETATM 10267 O O     . HOH F 3 .   ? -17.624 55.546  26.735  1.00 21.37  ? 1073 HOH B O     1 
HETATM 10268 O O     . HOH F 3 .   ? -22.008 56.382  31.680  1.00 21.07  ? 1074 HOH B O     1 
HETATM 10269 O O     . HOH F 3 .   ? -12.168 56.702  36.664  1.00 21.15  ? 1075 HOH B O     1 
HETATM 10270 O O     . HOH F 3 .   ? -8.110  60.277  27.880  1.00 35.90  ? 1076 HOH B O     1 
HETATM 10271 O O     . HOH F 3 .   ? -14.592 73.656  34.651  1.00 26.67  ? 1077 HOH B O     1 
HETATM 10272 O O     . HOH F 3 .   ? -14.847 76.159  36.077  1.00 20.55  ? 1078 HOH B O     1 
HETATM 10273 O O     . HOH F 3 .   ? -20.031 72.794  37.574  1.00 23.95  ? 1079 HOH B O     1 
HETATM 10274 O O     . HOH F 3 .   ? -36.221 67.422  33.515  1.00 14.02  ? 1080 HOH B O     1 
HETATM 10275 O O     . HOH F 3 .   ? -34.372 67.147  31.500  1.00 26.74  ? 1081 HOH B O     1 
HETATM 10276 O O     . HOH F 3 .   ? -31.185 69.056  35.097  1.00 21.90  ? 1082 HOH B O     1 
HETATM 10277 O O     . HOH F 3 .   ? -22.214 61.164  39.992  1.00 27.02  ? 1083 HOH B O     1 
HETATM 10278 O O     . HOH F 3 .   ? -29.869 71.935  35.381  1.00 18.31  ? 1084 HOH B O     1 
HETATM 10279 O O     . HOH F 3 .   ? -31.594 72.079  37.354  1.00 19.21  ? 1085 HOH B O     1 
HETATM 10280 O O     . HOH F 3 .   ? -36.579 79.840  32.516  1.00 31.05  ? 1086 HOH B O     1 
HETATM 10281 O O     . HOH F 3 .   ? -46.818 79.773  26.116  1.00 22.10  ? 1087 HOH B O     1 
HETATM 10282 O O     . HOH F 3 .   ? -45.968 76.117  35.488  1.00 24.25  ? 1088 HOH B O     1 
HETATM 10283 O O     . HOH F 3 .   ? -52.107 62.894  34.661  1.00 25.96  ? 1089 HOH B O     1 
HETATM 10284 O O     . HOH F 3 .   ? -52.453 61.166  24.873  1.00 33.98  ? 1090 HOH B O     1 
HETATM 10285 O O     . HOH F 3 .   ? -55.548 68.037  40.411  1.00 40.50  ? 1091 HOH B O     1 
HETATM 10286 O O     . HOH F 3 .   ? -53.217 69.067  21.495  1.00 17.68  ? 1092 HOH B O     1 
HETATM 10287 O O     . HOH F 3 .   ? -45.806 67.722  5.664   1.00 39.14  ? 1093 HOH B O     1 
HETATM 10288 O O     . HOH F 3 .   ? -46.333 75.076  3.712   1.00 25.40  ? 1094 HOH B O     1 
HETATM 10289 O O     . HOH F 3 .   ? -36.796 62.026  21.103  1.00 29.37  ? 1095 HOH B O     1 
HETATM 10290 O O     . HOH F 3 .   ? -38.904 57.765  23.824  1.00 21.10  ? 1096 HOH B O     1 
HETATM 10291 O O     . HOH F 3 .   ? -38.225 59.841  25.255  1.00 18.82  ? 1097 HOH B O     1 
HETATM 10292 O O     . HOH F 3 .   ? -29.326 57.060  16.656  1.00 18.72  ? 1098 HOH B O     1 
HETATM 10293 O O     . HOH F 3 .   ? -29.152 52.721  16.851  1.00 37.97  ? 1099 HOH B O     1 
HETATM 10294 O O     . HOH F 3 .   ? -36.033 59.110  7.442   1.00 34.67  ? 1100 HOH B O     1 
HETATM 10295 O O     . HOH F 3 .   ? -41.513 43.025  2.163   1.00 15.28  ? 1101 HOH B O     1 
HETATM 10296 O O     . HOH F 3 .   ? -42.456 41.133  0.904   1.00 28.10  ? 1102 HOH B O     1 
HETATM 10297 O O     . HOH F 3 .   ? -43.807 34.184  0.855   1.00 26.00  ? 1103 HOH B O     1 
HETATM 10298 O O     . HOH F 3 .   ? -46.012 45.706  9.731   1.00 24.33  ? 1104 HOH B O     1 
HETATM 10299 O O     . HOH F 3 .   ? -46.750 37.944  13.327  1.00 17.84  ? 1105 HOH B O     1 
HETATM 10300 O O     . HOH F 3 .   ? -12.341 87.503  18.608  1.00 27.66  ? 1106 HOH B O     1 
HETATM 10301 O O     . HOH F 3 .   ? -43.926 51.335  18.985  1.00 34.05  ? 1107 HOH B O     1 
HETATM 10302 O O     . HOH F 3 .   ? -41.842 32.069  7.500   1.00 40.72  ? 1108 HOH B O     1 
HETATM 10303 O O     . HOH F 3 .   ? -26.683 43.368  2.933   1.00 20.29  ? 1109 HOH B O     1 
HETATM 10304 O O     . HOH F 3 .   ? -24.821 45.334  2.895   1.00 25.50  ? 1110 HOH B O     1 
HETATM 10305 O O     . HOH F 3 .   ? -24.520 68.336  48.891  1.00 52.82  ? 1111 HOH B O     1 
HETATM 10306 O O     . HOH F 3 .   ? -25.886 74.450  47.145  1.00 36.87  ? 1112 HOH B O     1 
HETATM 10307 O O     . HOH F 3 .   ? -23.640 73.502  44.989  1.00 37.98  ? 1113 HOH B O     1 
HETATM 10308 O O     . HOH F 3 .   ? -26.192 76.996  40.343  1.00 30.69  ? 1114 HOH B O     1 
HETATM 10309 O O     . HOH F 3 .   ? -19.246 79.662  37.054  1.00 29.20  ? 1115 HOH B O     1 
HETATM 10310 O O     . HOH F 3 .   ? -28.261 85.972  41.256  1.00 43.35  ? 1116 HOH B O     1 
HETATM 10311 O O     . HOH F 3 .   ? -28.880 91.352  36.957  1.00 26.42  ? 1117 HOH B O     1 
HETATM 10312 O O     . HOH F 3 .   ? -28.352 91.438  39.826  1.00 32.95  ? 1118 HOH B O     1 
HETATM 10313 O O     . HOH F 3 .   ? -28.723 85.582  32.483  1.00 28.21  ? 1119 HOH B O     1 
HETATM 10314 O O     . HOH F 3 .   ? -29.542 84.306  34.832  1.00 36.33  ? 1120 HOH B O     1 
HETATM 10315 O O     . HOH F 3 .   ? -35.987 93.507  39.744  1.00 48.15  ? 1121 HOH B O     1 
HETATM 10316 O O     . HOH F 3 .   ? -33.219 93.882  40.366  1.00 43.90  ? 1122 HOH B O     1 
HETATM 10317 O O     . HOH F 3 .   ? -46.885 95.594  30.657  1.00 26.45  ? 1123 HOH B O     1 
HETATM 10318 O O     . HOH F 3 .   ? -47.567 84.342  24.966  1.00 42.31  ? 1124 HOH B O     1 
HETATM 10319 O O     . HOH F 3 .   ? -33.035 94.048  23.659  1.00 27.73  ? 1125 HOH B O     1 
HETATM 10320 O O     . HOH F 3 .   ? -31.842 91.722  25.304  1.00 24.86  ? 1126 HOH B O     1 
HETATM 10321 O O     . HOH F 3 .   ? -31.058 95.731  17.694  1.00 28.23  ? 1127 HOH B O     1 
HETATM 10322 O O     . HOH F 3 .   ? -45.517 97.438  19.043  1.00 43.31  ? 1128 HOH B O     1 
HETATM 10323 O O     . HOH F 3 .   ? -41.879 98.372  16.381  1.00 38.63  ? 1129 HOH B O     1 
HETATM 10324 O O     . HOH F 3 .   ? -53.312 86.518  20.076  1.00 30.31  ? 1130 HOH B O     1 
HETATM 10325 O O     . HOH F 3 .   ? -53.237 84.590  13.281  1.00 31.30  ? 1131 HOH B O     1 
HETATM 10326 O O     . HOH F 3 .   ? -55.182 86.226  11.039  1.00 45.59  ? 1132 HOH B O     1 
HETATM 10327 O O     . HOH F 3 .   ? -53.977 90.961  16.326  1.00 41.00  ? 1133 HOH B O     1 
HETATM 10328 O O     . HOH F 3 .   ? -49.809 79.113  11.529  1.00 25.31  ? 1134 HOH B O     1 
HETATM 10329 O O     . HOH F 3 .   ? -58.311 80.883  19.777  1.00 38.88  ? 1135 HOH B O     1 
HETATM 10330 O O     . HOH F 3 .   ? -57.352 71.701  14.629  1.00 33.63  ? 1136 HOH B O     1 
HETATM 10331 O O     . HOH F 3 .   ? -14.388 73.247  -12.360 1.00 31.05  ? 1137 HOH B O     1 
HETATM 10332 O O     . HOH F 3 .   ? -56.962 81.374  9.484   1.00 47.06  ? 1138 HOH B O     1 
HETATM 10333 O O     . HOH F 3 .   ? -33.751 86.692  6.177   1.00 29.83  ? 1139 HOH B O     1 
HETATM 10334 O O     . HOH F 3 .   ? -35.973 85.003  5.929   1.00 25.00  ? 1140 HOH B O     1 
HETATM 10335 O O     . HOH F 3 .   ? -31.361 95.300  8.877   1.00 32.94  ? 1141 HOH B O     1 
HETATM 10336 O O     . HOH F 3 .   ? -24.978 95.198  17.443  1.00 43.68  ? 1142 HOH B O     1 
HETATM 10337 O O     . HOH F 3 .   ? -21.569 95.432  17.268  1.00 33.25  ? 1143 HOH B O     1 
HETATM 10338 O O     . HOH F 3 .   ? -21.200 97.019  14.957  1.00 29.88  ? 1144 HOH B O     1 
HETATM 10339 O O     . HOH F 3 .   ? -22.740 99.526  15.427  1.00 25.68  ? 1145 HOH B O     1 
HETATM 10340 O O     . HOH F 3 .   ? -19.926 91.469  18.559  1.00 23.47  ? 1146 HOH B O     1 
HETATM 10341 O O     . HOH F 3 .   ? -16.621 95.793  7.077   1.00 46.70  ? 1147 HOH B O     1 
HETATM 10342 O O     . HOH F 3 .   ? -11.269 86.971  13.947  1.00 33.93  ? 1148 HOH B O     1 
HETATM 10343 O O     . HOH F 3 .   ? -10.968 83.629  19.983  1.00 45.54  ? 1149 HOH B O     1 
HETATM 10344 O O     . HOH F 3 .   ? -9.760  67.543  10.396  1.00 29.36  ? 1150 HOH B O     1 
HETATM 10345 O O     . HOH F 3 .   ? -8.643  65.156  9.081   1.00 34.45  ? 1151 HOH B O     1 
HETATM 10346 O O     . HOH F 3 .   ? -6.990  65.158  16.319  1.00 29.85  ? 1152 HOH B O     1 
HETATM 10347 O O     . HOH F 3 .   ? -6.622  63.110  12.363  1.00 41.39  ? 1153 HOH B O     1 
HETATM 10348 O O     . HOH F 3 .   ? -9.048  63.148  11.031  1.00 31.19  ? 1154 HOH B O     1 
HETATM 10349 O O     . HOH F 3 .   ? -9.018  64.634  6.508   1.00 37.46  ? 1155 HOH B O     1 
HETATM 10350 O O     . HOH F 3 .   ? -6.443  65.441  19.032  1.00 24.14  ? 1156 HOH B O     1 
HETATM 10351 O O     . HOH F 3 .   ? -4.584  74.317  15.293  1.00 30.67  ? 1157 HOH B O     1 
HETATM 10352 O O     . HOH F 3 .   ? -6.839  78.006  16.298  1.00 42.58  ? 1158 HOH B O     1 
HETATM 10353 O O     . HOH F 3 .   ? -7.002  81.326  11.449  1.00 38.27  ? 1159 HOH B O     1 
HETATM 10354 O O     . HOH F 3 .   ? -26.973 93.185  -4.435  1.00 28.29  ? 1160 HOH B O     1 
HETATM 10355 O O     . HOH F 3 .   ? -14.818 86.869  -5.313  1.00 33.29  ? 1161 HOH B O     1 
HETATM 10356 O O     . HOH F 3 .   ? -22.178 87.858  -9.034  1.00 48.37  ? 1162 HOH B O     1 
HETATM 10357 O O     . HOH F 3 .   ? -32.326 84.327  -8.739  1.00 40.02  ? 1163 HOH B O     1 
HETATM 10358 O O     . HOH F 3 .   ? -35.362 86.547  -5.052  1.00 33.63  ? 1164 HOH B O     1 
HETATM 10359 O O     . HOH F 3 .   ? -22.905 80.807  -9.411  1.00 43.13  ? 1165 HOH B O     1 
HETATM 10360 O O     . HOH F 3 .   ? -20.651 82.193  -9.333  1.00 36.13  ? 1166 HOH B O     1 
HETATM 10361 O O     . HOH F 3 .   ? -32.989 80.139  4.386   1.00 27.54  ? 1167 HOH B O     1 
HETATM 10362 O O     . HOH F 3 .   ? -22.017 65.812  10.421  1.00 36.01  ? 1168 HOH B O     1 
HETATM 10363 O O     . HOH F 3 .   ? -26.729 57.966  10.912  1.00 24.88  ? 1169 HOH B O     1 
HETATM 10364 O O     . HOH F 3 .   ? -26.462 54.185  5.033   1.00 40.09  ? 1170 HOH B O     1 
HETATM 10365 O O     . HOH F 3 .   ? -37.090 51.164  -0.461  1.00 36.28  ? 1171 HOH B O     1 
HETATM 10366 O O     . HOH F 3 .   ? -40.424 66.721  -5.839  1.00 22.00  ? 1172 HOH B O     1 
HETATM 10367 O O     . HOH F 3 .   ? -42.981 69.608  -2.879  1.00 30.15  ? 1173 HOH B O     1 
HETATM 10368 O O     . HOH F 3 .   ? -45.143 68.446  0.496   1.00 45.07  ? 1174 HOH B O     1 
HETATM 10369 O O     . HOH F 3 .   ? -43.402 68.136  5.167   1.00 28.03  ? 1175 HOH B O     1 
HETATM 10370 O O     . HOH F 3 .   ? -10.264 60.553  7.334   1.00 40.30  ? 1176 HOH B O     1 
HETATM 10371 O O     . HOH F 3 .   ? -24.049 58.537  5.437   1.00 42.70  ? 1177 HOH B O     1 
HETATM 10372 O O     . HOH F 3 .   ? -23.523 55.399  2.014   1.00 27.99  ? 1178 HOH B O     1 
HETATM 10373 O O     . HOH F 3 .   ? -22.772 56.187  -1.462  1.00 39.71  ? 1179 HOH B O     1 
HETATM 10374 O O     . HOH F 3 .   ? -17.854 58.621  -5.170  1.00 39.24  ? 1180 HOH B O     1 
HETATM 10375 O O     . HOH F 3 .   ? -19.217 60.672  -6.530  1.00 34.70  ? 1181 HOH B O     1 
HETATM 10376 O O     . HOH F 3 .   ? -22.429 56.008  -6.724  1.00 30.17  ? 1182 HOH B O     1 
HETATM 10377 O O     . HOH F 3 .   ? -21.427 58.401  -8.077  1.00 31.81  ? 1183 HOH B O     1 
HETATM 10378 O O     . HOH F 3 .   ? -32.221 64.181  -9.952  1.00 26.94  ? 1184 HOH B O     1 
HETATM 10379 O O     . HOH F 3 .   ? -41.846 59.290  -4.500  1.00 38.15  ? 1185 HOH B O     1 
HETATM 10380 O O     . HOH F 3 .   ? -33.626 66.344  -10.383 1.00 25.04  ? 1186 HOH B O     1 
HETATM 10381 O O     . HOH F 3 .   ? -28.668 70.458  -14.706 1.00 34.28  ? 1187 HOH B O     1 
HETATM 10382 O O     . HOH F 3 .   ? -29.672 64.505  -11.453 1.00 36.28  ? 1188 HOH B O     1 
HETATM 10383 O O     . HOH F 3 .   ? -12.683 72.509  2.319   1.00 31.62  ? 1189 HOH B O     1 
HETATM 10384 O O     . HOH F 3 .   ? -12.430 59.812  -9.881  1.00 42.06  ? 1190 HOH B O     1 
HETATM 10385 O O     . HOH F 3 .   ? -23.931 74.553  -15.346 1.00 41.76  ? 1191 HOH B O     1 
HETATM 10386 O O     . HOH F 3 .   ? -17.333 73.865  -11.117 1.00 26.77  ? 1192 HOH B O     1 
HETATM 10387 O O     . HOH F 3 .   ? -32.936 63.795  15.804  1.00 21.37  ? 1193 HOH B O     1 
HETATM 10388 O O     . HOH F 3 .   ? -33.347 61.647  13.904  1.00 23.08  ? 1194 HOH B O     1 
HETATM 10389 O O     . HOH F 3 .   ? -47.744 55.510  10.582  1.00 31.38  ? 1195 HOH B O     1 
HETATM 10390 O O     . HOH F 3 .   ? -45.478 63.723  16.224  1.00 26.60  ? 1196 HOH B O     1 
HETATM 10391 O O     . HOH F 3 .   ? -47.169 64.816  11.745  1.00 30.60  ? 1197 HOH B O     1 
HETATM 10392 O O     . HOH F 3 .   ? -46.379 59.746  6.170   1.00 42.57  ? 1198 HOH B O     1 
HETATM 10393 O O     . HOH F 3 .   ? -27.281 91.235  22.094  1.00 34.34  ? 1199 HOH B O     1 
HETATM 10394 O O     . HOH F 3 .   ? -16.524 87.739  28.422  1.00 39.61  ? 1200 HOH B O     1 
HETATM 10395 O O     . HOH F 3 .   ? -13.127 86.462  23.104  1.00 31.99  ? 1201 HOH B O     1 
HETATM 10396 O O     . HOH F 3 .   ? -11.796 82.745  26.656  1.00 34.22  ? 1202 HOH B O     1 
HETATM 10397 O O     . HOH F 3 .   ? -16.936 87.047  21.595  1.00 35.58  ? 1203 HOH B O     1 
HETATM 10398 O O     . HOH F 3 .   ? -21.648 66.569  14.720  1.00 31.36  ? 1204 HOH B O     1 
HETATM 10399 O O     . HOH F 3 .   ? -20.220 60.332  22.017  1.00 56.18  ? 1205 HOH B O     1 
HETATM 10400 O O     . HOH F 3 .   ? -5.151  62.674  21.323  1.00 35.33  ? 1206 HOH B O     1 
HETATM 10401 O O     . HOH F 3 .   ? -5.825  70.884  24.536  1.00 37.46  ? 1207 HOH B O     1 
HETATM 10402 O O     . HOH F 3 .   ? -5.703  70.071  27.312  1.00 31.35  ? 1208 HOH B O     1 
HETATM 10403 O O     . HOH F 3 .   ? -7.544  76.492  30.901  1.00 36.89  ? 1209 HOH B O     1 
HETATM 10404 O O     . HOH F 3 .   ? -8.751  79.674  19.989  1.00 21.98  ? 1210 HOH B O     1 
HETATM 10405 O O     . HOH F 3 .   ? -10.034 80.975  22.097  1.00 37.75  ? 1211 HOH B O     1 
HETATM 10406 O O     . HOH F 3 .   ? -30.803 59.164  23.546  1.00 33.75  ? 1212 HOH B O     1 
HETATM 10407 O O     . HOH F 3 .   ? -24.309 55.935  21.373  1.00 35.83  ? 1213 HOH B O     1 
HETATM 10408 O O     . HOH F 3 .   ? -22.559 56.934  23.069  1.00 29.05  ? 1214 HOH B O     1 
HETATM 10409 O O     . HOH F 3 .   ? -15.039 59.792  36.953  1.00 24.34  ? 1215 HOH B O     1 
HETATM 10410 O O     . HOH F 3 .   ? -5.379  65.256  27.756  1.00 38.44  ? 1216 HOH B O     1 
HETATM 10411 O O     . HOH F 3 .   ? -4.716  64.588  34.795  1.00 37.56  ? 1217 HOH B O     1 
HETATM 10412 O O     . HOH F 3 .   ? -6.274  66.355  35.548  1.00 51.40  ? 1218 HOH B O     1 
HETATM 10413 O O     . HOH F 3 .   ? -12.581 77.123  36.948  1.00 23.71  ? 1219 HOH B O     1 
HETATM 10414 O O     . HOH F 3 .   ? -7.490  72.677  38.746  1.00 29.37  ? 1220 HOH B O     1 
HETATM 10415 O O     . HOH F 3 .   ? -10.707 75.756  37.970  1.00 29.55  ? 1221 HOH B O     1 
HETATM 10416 O O     . HOH F 3 .   ? -13.411 81.786  34.316  1.00 34.20  ? 1222 HOH B O     1 
HETATM 10417 O O     . HOH F 3 .   ? -21.344 84.277  32.958  1.00 34.67  ? 1223 HOH B O     1 
HETATM 10418 O O     . HOH F 3 .   ? -27.140 62.364  42.739  1.00 38.51  ? 1224 HOH B O     1 
HETATM 10419 O O     . HOH F 3 .   ? -26.661 58.098  33.093  1.00 34.05  ? 1225 HOH B O     1 
HETATM 10420 O O     . HOH F 3 .   ? -29.397 55.943  29.757  1.00 24.94  ? 1226 HOH B O     1 
HETATM 10421 O O     . HOH F 3 .   ? -28.462 66.409  43.735  1.00 40.16  ? 1227 HOH B O     1 
HETATM 10422 O O     . HOH F 3 .   ? -12.414 65.150  40.123  1.00 42.30  ? 1228 HOH B O     1 
HETATM 10423 O O     . HOH F 3 .   ? -13.128 67.613  39.384  1.00 35.99  ? 1229 HOH B O     1 
HETATM 10424 O O     . HOH F 3 .   ? -23.660 67.678  44.893  1.00 37.89  ? 1230 HOH B O     1 
HETATM 10425 O O     . HOH F 3 .   ? -45.293 74.436  16.619  1.00 41.76  ? 1231 HOH B O     1 
HETATM 10426 O O     . HOH F 3 .   ? -32.281 65.409  41.872  1.00 27.08  ? 1232 HOH B O     1 
HETATM 10427 O O     . HOH F 3 .   ? -42.407 80.806  36.686  1.00 29.47  ? 1233 HOH B O     1 
HETATM 10428 O O     . HOH F 3 .   ? -43.738 76.270  37.204  1.00 48.51  ? 1234 HOH B O     1 
HETATM 10429 O O     . HOH F 3 .   ? -50.994 71.855  35.065  1.00 16.91  ? 1235 HOH B O     1 
HETATM 10430 O O     . HOH F 3 .   ? -58.520 65.336  36.939  1.00 32.64  ? 1236 HOH B O     1 
HETATM 10431 O O     . HOH F 3 .   ? -54.668 59.956  32.562  1.00 40.63  ? 1237 HOH B O     1 
HETATM 10432 O O     . HOH F 3 .   ? -59.553 68.145  24.147  1.00 30.02  ? 1238 HOH B O     1 
HETATM 10433 O O     . HOH F 3 .   ? -51.335 74.293  40.054  1.00 31.57  ? 1239 HOH B O     1 
HETATM 10434 O O     . HOH F 3 .   ? -50.137 59.784  28.188  1.00 28.97  ? 1240 HOH B O     1 
HETATM 10435 O O     . HOH F 3 .   ? -55.222 77.384  25.629  1.00 35.58  ? 1241 HOH B O     1 
HETATM 10436 O O     . HOH F 3 .   ? -48.537 74.965  5.426   1.00 29.16  ? 1242 HOH B O     1 
HETATM 10437 O O     . HOH F 3 .   ? -53.575 71.295  4.756   1.00 23.58  ? 1243 HOH B O     1 
HETATM 10438 O O     . HOH F 3 .   ? -54.153 65.212  8.550   1.00 41.01  ? 1244 HOH B O     1 
HETATM 10439 O O     . HOH F 3 .   ? -52.312 66.739  19.084  1.00 31.18  ? 1245 HOH B O     1 
HETATM 10440 O O     . HOH F 3 .   ? -43.179 66.727  19.174  1.00 27.71  ? 1246 HOH B O     1 
HETATM 10441 O O     . HOH F 3 .   ? -45.978 61.040  32.741  1.00 43.73  ? 1247 HOH B O     1 
HETATM 10442 O O     . HOH F 3 .   ? -43.050 60.317  30.286  1.00 37.75  ? 1248 HOH B O     1 
HETATM 10443 O O     . HOH F 3 .   ? -46.593 72.444  41.824  1.00 36.68  ? 1249 HOH B O     1 
HETATM 10444 O O     . HOH F 3 .   ? -40.397 57.121  26.170  1.00 29.65  ? 1250 HOH B O     1 
HETATM 10445 O O     . HOH F 3 .   ? -33.707 58.262  25.579  1.00 30.35  ? 1251 HOH B O     1 
HETATM 10446 O O     . HOH F 3 .   ? -47.594 63.372  19.976  1.00 35.11  ? 1252 HOH B O     1 
HETATM 10447 O O     . HOH F 3 .   ? -44.098 54.589  25.634  1.00 40.26  ? 1253 HOH B O     1 
HETATM 10448 O O     . HOH F 3 .   ? -47.400 56.474  26.775  1.00 39.52  ? 1254 HOH B O     1 
HETATM 10449 O O     . HOH F 3 .   ? -41.429 52.337  22.300  1.00 25.37  ? 1255 HOH B O     1 
HETATM 10450 O O     . HOH F 3 .   ? -45.045 52.223  8.934   1.00 31.35  ? 1256 HOH B O     1 
HETATM 10451 O O     . HOH F 3 .   ? -42.474 49.850  3.442   1.00 29.23  ? 1257 HOH B O     1 
HETATM 10452 O O     . HOH F 3 .   ? -37.930 46.750  -1.686  1.00 40.07  ? 1258 HOH B O     1 
HETATM 10453 O O     . HOH F 3 .   ? -40.646 44.036  -0.017  1.00 30.27  ? 1259 HOH B O     1 
HETATM 10454 O O     . HOH F 3 .   ? -45.557 43.033  3.605   1.00 32.74  ? 1260 HOH B O     1 
HETATM 10455 O O     . HOH F 3 .   ? -49.655 43.726  6.865   1.00 42.60  ? 1261 HOH B O     1 
HETATM 10456 O O     . HOH F 3 .   ? -50.893 48.151  12.686  1.00 33.06  ? 1262 HOH B O     1 
HETATM 10457 O O     . HOH F 3 .   ? -28.112 48.863  28.999  1.00 41.42  ? 1263 HOH B O     1 
HETATM 10458 O O     . HOH F 3 .   ? -22.030 51.808  30.098  1.00 43.06  ? 1264 HOH B O     1 
HETATM 10459 O O     . HOH F 3 .   ? -40.239 26.691  3.480   1.00 46.54  ? 1265 HOH B O     1 
HETATM 10460 O O     . HOH F 3 .   ? -40.571 32.482  0.539   1.00 31.13  ? 1266 HOH B O     1 
HETATM 10461 O O     . HOH F 3 .   ? -25.115 38.175  13.059  1.00 35.44  ? 1267 HOH B O     1 
HETATM 10462 O O     . HOH F 3 .   ? -27.747 49.391  16.208  1.00 28.83  ? 1268 HOH B O     1 
HETATM 10463 O O     . HOH F 3 .   ? -58.180 48.079  16.066  1.00 35.05  ? 1269 HOH B O     1 
HETATM 10464 O O     . HOH F 3 .   ? -35.379 38.150  21.030  1.00 29.68  ? 1270 HOH B O     1 
HETATM 10465 O O     . HOH F 3 .   ? -40.795 31.302  -1.718  1.00 32.87  ? 1271 HOH B O     1 
HETATM 10466 O O     . HOH F 3 .   ? -30.335 75.840  48.412  1.00 48.73  ? 1272 HOH B O     1 
HETATM 10467 O O     . HOH F 3 .   ? -25.830 83.811  45.133  1.00 35.40  ? 1273 HOH B O     1 
HETATM 10468 O O     . HOH F 3 .   ? -15.857 80.540  41.069  1.00 32.43  ? 1274 HOH B O     1 
HETATM 10469 O O     . HOH F 3 .   ? -20.801 91.397  34.060  1.00 41.10  ? 1275 HOH B O     1 
HETATM 10470 O O     . HOH F 3 .   ? -33.734 81.569  42.963  1.00 28.58  ? 1276 HOH B O     1 
HETATM 10471 O O     . HOH F 3 .   ? -55.097 80.042  21.874  1.00 34.00  ? 1277 HOH B O     1 
HETATM 10472 O O     . HOH F 3 .   ? -57.236 78.523  21.180  1.00 38.48  ? 1278 HOH B O     1 
HETATM 10473 O O     . HOH F 3 .   ? -27.037 96.135  8.964   1.00 30.95  ? 1279 HOH B O     1 
HETATM 10474 O O     . HOH F 3 .   ? -5.533  63.322  15.052  1.00 39.63  ? 1280 HOH B O     1 
HETATM 10475 O O     . HOH F 3 .   ? -33.972 65.784  8.664   1.00 26.75  ? 1281 HOH B O     1 
HETATM 10476 O O     . HOH F 3 .   ? -22.625 60.906  10.701  1.00 39.69  ? 1282 HOH B O     1 
HETATM 10477 O O     . HOH F 3 .   ? -37.039 54.674  4.020   1.00 35.60  ? 1283 HOH B O     1 
HETATM 10478 O O     . HOH F 3 .   ? -38.052 52.474  3.323   1.00 52.21  ? 1284 HOH B O     1 
HETATM 10479 O O     . HOH F 3 .   ? -39.234 62.274  3.967   1.00 46.20  ? 1285 HOH B O     1 
HETATM 10480 O O     . HOH F 3 .   ? -23.475 53.045  -4.704  1.00 33.83  ? 1286 HOH B O     1 
HETATM 10481 O O     . HOH F 3 .   ? -29.584 54.961  -6.311  1.00 38.07  ? 1287 HOH B O     1 
HETATM 10482 O O     . HOH F 3 .   ? -36.414 72.622  -10.594 1.00 37.81  ? 1288 HOH B O     1 
HETATM 10483 O O     . HOH F 3 .   ? -8.584  72.004  6.523   1.00 33.97  ? 1289 HOH B O     1 
HETATM 10484 O O     . HOH F 3 .   ? -16.187 58.977  -12.628 1.00 39.10  ? 1290 HOH B O     1 
HETATM 10485 O O     . HOH F 3 .   ? -9.913  73.249  -3.988  1.00 31.96  ? 1291 HOH B O     1 
HETATM 10486 O O     . HOH F 3 .   ? -11.940 72.937  -10.851 1.00 52.40  ? 1292 HOH B O     1 
HETATM 10487 O O     . HOH F 3 .   ? -22.810 93.019  -6.386  1.00 31.78  ? 1293 HOH B O     1 
HETATM 10488 O O     . HOH F 3 .   ? -37.498 97.678  2.851   1.00 40.62  ? 1294 HOH B O     1 
HETATM 10489 O O     . HOH F 3 .   ? -41.106 92.065  2.361   1.00 34.16  ? 1295 HOH B O     1 
HETATM 10490 O O     . HOH F 3 .   ? -35.559 67.437  13.283  1.00 32.81  ? 1296 HOH B O     1 
HETATM 10491 O O     . HOH F 3 .   ? -35.843 63.586  10.138  1.00 26.54  ? 1297 HOH B O     1 
HETATM 10492 O O     . HOH F 3 .   ? -18.744 88.815  21.771  1.00 42.47  ? 1298 HOH B O     1 
HETATM 10493 O O     . HOH F 3 .   ? -21.847 92.937  17.806  1.00 29.33  ? 1299 HOH B O     1 
HETATM 10494 O O     . HOH F 3 .   ? -25.750 63.897  15.826  1.00 28.26  ? 1300 HOH B O     1 
HETATM 10495 O O     . HOH F 3 .   ? -19.069 67.532  15.205  1.00 20.29  ? 1301 HOH B O     1 
HETATM 10496 O O     . HOH F 3 .   ? -6.113  61.689  26.375  1.00 31.26  ? 1302 HOH B O     1 
HETATM 10497 O O     . HOH F 3 .   ? -6.669  67.212  21.077  1.00 35.26  ? 1303 HOH B O     1 
HETATM 10498 O O     . HOH F 3 .   ? -4.348  80.710  27.564  1.00 41.02  ? 1304 HOH B O     1 
HETATM 10499 O O     . HOH F 3 .   ? -26.742 63.998  20.612  1.00 37.68  ? 1305 HOH B O     1 
HETATM 10500 O O     . HOH F 3 .   ? -22.206 55.669  27.567  1.00 34.12  ? 1306 HOH B O     1 
HETATM 10501 O O     . HOH F 3 .   ? -16.288 79.457  36.768  1.00 24.12  ? 1307 HOH B O     1 
HETATM 10502 O O     . HOH F 3 .   ? -33.351 65.098  21.201  1.00 39.05  ? 1308 HOH B O     1 
HETA